data_6D6U
# 
_entry.id   6D6U 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.329 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   6D6U         
WWPDB D_1000233972 
EMDB  EMD-7817     
# 
_pdbx_database_related.db_name        EMDB 
_pdbx_database_related.details        
'Human GABA-A receptor alpha1-beta2-gamma2 subtype in complex with GABA and flumazenil, conformation A' 
_pdbx_database_related.db_id          EMD-7817 
_pdbx_database_related.content_type   'associated EM volume' 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.entry_id                        6D6U 
_pdbx_database_status.recvd_initial_deposition_date   2018-04-22 
_pdbx_database_status.SG_entry                        N 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_nmr_data            ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
_audit_author.identifier_ORCID 
'Zhu, S.'        1 ? 
'Noviello, C.M.' 2 ? 
'Teng, J.'       3 ? 
'Walsh Jr, R.M.' 4 ? 
'Kim, J.J.'      5 ? 
'Hibbs, R.E.'    6 ? 
# 
_citation.abstract                  ? 
_citation.abstract_id_CAS           ? 
_citation.book_id_ISBN              ? 
_citation.book_publisher            ? 
_citation.book_publisher_city       ? 
_citation.book_title                ? 
_citation.coordinate_linkage        ? 
_citation.country                   UK 
_citation.database_id_Medline       ? 
_citation.details                   ? 
_citation.id                        primary 
_citation.journal_abbrev            Nature 
_citation.journal_id_ASTM           NATUAS 
_citation.journal_id_CSD            0006 
_citation.journal_id_ISSN           1476-4687 
_citation.journal_full              ? 
_citation.journal_issue             ? 
_citation.journal_volume            559 
_citation.language                  ? 
_citation.page_first                67 
_citation.page_last                 72 
_citation.title                     'Structure of a human synaptic GABAAreceptor.' 
_citation.year                      2018 
_citation.database_id_CSD           ? 
_citation.pdbx_database_id_DOI      10.1038/s41586-018-0255-3 
_citation.pdbx_database_id_PubMed   29950725 
_citation.unpublished_flag          ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Zhu, S.'        1 ? 
primary 'Noviello, C.M.' 2 ? 
primary 'Teng, J.'       3 ? 
primary 'Walsh, R.M.'    4 ? 
primary 'Kim, J.J.'      5 ? 
primary 'Hibbs, R.E.'    6 ? 
# 
_cell.angle_alpha                  90.00 
_cell.angle_alpha_esd              ? 
_cell.angle_beta                   90.00 
_cell.angle_beta_esd               ? 
_cell.angle_gamma                  90.00 
_cell.angle_gamma_esd              ? 
_cell.entry_id                     6D6U 
_cell.details                      ? 
_cell.formula_units_Z              ? 
_cell.length_a                     1.0 
_cell.length_a_esd                 ? 
_cell.length_b                     1.0 
_cell.length_b_esd                 ? 
_cell.length_c                     1.0 
_cell.length_c_esd                 ? 
_cell.volume                       ? 
_cell.volume_esd                   ? 
_cell.Z_PDB                        1 
_cell.reciprocal_angle_alpha       ? 
_cell.reciprocal_angle_beta        ? 
_cell.reciprocal_angle_gamma       ? 
_cell.reciprocal_angle_alpha_esd   ? 
_cell.reciprocal_angle_beta_esd    ? 
_cell.reciprocal_angle_gamma_esd   ? 
_cell.reciprocal_length_a          ? 
_cell.reciprocal_length_b          ? 
_cell.reciprocal_length_c          ? 
_cell.reciprocal_length_a_esd      ? 
_cell.reciprocal_length_b_esd      ? 
_cell.reciprocal_length_c_esd      ? 
_cell.pdbx_unique_axis             ? 
# 
_symmetry.entry_id                         6D6U 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                1 
_symmetry.space_group_name_Hall            ? 
_symmetry.space_group_name_H-M             'P 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1  polymer     man 'Gamma-aminobutyric acid receptor subunit beta-2,Gamma-aminobutyric acid receptor subunit beta-2' 39521.691 2  
? ? ? ? 
2  polymer     man 'Gamma-aminobutyric acid receptor subunit alpha-1,Gamma-aminobutyric acid receptor subunit alpha-1' 41061.211 2 
? ? ? ? 
3  polymer     man 'Gamma-aminobutyric acid receptor subunit gamma-2,Gamma-aminobutyric acid receptor subunit gamma-2' 45354.660 1 
? ? ? ? 
4  polymer     nat 'Kappa Fab Light Chain' 23505.943 2  ? ? ? ? 
5  polymer     nat 'IgG2b Fab Heavy Chain' 49811.043 2  ? ? ? ? 
6  branched    man 
'beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose' 586.542   2  
? ? ? ? 
7  branched    man 
;alpha-D-mannopyranose-(1-2)-alpha-D-mannopyranose-(1-3)-[alpha-D-mannopyranose-(1-3)-[alpha-D-mannopyranose-(1-6)]alpha-D-mannopyranose-(1-6)]beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose
;
1397.245  1  ? ? ? ? 
8  branched    man 
;alpha-D-mannopyranose-(1-3)-[alpha-D-mannopyranose-(1-6)]beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose
;
910.823   1  ? ? ? ? 
9  non-polymer man 2-acetamido-2-deoxy-beta-D-glucopyranose 221.208   2  ? ? ? ? 
10 non-polymer syn 'GAMMA-AMINO-BUTANOIC ACID' 103.120   2  ? ? ? ? 
11 non-polymer syn 'CHOLESTEROL HEMISUCCINATE' 486.726   12 ? ? ? ? 
12 non-polymer syn 'ethyl 8-fluoro-5-methyl-6-oxo-5,6-dihydro-4H-imidazo[1,5-a][1,4]benzodiazepine-3-carboxylate' 303.288   1  ? ? 
? ? 
# 
loop_
_entity_name_com.entity_id 
_entity_name_com.name 
1 'GABA(A) receptor subunit beta-2,GABA(A) receptor subunit beta-2'   
2 'GABA(A) receptor subunit alpha-1,GABA(A) receptor subunit alpha-1' 
3 'GABA(A) receptor subunit gamma-2,GABA(A) receptor subunit gamma-2' 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)' no no 
;QSVNDPSNMSLVKETVDRLLKGYDIRLRPDFGGPPVAVGMNIDIASIDMVSEVNMDYTLTMYFQQAWRDKRLSYNVIPLN
LTLDNRVADQLWVPDTYFLNDKKSFVHGVTVKNRMIRLHPDGTVLYGLRITTTAACMMDLRRYPLDEQNCTLEIESYGYT
TDDIEFYWRGDDNAVTGVTKIELPQFSIVDYKLITKKVVFSTGSYPRLSLSFKLKRNIGYFILQTYMPSILITILSWVSF
WINYDASAARVALGITTVLTMTTINTHLRETLPKIPYVKAIDMYLMGCFVFVFMALLEYALVNYIFFSQPARAAAIDRWS
RIFFPVVFSFFNIVYWLYYVN
;
;QSVNDPSNMSLVKETVDRLLKGYDIRLRPDFGGPPVAVGMNIDIASIDMVSEVNMDYTLTMYFQQAWRDKRLSYNVIPLN
LTLDNRVADQLWVPDTYFLNDKKSFVHGVTVKNRMIRLHPDGTVLYGLRITTTAACMMDLRRYPLDEQNCTLEIESYGYT
TDDIEFYWRGDDNAVTGVTKIELPQFSIVDYKLITKKVVFSTGSYPRLSLSFKLKRNIGYFILQTYMPSILITILSWVSF
WINYDASAARVALGITTVLTMTTINTHLRETLPKIPYVKAIDMYLMGCFVFVFMALLEYALVNYIFFSQPARAAAIDRWS
RIFFPVVFSFFNIVYWLYYVN
;
A,C ? 
2 'polypeptide(L)' no no 
;QPSLQDELKDNTTVFTRILDRLLDGYDNRLRPGLGERVTEVKTDIFVTSFGPVSDHDMEYTIDVFFRQSWKDERLKFKGP
MTVLRLNNLMASKIWTPDTFFHNGKKSVAHNMTMPNKLLRITEDGTLLYTMRLTVRAECPMHLEDFPMDAHACPLKFGSY
AYTRAEVVYEWTREPARSVVVAEDGSRLNQYDLLGQTVDSGIVQSSTGEYVVMTTHFHLKRKIGYFVIQTYLPCIMTVIL
SQVSFWLNRESVPARTVFGVTTVLTMTTLSISARNSLPKVAYATAMDWFIAVCYAFVFSALIEFATVNYFTKSQPARAAK
IDRLSRIAFPLLFGIFNLVYWATYLNREPQLKAPTPHQ
;
;QPSLQDELKDNTTVFTRILDRLLDGYDNRLRPGLGERVTEVKTDIFVTSFGPVSDHDMEYTIDVFFRQSWKDERLKFKGP
MTVLRLNNLMASKIWTPDTFFHNGKKSVAHNMTMPNKLLRITEDGTLLYTMRLTVRAECPMHLEDFPMDAHACPLKFGSY
AYTRAEVVYEWTREPARSVVVAEDGSRLNQYDLLGQTVDSGIVQSSTGEYVVMTTHFHLKRKIGYFVIQTYLPCIMTVIL
SQVSFWLNRESVPARTVFGVTTVLTMTTLSISARNSLPKVAYATAMDWFIAVCYAFVFSALIEFATVNYFTKSQPARAAK
IDRLSRIAFPLLFGIFNLVYWATYLNREPQLKAPTPHQ
;
B,D ? 
3 'polypeptide(L)' no no 
;WSHPQFEKGGGSGGGSGGSSAWSHPQFEKLEVLFQGPQKSDDDYEDYASNKTWVLTPKVPEGDVTVILNNLLEGYDNKLR
PDIGVKPTLIHTDMYVNSIGPVNAINMEYTIDIFFAQTWYDRRLKFNSTIKVLRLNSNMVGKIWIPDTFFRNSKKADAHW
ITTPNRMLRIWNDGRVLYTLRLTIDAECQLQLHNFPMDEHSCPLEFSSYGYPREEIVYQWKRSSVEVGDTRSWRLYQFSF
VGLRNTTEVVKTTSGDYVVMSVYFDLSRRMGYFTIQTYIPCTLIVVLSWVSFWINKDAVPARTSLGITTVLTMTTLSTIA
RKSLPKVSYVTAMDLFVSVCFIFVFSALVEYGTLHYFVSSQPARAAKMDSYARIFFPTAFCLFNLVYWVSYLYL
;
;WSHPQFEKGGGSGGGSGGSSAWSHPQFEKLEVLFQGPQKSDDDYEDYASNKTWVLTPKVPEGDVTVILNNLLEGYDNKLR
PDIGVKPTLIHTDMYVNSIGPVNAINMEYTIDIFFAQTWYDRRLKFNSTIKVLRLNSNMVGKIWIPDTFFRNSKKADAHW
ITTPNRMLRIWNDGRVLYTLRLTIDAECQLQLHNFPMDEHSCPLEFSSYGYPREEIVYQWKRSSVEVGDTRSWRLYQFSF
VGLRNTTEVVKTTSGDYVVMSVYFDLSRRMGYFTIQTYIPCTLIVVLSWVSFWINKDAVPARTSLGITTVLTMTTLSTIA
RKSLPKVSYVTAMDLFVSVCFIFVFSALVEYGTLHYFVSSQPARAAKMDSYARIFFPTAFCLFNLVYWVSYLYL
;
E   ? 
4 'polypeptide(L)' no no 
;NIVMTQSPKSMSMSVGERVTLSCKASEYVGTYVSWYQQKPEQSPKLLIYGASNRYTGVPDRFTGSGSATDFTLTIGSVQA
EDLADYHCGQSYSYPTFGAGTKLELKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLN
SWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNEC
;
;NIVMTQSPKSMSMSVGERVTLSCKASEYVGTYVSWYQQKPEQSPKLLIYGASNRYTGVPDRFTGSGSATDFTLTIGSVQA
EDLADYHCGQSYSYPTFGAGTKLELKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLN
SWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNEC
;
I,L ? 
5 'polypeptide(L)' no no 
;EVQLQQSGAELVKPGASVKLSCTASGFNIKDTYMYWVKQRPEQGLEWIGRIDPANGDTKYDPKFQGKATITTDTFSNTAY
LQLSSLTSEDTAVYYCARKGLRWAMDYWGQGTSVTVSTAKTTPPSVYPLAPGCGDTTGSSVTLGCLVKGYFPESVTVTWN
SGSLSSSVHTFPALLQSGLYTMSSSVTVPSSTWPSQTVTCSVAHPASSTTVDKKLEPSGPISTINPCPPCKECHKCPAPN
LEGGPSVFIFPPNIKDVLMISLTPKVTCVVVDVSEDDPDVQISWFVNNVEVHTAQTQTHREDYNSTIRVVSTLPIQHQDW
MSGKEFKCKVNNKDLPSPIERTISKIKGLVRAPQVYILPPPAEQLSRKDVSLTCLVVGFNPGDISVEWTSNGHTEENYKD
TAPVLDSDGSYFIYSKLNMKTSKWEKTDSFSCNVRHEGLKNYYLKKTISRSPGK
;
;EVQLQQSGAELVKPGASVKLSCTASGFNIKDTYMYWVKQRPEQGLEWIGRIDPANGDTKYDPKFQGKATITTDTFSNTAY
LQLSSLTSEDTAVYYCARKGLRWAMDYWGQGTSVTVSTAKTTPPSVYPLAPGCGDTTGSSVTLGCLVKGYFPESVTVTWN
SGSLSSSVHTFPALLQSGLYTMSSSVTVPSSTWPSQTVTCSVAHPASSTTVDKKLEPSGPISTINPCPPCKECHKCPAPN
LEGGPSVFIFPPNIKDVLMISLTPKVTCVVVDVSEDDPDVQISWFVNNVEVHTAQTQTHREDYNSTIRVVSTLPIQHQDW
MSGKEFKCKVNNKDLPSPIERTISKIKGLVRAPQVYILPPPAEQLSRKDVSLTCLVVGFNPGDISVEWTSNGHTEENYKD
TAPVLDSDGSYFIYSKLNMKTSKWEKTDSFSCNVRHEGLKNYYLKKTISRSPGK
;
J,K ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   GLN n 
1 2   SER n 
1 3   VAL n 
1 4   ASN n 
1 5   ASP n 
1 6   PRO n 
1 7   SER n 
1 8   ASN n 
1 9   MET n 
1 10  SER n 
1 11  LEU n 
1 12  VAL n 
1 13  LYS n 
1 14  GLU n 
1 15  THR n 
1 16  VAL n 
1 17  ASP n 
1 18  ARG n 
1 19  LEU n 
1 20  LEU n 
1 21  LYS n 
1 22  GLY n 
1 23  TYR n 
1 24  ASP n 
1 25  ILE n 
1 26  ARG n 
1 27  LEU n 
1 28  ARG n 
1 29  PRO n 
1 30  ASP n 
1 31  PHE n 
1 32  GLY n 
1 33  GLY n 
1 34  PRO n 
1 35  PRO n 
1 36  VAL n 
1 37  ALA n 
1 38  VAL n 
1 39  GLY n 
1 40  MET n 
1 41  ASN n 
1 42  ILE n 
1 43  ASP n 
1 44  ILE n 
1 45  ALA n 
1 46  SER n 
1 47  ILE n 
1 48  ASP n 
1 49  MET n 
1 50  VAL n 
1 51  SER n 
1 52  GLU n 
1 53  VAL n 
1 54  ASN n 
1 55  MET n 
1 56  ASP n 
1 57  TYR n 
1 58  THR n 
1 59  LEU n 
1 60  THR n 
1 61  MET n 
1 62  TYR n 
1 63  PHE n 
1 64  GLN n 
1 65  GLN n 
1 66  ALA n 
1 67  TRP n 
1 68  ARG n 
1 69  ASP n 
1 70  LYS n 
1 71  ARG n 
1 72  LEU n 
1 73  SER n 
1 74  TYR n 
1 75  ASN n 
1 76  VAL n 
1 77  ILE n 
1 78  PRO n 
1 79  LEU n 
1 80  ASN n 
1 81  LEU n 
1 82  THR n 
1 83  LEU n 
1 84  ASP n 
1 85  ASN n 
1 86  ARG n 
1 87  VAL n 
1 88  ALA n 
1 89  ASP n 
1 90  GLN n 
1 91  LEU n 
1 92  TRP n 
1 93  VAL n 
1 94  PRO n 
1 95  ASP n 
1 96  THR n 
1 97  TYR n 
1 98  PHE n 
1 99  LEU n 
1 100 ASN n 
1 101 ASP n 
1 102 LYS n 
1 103 LYS n 
1 104 SER n 
1 105 PHE n 
1 106 VAL n 
1 107 HIS n 
1 108 GLY n 
1 109 VAL n 
1 110 THR n 
1 111 VAL n 
1 112 LYS n 
1 113 ASN n 
1 114 ARG n 
1 115 MET n 
1 116 ILE n 
1 117 ARG n 
1 118 LEU n 
1 119 HIS n 
1 120 PRO n 
1 121 ASP n 
1 122 GLY n 
1 123 THR n 
1 124 VAL n 
1 125 LEU n 
1 126 TYR n 
1 127 GLY n 
1 128 LEU n 
1 129 ARG n 
1 130 ILE n 
1 131 THR n 
1 132 THR n 
1 133 THR n 
1 134 ALA n 
1 135 ALA n 
1 136 CYS n 
1 137 MET n 
1 138 MET n 
1 139 ASP n 
1 140 LEU n 
1 141 ARG n 
1 142 ARG n 
1 143 TYR n 
1 144 PRO n 
1 145 LEU n 
1 146 ASP n 
1 147 GLU n 
1 148 GLN n 
1 149 ASN n 
1 150 CYS n 
1 151 THR n 
1 152 LEU n 
1 153 GLU n 
1 154 ILE n 
1 155 GLU n 
1 156 SER n 
1 157 TYR n 
1 158 GLY n 
1 159 TYR n 
1 160 THR n 
1 161 THR n 
1 162 ASP n 
1 163 ASP n 
1 164 ILE n 
1 165 GLU n 
1 166 PHE n 
1 167 TYR n 
1 168 TRP n 
1 169 ARG n 
1 170 GLY n 
1 171 ASP n 
1 172 ASP n 
1 173 ASN n 
1 174 ALA n 
1 175 VAL n 
1 176 THR n 
1 177 GLY n 
1 178 VAL n 
1 179 THR n 
1 180 LYS n 
1 181 ILE n 
1 182 GLU n 
1 183 LEU n 
1 184 PRO n 
1 185 GLN n 
1 186 PHE n 
1 187 SER n 
1 188 ILE n 
1 189 VAL n 
1 190 ASP n 
1 191 TYR n 
1 192 LYS n 
1 193 LEU n 
1 194 ILE n 
1 195 THR n 
1 196 LYS n 
1 197 LYS n 
1 198 VAL n 
1 199 VAL n 
1 200 PHE n 
1 201 SER n 
1 202 THR n 
1 203 GLY n 
1 204 SER n 
1 205 TYR n 
1 206 PRO n 
1 207 ARG n 
1 208 LEU n 
1 209 SER n 
1 210 LEU n 
1 211 SER n 
1 212 PHE n 
1 213 LYS n 
1 214 LEU n 
1 215 LYS n 
1 216 ARG n 
1 217 ASN n 
1 218 ILE n 
1 219 GLY n 
1 220 TYR n 
1 221 PHE n 
1 222 ILE n 
1 223 LEU n 
1 224 GLN n 
1 225 THR n 
1 226 TYR n 
1 227 MET n 
1 228 PRO n 
1 229 SER n 
1 230 ILE n 
1 231 LEU n 
1 232 ILE n 
1 233 THR n 
1 234 ILE n 
1 235 LEU n 
1 236 SER n 
1 237 TRP n 
1 238 VAL n 
1 239 SER n 
1 240 PHE n 
1 241 TRP n 
1 242 ILE n 
1 243 ASN n 
1 244 TYR n 
1 245 ASP n 
1 246 ALA n 
1 247 SER n 
1 248 ALA n 
1 249 ALA n 
1 250 ARG n 
1 251 VAL n 
1 252 ALA n 
1 253 LEU n 
1 254 GLY n 
1 255 ILE n 
1 256 THR n 
1 257 THR n 
1 258 VAL n 
1 259 LEU n 
1 260 THR n 
1 261 MET n 
1 262 THR n 
1 263 THR n 
1 264 ILE n 
1 265 ASN n 
1 266 THR n 
1 267 HIS n 
1 268 LEU n 
1 269 ARG n 
1 270 GLU n 
1 271 THR n 
1 272 LEU n 
1 273 PRO n 
1 274 LYS n 
1 275 ILE n 
1 276 PRO n 
1 277 TYR n 
1 278 VAL n 
1 279 LYS n 
1 280 ALA n 
1 281 ILE n 
1 282 ASP n 
1 283 MET n 
1 284 TYR n 
1 285 LEU n 
1 286 MET n 
1 287 GLY n 
1 288 CYS n 
1 289 PHE n 
1 290 VAL n 
1 291 PHE n 
1 292 VAL n 
1 293 PHE n 
1 294 MET n 
1 295 ALA n 
1 296 LEU n 
1 297 LEU n 
1 298 GLU n 
1 299 TYR n 
1 300 ALA n 
1 301 LEU n 
1 302 VAL n 
1 303 ASN n 
1 304 TYR n 
1 305 ILE n 
1 306 PHE n 
1 307 PHE n 
1 308 SER n 
1 309 GLN n 
1 310 PRO n 
1 311 ALA n 
1 312 ARG n 
1 313 ALA n 
1 314 ALA n 
1 315 ALA n 
1 316 ILE n 
1 317 ASP n 
1 318 ARG n 
1 319 TRP n 
1 320 SER n 
1 321 ARG n 
1 322 ILE n 
1 323 PHE n 
1 324 PHE n 
1 325 PRO n 
1 326 VAL n 
1 327 VAL n 
1 328 PHE n 
1 329 SER n 
1 330 PHE n 
1 331 PHE n 
1 332 ASN n 
1 333 ILE n 
1 334 VAL n 
1 335 TYR n 
1 336 TRP n 
1 337 LEU n 
1 338 TYR n 
1 339 TYR n 
1 340 VAL n 
1 341 ASN n 
2 1   GLN n 
2 2   PRO n 
2 3   SER n 
2 4   LEU n 
2 5   GLN n 
2 6   ASP n 
2 7   GLU n 
2 8   LEU n 
2 9   LYS n 
2 10  ASP n 
2 11  ASN n 
2 12  THR n 
2 13  THR n 
2 14  VAL n 
2 15  PHE n 
2 16  THR n 
2 17  ARG n 
2 18  ILE n 
2 19  LEU n 
2 20  ASP n 
2 21  ARG n 
2 22  LEU n 
2 23  LEU n 
2 24  ASP n 
2 25  GLY n 
2 26  TYR n 
2 27  ASP n 
2 28  ASN n 
2 29  ARG n 
2 30  LEU n 
2 31  ARG n 
2 32  PRO n 
2 33  GLY n 
2 34  LEU n 
2 35  GLY n 
2 36  GLU n 
2 37  ARG n 
2 38  VAL n 
2 39  THR n 
2 40  GLU n 
2 41  VAL n 
2 42  LYS n 
2 43  THR n 
2 44  ASP n 
2 45  ILE n 
2 46  PHE n 
2 47  VAL n 
2 48  THR n 
2 49  SER n 
2 50  PHE n 
2 51  GLY n 
2 52  PRO n 
2 53  VAL n 
2 54  SER n 
2 55  ASP n 
2 56  HIS n 
2 57  ASP n 
2 58  MET n 
2 59  GLU n 
2 60  TYR n 
2 61  THR n 
2 62  ILE n 
2 63  ASP n 
2 64  VAL n 
2 65  PHE n 
2 66  PHE n 
2 67  ARG n 
2 68  GLN n 
2 69  SER n 
2 70  TRP n 
2 71  LYS n 
2 72  ASP n 
2 73  GLU n 
2 74  ARG n 
2 75  LEU n 
2 76  LYS n 
2 77  PHE n 
2 78  LYS n 
2 79  GLY n 
2 80  PRO n 
2 81  MET n 
2 82  THR n 
2 83  VAL n 
2 84  LEU n 
2 85  ARG n 
2 86  LEU n 
2 87  ASN n 
2 88  ASN n 
2 89  LEU n 
2 90  MET n 
2 91  ALA n 
2 92  SER n 
2 93  LYS n 
2 94  ILE n 
2 95  TRP n 
2 96  THR n 
2 97  PRO n 
2 98  ASP n 
2 99  THR n 
2 100 PHE n 
2 101 PHE n 
2 102 HIS n 
2 103 ASN n 
2 104 GLY n 
2 105 LYS n 
2 106 LYS n 
2 107 SER n 
2 108 VAL n 
2 109 ALA n 
2 110 HIS n 
2 111 ASN n 
2 112 MET n 
2 113 THR n 
2 114 MET n 
2 115 PRO n 
2 116 ASN n 
2 117 LYS n 
2 118 LEU n 
2 119 LEU n 
2 120 ARG n 
2 121 ILE n 
2 122 THR n 
2 123 GLU n 
2 124 ASP n 
2 125 GLY n 
2 126 THR n 
2 127 LEU n 
2 128 LEU n 
2 129 TYR n 
2 130 THR n 
2 131 MET n 
2 132 ARG n 
2 133 LEU n 
2 134 THR n 
2 135 VAL n 
2 136 ARG n 
2 137 ALA n 
2 138 GLU n 
2 139 CYS n 
2 140 PRO n 
2 141 MET n 
2 142 HIS n 
2 143 LEU n 
2 144 GLU n 
2 145 ASP n 
2 146 PHE n 
2 147 PRO n 
2 148 MET n 
2 149 ASP n 
2 150 ALA n 
2 151 HIS n 
2 152 ALA n 
2 153 CYS n 
2 154 PRO n 
2 155 LEU n 
2 156 LYS n 
2 157 PHE n 
2 158 GLY n 
2 159 SER n 
2 160 TYR n 
2 161 ALA n 
2 162 TYR n 
2 163 THR n 
2 164 ARG n 
2 165 ALA n 
2 166 GLU n 
2 167 VAL n 
2 168 VAL n 
2 169 TYR n 
2 170 GLU n 
2 171 TRP n 
2 172 THR n 
2 173 ARG n 
2 174 GLU n 
2 175 PRO n 
2 176 ALA n 
2 177 ARG n 
2 178 SER n 
2 179 VAL n 
2 180 VAL n 
2 181 VAL n 
2 182 ALA n 
2 183 GLU n 
2 184 ASP n 
2 185 GLY n 
2 186 SER n 
2 187 ARG n 
2 188 LEU n 
2 189 ASN n 
2 190 GLN n 
2 191 TYR n 
2 192 ASP n 
2 193 LEU n 
2 194 LEU n 
2 195 GLY n 
2 196 GLN n 
2 197 THR n 
2 198 VAL n 
2 199 ASP n 
2 200 SER n 
2 201 GLY n 
2 202 ILE n 
2 203 VAL n 
2 204 GLN n 
2 205 SER n 
2 206 SER n 
2 207 THR n 
2 208 GLY n 
2 209 GLU n 
2 210 TYR n 
2 211 VAL n 
2 212 VAL n 
2 213 MET n 
2 214 THR n 
2 215 THR n 
2 216 HIS n 
2 217 PHE n 
2 218 HIS n 
2 219 LEU n 
2 220 LYS n 
2 221 ARG n 
2 222 LYS n 
2 223 ILE n 
2 224 GLY n 
2 225 TYR n 
2 226 PHE n 
2 227 VAL n 
2 228 ILE n 
2 229 GLN n 
2 230 THR n 
2 231 TYR n 
2 232 LEU n 
2 233 PRO n 
2 234 CYS n 
2 235 ILE n 
2 236 MET n 
2 237 THR n 
2 238 VAL n 
2 239 ILE n 
2 240 LEU n 
2 241 SER n 
2 242 GLN n 
2 243 VAL n 
2 244 SER n 
2 245 PHE n 
2 246 TRP n 
2 247 LEU n 
2 248 ASN n 
2 249 ARG n 
2 250 GLU n 
2 251 SER n 
2 252 VAL n 
2 253 PRO n 
2 254 ALA n 
2 255 ARG n 
2 256 THR n 
2 257 VAL n 
2 258 PHE n 
2 259 GLY n 
2 260 VAL n 
2 261 THR n 
2 262 THR n 
2 263 VAL n 
2 264 LEU n 
2 265 THR n 
2 266 MET n 
2 267 THR n 
2 268 THR n 
2 269 LEU n 
2 270 SER n 
2 271 ILE n 
2 272 SER n 
2 273 ALA n 
2 274 ARG n 
2 275 ASN n 
2 276 SER n 
2 277 LEU n 
2 278 PRO n 
2 279 LYS n 
2 280 VAL n 
2 281 ALA n 
2 282 TYR n 
2 283 ALA n 
2 284 THR n 
2 285 ALA n 
2 286 MET n 
2 287 ASP n 
2 288 TRP n 
2 289 PHE n 
2 290 ILE n 
2 291 ALA n 
2 292 VAL n 
2 293 CYS n 
2 294 TYR n 
2 295 ALA n 
2 296 PHE n 
2 297 VAL n 
2 298 PHE n 
2 299 SER n 
2 300 ALA n 
2 301 LEU n 
2 302 ILE n 
2 303 GLU n 
2 304 PHE n 
2 305 ALA n 
2 306 THR n 
2 307 VAL n 
2 308 ASN n 
2 309 TYR n 
2 310 PHE n 
2 311 THR n 
2 312 LYS n 
2 313 SER n 
2 314 GLN n 
2 315 PRO n 
2 316 ALA n 
2 317 ARG n 
2 318 ALA n 
2 319 ALA n 
2 320 LYS n 
2 321 ILE n 
2 322 ASP n 
2 323 ARG n 
2 324 LEU n 
2 325 SER n 
2 326 ARG n 
2 327 ILE n 
2 328 ALA n 
2 329 PHE n 
2 330 PRO n 
2 331 LEU n 
2 332 LEU n 
2 333 PHE n 
2 334 GLY n 
2 335 ILE n 
2 336 PHE n 
2 337 ASN n 
2 338 LEU n 
2 339 VAL n 
2 340 TYR n 
2 341 TRP n 
2 342 ALA n 
2 343 THR n 
2 344 TYR n 
2 345 LEU n 
2 346 ASN n 
2 347 ARG n 
2 348 GLU n 
2 349 PRO n 
2 350 GLN n 
2 351 LEU n 
2 352 LYS n 
2 353 ALA n 
2 354 PRO n 
2 355 THR n 
2 356 PRO n 
2 357 HIS n 
2 358 GLN n 
3 1   TRP n 
3 2   SER n 
3 3   HIS n 
3 4   PRO n 
3 5   GLN n 
3 6   PHE n 
3 7   GLU n 
3 8   LYS n 
3 9   GLY n 
3 10  GLY n 
3 11  GLY n 
3 12  SER n 
3 13  GLY n 
3 14  GLY n 
3 15  GLY n 
3 16  SER n 
3 17  GLY n 
3 18  GLY n 
3 19  SER n 
3 20  SER n 
3 21  ALA n 
3 22  TRP n 
3 23  SER n 
3 24  HIS n 
3 25  PRO n 
3 26  GLN n 
3 27  PHE n 
3 28  GLU n 
3 29  LYS n 
3 30  LEU n 
3 31  GLU n 
3 32  VAL n 
3 33  LEU n 
3 34  PHE n 
3 35  GLN n 
3 36  GLY n 
3 37  PRO n 
3 38  GLN n 
3 39  LYS n 
3 40  SER n 
3 41  ASP n 
3 42  ASP n 
3 43  ASP n 
3 44  TYR n 
3 45  GLU n 
3 46  ASP n 
3 47  TYR n 
3 48  ALA n 
3 49  SER n 
3 50  ASN n 
3 51  LYS n 
3 52  THR n 
3 53  TRP n 
3 54  VAL n 
3 55  LEU n 
3 56  THR n 
3 57  PRO n 
3 58  LYS n 
3 59  VAL n 
3 60  PRO n 
3 61  GLU n 
3 62  GLY n 
3 63  ASP n 
3 64  VAL n 
3 65  THR n 
3 66  VAL n 
3 67  ILE n 
3 68  LEU n 
3 69  ASN n 
3 70  ASN n 
3 71  LEU n 
3 72  LEU n 
3 73  GLU n 
3 74  GLY n 
3 75  TYR n 
3 76  ASP n 
3 77  ASN n 
3 78  LYS n 
3 79  LEU n 
3 80  ARG n 
3 81  PRO n 
3 82  ASP n 
3 83  ILE n 
3 84  GLY n 
3 85  VAL n 
3 86  LYS n 
3 87  PRO n 
3 88  THR n 
3 89  LEU n 
3 90  ILE n 
3 91  HIS n 
3 92  THR n 
3 93  ASP n 
3 94  MET n 
3 95  TYR n 
3 96  VAL n 
3 97  ASN n 
3 98  SER n 
3 99  ILE n 
3 100 GLY n 
3 101 PRO n 
3 102 VAL n 
3 103 ASN n 
3 104 ALA n 
3 105 ILE n 
3 106 ASN n 
3 107 MET n 
3 108 GLU n 
3 109 TYR n 
3 110 THR n 
3 111 ILE n 
3 112 ASP n 
3 113 ILE n 
3 114 PHE n 
3 115 PHE n 
3 116 ALA n 
3 117 GLN n 
3 118 THR n 
3 119 TRP n 
3 120 TYR n 
3 121 ASP n 
3 122 ARG n 
3 123 ARG n 
3 124 LEU n 
3 125 LYS n 
3 126 PHE n 
3 127 ASN n 
3 128 SER n 
3 129 THR n 
3 130 ILE n 
3 131 LYS n 
3 132 VAL n 
3 133 LEU n 
3 134 ARG n 
3 135 LEU n 
3 136 ASN n 
3 137 SER n 
3 138 ASN n 
3 139 MET n 
3 140 VAL n 
3 141 GLY n 
3 142 LYS n 
3 143 ILE n 
3 144 TRP n 
3 145 ILE n 
3 146 PRO n 
3 147 ASP n 
3 148 THR n 
3 149 PHE n 
3 150 PHE n 
3 151 ARG n 
3 152 ASN n 
3 153 SER n 
3 154 LYS n 
3 155 LYS n 
3 156 ALA n 
3 157 ASP n 
3 158 ALA n 
3 159 HIS n 
3 160 TRP n 
3 161 ILE n 
3 162 THR n 
3 163 THR n 
3 164 PRO n 
3 165 ASN n 
3 166 ARG n 
3 167 MET n 
3 168 LEU n 
3 169 ARG n 
3 170 ILE n 
3 171 TRP n 
3 172 ASN n 
3 173 ASP n 
3 174 GLY n 
3 175 ARG n 
3 176 VAL n 
3 177 LEU n 
3 178 TYR n 
3 179 THR n 
3 180 LEU n 
3 181 ARG n 
3 182 LEU n 
3 183 THR n 
3 184 ILE n 
3 185 ASP n 
3 186 ALA n 
3 187 GLU n 
3 188 CYS n 
3 189 GLN n 
3 190 LEU n 
3 191 GLN n 
3 192 LEU n 
3 193 HIS n 
3 194 ASN n 
3 195 PHE n 
3 196 PRO n 
3 197 MET n 
3 198 ASP n 
3 199 GLU n 
3 200 HIS n 
3 201 SER n 
3 202 CYS n 
3 203 PRO n 
3 204 LEU n 
3 205 GLU n 
3 206 PHE n 
3 207 SER n 
3 208 SER n 
3 209 TYR n 
3 210 GLY n 
3 211 TYR n 
3 212 PRO n 
3 213 ARG n 
3 214 GLU n 
3 215 GLU n 
3 216 ILE n 
3 217 VAL n 
3 218 TYR n 
3 219 GLN n 
3 220 TRP n 
3 221 LYS n 
3 222 ARG n 
3 223 SER n 
3 224 SER n 
3 225 VAL n 
3 226 GLU n 
3 227 VAL n 
3 228 GLY n 
3 229 ASP n 
3 230 THR n 
3 231 ARG n 
3 232 SER n 
3 233 TRP n 
3 234 ARG n 
3 235 LEU n 
3 236 TYR n 
3 237 GLN n 
3 238 PHE n 
3 239 SER n 
3 240 PHE n 
3 241 VAL n 
3 242 GLY n 
3 243 LEU n 
3 244 ARG n 
3 245 ASN n 
3 246 THR n 
3 247 THR n 
3 248 GLU n 
3 249 VAL n 
3 250 VAL n 
3 251 LYS n 
3 252 THR n 
3 253 THR n 
3 254 SER n 
3 255 GLY n 
3 256 ASP n 
3 257 TYR n 
3 258 VAL n 
3 259 VAL n 
3 260 MET n 
3 261 SER n 
3 262 VAL n 
3 263 TYR n 
3 264 PHE n 
3 265 ASP n 
3 266 LEU n 
3 267 SER n 
3 268 ARG n 
3 269 ARG n 
3 270 MET n 
3 271 GLY n 
3 272 TYR n 
3 273 PHE n 
3 274 THR n 
3 275 ILE n 
3 276 GLN n 
3 277 THR n 
3 278 TYR n 
3 279 ILE n 
3 280 PRO n 
3 281 CYS n 
3 282 THR n 
3 283 LEU n 
3 284 ILE n 
3 285 VAL n 
3 286 VAL n 
3 287 LEU n 
3 288 SER n 
3 289 TRP n 
3 290 VAL n 
3 291 SER n 
3 292 PHE n 
3 293 TRP n 
3 294 ILE n 
3 295 ASN n 
3 296 LYS n 
3 297 ASP n 
3 298 ALA n 
3 299 VAL n 
3 300 PRO n 
3 301 ALA n 
3 302 ARG n 
3 303 THR n 
3 304 SER n 
3 305 LEU n 
3 306 GLY n 
3 307 ILE n 
3 308 THR n 
3 309 THR n 
3 310 VAL n 
3 311 LEU n 
3 312 THR n 
3 313 MET n 
3 314 THR n 
3 315 THR n 
3 316 LEU n 
3 317 SER n 
3 318 THR n 
3 319 ILE n 
3 320 ALA n 
3 321 ARG n 
3 322 LYS n 
3 323 SER n 
3 324 LEU n 
3 325 PRO n 
3 326 LYS n 
3 327 VAL n 
3 328 SER n 
3 329 TYR n 
3 330 VAL n 
3 331 THR n 
3 332 ALA n 
3 333 MET n 
3 334 ASP n 
3 335 LEU n 
3 336 PHE n 
3 337 VAL n 
3 338 SER n 
3 339 VAL n 
3 340 CYS n 
3 341 PHE n 
3 342 ILE n 
3 343 PHE n 
3 344 VAL n 
3 345 PHE n 
3 346 SER n 
3 347 ALA n 
3 348 LEU n 
3 349 VAL n 
3 350 GLU n 
3 351 TYR n 
3 352 GLY n 
3 353 THR n 
3 354 LEU n 
3 355 HIS n 
3 356 TYR n 
3 357 PHE n 
3 358 VAL n 
3 359 SER n 
3 360 SER n 
3 361 GLN n 
3 362 PRO n 
3 363 ALA n 
3 364 ARG n 
3 365 ALA n 
3 366 ALA n 
3 367 LYS n 
3 368 MET n 
3 369 ASP n 
3 370 SER n 
3 371 TYR n 
3 372 ALA n 
3 373 ARG n 
3 374 ILE n 
3 375 PHE n 
3 376 PHE n 
3 377 PRO n 
3 378 THR n 
3 379 ALA n 
3 380 PHE n 
3 381 CYS n 
3 382 LEU n 
3 383 PHE n 
3 384 ASN n 
3 385 LEU n 
3 386 VAL n 
3 387 TYR n 
3 388 TRP n 
3 389 VAL n 
3 390 SER n 
3 391 TYR n 
3 392 LEU n 
3 393 TYR n 
3 394 LEU n 
4 1   ASN n 
4 2   ILE n 
4 3   VAL n 
4 4   MET n 
4 5   THR n 
4 6   GLN n 
4 7   SER n 
4 8   PRO n 
4 9   LYS n 
4 10  SER n 
4 11  MET n 
4 12  SER n 
4 13  MET n 
4 14  SER n 
4 15  VAL n 
4 16  GLY n 
4 17  GLU n 
4 18  ARG n 
4 19  VAL n 
4 20  THR n 
4 21  LEU n 
4 22  SER n 
4 23  CYS n 
4 24  LYS n 
4 25  ALA n 
4 26  SER n 
4 27  GLU n 
4 28  TYR n 
4 29  VAL n 
4 30  GLY n 
4 31  THR n 
4 32  TYR n 
4 33  VAL n 
4 34  SER n 
4 35  TRP n 
4 36  TYR n 
4 37  GLN n 
4 38  GLN n 
4 39  LYS n 
4 40  PRO n 
4 41  GLU n 
4 42  GLN n 
4 43  SER n 
4 44  PRO n 
4 45  LYS n 
4 46  LEU n 
4 47  LEU n 
4 48  ILE n 
4 49  TYR n 
4 50  GLY n 
4 51  ALA n 
4 52  SER n 
4 53  ASN n 
4 54  ARG n 
4 55  TYR n 
4 56  THR n 
4 57  GLY n 
4 58  VAL n 
4 59  PRO n 
4 60  ASP n 
4 61  ARG n 
4 62  PHE n 
4 63  THR n 
4 64  GLY n 
4 65  SER n 
4 66  GLY n 
4 67  SER n 
4 68  ALA n 
4 69  THR n 
4 70  ASP n 
4 71  PHE n 
4 72  THR n 
4 73  LEU n 
4 74  THR n 
4 75  ILE n 
4 76  GLY n 
4 77  SER n 
4 78  VAL n 
4 79  GLN n 
4 80  ALA n 
4 81  GLU n 
4 82  ASP n 
4 83  LEU n 
4 84  ALA n 
4 85  ASP n 
4 86  TYR n 
4 87  HIS n 
4 88  CYS n 
4 89  GLY n 
4 90  GLN n 
4 91  SER n 
4 92  TYR n 
4 93  SER n 
4 94  TYR n 
4 95  PRO n 
4 96  THR n 
4 97  PHE n 
4 98  GLY n 
4 99  ALA n 
4 100 GLY n 
4 101 THR n 
4 102 LYS n 
4 103 LEU n 
4 104 GLU n 
4 105 LEU n 
4 106 LYS n 
4 107 ARG n 
4 108 ALA n 
4 109 ASP n 
4 110 ALA n 
4 111 ALA n 
4 112 PRO n 
4 113 THR n 
4 114 VAL n 
4 115 SER n 
4 116 ILE n 
4 117 PHE n 
4 118 PRO n 
4 119 PRO n 
4 120 SER n 
4 121 SER n 
4 122 GLU n 
4 123 GLN n 
4 124 LEU n 
4 125 THR n 
4 126 SER n 
4 127 GLY n 
4 128 GLY n 
4 129 ALA n 
4 130 SER n 
4 131 VAL n 
4 132 VAL n 
4 133 CYS n 
4 134 PHE n 
4 135 LEU n 
4 136 ASN n 
4 137 ASN n 
4 138 PHE n 
4 139 TYR n 
4 140 PRO n 
4 141 LYS n 
4 142 ASP n 
4 143 ILE n 
4 144 ASN n 
4 145 VAL n 
4 146 LYS n 
4 147 TRP n 
4 148 LYS n 
4 149 ILE n 
4 150 ASP n 
4 151 GLY n 
4 152 SER n 
4 153 GLU n 
4 154 ARG n 
4 155 GLN n 
4 156 ASN n 
4 157 GLY n 
4 158 VAL n 
4 159 LEU n 
4 160 ASN n 
4 161 SER n 
4 162 TRP n 
4 163 THR n 
4 164 ASP n 
4 165 GLN n 
4 166 ASP n 
4 167 SER n 
4 168 LYS n 
4 169 ASP n 
4 170 SER n 
4 171 THR n 
4 172 TYR n 
4 173 SER n 
4 174 MET n 
4 175 SER n 
4 176 SER n 
4 177 THR n 
4 178 LEU n 
4 179 THR n 
4 180 LEU n 
4 181 THR n 
4 182 LYS n 
4 183 ASP n 
4 184 GLU n 
4 185 TYR n 
4 186 GLU n 
4 187 ARG n 
4 188 HIS n 
4 189 ASN n 
4 190 SER n 
4 191 TYR n 
4 192 THR n 
4 193 CYS n 
4 194 GLU n 
4 195 ALA n 
4 196 THR n 
4 197 HIS n 
4 198 LYS n 
4 199 THR n 
4 200 SER n 
4 201 THR n 
4 202 SER n 
4 203 PRO n 
4 204 ILE n 
4 205 VAL n 
4 206 LYS n 
4 207 SER n 
4 208 PHE n 
4 209 ASN n 
4 210 ARG n 
4 211 ASN n 
4 212 GLU n 
4 213 CYS n 
5 1   GLU n 
5 2   VAL n 
5 3   GLN n 
5 4   LEU n 
5 5   GLN n 
5 6   GLN n 
5 7   SER n 
5 8   GLY n 
5 9   ALA n 
5 10  GLU n 
5 11  LEU n 
5 12  VAL n 
5 13  LYS n 
5 14  PRO n 
5 15  GLY n 
5 16  ALA n 
5 17  SER n 
5 18  VAL n 
5 19  LYS n 
5 20  LEU n 
5 21  SER n 
5 22  CYS n 
5 23  THR n 
5 24  ALA n 
5 25  SER n 
5 26  GLY n 
5 27  PHE n 
5 28  ASN n 
5 29  ILE n 
5 30  LYS n 
5 31  ASP n 
5 32  THR n 
5 33  TYR n 
5 34  MET n 
5 35  TYR n 
5 36  TRP n 
5 37  VAL n 
5 38  LYS n 
5 39  GLN n 
5 40  ARG n 
5 41  PRO n 
5 42  GLU n 
5 43  GLN n 
5 44  GLY n 
5 45  LEU n 
5 46  GLU n 
5 47  TRP n 
5 48  ILE n 
5 49  GLY n 
5 50  ARG n 
5 51  ILE n 
5 52  ASP n 
5 53  PRO n 
5 54  ALA n 
5 55  ASN n 
5 56  GLY n 
5 57  ASP n 
5 58  THR n 
5 59  LYS n 
5 60  TYR n 
5 61  ASP n 
5 62  PRO n 
5 63  LYS n 
5 64  PHE n 
5 65  GLN n 
5 66  GLY n 
5 67  LYS n 
5 68  ALA n 
5 69  THR n 
5 70  ILE n 
5 71  THR n 
5 72  THR n 
5 73  ASP n 
5 74  THR n 
5 75  PHE n 
5 76  SER n 
5 77  ASN n 
5 78  THR n 
5 79  ALA n 
5 80  TYR n 
5 81  LEU n 
5 82  GLN n 
5 83  LEU n 
5 84  SER n 
5 85  SER n 
5 86  LEU n 
5 87  THR n 
5 88  SER n 
5 89  GLU n 
5 90  ASP n 
5 91  THR n 
5 92  ALA n 
5 93  VAL n 
5 94  TYR n 
5 95  TYR n 
5 96  CYS n 
5 97  ALA n 
5 98  ARG n 
5 99  LYS n 
5 100 GLY n 
5 101 LEU n 
5 102 ARG n 
5 103 TRP n 
5 104 ALA n 
5 105 MET n 
5 106 ASP n 
5 107 TYR n 
5 108 TRP n 
5 109 GLY n 
5 110 GLN n 
5 111 GLY n 
5 112 THR n 
5 113 SER n 
5 114 VAL n 
5 115 THR n 
5 116 VAL n 
5 117 SER n 
5 118 THR n 
5 119 ALA n 
5 120 LYS n 
5 121 THR n 
5 122 THR n 
5 123 PRO n 
5 124 PRO n 
5 125 SER n 
5 126 VAL n 
5 127 TYR n 
5 128 PRO n 
5 129 LEU n 
5 130 ALA n 
5 131 PRO n 
5 132 GLY n 
5 133 CYS n 
5 134 GLY n 
5 135 ASP n 
5 136 THR n 
5 137 THR n 
5 138 GLY n 
5 139 SER n 
5 140 SER n 
5 141 VAL n 
5 142 THR n 
5 143 LEU n 
5 144 GLY n 
5 145 CYS n 
5 146 LEU n 
5 147 VAL n 
5 148 LYS n 
5 149 GLY n 
5 150 TYR n 
5 151 PHE n 
5 152 PRO n 
5 153 GLU n 
5 154 SER n 
5 155 VAL n 
5 156 THR n 
5 157 VAL n 
5 158 THR n 
5 159 TRP n 
5 160 ASN n 
5 161 SER n 
5 162 GLY n 
5 163 SER n 
5 164 LEU n 
5 165 SER n 
5 166 SER n 
5 167 SER n 
5 168 VAL n 
5 169 HIS n 
5 170 THR n 
5 171 PHE n 
5 172 PRO n 
5 173 ALA n 
5 174 LEU n 
5 175 LEU n 
5 176 GLN n 
5 177 SER n 
5 178 GLY n 
5 179 LEU n 
5 180 TYR n 
5 181 THR n 
5 182 MET n 
5 183 SER n 
5 184 SER n 
5 185 SER n 
5 186 VAL n 
5 187 THR n 
5 188 VAL n 
5 189 PRO n 
5 190 SER n 
5 191 SER n 
5 192 THR n 
5 193 TRP n 
5 194 PRO n 
5 195 SER n 
5 196 GLN n 
5 197 THR n 
5 198 VAL n 
5 199 THR n 
5 200 CYS n 
5 201 SER n 
5 202 VAL n 
5 203 ALA n 
5 204 HIS n 
5 205 PRO n 
5 206 ALA n 
5 207 SER n 
5 208 SER n 
5 209 THR n 
5 210 THR n 
5 211 VAL n 
5 212 ASP n 
5 213 LYS n 
5 214 LYS n 
5 215 LEU n 
5 216 GLU n 
5 217 PRO n 
5 218 SER n 
5 219 GLY n 
5 220 PRO n 
5 221 ILE n 
5 222 SER n 
5 223 THR n 
5 224 ILE n 
5 225 ASN n 
5 226 PRO n 
5 227 CYS n 
5 228 PRO n 
5 229 PRO n 
5 230 CYS n 
5 231 LYS n 
5 232 GLU n 
5 233 CYS n 
5 234 HIS n 
5 235 LYS n 
5 236 CYS n 
5 237 PRO n 
5 238 ALA n 
5 239 PRO n 
5 240 ASN n 
5 241 LEU n 
5 242 GLU n 
5 243 GLY n 
5 244 GLY n 
5 245 PRO n 
5 246 SER n 
5 247 VAL n 
5 248 PHE n 
5 249 ILE n 
5 250 PHE n 
5 251 PRO n 
5 252 PRO n 
5 253 ASN n 
5 254 ILE n 
5 255 LYS n 
5 256 ASP n 
5 257 VAL n 
5 258 LEU n 
5 259 MET n 
5 260 ILE n 
5 261 SER n 
5 262 LEU n 
5 263 THR n 
5 264 PRO n 
5 265 LYS n 
5 266 VAL n 
5 267 THR n 
5 268 CYS n 
5 269 VAL n 
5 270 VAL n 
5 271 VAL n 
5 272 ASP n 
5 273 VAL n 
5 274 SER n 
5 275 GLU n 
5 276 ASP n 
5 277 ASP n 
5 278 PRO n 
5 279 ASP n 
5 280 VAL n 
5 281 GLN n 
5 282 ILE n 
5 283 SER n 
5 284 TRP n 
5 285 PHE n 
5 286 VAL n 
5 287 ASN n 
5 288 ASN n 
5 289 VAL n 
5 290 GLU n 
5 291 VAL n 
5 292 HIS n 
5 293 THR n 
5 294 ALA n 
5 295 GLN n 
5 296 THR n 
5 297 GLN n 
5 298 THR n 
5 299 HIS n 
5 300 ARG n 
5 301 GLU n 
5 302 ASP n 
5 303 TYR n 
5 304 ASN n 
5 305 SER n 
5 306 THR n 
5 307 ILE n 
5 308 ARG n 
5 309 VAL n 
5 310 VAL n 
5 311 SER n 
5 312 THR n 
5 313 LEU n 
5 314 PRO n 
5 315 ILE n 
5 316 GLN n 
5 317 HIS n 
5 318 GLN n 
5 319 ASP n 
5 320 TRP n 
5 321 MET n 
5 322 SER n 
5 323 GLY n 
5 324 LYS n 
5 325 GLU n 
5 326 PHE n 
5 327 LYS n 
5 328 CYS n 
5 329 LYS n 
5 330 VAL n 
5 331 ASN n 
5 332 ASN n 
5 333 LYS n 
5 334 ASP n 
5 335 LEU n 
5 336 PRO n 
5 337 SER n 
5 338 PRO n 
5 339 ILE n 
5 340 GLU n 
5 341 ARG n 
5 342 THR n 
5 343 ILE n 
5 344 SER n 
5 345 LYS n 
5 346 ILE n 
5 347 LYS n 
5 348 GLY n 
5 349 LEU n 
5 350 VAL n 
5 351 ARG n 
5 352 ALA n 
5 353 PRO n 
5 354 GLN n 
5 355 VAL n 
5 356 TYR n 
5 357 ILE n 
5 358 LEU n 
5 359 PRO n 
5 360 PRO n 
5 361 PRO n 
5 362 ALA n 
5 363 GLU n 
5 364 GLN n 
5 365 LEU n 
5 366 SER n 
5 367 ARG n 
5 368 LYS n 
5 369 ASP n 
5 370 VAL n 
5 371 SER n 
5 372 LEU n 
5 373 THR n 
5 374 CYS n 
5 375 LEU n 
5 376 VAL n 
5 377 VAL n 
5 378 GLY n 
5 379 PHE n 
5 380 ASN n 
5 381 PRO n 
5 382 GLY n 
5 383 ASP n 
5 384 ILE n 
5 385 SER n 
5 386 VAL n 
5 387 GLU n 
5 388 TRP n 
5 389 THR n 
5 390 SER n 
5 391 ASN n 
5 392 GLY n 
5 393 HIS n 
5 394 THR n 
5 395 GLU n 
5 396 GLU n 
5 397 ASN n 
5 398 TYR n 
5 399 LYS n 
5 400 ASP n 
5 401 THR n 
5 402 ALA n 
5 403 PRO n 
5 404 VAL n 
5 405 LEU n 
5 406 ASP n 
5 407 SER n 
5 408 ASP n 
5 409 GLY n 
5 410 SER n 
5 411 TYR n 
5 412 PHE n 
5 413 ILE n 
5 414 TYR n 
5 415 SER n 
5 416 LYS n 
5 417 LEU n 
5 418 ASN n 
5 419 MET n 
5 420 LYS n 
5 421 THR n 
5 422 SER n 
5 423 LYS n 
5 424 TRP n 
5 425 GLU n 
5 426 LYS n 
5 427 THR n 
5 428 ASP n 
5 429 SER n 
5 430 PHE n 
5 431 SER n 
5 432 CYS n 
5 433 ASN n 
5 434 VAL n 
5 435 ARG n 
5 436 HIS n 
5 437 GLU n 
5 438 GLY n 
5 439 LEU n 
5 440 LYS n 
5 441 ASN n 
5 442 TYR n 
5 443 TYR n 
5 444 LEU n 
5 445 LYS n 
5 446 LYS n 
5 447 THR n 
5 448 ILE n 
5 449 SER n 
5 450 ARG n 
5 451 SER n 
5 452 PRO n 
5 453 GLY n 
5 454 LYS n 
# 
loop_
_entity_src_gen.entity_id 
_entity_src_gen.pdbx_src_id 
_entity_src_gen.pdbx_alt_source_flag 
_entity_src_gen.pdbx_seq_type 
_entity_src_gen.pdbx_beg_seq_num 
_entity_src_gen.pdbx_end_seq_num 
_entity_src_gen.gene_src_common_name 
_entity_src_gen.gene_src_genus 
_entity_src_gen.pdbx_gene_src_gene 
_entity_src_gen.gene_src_species 
_entity_src_gen.gene_src_strain 
_entity_src_gen.gene_src_tissue 
_entity_src_gen.gene_src_tissue_fraction 
_entity_src_gen.gene_src_details 
_entity_src_gen.pdbx_gene_src_fragment 
_entity_src_gen.pdbx_gene_src_scientific_name 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 
_entity_src_gen.pdbx_gene_src_variant 
_entity_src_gen.pdbx_gene_src_cell_line 
_entity_src_gen.pdbx_gene_src_atcc 
_entity_src_gen.pdbx_gene_src_organ 
_entity_src_gen.pdbx_gene_src_organelle 
_entity_src_gen.pdbx_gene_src_cell 
_entity_src_gen.pdbx_gene_src_cellular_location 
_entity_src_gen.host_org_common_name 
_entity_src_gen.pdbx_host_org_scientific_name 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 
_entity_src_gen.host_org_genus 
_entity_src_gen.pdbx_host_org_gene 
_entity_src_gen.pdbx_host_org_organ 
_entity_src_gen.host_org_species 
_entity_src_gen.pdbx_host_org_tissue 
_entity_src_gen.pdbx_host_org_tissue_fraction 
_entity_src_gen.pdbx_host_org_strain 
_entity_src_gen.pdbx_host_org_variant 
_entity_src_gen.pdbx_host_org_cell_line 
_entity_src_gen.pdbx_host_org_atcc 
_entity_src_gen.pdbx_host_org_culture_collection 
_entity_src_gen.pdbx_host_org_cell 
_entity_src_gen.pdbx_host_org_organelle 
_entity_src_gen.pdbx_host_org_cellular_location 
_entity_src_gen.pdbx_host_org_vector_type 
_entity_src_gen.pdbx_host_org_vector 
_entity_src_gen.host_org_details 
_entity_src_gen.expression_system_id 
_entity_src_gen.plasmid_name 
_entity_src_gen.plasmid_details 
_entity_src_gen.pdbx_description 
1 1 sample 'Biological sequence' 1   307 Human ? GABRB2 ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? Human 'Homo sapiens' 9606 ? 
? ? ? ? ? ? GnTI- HEK293 CRL-3022 ? ? ? ? ? ? ? ? pEZT-BM ? ? 
1 2 sample 'Biological sequence' 308 341 Human ? GABRB2 ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? Human 'Homo sapiens' 9606 ? 
? ? ? ? ? ? GnTI- HEK293 CRL-3022 ? ? ? ? ? ? ? ? pEZT-BM ? ? 
2 1 sample 'Biological sequence' 1   312 Human ? GABRA1 ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? Human 'Homo sapiens' 9606 ? 
? ? ? ? ? ? GnTI- HEK293 CRL-3022 ? ? ? ? ? ? ? ? ?       ? ? 
2 2 sample 'Biological sequence' 313 358 Human ? GABRA1 ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? Human 'Homo sapiens' 9606 ? 
? ? ? ? ? ? GnTI- HEK293 CRL-3022 ? ? ? ? ? ? ? ? ?       ? ? 
3 1 sample 'Biological sequence' 1   359 Human ? GABRG2 ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? Human 'Homo sapiens' 9606 ? 
? ? ? ? ? ? GnTI- HEK293 CRL-3022 ? ? ? ? ? ? ? ? pEZT-BM ? ? 
3 2 sample 'Biological sequence' 360 394 Human ? GABRG2 ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? Human 'Homo sapiens' 9606 ? 
? ? ? ? ? ? GnTI- HEK293 CRL-3022 ? ? ? ? ? ? ? ? pEZT-BM ? ? 
# 
loop_
_entity_src_nat.entity_id 
_entity_src_nat.pdbx_src_id 
_entity_src_nat.pdbx_alt_source_flag 
_entity_src_nat.pdbx_beg_seq_num 
_entity_src_nat.pdbx_end_seq_num 
_entity_src_nat.common_name 
_entity_src_nat.pdbx_organism_scientific 
_entity_src_nat.pdbx_ncbi_taxonomy_id 
_entity_src_nat.genus 
_entity_src_nat.species 
_entity_src_nat.strain 
_entity_src_nat.tissue 
_entity_src_nat.tissue_fraction 
_entity_src_nat.pdbx_secretion 
_entity_src_nat.pdbx_fragment 
_entity_src_nat.pdbx_variant 
_entity_src_nat.pdbx_cell_line 
_entity_src_nat.pdbx_atcc 
_entity_src_nat.pdbx_cellular_location 
_entity_src_nat.pdbx_organ 
_entity_src_nat.pdbx_organelle 
_entity_src_nat.pdbx_cell 
_entity_src_nat.pdbx_plasmid_name 
_entity_src_nat.pdbx_plasmid_details 
_entity_src_nat.details 
4 1 sample 1 213 'house mouse' 'Mus musculus' 10090 ? ? BALB/c ? ? ? ? ? ? ? ? ? ? ? ? 'From generated Hybrido' ? 
5 1 sample 1 454 'house mouse' 'Mus musculus' 10090 ? ? BALB/c ? ? ? ? ? ? ? ? ? ? ? ? ?                        ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_db_isoform 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
1 UNP GBRB2_HUMAN P47870 ? 1 
;QSVNDPSNMSLVKETVDRLLKGYDIRLRPDFGGPPVAVGMNIDIASIDMVSEVNMDYTLTMYFQQAWRDKRLSYNVIPLN
LTLDNRVADQLWVPDTYFLNDKKSFVHGVTVKNRMIRLHPDGTVLYGLRITTTAACMMDLRRYPLDEQNCTLEIESYGYT
TDDIEFYWRGDDNAVTGVTKIELPQFSIVDYKLITKKVVFSTGSYPRLSLSFKLKRNIGYFILQTYMPSILITILSWVSF
WINYDASAARVALGITTVLTMTTINTHLRETLPKIPYVKAIDMYLMGCFVFVFMALLEYALVNYIFF
;
25  
2 UNP GBRB2_HUMAN P47870 ? 1 AIDRWSRIFFPVVFSFFNIVYWLYYVN 486 
3 UNP GBRA1_HUMAN P14867 ? 2 
;QPSLQDELKDNTTVFTRILDRLLDGYDNRLRPGLGERVTEVKTDIFVTSFGPVSDHDMEYTIDVFFRQSWKDERLKFKGP
MTVLRLNNLMASKIWTPDTFFHNGKKSVAHNMTMPNKLLRITEDGTLLYTMRLTVRAECPMHLEDFPMDAHACPLKFGSY
AYTRAEVVYEWTREPARSVVVAEDGSRLNQYDLLGQTVDSGIVQSSTGEYVVMTTHFHLKRKIGYFVIQTYLPCIMTVIL
SQVSFWLNRESVPARTVFGVTTVLTMTTLSISARNSLPKVAYATAMDWFIAVCYAFVFSALIEFATVNYFTK
;
28  
4 UNP GBRA1_HUMAN P14867 ? 2 KIDRLSRIAFPLLFGIFNLVYWATYLNREPQLKAPTPHQ 418 
5 UNP GBRG2_HUMAN P18507 ? 3 
;QKSDDDYEDYASNKTWVLTPKVPEGDVTVILNNLLEGYDNKLRPDIGVKPTLIHTDMYVNSIGPVNAINMEYTIDIFFAQ
TWYDRRLKFNSTIKVLRLNSNMVGKIWIPDTFFRNSKKADAHWITTPNRMLRIWNDGRVLYTLRLTIDAECQLQLHNFPM
DEHSCPLEFSSYGYPREEIVYQWKRSSVEVGDTRSWRLYQFSFVGLRNTTEVVKTTSGDYVVMSVYFDLSRRMGYFTIQT
YIPCTLIVVLSWVSFWINKDAVPARTSLGITTVLTMTTLSTIARKSLPKVSYVTAMDLFVSVCFIFVFSALVEYGTLHYF
VS
;
40  
6 UNP GBRG2_HUMAN P18507 ? 3 AKMDSYARIFFPTAFCLFNLVYWVSYLYL 439 
7 PDB 6D6U        6D6U   ? 4 ? 1   
8 PDB 6D6U        6D6U   ? 5 ? 1   
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1  1 6D6U A 1   ? 307 ? P47870 25  ? 331 ? 1   307 
2  2 6D6U A 315 ? 341 ? P47870 486 ? 512 ? 315 341 
3  3 6D6U B 1   ? 312 ? P14867 28  ? 339 ? 1   312 
4  4 6D6U B 320 ? 358 ? P14867 418 ? 456 ? 320 358 
5  1 6D6U C 1   ? 307 ? P47870 25  ? 331 ? 1   307 
6  2 6D6U C 315 ? 341 ? P47870 486 ? 512 ? 315 341 
7  3 6D6U D 1   ? 312 ? P14867 28  ? 339 ? 1   312 
8  4 6D6U D 320 ? 358 ? P14867 418 ? 456 ? 320 358 
9  5 6D6U E 38  ? 359 ? P18507 40  ? 361 ? 1   322 
10 6 6D6U E 366 ? 394 ? P18507 439 ? 467 ? 329 357 
11 7 6D6U I 1   ? 213 ? 6D6U   1   ? 213 ? 1   213 
12 8 6D6U J 1   ? 454 ? 6D6U   1   ? 454 ? 1   454 
13 7 6D6U L 1   ? 213 ? 6D6U   1   ? 213 ? 1   213 
14 8 6D6U K 1   ? 454 ? 6D6U   1   ? 454 ? 1   454 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 6D6U SER A 308 ? UNP P47870 ? ? linker           308 1  
1 6D6U GLN A 309 ? UNP P47870 ? ? linker           309 2  
1 6D6U PRO A 310 ? UNP P47870 ? ? linker           310 3  
1 6D6U ALA A 311 ? UNP P47870 ? ? linker           311 4  
1 6D6U ARG A 312 ? UNP P47870 ? ? linker           312 5  
1 6D6U ALA A 313 ? UNP P47870 ? ? linker           313 6  
1 6D6U ALA A 314 ? UNP P47870 ? ? linker           314 7  
3 6D6U SER B 313 ? UNP P14867 ? ? linker           313 8  
3 6D6U GLN B 314 ? UNP P14867 ? ? linker           314 9  
3 6D6U PRO B 315 ? UNP P14867 ? ? linker           315 10 
3 6D6U ALA B 316 ? UNP P14867 ? ? linker           316 11 
3 6D6U ARG B 317 ? UNP P14867 ? ? linker           317 12 
3 6D6U ALA B 318 ? UNP P14867 ? ? linker           318 13 
3 6D6U ALA B 319 ? UNP P14867 ? ? linker           319 14 
5 6D6U SER C 308 ? UNP P47870 ? ? linker           308 15 
5 6D6U GLN C 309 ? UNP P47870 ? ? linker           309 16 
5 6D6U PRO C 310 ? UNP P47870 ? ? linker           310 17 
5 6D6U ALA C 311 ? UNP P47870 ? ? linker           311 18 
5 6D6U ARG C 312 ? UNP P47870 ? ? linker           312 19 
5 6D6U ALA C 313 ? UNP P47870 ? ? linker           313 20 
5 6D6U ALA C 314 ? UNP P47870 ? ? linker           314 21 
7 6D6U SER D 313 ? UNP P14867 ? ? linker           313 22 
7 6D6U GLN D 314 ? UNP P14867 ? ? linker           314 23 
7 6D6U PRO D 315 ? UNP P14867 ? ? linker           315 24 
7 6D6U ALA D 316 ? UNP P14867 ? ? linker           316 25 
7 6D6U ARG D 317 ? UNP P14867 ? ? linker           317 26 
7 6D6U ALA D 318 ? UNP P14867 ? ? linker           318 27 
7 6D6U ALA D 319 ? UNP P14867 ? ? linker           319 28 
9 6D6U TRP E 1   ? UNP P18507 ? ? 'expression tag' -36 29 
9 6D6U SER E 2   ? UNP P18507 ? ? 'expression tag' -35 30 
9 6D6U HIS E 3   ? UNP P18507 ? ? 'expression tag' -34 31 
9 6D6U PRO E 4   ? UNP P18507 ? ? 'expression tag' -33 32 
9 6D6U GLN E 5   ? UNP P18507 ? ? 'expression tag' -32 33 
9 6D6U PHE E 6   ? UNP P18507 ? ? 'expression tag' -31 34 
9 6D6U GLU E 7   ? UNP P18507 ? ? 'expression tag' -30 35 
9 6D6U LYS E 8   ? UNP P18507 ? ? 'expression tag' -29 36 
9 6D6U GLY E 9   ? UNP P18507 ? ? 'expression tag' -28 37 
9 6D6U GLY E 10  ? UNP P18507 ? ? 'expression tag' -27 38 
9 6D6U GLY E 11  ? UNP P18507 ? ? 'expression tag' -26 39 
9 6D6U SER E 12  ? UNP P18507 ? ? 'expression tag' -25 40 
9 6D6U GLY E 13  ? UNP P18507 ? ? 'expression tag' -24 41 
9 6D6U GLY E 14  ? UNP P18507 ? ? 'expression tag' -23 42 
9 6D6U GLY E 15  ? UNP P18507 ? ? 'expression tag' -22 43 
9 6D6U SER E 16  ? UNP P18507 ? ? 'expression tag' -21 44 
9 6D6U GLY E 17  ? UNP P18507 ? ? 'expression tag' -20 45 
9 6D6U GLY E 18  ? UNP P18507 ? ? 'expression tag' -19 46 
9 6D6U SER E 19  ? UNP P18507 ? ? 'expression tag' -18 47 
9 6D6U SER E 20  ? UNP P18507 ? ? 'expression tag' -17 48 
9 6D6U ALA E 21  ? UNP P18507 ? ? 'expression tag' -16 49 
9 6D6U TRP E 22  ? UNP P18507 ? ? 'expression tag' -15 50 
9 6D6U SER E 23  ? UNP P18507 ? ? 'expression tag' -14 51 
9 6D6U HIS E 24  ? UNP P18507 ? ? 'expression tag' -13 52 
9 6D6U PRO E 25  ? UNP P18507 ? ? 'expression tag' -12 53 
9 6D6U GLN E 26  ? UNP P18507 ? ? 'expression tag' -11 54 
9 6D6U PHE E 27  ? UNP P18507 ? ? 'expression tag' -10 55 
9 6D6U GLU E 28  ? UNP P18507 ? ? 'expression tag' -9  56 
9 6D6U LYS E 29  ? UNP P18507 ? ? 'expression tag' -8  57 
9 6D6U LEU E 30  ? UNP P18507 ? ? 'expression tag' -7  58 
9 6D6U GLU E 31  ? UNP P18507 ? ? 'expression tag' -6  59 
9 6D6U VAL E 32  ? UNP P18507 ? ? 'expression tag' -5  60 
9 6D6U LEU E 33  ? UNP P18507 ? ? 'expression tag' -4  61 
9 6D6U PHE E 34  ? UNP P18507 ? ? 'expression tag' -3  62 
9 6D6U GLN E 35  ? UNP P18507 ? ? 'expression tag' -2  63 
9 6D6U GLY E 36  ? UNP P18507 ? ? 'expression tag' -1  64 
9 6D6U PRO E 37  ? UNP P18507 ? ? 'expression tag' 0   65 
9 6D6U SER E 360 ? UNP P18507 ? ? linker           323 66 
9 6D6U GLN E 361 ? UNP P18507 ? ? linker           324 67 
9 6D6U PRO E 362 ? UNP P18507 ? ? linker           325 68 
9 6D6U ALA E 363 ? UNP P18507 ? ? linker           326 69 
9 6D6U ARG E 364 ? UNP P18507 ? ? linker           327 70 
9 6D6U ALA E 365 ? UNP P18507 ? ? linker           328 71 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ABU non-polymer                   . 'GAMMA-AMINO-BUTANOIC ACID'                                                                    
'GAMMA(AMINO)-BUTYRIC ACID' 'C4 H9 N O2'      103.120 
ALA 'L-peptide linking'           y ALANINE                                                                                        
?                           'C3 H7 N O2'      89.093  
ARG 'L-peptide linking'           y ARGININE                                                                                       
?                           'C6 H15 N4 O2 1'  175.209 
ASN 'L-peptide linking'           y ASPARAGINE                                                                                     
?                           'C4 H8 N2 O3'     132.118 
ASP 'L-peptide linking'           y 'ASPARTIC ACID'                                                                                
?                           'C4 H7 N O4'      133.103 
BMA 'D-saccharide, beta linking'  . beta-D-mannopyranose                                                                           
?                           'C6 H12 O6'       180.156 
CYS 'L-peptide linking'           y CYSTEINE                                                                                       
?                           'C3 H7 N O2 S'    121.158 
FYP non-polymer                   . 'ethyl 8-fluoro-5-methyl-6-oxo-5,6-dihydro-4H-imidazo[1,5-a][1,4]benzodiazepine-3-carboxylate' 
Flumazenil                  'C15 H14 F N3 O3' 303.288 
GLN 'L-peptide linking'           y GLUTAMINE                                                                                      
?                           'C5 H10 N2 O3'    146.144 
GLU 'L-peptide linking'           y 'GLUTAMIC ACID'                                                                                
?                           'C5 H9 N O4'      147.129 
GLY 'peptide linking'             y GLYCINE                                                                                        
?                           'C2 H5 N O2'      75.067  
HIS 'L-peptide linking'           y HISTIDINE                                                                                      
?                           'C6 H10 N3 O2 1'  156.162 
ILE 'L-peptide linking'           y ISOLEUCINE                                                                                     
?                           'C6 H13 N O2'     131.173 
LEU 'L-peptide linking'           y LEUCINE                                                                                        
?                           'C6 H13 N O2'     131.173 
LYS 'L-peptide linking'           y LYSINE                                                                                         
?                           'C6 H15 N2 O2 1'  147.195 
MAN 'D-saccharide, alpha linking' . alpha-D-mannopyranose                                                                          
?                           'C6 H12 O6'       180.156 
MET 'L-peptide linking'           y METHIONINE                                                                                     
?                           'C5 H11 N O2 S'   149.211 
NAG 'D-saccharide, beta linking'  . 2-acetamido-2-deoxy-beta-D-glucopyranose                                                       
?                           'C8 H15 N O6'     221.208 
PHE 'L-peptide linking'           y PHENYLALANINE                                                                                  
?                           'C9 H11 N O2'     165.189 
PRO 'L-peptide linking'           y PROLINE                                                                                        
?                           'C5 H9 N O2'      115.130 
SER 'L-peptide linking'           y SERINE                                                                                         
?                           'C3 H7 N O3'      105.093 
THR 'L-peptide linking'           y THREONINE                                                                                      
?                           'C4 H9 N O3'      119.119 
TRP 'L-peptide linking'           y TRYPTOPHAN                                                                                     
?                           'C11 H12 N2 O2'   204.225 
TYR 'L-peptide linking'           y TYROSINE                                                                                       
?                           'C9 H11 N O3'     181.189 
VAL 'L-peptide linking'           y VALINE                                                                                         
?                           'C5 H11 N O2'     117.146 
Y01 non-polymer                   . 'CHOLESTEROL HEMISUCCINATE'                                                                    
?                           'C31 H50 O4'      486.726 
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.entry_id                   6D6U 
_exptl.crystals_number            ? 
_exptl.details                    ? 
_exptl.method                     'ELECTRON MICROSCOPY' 
_exptl.method_details             ? 
# 
_refine.pdbx_refine_id                           'ELECTRON MICROSCOPY' 
_refine.entry_id                                 6D6U 
_refine.pdbx_diffrn_id                           ? 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.ls_number_reflns_obs                     ? 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             ? 
_refine.ls_d_res_high                            3.80 
_refine.ls_percent_reflns_obs                    ? 
_refine.ls_R_factor_obs                          ? 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       ? 
_refine.ls_R_factor_R_free                       ? 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 ? 
_refine.ls_number_reflns_R_free                  ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.B_iso_mean                               ? 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_ls_cross_valid_method               ? 
_refine.details                                  ? 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_method_to_determine_struct          ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.overall_SU_B                             ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_struct.entry_id                     6D6U 
_struct.title                        
'Human GABA-A receptor alpha1-beta2-gamma2 subtype in complex with GABA and flumazenil, conformation A' 
_struct.pdbx_descriptor              
;Gamma-aminobutyric acid receptor subunit beta-2,Gamma-aminobutyric acid receptor subunit alpha-1,Gamma-aminobutyric acid receptor subunit gamma-2,Kappa Fab Light Chain, IgG2b Fab Heavy Chain
;
_struct.pdbx_model_details           ? 
_struct.pdbx_formula_weight          ? 
_struct.pdbx_formula_weight_method   ? 
_struct.pdbx_model_type_details      ? 
_struct.pdbx_CASP_flag               N 
# 
_struct_keywords.entry_id        6D6U 
_struct_keywords.text            'Ligand-gated ion channel, GABA-A receptor, Cys-loop receptor, TRANSPORT PROTEIN' 
_struct_keywords.pdbx_keywords   'TRANSPORT PROTEIN' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A  N N 1  ? 
B  N N 2  ? 
C  N N 1  ? 
D  N N 2  ? 
E  N N 3  ? 
F  N N 4  ? 
G  N N 5  ? 
H  N N 4  ? 
I  N N 5  ? 
J  N N 6  ? 
K  N N 7  ? 
L  N N 6  ? 
M  N N 8  ? 
N  N N 9  ? 
O  N N 10 ? 
P  N N 11 ? 
Q  N N 11 ? 
R  N N 11 ? 
S  N N 9  ? 
T  N N 10 ? 
U  N N 11 ? 
V  N N 11 ? 
W  N N 11 ? 
X  N N 11 ? 
Y  N N 11 ? 
Z  N N 11 ? 
AA N N 11 ? 
BA N N 11 ? 
CA N N 12 ? 
DA N N 11 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  AA1 ASN A 8   ? LEU A 20  ? ASN A 8   LEU A 20  1 ? 13 
HELX_P HELX_P2  AA2 ARG A 86  ? GLN A 90  ? ARG A 86  GLN A 90  5 ? 5  
HELX_P HELX_P3  AA3 GLY A 170 ? ASN A 173 ? GLY A 170 ASN A 173 5 ? 4  
HELX_P HELX_P4  AA4 ASN A 217 ? TYR A 226 ? ASN A 217 TYR A 226 1 ? 10 
HELX_P HELX_P5  AA5 TYR A 226 ? SER A 236 ? TYR A 226 SER A 236 1 ? 11 
HELX_P HELX_P6  AA6 TRP A 237 ? TRP A 241 ? TRP A 237 TRP A 241 5 ? 5  
HELX_P HELX_P7  AA7 SER A 247 ? LEU A 272 ? SER A 247 LEU A 272 1 ? 26 
HELX_P HELX_P8  AA8 ALA A 280 ? GLN A 309 ? ALA A 280 GLN A 309 1 ? 30 
HELX_P HELX_P9  AA9 GLN A 309 ? VAL A 340 ? GLN A 309 VAL A 340 1 ? 32 
HELX_P HELX_P10 AB1 ASN B 11  ? LEU B 22  ? ASN B 11  LEU B 22  1 ? 12 
HELX_P HELX_P11 AB2 ASP B 72  ? LYS B 76  ? ASP B 72  LYS B 76  5 ? 5  
HELX_P HELX_P12 AB3 LEU B 89  ? LYS B 93  ? LEU B 89  LYS B 93  5 ? 5  
HELX_P HELX_P13 AB4 GLU B 174 ? VAL B 179 ? GLU B 174 VAL B 179 1 ? 6  
HELX_P HELX_P14 AB5 ILE B 223 ? THR B 230 ? ILE B 223 THR B 230 1 ? 8  
HELX_P HELX_P15 AB6 THR B 230 ? SER B 241 ? THR B 230 SER B 241 1 ? 12 
HELX_P HELX_P16 AB7 GLN B 242 ? LEU B 247 ? GLN B 242 LEU B 247 1 ? 6  
HELX_P HELX_P17 AB8 SER B 251 ? LEU B 277 ? SER B 251 LEU B 277 1 ? 27 
HELX_P HELX_P18 AB9 MET B 286 ? THR B 311 ? MET B 286 THR B 311 1 ? 26 
HELX_P HELX_P19 AC1 GLN B 314 ? LEU B 345 ? GLN B 314 LEU B 345 1 ? 32 
HELX_P HELX_P20 AC2 MET C 9   ? LEU C 20  ? MET C 9   LEU C 20  1 ? 12 
HELX_P HELX_P21 AC3 ARG C 86  ? GLN C 90  ? ARG C 86  GLN C 90  5 ? 5  
HELX_P HELX_P22 AC4 ILE C 218 ? TYR C 226 ? ILE C 218 TYR C 226 1 ? 9  
HELX_P HELX_P23 AC5 TYR C 226 ? SER C 239 ? TYR C 226 SER C 239 1 ? 14 
HELX_P HELX_P24 AC6 ALA C 246 ? LEU C 272 ? ALA C 246 LEU C 272 1 ? 27 
HELX_P HELX_P25 AC7 LYS C 279 ? PHE C 306 ? LYS C 279 PHE C 306 1 ? 28 
HELX_P HELX_P26 AC8 GLN C 309 ? TYR C 339 ? GLN C 309 TYR C 339 1 ? 31 
HELX_P HELX_P27 AC9 THR D 12  ? LEU D 23  ? THR D 12  LEU D 23  1 ? 12 
HELX_P HELX_P28 AD1 ASN D 88  ? LYS D 93  ? ASN D 88  LYS D 93  5 ? 6  
HELX_P HELX_P29 AD2 HIS D 142 ? PHE D 146 ? HIS D 142 PHE D 146 5 ? 5  
HELX_P HELX_P30 AD3 GLU D 174 ? SER D 178 ? GLU D 174 SER D 178 5 ? 5  
HELX_P HELX_P31 AD4 ILE D 223 ? THR D 230 ? ILE D 223 THR D 230 1 ? 8  
HELX_P HELX_P32 AD5 THR D 230 ? GLN D 242 ? THR D 230 GLN D 242 1 ? 13 
HELX_P HELX_P33 AD6 VAL D 243 ? LEU D 247 ? VAL D 243 LEU D 247 5 ? 5  
HELX_P HELX_P34 AD7 SER D 251 ? ASN D 275 ? SER D 251 ASN D 275 1 ? 25 
HELX_P HELX_P35 AD8 THR D 284 ? GLN D 314 ? THR D 284 GLN D 314 1 ? 31 
HELX_P HELX_P36 AD9 GLN D 314 ? ASN D 346 ? GLN D 314 ASN D 346 1 ? 33 
HELX_P HELX_P37 AE1 ASP E 63  ? GLU E 73  ? ASP E 26  GLU E 36  1 ? 11 
HELX_P HELX_P38 AE2 ASN E 136 ? VAL E 140 ? ASN E 99  VAL E 103 5 ? 5  
HELX_P HELX_P39 AE3 ASP E 229 ? TRP E 233 ? ASP E 192 TRP E 196 5 ? 5  
HELX_P HELX_P40 AE4 TYR E 278 ? TRP E 289 ? TYR E 241 TRP E 252 1 ? 12 
HELX_P HELX_P41 AE5 VAL E 290 ? PHE E 292 ? VAL E 253 PHE E 255 5 ? 3  
HELX_P HELX_P42 AE6 ALA E 298 ? ARG E 321 ? ALA E 261 ARG E 284 1 ? 24 
HELX_P HELX_P43 AE7 THR E 331 ? PHE E 357 ? THR E 294 PHE E 320 1 ? 27 
HELX_P HELX_P44 AE8 GLN E 361 ? LEU E 392 ? GLN E 324 LEU E 355 1 ? 32 
HELX_P HELX_P45 AE9 ASN G 28  ? THR G 32  ? ASN J 28  THR J 32  5 ? 5  
HELX_P HELX_P46 AF1 THR G 87  ? THR G 91  ? THR J 87  THR J 91  5 ? 5  
HELX_P HELX_P47 AF2 ASN I 28  ? THR I 32  ? ASN K 28  THR K 32  5 ? 5  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
_struct_conn.pdbx_role 
disulf1  disulf ?    ? A CYS 136 SG  ? ? ? 1_555 A CYS 150 SG ? ? A CYS 136 A CYS 150 1_555 ? ? ? ? ? ? ? 2.035 ? ?               
disulf2  disulf ?    ? B CYS 139 SG  ? ? ? 1_555 B CYS 153 SG ? ? B CYS 139 B CYS 153 1_555 ? ? ? ? ? ? ? 2.037 ? ?               
disulf3  disulf ?    ? B CYS 234 SG  ? ? ? 1_555 B CYS 293 SG ? ? B CYS 234 B CYS 293 1_555 ? ? ? ? ? ? ? 2.037 ? ?               
disulf4  disulf ?    ? C CYS 136 SG  ? ? ? 1_555 C CYS 150 SG ? ? C CYS 136 C CYS 150 1_555 ? ? ? ? ? ? ? 2.037 ? ?               
disulf5  disulf ?    ? D CYS 139 SG  ? ? ? 1_555 D CYS 153 SG ? ? D CYS 139 D CYS 153 1_555 ? ? ? ? ? ? ? 2.037 ? ?               
disulf6  disulf ?    ? D CYS 234 SG  ? ? ? 1_555 D CYS 293 SG ? ? D CYS 234 D CYS 293 1_555 ? ? ? ? ? ? ? 2.028 ? ?               
disulf7  disulf ?    ? E CYS 188 SG  ? ? ? 1_555 E CYS 202 SG ? ? E CYS 151 E CYS 165 1_555 ? ? ? ? ? ? ? 2.032 ? ?               
disulf8  disulf ?    ? E CYS 281 SG  ? ? ? 1_555 E CYS 340 SG ? ? E CYS 244 E CYS 303 1_555 ? ? ? ? ? ? ? 2.031 ? ?               
disulf9  disulf ?    ? F CYS 23  SG  ? ? ? 1_555 F CYS 88  SG ? ? I CYS 23  I CYS 88  1_555 ? ? ? ? ? ? ? 2.033 ? ?               
disulf10 disulf ?    ? G CYS 22  SG  ? ? ? 1_555 G CYS 96  SG ? ? J CYS 22  J CYS 96  1_555 ? ? ? ? ? ? ? 2.035 ? ?               
disulf11 disulf ?    ? H CYS 23  SG  ? ? ? 1_555 H CYS 88  SG ? ? L CYS 23  L CYS 88  1_555 ? ? ? ? ? ? ? 2.033 ? ?               
disulf12 disulf ?    ? I CYS 22  SG  ? ? ? 1_555 I CYS 96  SG ? ? K CYS 22  K CYS 96  1_555 ? ? ? ? ? ? ? 2.033 ? ?               
covale1  covale one  ? A ASN 80  ND2 ? ? ? 1_555 N NAG .   C1 ? ? A ASN 80  A NAG 404 1_555 ? ? ? ? ? ? ? 1.458 ? N-Glycosylation 
covale2  covale one  ? A ASN 149 ND2 ? ? ? 1_555 J NAG .   C1 ? ? A ASN 149 F NAG 1   1_555 ? ? ? ? ? ? ? 1.442 ? N-Glycosylation 
covale3  covale one  ? B ASN 111 ND2 ? ? ? 1_555 K NAG .   C1 ? ? B ASN 111 G NAG 1   1_555 ? ? ? ? ? ? ? 1.434 ? N-Glycosylation 
covale4  covale one  ? C ASN 80  ND2 ? ? ? 1_555 S NAG .   C1 ? ? C ASN 80  C NAG 404 1_555 ? ? ? ? ? ? ? 1.441 ? N-Glycosylation 
covale5  covale one  ? C ASN 149 ND2 ? ? ? 1_555 L NAG .   C1 ? ? C ASN 149 H NAG 1   1_555 ? ? ? ? ? ? ? 1.436 ? N-Glycosylation 
covale6  covale one  ? D ASN 111 ND2 ? ? ? 1_555 M NAG .   C1 ? ? D ASN 111 M NAG 1   1_555 ? ? ? ? ? ? ? 1.445 ? N-Glycosylation 
covale7  covale both ? J NAG .   O4  ? ? ? 1_555 J NAG .   C1 ? ? F NAG 1   F NAG 2   1_555 ? ? ? ? ? ? ? 1.441 ? ?               
covale8  covale both ? J NAG .   O4  ? ? ? 1_555 J BMA .   C1 ? ? F NAG 2   F BMA 3   1_555 ? ? ? ? ? ? ? 1.444 ? ?               
covale9  covale both ? K NAG .   O4  ? ? ? 1_555 K NAG .   C1 ? ? G NAG 1   G NAG 2   1_555 ? ? ? ? ? ? ? 1.448 ? ?               
covale10 covale both ? K NAG .   O4  ? ? ? 1_555 K BMA .   C1 ? ? G NAG 2   G BMA 3   1_555 ? ? ? ? ? ? ? 1.444 ? ?               
covale11 covale both ? K BMA .   O3  ? ? ? 1_555 K MAN .   C1 ? ? G BMA 3   G MAN 4   1_555 ? ? ? ? ? ? ? 1.442 ? ?               
covale12 covale both ? K BMA .   O6  ? ? ? 1_555 K MAN .   C1 ? ? G BMA 3   G MAN 6   1_555 ? ? ? ? ? ? ? 1.434 ? ?               
covale13 covale both ? K MAN .   O2  ? ? ? 1_555 K MAN .   C1 ? ? G MAN 4   G MAN 5   1_555 ? ? ? ? ? ? ? 1.437 ? ?               
covale14 covale both ? K MAN .   O3  ? ? ? 1_555 K MAN .   C1 ? ? G MAN 6   G MAN 7   1_555 ? ? ? ? ? ? ? 1.445 ? ?               
covale15 covale both ? K MAN .   O6  ? ? ? 1_555 K MAN .   C1 ? ? G MAN 6   G MAN 8   1_555 ? ? ? ? ? ? ? 1.444 ? ?               
covale16 covale both ? L NAG .   O4  ? ? ? 1_555 L NAG .   C1 ? ? H NAG 1   H NAG 2   1_555 ? ? ? ? ? ? ? 1.439 ? ?               
covale17 covale both ? L NAG .   O4  ? ? ? 1_555 L BMA .   C1 ? ? H NAG 2   H BMA 3   1_555 ? ? ? ? ? ? ? 1.444 ? ?               
covale18 covale both ? M NAG .   O4  ? ? ? 1_555 M NAG .   C1 ? ? M NAG 1   M NAG 2   1_555 ? ? ? ? ? ? ? 1.443 ? ?               
covale19 covale both ? M NAG .   O4  ? ? ? 1_555 M BMA .   C1 ? ? M NAG 2   M BMA 3   1_555 ? ? ? ? ? ? ? 1.443 ? ?               
covale20 covale both ? M BMA .   O3  ? ? ? 1_555 M MAN .   C1 ? ? M BMA 3   M MAN 4   1_555 ? ? ? ? ? ? ? 1.441 ? ?               
covale21 covale both ? M BMA .   O6  ? ? ? 1_555 M MAN .   C1 ? ? M BMA 3   M MAN 5   1_555 ? ? ? ? ? ? ? 1.447 ? ?               
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
disulf ? ? 
covale ? ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 TYR 143 A . ? TYR 143 A PRO 144 A ? PRO 144 A 1 -5.96 
2 PHE 146 B . ? PHE 146 B PRO 147 B ? PRO 147 B 1 -0.48 
3 TYR 143 C . ? TYR 143 C PRO 144 C ? PRO 144 C 1 2.03  
4 PHE 146 D . ? PHE 146 D PRO 147 D ? PRO 147 D 1 -6.12 
5 PHE 195 E . ? PHE 158 E PRO 196 E ? PRO 159 E 1 5.26  
6 SER 7   F . ? SER 7   I PRO 8   F ? PRO 8   I 1 0.25  
7 SER 7   H . ? SER 7   L PRO 8   H ? PRO 8   L 1 -0.45 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA1 ? 5 ? 
AA2 ? 5 ? 
AA3 ? 4 ? 
AA4 ? 3 ? 
AA5 ? 2 ? 
AA6 ? 3 ? 
AA7 ? 3 ? 
AA8 ? 4 ? 
AA9 ? 6 ? 
AB1 ? 5 ? 
AB2 ? 4 ? 
AB3 ? 6 ? 
AB4 ? 2 ? 
AB5 ? 4 ? 
AB6 ? 4 ? 
AB7 ? 4 ? 
AB8 ? 5 ? 
AB9 ? 6 ? 
AC1 ? 2 ? 
AC2 ? 3 ? 
AC3 ? 3 ? 
AC4 ? 4 ? 
AC5 ? 5 ? 
AC6 ? 4 ? 
AC7 ? 4 ? 
AC8 ? 6 ? 
AC9 ? 4 ? 
AD1 ? 4 ? 
AD2 ? 4 ? 
AD3 ? 4 ? 
AD4 ? 6 ? 
AD5 ? 4 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA1 1 2 ? anti-parallel 
AA1 2 3 ? anti-parallel 
AA1 3 4 ? anti-parallel 
AA1 4 5 ? parallel      
AA2 1 2 ? anti-parallel 
AA2 2 3 ? anti-parallel 
AA2 3 4 ? anti-parallel 
AA2 4 5 ? parallel      
AA3 1 2 ? anti-parallel 
AA3 2 3 ? anti-parallel 
AA3 3 4 ? anti-parallel 
AA4 1 2 ? anti-parallel 
AA4 2 3 ? parallel      
AA5 1 2 ? parallel      
AA6 1 2 ? anti-parallel 
AA6 2 3 ? anti-parallel 
AA7 1 2 ? anti-parallel 
AA7 2 3 ? anti-parallel 
AA8 1 2 ? anti-parallel 
AA8 2 3 ? anti-parallel 
AA8 3 4 ? anti-parallel 
AA9 1 2 ? anti-parallel 
AA9 2 3 ? anti-parallel 
AA9 3 4 ? anti-parallel 
AA9 4 5 ? anti-parallel 
AA9 5 6 ? parallel      
AB1 1 2 ? anti-parallel 
AB1 2 3 ? anti-parallel 
AB1 3 4 ? anti-parallel 
AB1 4 5 ? parallel      
AB2 1 2 ? anti-parallel 
AB2 2 3 ? anti-parallel 
AB2 3 4 ? anti-parallel 
AB3 1 2 ? anti-parallel 
AB3 2 3 ? anti-parallel 
AB3 3 4 ? anti-parallel 
AB3 4 5 ? anti-parallel 
AB3 5 6 ? parallel      
AB4 1 2 ? parallel      
AB5 1 2 ? anti-parallel 
AB5 2 3 ? anti-parallel 
AB5 3 4 ? anti-parallel 
AB6 1 2 ? anti-parallel 
AB6 2 3 ? anti-parallel 
AB6 3 4 ? anti-parallel 
AB7 1 2 ? anti-parallel 
AB7 2 3 ? anti-parallel 
AB7 3 4 ? anti-parallel 
AB8 1 2 ? anti-parallel 
AB8 2 3 ? anti-parallel 
AB8 3 4 ? anti-parallel 
AB8 4 5 ? anti-parallel 
AB9 1 2 ? anti-parallel 
AB9 2 3 ? anti-parallel 
AB9 3 4 ? anti-parallel 
AB9 4 5 ? anti-parallel 
AB9 5 6 ? parallel      
AC1 1 2 ? anti-parallel 
AC2 1 2 ? anti-parallel 
AC2 2 3 ? anti-parallel 
AC3 1 2 ? anti-parallel 
AC3 2 3 ? anti-parallel 
AC4 1 2 ? anti-parallel 
AC4 2 3 ? anti-parallel 
AC4 3 4 ? anti-parallel 
AC5 1 2 ? parallel      
AC5 2 3 ? anti-parallel 
AC5 3 4 ? anti-parallel 
AC5 4 5 ? anti-parallel 
AC6 1 2 ? parallel      
AC6 2 3 ? anti-parallel 
AC6 3 4 ? anti-parallel 
AC7 1 2 ? anti-parallel 
AC7 2 3 ? anti-parallel 
AC7 3 4 ? anti-parallel 
AC8 1 2 ? parallel      
AC8 2 3 ? anti-parallel 
AC8 3 4 ? anti-parallel 
AC8 4 5 ? anti-parallel 
AC8 5 6 ? anti-parallel 
AC9 1 2 ? anti-parallel 
AC9 2 3 ? anti-parallel 
AC9 3 4 ? anti-parallel 
AD1 1 2 ? anti-parallel 
AD1 2 3 ? anti-parallel 
AD1 3 4 ? anti-parallel 
AD2 1 2 ? anti-parallel 
AD2 2 3 ? anti-parallel 
AD2 3 4 ? anti-parallel 
AD3 1 2 ? anti-parallel 
AD3 2 3 ? anti-parallel 
AD3 3 4 ? anti-parallel 
AD4 1 2 ? parallel      
AD4 2 3 ? anti-parallel 
AD4 3 4 ? anti-parallel 
AD4 4 5 ? anti-parallel 
AD4 5 6 ? anti-parallel 
AD5 1 2 ? parallel      
AD5 2 3 ? anti-parallel 
AD5 3 4 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA1 1 ASP A 101 ? VAL A 106 ? ASP A 101 VAL A 106 
AA1 2 THR A 123 ? ALA A 135 ? THR A 123 ALA A 135 
AA1 3 ASP A 56  ? ARG A 68  ? ASP A 56  ARG A 68  
AA1 4 VAL A 36  ? VAL A 50  ? VAL A 36  VAL A 50  
AA1 5 ILE A 164 ? TRP A 168 ? ILE A 164 TRP A 168 
AA2 1 MET A 115 ? ARG A 117 ? MET A 115 ARG A 117 
AA2 2 THR A 123 ? ALA A 135 ? THR A 123 ALA A 135 
AA2 3 ASP A 56  ? ARG A 68  ? ASP A 56  ARG A 68  
AA2 4 VAL A 36  ? VAL A 50  ? VAL A 36  VAL A 50  
AA2 5 VAL A 175 ? THR A 176 ? VAL A 175 THR A 176 
AA3 1 TYR A 97  ? PHE A 98  ? TYR A 97  PHE A 98  
AA3 2 GLU A 147 ? GLU A 155 ? GLU A 147 GLU A 155 
AA3 3 SER A 204 ? ARG A 216 ? SER A 204 ARG A 216 
AA3 4 PHE A 186 ? VAL A 199 ? PHE A 186 VAL A 199 
AA4 1 ARG B 67  ? SER B 69  ? ARG B 67  SER B 69  
AA4 2 THR B 39  ? ASP B 44  ? THR B 39  ASP B 44  
AA4 3 VAL B 167 ? TRP B 171 ? VAL B 167 TRP B 171 
AA5 1 PHE B 46  ? VAL B 47  ? PHE B 46  VAL B 47  
AA5 2 VAL B 180 ? VAL B 181 ? VAL B 180 VAL B 181 
AA6 1 GLU B 59  ? VAL B 64  ? GLU B 59  VAL B 64  
AA6 2 LEU B 133 ? GLU B 138 ? LEU B 133 GLU B 138 
AA6 3 VAL B 108 ? ALA B 109 ? VAL B 108 ALA B 109 
AA7 1 VAL B 83  ? LEU B 86  ? VAL B 83  LEU B 86  
AA7 2 LEU B 118 ? THR B 122 ? LEU B 118 THR B 122 
AA7 3 TYR B 129 ? THR B 130 ? TYR B 129 THR B 130 
AA8 1 PHE B 100 ? PHE B 101 ? PHE B 100 PHE B 101 
AA8 2 ALA B 150 ? GLY B 158 ? ALA B 150 GLY B 158 
AA8 3 GLU B 209 ? ARG B 221 ? GLU B 209 ARG B 221 
AA8 4 TYR B 191 ? GLN B 204 ? TYR B 191 GLN B 204 
AA9 1 THR C 82  ? LEU C 83  ? THR C 82  LEU C 83  
AA9 2 MET C 115 ? ARG C 117 ? MET C 115 ARG C 117 
AA9 3 THR C 123 ? GLY C 127 ? THR C 123 GLY C 127 
AA9 4 ASP C 56  ? ARG C 68  ? ASP C 56  ARG C 68  
AA9 5 VAL C 36  ? SER C 51  ? VAL C 36  SER C 51  
AA9 6 ILE C 164 ? TRP C 168 ? ILE C 164 TRP C 168 
AB1 1 ASP C 101 ? SER C 104 ? ASP C 101 SER C 104 
AB1 2 ILE C 130 ? ALA C 134 ? ILE C 130 ALA C 134 
AB1 3 ASP C 56  ? ARG C 68  ? ASP C 56  ARG C 68  
AB1 4 VAL C 36  ? SER C 51  ? VAL C 36  SER C 51  
AB1 5 VAL C 175 ? THR C 176 ? VAL C 175 THR C 176 
AB2 1 THR C 96  ? PHE C 98  ? THR C 96  PHE C 98  
AB2 2 GLU C 147 ? SER C 156 ? GLU C 147 SER C 156 
AB2 3 SER C 204 ? ARG C 216 ? SER C 204 ARG C 216 
AB2 4 PHE C 186 ? VAL C 199 ? PHE C 186 VAL C 199 
AB3 1 VAL D 83  ? LEU D 86  ? VAL D 83  LEU D 86  
AB3 2 LYS D 117 ? THR D 122 ? LYS D 117 THR D 122 
AB3 3 LEU D 127 ? MET D 131 ? LEU D 127 MET D 131 
AB3 4 ARG D 67  ? SER D 69  ? ARG D 67  SER D 69  
AB3 5 THR D 39  ? ASP D 44  ? THR D 39  ASP D 44  
AB3 6 VAL D 167 ? TRP D 171 ? VAL D 167 TRP D 171 
AB4 1 PHE D 46  ? VAL D 47  ? PHE D 46  VAL D 47  
AB4 2 VAL D 180 ? VAL D 181 ? VAL D 180 VAL D 181 
AB5 1 PHE D 50  ? VAL D 53  ? PHE D 50  VAL D 53  
AB5 2 GLU D 59  ? VAL D 64  ? GLU D 59  VAL D 64  
AB5 3 LEU D 133 ? GLU D 138 ? LEU D 133 GLU D 138 
AB5 4 VAL D 108 ? ALA D 109 ? VAL D 108 ALA D 109 
AB6 1 THR D 99  ? PHE D 101 ? THR D 99  PHE D 101 
AB6 2 ALA D 152 ? SER D 159 ? ALA D 152 SER D 159 
AB6 3 GLU D 209 ? ARG D 221 ? GLU D 209 ARG D 221 
AB6 4 TYR D 191 ? VAL D 198 ? TYR D 191 VAL D 198 
AB7 1 THR D 99  ? PHE D 101 ? THR D 99  PHE D 101 
AB7 2 ALA D 152 ? SER D 159 ? ALA D 152 SER D 159 
AB7 3 GLU D 209 ? ARG D 221 ? GLU D 209 ARG D 221 
AB7 4 ILE D 202 ? GLN D 204 ? ILE D 202 GLN D 204 
AB8 1 LEU E 133 ? LEU E 135 ? LEU E 96  LEU E 98  
AB8 2 ARG E 166 ? ILE E 170 ? ARG E 129 ILE E 133 
AB8 3 VAL E 176 ? ARG E 181 ? VAL E 139 ARG E 144 
AB8 4 TYR E 109 ? TRP E 119 ? TYR E 72  TRP E 82  
AB8 5 ILE E 184 ? ALA E 186 ? ILE E 147 ALA E 149 
AB9 1 LEU E 133 ? LEU E 135 ? LEU E 96  LEU E 98  
AB9 2 ARG E 166 ? ILE E 170 ? ARG E 129 ILE E 133 
AB9 3 VAL E 176 ? ARG E 181 ? VAL E 139 ARG E 144 
AB9 4 TYR E 109 ? TRP E 119 ? TYR E 72  TRP E 82  
AB9 5 THR E 88  ? ILE E 99  ? THR E 51  ILE E 62  
AB9 6 ILE E 216 ? GLU E 226 ? ILE E 179 GLU E 189 
AC1 1 PHE E 149 ? PHE E 150 ? PHE E 112 PHE E 113 
AC1 2 PHE E 206 ? SER E 207 ? PHE E 169 SER E 170 
AC2 1 GLU E 199 ? LEU E 204 ? GLU E 162 LEU E 167 
AC2 2 ASP E 256 ? ARG E 268 ? ASP E 219 ARG E 231 
AC2 3 PHE E 238 ? PHE E 240 ? PHE E 201 PHE E 203 
AC3 1 GLU E 199 ? LEU E 204 ? GLU E 162 LEU E 167 
AC3 2 ASP E 256 ? ARG E 268 ? ASP E 219 ARG E 231 
AC3 3 ARG E 244 ? LYS E 251 ? ARG E 207 LYS E 214 
AC4 1 MET F 4   ? SER F 7   ? MET I 4   SER I 7   
AC4 2 VAL F 19  ? ALA F 25  ? VAL I 19  ALA I 25  
AC4 3 PHE F 71  ? ILE F 75  ? PHE I 71  ILE I 75  
AC4 4 PHE F 62  ? GLY F 66  ? PHE I 62  GLY I 66  
AC5 1 SER F 10  ? MET F 13  ? SER I 10  MET I 13  
AC5 2 THR F 101 ? LEU F 105 ? THR I 101 LEU I 105 
AC5 3 ASP F 85  ? GLN F 90  ? ASP I 85  GLN I 90  
AC5 4 VAL F 33  ? GLN F 38  ? VAL I 33  GLN I 38  
AC5 5 LYS F 45  ? ILE F 48  ? LYS I 45  ILE I 48  
AC6 1 SER F 10  ? MET F 13  ? SER I 10  MET I 13  
AC6 2 THR F 101 ? LEU F 105 ? THR I 101 LEU I 105 
AC6 3 ASP F 85  ? GLN F 90  ? ASP I 85  GLN I 90  
AC6 4 THR F 96  ? PHE F 97  ? THR I 96  PHE I 97  
AC7 1 LEU G 4   ? GLN G 6   ? LEU J 4   GLN J 6   
AC7 2 VAL G 18  ? ALA G 24  ? VAL J 18  ALA J 24  
AC7 3 THR G 78  ? LEU G 83  ? THR J 78  LEU J 83  
AC7 4 ALA G 68  ? ASP G 73  ? ALA J 68  ASP J 73  
AC8 1 GLU G 10  ? VAL G 12  ? GLU J 10  VAL J 12  
AC8 2 THR G 112 ? VAL G 116 ? THR J 112 VAL J 116 
AC8 3 ALA G 92  ? ARG G 98  ? ALA J 92  ARG J 98  
AC8 4 MET G 34  ? GLN G 39  ? MET J 34  GLN J 39  
AC8 5 GLU G 46  ? ILE G 51  ? GLU J 46  ILE J 51  
AC8 6 THR G 58  ? TYR G 60  ? THR J 58  TYR J 60  
AC9 1 MET H 4   ? SER H 7   ? MET L 4   SER L 7   
AC9 2 VAL H 19  ? ALA H 25  ? VAL L 19  ALA L 25  
AC9 3 ASP H 70  ? ILE H 75  ? ASP L 70  ILE L 75  
AC9 4 THR H 63  ? GLY H 66  ? THR L 63  GLY L 66  
AD1 1 LYS H 45  ? TYR H 49  ? LYS L 45  TYR L 49  
AD1 2 VAL H 33  ? GLN H 38  ? VAL L 33  GLN L 38  
AD1 3 ASP H 85  ? GLN H 90  ? ASP L 85  GLN L 90  
AD1 4 THR H 96  ? PHE H 97  ? THR L 96  PHE L 97  
AD2 1 LYS H 45  ? TYR H 49  ? LYS L 45  TYR L 49  
AD2 2 VAL H 33  ? GLN H 38  ? VAL L 33  GLN L 38  
AD2 3 ASP H 85  ? GLN H 90  ? ASP L 85  GLN L 90  
AD2 4 THR H 101 ? LYS H 102 ? THR L 101 LYS L 102 
AD3 1 LEU I 4   ? GLN I 6   ? LEU K 4   GLN K 6   
AD3 2 LYS I 19  ? ALA I 24  ? LYS K 19  ALA K 24  
AD3 3 THR I 78  ? LEU I 83  ? THR K 78  LEU K 83  
AD3 4 ALA I 68  ? ASP I 73  ? ALA K 68  ASP K 73  
AD4 1 GLU I 10  ? VAL I 12  ? GLU K 10  VAL K 12  
AD4 2 THR I 112 ? VAL I 116 ? THR K 112 VAL K 116 
AD4 3 ALA I 92  ? LYS I 99  ? ALA K 92  LYS K 99  
AD4 4 MET I 34  ? GLN I 39  ? MET K 34  GLN K 39  
AD4 5 LEU I 45  ? ILE I 51  ? LEU K 45  ILE K 51  
AD4 6 THR I 58  ? TYR I 60  ? THR K 58  TYR K 60  
AD5 1 GLU I 10  ? VAL I 12  ? GLU K 10  VAL K 12  
AD5 2 THR I 112 ? VAL I 116 ? THR K 112 VAL K 116 
AD5 3 ALA I 92  ? LYS I 99  ? ALA K 92  LYS K 99  
AD5 4 MET I 105 ? TRP I 108 ? MET K 105 TRP K 108 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA1 1 2 N LYS A 103 ? N LYS A 103 O THR A 133 ? O THR A 133 
AA1 2 3 O LEU A 128 ? O LEU A 128 N PHE A 63  ? N PHE A 63  
AA1 3 4 O ALA A 66  ? O ALA A 66  N GLY A 39  ? N GLY A 39  
AA1 4 5 N VAL A 38  ? N VAL A 38  O GLU A 165 ? O GLU A 165 
AA2 1 2 N ARG A 117 ? N ARG A 117 O LEU A 125 ? O LEU A 125 
AA2 2 3 O LEU A 128 ? O LEU A 128 N PHE A 63  ? N PHE A 63  
AA2 3 4 O ALA A 66  ? O ALA A 66  N GLY A 39  ? N GLY A 39  
AA2 4 5 N ILE A 42  ? N ILE A 42  O THR A 176 ? O THR A 176 
AA3 1 2 N TYR A 97  ? N TYR A 97  O GLU A 155 ? O GLU A 155 
AA3 2 3 N ILE A 154 ? N ILE A 154 O LEU A 208 ? O LEU A 208 
AA3 3 4 O SER A 211 ? O SER A 211 N LYS A 192 ? N LYS A 192 
AA4 1 2 O SER B 69  ? O SER B 69  N LYS B 42  ? N LYS B 42  
AA4 2 3 N THR B 43  ? N THR B 43  O GLU B 170 ? O GLU B 170 
AA5 1 2 N VAL B 47  ? N VAL B 47  O VAL B 180 ? O VAL B 180 
AA6 1 2 N TYR B 60  ? N TYR B 60  O ALA B 137 ? O ALA B 137 
AA6 2 3 O THR B 134 ? O THR B 134 N VAL B 108 ? N VAL B 108 
AA7 1 2 N LEU B 84  ? N LEU B 84  O ILE B 121 ? O ILE B 121 
AA7 2 3 N LEU B 118 ? N LEU B 118 O THR B 130 ? O THR B 130 
AA8 1 2 N PHE B 100 ? N PHE B 100 O GLY B 158 ? O GLY B 158 
AA8 2 3 N LEU B 155 ? N LEU B 155 O THR B 215 ? O THR B 215 
AA8 3 4 O HIS B 216 ? O HIS B 216 N THR B 197 ? N THR B 197 
AA9 1 2 N LEU C 83  ? N LEU C 83  O ILE C 116 ? O ILE C 116 
AA9 2 3 N MET C 115 ? N MET C 115 O GLY C 127 ? O GLY C 127 
AA9 3 4 O TYR C 126 ? O TYR C 126 N GLN C 65  ? N GLN C 65  
AA9 4 5 O TYR C 62  ? O TYR C 62  N ASP C 43  ? N ASP C 43  
AA9 5 6 N VAL C 38  ? N VAL C 38  O GLU C 165 ? O GLU C 165 
AB1 1 2 N LYS C 103 ? N LYS C 103 O THR C 133 ? O THR C 133 
AB1 2 3 O THR C 132 ? O THR C 132 N LEU C 59  ? N LEU C 59  
AB1 3 4 O TYR C 62  ? O TYR C 62  N ASP C 43  ? N ASP C 43  
AB1 4 5 N ILE C 44  ? N ILE C 44  O THR C 176 ? O THR C 176 
AB2 1 2 N TYR C 97  ? N TYR C 97  O GLU C 155 ? O GLU C 155 
AB2 2 3 N ILE C 154 ? N ILE C 154 O LEU C 208 ? O LEU C 208 
AB2 3 4 O TYR C 205 ? O TYR C 205 N VAL C 198 ? N VAL C 198 
AB3 1 2 N LEU D 84  ? N LEU D 84  O ILE D 121 ? O ILE D 121 
AB3 2 3 N ARG D 120 ? N ARG D 120 O LEU D 128 ? O LEU D 128 
AB3 3 4 O TYR D 129 ? O TYR D 129 N GLN D 68  ? N GLN D 68  
AB3 4 5 O ARG D 67  ? O ARG D 67  N ASP D 44  ? N ASP D 44  
AB3 5 6 N THR D 39  ? N THR D 39  O VAL D 168 ? O VAL D 168 
AB4 1 2 N VAL D 47  ? N VAL D 47  O VAL D 180 ? O VAL D 180 
AB5 1 2 N GLY D 51  ? N GLY D 51  O THR D 61  ? O THR D 61  
AB5 2 3 N ILE D 62  ? N ILE D 62  O VAL D 135 ? O VAL D 135 
AB5 3 4 O THR D 134 ? O THR D 134 N VAL D 108 ? N VAL D 108 
AB6 1 2 N PHE D 100 ? N PHE D 100 O GLY D 158 ? O GLY D 158 
AB6 2 3 N CYS D 153 ? N CYS D 153 O PHE D 217 ? O PHE D 217 
AB6 3 4 O HIS D 216 ? O HIS D 216 N THR D 197 ? N THR D 197 
AB7 1 2 N PHE D 100 ? N PHE D 100 O GLY D 158 ? O GLY D 158 
AB7 2 3 N CYS D 153 ? N CYS D 153 O PHE D 217 ? O PHE D 217 
AB7 3 4 O TYR D 210 ? O TYR D 210 N VAL D 203 ? N VAL D 203 
AB8 1 2 N LEU E 133 ? N LEU E 96  O ILE E 170 ? O ILE E 133 
AB8 2 3 N MET E 167 ? N MET E 130 O THR E 179 ? O THR E 142 
AB8 3 4 O TYR E 178 ? O TYR E 141 N GLN E 117 ? N GLN E 80  
AB8 4 5 N ILE E 111 ? N ILE E 74  O ILE E 184 ? O ILE E 147 
AB9 1 2 N LEU E 133 ? N LEU E 96  O ILE E 170 ? O ILE E 133 
AB9 2 3 N MET E 167 ? N MET E 130 O THR E 179 ? O THR E 142 
AB9 3 4 O TYR E 178 ? O TYR E 141 N GLN E 117 ? N GLN E 80  
AB9 4 5 O ASP E 112 ? O ASP E 75  N ASN E 97  ? N ASN E 60  
AB9 5 6 N THR E 92  ? N THR E 55  O GLN E 219 ? O GLN E 182 
AC1 1 2 N PHE E 149 ? N PHE E 112 O SER E 207 ? O SER E 170 
AC2 1 2 N HIS E 200 ? N HIS E 163 O LEU E 266 ? O LEU E 229 
AC2 2 3 O SER E 267 ? O SER E 230 N SER E 239 ? N SER E 202 
AC3 1 2 N HIS E 200 ? N HIS E 163 O LEU E 266 ? O LEU E 229 
AC3 2 3 O TYR E 257 ? O TYR E 220 N VAL E 250 ? N VAL E 213 
AC4 1 2 N THR F 5   ? N THR I 5   O LYS F 24  ? O LYS I 24  
AC4 2 3 N LEU F 21  ? N LEU I 21  O LEU F 73  ? O LEU I 73  
AC4 3 4 O THR F 74  ? O THR I 74  N THR F 63  ? N THR I 63  
AC5 1 2 N MET F 11  ? N MET I 11  O LYS F 102 ? O LYS I 102 
AC5 2 3 O THR F 101 ? O THR I 101 N TYR F 86  ? N TYR I 86  
AC5 3 4 O GLY F 89  ? O GLY I 89  N SER F 34  ? N SER I 34  
AC5 4 5 N GLN F 37  ? N GLN I 37  O LYS F 45  ? O LYS I 45  
AC6 1 2 N MET F 11  ? N MET I 11  O LYS F 102 ? O LYS I 102 
AC6 2 3 O THR F 101 ? O THR I 101 N TYR F 86  ? N TYR I 86  
AC6 3 4 N GLN F 90  ? N GLN I 90  O THR F 96  ? O THR I 96  
AC7 1 2 N GLN G 5   ? N GLN J 5   O THR G 23  ? O THR J 23  
AC7 2 3 N LEU G 20  ? N LEU J 20  O LEU G 81  ? O LEU J 81  
AC7 3 4 O TYR G 80  ? O TYR J 80  N THR G 71  ? N THR J 71  
AC8 1 2 N GLU G 10  ? N GLU J 10  O SER G 113 ? O SER J 113 
AC8 2 3 O THR G 112 ? O THR J 112 N TYR G 94  ? N TYR J 94  
AC8 3 4 O TYR G 95  ? O TYR J 95  N VAL G 37  ? N VAL J 37  
AC8 4 5 N TRP G 36  ? N TRP J 36  O ILE G 48  ? O ILE J 48  
AC8 5 6 N ARG G 50  ? N ARG J 50  O LYS G 59  ? O LYS J 59  
AC9 1 2 N SER H 7   ? N SER L 7   O SER H 22  ? O SER L 22  
AC9 2 3 N CYS H 23  ? N CYS L 23  O PHE H 71  ? O PHE L 71  
AC9 3 4 O THR H 74  ? O THR L 74  N THR H 63  ? N THR L 63  
AD1 1 2 O LEU H 47  ? O LEU L 47  N TRP H 35  ? N TRP L 35  
AD1 2 3 N TYR H 36  ? N TYR L 36  O HIS H 87  ? O HIS L 87  
AD1 3 4 N GLN H 90  ? N GLN L 90  O THR H 96  ? O THR L 96  
AD2 1 2 O LEU H 47  ? O LEU L 47  N TRP H 35  ? N TRP L 35  
AD2 2 3 N TYR H 36  ? N TYR L 36  O HIS H 87  ? O HIS L 87  
AD2 3 4 N TYR H 86  ? N TYR L 86  O THR H 101 ? O THR L 101 
AD3 1 2 N GLN I 5   ? N GLN K 5   O THR I 23  ? O THR K 23  
AD3 2 3 N LEU I 20  ? N LEU K 20  O LEU I 81  ? O LEU K 81  
AD3 3 4 O TYR I 80  ? O TYR K 80  N THR I 71  ? N THR K 71  
AD4 1 2 N GLU I 10  ? N GLU K 10  O SER I 113 ? O SER K 113 
AD4 2 3 O THR I 112 ? O THR K 112 N TYR I 94  ? N TYR K 94  
AD4 3 4 O TYR I 95  ? O TYR K 95  N VAL I 37  ? N VAL K 37  
AD4 4 5 N TRP I 36  ? N TRP K 36  O ILE I 48  ? O ILE K 48  
AD4 5 6 N ARG I 50  ? N ARG K 50  O LYS I 59  ? O LYS K 59  
AD5 1 2 N GLU I 10  ? N GLU K 10  O SER I 113 ? O SER K 113 
AD5 2 3 O THR I 112 ? O THR K 112 N TYR I 94  ? N TYR K 94  
AD5 3 4 N ARG I 98  ? N ARG K 98  O TYR I 107 ? O TYR K 107 
# 
_atom_sites.entry_id                    6D6U 
_atom_sites.fract_transf_matrix[1][1]   1.000000 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   1.000000 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   1.000000 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
F 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1     N N   . ASN A  1  8   ? 137.265 199.274 141.410 1.00 70.76  ? 8   ASN A N   1 
ATOM   2     C CA  . ASN A  1  8   ? 135.819 199.355 141.254 1.00 70.76  ? 8   ASN A CA  1 
ATOM   3     C C   . ASN A  1  8   ? 135.330 198.196 140.389 1.00 70.76  ? 8   ASN A C   1 
ATOM   4     O O   . ASN A  1  8   ? 136.102 197.608 139.636 1.00 70.76  ? 8   ASN A O   1 
ATOM   5     C CB  . ASN A  1  8   ? 135.418 200.700 140.642 1.00 70.76  ? 8   ASN A CB  1 
ATOM   6     C CG  . ASN A  1  8   ? 133.926 200.965 140.727 1.00 70.76  ? 8   ASN A CG  1 
ATOM   7     O OD1 . ASN A  1  8   ? 133.163 200.140 141.229 1.00 70.76  ? 8   ASN A OD1 1 
ATOM   8     N ND2 . ASN A  1  8   ? 133.504 202.123 140.237 1.00 70.76  ? 8   ASN A ND2 1 
ATOM   9     N N   . MET A  1  9   ? 134.041 197.875 140.505 1.00 71.49  ? 9   MET A N   1 
ATOM   10    C CA  . MET A  1  9   ? 133.498 196.714 139.808 1.00 71.49  ? 9   MET A CA  1 
ATOM   11    C C   . MET A  1  9   ? 133.345 196.977 138.315 1.00 71.49  ? 9   MET A C   1 
ATOM   12    O O   . MET A  1  9   ? 133.778 196.169 137.485 1.00 71.49  ? 9   MET A O   1 
ATOM   13    C CB  . MET A  1  9   ? 132.155 196.325 140.424 1.00 71.49  ? 9   MET A CB  1 
ATOM   14    C CG  . MET A  1  9   ? 131.544 195.060 139.857 1.00 71.49  ? 9   MET A CG  1 
ATOM   15    S SD  . MET A  1  9   ? 132.500 193.583 140.230 1.00 71.49  ? 9   MET A SD  1 
ATOM   16    C CE  . MET A  1  9   ? 131.911 192.489 138.943 1.00 71.49  ? 9   MET A CE  1 
ATOM   17    N N   . SER A  1  10  ? 132.728 198.105 137.953 1.00 64.56  ? 10  SER A N   1 
ATOM   18    C CA  . SER A  1  10  ? 132.406 198.352 136.551 1.00 64.56  ? 10  SER A CA  1 
ATOM   19    C C   . SER A  1  10  ? 133.652 198.550 135.699 1.00 64.56  ? 10  SER A C   1 
ATOM   20    O O   . SER A  1  10  ? 133.643 198.205 134.512 1.00 64.56  ? 10  SER A O   1 
ATOM   21    C CB  . SER A  1  10  ? 131.481 199.561 136.427 1.00 64.56  ? 10  SER A CB  1 
ATOM   22    O OG  . SER A  1  10  ? 130.223 199.293 137.018 1.00 64.56  ? 10  SER A OG  1 
ATOM   23    N N   . LEU A  1  11  ? 134.726 199.098 136.271 1.00 55.08  ? 11  LEU A N   1 
ATOM   24    C CA  . LEU A  1  11  ? 135.972 199.209 135.520 1.00 55.08  ? 11  LEU A CA  1 
ATOM   25    C C   . LEU A  1  11  ? 136.452 197.839 135.064 1.00 55.08  ? 11  LEU A C   1 
ATOM   26    O O   . LEU A  1  11  ? 136.724 197.624 133.877 1.00 55.08  ? 11  LEU A O   1 
ATOM   27    C CB  . LEU A  1  11  ? 137.043 199.894 136.365 1.00 55.08  ? 11  LEU A CB  1 
ATOM   28    C CG  . LEU A  1  11  ? 136.845 201.375 136.676 1.00 55.08  ? 11  LEU A CG  1 
ATOM   29    C CD1 . LEU A  1  11  ? 137.919 201.861 137.636 1.00 55.08  ? 11  LEU A CD1 1 
ATOM   30    C CD2 . LEU A  1  11  ? 136.865 202.186 135.394 1.00 55.08  ? 11  LEU A CD2 1 
ATOM   31    N N   . VAL A  1  12  ? 136.549 196.893 135.999 1.00 45.71  ? 12  VAL A N   1 
ATOM   32    C CA  . VAL A  1  12  ? 137.001 195.550 135.660 1.00 45.71  ? 12  VAL A CA  1 
ATOM   33    C C   . VAL A  1  12  ? 136.014 194.879 134.715 1.00 45.71  ? 12  VAL A C   1 
ATOM   34    O O   . VAL A  1  12  ? 136.407 194.165 133.782 1.00 45.71  ? 12  VAL A O   1 
ATOM   35    C CB  . VAL A  1  12  ? 137.210 194.728 136.942 1.00 45.71  ? 12  VAL A CB  1 
ATOM   36    C CG1 . VAL A  1  12  ? 137.651 193.335 136.600 1.00 45.71  ? 12  VAL A CG1 1 
ATOM   37    C CG2 . VAL A  1  12  ? 138.232 195.403 137.831 1.00 45.71  ? 12  VAL A CG2 1 
ATOM   38    N N   . LYS A  1  13  ? 134.717 195.113 134.932 1.00 49.69  ? 13  LYS A N   1 
ATOM   39    C CA  . LYS A  1  13  ? 133.700 194.528 134.064 1.00 49.69  ? 13  LYS A CA  1 
ATOM   40    C C   . LYS A  1  13  ? 133.896 194.963 132.619 1.00 49.69  ? 13  LYS A C   1 
ATOM   41    O O   . LYS A  1  13  ? 133.976 194.126 131.713 1.00 49.69  ? 13  LYS A O   1 
ATOM   42    C CB  . LYS A  1  13  ? 132.305 194.914 134.554 1.00 49.69  ? 13  LYS A CB  1 
ATOM   43    C CG  . LYS A  1  13  ? 131.175 194.318 133.734 1.00 49.69  ? 13  LYS A CG  1 
ATOM   44    C CD  . LYS A  1  13  ? 129.821 194.731 134.288 1.00 49.69  ? 13  LYS A CD  1 
ATOM   45    C CE  . LYS A  1  13  ? 128.686 194.081 133.519 1.00 49.69  ? 13  LYS A CE  1 
ATOM   46    N NZ  . LYS A  1  13  ? 128.604 194.581 132.121 1.00 49.69  ? 13  LYS A NZ  1 
ATOM   47    N N   . GLU A  1  14  ? 133.997 196.273 132.383 1.00 50.29  ? 14  GLU A N   1 
ATOM   48    C CA  . GLU A  1  14  ? 134.151 196.750 131.015 1.00 50.29  ? 14  GLU A CA  1 
ATOM   49    C C   . GLU A  1  14  ? 135.520 196.420 130.439 1.00 50.29  ? 14  GLU A C   1 
ATOM   50    O O   . GLU A  1  14  ? 135.630 196.211 129.226 1.00 50.29  ? 14  GLU A O   1 
ATOM   51    C CB  . GLU A  1  14  ? 133.904 198.255 130.937 1.00 50.29  ? 14  GLU A CB  1 
ATOM   52    C CG  . GLU A  1  14  ? 134.944 199.108 131.633 1.00 50.29  ? 14  GLU A CG  1 
ATOM   53    C CD  . GLU A  1  14  ? 134.614 200.586 131.564 1.00 50.29  ? 14  GLU A CD  1 
ATOM   54    O OE1 . GLU A  1  14  ? 133.563 200.932 130.988 1.00 50.29  ? 14  GLU A OE1 1 
ATOM   55    O OE2 . GLU A  1  14  ? 135.400 201.402 132.086 1.00 50.29  ? 14  GLU A OE2 1 
ATOM   56    N N   . THR A  1  15  ? 136.552 196.307 131.277 1.00 46.85  ? 15  THR A N   1 
ATOM   57    C CA  . THR A  1  15  ? 137.856 195.901 130.766 1.00 46.85  ? 15  THR A CA  1 
ATOM   58    C C   . THR A  1  15  ? 137.810 194.473 130.243 1.00 46.85  ? 15  THR A C   1 
ATOM   59    O O   . THR A  1  15  ? 138.291 194.191 129.140 1.00 46.85  ? 15  THR A O   1 
ATOM   60    C CB  . THR A  1  15  ? 138.918 196.043 131.852 1.00 46.85  ? 15  THR A CB  1 
ATOM   61    O OG1 . THR A  1  15  ? 139.029 197.420 132.230 1.00 46.85  ? 15  THR A OG1 1 
ATOM   62    C CG2 . THR A  1  15  ? 140.261 195.557 131.350 1.00 46.85  ? 15  THR A CG2 1 
ATOM   63    N N   . VAL A  1  16  ? 137.215 193.559 131.012 1.00 39.89  ? 16  VAL A N   1 
ATOM   64    C CA  . VAL A  1  16  ? 137.087 192.187 130.533 1.00 39.89  ? 16  VAL A CA  1 
ATOM   65    C C   . VAL A  1  16  ? 136.187 192.132 129.306 1.00 39.89  ? 16  VAL A C   1 
ATOM   66    O O   . VAL A  1  16  ? 136.466 191.401 128.344 1.00 39.89  ? 16  VAL A O   1 
ATOM   67    C CB  . VAL A  1  16  ? 136.574 191.275 131.660 1.00 39.89  ? 16  VAL A CB  1 
ATOM   68    C CG1 . VAL A  1  16  ? 136.332 189.876 131.138 1.00 39.89  ? 16  VAL A CG1 1 
ATOM   69    C CG2 . VAL A  1  16  ? 137.571 191.247 132.795 1.00 39.89  ? 16  VAL A CG2 1 
ATOM   70    N N   . ASP A  1  17  ? 135.109 192.920 129.302 1.00 48.40  ? 17  ASP A N   1 
ATOM   71    C CA  . ASP A  1  17  ? 134.199 192.912 128.162 1.00 48.40  ? 17  ASP A CA  1 
ATOM   72    C C   . ASP A  1  17  ? 134.890 193.381 126.888 1.00 48.40  ? 17  ASP A C   1 
ATOM   73    O O   . ASP A  1  17  ? 134.589 192.886 125.798 1.00 48.40  ? 17  ASP A O   1 
ATOM   74    C CB  . ASP A  1  17  ? 132.975 193.776 128.459 1.00 48.40  ? 17  ASP A CB  1 
ATOM   75    C CG  . ASP A  1  17  ? 132.040 193.136 129.470 1.00 48.40  ? 17  ASP A CG  1 
ATOM   76    O OD1 . ASP A  1  17  ? 131.981 191.890 129.520 1.00 48.40  ? 17  ASP A OD1 1 
ATOM   77    O OD2 . ASP A  1  17  ? 131.365 193.875 130.216 1.00 48.40  ? 17  ASP A OD2 1 
ATOM   78    N N   . ARG A  1  18  ? 135.810 194.342 126.996 1.00 48.32  ? 18  ARG A N   1 
ATOM   79    C CA  . ARG A  1  18  ? 136.513 194.774 125.792 1.00 48.32  ? 18  ARG A CA  1 
ATOM   80    C C   . ARG A  1  18  ? 137.681 193.859 125.453 1.00 48.32  ? 18  ARG A C   1 
ATOM   81    O O   . ARG A  1  18  ? 138.105 193.813 124.293 1.00 48.32  ? 18  ARG A O   1 
ATOM   82    C CB  . ARG A  1  18  ? 136.994 196.222 125.918 1.00 48.32  ? 18  ARG A CB  1 
ATOM   83    C CG  . ARG A  1  18  ? 138.112 196.467 126.908 1.00 48.32  ? 18  ARG A CG  1 
ATOM   84    C CD  . ARG A  1  18  ? 138.475 197.946 126.924 1.00 48.32  ? 18  ARG A CD  1 
ATOM   85    N NE  . ARG A  1  18  ? 137.394 198.776 127.452 1.00 48.32  ? 18  ARG A NE  1 
ATOM   86    C CZ  . ARG A  1  18  ? 137.372 200.103 127.388 1.00 48.32  ? 18  ARG A CZ  1 
ATOM   87    N NH1 . ARG A  1  18  ? 138.369 200.756 126.809 1.00 48.32  ? 18  ARG A NH1 1 
ATOM   88    N NH2 . ARG A  1  18  ? 136.351 200.780 127.894 1.00 48.32  ? 18  ARG A NH2 1 
ATOM   89    N N   . LEU A  1  19  ? 138.219 193.129 126.431 1.00 39.71  ? 19  LEU A N   1 
ATOM   90    C CA  . LEU A  1  19  ? 139.208 192.106 126.111 1.00 39.71  ? 19  LEU A CA  1 
ATOM   91    C C   . LEU A  1  19  ? 138.590 190.995 125.275 1.00 39.71  ? 19  LEU A C   1 
ATOM   92    O O   . LEU A  1  19  ? 139.154 190.578 124.259 1.00 39.71  ? 19  LEU A O   1 
ATOM   93    C CB  . LEU A  1  19  ? 139.819 191.527 127.385 1.00 39.71  ? 19  LEU A CB  1 
ATOM   94    C CG  . LEU A  1  19  ? 140.764 192.412 128.188 1.00 39.71  ? 19  LEU A CG  1 
ATOM   95    C CD1 . LEU A  1  19  ? 141.188 191.695 129.454 1.00 39.71  ? 19  LEU A CD1 1 
ATOM   96    C CD2 . LEU A  1  19  ? 141.964 192.768 127.343 1.00 39.71  ? 19  LEU A CD2 1 
ATOM   97    N N   . LEU A  1  20  ? 137.425 190.499 125.691 1.00 37.67  ? 20  LEU A N   1 
ATOM   98    C CA  . LEU A  1  20  ? 136.791 189.368 125.023 1.00 37.67  ? 20  LEU A CA  1 
ATOM   99    C C   . LEU A  1  20  ? 135.791 189.790 123.955 1.00 37.67  ? 20  LEU A C   1 
ATOM   100   O O   . LEU A  1  20  ? 134.801 189.085 123.727 1.00 37.67  ? 20  LEU A O   1 
ATOM   101   C CB  . LEU A  1  20  ? 136.125 188.453 126.050 1.00 37.67  ? 20  LEU A CB  1 
ATOM   102   C CG  . LEU A  1  20  ? 137.034 187.410 126.699 1.00 37.67  ? 20  LEU A CG  1 
ATOM   103   C CD1 . LEU A  1  20  ? 138.055 188.041 127.623 1.00 37.67  ? 20  LEU A CD1 1 
ATOM   104   C CD2 . LEU A  1  20  ? 136.197 186.409 127.456 1.00 37.67  ? 20  LEU A CD2 1 
ATOM   105   N N   . LYS A  1  21  ? 136.016 190.925 123.297 1.00 48.44  ? 21  LYS A N   1 
ATOM   106   C CA  . LYS A  1  21  ? 135.202 191.359 122.168 1.00 48.44  ? 21  LYS A CA  1 
ATOM   107   C C   . LYS A  1  21  ? 136.084 191.430 120.931 1.00 48.44  ? 21  LYS A C   1 
ATOM   108   O O   . LYS A  1  21  ? 137.047 192.202 120.896 1.00 48.44  ? 21  LYS A O   1 
ATOM   109   C CB  . LYS A  1  21  ? 134.553 192.716 122.439 1.00 48.44  ? 21  LYS A CB  1 
ATOM   110   C CG  . LYS A  1  21  ? 133.614 193.177 121.341 1.00 48.44  ? 21  LYS A CG  1 
ATOM   111   C CD  . LYS A  1  21  ? 132.938 194.484 121.714 1.00 48.44  ? 21  LYS A CD  1 
ATOM   112   C CE  . LYS A  1  21  ? 132.002 194.949 120.616 1.00 48.44  ? 21  LYS A CE  1 
ATOM   113   N NZ  . LYS A  1  21  ? 131.339 196.235 120.962 1.00 48.44  ? 21  LYS A NZ  1 
ATOM   114   N N   . GLY A  1  22  ? 135.746 190.638 119.916 1.00 52.59  ? 22  GLY A N   1 
ATOM   115   C CA  . GLY A  1  22  ? 136.561 190.537 118.725 1.00 52.59  ? 22  GLY A CA  1 
ATOM   116   C C   . GLY A  1  22  ? 137.711 189.561 118.821 1.00 52.59  ? 22  GLY A C   1 
ATOM   117   O O   . GLY A  1  22  ? 138.475 189.432 117.856 1.00 52.59  ? 22  GLY A O   1 
ATOM   118   N N   . TYR A  1  23  ? 137.858 188.870 119.946 1.00 37.37  ? 23  TYR A N   1 
ATOM   119   C CA  . TYR A  1  23  ? 138.924 187.896 120.122 1.00 37.37  ? 23  TYR A CA  1 
ATOM   120   C C   . TYR A  1  23  ? 138.597 186.652 119.307 1.00 37.37  ? 23  TYR A C   1 
ATOM   121   O O   . TYR A  1  23  ? 137.582 185.992 119.553 1.00 37.37  ? 23  TYR A O   1 
ATOM   122   C CB  . TYR A  1  23  ? 139.076 187.558 121.603 1.00 37.37  ? 23  TYR A CB  1 
ATOM   123   C CG  . TYR A  1  23  ? 140.247 186.671 121.928 1.00 37.37  ? 23  TYR A CG  1 
ATOM   124   C CD1 . TYR A  1  23  ? 141.532 187.178 121.958 1.00 37.37  ? 23  TYR A CD1 1 
ATOM   125   C CD2 . TYR A  1  23  ? 140.069 185.331 122.217 1.00 37.37  ? 23  TYR A CD2 1 
ATOM   126   C CE1 . TYR A  1  23  ? 142.606 186.377 122.261 1.00 37.37  ? 23  TYR A CE1 1 
ATOM   127   C CE2 . TYR A  1  23  ? 141.140 184.523 122.522 1.00 37.37  ? 23  TYR A CE2 1 
ATOM   128   C CZ  . TYR A  1  23  ? 142.407 185.052 122.540 1.00 37.37  ? 23  TYR A CZ  1 
ATOM   129   O OH  . TYR A  1  23  ? 143.484 184.255 122.842 1.00 37.37  ? 23  TYR A OH  1 
ATOM   130   N N   . ASP A  1  24  ? 139.446 186.334 118.335 1.00 38.82  ? 24  ASP A N   1 
ATOM   131   C CA  . ASP A  1  24  ? 139.209 185.228 117.414 1.00 38.82  ? 24  ASP A CA  1 
ATOM   132   C C   . ASP A  1  24  ? 140.027 184.031 117.884 1.00 38.82  ? 24  ASP A C   1 
ATOM   133   O O   . ASP A  1  24  ? 141.254 184.018 117.751 1.00 38.82  ? 24  ASP A O   1 
ATOM   134   C CB  . ASP A  1  24  ? 139.578 185.634 115.990 1.00 38.82  ? 24  ASP A CB  1 
ATOM   135   C CG  . ASP A  1  24  ? 139.040 184.675 114.949 1.00 38.82  ? 24  ASP A CG  1 
ATOM   136   O OD1 . ASP A  1  24  ? 138.398 183.675 115.331 1.00 38.82  ? 24  ASP A OD1 1 
ATOM   137   O OD2 . ASP A  1  24  ? 139.254 184.925 113.744 1.00 38.82  ? 24  ASP A OD2 1 
ATOM   138   N N   . ILE A  1  25  ? 139.341 183.019 118.421 1.00 28.02  ? 25  ILE A N   1 
ATOM   139   C CA  . ILE A  1  25  ? 140.026 181.903 119.062 1.00 28.02  ? 25  ILE A CA  1 
ATOM   140   C C   . ILE A  1  25  ? 140.743 181.004 118.065 1.00 28.02  ? 25  ILE A C   1 
ATOM   141   O O   . ILE A  1  25  ? 141.653 180.264 118.450 1.00 28.02  ? 25  ILE A O   1 
ATOM   142   C CB  . ILE A  1  25  ? 139.019 181.089 119.895 1.00 28.02  ? 25  ILE A CB  1 
ATOM   143   C CG1 . ILE A  1  25  ? 139.737 180.047 120.751 1.00 28.02  ? 25  ILE A CG1 1 
ATOM   144   C CG2 . ILE A  1  25  ? 137.995 180.430 118.998 1.00 28.02  ? 25  ILE A CG2 1 
ATOM   145   C CD1 . ILE A  1  25  ? 138.851 179.396 121.773 1.00 28.02  ? 25  ILE A CD1 1 
ATOM   146   N N   . ARG A  1  26  ? 140.382 181.057 116.785 1.00 28.32  ? 26  ARG A N   1 
ATOM   147   C CA  . ARG A  1  26  ? 140.957 180.123 115.827 1.00 28.32  ? 26  ARG A CA  1 
ATOM   148   C C   . ARG A  1  26  ? 142.429 180.392 115.545 1.00 28.32  ? 26  ARG A C   1 
ATOM   149   O O   . ARG A  1  26  ? 143.107 179.520 114.995 1.00 28.32  ? 26  ARG A O   1 
ATOM   150   C CB  . ARG A  1  26  ? 140.165 180.168 114.525 1.00 28.32  ? 26  ARG A CB  1 
ATOM   151   C CG  . ARG A  1  26  ? 138.756 179.640 114.651 1.00 28.32  ? 26  ARG A CG  1 
ATOM   152   C CD  . ARG A  1  26  ? 138.078 179.605 113.305 1.00 28.32  ? 26  ARG A CD  1 
ATOM   153   N NE  . ARG A  1  26  ? 137.950 180.948 112.754 1.00 28.32  ? 26  ARG A NE  1 
ATOM   154   C CZ  . ARG A  1  26  ? 136.929 181.758 113.001 1.00 28.32  ? 26  ARG A CZ  1 
ATOM   155   N NH1 . ARG A  1  26  ? 135.943 181.359 113.788 1.00 28.32  ? 26  ARG A NH1 1 
ATOM   156   N NH2 . ARG A  1  26  ? 136.895 182.965 112.458 1.00 28.32  ? 26  ARG A NH2 1 
ATOM   157   N N   . LEU A  1  27  ? 142.941 181.564 115.909 1.00 28.59  ? 27  LEU A N   1 
ATOM   158   C CA  . LEU A  1  27  ? 144.296 181.969 115.561 1.00 28.59  ? 27  LEU A CA  1 
ATOM   159   C C   . LEU A  1  27  ? 145.141 182.118 116.816 1.00 28.59  ? 27  LEU A C   1 
ATOM   160   O O   . LEU A  1  27  ? 144.750 182.821 117.753 1.00 28.59  ? 27  LEU A O   1 
ATOM   161   C CB  . LEU A  1  27  ? 144.292 183.286 114.787 1.00 28.59  ? 27  LEU A CB  1 
ATOM   162   C CG  . LEU A  1  27  ? 143.956 183.237 113.300 1.00 28.59  ? 27  LEU A CG  1 
ATOM   163   C CD1 . LEU A  1  27  ? 142.483 182.968 113.069 1.00 28.59  ? 27  LEU A CD1 1 
ATOM   164   C CD2 . LEU A  1  27  ? 144.359 184.545 112.667 1.00 28.59  ? 27  LEU A CD2 1 
ATOM   165   N N   . ARG A  1  28  ? 146.302 181.473 116.823 1.00 25.46  ? 28  ARG A N   1 
ATOM   166   C CA  . ARG A  1  28  ? 147.226 181.610 117.931 1.00 25.46  ? 28  ARG A CA  1 
ATOM   167   C C   . ARG A  1  28  ? 147.863 182.999 117.907 1.00 25.46  ? 28  ARG A C   1 
ATOM   168   O O   . ARG A  1  28  ? 147.822 183.688 116.887 1.00 25.46  ? 28  ARG A O   1 
ATOM   169   C CB  . ARG A  1  28  ? 148.280 180.505 117.865 1.00 25.46  ? 28  ARG A CB  1 
ATOM   170   C CG  . ARG A  1  28  ? 149.084 180.437 116.579 1.00 25.46  ? 28  ARG A CG  1 
ATOM   171   C CD  . ARG A  1  28  ? 150.379 181.209 116.693 1.00 25.46  ? 28  ARG A CD  1 
ATOM   172   N NE  . ARG A  1  28  ? 151.246 181.008 115.540 1.00 25.46  ? 28  ARG A NE  1 
ATOM   173   C CZ  . ARG A  1  28  ? 152.356 181.701 115.323 1.00 25.46  ? 28  ARG A CZ  1 
ATOM   174   N NH1 . ARG A  1  28  ? 152.728 182.638 116.182 1.00 25.46  ? 28  ARG A NH1 1 
ATOM   175   N NH2 . ARG A  1  28  ? 153.093 181.457 114.250 1.00 25.46  ? 28  ARG A NH2 1 
ATOM   176   N N   . PRO A  1  29  ? 148.436 183.444 119.027 1.00 30.04  ? 29  PRO A N   1 
ATOM   177   C CA  . PRO A  1  29  ? 149.020 184.792 119.066 1.00 30.04  ? 29  PRO A CA  1 
ATOM   178   C C   . PRO A  1  29  ? 150.144 184.942 118.054 1.00 30.04  ? 29  PRO A C   1 
ATOM   179   O O   . PRO A  1  29  ? 151.006 184.071 117.926 1.00 30.04  ? 29  PRO A O   1 
ATOM   180   C CB  . PRO A  1  29  ? 149.538 184.910 120.502 1.00 30.04  ? 29  PRO A CB  1 
ATOM   181   C CG  . PRO A  1  29  ? 148.728 183.950 121.269 1.00 30.04  ? 29  PRO A CG  1 
ATOM   182   C CD  . PRO A  1  29  ? 148.485 182.801 120.349 1.00 30.04  ? 29  PRO A CD  1 
ATOM   183   N N   . ASP A  1  30  ? 150.124 186.064 117.333 1.00 32.58  ? 30  ASP A N   1 
ATOM   184   C CA  . ASP A  1  30  ? 151.119 186.372 116.309 1.00 32.58  ? 30  ASP A CA  1 
ATOM   185   C C   . ASP A  1  30  ? 151.106 185.311 115.207 1.00 32.58  ? 30  ASP A C   1 
ATOM   186   O O   . ASP A  1  30  ? 152.099 184.631 114.947 1.00 32.58  ? 30  ASP A O   1 
ATOM   187   C CB  . ASP A  1  30  ? 152.512 186.510 116.930 1.00 32.58  ? 30  ASP A CB  1 
ATOM   188   C CG  . ASP A  1  30  ? 152.613 187.688 117.870 1.00 32.58  ? 30  ASP A CG  1 
ATOM   189   O OD1 . ASP A  1  30  ? 151.884 188.680 117.661 1.00 32.58  ? 30  ASP A OD1 1 
ATOM   190   O OD2 . ASP A  1  30  ? 153.417 187.621 118.822 1.00 32.58  ? 30  ASP A OD2 1 
ATOM   191   N N   . PHE A  1  31  ? 149.950 185.193 114.550 1.00 31.32  ? 31  PHE A N   1 
ATOM   192   C CA  . PHE A  1  31  ? 149.746 184.110 113.594 1.00 31.32  ? 31  PHE A CA  1 
ATOM   193   C C   . PHE A  1  31  ? 150.697 184.199 112.410 1.00 31.32  ? 31  PHE A C   1 
ATOM   194   O O   . PHE A  1  31  ? 150.998 183.180 111.781 1.00 31.32  ? 31  PHE A O   1 
ATOM   195   C CB  . PHE A  1  31  ? 148.298 184.104 113.112 1.00 31.32  ? 31  PHE A CB  1 
ATOM   196   C CG  . PHE A  1  31  ? 147.986 182.999 112.149 1.00 31.32  ? 31  PHE A CG  1 
ATOM   197   C CD1 . PHE A  1  31  ? 147.902 181.692 112.584 1.00 31.32  ? 31  PHE A CD1 1 
ATOM   198   C CD2 . PHE A  1  31  ? 147.765 183.267 110.814 1.00 31.32  ? 31  PHE A CD2 1 
ATOM   199   C CE1 . PHE A  1  31  ? 147.616 180.673 111.705 1.00 31.32  ? 31  PHE A CE1 1 
ATOM   200   C CE2 . PHE A  1  31  ? 147.475 182.249 109.931 1.00 31.32  ? 31  PHE A CE2 1 
ATOM   201   C CZ  . PHE A  1  31  ? 147.402 180.952 110.378 1.00 31.32  ? 31  PHE A CZ  1 
ATOM   202   N N   . GLY A  1  32  ? 151.174 185.394 112.085 1.00 44.96  ? 32  GLY A N   1 
ATOM   203   C CA  . GLY A  1  32  ? 152.064 185.548 110.952 1.00 44.96  ? 32  GLY A CA  1 
ATOM   204   C C   . GLY A  1  32  ? 153.535 185.594 111.310 1.00 44.96  ? 32  GLY A C   1 
ATOM   205   O O   . GLY A  1  32  ? 154.386 185.217 110.501 1.00 44.96  ? 32  GLY A O   1 
ATOM   206   N N   . GLY A  1  33  ? 153.848 186.045 112.522 1.00 42.81  ? 33  GLY A N   1 
ATOM   207   C CA  . GLY A  1  33  ? 155.212 186.331 112.896 1.00 42.81  ? 33  GLY A CA  1 
ATOM   208   C C   . GLY A  1  33  ? 155.925 185.210 113.625 1.00 42.81  ? 33  GLY A C   1 
ATOM   209   O O   . GLY A  1  33  ? 155.685 184.022 113.391 1.00 42.81  ? 33  GLY A O   1 
ATOM   210   N N   . PRO A  1  34  ? 156.832 185.582 114.522 1.00 37.03  ? 34  PRO A N   1 
ATOM   211   C CA  . PRO A  1  34  ? 157.664 184.593 115.217 1.00 37.03  ? 34  PRO A CA  1 
ATOM   212   C C   . PRO A  1  34  ? 156.833 183.714 116.133 1.00 37.03  ? 34  PRO A C   1 
ATOM   213   O O   . PRO A  1  34  ? 155.696 184.064 116.478 1.00 37.03  ? 34  PRO A O   1 
ATOM   214   C CB  . PRO A  1  34  ? 158.641 185.465 116.020 1.00 37.03  ? 34  PRO A CB  1 
ATOM   215   C CG  . PRO A  1  34  ? 158.656 186.774 115.308 1.00 37.03  ? 34  PRO A CG  1 
ATOM   216   C CD  . PRO A  1  34  ? 157.261 186.959 114.807 1.00 37.03  ? 34  PRO A CD  1 
ATOM   217   N N   . PRO A  1  35  ? 157.366 182.569 116.553 1.00 27.39  ? 35  PRO A N   1 
ATOM   218   C CA  . PRO A  1  35  ? 156.595 181.667 117.411 1.00 27.39  ? 35  PRO A CA  1 
ATOM   219   C C   . PRO A  1  35  ? 156.395 182.234 118.804 1.00 27.39  ? 35  PRO A C   1 
ATOM   220   O O   . PRO A  1  35  ? 157.066 183.175 119.230 1.00 27.39  ? 35  PRO A O   1 
ATOM   221   C CB  . PRO A  1  35  ? 157.454 180.401 117.454 1.00 27.39  ? 35  PRO A CB  1 
ATOM   222   C CG  . PRO A  1  35  ? 158.829 180.881 117.201 1.00 27.39  ? 35  PRO A CG  1 
ATOM   223   C CD  . PRO A  1  35  ? 158.694 182.018 116.237 1.00 27.39  ? 35  PRO A CD  1 
ATOM   224   N N   . VAL A  1  36  ? 155.453 181.630 119.521 1.00 23.66  ? 36  VAL A N   1 
ATOM   225   C CA  . VAL A  1  36  ? 155.111 182.023 120.882 1.00 23.66  ? 36  VAL A CA  1 
ATOM   226   C C   . VAL A  1  36  ? 155.823 181.100 121.859 1.00 23.66  ? 36  VAL A C   1 
ATOM   227   O O   . VAL A  1  36  ? 155.929 179.890 121.627 1.00 23.66  ? 36  VAL A O   1 
ATOM   228   C CB  . VAL A  1  36  ? 153.586 182.001 121.094 1.00 23.66  ? 36  VAL A CB  1 
ATOM   229   C CG1 . VAL A  1  36  ? 153.039 180.607 120.906 1.00 23.66  ? 36  VAL A CG1 1 
ATOM   230   C CG2 . VAL A  1  36  ? 153.240 182.517 122.468 1.00 23.66  ? 36  VAL A CG2 1 
ATOM   231   N N   . ALA A  1  37  ? 156.333 181.673 122.946 1.00 21.68  ? 37  ALA A N   1 
ATOM   232   C CA  . ALA A  1  37  ? 157.111 180.926 123.928 1.00 21.68  ? 37  ALA A CA  1 
ATOM   233   C C   . ALA A  1  37  ? 156.182 180.447 125.034 1.00 21.68  ? 37  ALA A C   1 
ATOM   234   O O   . ALA A  1  37  ? 155.630 181.257 125.783 1.00 21.68  ? 37  ALA A O   1 
ATOM   235   C CB  . ALA A  1  37  ? 158.233 181.790 124.491 1.00 21.68  ? 37  ALA A CB  1 
ATOM   236   N N   . VAL A  1  38  ? 156.018 179.132 125.144 1.00 24.26  ? 38  VAL A N   1 
ATOM   237   C CA  . VAL A  1  38  ? 155.155 178.516 126.145 1.00 24.26  ? 38  VAL A CA  1 
ATOM   238   C C   . VAL A  1  38  ? 156.036 177.794 127.150 1.00 24.26  ? 38  VAL A C   1 
ATOM   239   O O   . VAL A  1  38  ? 156.731 176.835 126.798 1.00 24.26  ? 38  VAL A O   1 
ATOM   240   C CB  . VAL A  1  38  ? 154.152 177.550 125.505 1.00 24.26  ? 38  VAL A CB  1 
ATOM   241   C CG1 . VAL A  1  38  ? 153.419 176.782 126.573 1.00 24.26  ? 38  VAL A CG1 1 
ATOM   242   C CG2 . VAL A  1  38  ? 153.176 178.312 124.646 1.00 24.26  ? 38  VAL A CG2 1 
ATOM   243   N N   . GLY A  1  39  ? 156.001 178.246 128.400 1.00 21.79  ? 39  GLY A N   1 
ATOM   244   C CA  . GLY A  1  39  ? 156.815 177.680 129.461 1.00 21.79  ? 39  GLY A CA  1 
ATOM   245   C C   . GLY A  1  39  ? 155.969 176.823 130.388 1.00 21.79  ? 39  GLY A C   1 
ATOM   246   O O   . GLY A  1  39  ? 154.970 177.288 130.936 1.00 21.79  ? 39  GLY A O   1 
ATOM   247   N N   . MET A  1  40  ? 156.387 175.577 130.552 1.00 27.77  ? 40  MET A N   1 
ATOM   248   C CA  . MET A  1  40  ? 155.653 174.591 131.326 1.00 27.77  ? 40  MET A CA  1 
ATOM   249   C C   . MET A  1  40  ? 156.202 174.489 132.741 1.00 27.77  ? 40  MET A C   1 
ATOM   250   O O   . MET A  1  40  ? 157.312 174.934 133.036 1.00 27.77  ? 40  MET A O   1 
ATOM   251   C CB  . MET A  1  40  ? 155.719 173.235 130.635 1.00 27.77  ? 40  MET A CB  1 
ATOM   252   C CG  . MET A  1  40  ? 154.944 173.202 129.348 1.00 27.77  ? 40  MET A CG  1 
ATOM   253   S SD  . MET A  1  40  ? 155.250 171.688 128.444 1.00 27.77  ? 40  MET A SD  1 
ATOM   254   C CE  . MET A  1  40  ? 154.613 170.511 129.618 1.00 27.77  ? 40  MET A CE  1 
ATOM   255   N N   . ASN A  1  41  ? 155.394 173.906 133.624 1.00 22.78  ? 41  ASN A N   1 
ATOM   256   C CA  . ASN A  1  41  ? 155.771 173.787 135.030 1.00 22.78  ? 41  ASN A CA  1 
ATOM   257   C C   . ASN A  1  41  ? 154.910 172.701 135.660 1.00 22.78  ? 41  ASN A C   1 
ATOM   258   O O   . ASN A  1  41  ? 153.705 172.899 135.834 1.00 22.78  ? 41  ASN A O   1 
ATOM   259   C CB  . ASN A  1  41  ? 155.588 175.122 135.736 1.00 22.78  ? 41  ASN A CB  1 
ATOM   260   C CG  . ASN A  1  41  ? 156.157 175.127 137.127 1.00 22.78  ? 41  ASN A CG  1 
ATOM   261   O OD1 . ASN A  1  41  ? 156.640 174.113 137.614 1.00 22.78  ? 41  ASN A OD1 1 
ATOM   262   N ND2 . ASN A  1  41  ? 156.112 176.280 137.778 1.00 22.78  ? 41  ASN A ND2 1 
ATOM   263   N N   . ILE A  1  42  ? 155.519 171.572 136.011 1.00 21.31  ? 42  ILE A N   1 
ATOM   264   C CA  . ILE A  1  42  ? 154.807 170.421 136.558 1.00 21.31  ? 42  ILE A CA  1 
ATOM   265   C C   . ILE A  1  42  ? 155.037 170.358 138.059 1.00 21.31  ? 42  ILE A C   1 
ATOM   266   O O   . ILE A  1  42  ? 156.122 170.692 138.546 1.00 21.31  ? 42  ILE A O   1 
ATOM   267   C CB  . ILE A  1  42  ? 155.257 169.116 135.878 1.00 21.31  ? 42  ILE A CB  1 
ATOM   268   C CG1 . ILE A  1  42  ? 154.907 169.140 134.396 1.00 21.31  ? 42  ILE A CG1 1 
ATOM   269   C CG2 . ILE A  1  42  ? 154.617 167.911 136.525 1.00 21.31  ? 42  ILE A CG2 1 
ATOM   270   C CD1 . ILE A  1  42  ? 155.482 167.981 133.626 1.00 21.31  ? 42  ILE A CD1 1 
ATOM   271   N N   . ASP A  1  43  ? 154.014 169.931 138.796 1.00 19.52  ? 43  ASP A N   1 
ATOM   272   C CA  . ASP A  1  43  ? 154.083 169.762 140.247 1.00 19.52  ? 43  ASP A CA  1 
ATOM   273   C C   . ASP A  1  43  ? 153.461 168.411 140.595 1.00 19.52  ? 43  ASP A C   1 
ATOM   274   O O   . ASP A  1  43  ? 152.261 168.332 140.865 1.00 19.52  ? 43  ASP A O   1 
ATOM   275   C CB  . ASP A  1  43  ? 153.374 170.907 140.955 1.00 19.52  ? 43  ASP A CB  1 
ATOM   276   C CG  . ASP A  1  43  ? 153.574 170.880 142.452 1.00 19.52  ? 43  ASP A CG  1 
ATOM   277   O OD1 . ASP A  1  43  ? 154.259 169.964 142.948 1.00 19.52  ? 43  ASP A OD1 1 
ATOM   278   O OD2 . ASP A  1  43  ? 153.042 171.778 143.137 1.00 19.52  ? 43  ASP A OD2 1 
ATOM   279   N N   . ILE A  1  44  ? 154.278 167.356 140.605 1.00 20.00  ? 44  ILE A N   1 
ATOM   280   C CA  . ILE A  1  44  ? 153.766 166.015 140.871 1.00 20.00  ? 44  ILE A CA  1 
ATOM   281   C C   . ILE A  1  44  ? 153.228 165.947 142.289 1.00 20.00  ? 44  ILE A C   1 
ATOM   282   O O   . ILE A  1  44  ? 153.934 166.267 143.252 1.00 20.00  ? 44  ILE A O   1 
ATOM   283   C CB  . ILE A  1  44  ? 154.850 164.962 140.646 1.00 20.00  ? 44  ILE A CB  1 
ATOM   284   C CG1 . ILE A  1  44  ? 155.245 164.909 139.175 1.00 20.00  ? 44  ILE A CG1 1 
ATOM   285   C CG2 . ILE A  1  44  ? 154.358 163.609 141.102 1.00 20.00  ? 44  ILE A CG2 1 
ATOM   286   C CD1 . ILE A  1  44  ? 156.459 164.058 138.914 1.00 20.00  ? 44  ILE A CD1 1 
ATOM   287   N N   . ALA A  1  45  ? 151.972 165.528 142.426 1.00 20.23  ? 45  ALA A N   1 
ATOM   288   C CA  . ALA A  1  45  ? 151.380 165.374 143.749 1.00 20.23  ? 45  ALA A CA  1 
ATOM   289   C C   . ALA A  1  45  ? 151.738 164.025 144.358 1.00 20.23  ? 45  ALA A C   1 
ATOM   290   O O   . ALA A  1  45  ? 152.296 163.958 145.457 1.00 20.23  ? 45  ALA A O   1 
ATOM   291   C CB  . ALA A  1  45  ? 149.862 165.544 143.676 1.00 20.23  ? 45  ALA A CB  1 
ATOM   292   N N   . SER A  1  46  ? 151.424 162.937 143.658 1.00 24.49  ? 46  SER A N   1 
ATOM   293   C CA  . SER A  1  46  ? 151.674 161.610 144.199 1.00 24.49  ? 46  SER A CA  1 
ATOM   294   C C   . SER A  1  46  ? 151.595 160.583 143.083 1.00 24.49  ? 46  SER A C   1 
ATOM   295   O O   . SER A  1  46  ? 150.808 160.726 142.147 1.00 24.49  ? 46  SER A O   1 
ATOM   296   C CB  . SER A  1  46  ? 150.672 161.257 145.299 1.00 24.49  ? 46  SER A CB  1 
ATOM   297   O OG  . SER A  1  46  ? 149.370 161.132 144.760 1.00 24.49  ? 46  SER A OG  1 
ATOM   298   N N   . ILE A  1  47  ? 152.412 159.543 143.204 1.00 27.48  ? 47  ILE A N   1 
ATOM   299   C CA  . ILE A  1  47  ? 152.453 158.441 142.251 1.00 27.48  ? 47  ILE A CA  1 
ATOM   300   C C   . ILE A  1  47  ? 151.777 157.251 142.913 1.00 27.48  ? 47  ILE A C   1 
ATOM   301   O O   . ILE A  1  47  ? 152.297 156.692 143.885 1.00 27.48  ? 47  ILE A O   1 
ATOM   302   C CB  . ILE A  1  47  ? 153.888 158.108 141.830 1.00 27.48  ? 47  ILE A CB  1 
ATOM   303   C CG1 . ILE A  1  47  ? 154.499 159.284 141.077 1.00 27.48  ? 47  ILE A CG1 1 
ATOM   304   C CG2 . ILE A  1  47  ? 153.910 156.867 140.979 1.00 27.48  ? 47  ILE A CG2 1 
ATOM   305   C CD1 . ILE A  1  47  ? 155.971 159.140 140.837 1.00 27.48  ? 47  ILE A CD1 1 
ATOM   306   N N   . ASP A  1  48  ? 150.619 156.857 142.390 1.00 43.37  ? 48  ASP A N   1 
ATOM   307   C CA  . ASP A  1  48  ? 149.765 155.909 143.093 1.00 43.37  ? 48  ASP A CA  1 
ATOM   308   C C   . ASP A  1  48  ? 150.307 154.487 143.053 1.00 43.37  ? 48  ASP A C   1 
ATOM   309   O O   . ASP A  1  48  ? 150.652 153.926 144.096 1.00 43.37  ? 48  ASP A O   1 
ATOM   310   C CB  . ASP A  1  48  ? 148.350 155.940 142.509 1.00 43.37  ? 48  ASP A CB  1 
ATOM   311   C CG  . ASP A  1  48  ? 147.621 157.237 142.811 1.00 43.37  ? 48  ASP A CG  1 
ATOM   312   O OD1 . ASP A  1  48  ? 147.911 157.855 143.856 1.00 43.37  ? 48  ASP A OD1 1 
ATOM   313   O OD2 . ASP A  1  48  ? 146.754 157.638 142.005 1.00 43.37  ? 48  ASP A OD2 1 
ATOM   314   N N   . MET A  1  49  ? 150.406 153.898 141.865 1.00 42.88  ? 49  MET A N   1 
ATOM   315   C CA  . MET A  1  49  ? 150.723 152.483 141.754 1.00 42.88  ? 49  MET A CA  1 
ATOM   316   C C   . MET A  1  49  ? 151.652 152.245 140.578 1.00 42.88  ? 49  MET A C   1 
ATOM   317   O O   . MET A  1  49  ? 151.592 152.945 139.566 1.00 42.88  ? 49  MET A O   1 
ATOM   318   C CB  . MET A  1  49  ? 149.457 151.636 141.594 1.00 42.88  ? 49  MET A CB  1 
ATOM   319   C CG  . MET A  1  49  ? 148.698 151.893 140.309 1.00 42.88  ? 49  MET A CG  1 
ATOM   320   S SD  . MET A  1  49  ? 147.191 150.913 140.186 1.00 42.88  ? 49  MET A SD  1 
ATOM   321   C CE  . MET A  1  49  ? 147.873 149.283 139.909 1.00 42.88  ? 49  MET A CE  1 
ATOM   322   N N   . VAL A  1  50  ? 152.513 151.243 140.725 1.00 39.29  ? 50  VAL A N   1 
ATOM   323   C CA  . VAL A  1  50  ? 153.465 150.848 139.697 1.00 39.29  ? 50  VAL A CA  1 
ATOM   324   C C   . VAL A  1  50  ? 153.354 149.344 139.526 1.00 39.29  ? 50  VAL A C   1 
ATOM   325   O O   . VAL A  1  50  ? 153.582 148.592 140.480 1.00 39.29  ? 50  VAL A O   1 
ATOM   326   C CB  . VAL A  1  50  ? 154.905 151.243 140.058 1.00 39.29  ? 50  VAL A CB  1 
ATOM   327   C CG1 . VAL A  1  50  ? 155.857 150.714 139.021 1.00 39.29  ? 50  VAL A CG1 1 
ATOM   328   C CG2 . VAL A  1  50  ? 155.029 152.748 140.170 1.00 39.29  ? 50  VAL A CG2 1 
ATOM   329   N N   . SER A  1  51  ? 153.011 148.904 138.320 1.00 43.36  ? 51  SER A N   1 
ATOM   330   C CA  . SER A  1  51  ? 152.750 147.499 138.051 1.00 43.36  ? 51  SER A CA  1 
ATOM   331   C C   . SER A  1  51  ? 153.735 146.957 137.027 1.00 43.36  ? 51  SER A C   1 
ATOM   332   O O   . SER A  1  51  ? 154.269 147.700 136.199 1.00 43.36  ? 51  SER A O   1 
ATOM   333   C CB  . SER A  1  51  ? 151.322 147.292 137.546 1.00 43.36  ? 51  SER A CB  1 
ATOM   334   O OG  . SER A  1  51  ? 151.093 145.932 137.227 1.00 43.36  ? 51  SER A OG  1 
ATOM   335   N N   . GLU A  1  52  ? 153.977 145.648 137.097 1.00 51.73  ? 52  GLU A N   1 
ATOM   336   C CA  . GLU A  1  52  ? 154.788 144.957 136.107 1.00 51.73  ? 52  GLU A CA  1 
ATOM   337   C C   . GLU A  1  52  ? 153.966 144.103 135.155 1.00 51.73  ? 52  GLU A C   1 
ATOM   338   O O   . GLU A  1  52  ? 154.494 143.676 134.123 1.00 51.73  ? 52  GLU A O   1 
ATOM   339   C CB  . GLU A  1  52  ? 155.838 144.067 136.786 1.00 51.73  ? 52  GLU A CB  1 
ATOM   340   C CG  . GLU A  1  52  ? 156.895 144.813 137.579 1.00 51.73  ? 52  GLU A CG  1 
ATOM   341   C CD  . GLU A  1  52  ? 156.487 145.046 139.020 1.00 51.73  ? 52  GLU A CD  1 
ATOM   342   O OE1 . GLU A  1  52  ? 155.403 144.569 139.416 1.00 51.73  ? 52  GLU A OE1 1 
ATOM   343   O OE2 . GLU A  1  52  ? 157.256 145.697 139.759 1.00 51.73  ? 52  GLU A OE2 1 
ATOM   344   N N   . VAL A  1  53  ? 152.701 143.834 135.474 1.00 49.89  ? 53  VAL A N   1 
ATOM   345   C CA  . VAL A  1  53  ? 151.867 143.030 134.589 1.00 49.89  ? 53  VAL A CA  1 
ATOM   346   C C   . VAL A  1  53  ? 151.388 143.857 133.405 1.00 49.89  ? 53  VAL A C   1 
ATOM   347   O O   . VAL A  1  53  ? 151.488 143.431 132.250 1.00 49.89  ? 53  VAL A O   1 
ATOM   348   C CB  . VAL A  1  53  ? 150.684 142.430 135.368 1.00 49.89  ? 53  VAL A CB  1 
ATOM   349   C CG1 . VAL A  1  53  ? 149.778 141.657 134.429 1.00 49.89  ? 53  VAL A CG1 1 
ATOM   350   C CG2 . VAL A  1  53  ? 151.185 141.541 136.487 1.00 49.89  ? 53  VAL A CG2 1 
ATOM   351   N N   . ASN A  1  54  ? 150.860 145.050 133.671 1.00 44.90  ? 54  ASN A N   1 
ATOM   352   C CA  . ASN A  1  54  ? 150.408 145.935 132.608 1.00 44.90  ? 54  ASN A CA  1 
ATOM   353   C C   . ASN A  1  54  ? 151.491 146.888 132.129 1.00 44.90  ? 54  ASN A C   1 
ATOM   354   O O   . ASN A  1  54  ? 151.342 147.480 131.054 1.00 44.90  ? 54  ASN A O   1 
ATOM   355   C CB  . ASN A  1  54  ? 149.205 146.753 133.076 1.00 44.90  ? 54  ASN A CB  1 
ATOM   356   C CG  . ASN A  1  54  ? 147.978 145.905 133.294 1.00 44.90  ? 54  ASN A CG  1 
ATOM   357   O OD1 . ASN A  1  54  ? 147.690 145.001 132.514 1.00 44.90  ? 54  ASN A OD1 1 
ATOM   358   N ND2 . ASN A  1  54  ? 147.239 146.196 134.357 1.00 44.90  ? 54  ASN A ND2 1 
ATOM   359   N N   . MET A  1  55  ? 152.565 147.051 132.899 1.00 48.04  ? 55  MET A N   1 
ATOM   360   C CA  . MET A  1  55  ? 153.641 147.991 132.591 1.00 48.04  ? 55  MET A CA  1 
ATOM   361   C C   . MET A  1  55  ? 153.102 149.415 132.447 1.00 48.04  ? 55  MET A C   1 
ATOM   362   O O   . MET A  1  55  ? 153.218 150.053 131.400 1.00 48.04  ? 55  MET A O   1 
ATOM   363   C CB  . MET A  1  55  ? 154.410 147.558 131.339 1.00 48.04  ? 55  MET A CB  1 
ATOM   364   C CG  . MET A  1  55  ? 155.255 146.313 131.537 1.00 48.04  ? 55  MET A CG  1 
ATOM   365   S SD  . MET A  1  55  ? 156.183 145.862 130.060 1.00 48.04  ? 55  MET A SD  1 
ATOM   366   C CE  . MET A  1  55  ? 157.014 144.381 130.623 1.00 48.04  ? 55  MET A CE  1 
ATOM   367   N N   . ASP A  1  56  ? 152.501 149.904 133.528 1.00 40.79  ? 56  ASP A N   1 
ATOM   368   C CA  . ASP A  1  56  ? 152.001 151.268 133.565 1.00 40.79  ? 56  ASP A CA  1 
ATOM   369   C C   . ASP A  1  56  ? 152.059 151.784 134.992 1.00 40.79  ? 56  ASP A C   1 
ATOM   370   O O   . ASP A  1  56  ? 152.175 151.013 135.947 1.00 40.79  ? 56  ASP A O   1 
ATOM   371   C CB  . ASP A  1  56  ? 150.575 151.363 133.014 1.00 40.79  ? 56  ASP A CB  1 
ATOM   372   C CG  . ASP A  1  56  ? 149.592 150.513 133.787 1.00 40.79  ? 56  ASP A CG  1 
ATOM   373   O OD1 . ASP A  1  56  ? 150.024 149.743 134.667 1.00 40.79  ? 56  ASP A OD1 1 
ATOM   374   O OD2 . ASP A  1  56  ? 148.377 150.626 133.522 1.00 40.79  ? 56  ASP A OD2 1 
ATOM   375   N N   . TYR A  1  57  ? 151.976 153.103 135.131 1.00 30.03  ? 57  TYR A N   1 
ATOM   376   C CA  . TYR A  1  57  ? 152.005 153.720 136.447 1.00 30.03  ? 57  TYR A CA  1 
ATOM   377   C C   . TYR A  1  57  ? 151.159 154.981 136.420 1.00 30.03  ? 57  TYR A C   1 
ATOM   378   O O   . TYR A  1  57  ? 151.270 155.789 135.496 1.00 30.03  ? 57  TYR A O   1 
ATOM   379   C CB  . TYR A  1  57  ? 153.438 154.042 136.874 1.00 30.03  ? 57  TYR A CB  1 
ATOM   380   C CG  . TYR A  1  57  ? 154.088 155.132 136.068 1.00 30.03  ? 57  TYR A CG  1 
ATOM   381   C CD1 . TYR A  1  57  ? 154.702 154.859 134.863 1.00 30.03  ? 57  TYR A CD1 1 
ATOM   382   C CD2 . TYR A  1  57  ? 154.113 156.433 136.531 1.00 30.03  ? 57  TYR A CD2 1 
ATOM   383   C CE1 . TYR A  1  57  ? 155.301 155.856 134.131 1.00 30.03  ? 57  TYR A CE1 1 
ATOM   384   C CE2 . TYR A  1  57  ? 154.711 157.433 135.809 1.00 30.03  ? 57  TYR A CE2 1 
ATOM   385   C CZ  . TYR A  1  57  ? 155.303 157.141 134.610 1.00 30.03  ? 57  TYR A CZ  1 
ATOM   386   O OH  . TYR A  1  57  ? 155.904 158.141 133.883 1.00 30.03  ? 57  TYR A OH  1 
ATOM   387   N N   . THR A  1  58  ? 150.320 155.143 137.435 1.00 25.41  ? 58  THR A N   1 
ATOM   388   C CA  . THR A  1  58  ? 149.381 156.252 137.514 1.00 25.41  ? 58  THR A CA  1 
ATOM   389   C C   . THR A  1  58  ? 149.952 157.354 138.390 1.00 25.41  ? 58  THR A C   1 
ATOM   390   O O   . THR A  1  58  ? 150.435 157.084 139.493 1.00 25.41  ? 58  THR A O   1 
ATOM   391   C CB  . THR A  1  58  ? 148.042 155.779 138.076 1.00 25.41  ? 58  THR A CB  1 
ATOM   392   O OG1 . THR A  1  58  ? 147.463 154.819 137.185 1.00 25.41  ? 58  THR A OG1 1 
ATOM   393   C CG2 . THR A  1  58  ? 147.094 156.943 138.249 1.00 25.41  ? 58  THR A CG2 1 
ATOM   394   N N   . LEU A  1  59  ? 149.896 158.591 137.905 1.00 17.43  ? 59  LEU A N   1 
ATOM   395   C CA  . LEU A  1  59  ? 150.380 159.738 138.656 1.00 17.43  ? 59  LEU A CA  1 
ATOM   396   C C   . LEU A  1  59  ? 149.346 160.850 138.608 1.00 17.43  ? 59  LEU A C   1 
ATOM   397   O O   . LEU A  1  59  ? 148.659 161.024 137.601 1.00 17.43  ? 59  LEU A O   1 
ATOM   398   C CB  . LEU A  1  59  ? 151.725 160.233 138.112 1.00 17.43  ? 59  LEU A CB  1 
ATOM   399   C CG  . LEU A  1  59  ? 151.820 160.775 136.688 1.00 17.43  ? 59  LEU A CG  1 
ATOM   400   C CD1 . LEU A  1  59  ? 151.538 162.261 136.657 1.00 17.43  ? 59  LEU A CD1 1 
ATOM   401   C CD2 . LEU A  1  59  ? 153.183 160.496 136.099 1.00 17.43  ? 59  LEU A CD2 1 
ATOM   402   N N   . THR A  1  60  ? 149.234 161.594 139.703 1.00 17.47  ? 60  THR A N   1 
ATOM   403   C CA  . THR A  1  60  ? 148.347 162.744 139.801 1.00 17.47  ? 60  THR A CA  1 
ATOM   404   C C   . THR A  1  60  ? 149.198 163.985 140.000 1.00 17.47  ? 60  THR A C   1 
ATOM   405   O O   . THR A  1  60  ? 150.052 164.012 140.890 1.00 17.47  ? 60  THR A O   1 
ATOM   406   C CB  . THR A  1  60  ? 147.361 162.588 140.959 1.00 17.47  ? 60  THR A CB  1 
ATOM   407   O OG1 . THR A  1  60  ? 146.533 161.441 140.736 1.00 17.47  ? 60  THR A OG1 1 
ATOM   408   C CG2 . THR A  1  60  ? 146.490 163.817 141.085 1.00 17.47  ? 60  THR A CG2 1 
ATOM   409   N N   . MET A  1  61  ? 148.978 165.006 139.178 1.00 21.27  ? 61  MET A N   1 
ATOM   410   C CA  . MET A  1  61  ? 149.883 166.144 139.161 1.00 21.27  ? 61  MET A CA  1 
ATOM   411   C C   . MET A  1  61  ? 149.121 167.438 138.931 1.00 21.27  ? 61  MET A C   1 
ATOM   412   O O   . MET A  1  61  ? 147.968 167.436 138.503 1.00 21.27  ? 61  MET A O   1 
ATOM   413   C CB  . MET A  1  61  ? 150.952 165.977 138.082 1.00 21.27  ? 61  MET A CB  1 
ATOM   414   C CG  . MET A  1  61  ? 150.405 165.944 136.681 1.00 21.27  ? 61  MET A CG  1 
ATOM   415   S SD  . MET A  1  61  ? 151.710 165.702 135.473 1.00 21.27  ? 61  MET A SD  1 
ATOM   416   C CE  . MET A  1  61  ? 150.751 165.665 133.971 1.00 21.27  ? 61  MET A CE  1 
ATOM   417   N N   . TYR A  1  62  ? 149.791 168.549 139.222 1.00 26.11  ? 62  TYR A N   1 
ATOM   418   C CA  . TYR A  1  62  ? 149.284 169.882 138.926 1.00 26.11  ? 62  TYR A CA  1 
ATOM   419   C C   . TYR A  1  62  ? 150.040 170.407 137.718 1.00 26.11  ? 62  TYR A C   1 
ATOM   420   O O   . TYR A  1  62  ? 151.252 170.623 137.790 1.00 26.11  ? 62  TYR A O   1 
ATOM   421   C CB  . TYR A  1  62  ? 149.469 170.836 140.103 1.00 26.11  ? 62  TYR A CB  1 
ATOM   422   C CG  . TYR A  1  62  ? 148.688 170.477 141.335 1.00 26.11  ? 62  TYR A CG  1 
ATOM   423   C CD1 . TYR A  1  62  ? 147.702 169.510 141.302 1.00 26.11  ? 62  TYR A CD1 1 
ATOM   424   C CD2 . TYR A  1  62  ? 148.928 171.122 142.533 1.00 26.11  ? 62  TYR A CD2 1 
ATOM   425   C CE1 . TYR A  1  62  ? 146.994 169.185 142.428 1.00 26.11  ? 62  TYR A CE1 1 
ATOM   426   C CE2 . TYR A  1  62  ? 148.225 170.805 143.660 1.00 26.11  ? 62  TYR A CE2 1 
ATOM   427   C CZ  . TYR A  1  62  ? 147.260 169.837 143.603 1.00 26.11  ? 62  TYR A CZ  1 
ATOM   428   O OH  . TYR A  1  62  ? 146.553 169.518 144.732 1.00 26.11  ? 62  TYR A OH  1 
ATOM   429   N N   . PHE A  1  63  ? 149.333 170.626 136.624 1.00 26.25  ? 63  PHE A N   1 
ATOM   430   C CA  . PHE A  1  63  ? 149.949 170.948 135.347 1.00 26.25  ? 63  PHE A CA  1 
ATOM   431   C C   . PHE A  1  63  ? 149.706 172.417 135.042 1.00 26.25  ? 63  PHE A C   1 
ATOM   432   O O   . PHE A  1  63  ? 148.555 172.836 134.885 1.00 26.25  ? 63  PHE A O   1 
ATOM   433   C CB  . PHE A  1  63  ? 149.367 170.054 134.256 1.00 26.25  ? 63  PHE A CB  1 
ATOM   434   C CG  . PHE A  1  63  ? 150.039 170.185 132.938 1.00 26.25  ? 63  PHE A CG  1 
ATOM   435   C CD1 . PHE A  1  63  ? 151.261 169.598 132.718 1.00 26.25  ? 63  PHE A CD1 1 
ATOM   436   C CD2 . PHE A  1  63  ? 149.438 170.876 131.909 1.00 26.25  ? 63  PHE A CD2 1 
ATOM   437   C CE1 . PHE A  1  63  ? 151.875 169.707 131.505 1.00 26.25  ? 63  PHE A CE1 1 
ATOM   438   C CE2 . PHE A  1  63  ? 150.048 170.988 130.690 1.00 26.25  ? 63  PHE A CE2 1 
ATOM   439   C CZ  . PHE A  1  63  ? 151.268 170.402 130.487 1.00 26.25  ? 63  PHE A CZ  1 
ATOM   440   N N   . GLN A  1  64  ? 150.781 173.197 134.969 1.00 27.91  ? 64  GLN A N   1 
ATOM   441   C CA  . GLN A  1  64  ? 150.686 174.626 134.710 1.00 27.91  ? 64  GLN A CA  1 
ATOM   442   C C   . GLN A  1  64  ? 151.558 174.993 133.524 1.00 27.91  ? 64  GLN A C   1 
ATOM   443   O O   . GLN A  1  64  ? 152.537 174.311 133.221 1.00 27.91  ? 64  GLN A O   1 
ATOM   444   C CB  . GLN A  1  64  ? 151.112 175.456 135.915 1.00 27.91  ? 64  GLN A CB  1 
ATOM   445   C CG  . GLN A  1  64  ? 150.219 175.308 137.116 1.00 27.91  ? 64  GLN A CG  1 
ATOM   446   C CD  . GLN A  1  64  ? 150.658 176.184 138.260 1.00 27.91  ? 64  GLN A CD  1 
ATOM   447   O OE1 . GLN A  1  64  ? 151.663 176.886 138.167 1.00 27.91  ? 64  GLN A OE1 1 
ATOM   448   N NE2 . GLN A  1  64  ? 149.907 176.148 139.353 1.00 27.91  ? 64  GLN A NE2 1 
ATOM   449   N N   . GLN A  1  65  ? 151.199 176.088 132.861 1.00 23.68  ? 65  GLN A N   1 
ATOM   450   C CA  . GLN A  1  65  ? 151.932 176.538 131.689 1.00 23.68  ? 65  GLN A CA  1 
ATOM   451   C C   . GLN A  1  65  ? 151.532 177.970 131.375 1.00 23.68  ? 65  GLN A C   1 
ATOM   452   O O   . GLN A  1  65  ? 150.357 178.321 131.478 1.00 23.68  ? 65  GLN A O   1 
ATOM   453   C CB  . GLN A  1  65  ? 151.666 175.610 130.502 1.00 23.68  ? 65  GLN A CB  1 
ATOM   454   C CG  . GLN A  1  65  ? 150.209 175.460 130.150 1.00 23.68  ? 65  GLN A CG  1 
ATOM   455   C CD  . GLN A  1  65  ? 149.984 174.414 129.088 1.00 23.68  ? 65  GLN A CD  1 
ATOM   456   O OE1 . GLN A  1  65  ? 150.933 173.850 128.548 1.00 23.68  ? 65  GLN A OE1 1 
ATOM   457   N NE2 . GLN A  1  65  ? 148.725 174.135 128.789 1.00 23.68  ? 65  GLN A NE2 1 
ATOM   458   N N   . ALA A  1  66  ? 152.508 178.791 131.000 1.00 23.86  ? 66  ALA A N   1 
ATOM   459   C CA  . ALA A  1  66  ? 152.271 180.216 130.822 1.00 23.86  ? 66  ALA A CA  1 
ATOM   460   C C   . ALA A  1  66  ? 152.938 180.713 129.552 1.00 23.86  ? 66  ALA A C   1 
ATOM   461   O O   . ALA A  1  66  ? 154.113 180.425 129.314 1.00 23.86  ? 66  ALA A O   1 
ATOM   462   C CB  . ALA A  1  66  ? 152.792 181.007 132.022 1.00 23.86  ? 66  ALA A CB  1 
ATOM   463   N N   . TRP A  1  67  ? 152.193 181.472 128.754 1.00 43.48  ? 67  TRP A N   1 
ATOM   464   C CA  . TRP A  1  67  ? 152.689 182.075 127.526 1.00 43.48  ? 67  TRP A CA  1 
ATOM   465   C C   . TRP A  1  67  ? 152.418 183.570 127.578 1.00 43.48  ? 67  TRP A C   1 
ATOM   466   O O   . TRP A  1  67  ? 151.929 184.095 128.580 1.00 43.48  ? 67  TRP A O   1 
ATOM   467   C CB  . TRP A  1  67  ? 152.033 181.442 126.297 1.00 43.48  ? 67  TRP A CB  1 
ATOM   468   C CG  . TRP A  1  67  ? 150.561 181.591 126.289 1.00 43.48  ? 67  TRP A CG  1 
ATOM   469   C CD1 . TRP A  1  67  ? 149.843 182.590 125.716 1.00 43.48  ? 67  TRP A CD1 1 
ATOM   470   C CD2 . TRP A  1  67  ? 149.616 180.721 126.910 1.00 43.48  ? 67  TRP A CD2 1 
ATOM   471   N NE1 . TRP A  1  67  ? 148.503 182.390 125.927 1.00 43.48  ? 67  TRP A NE1 1 
ATOM   472   C CE2 . TRP A  1  67  ? 148.339 181.247 126.661 1.00 43.48  ? 67  TRP A CE2 1 
ATOM   473   C CE3 . TRP A  1  67  ? 149.726 179.543 127.645 1.00 43.48  ? 67  TRP A CE3 1 
ATOM   474   C CZ2 . TRP A  1  67  ? 147.184 180.642 127.126 1.00 43.48  ? 67  TRP A CZ2 1 
ATOM   475   C CZ3 . TRP A  1  67  ? 148.580 178.944 128.105 1.00 43.48  ? 67  TRP A CZ3 1 
ATOM   476   C CH2 . TRP A  1  67  ? 147.325 179.491 127.842 1.00 43.48  ? 67  TRP A CH2 1 
ATOM   477   N N   . ARG A  1  68  ? 152.738 184.267 126.493 1.00 35.13  ? 68  ARG A N   1 
ATOM   478   C CA  . ARG A  1  68  ? 152.538 185.708 126.412 1.00 35.13  ? 68  ARG A CA  1 
ATOM   479   C C   . ARG A  1  68  ? 151.676 186.023 125.201 1.00 35.13  ? 68  ARG A C   1 
ATOM   480   O O   . ARG A  1  68  ? 152.094 185.797 124.062 1.00 35.13  ? 68  ARG A O   1 
ATOM   481   C CB  . ARG A  1  68  ? 153.871 186.448 126.331 1.00 35.13  ? 68  ARG A CB  1 
ATOM   482   C CG  . ARG A  1  68  ? 153.713 187.948 126.363 1.00 35.13  ? 68  ARG A CG  1 
ATOM   483   C CD  . ARG A  1  68  ? 155.047 188.659 126.346 1.00 35.13  ? 68  ARG A CD  1 
ATOM   484   N NE  . ARG A  1  68  ? 154.860 190.103 126.404 1.00 35.13  ? 68  ARG A NE  1 
ATOM   485   C CZ  . ARG A  1  68  ? 154.677 190.870 125.336 1.00 35.13  ? 68  ARG A CZ  1 
ATOM   486   N NH1 . ARG A  1  68  ? 154.659 190.328 124.127 1.00 35.13  ? 68  ARG A NH1 1 
ATOM   487   N NH2 . ARG A  1  68  ? 154.508 192.177 125.475 1.00 35.13  ? 68  ARG A NH2 1 
ATOM   488   N N   . ASP A  1  69  ? 150.487 186.563 125.449 1.00 31.27  ? 69  ASP A N   1 
ATOM   489   C CA  . ASP A  1  69  ? 149.487 186.812 124.417 1.00 31.27  ? 69  ASP A CA  1 
ATOM   490   C C   . ASP A  1  69  ? 149.229 188.311 124.356 1.00 31.27  ? 69  ASP A C   1 
ATOM   491   O O   . ASP A  1  69  ? 148.667 188.886 125.293 1.00 31.27  ? 69  ASP A O   1 
ATOM   492   C CB  . ASP A  1  69  ? 148.206 186.040 124.725 1.00 31.27  ? 69  ASP A CB  1 
ATOM   493   C CG  . ASP A  1  69  ? 147.227 186.051 123.578 1.00 31.27  ? 69  ASP A CG  1 
ATOM   494   O OD1 . ASP A  1  69  ? 147.518 186.693 122.549 1.00 31.27  ? 69  ASP A OD1 1 
ATOM   495   O OD2 . ASP A  1  69  ? 146.165 185.405 123.703 1.00 31.27  ? 69  ASP A OD2 1 
ATOM   496   N N   . LYS A  1  70  ? 149.626 188.941 123.250 1.00 28.73  ? 70  LYS A N   1 
ATOM   497   C CA  . LYS A  1  70  ? 149.557 190.394 123.148 1.00 28.73  ? 70  LYS A CA  1 
ATOM   498   C C   . LYS A  1  70  ? 148.134 190.925 123.057 1.00 28.73  ? 70  LYS A C   1 
ATOM   499   O O   . LYS A  1  70  ? 147.943 192.139 123.174 1.00 28.73  ? 70  LYS A O   1 
ATOM   500   C CB  . LYS A  1  70  ? 150.354 190.876 121.937 1.00 28.73  ? 70  LYS A CB  1 
ATOM   501   C CG  . LYS A  1  70  ? 151.856 190.713 122.077 1.00 28.73  ? 70  LYS A CG  1 
ATOM   502   C CD  . LYS A  1  70  ? 152.584 191.275 120.866 1.00 28.73  ? 70  LYS A CD  1 
ATOM   503   C CE  . LYS A  1  70  ? 154.088 191.114 120.999 1.00 28.73  ? 70  LYS A CE  1 
ATOM   504   N NZ  . LYS A  1  70  ? 154.814 191.665 119.823 1.00 28.73  ? 70  LYS A NZ  1 
ATOM   505   N N   . ARG A  1  71  ? 147.140 190.064 122.847 1.00 26.16  ? 71  ARG A N   1 
ATOM   506   C CA  . ARG A  1  71  ? 145.769 190.543 122.726 1.00 26.16  ? 71  ARG A CA  1 
ATOM   507   C C   . ARG A  1  71  ? 145.102 190.728 124.080 1.00 26.16  ? 71  ARG A C   1 
ATOM   508   O O   . ARG A  1  71  ? 144.193 191.553 124.208 1.00 26.16  ? 71  ARG A O   1 
ATOM   509   C CB  . ARG A  1  71  ? 144.951 189.585 121.863 1.00 26.16  ? 71  ARG A CB  1 
ATOM   510   C CG  . ARG A  1  71  ? 145.381 189.560 120.410 1.00 26.16  ? 71  ARG A CG  1 
ATOM   511   C CD  . ARG A  1  71  ? 144.413 188.764 119.566 1.00 26.16  ? 71  ARG A CD  1 
ATOM   512   N NE  . ARG A  1  71  ? 144.373 187.366 119.971 1.00 26.16  ? 71  ARG A NE  1 
ATOM   513   C CZ  . ARG A  1  71  ? 145.189 186.431 119.503 1.00 26.16  ? 71  ARG A CZ  1 
ATOM   514   N NH1 . ARG A  1  71  ? 146.112 186.748 118.608 1.00 26.16  ? 71  ARG A NH1 1 
ATOM   515   N NH2 . ARG A  1  71  ? 145.083 185.181 119.928 1.00 26.16  ? 71  ARG A NH2 1 
ATOM   516   N N   . LEU A  1  72  ? 145.531 189.980 125.092 1.00 26.77  ? 72  LEU A N   1 
ATOM   517   C CA  . LEU A  1  72  ? 144.946 190.076 126.428 1.00 26.77  ? 72  LEU A CA  1 
ATOM   518   C C   . LEU A  1  72  ? 145.759 191.037 127.296 1.00 26.77  ? 72  LEU A C   1 
ATOM   519   O O   . LEU A  1  72  ? 146.354 190.666 128.305 1.00 26.77  ? 72  LEU A O   1 
ATOM   520   C CB  . LEU A  1  72  ? 144.865 188.696 127.066 1.00 26.77  ? 72  LEU A CB  1 
ATOM   521   C CG  . LEU A  1  72  ? 143.995 187.684 126.330 1.00 26.77  ? 72  LEU A CG  1 
ATOM   522   C CD1 . LEU A  1  72  ? 144.081 186.335 127.006 1.00 26.77  ? 72  LEU A CD1 1 
ATOM   523   C CD2 . LEU A  1  72  ? 142.568 188.169 126.272 1.00 26.77  ? 72  LEU A CD2 1 
ATOM   524   N N   . SER A  1  73  ? 145.773 192.300 126.880 1.00 35.85  ? 73  SER A N   1 
ATOM   525   C CA  . SER A  1  73  ? 146.566 193.330 127.532 1.00 35.85  ? 73  SER A CA  1 
ATOM   526   C C   . SER A  1  73  ? 145.657 194.454 128.001 1.00 35.85  ? 73  SER A C   1 
ATOM   527   O O   . SER A  1  73  ? 144.781 194.901 127.255 1.00 35.85  ? 73  SER A O   1 
ATOM   528   C CB  . SER A  1  73  ? 147.637 193.877 126.591 1.00 35.85  ? 73  SER A CB  1 
ATOM   529   O OG  . SER A  1  73  ? 148.380 194.901 127.224 1.00 35.85  ? 73  SER A OG  1 
ATOM   530   N N   . TYR A  1  74  ? 145.872 194.908 129.232 1.00 41.50  ? 74  TYR A N   1 
ATOM   531   C CA  . TYR A  1  74  ? 145.072 195.972 129.816 1.00 41.50  ? 74  TYR A CA  1 
ATOM   532   C C   . TYR A  1  74  ? 145.952 196.802 130.736 1.00 41.50  ? 74  TYR A C   1 
ATOM   533   O O   . TYR A  1  74  ? 146.835 196.266 131.409 1.00 41.50  ? 74  TYR A O   1 
ATOM   534   C CB  . TYR A  1  74  ? 143.877 195.405 130.583 1.00 41.50  ? 74  TYR A CB  1 
ATOM   535   C CG  . TYR A  1  74  ? 144.268 194.494 131.718 1.00 41.50  ? 74  TYR A CG  1 
ATOM   536   C CD1 . TYR A  1  74  ? 144.472 193.143 131.503 1.00 41.50  ? 74  TYR A CD1 1 
ATOM   537   C CD2 . TYR A  1  74  ? 144.423 194.979 133.003 1.00 41.50  ? 74  TYR A CD2 1 
ATOM   538   C CE1 . TYR A  1  74  ? 144.827 192.305 132.532 1.00 41.50  ? 74  TYR A CE1 1 
ATOM   539   C CE2 . TYR A  1  74  ? 144.778 194.146 134.038 1.00 41.50  ? 74  TYR A CE2 1 
ATOM   540   C CZ  . TYR A  1  74  ? 144.980 192.811 133.797 1.00 41.50  ? 74  TYR A CZ  1 
ATOM   541   O OH  . TYR A  1  74  ? 145.334 191.978 134.828 1.00 41.50  ? 74  TYR A OH  1 
ATOM   542   N N   . ASN A  1  75  ? 145.702 198.110 130.764 1.00 56.62  ? 75  ASN A N   1 
ATOM   543   C CA  . ASN A  1  75  ? 146.522 199.036 131.535 1.00 56.62  ? 75  ASN A CA  1 
ATOM   544   C C   . ASN A  1  75  ? 145.708 199.893 132.495 1.00 56.62  ? 75  ASN A C   1 
ATOM   545   O O   . ASN A  1  75  ? 146.235 200.874 133.030 1.00 56.62  ? 75  ASN A O   1 
ATOM   546   C CB  . ASN A  1  75  ? 147.328 199.928 130.591 1.00 56.62  ? 75  ASN A CB  1 
ATOM   547   C CG  . ASN A  1  75  ? 148.385 199.158 129.836 1.00 56.62  ? 75  ASN A CG  1 
ATOM   548   O OD1 . ASN A  1  75  ? 149.055 198.293 130.398 1.00 56.62  ? 75  ASN A OD1 1 
ATOM   549   N ND2 . ASN A  1  75  ? 148.538 199.463 128.554 1.00 56.62  ? 75  ASN A ND2 1 
ATOM   550   N N   . VAL A  1  76  ? 144.444 199.557 132.722 1.00 58.37  ? 76  VAL A N   1 
ATOM   551   C CA  . VAL A  1  76  ? 143.600 200.335 133.621 1.00 58.37  ? 76  VAL A CA  1 
ATOM   552   C C   . VAL A  1  76  ? 143.711 199.842 135.058 1.00 58.37  ? 76  VAL A C   1 
ATOM   553   O O   . VAL A  1  76  ? 143.952 200.626 135.979 1.00 58.37  ? 76  VAL A O   1 
ATOM   554   C CB  . VAL A  1  76  ? 142.140 200.299 133.124 1.00 58.37  ? 76  VAL A CB  1 
ATOM   555   C CG1 . VAL A  1  76  ? 141.235 201.040 134.090 1.00 58.37  ? 76  VAL A CG1 1 
ATOM   556   C CG2 . VAL A  1  76  ? 142.041 200.889 131.729 1.00 58.37  ? 76  VAL A CG2 1 
ATOM   557   N N   . ILE A  1  77  ? 143.544 198.546 135.273 1.00 58.48  ? 77  ILE A N   1 
ATOM   558   C CA  . ILE A  1  77  ? 143.524 197.955 136.609 1.00 58.48  ? 77  ILE A CA  1 
ATOM   559   C C   . ILE A  1  77  ? 144.870 197.286 136.861 1.00 58.48  ? 77  ILE A C   1 
ATOM   560   O O   . ILE A  1  77  ? 145.312 196.487 136.026 1.00 58.48  ? 77  ILE A O   1 
ATOM   561   C CB  . ILE A  1  77  ? 142.379 196.938 136.760 1.00 58.48  ? 77  ILE A CB  1 
ATOM   562   C CG1 . ILE A  1  77  ? 141.019 197.625 136.633 1.00 58.48  ? 77  ILE A CG1 1 
ATOM   563   C CG2 . ILE A  1  77  ? 142.484 196.206 138.084 1.00 58.48  ? 77  ILE A CG2 1 
ATOM   564   C CD1 . ILE A  1  77  ? 140.464 197.641 135.227 1.00 58.48  ? 77  ILE A CD1 1 
ATOM   565   N N   . PRO A  1  78  ? 145.544 197.576 137.976 1.00 62.91  ? 78  PRO A N   1 
ATOM   566   C CA  . PRO A  1  78  ? 146.820 196.910 138.277 1.00 62.91  ? 78  PRO A CA  1 
ATOM   567   C C   . PRO A  1  78  ? 146.689 195.541 138.930 1.00 62.91  ? 78  PRO A C   1 
ATOM   568   O O   . PRO A  1  78  ? 147.713 194.953 139.292 1.00 62.91  ? 78  PRO A O   1 
ATOM   569   C CB  . PRO A  1  78  ? 147.499 197.901 139.232 1.00 62.91  ? 78  PRO A CB  1 
ATOM   570   C CG  . PRO A  1  78  ? 146.371 198.588 139.907 1.00 62.91  ? 78  PRO A CG  1 
ATOM   571   C CD  . PRO A  1  78  ? 145.282 198.709 138.880 1.00 62.91  ? 78  PRO A CD  1 
ATOM   572   N N   . LEU A  1  79  ? 145.479 195.014 139.096 1.00 58.41  ? 79  LEU A N   1 
ATOM   573   C CA  . LEU A  1  79  ? 145.290 193.777 139.839 1.00 58.41  ? 79  LEU A CA  1 
ATOM   574   C C   . LEU A  1  79  ? 145.680 192.557 139.003 1.00 58.41  ? 79  LEU A C   1 
ATOM   575   O O   . LEU A  1  79  ? 145.936 192.637 137.799 1.00 58.41  ? 79  LEU A O   1 
ATOM   576   C CB  . LEU A  1  79  ? 143.841 193.649 140.298 1.00 58.41  ? 79  LEU A CB  1 
ATOM   577   C CG  . LEU A  1  79  ? 143.409 194.696 141.319 1.00 58.41  ? 79  LEU A CG  1 
ATOM   578   C CD1 . LEU A  1  79  ? 141.927 194.576 141.610 1.00 58.41  ? 79  LEU A CD1 1 
ATOM   579   C CD2 . LEU A  1  79  ? 144.225 194.559 142.588 1.00 58.41  ? 79  LEU A CD2 1 
ATOM   580   N N   . ASN A  1  80  ? 145.725 191.409 139.677 1.00 54.11  ? 80  ASN A N   1 
ATOM   581   C CA  . ASN A  1  80  ? 145.946 190.109 139.047 1.00 54.11  ? 80  ASN A CA  1 
ATOM   582   C C   . ASN A  1  80  ? 144.578 189.522 138.733 1.00 54.11  ? 80  ASN A C   1 
ATOM   583   O O   . ASN A  1  80  ? 144.001 188.793 139.539 1.00 54.11  ? 80  ASN A O   1 
ATOM   584   C CB  . ASN A  1  80  ? 146.710 189.181 139.979 1.00 54.11  ? 80  ASN A CB  1 
ATOM   585   C CG  . ASN A  1  80  ? 148.047 189.737 140.412 1.00 54.11  ? 80  ASN A CG  1 
ATOM   586   O OD1 . ASN A  1  80  ? 148.162 190.236 141.528 1.00 54.11  ? 80  ASN A OD1 1 
ATOM   587   N ND2 . ASN A  1  80  ? 149.070 189.613 139.555 1.00 54.11  ? 80  ASN A ND2 1 
ATOM   588   N N   . LEU A  1  81  ? 144.044 189.831 137.555 1.00 32.71  ? 81  LEU A N   1 
ATOM   589   C CA  . LEU A  1  81  ? 142.728 189.319 137.194 1.00 32.71  ? 81  LEU A CA  1 
ATOM   590   C C   . LEU A  1  81  ? 142.744 187.799 137.152 1.00 32.71  ? 81  LEU A C   1 
ATOM   591   O O   . LEU A  1  81  ? 143.519 187.197 136.404 1.00 32.71  ? 81  LEU A O   1 
ATOM   592   C CB  . LEU A  1  81  ? 142.284 189.879 135.846 1.00 32.71  ? 81  LEU A CB  1 
ATOM   593   C CG  . LEU A  1  81  ? 141.929 191.358 135.818 1.00 32.71  ? 81  LEU A CG  1 
ATOM   594   C CD1 . LEU A  1  81  ? 141.615 191.792 134.405 1.00 32.71  ? 81  LEU A CD1 1 
ATOM   595   C CD2 . LEU A  1  81  ? 140.750 191.591 136.729 1.00 32.71  ? 81  LEU A CD2 1 
ATOM   596   N N   . THR A  1  82  ? 141.896 187.181 137.965 1.00 25.24  ? 82  THR A N   1 
ATOM   597   C CA  . THR A  1  82  ? 141.740 185.729 137.988 1.00 25.24  ? 82  THR A CA  1 
ATOM   598   C C   . THR A  1  82  ? 140.300 185.410 137.611 1.00 25.24  ? 82  THR A C   1 
ATOM   599   O O   . THR A  1  82  ? 139.408 185.435 138.463 1.00 25.24  ? 82  THR A O   1 
ATOM   600   C CB  . THR A  1  82  ? 142.089 185.151 139.349 1.00 25.24  ? 82  THR A CB  1 
ATOM   601   O OG1 . THR A  1  82  ? 143.443 185.477 139.675 1.00 25.24  ? 82  THR A OG1 1 
ATOM   602   C CG2 . THR A  1  82  ? 141.939 183.650 139.317 1.00 25.24  ? 82  THR A CG2 1 
ATOM   603   N N   . LEU A  1  83  ? 140.078 185.105 136.339 1.00 21.76  ? 83  LEU A N   1 
ATOM   604   C CA  . LEU A  1  83  ? 138.735 184.865 135.849 1.00 21.76  ? 83  LEU A CA  1 
ATOM   605   C C   . LEU A  1  83  ? 138.230 183.504 136.322 1.00 21.76  ? 83  LEU A C   1 
ATOM   606   O O   . LEU A  1  83  ? 138.967 182.700 136.895 1.00 21.76  ? 83  LEU A O   1 
ATOM   607   C CB  . LEU A  1  83  ? 138.717 184.941 134.328 1.00 21.76  ? 83  LEU A CB  1 
ATOM   608   C CG  . LEU A  1  83  ? 139.149 186.295 133.778 1.00 21.76  ? 83  LEU A CG  1 
ATOM   609   C CD1 . LEU A  1  83  ? 139.220 186.249 132.267 1.00 21.76  ? 83  LEU A CD1 1 
ATOM   610   C CD2 . LEU A  1  83  ? 138.206 187.381 134.245 1.00 21.76  ? 83  LEU A CD2 1 
ATOM   611   N N   . ASP A  1  84  ? 136.949 183.251 136.079 1.00 25.47  ? 84  ASP A N   1 
ATOM   612   C CA  . ASP A  1  84  ? 136.379 181.958 136.418 1.00 25.47  ? 84  ASP A CA  1 
ATOM   613   C C   . ASP A  1  84  ? 136.846 180.913 135.410 1.00 25.47  ? 84  ASP A C   1 
ATOM   614   O O   . ASP A  1  84  ? 137.355 181.236 134.338 1.00 25.47  ? 84  ASP A O   1 
ATOM   615   C CB  . ASP A  1  84  ? 134.854 182.031 136.443 1.00 25.47  ? 84  ASP A CB  1 
ATOM   616   C CG  . ASP A  1  84  ? 134.222 180.835 137.125 1.00 25.47  ? 84  ASP A CG  1 
ATOM   617   O OD1 . ASP A  1  84  ? 134.971 179.950 137.588 1.00 25.47  ? 84  ASP A OD1 1 
ATOM   618   O OD2 . ASP A  1  84  ? 132.978 180.775 137.199 1.00 25.47  ? 84  ASP A OD2 1 
ATOM   619   N N   . ASN A  1  85  ? 136.664 179.643 135.762 1.00 20.26  ? 85  ASN A N   1 
ATOM   620   C CA  . ASN A  1  85  ? 137.148 178.579 134.892 1.00 20.26  ? 85  ASN A CA  1 
ATOM   621   C C   . ASN A  1  85  ? 136.335 178.418 133.615 1.00 20.26  ? 85  ASN A C   1 
ATOM   622   O O   . ASN A  1  85  ? 136.664 177.537 132.815 1.00 20.26  ? 85  ASN A O   1 
ATOM   623   C CB  . ASN A  1  85  ? 137.186 177.255 135.652 1.00 20.26  ? 85  ASN A CB  1 
ATOM   624   C CG  . ASN A  1  85  ? 135.828 176.825 136.143 1.00 20.26  ? 85  ASN A CG  1 
ATOM   625   O OD1 . ASN A  1  85  ? 134.819 177.464 135.860 1.00 20.26  ? 85  ASN A OD1 1 
ATOM   626   N ND2 . ASN A  1  85  ? 135.793 175.732 136.886 1.00 20.26  ? 85  ASN A ND2 1 
ATOM   627   N N   . ARG A  1  86  ? 135.288 179.217 133.402 1.00 23.10  ? 86  ARG A N   1 
ATOM   628   C CA  . ARG A  1  86  ? 134.531 179.122 132.159 1.00 23.10  ? 86  ARG A CA  1 
ATOM   629   C C   . ARG A  1  86  ? 135.231 179.817 131.002 1.00 23.10  ? 86  ARG A C   1 
ATOM   630   O O   . ARG A  1  86  ? 135.070 179.403 129.850 1.00 23.10  ? 86  ARG A O   1 
ATOM   631   C CB  . ARG A  1  86  ? 133.135 179.717 132.327 1.00 23.10  ? 86  ARG A CB  1 
ATOM   632   C CG  . ARG A  1  86  ? 132.206 178.912 133.201 1.00 23.10  ? 86  ARG A CG  1 
ATOM   633   C CD  . ARG A  1  86  ? 130.844 179.573 133.275 1.00 23.10  ? 86  ARG A CD  1 
ATOM   634   N NE  . ARG A  1  86  ? 129.938 178.832 134.141 1.00 23.10  ? 86  ARG A NE  1 
ATOM   635   C CZ  . ARG A  1  86  ? 129.820 179.051 135.444 1.00 23.10  ? 86  ARG A CZ  1 
ATOM   636   N NH1 . ARG A  1  86  ? 130.552 179.991 136.024 1.00 23.10  ? 86  ARG A NH1 1 
ATOM   637   N NH2 . ARG A  1  86  ? 128.973 178.333 136.168 1.00 23.10  ? 86  ARG A NH2 1 
ATOM   638   N N   . VAL A  1  87  ? 136.002 180.871 131.279 1.00 19.72  ? 87  VAL A N   1 
ATOM   639   C CA  . VAL A  1  87  ? 136.638 181.634 130.214 1.00 19.72  ? 87  VAL A CA  1 
ATOM   640   C C   . VAL A  1  87  ? 137.670 180.818 129.453 1.00 19.72  ? 87  VAL A C   1 
ATOM   641   O O   . VAL A  1  87  ? 138.097 181.229 128.369 1.00 19.72  ? 87  VAL A O   1 
ATOM   642   C CB  . VAL A  1  87  ? 137.276 182.910 130.800 1.00 19.72  ? 87  VAL A CB  1 
ATOM   643   C CG1 . VAL A  1  87  ? 138.482 182.557 131.629 1.00 19.72  ? 87  VAL A CG1 1 
ATOM   644   C CG2 . VAL A  1  87  ? 137.635 183.903 129.712 1.00 19.72  ? 87  VAL A CG2 1 
ATOM   645   N N   . ALA A  1  88  ? 138.066 179.656 129.976 1.00 19.32  ? 88  ALA A N   1 
ATOM   646   C CA  . ALA A  1  88  ? 139.038 178.828 129.273 1.00 19.32  ? 88  ALA A CA  1 
ATOM   647   C C   . ALA A  1  88  ? 138.506 178.343 127.933 1.00 19.32  ? 88  ALA A C   1 
ATOM   648   O O   . ALA A  1  88  ? 139.290 178.008 127.041 1.00 19.32  ? 88  ALA A O   1 
ATOM   649   C CB  . ALA A  1  88  ? 139.441 177.638 130.138 1.00 19.32  ? 88  ALA A CB  1 
ATOM   650   N N   . ASP A  1  89  ? 137.185 178.286 127.773 1.00 26.07  ? 89  ASP A N   1 
ATOM   651   C CA  . ASP A  1  89  ? 136.604 177.875 126.503 1.00 26.07  ? 89  ASP A CA  1 
ATOM   652   C C   . ASP A  1  89  ? 136.651 178.972 125.451 1.00 26.07  ? 89  ASP A C   1 
ATOM   653   O O   . ASP A  1  89  ? 136.525 178.673 124.260 1.00 26.07  ? 89  ASP A O   1 
ATOM   654   C CB  . ASP A  1  89  ? 135.155 177.430 126.700 1.00 26.07  ? 89  ASP A CB  1 
ATOM   655   C CG  . ASP A  1  89  ? 135.045 176.125 127.458 1.00 26.07  ? 89  ASP A CG  1 
ATOM   656   O OD1 . ASP A  1  89  ? 135.971 175.295 127.352 1.00 26.07  ? 89  ASP A OD1 1 
ATOM   657   O OD2 . ASP A  1  89  ? 134.030 175.925 128.159 1.00 26.07  ? 89  ASP A OD2 1 
ATOM   658   N N   . GLN A  1  90  ? 136.815 180.227 125.858 1.00 20.64  ? 90  GLN A N   1 
ATOM   659   C CA  . GLN A  1  90  ? 136.795 181.338 124.921 1.00 20.64  ? 90  GLN A CA  1 
ATOM   660   C C   . GLN A  1  90  ? 138.176 181.883 124.600 1.00 20.64  ? 90  GLN A C   1 
ATOM   661   O O   . GLN A  1  90  ? 138.334 182.548 123.573 1.00 20.64  ? 90  GLN A O   1 
ATOM   662   C CB  . GLN A  1  90  ? 135.919 182.469 125.464 1.00 20.64  ? 90  GLN A CB  1 
ATOM   663   C CG  . GLN A  1  90  ? 134.468 182.069 125.634 1.00 20.64  ? 90  GLN A CG  1 
ATOM   664   C CD  . GLN A  1  90  ? 133.614 183.186 126.187 1.00 20.64  ? 90  GLN A CD  1 
ATOM   665   O OE1 . GLN A  1  90  ? 134.107 184.270 126.479 1.00 20.64  ? 90  GLN A OE1 1 
ATOM   666   N NE2 . GLN A  1  90  ? 132.323 182.923 126.343 1.00 20.64  ? 90  GLN A NE2 1 
ATOM   667   N N   . LEU A  1  91  ? 139.166 181.630 125.443 1.00 19.88  ? 91  LEU A N   1 
ATOM   668   C CA  . LEU A  1  91  ? 140.532 182.042 125.171 1.00 19.88  ? 91  LEU A CA  1 
ATOM   669   C C   . LEU A  1  91  ? 141.279 180.948 124.421 1.00 19.88  ? 91  LEU A C   1 
ATOM   670   O O   . LEU A  1  91  ? 140.837 179.802 124.339 1.00 19.88  ? 91  LEU A O   1 
ATOM   671   C CB  . LEU A  1  91  ? 141.267 182.370 126.466 1.00 19.88  ? 91  LEU A CB  1 
ATOM   672   C CG  . LEU A  1  91  ? 140.720 183.565 127.234 1.00 19.88  ? 91  LEU A CG  1 
ATOM   673   C CD1 . LEU A  1  91  ? 141.470 183.737 128.537 1.00 19.88  ? 91  LEU A CD1 1 
ATOM   674   C CD2 . LEU A  1  91  ? 140.816 184.809 126.384 1.00 19.88  ? 91  LEU A CD2 1 
ATOM   675   N N   . TRP A  1  92  ? 142.429 181.317 123.868 1.00 20.49  ? 92  TRP A N   1 
ATOM   676   C CA  . TRP A  1  92  ? 143.292 180.338 123.231 1.00 20.49  ? 92  TRP A CA  1 
ATOM   677   C C   . TRP A  1  92  ? 144.086 179.585 124.286 1.00 20.49  ? 92  TRP A C   1 
ATOM   678   O O   . TRP A  1  92  ? 144.537 180.167 125.273 1.00 20.49  ? 92  TRP A O   1 
ATOM   679   C CB  . TRP A  1  92  ? 144.252 181.007 122.255 1.00 20.49  ? 92  TRP A CB  1 
ATOM   680   C CG  . TRP A  1  92  ? 145.095 180.021 121.539 1.00 20.49  ? 92  TRP A CG  1 
ATOM   681   C CD1 . TRP A  1  92  ? 144.691 179.153 120.577 1.00 20.49  ? 92  TRP A CD1 1 
ATOM   682   C CD2 . TRP A  1  92  ? 146.481 179.760 121.760 1.00 20.49  ? 92  TRP A CD2 1 
ATOM   683   N NE1 . TRP A  1  92  ? 145.746 178.385 120.161 1.00 20.49  ? 92  TRP A NE1 1 
ATOM   684   C CE2 . TRP A  1  92  ? 146.857 178.737 120.877 1.00 20.49  ? 92  TRP A CE2 1 
ATOM   685   C CE3 . TRP A  1  92  ? 147.444 180.302 122.611 1.00 20.49  ? 92  TRP A CE3 1 
ATOM   686   C CZ2 . TRP A  1  92  ? 148.152 178.244 120.821 1.00 20.49  ? 92  TRP A CZ2 1 
ATOM   687   C CZ3 . TRP A  1  92  ? 148.729 179.811 122.552 1.00 20.49  ? 92  TRP A CZ3 1 
ATOM   688   C CH2 . TRP A  1  92  ? 149.071 178.791 121.666 1.00 20.49  ? 92  TRP A CH2 1 
ATOM   689   N N   . VAL A  1  93  ? 144.250 178.284 124.077 1.00 18.26  ? 93  VAL A N   1 
ATOM   690   C CA  . VAL A  1  93  ? 145.076 177.458 124.953 1.00 18.26  ? 93  VAL A CA  1 
ATOM   691   C C   . VAL A  1  93  ? 145.875 176.484 124.095 1.00 18.26  ? 93  VAL A C   1 
ATOM   692   O O   . VAL A  1  93  ? 145.302 175.803 123.234 1.00 18.26  ? 93  VAL A O   1 
ATOM   693   C CB  . VAL A  1  93  ? 144.226 176.724 126.000 1.00 18.26  ? 93  VAL A CB  1 
ATOM   694   C CG1 . VAL A  1  93  ? 143.671 177.699 127.009 1.00 18.26  ? 93  VAL A CG1 1 
ATOM   695   C CG2 . VAL A  1  93  ? 143.081 176.005 125.328 1.00 18.26  ? 93  VAL A CG2 1 
ATOM   696   N N   . PRO A  1  94  ? 147.188 176.387 124.282 1.00 17.97  ? 94  PRO A N   1 
ATOM   697   C CA  . PRO A  1  94  ? 147.991 175.518 123.417 1.00 17.97  ? 94  PRO A CA  1 
ATOM   698   C C   . PRO A  1  94  ? 147.693 174.055 123.696 1.00 17.97  ? 94  PRO A C   1 
ATOM   699   O O   . PRO A  1  94  ? 147.669 173.623 124.849 1.00 17.97  ? 94  PRO A O   1 
ATOM   700   C CB  . PRO A  1  94  ? 149.429 175.880 123.794 1.00 17.97  ? 94  PRO A CB  1 
ATOM   701   C CG  . PRO A  1  94  ? 149.328 176.337 125.193 1.00 17.97  ? 94  PRO A CG  1 
ATOM   702   C CD  . PRO A  1  94  ? 148.006 177.034 125.316 1.00 17.97  ? 94  PRO A CD  1 
ATOM   703   N N   . ASP A  1  95  ? 147.468 173.294 122.629 1.00 26.66  ? 95  ASP A N   1 
ATOM   704   C CA  . ASP A  1  95  ? 147.217 171.869 122.765 1.00 26.66  ? 95  ASP A CA  1 
ATOM   705   C C   . ASP A  1  95  ? 148.504 171.138 123.110 1.00 26.66  ? 95  ASP A C   1 
ATOM   706   O O   . ASP A  1  95  ? 149.580 171.461 122.603 1.00 26.66  ? 95  ASP A O   1 
ATOM   707   C CB  . ASP A  1  95  ? 146.600 171.303 121.488 1.00 26.66  ? 95  ASP A CB  1 
ATOM   708   C CG  . ASP A  1  95  ? 147.415 171.618 120.263 1.00 26.66  ? 95  ASP A CG  1 
ATOM   709   O OD1 . ASP A  1  95  ? 148.398 172.375 120.380 1.00 26.66  ? 95  ASP A OD1 1 
ATOM   710   O OD2 . ASP A  1  95  ? 147.068 171.109 119.176 1.00 26.66  ? 95  ASP A OD2 1 
ATOM   711   N N   . THR A  1  96  ? 148.387 170.161 124.001 1.00 19.03  ? 96  THR A N   1 
ATOM   712   C CA  . THR A  1  96  ? 149.549 169.506 124.586 1.00 19.03  ? 96  THR A CA  1 
ATOM   713   C C   . THR A  1  96  ? 149.137 168.093 124.961 1.00 19.03  ? 96  THR A C   1 
ATOM   714   O O   . THR A  1  96  ? 148.435 167.902 125.955 1.00 19.03  ? 96  THR A O   1 
ATOM   715   C CB  . THR A  1  96  ? 150.028 170.274 125.807 1.00 19.03  ? 96  THR A CB  1 
ATOM   716   O OG1 . THR A  1  96  ? 150.419 171.592 125.416 1.00 19.03  ? 96  THR A OG1 1 
ATOM   717   C CG2 . THR A  1  96  ? 151.191 169.580 126.431 1.00 19.03  ? 96  THR A CG2 1 
ATOM   718   N N   . TYR A  1  97  ? 149.528 167.111 124.167 1.00 20.23  ? 97  TYR A N   1 
ATOM   719   C CA  . TYR A  1  97  ? 149.136 165.751 124.471 1.00 20.23  ? 97  TYR A CA  1 
ATOM   720   C C   . TYR A  1  97  ? 150.306 164.952 124.981 1.00 20.23  ? 97  TYR A C   1 
ATOM   721   O O   . TYR A  1  97  ? 151.443 165.281 124.704 1.00 20.23  ? 97  TYR A O   1 
ATOM   722   C CB  . TYR A  1  97  ? 148.551 165.086 123.242 1.00 20.23  ? 97  TYR A CB  1 
ATOM   723   C CG  . TYR A  1  97  ? 149.583 164.679 122.234 1.00 20.23  ? 97  TYR A CG  1 
ATOM   724   C CD1 . TYR A  1  97  ? 150.280 165.623 121.511 1.00 20.23  ? 97  TYR A CD1 1 
ATOM   725   C CD2 . TYR A  1  97  ? 149.848 163.347 121.994 1.00 20.23  ? 97  TYR A CD2 1 
ATOM   726   C CE1 . TYR A  1  97  ? 151.221 165.251 120.579 1.00 20.23  ? 97  TYR A CE1 1 
ATOM   727   C CE2 . TYR A  1  97  ? 150.787 162.965 121.065 1.00 20.23  ? 97  TYR A CE2 1 
ATOM   728   C CZ  . TYR A  1  97  ? 151.467 163.923 120.361 1.00 20.23  ? 97  TYR A CZ  1 
ATOM   729   O OH  . TYR A  1  97  ? 152.400 163.544 119.434 1.00 20.23  ? 97  TYR A OH  1 
ATOM   730   N N   . PHE A  1  98  ? 150.018 163.892 125.721 1.00 19.63  ? 98  PHE A N   1 
ATOM   731   C CA  . PHE A  1  98  ? 151.049 163.040 126.290 1.00 19.63  ? 98  PHE A CA  1 
ATOM   732   C C   . PHE A  1  98  ? 151.263 161.852 125.366 1.00 19.63  ? 98  PHE A C   1 
ATOM   733   O O   . PHE A  1  98  ? 150.318 161.118 125.066 1.00 19.63  ? 98  PHE A O   1 
ATOM   734   C CB  . PHE A  1  98  ? 150.653 162.570 127.686 1.00 19.63  ? 98  PHE A CB  1 
ATOM   735   C CG  . PHE A  1  98  ? 150.465 163.686 128.666 1.00 19.63  ? 98  PHE A CG  1 
ATOM   736   C CD1 . PHE A  1  98  ? 150.909 164.960 128.384 1.00 19.63  ? 98  PHE A CD1 1 
ATOM   737   C CD2 . PHE A  1  98  ? 149.833 163.462 129.868 1.00 19.63  ? 98  PHE A CD2 1 
ATOM   738   C CE1 . PHE A  1  98  ? 150.729 165.984 129.281 1.00 19.63  ? 98  PHE A CE1 1 
ATOM   739   C CE2 . PHE A  1  98  ? 149.653 164.483 130.767 1.00 19.63  ? 98  PHE A CE2 1 
ATOM   740   C CZ  . PHE A  1  98  ? 150.099 165.746 130.472 1.00 19.63  ? 98  PHE A CZ  1 
ATOM   741   N N   . LEU A  1  99  ? 152.505 161.660 124.918 1.00 16.02  ? 99  LEU A N   1 
ATOM   742   C CA  . LEU A  1  99  ? 152.759 160.686 123.863 1.00 16.02  ? 99  LEU A CA  1 
ATOM   743   C C   . LEU A  1  99  ? 152.434 159.265 124.298 1.00 16.02  ? 99  LEU A C   1 
ATOM   744   O O   . LEU A  1  99  ? 152.189 158.409 123.441 1.00 16.02  ? 99  LEU A O   1 
ATOM   745   C CB  . LEU A  1  99  ? 154.212 160.765 123.403 1.00 16.02  ? 99  LEU A CB  1 
ATOM   746   C CG  . LEU A  1  99  ? 154.536 159.953 122.151 1.00 16.02  ? 99  LEU A CG  1 
ATOM   747   C CD1 . LEU A  1  99  ? 153.804 160.531 120.964 1.00 16.02  ? 99  LEU A CD1 1 
ATOM   748   C CD2 . LEU A  1  99  ? 156.024 159.901 121.893 1.00 16.02  ? 99  LEU A CD2 1 
ATOM   749   N N   . ASN A  1  100 ? 152.407 158.994 125.601 1.00 16.56  ? 100 ASN A N   1 
ATOM   750   C CA  . ASN A  1  100 ? 152.097 157.657 126.112 1.00 16.56  ? 100 ASN A CA  1 
ATOM   751   C C   . ASN A  1  100 ? 151.181 157.779 127.332 1.00 16.56  ? 100 ASN A C   1 
ATOM   752   O O   . ASN A  1  100 ? 151.635 158.005 128.455 1.00 16.56  ? 100 ASN A O   1 
ATOM   753   C CB  . ASN A  1  100 ? 153.380 156.893 126.414 1.00 16.56  ? 100 ASN A CB  1 
ATOM   754   C CG  . ASN A  1  100 ? 154.344 157.683 127.268 1.00 16.56  ? 100 ASN A CG  1 
ATOM   755   O OD1 . ASN A  1  100 ? 154.033 158.775 127.731 1.00 16.56  ? 100 ASN A OD1 1 
ATOM   756   N ND2 . ASN A  1  100 ? 155.537 157.140 127.464 1.00 16.56  ? 100 ASN A ND2 1 
ATOM   757   N N   . ASP A  1  101 ? 149.880 157.634 127.095 1.00 22.18  ? 101 ASP A N   1 
ATOM   758   C CA  . ASP A  1  101 ? 148.892 157.649 128.167 1.00 22.18  ? 101 ASP A CA  1 
ATOM   759   C C   . ASP A  1  101 ? 147.713 156.774 127.771 1.00 22.18  ? 101 ASP A C   1 
ATOM   760   O O   . ASP A  1  101 ? 147.035 157.042 126.778 1.00 22.18  ? 101 ASP A O   1 
ATOM   761   C CB  . ASP A  1  101 ? 148.440 159.075 128.487 1.00 22.18  ? 101 ASP A CB  1 
ATOM   762   C CG  . ASP A  1  101 ? 147.923 159.821 127.272 1.00 22.18  ? 101 ASP A CG  1 
ATOM   763   O OD1 . ASP A  1  101 ? 148.042 159.308 126.141 1.00 22.18  ? 101 ASP A OD1 1 
ATOM   764   O OD2 . ASP A  1  101 ? 147.387 160.932 127.448 1.00 22.18  ? 101 ASP A OD2 1 
ATOM   765   N N   . LYS A  1  102 ? 147.470 155.726 128.546 1.00 23.65  ? 102 LYS A N   1 
ATOM   766   C CA  . LYS A  1  102 ? 146.392 154.809 128.209 1.00 23.65  ? 102 LYS A CA  1 
ATOM   767   C C   . LYS A  1  102 ? 145.029 155.384 128.581 1.00 23.65  ? 102 LYS A C   1 
ATOM   768   O O   . LYS A  1  102 ? 144.062 155.227 127.828 1.00 23.65  ? 102 LYS A O   1 
ATOM   769   C CB  . LYS A  1  102 ? 146.639 153.469 128.896 1.00 23.65  ? 102 LYS A CB  1 
ATOM   770   C CG  . LYS A  1  102 ? 147.884 152.775 128.376 1.00 23.65  ? 102 LYS A CG  1 
ATOM   771   C CD  . LYS A  1  102 ? 148.257 151.563 129.204 1.00 23.65  ? 102 LYS A CD  1 
ATOM   772   C CE  . LYS A  1  102 ? 147.274 150.435 128.990 1.00 23.65  ? 102 LYS A CE  1 
ATOM   773   N NZ  . LYS A  1  102 ? 147.716 149.189 129.663 1.00 23.65  ? 102 LYS A NZ  1 
ATOM   774   N N   . LYS A  1  103 ? 144.936 156.062 129.723 1.00 26.69  ? 103 LYS A N   1 
ATOM   775   C CA  . LYS A  1  103 ? 143.693 156.675 130.178 1.00 26.69  ? 103 LYS A CA  1 
ATOM   776   C C   . LYS A  1  103 ? 144.035 157.921 130.977 1.00 26.69  ? 103 LYS A C   1 
ATOM   777   O O   . LYS A  1  103 ? 144.846 157.855 131.904 1.00 26.69  ? 103 LYS A O   1 
ATOM   778   C CB  . LYS A  1  103 ? 142.875 155.713 131.045 1.00 26.69  ? 103 LYS A CB  1 
ATOM   779   C CG  . LYS A  1  103 ? 142.215 154.575 130.294 1.00 26.69  ? 103 LYS A CG  1 
ATOM   780   C CD  . LYS A  1  103 ? 141.593 153.567 131.250 1.00 26.69  ? 103 LYS A CD  1 
ATOM   781   C CE  . LYS A  1  103 ? 140.138 153.889 131.551 1.00 26.69  ? 103 LYS A CE  1 
ATOM   782   N NZ  . LYS A  1  103 ? 139.992 155.097 132.408 1.00 26.69  ? 103 LYS A NZ  1 
ATOM   783   N N   . SER A  1  104 ? 143.414 159.043 130.633 1.00 17.74  ? 104 SER A N   1 
ATOM   784   C CA  . SER A  1  104 ? 143.653 160.289 131.343 1.00 17.74  ? 104 SER A CA  1 
ATOM   785   C C   . SER A  1  104 ? 142.364 161.085 131.422 1.00 17.74  ? 104 SER A C   1 
ATOM   786   O O   . SER A  1  104 ? 141.531 161.035 130.515 1.00 17.74  ? 104 SER A O   1 
ATOM   787   C CB  . SER A  1  104 ? 144.733 161.127 130.662 1.00 17.74  ? 104 SER A CB  1 
ATOM   788   O OG  . SER A  1  104 ? 145.985 160.471 130.701 1.00 17.74  ? 104 SER A OG  1 
ATOM   789   N N   . PHE A  1  105 ? 142.209 161.827 132.513 1.00 16.68  ? 105 PHE A N   1 
ATOM   790   C CA  . PHE A  1  105 ? 141.017 162.633 132.709 1.00 16.68  ? 105 PHE A CA  1 
ATOM   791   C C   . PHE A  1  105 ? 141.354 163.817 133.600 1.00 16.68  ? 105 PHE A C   1 
ATOM   792   O O   . PHE A  1  105 ? 142.454 163.921 134.143 1.00 16.68  ? 105 PHE A O   1 
ATOM   793   C CB  . PHE A  1  105 ? 139.881 161.804 133.304 1.00 16.68  ? 105 PHE A CB  1 
ATOM   794   C CG  . PHE A  1  105 ? 140.177 161.255 134.663 1.00 16.68  ? 105 PHE A CG  1 
ATOM   795   C CD1 . PHE A  1  105 ? 140.835 160.052 134.804 1.00 16.68  ? 105 PHE A CD1 1 
ATOM   796   C CD2 . PHE A  1  105 ? 139.767 161.921 135.797 1.00 16.68  ? 105 PHE A CD2 1 
ATOM   797   C CE1 . PHE A  1  105 ? 141.098 159.536 136.050 1.00 16.68  ? 105 PHE A CE1 1 
ATOM   798   C CE2 . PHE A  1  105 ? 140.027 161.408 137.045 1.00 16.68  ? 105 PHE A CE2 1 
ATOM   799   C CZ  . PHE A  1  105 ? 140.693 160.215 137.172 1.00 16.68  ? 105 PHE A CZ  1 
ATOM   800   N N   . VAL A  1  106 ? 140.387 164.718 133.735 1.00 13.64  ? 106 VAL A N   1 
ATOM   801   C CA  . VAL A  1  106 ? 140.524 165.923 134.540 1.00 13.64  ? 106 VAL A CA  1 
ATOM   802   C C   . VAL A  1  106 ? 139.494 165.861 135.654 1.00 13.64  ? 106 VAL A C   1 
ATOM   803   O O   . VAL A  1  106 ? 138.300 165.690 135.387 1.00 13.64  ? 106 VAL A O   1 
ATOM   804   C CB  . VAL A  1  106 ? 140.331 167.187 133.690 1.00 13.64  ? 106 VAL A CB  1 
ATOM   805   C CG1 . VAL A  1  106 ? 140.382 168.412 134.559 1.00 13.64  ? 106 VAL A CG1 1 
ATOM   806   C CG2 . VAL A  1  106 ? 141.380 167.251 132.612 1.00 13.64  ? 106 VAL A CG2 1 
ATOM   807   N N   . HIS A  1  107 ? 139.950 166.000 136.894 1.00 15.51  ? 107 HIS A N   1 
ATOM   808   C CA  . HIS A  1  107 ? 139.059 165.825 138.031 1.00 15.51  ? 107 HIS A CA  1 
ATOM   809   C C   . HIS A  1  107 ? 137.923 166.838 137.999 1.00 15.51  ? 107 HIS A C   1 
ATOM   810   O O   . HIS A  1  107 ? 138.111 168.001 137.638 1.00 15.51  ? 107 HIS A O   1 
ATOM   811   C CB  . HIS A  1  107 ? 139.844 165.944 139.332 1.00 15.51  ? 107 HIS A CB  1 
ATOM   812   C CG  . HIS A  1  107 ? 140.817 164.829 139.547 1.00 15.51  ? 107 HIS A CG  1 
ATOM   813   N ND1 . HIS A  1  107 ? 140.426 163.571 139.947 1.00 15.51  ? 107 HIS A ND1 1 
ATOM   814   C CD2 . HIS A  1  107 ? 142.161 164.779 139.410 1.00 15.51  ? 107 HIS A CD2 1 
ATOM   815   C CE1 . HIS A  1  107 ? 141.488 162.795 140.054 1.00 15.51  ? 107 HIS A CE1 1 
ATOM   816   N NE2 . HIS A  1  107 ? 142.554 163.504 139.733 1.00 15.51  ? 107 HIS A NE2 1 
ATOM   817   N N   . GLY A  1  108 ? 136.733 166.378 138.373 1.00 17.13  ? 108 GLY A N   1 
ATOM   818   C CA  . GLY A  1  108 ? 135.525 167.175 138.319 1.00 17.13  ? 108 GLY A CA  1 
ATOM   819   C C   . GLY A  1  108 ? 134.790 167.277 139.641 1.00 17.13  ? 108 GLY A C   1 
ATOM   820   O O   . GLY A  1  108 ? 133.567 167.121 139.673 1.00 17.13  ? 108 GLY A O   1 
ATOM   821   N N   . VAL A  1  109 ? 135.522 167.511 140.736 1.00 25.81  ? 109 VAL A N   1 
ATOM   822   C CA  . VAL A  1  109 ? 134.948 167.400 142.080 1.00 25.81  ? 109 VAL A CA  1 
ATOM   823   C C   . VAL A  1  109 ? 133.692 168.249 142.203 1.00 25.81  ? 109 VAL A C   1 
ATOM   824   O O   . VAL A  1  109 ? 132.586 167.732 142.388 1.00 25.81  ? 109 VAL A O   1 
ATOM   825   C CB  . VAL A  1  109 ? 135.981 167.804 143.143 1.00 25.81  ? 109 VAL A CB  1 
ATOM   826   C CG1 . VAL A  1  109 ? 135.340 167.773 144.513 1.00 25.81  ? 109 VAL A CG1 1 
ATOM   827   C CG2 . VAL A  1  109 ? 137.191 166.888 143.089 1.00 25.81  ? 109 VAL A CG2 1 
ATOM   828   N N   . THR A  1  110 ? 133.842 169.562 142.098 1.00 21.45  ? 110 THR A N   1 
ATOM   829   C CA  . THR A  1  110 ? 132.698 170.461 142.089 1.00 21.45  ? 110 THR A CA  1 
ATOM   830   C C   . THR A  1  110 ? 132.614 171.305 140.833 1.00 21.45  ? 110 THR A C   1 
ATOM   831   O O   . THR A  1  110 ? 131.508 171.614 140.387 1.00 21.45  ? 110 THR A O   1 
ATOM   832   C CB  . THR A  1  110 ? 132.723 171.389 143.309 1.00 21.45  ? 110 THR A CB  1 
ATOM   833   O OG1 . THR A  1  110 ? 133.902 172.195 143.269 1.00 21.45  ? 110 THR A OG1 1 
ATOM   834   C CG2 . THR A  1  110 ? 132.720 170.582 144.585 1.00 21.45  ? 110 THR A CG2 1 
ATOM   835   N N   . VAL A  1  111 ? 133.750 171.690 140.258 1.00 21.24  ? 111 VAL A N   1 
ATOM   836   C CA  . VAL A  1  111 ? 133.821 172.263 138.922 1.00 21.24  ? 111 VAL A CA  1 
ATOM   837   C C   . VAL A  1  111 ? 135.046 171.667 138.252 1.00 21.24  ? 111 VAL A C   1 
ATOM   838   O O   . VAL A  1  111 ? 135.925 171.109 138.911 1.00 21.24  ? 111 VAL A O   1 
ATOM   839   C CB  . VAL A  1  111 ? 133.920 173.799 138.936 1.00 21.24  ? 111 VAL A CB  1 
ATOM   840   C CG1 . VAL A  1  111 ? 132.681 174.416 139.559 1.00 21.24  ? 111 VAL A CG1 1 
ATOM   841   C CG2 . VAL A  1  111 ? 135.155 174.214 139.689 1.00 21.24  ? 111 VAL A CG2 1 
ATOM   842   N N   . LYS A  1  112 ? 135.104 171.778 136.928 1.00 16.03  ? 112 LYS A N   1 
ATOM   843   C CA  . LYS A  1  112 ? 136.294 171.314 136.229 1.00 16.03  ? 112 LYS A CA  1 
ATOM   844   C C   . LYS A  1  112 ? 137.504 172.080 136.731 1.00 16.03  ? 112 LYS A C   1 
ATOM   845   O O   . LYS A  1  112 ? 137.576 173.304 136.597 1.00 16.03  ? 112 LYS A O   1 
ATOM   846   C CB  . LYS A  1  112 ? 136.147 171.478 134.721 1.00 16.03  ? 112 LYS A CB  1 
ATOM   847   C CG  . LYS A  1  112 ? 135.230 170.469 134.078 1.00 16.03  ? 112 LYS A CG  1 
ATOM   848   C CD  . LYS A  1  112 ? 135.169 170.666 132.576 1.00 16.03  ? 112 LYS A CD  1 
ATOM   849   C CE  . LYS A  1  112 ? 136.192 169.789 131.873 1.00 16.03  ? 112 LYS A CE  1 
ATOM   850   N NZ  . LYS A  1  112 ? 137.588 170.234 132.119 1.00 16.03  ? 112 LYS A NZ  1 
ATOM   851   N N   . ASN A  1  113 ? 138.453 171.358 137.315 1.00 28.42  ? 113 ASN A N   1 
ATOM   852   C CA  . ASN A  1  113 ? 139.566 171.987 138.014 1.00 28.42  ? 113 ASN A CA  1 
ATOM   853   C C   . ASN A  1  113 ? 140.513 172.604 137.001 1.00 28.42  ? 113 ASN A C   1 
ATOM   854   O O   . ASN A  1  113 ? 141.369 171.922 136.439 1.00 28.42  ? 113 ASN A O   1 
ATOM   855   C CB  . ASN A  1  113 ? 140.293 170.966 138.879 1.00 28.42  ? 113 ASN A CB  1 
ATOM   856   C CG  . ASN A  1  113 ? 139.408 170.378 139.940 1.00 28.42  ? 113 ASN A CG  1 
ATOM   857   O OD1 . ASN A  1  113 ? 139.156 169.176 139.962 1.00 28.42  ? 113 ASN A OD1 1 
ATOM   858   N ND2 . ASN A  1  113 ? 138.915 171.224 140.823 1.00 28.42  ? 113 ASN A ND2 1 
ATOM   859   N N   . ARG A  1  114 ? 140.361 173.901 136.756 1.00 25.67  ? 114 ARG A N   1 
ATOM   860   C CA  . ARG A  1  114 ? 141.397 174.644 136.059 1.00 25.67  ? 114 ARG A CA  1 
ATOM   861   C C   . ARG A  1  114 ? 141.275 176.109 136.435 1.00 25.67  ? 114 ARG A C   1 
ATOM   862   O O   . ARG A  1  114 ? 140.198 176.577 136.807 1.00 25.67  ? 114 ARG A O   1 
ATOM   863   C CB  . ARG A  1  114 ? 141.331 174.470 134.538 1.00 25.67  ? 114 ARG A CB  1 
ATOM   864   C CG  . ARG A  1  114 ? 140.208 175.174 133.821 1.00 25.67  ? 114 ARG A CG  1 
ATOM   865   C CD  . ARG A  1  114 ? 139.054 174.235 133.609 1.00 25.67  ? 114 ARG A CD  1 
ATOM   866   N NE  . ARG A  1  114 ? 138.097 174.748 132.639 1.00 25.67  ? 114 ARG A NE  1 
ATOM   867   C CZ  . ARG A  1  114 ? 138.086 174.390 131.362 1.00 25.67  ? 114 ARG A CZ  1 
ATOM   868   N NH1 . ARG A  1  114 ? 138.983 173.526 130.911 1.00 25.67  ? 114 ARG A NH1 1 
ATOM   869   N NH2 . ARG A  1  114 ? 137.182 174.889 130.535 1.00 25.67  ? 114 ARG A NH2 1 
ATOM   870   N N   . MET A  1  115 ? 142.393 176.819 136.350 1.00 24.26  ? 115 MET A N   1 
ATOM   871   C CA  . MET A  1  115 ? 142.434 178.237 136.659 1.00 24.26  ? 115 MET A CA  1 
ATOM   872   C C   . MET A  1  115 ? 142.784 179.017 135.403 1.00 24.26  ? 115 MET A C   1 
ATOM   873   O O   . MET A  1  115 ? 143.372 178.485 134.461 1.00 24.26  ? 115 MET A O   1 
ATOM   874   C CB  . MET A  1  115 ? 143.470 178.564 137.738 1.00 24.26  ? 115 MET A CB  1 
ATOM   875   C CG  . MET A  1  115 ? 144.900 178.488 137.236 1.00 24.26  ? 115 MET A CG  1 
ATOM   876   S SD  . MET A  1  115 ? 146.152 178.858 138.479 1.00 24.26  ? 115 MET A SD  1 
ATOM   877   C CE  . MET A  1  115 ? 146.179 177.335 139.414 1.00 24.26  ? 115 MET A CE  1 
ATOM   878   N N   . ILE A  1  116 ? 142.415 180.290 135.403 1.00 23.16  ? 116 ILE A N   1 
ATOM   879   C CA  . ILE A  1  116 ? 142.879 181.248 134.411 1.00 23.16  ? 116 ILE A CA  1 
ATOM   880   C C   . ILE A  1  116 ? 143.351 182.481 135.159 1.00 23.16  ? 116 ILE A C   1 
ATOM   881   O O   . ILE A  1  116 ? 142.601 183.046 135.961 1.00 23.16  ? 116 ILE A O   1 
ATOM   882   C CB  . ILE A  1  116 ? 141.781 181.627 133.406 1.00 23.16  ? 116 ILE A CB  1 
ATOM   883   C CG1 . ILE A  1  116 ? 141.278 180.397 132.668 1.00 23.16  ? 116 ILE A CG1 1 
ATOM   884   C CG2 . ILE A  1  116 ? 142.326 182.604 132.399 1.00 23.16  ? 116 ILE A CG2 1 
ATOM   885   C CD1 . ILE A  1  116 ? 142.303 179.791 131.778 1.00 23.16  ? 116 ILE A CD1 1 
ATOM   886   N N   . ARG A  1  117 ? 144.586 182.895 134.911 1.00 21.00  ? 117 ARG A N   1 
ATOM   887   C CA  . ARG A  1  117 ? 145.170 184.031 135.614 1.00 21.00  ? 117 ARG A CA  1 
ATOM   888   C C   . ARG A  1  117 ? 145.758 184.974 134.580 1.00 21.00  ? 117 ARG A C   1 
ATOM   889   O O   . ARG A  1  117 ? 146.737 184.628 133.914 1.00 21.00  ? 117 ARG A O   1 
ATOM   890   C CB  . ARG A  1  117 ? 146.243 183.577 136.598 1.00 21.00  ? 117 ARG A CB  1 
ATOM   891   C CG  . ARG A  1  117 ? 146.727 184.670 137.521 1.00 21.00  ? 117 ARG A CG  1 
ATOM   892   C CD  . ARG A  1  117 ? 147.821 184.158 138.429 1.00 21.00  ? 117 ARG A CD  1 
ATOM   893   N NE  . ARG A  1  117 ? 147.363 183.048 139.253 1.00 21.00  ? 117 ARG A NE  1 
ATOM   894   C CZ  . ARG A  1  117 ? 146.693 183.192 140.387 1.00 21.00  ? 117 ARG A CZ  1 
ATOM   895   N NH1 . ARG A  1  117 ? 146.401 184.405 140.830 1.00 21.00  ? 117 ARG A NH1 1 
ATOM   896   N NH2 . ARG A  1  117 ? 146.318 182.127 141.076 1.00 21.00  ? 117 ARG A NH2 1 
ATOM   897   N N   . LEU A  1  118 ? 145.173 186.156 134.443 1.00 24.47  ? 118 LEU A N   1 
ATOM   898   C CA  . LEU A  1  118 ? 145.706 187.147 133.521 1.00 24.47  ? 118 LEU A CA  1 
ATOM   899   C C   . LEU A  1  118 ? 146.803 187.938 134.229 1.00 24.47  ? 118 LEU A C   1 
ATOM   900   O O   . LEU A  1  118 ? 147.223 187.600 135.338 1.00 24.47  ? 118 LEU A O   1 
ATOM   901   C CB  . LEU A  1  118 ? 144.584 188.028 132.989 1.00 24.47  ? 118 LEU A CB  1 
ATOM   902   C CG  . LEU A  1  118 ? 143.578 187.255 132.140 1.00 24.47  ? 118 LEU A CG  1 
ATOM   903   C CD1 . LEU A  1  118 ? 142.440 188.146 131.689 1.00 24.47  ? 118 LEU A CD1 1 
ATOM   904   C CD2 . LEU A  1  118 ? 144.276 186.637 130.954 1.00 24.47  ? 118 LEU A CD2 1 
ATOM   905   N N   . HIS A  1  119 ? 147.290 188.995 133.590 1.00 29.22  ? 119 HIS A N   1 
ATOM   906   C CA  . HIS A  1  119 ? 148.364 189.814 134.135 1.00 29.22  ? 119 HIS A CA  1 
ATOM   907   C C   . HIS A  1  119 ? 148.327 191.176 133.462 1.00 29.22  ? 119 HIS A C   1 
ATOM   908   O O   . HIS A  1  119 ? 147.735 191.324 132.388 1.00 29.22  ? 119 HIS A O   1 
ATOM   909   C CB  . HIS A  1  119 ? 149.733 189.147 133.936 1.00 29.22  ? 119 HIS A CB  1 
ATOM   910   C CG  . HIS A  1  119 ? 150.046 188.109 134.962 1.00 29.22  ? 119 HIS A CG  1 
ATOM   911   N ND1 . HIS A  1  119 ? 149.687 186.788 134.825 1.00 29.22  ? 119 HIS A ND1 1 
ATOM   912   C CD2 . HIS A  1  119 ? 150.680 188.206 136.152 1.00 29.22  ? 119 HIS A CD2 1 
ATOM   913   C CE1 . HIS A  1  119 ? 150.091 186.113 135.886 1.00 29.22  ? 119 HIS A CE1 1 
ATOM   914   N NE2 . HIS A  1  119 ? 150.697 186.951 136.707 1.00 29.22  ? 119 HIS A NE2 1 
ATOM   915   N N   . PRO A  1  120 ? 148.943 192.193 134.070 1.00 36.41  ? 120 PRO A N   1 
ATOM   916   C CA  . PRO A  1  120 ? 148.944 193.516 133.432 1.00 36.41  ? 120 PRO A CA  1 
ATOM   917   C C   . PRO A  1  120 ? 149.717 193.555 132.127 1.00 36.41  ? 120 PRO A C   1 
ATOM   918   O O   . PRO A  1  120 ? 149.387 194.366 131.255 1.00 36.41  ? 120 PRO A O   1 
ATOM   919   C CB  . PRO A  1  120 ? 149.583 194.416 134.496 1.00 36.41  ? 120 PRO A CB  1 
ATOM   920   C CG  . PRO A  1  120 ? 150.406 193.499 135.319 1.00 36.41  ? 120 PRO A CG  1 
ATOM   921   C CD  . PRO A  1  120 ? 149.656 192.206 135.357 1.00 36.41  ? 120 PRO A CD  1 
ATOM   922   N N   . ASP A  1  121 ? 150.735 192.717 131.961 1.00 35.40  ? 121 ASP A N   1 
ATOM   923   C CA  . ASP A  1  121 ? 151.498 192.696 130.721 1.00 35.40  ? 121 ASP A CA  1 
ATOM   924   C C   . ASP A  1  121 ? 151.014 191.637 129.740 1.00 35.40  ? 121 ASP A C   1 
ATOM   925   O O   . ASP A  1  121 ? 151.639 191.455 128.691 1.00 35.40  ? 121 ASP A O   1 
ATOM   926   C CB  . ASP A  1  121 ? 152.989 192.494 131.016 1.00 35.40  ? 121 ASP A CB  1 
ATOM   927   C CG  . ASP A  1  121 ? 153.278 191.191 131.732 1.00 35.40  ? 121 ASP A CG  1 
ATOM   928   O OD1 . ASP A  1  121 ? 152.322 190.465 132.068 1.00 35.40  ? 121 ASP A OD1 1 
ATOM   929   O OD2 . ASP A  1  121 ? 154.467 190.889 131.961 1.00 35.40  ? 121 ASP A OD2 1 
ATOM   930   N N   . GLY A  1  122 ? 149.927 190.939 130.051 1.00 29.31  ? 122 GLY A N   1 
ATOM   931   C CA  . GLY A  1  122 ? 149.374 189.957 129.142 1.00 29.31  ? 122 GLY A CA  1 
ATOM   932   C C   . GLY A  1  122 ? 149.903 188.552 129.296 1.00 29.31  ? 122 GLY A C   1 
ATOM   933   O O   . GLY A  1  122 ? 149.752 187.747 128.372 1.00 29.31  ? 122 GLY A O   1 
ATOM   934   N N   . THR A  1  123 ? 150.518 188.227 130.427 1.00 24.06  ? 123 THR A N   1 
ATOM   935   C CA  . THR A  1  123 ? 151.073 186.895 130.652 1.00 24.06  ? 123 THR A CA  1 
ATOM   936   C C   . THR A  1  123 ? 149.973 186.006 131.217 1.00 24.06  ? 123 THR A C   1 
ATOM   937   O O   . THR A  1  123 ? 149.679 186.047 132.411 1.00 24.06  ? 123 THR A O   1 
ATOM   938   C CB  . THR A  1  123 ? 152.271 186.965 131.590 1.00 24.06  ? 123 THR A CB  1 
ATOM   939   O OG1 . THR A  1  123 ? 153.293 187.778 131.002 1.00 24.06  ? 123 THR A OG1 1 
ATOM   940   C CG2 . THR A  1  123 ? 152.827 185.580 131.847 1.00 24.06  ? 123 THR A CG2 1 
ATOM   941   N N   . VAL A  1  124 ? 149.362 185.198 130.353 1.00 24.67  ? 124 VAL A N   1 
ATOM   942   C CA  . VAL A  1  124 ? 148.317 184.281 130.788 1.00 24.67  ? 124 VAL A CA  1 
ATOM   943   C C   . VAL A  1  124 ? 148.949 183.120 131.547 1.00 24.67  ? 124 VAL A C   1 
ATOM   944   O O   . VAL A  1  124 ? 150.128 182.798 131.364 1.00 24.67  ? 124 VAL A O   1 
ATOM   945   C CB  . VAL A  1  124 ? 147.512 183.801 129.567 1.00 24.67  ? 124 VAL A CB  1 
ATOM   946   C CG1 . VAL A  1  124 ? 146.433 182.817 129.960 1.00 24.67  ? 124 VAL A CG1 1 
ATOM   947   C CG2 . VAL A  1  124 ? 146.899 184.983 128.861 1.00 24.67  ? 124 VAL A CG2 1 
ATOM   948   N N   . LEU A  1  125 ? 148.175 182.501 132.436 1.00 20.45  ? 125 LEU A N   1 
ATOM   949   C CA  . LEU A  1  125 ? 148.652 181.359 133.205 1.00 20.45  ? 125 LEU A CA  1 
ATOM   950   C C   . LEU A  1  125 ? 147.531 180.336 133.287 1.00 20.45  ? 125 LEU A C   1 
ATOM   951   O O   . LEU A  1  125 ? 146.486 180.608 133.882 1.00 20.45  ? 125 LEU A O   1 
ATOM   952   C CB  . LEU A  1  125 ? 149.103 181.794 134.600 1.00 20.45  ? 125 LEU A CB  1 
ATOM   953   C CG  . LEU A  1  125 ? 149.942 180.813 135.419 1.00 20.45  ? 125 LEU A CG  1 
ATOM   954   C CD1 . LEU A  1  125 ? 150.850 181.586 136.357 1.00 20.45  ? 125 LEU A CD1 1 
ATOM   955   C CD2 . LEU A  1  125 ? 149.081 179.842 136.200 1.00 20.45  ? 125 LEU A CD2 1 
ATOM   956   N N   . TYR A  1  126 ? 147.754 179.161 132.706 1.00 43.48  ? 126 TYR A N   1 
ATOM   957   C CA  . TYR A  1  126 ? 146.732 178.134 132.541 1.00 43.48  ? 126 TYR A CA  1 
ATOM   958   C C   . TYR A  1  126 ? 147.159 176.900 133.317 1.00 43.48  ? 126 TYR A C   1 
ATOM   959   O O   . TYR A  1  126 ? 148.244 176.364 133.079 1.00 43.48  ? 126 TYR A O   1 
ATOM   960   C CB  . TYR A  1  126 ? 146.559 177.802 131.060 1.00 43.48  ? 126 TYR A CB  1 
ATOM   961   C CG  . TYR A  1  126 ? 145.481 176.803 130.726 1.00 43.48  ? 126 TYR A CG  1 
ATOM   962   C CD1 . TYR A  1  126 ? 144.157 177.181 130.680 1.00 43.48  ? 126 TYR A CD1 1 
ATOM   963   C CD2 . TYR A  1  126 ? 145.794 175.490 130.427 1.00 43.48  ? 126 TYR A CD2 1 
ATOM   964   C CE1 . TYR A  1  126 ? 143.173 176.284 130.363 1.00 43.48  ? 126 TYR A CE1 1 
ATOM   965   C CE2 . TYR A  1  126 ? 144.816 174.582 130.107 1.00 43.48  ? 126 TYR A CE2 1 
ATOM   966   C CZ  . TYR A  1  126 ? 143.506 174.986 130.077 1.00 43.48  ? 126 TYR A CZ  1 
ATOM   967   O OH  . TYR A  1  126 ? 142.522 174.084 129.760 1.00 43.48  ? 126 TYR A OH  1 
ATOM   968   N N   . GLY A  1  127 ? 146.317 176.449 134.233 1.00 31.72  ? 127 GLY A N   1 
ATOM   969   C CA  . GLY A  1  127 ? 146.639 175.300 135.054 1.00 31.72  ? 127 GLY A CA  1 
ATOM   970   C C   . GLY A  1  127 ? 145.541 174.260 135.015 1.00 31.72  ? 127 GLY A C   1 
ATOM   971   O O   . GLY A  1  127 ? 144.363 174.576 134.883 1.00 31.72  ? 127 GLY A O   1 
ATOM   972   N N   . LEU A  1  128 ? 145.949 173.002 135.138 1.00 43.48  ? 128 LEU A N   1 
ATOM   973   C CA  . LEU A  1  128 ? 145.038 171.867 135.161 1.00 43.48  ? 128 LEU A CA  1 
ATOM   974   C C   . LEU A  1  128 ? 145.348 170.996 136.369 1.00 43.48  ? 128 LEU A C   1 
ATOM   975   O O   . LEU A  1  128 ? 146.243 171.294 137.162 1.00 43.48  ? 128 LEU A O   1 
ATOM   976   C CB  . LEU A  1  128 ? 145.136 171.045 133.873 1.00 43.48  ? 128 LEU A CB  1 
ATOM   977   C CG  . LEU A  1  128 ? 144.542 171.657 132.614 1.00 43.48  ? 128 LEU A CG  1 
ATOM   978   C CD1 . LEU A  1  128 ? 144.898 170.815 131.417 1.00 43.48  ? 128 LEU A CD1 1 
ATOM   979   C CD2 . LEU A  1  128 ? 143.044 171.739 132.758 1.00 43.48  ? 128 LEU A CD2 1 
ATOM   980   N N   . ARG A  1  129 ? 144.582 169.917 136.523 1.00 43.48  ? 129 ARG A N   1 
ATOM   981   C CA  . ARG A  1  129 ? 144.848 168.910 137.549 1.00 43.48  ? 129 ARG A CA  1 
ATOM   982   C C   . ARG A  1  129 ? 144.540 167.548 136.941 1.00 43.48  ? 129 ARG A C   1 
ATOM   983   O O   . ARG A  1  129 ? 143.375 167.157 136.842 1.00 43.48  ? 129 ARG A O   1 
ATOM   984   C CB  . ARG A  1  129 ? 144.028 169.162 138.802 1.00 43.48  ? 129 ARG A CB  1 
ATOM   985   C CG  . ARG A  1  129 ? 144.352 168.216 139.925 1.00 43.48  ? 129 ARG A CG  1 
ATOM   986   C CD  . ARG A  1  129 ? 143.639 168.626 141.192 1.00 43.48  ? 129 ARG A CD  1 
ATOM   987   N NE  . ARG A  1  129 ? 144.043 167.790 142.311 1.00 43.48  ? 129 ARG A NE  1 
ATOM   988   C CZ  . ARG A  1  129 ? 143.411 166.686 142.679 1.00 43.48  ? 129 ARG A CZ  1 
ATOM   989   N NH1 . ARG A  1  129 ? 142.329 166.295 142.027 1.00 43.48  ? 129 ARG A NH1 1 
ATOM   990   N NH2 . ARG A  1  129 ? 143.856 165.981 143.707 1.00 43.48  ? 129 ARG A NH2 1 
ATOM   991   N N   . ILE A  1  130 ? 145.584 166.823 136.561 1.00 26.47  ? 130 ILE A N   1 
ATOM   992   C CA  . ILE A  1  130 ? 145.475 165.674 135.673 1.00 26.47  ? 130 ILE A CA  1 
ATOM   993   C C   . ILE A  1  130 ? 145.839 164.395 136.409 1.00 26.47  ? 130 ILE A C   1 
ATOM   994   O O   . ILE A  1  130 ? 146.672 164.393 137.320 1.00 26.47  ? 130 ILE A O   1 
ATOM   995   C CB  . ILE A  1  130 ? 146.379 165.886 134.444 1.00 26.47  ? 130 ILE A CB  1 
ATOM   996   C CG1 . ILE A  1  130 ? 145.815 166.997 133.567 1.00 26.47  ? 130 ILE A CG1 1 
ATOM   997   C CG2 . ILE A  1  130 ? 146.555 164.619 133.660 1.00 26.47  ? 130 ILE A CG2 1 
ATOM   998   C CD1 . ILE A  1  130 ? 146.733 167.399 132.452 1.00 26.47  ? 130 ILE A CD1 1 
ATOM   999   N N   . THR A  1  131 ? 145.201 163.298 136.011 1.00 13.29  ? 131 THR A N   1 
ATOM   1000  C CA  . THR A  1  131 ? 145.557 161.956 136.455 1.00 13.29  ? 131 THR A CA  1 
ATOM   1001  C C   . THR A  1  131 ? 145.871 161.120 135.222 1.00 13.29  ? 131 THR A C   1 
ATOM   1002  O O   . THR A  1  131 ? 144.964 160.747 134.473 1.00 13.29  ? 131 THR A O   1 
ATOM   1003  C CB  . THR A  1  131 ? 144.430 161.326 137.266 1.00 13.29  ? 131 THR A CB  1 
ATOM   1004  O OG1 . THR A  1  131 ? 144.213 162.093 138.456 1.00 13.29  ? 131 THR A OG1 1 
ATOM   1005  C CG2 . THR A  1  131 ? 144.779 159.899 137.636 1.00 13.29  ? 131 THR A CG2 1 
ATOM   1006  N N   . THR A  1  132 ? 147.147 160.818 135.018 1.00 19.97  ? 132 THR A N   1 
ATOM   1007  C CA  . THR A  1  132 ? 147.613 160.105 133.838 1.00 19.97  ? 132 THR A CA  1 
ATOM   1008  C C   . THR A  1  132 ? 148.028 158.694 134.220 1.00 19.97  ? 132 THR A C   1 
ATOM   1009  O O   . THR A  1  132 ? 148.817 158.507 135.150 1.00 19.97  ? 132 THR A O   1 
ATOM   1010  C CB  . THR A  1  132 ? 148.794 160.831 133.193 1.00 19.97  ? 132 THR A CB  1 
ATOM   1011  O OG1 . THR A  1  132 ? 148.379 162.124 132.747 1.00 19.97  ? 132 THR A OG1 1 
ATOM   1012  C CG2 . THR A  1  132 ? 149.322 160.046 132.016 1.00 19.97  ? 132 THR A CG2 1 
ATOM   1013  N N   . THR A  1  133 ? 147.489 157.707 133.512 1.00 21.35  ? 133 THR A N   1 
ATOM   1014  C CA  . THR A  1  133 ? 147.942 156.327 133.646 1.00 21.35  ? 133 THR A CA  1 
ATOM   1015  C C   . THR A  1  133 ? 148.923 156.022 132.516 1.00 21.35  ? 133 THR A C   1 
ATOM   1016  O O   . THR A  1  133 ? 148.651 155.266 131.586 1.00 21.35  ? 133 THR A O   1 
ATOM   1017  C CB  . THR A  1  133 ? 146.750 155.375 133.646 1.00 21.35  ? 133 THR A CB  1 
ATOM   1018  O OG1 . THR A  1  133 ? 145.844 155.758 134.686 1.00 21.35  ? 133 THR A OG1 1 
ATOM   1019  C CG2 . THR A  1  133 ? 147.201 153.946 133.908 1.00 21.35  ? 133 THR A CG2 1 
ATOM   1020  N N   . ALA A  1  134 ? 150.085 156.656 132.607 1.00 24.19  ? 134 ALA A N   1 
ATOM   1021  C CA  . ALA A  1  134 ? 151.085 156.532 131.560 1.00 24.19  ? 134 ALA A CA  1 
ATOM   1022  C C   . ALA A  1  134 ? 151.670 155.127 131.534 1.00 24.19  ? 134 ALA A C   1 
ATOM   1023  O O   . ALA A  1  134 ? 151.558 154.360 132.491 1.00 24.19  ? 134 ALA A O   1 
ATOM   1024  C CB  . ALA A  1  134 ? 152.202 157.555 131.757 1.00 24.19  ? 134 ALA A CB  1 
ATOM   1025  N N   . ALA A  1  135 ? 152.307 154.796 130.417 1.00 35.44  ? 135 ALA A N   1 
ATOM   1026  C CA  . ALA A  1  135 ? 152.887 153.480 130.197 1.00 35.44  ? 135 ALA A CA  1 
ATOM   1027  C C   . ALA A  1  135 ? 154.383 153.612 129.968 1.00 35.44  ? 135 ALA A C   1 
ATOM   1028  O O   . ALA A  1  135 ? 154.816 154.370 129.097 1.00 35.44  ? 135 ALA A O   1 
ATOM   1029  C CB  . ALA A  1  135 ? 152.232 152.786 129.004 1.00 35.44  ? 135 ALA A CB  1 
ATOM   1030  N N   . CYS A  1  136 ? 155.165 152.872 130.747 1.00 48.53  ? 136 CYS A N   1 
ATOM   1031  C CA  . CYS A  1  136 ? 156.614 152.848 130.621 1.00 48.53  ? 136 CYS A CA  1 
ATOM   1032  C C   . CYS A  1  136 ? 157.072 151.413 130.425 1.00 48.53  ? 136 CYS A C   1 
ATOM   1033  O O   . CYS A  1  136 ? 156.465 150.482 130.961 1.00 48.53  ? 136 CYS A O   1 
ATOM   1034  C CB  . CYS A  1  136 ? 157.298 153.446 131.855 1.00 48.53  ? 136 CYS A CB  1 
ATOM   1035  S SG  . CYS A  1  136 ? 157.040 152.520 133.391 1.00 48.53  ? 136 CYS A SG  1 
ATOM   1036  N N   . MET A  1  137 ? 158.137 151.235 129.650 1.00 55.30  ? 137 MET A N   1 
ATOM   1037  C CA  . MET A  1  137 ? 158.672 149.905 129.404 1.00 55.30  ? 137 MET A CA  1 
ATOM   1038  C C   . MET A  1  137 ? 159.611 149.487 130.524 1.00 55.30  ? 137 MET A C   1 
ATOM   1039  O O   . MET A  1  137 ? 160.491 150.251 130.931 1.00 55.30  ? 137 MET A O   1 
ATOM   1040  C CB  . MET A  1  137 ? 159.392 149.854 128.061 1.00 55.30  ? 137 MET A CB  1 
ATOM   1041  C CG  . MET A  1  137 ? 158.436 149.889 126.909 1.00 55.30  ? 137 MET A CG  1 
ATOM   1042  S SD  . MET A  1  137 ? 157.289 148.527 127.138 1.00 55.30  ? 137 MET A SD  1 
ATOM   1043  C CE  . MET A  1  137 ? 158.389 147.135 126.909 1.00 55.30  ? 137 MET A CE  1 
ATOM   1044  N N   . MET A  1  138 ? 159.424 148.264 131.011 1.00 53.06  ? 138 MET A N   1 
ATOM   1045  C CA  . MET A  1  138 ? 160.186 147.729 132.128 1.00 53.06  ? 138 MET A CA  1 
ATOM   1046  C C   . MET A  1  138 ? 160.965 146.512 131.658 1.00 53.06  ? 138 MET A C   1 
ATOM   1047  O O   . MET A  1  138 ? 160.374 145.540 131.177 1.00 53.06  ? 138 MET A O   1 
ATOM   1048  C CB  . MET A  1  138 ? 159.264 147.360 133.290 1.00 53.06  ? 138 MET A CB  1 
ATOM   1049  C CG  . MET A  1  138 ? 158.614 148.554 133.949 1.00 53.06  ? 138 MET A CG  1 
ATOM   1050  S SD  . MET A  1  138 ? 157.535 148.100 135.312 1.00 53.06  ? 138 MET A SD  1 
ATOM   1051  C CE  . MET A  1  138 ? 156.927 149.717 135.767 1.00 53.06  ? 138 MET A CE  1 
ATOM   1052  N N   . ASP A  1  139 ? 162.285 146.571 131.794 1.00 59.90  ? 139 ASP A N   1 
ATOM   1053  C CA  . ASP A  1  139 ? 163.147 145.430 131.527 1.00 59.90  ? 139 ASP A CA  1 
ATOM   1054  C C   . ASP A  1  139 ? 163.274 144.613 132.805 1.00 59.90  ? 139 ASP A C   1 
ATOM   1055  O O   . ASP A  1  139 ? 163.708 145.133 133.838 1.00 59.90  ? 139 ASP A O   1 
ATOM   1056  C CB  . ASP A  1  139 ? 164.519 145.889 131.041 1.00 59.90  ? 139 ASP A CB  1 
ATOM   1057  C CG  . ASP A  1  139 ? 165.369 144.745 130.533 1.00 59.90  ? 139 ASP A CG  1 
ATOM   1058  O OD1 . ASP A  1  139 ? 164.892 143.592 130.562 1.00 59.90  ? 139 ASP A OD1 1 
ATOM   1059  O OD2 . ASP A  1  139 ? 166.516 144.995 130.109 1.00 59.90  ? 139 ASP A OD2 1 
ATOM   1060  N N   . LEU A  1  140 ? 162.898 143.336 132.738 1.00 62.83  ? 140 LEU A N   1 
ATOM   1061  C CA  . LEU A  1  140 ? 162.928 142.468 133.909 1.00 62.83  ? 140 LEU A CA  1 
ATOM   1062  C C   . LEU A  1  140 ? 163.919 141.322 133.758 1.00 62.83  ? 140 LEU A C   1 
ATOM   1063  O O   . LEU A  1  140 ? 163.803 140.313 134.457 1.00 62.83  ? 140 LEU A O   1 
ATOM   1064  C CB  . LEU A  1  140 ? 161.530 141.932 134.213 1.00 62.83  ? 140 LEU A CB  1 
ATOM   1065  C CG  . LEU A  1  140 ? 160.557 143.011 134.680 1.00 62.83  ? 140 LEU A CG  1 
ATOM   1066  C CD1 . LEU A  1  140 ? 159.168 142.446 134.856 1.00 62.83  ? 140 LEU A CD1 1 
ATOM   1067  C CD2 . LEU A  1  140 ? 161.051 143.626 135.972 1.00 62.83  ? 140 LEU A CD2 1 
ATOM   1068  N N   . ARG A  1  141 ? 164.895 141.456 132.859 1.00 67.02  ? 141 ARG A N   1 
ATOM   1069  C CA  . ARG A  1  141 ? 165.957 140.459 132.776 1.00 67.02  ? 141 ARG A CA  1 
ATOM   1070  C C   . ARG A  1  141 ? 166.765 140.395 134.063 1.00 67.02  ? 141 ARG A C   1 
ATOM   1071  O O   . ARG A  1  141 ? 167.326 139.345 134.392 1.00 67.02  ? 141 ARG A O   1 
ATOM   1072  C CB  . ARG A  1  141 ? 166.871 140.764 131.591 1.00 67.02  ? 141 ARG A CB  1 
ATOM   1073  C CG  . ARG A  1  141 ? 166.175 140.706 130.248 1.00 67.02  ? 141 ARG A CG  1 
ATOM   1074  C CD  . ARG A  1  141 ? 165.812 139.281 129.884 1.00 67.02  ? 141 ARG A CD  1 
ATOM   1075  N NE  . ARG A  1  141 ? 165.100 139.212 128.613 1.00 67.02  ? 141 ARG A NE  1 
ATOM   1076  C CZ  . ARG A  1  141 ? 165.695 139.123 127.429 1.00 67.02  ? 141 ARG A CZ  1 
ATOM   1077  N NH1 . ARG A  1  141 ? 167.019 139.102 127.351 1.00 67.02  ? 141 ARG A NH1 1 
ATOM   1078  N NH2 . ARG A  1  141 ? 164.967 139.061 126.323 1.00 67.02  ? 141 ARG A NH2 1 
ATOM   1079  N N   . ARG A  1  142 ? 166.841 141.501 134.801 1.00 57.04  ? 142 ARG A N   1 
ATOM   1080  C CA  . ARG A  1  142 ? 167.607 141.577 136.037 1.00 57.04  ? 142 ARG A CA  1 
ATOM   1081  C C   . ARG A  1  142 ? 166.725 141.521 137.278 1.00 57.04  ? 142 ARG A C   1 
ATOM   1082  O O   . ARG A  1  142 ? 167.175 141.899 138.365 1.00 57.04  ? 142 ARG A O   1 
ATOM   1083  C CB  . ARG A  1  142 ? 168.451 142.850 136.047 1.00 57.04  ? 142 ARG A CB  1 
ATOM   1084  C CG  . ARG A  1  142 ? 169.539 142.878 134.992 1.00 57.04  ? 142 ARG A CG  1 
ATOM   1085  C CD  . ARG A  1  142 ? 170.226 144.234 134.949 1.00 57.04  ? 142 ARG A CD  1 
ATOM   1086  N NE  . ARG A  1  142 ? 170.960 144.533 136.173 1.00 57.04  ? 142 ARG A NE  1 
ATOM   1087  C CZ  . ARG A  1  142 ? 172.234 144.217 136.374 1.00 57.04  ? 142 ARG A CZ  1 
ATOM   1088  N NH1 . ARG A  1  142 ? 172.918 143.593 135.426 1.00 57.04  ? 142 ARG A NH1 1 
ATOM   1089  N NH2 . ARG A  1  142 ? 172.825 144.528 137.519 1.00 57.04  ? 142 ARG A NH2 1 
ATOM   1090  N N   . TYR A  1  143 ? 165.484 141.071 137.137 1.00 57.13  ? 143 TYR A N   1 
ATOM   1091  C CA  . TYR A  1  143 ? 164.582 140.981 138.276 1.00 57.13  ? 143 TYR A CA  1 
ATOM   1092  C C   . TYR A  1  143 ? 165.180 140.076 139.349 1.00 57.13  ? 143 TYR A C   1 
ATOM   1093  O O   . TYR A  1  143 ? 165.796 139.055 139.024 1.00 57.13  ? 143 TYR A O   1 
ATOM   1094  C CB  . TYR A  1  143 ? 163.232 140.420 137.828 1.00 57.13  ? 143 TYR A CB  1 
ATOM   1095  C CG  . TYR A  1  143 ? 162.171 140.377 138.901 1.00 57.13  ? 143 TYR A CG  1 
ATOM   1096  C CD1 . TYR A  1  143 ? 161.440 141.509 139.226 1.00 57.13  ? 143 TYR A CD1 1 
ATOM   1097  C CD2 . TYR A  1  143 ? 161.901 139.206 139.591 1.00 57.13  ? 143 TYR A CD2 1 
ATOM   1098  C CE1 . TYR A  1  143 ? 160.465 141.476 140.201 1.00 57.13  ? 143 TYR A CE1 1 
ATOM   1099  C CE2 . TYR A  1  143 ? 160.929 139.164 140.570 1.00 57.13  ? 143 TYR A CE2 1 
ATOM   1100  C CZ  . TYR A  1  143 ? 160.215 140.302 140.871 1.00 57.13  ? 143 TYR A CZ  1 
ATOM   1101  O OH  . TYR A  1  143 ? 159.247 140.269 141.845 1.00 57.13  ? 143 TYR A OH  1 
ATOM   1102  N N   . PRO A  1  144 ? 165.028 140.415 140.635 1.00 54.44  ? 144 PRO A N   1 
ATOM   1103  C CA  . PRO A  1  144 ? 164.439 141.650 141.150 1.00 54.44  ? 144 PRO A CA  1 
ATOM   1104  C C   . PRO A  1  144 ? 165.472 142.731 141.460 1.00 54.44  ? 144 PRO A C   1 
ATOM   1105  O O   . PRO A  1  144 ? 165.137 143.728 142.093 1.00 54.44  ? 144 PRO A O   1 
ATOM   1106  C CB  . PRO A  1  144 ? 163.762 141.191 142.438 1.00 54.44  ? 144 PRO A CB  1 
ATOM   1107  C CG  . PRO A  1  144 ? 164.625 140.096 142.911 1.00 54.44  ? 144 PRO A CG  1 
ATOM   1108  C CD  . PRO A  1  144 ? 165.123 139.387 141.685 1.00 54.44  ? 144 PRO A CD  1 
ATOM   1109  N N   . LEU A  1  145 ? 166.715 142.531 141.032 1.00 59.39  ? 145 LEU A N   1 
ATOM   1110  C CA  . LEU A  1  145 ? 167.780 143.502 141.274 1.00 59.39  ? 145 LEU A CA  1 
ATOM   1111  C C   . LEU A  1  145 ? 167.945 144.343 140.012 1.00 59.39  ? 145 LEU A C   1 
ATOM   1112  O O   . LEU A  1  145 ? 168.878 144.169 139.229 1.00 59.39  ? 145 LEU A O   1 
ATOM   1113  C CB  . LEU A  1  145 ? 169.074 142.798 141.665 1.00 59.39  ? 145 LEU A CB  1 
ATOM   1114  C CG  . LEU A  1  145 ? 169.192 142.313 143.111 1.00 59.39  ? 145 LEU A CG  1 
ATOM   1115  C CD1 . LEU A  1  145 ? 168.297 141.115 143.377 1.00 59.39  ? 145 LEU A CD1 1 
ATOM   1116  C CD2 . LEU A  1  145 ? 170.632 141.974 143.425 1.00 59.39  ? 145 LEU A CD2 1 
ATOM   1117  N N   . ASP A  1  146 ? 167.015 145.274 139.819 1.00 60.71  ? 146 ASP A N   1 
ATOM   1118  C CA  . ASP A  1  146 ? 166.948 146.049 138.591 1.00 60.71  ? 146 ASP A CA  1 
ATOM   1119  C C   . ASP A  1  146 ? 166.747 147.526 138.893 1.00 60.71  ? 146 ASP A C   1 
ATOM   1120  O O   . ASP A  1  146 ? 166.350 147.915 139.994 1.00 60.71  ? 146 ASP A O   1 
ATOM   1121  C CB  . ASP A  1  146 ? 165.822 145.549 137.676 1.00 60.71  ? 146 ASP A CB  1 
ATOM   1122  C CG  . ASP A  1  146 ? 164.461 145.604 138.343 1.00 60.71  ? 146 ASP A CG  1 
ATOM   1123  O OD1 . ASP A  1  146 ? 164.396 145.922 139.546 1.00 60.71  ? 146 ASP A OD1 1 
ATOM   1124  O OD2 . ASP A  1  146 ? 163.451 145.336 137.661 1.00 60.71  ? 146 ASP A OD2 1 
ATOM   1125  N N   . GLU A  1  147 ? 167.031 148.347 137.887 1.00 61.94  ? 147 GLU A N   1 
ATOM   1126  C CA  . GLU A  1  147 ? 166.788 149.782 137.930 1.00 61.94  ? 147 GLU A CA  1 
ATOM   1127  C C   . GLU A  1  147 ? 165.884 150.136 136.761 1.00 61.94  ? 147 GLU A C   1 
ATOM   1128  O O   . GLU A  1  147 ? 166.228 149.866 135.606 1.00 61.94  ? 147 GLU A O   1 
ATOM   1129  C CB  . GLU A  1  147 ? 168.097 150.568 137.863 1.00 61.94  ? 147 GLU A CB  1 
ATOM   1130  C CG  . GLU A  1  147 ? 168.988 150.384 139.078 1.00 61.94  ? 147 GLU A CG  1 
ATOM   1131  C CD  . GLU A  1  147 ? 170.283 151.161 138.972 1.00 61.94  ? 147 GLU A CD  1 
ATOM   1132  O OE1 . GLU A  1  147 ? 170.539 151.750 137.901 1.00 61.94  ? 147 GLU A OE1 1 
ATOM   1133  O OE2 . GLU A  1  147 ? 171.048 151.182 139.958 1.00 61.94  ? 147 GLU A OE2 1 
ATOM   1134  N N   . GLN A  1  148 ? 164.737 150.736 137.058 1.00 52.29  ? 148 GLN A N   1 
ATOM   1135  C CA  . GLN A  1  148 ? 163.732 151.041 136.051 1.00 52.29  ? 148 GLN A CA  1 
ATOM   1136  C C   . GLN A  1  148 ? 163.832 152.498 135.629 1.00 52.29  ? 148 GLN A C   1 
ATOM   1137  O O   . GLN A  1  148 ? 164.074 153.380 136.457 1.00 52.29  ? 148 GLN A O   1 
ATOM   1138  C CB  . GLN A  1  148 ? 162.330 150.757 136.585 1.00 52.29  ? 148 GLN A CB  1 
ATOM   1139  C CG  . GLN A  1  148 ? 162.105 149.317 136.952 1.00 52.29  ? 148 GLN A CG  1 
ATOM   1140  C CD  . GLN A  1  148 ? 162.229 148.411 135.759 1.00 52.29  ? 148 GLN A CD  1 
ATOM   1141  O OE1 . GLN A  1  148 ? 161.822 148.767 134.656 1.00 52.29  ? 148 GLN A OE1 1 
ATOM   1142  N NE2 . GLN A  1  148 ? 162.793 147.231 135.967 1.00 52.29  ? 148 GLN A NE2 1 
ATOM   1143  N N   . ASN A  1  149 ? 163.648 152.744 134.336 1.00 48.29  ? 149 ASN A N   1 
ATOM   1144  C CA  . ASN A  1  149 ? 163.633 154.091 133.772 1.00 48.29  ? 149 ASN A CA  1 
ATOM   1145  C C   . ASN A  1  149 ? 162.260 154.316 133.150 1.00 48.29  ? 149 ASN A C   1 
ATOM   1146  O O   . ASN A  1  149 ? 162.065 154.087 131.955 1.00 48.29  ? 149 ASN A O   1 
ATOM   1147  C CB  . ASN A  1  149 ? 164.759 154.272 132.753 1.00 48.29  ? 149 ASN A CB  1 
ATOM   1148  C CG  . ASN A  1  149 ? 164.841 155.689 132.213 1.00 48.29  ? 149 ASN A CG  1 
ATOM   1149  O OD1 . ASN A  1  149 ? 164.043 156.549 132.571 1.00 48.29  ? 149 ASN A OD1 1 
ATOM   1150  N ND2 . ASN A  1  149 ? 165.812 155.933 131.344 1.00 48.29  ? 149 ASN A ND2 1 
ATOM   1151  N N   . CYS A  1  150 ? 161.309 154.767 133.961 1.00 45.49  ? 150 CYS A N   1 
ATOM   1152  C CA  . CYS A  1  150 ? 159.986 155.138 133.480 1.00 45.49  ? 150 CYS A CA  1 
ATOM   1153  C C   . CYS A  1  150 ? 159.932 156.641 133.260 1.00 45.49  ? 150 CYS A C   1 
ATOM   1154  O O   . CYS A  1  150 ? 160.527 157.412 134.017 1.00 45.49  ? 150 CYS A O   1 
ATOM   1155  C CB  . CYS A  1  150 ? 158.894 154.705 134.457 1.00 45.49  ? 150 CYS A CB  1 
ATOM   1156  S SG  . CYS A  1  150 ? 158.666 152.914 134.550 1.00 45.49  ? 150 CYS A SG  1 
ATOM   1157  N N   . THR A  1  151 ? 159.212 157.054 132.220 1.00 34.33  ? 151 THR A N   1 
ATOM   1158  C CA  . THR A  1  151 ? 159.306 158.414 131.716 1.00 34.33  ? 151 THR A CA  1 
ATOM   1159  C C   . THR A  1  151 ? 157.919 158.957 131.409 1.00 34.33  ? 151 THR A C   1 
ATOM   1160  O O   . THR A  1  151 ? 156.918 158.241 131.458 1.00 34.33  ? 151 THR A O   1 
ATOM   1161  C CB  . THR A  1  151 ? 160.185 158.476 130.465 1.00 34.33  ? 151 THR A CB  1 
ATOM   1162  O OG1 . THR A  1  151 ? 160.359 159.840 130.068 1.00 34.33  ? 151 THR A OG1 1 
ATOM   1163  C CG2 . THR A  1  151 ? 159.544 157.698 129.332 1.00 34.33  ? 151 THR A CG2 1 
ATOM   1164  N N   . LEU A  1  152 ? 157.878 160.251 131.097 1.00 24.84  ? 152 LEU A N   1 
ATOM   1165  C CA  . LEU A  1  152 ? 156.664 160.946 130.683 1.00 24.84  ? 152 LEU A CA  1 
ATOM   1166  C C   . LEU A  1  152 ? 157.036 161.942 129.599 1.00 24.84  ? 152 LEU A C   1 
ATOM   1167  O O   . LEU A  1  152 ? 157.791 162.881 129.862 1.00 24.84  ? 152 LEU A O   1 
ATOM   1168  C CB  . LEU A  1  152 ? 156.013 161.669 131.860 1.00 24.84  ? 152 LEU A CB  1 
ATOM   1169  C CG  . LEU A  1  152 ? 154.765 162.469 131.507 1.00 24.84  ? 152 LEU A CG  1 
ATOM   1170  C CD1 . LEU A  1  152 ? 153.686 161.539 131.008 1.00 24.84  ? 152 LEU A CD1 1 
ATOM   1171  C CD2 . LEU A  1  152 ? 154.283 163.260 132.702 1.00 24.84  ? 152 LEU A CD2 1 
ATOM   1172  N N   . GLU A  1  153 ? 156.511 161.755 128.393 1.00 27.18  ? 153 GLU A N   1 
ATOM   1173  C CA  . GLU A  1  153 ? 156.897 162.571 127.249 1.00 27.18  ? 153 GLU A CA  1 
ATOM   1174  C C   . GLU A  1  153 ? 155.752 163.483 126.838 1.00 27.18  ? 153 GLU A C   1 
ATOM   1175  O O   . GLU A  1  153 ? 154.612 163.034 126.700 1.00 27.18  ? 153 GLU A O   1 
ATOM   1176  C CB  . GLU A  1  153 ? 157.335 161.697 126.075 1.00 27.18  ? 153 GLU A CB  1 
ATOM   1177  C CG  . GLU A  1  153 ? 158.641 160.968 126.330 1.00 27.18  ? 153 GLU A CG  1 
ATOM   1178  C CD  . GLU A  1  153 ? 159.109 160.163 125.137 1.00 27.18  ? 153 GLU A CD  1 
ATOM   1179  O OE1 . GLU A  1  153 ? 158.366 160.085 124.140 1.00 27.18  ? 153 GLU A OE1 1 
ATOM   1180  O OE2 . GLU A  1  153 ? 160.225 159.607 125.197 1.00 27.18  ? 153 GLU A OE2 1 
ATOM   1181  N N   . ILE A  1  154 ? 156.071 164.756 126.629 1.00 16.10  ? 154 ILE A N   1 
ATOM   1182  C CA  . ILE A  1  154 ? 155.097 165.810 126.387 1.00 16.10  ? 154 ILE A CA  1 
ATOM   1183  C C   . ILE A  1  154 ? 155.463 166.516 125.093 1.00 16.10  ? 154 ILE A C   1 
ATOM   1184  O O   . ILE A  1  154 ? 156.641 166.799 124.856 1.00 16.10  ? 154 ILE A O   1 
ATOM   1185  C CB  . ILE A  1  154 ? 155.090 166.814 127.551 1.00 16.10  ? 154 ILE A CB  1 
ATOM   1186  C CG1 . ILE A  1  154 ? 154.746 166.113 128.856 1.00 16.10  ? 154 ILE A CG1 1 
ATOM   1187  C CG2 . ILE A  1  154 ? 154.123 167.916 127.277 1.00 16.10  ? 154 ILE A CG2 1 
ATOM   1188  C CD1 . ILE A  1  154 ? 155.015 166.955 130.065 1.00 16.10  ? 154 ILE A CD1 1 
ATOM   1189  N N   . GLU A  1  155 ? 154.476 166.825 124.272 1.00 22.55  ? 155 GLU A N   1 
ATOM   1190  C CA  . GLU A  1  155 ? 154.764 167.553 123.082 1.00 22.55  ? 155 GLU A CA  1 
ATOM   1191  C C   . GLU A  1  155 ? 153.539 168.245 122.595 1.00 22.55  ? 155 GLU A C   1 
ATOM   1192  O O   . GLU A  1  155 ? 152.433 167.888 122.959 1.00 22.55  ? 155 GLU A O   1 
ATOM   1193  C CB  . GLU A  1  155 ? 155.193 166.574 121.999 1.00 22.55  ? 155 GLU A CB  1 
ATOM   1194  C CG  . GLU A  1  155 ? 154.363 165.321 121.875 1.00 22.55  ? 155 GLU A CG  1 
ATOM   1195  C CD  . GLU A  1  155 ? 155.081 164.277 121.048 1.00 22.55  ? 155 GLU A CD  1 
ATOM   1196  O OE1 . GLU A  1  155 ? 156.184 164.581 120.549 1.00 22.55  ? 155 GLU A OE1 1 
ATOM   1197  O OE2 . GLU A  1  155 ? 154.547 163.158 120.894 1.00 22.55  ? 155 GLU A OE2 1 
ATOM   1198  N N   . SER A  1  156 ? 153.742 169.233 121.727 1.00 17.15  ? 156 SER A N   1 
ATOM   1199  C CA  . SER A  1  156 ? 152.651 169.850 120.991 1.00 17.15  ? 156 SER A CA  1 
ATOM   1200  C C   . SER A  1  156 ? 152.180 168.922 119.882 1.00 17.15  ? 156 SER A C   1 
ATOM   1201  O O   . SER A  1  156 ? 152.861 167.965 119.512 1.00 17.15  ? 156 SER A O   1 
ATOM   1202  C CB  . SER A  1  156 ? 153.088 171.184 120.400 1.00 17.15  ? 156 SER A CB  1 
ATOM   1203  O OG  . SER A  1  156 ? 152.045 171.751 119.632 1.00 17.15  ? 156 SER A OG  1 
ATOM   1204  N N   . TYR A  1  157 ? 150.985 169.200 119.371 1.00 19.17  ? 157 TYR A N   1 
ATOM   1205  C CA  . TYR A  1  157 ? 150.388 168.342 118.358 1.00 19.17  ? 157 TYR A CA  1 
ATOM   1206  C C   . TYR A  1  157 ? 150.034 168.953 117.012 1.00 19.17  ? 157 TYR A C   1 
ATOM   1207  O O   . TYR A  1  157 ? 150.256 168.329 115.987 1.00 19.17  ? 157 TYR A O   1 
ATOM   1208  C CB  . TYR A  1  157 ? 149.150 167.658 118.916 1.00 19.17  ? 157 TYR A CB  1 
ATOM   1209  C CG  . TYR A  1  157 ? 148.631 166.609 117.985 1.00 19.17  ? 157 TYR A CG  1 
ATOM   1210  C CD1 . TYR A  1  157 ? 149.503 165.783 117.316 1.00 19.17  ? 157 TYR A CD1 1 
ATOM   1211  C CD2 . TYR A  1  157 ? 147.279 166.440 117.778 1.00 19.17  ? 157 TYR A CD2 1 
ATOM   1212  C CE1 . TYR A  1  157 ? 149.046 164.815 116.458 1.00 19.17  ? 157 TYR A CE1 1 
ATOM   1213  C CE2 . TYR A  1  157 ? 146.812 165.472 116.921 1.00 19.17  ? 157 TYR A CE2 1 
ATOM   1214  C CZ  . TYR A  1  157 ? 147.708 164.665 116.266 1.00 19.17  ? 157 TYR A CZ  1 
ATOM   1215  O OH  . TYR A  1  157 ? 147.278 163.697 115.403 1.00 19.17  ? 157 TYR A OH  1 
ATOM   1216  N N   . GLY A  1  158 ? 149.459 170.145 117.004 1.00 19.38  ? 158 GLY A N   1 
ATOM   1217  C CA  . GLY A  1  158 ? 149.085 170.780 115.757 1.00 19.38  ? 158 GLY A CA  1 
ATOM   1218  C C   . GLY A  1  158 ? 150.014 171.851 115.250 1.00 19.38  ? 158 GLY A C   1 
ATOM   1219  O O   . GLY A  1  158 ? 149.817 172.346 114.139 1.00 19.38  ? 158 GLY A O   1 
ATOM   1220  N N   . TYR A  1  159 ? 151.026 172.224 116.026 1.00 20.46  ? 159 TYR A N   1 
ATOM   1221  C CA  . TYR A  1  159 ? 151.893 173.349 115.711 1.00 20.46  ? 159 TYR A CA  1 
ATOM   1222  C C   . TYR A  1  159 ? 153.322 172.854 115.557 1.00 20.46  ? 159 TYR A C   1 
ATOM   1223  O O   . TYR A  1  159 ? 153.851 172.196 116.456 1.00 20.46  ? 159 TYR A O   1 
ATOM   1224  C CB  . TYR A  1  159 ? 151.806 174.398 116.815 1.00 20.46  ? 159 TYR A CB  1 
ATOM   1225  C CG  . TYR A  1  159 ? 150.440 175.025 116.938 1.00 20.46  ? 159 TYR A CG  1 
ATOM   1226  C CD1 . TYR A  1  159 ? 149.579 175.081 115.858 1.00 20.46  ? 159 TYR A CD1 1 
ATOM   1227  C CD2 . TYR A  1  159 ? 149.988 175.502 118.155 1.00 20.46  ? 159 TYR A CD2 1 
ATOM   1228  C CE1 . TYR A  1  159 ? 148.324 175.642 115.976 1.00 20.46  ? 159 TYR A CE1 1 
ATOM   1229  C CE2 . TYR A  1  159 ? 148.736 176.056 118.283 1.00 20.46  ? 159 TYR A CE2 1 
ATOM   1230  C CZ  . TYR A  1  159 ? 147.908 176.124 117.193 1.00 20.46  ? 159 TYR A CZ  1 
ATOM   1231  O OH  . TYR A  1  159 ? 146.659 176.678 117.323 1.00 20.46  ? 159 TYR A OH  1 
ATOM   1232  N N   . THR A  1  160 ? 153.946 173.177 114.428 1.00 24.03  ? 160 THR A N   1 
ATOM   1233  C CA  . THR A  1  160 ? 155.309 172.740 114.175 1.00 24.03  ? 160 THR A CA  1 
ATOM   1234  C C   . THR A  1  160 ? 156.287 173.583 114.985 1.00 24.03  ? 160 THR A C   1 
ATOM   1235  O O   . THR A  1  160 ? 155.910 174.541 115.662 1.00 24.03  ? 160 THR A O   1 
ATOM   1236  C CB  . THR A  1  160 ? 155.632 172.831 112.688 1.00 24.03  ? 160 THR A CB  1 
ATOM   1237  O OG1 . THR A  1  160 ? 155.582 174.199 112.275 1.00 24.03  ? 160 THR A OG1 1 
ATOM   1238  C CG2 . THR A  1  160 ? 154.623 172.044 111.885 1.00 24.03  ? 160 THR A CG2 1 
ATOM   1239  N N   . THR A  1  161 ? 157.573 173.236 114.904 1.00 26.27  ? 161 THR A N   1 
ATOM   1240  C CA  . THR A  1  161 ? 158.574 173.958 115.679 1.00 26.27  ? 161 THR A CA  1 
ATOM   1241  C C   . THR A  1  161 ? 158.769 175.382 115.187 1.00 26.27  ? 161 THR A C   1 
ATOM   1242  O O   . THR A  1  161 ? 159.383 176.187 115.891 1.00 26.27  ? 161 THR A O   1 
ATOM   1243  C CB  . THR A  1  161 ? 159.911 173.229 115.648 1.00 26.27  ? 161 THR A CB  1 
ATOM   1244  O OG1 . THR A  1  161 ? 160.808 173.852 116.575 1.00 26.27  ? 161 THR A OG1 1 
ATOM   1245  C CG2 . THR A  1  161 ? 160.511 173.301 114.262 1.00 26.27  ? 161 THR A CG2 1 
ATOM   1246  N N   . ASP A  1  162 ? 158.279 175.705 113.994 1.00 33.89  ? 162 ASP A N   1 
ATOM   1247  C CA  . ASP A  1  162 ? 158.268 177.076 113.507 1.00 33.89  ? 162 ASP A CA  1 
ATOM   1248  C C   . ASP A  1  162 ? 157.113 177.882 114.077 1.00 33.89  ? 162 ASP A C   1 
ATOM   1249  O O   . ASP A  1  162 ? 156.916 179.028 113.662 1.00 33.89  ? 162 ASP A O   1 
ATOM   1250  C CB  . ASP A  1  162 ? 158.194 177.095 111.979 1.00 33.89  ? 162 ASP A CB  1 
ATOM   1251  C CG  . ASP A  1  162 ? 159.440 176.532 111.329 1.00 33.89  ? 162 ASP A CG  1 
ATOM   1252  O OD1 . ASP A  1  162 ? 160.527 176.635 111.933 1.00 33.89  ? 162 ASP A OD1 1 
ATOM   1253  O OD2 . ASP A  1  162 ? 159.333 175.982 110.214 1.00 33.89  ? 162 ASP A OD2 1 
ATOM   1254  N N   . ASP A  1  163 ? 156.341 177.309 114.991 1.00 28.78  ? 163 ASP A N   1 
ATOM   1255  C CA  . ASP A  1  163 ? 155.104 177.911 115.464 1.00 28.78  ? 163 ASP A CA  1 
ATOM   1256  C C   . ASP A  1  163 ? 155.036 178.054 116.977 1.00 28.78  ? 163 ASP A C   1 
ATOM   1257  O O   . ASP A  1  163 ? 154.505 179.051 117.468 1.00 28.78  ? 163 ASP A O   1 
ATOM   1258  C CB  . ASP A  1  163 ? 153.918 177.079 114.951 1.00 28.78  ? 163 ASP A CB  1 
ATOM   1259  C CG  . ASP A  1  163 ? 152.590 177.794 115.074 1.00 28.78  ? 163 ASP A CG  1 
ATOM   1260  O OD1 . ASP A  1  163 ? 152.541 178.895 115.651 1.00 28.78  ? 163 ASP A OD1 1 
ATOM   1261  O OD2 . ASP A  1  163 ? 151.587 177.257 114.563 1.00 28.78  ? 163 ASP A OD2 1 
ATOM   1262  N N   . ILE A  1  164 ? 155.573 177.102 117.739 1.00 22.56  ? 164 ILE A N   1 
ATOM   1263  C CA  . ILE A  1  164 ? 155.488 177.142 119.194 1.00 22.56  ? 164 ILE A CA  1 
ATOM   1264  C C   . ILE A  1  164 ? 156.763 176.561 119.793 1.00 22.56  ? 164 ILE A C   1 
ATOM   1265  O O   . ILE A  1  164 ? 157.408 175.690 119.203 1.00 22.56  ? 164 ILE A O   1 
ATOM   1266  C CB  . ILE A  1  164 ? 154.238 176.391 119.697 1.00 22.56  ? 164 ILE A CB  1 
ATOM   1267  C CG1 . ILE A  1  164 ? 153.970 176.692 121.165 1.00 22.56  ? 164 ILE A CG1 1 
ATOM   1268  C CG2 . ILE A  1  164 ? 154.396 174.905 119.502 1.00 22.56  ? 164 ILE A CG2 1 
ATOM   1269  C CD1 . ILE A  1  164 ? 152.609 176.245 121.624 1.00 22.56  ? 164 ILE A CD1 1 
ATOM   1270  N N   . GLU A  1  165 ? 157.132 177.059 120.974 1.00 21.45  ? 165 GLU A N   1 
ATOM   1271  C CA  . GLU A  1  165 ? 158.371 176.685 121.647 1.00 21.45  ? 165 GLU A CA  1 
ATOM   1272  C C   . GLU A  1  165 ? 158.082 176.301 123.088 1.00 21.45  ? 165 GLU A C   1 
ATOM   1273  O O   . GLU A  1  165 ? 157.485 177.085 123.831 1.00 21.45  ? 165 GLU A O   1 
ATOM   1274  C CB  . GLU A  1  165 ? 159.380 177.835 121.628 1.00 21.45  ? 165 GLU A CB  1 
ATOM   1275  C CG  . GLU A  1  165 ? 159.893 178.205 120.257 1.00 21.45  ? 165 GLU A CG  1 
ATOM   1276  C CD  . GLU A  1  165 ? 160.770 177.131 119.662 1.00 21.45  ? 165 GLU A CD  1 
ATOM   1277  O OE1 . GLU A  1  165 ? 161.447 176.424 120.436 1.00 21.45  ? 165 GLU A OE1 1 
ATOM   1278  O OE2 . GLU A  1  165 ? 160.787 176.997 118.421 1.00 21.45  ? 165 GLU A OE2 1 
ATOM   1279  N N   . PHE A  1  166 ? 158.520 175.113 123.488 1.00 18.51  ? 166 PHE A N   1 
ATOM   1280  C CA  . PHE A  1  166 ? 158.409 174.663 124.868 1.00 18.51  ? 166 PHE A CA  1 
ATOM   1281  C C   . PHE A  1  166 ? 159.743 174.827 125.577 1.00 18.51  ? 166 PHE A C   1 
ATOM   1282  O O   . PHE A  1  166 ? 160.800 174.587 124.991 1.00 18.51  ? 166 PHE A O   1 
ATOM   1283  C CB  . PHE A  1  166 ? 157.977 173.201 124.948 1.00 18.51  ? 166 PHE A CB  1 
ATOM   1284  C CG  . PHE A  1  166 ? 156.542 172.966 124.600 1.00 18.51  ? 166 PHE A CG  1 
ATOM   1285  C CD1 . PHE A  1  166 ? 155.653 174.013 124.506 1.00 18.51  ? 166 PHE A CD1 1 
ATOM   1286  C CD2 . PHE A  1  166 ? 156.080 171.687 124.391 1.00 18.51  ? 166 PHE A CD2 1 
ATOM   1287  C CE1 . PHE A  1  166 ? 154.337 173.784 124.196 1.00 18.51  ? 166 PHE A CE1 1 
ATOM   1288  C CE2 . PHE A  1  166 ? 154.770 171.456 124.084 1.00 18.51  ? 166 PHE A CE2 1 
ATOM   1289  C CZ  . PHE A  1  166 ? 153.897 172.504 123.986 1.00 18.51  ? 166 PHE A CZ  1 
ATOM   1290  N N   . TYR A  1  167 ? 159.687 175.228 126.844 1.00 19.32  ? 167 TYR A N   1 
ATOM   1291  C CA  . TYR A  1  167 ? 160.890 175.339 127.654 1.00 19.32  ? 167 TYR A CA  1 
ATOM   1292  C C   . TYR A  1  167 ? 160.490 175.276 129.119 1.00 19.32  ? 167 TYR A C   1 
ATOM   1293  O O   . TYR A  1  167 ? 159.507 175.901 129.520 1.00 19.32  ? 167 TYR A O   1 
ATOM   1294  C CB  . TYR A  1  167 ? 161.644 176.640 127.364 1.00 19.32  ? 167 TYR A CB  1 
ATOM   1295  C CG  . TYR A  1  167 ? 160.933 177.885 127.838 1.00 19.32  ? 167 TYR A CG  1 
ATOM   1296  C CD1 . TYR A  1  167 ? 159.979 178.503 127.052 1.00 19.32  ? 167 TYR A CD1 1 
ATOM   1297  C CD2 . TYR A  1  167 ? 161.235 178.453 129.065 1.00 19.32  ? 167 TYR A CD2 1 
ATOM   1298  C CE1 . TYR A  1  167 ? 159.331 179.641 127.481 1.00 19.32  ? 167 TYR A CE1 1 
ATOM   1299  C CE2 . TYR A  1  167 ? 160.593 179.590 129.500 1.00 19.32  ? 167 TYR A CE2 1 
ATOM   1300  C CZ  . TYR A  1  167 ? 159.643 180.179 128.705 1.00 19.32  ? 167 TYR A CZ  1 
ATOM   1301  O OH  . TYR A  1  167 ? 159.005 181.314 129.141 1.00 19.32  ? 167 TYR A OH  1 
ATOM   1302  N N   . TRP A  1  168 ? 161.245 174.518 129.909 1.00 24.00  ? 168 TRP A N   1 
ATOM   1303  C CA  . TRP A  1  168 ? 160.972 174.457 131.336 1.00 24.00  ? 168 TRP A CA  1 
ATOM   1304  C C   . TRP A  1  168 ? 161.263 175.807 131.972 1.00 24.00  ? 168 TRP A C   1 
ATOM   1305  O O   . TRP A  1  168 ? 162.261 176.457 131.654 1.00 24.00  ? 168 TRP A O   1 
ATOM   1306  C CB  . TRP A  1  168 ? 161.817 173.377 132.001 1.00 24.00  ? 168 TRP A CB  1 
ATOM   1307  C CG  . TRP A  1  168 ? 161.507 171.997 131.549 1.00 24.00  ? 168 TRP A CG  1 
ATOM   1308  C CD1 . TRP A  1  168 ? 162.184 171.276 130.618 1.00 24.00  ? 168 TRP A CD1 1 
ATOM   1309  C CD2 . TRP A  1  168 ? 160.443 171.160 132.009 1.00 24.00  ? 168 TRP A CD2 1 
ATOM   1310  N NE1 . TRP A  1  168 ? 161.610 170.041 130.467 1.00 24.00  ? 168 TRP A NE1 1 
ATOM   1311  C CE2 . TRP A  1  168 ? 160.537 169.946 131.312 1.00 24.00  ? 168 TRP A CE2 1 
ATOM   1312  C CE3 . TRP A  1  168 ? 159.420 171.320 132.941 1.00 24.00  ? 168 TRP A CE3 1 
ATOM   1313  C CZ2 . TRP A  1  168 ? 159.647 168.899 131.515 1.00 24.00  ? 168 TRP A CZ2 1 
ATOM   1314  C CZ3 . TRP A  1  168 ? 158.538 170.278 133.142 1.00 24.00  ? 168 TRP A CZ3 1 
ATOM   1315  C CH2 . TRP A  1  168 ? 158.658 169.084 132.435 1.00 24.00  ? 168 TRP A CH2 1 
ATOM   1316  N N   . ARG A  1  169 ? 160.385 176.235 132.871 1.00 32.91  ? 169 ARG A N   1 
ATOM   1317  C CA  . ARG A  1  169 ? 160.515 177.525 133.534 1.00 32.91  ? 169 ARG A CA  1 
ATOM   1318  C C   . ARG A  1  169 ? 161.121 177.307 134.912 1.00 32.91  ? 169 ARG A C   1 
ATOM   1319  O O   . ARG A  1  169 ? 160.519 176.639 135.758 1.00 32.91  ? 169 ARG A O   1 
ATOM   1320  C CB  . ARG A  1  169 ? 159.161 178.222 133.641 1.00 32.91  ? 169 ARG A CB  1 
ATOM   1321  C CG  . ARG A  1  169 ? 159.244 179.626 134.197 1.00 32.91  ? 169 ARG A CG  1 
ATOM   1322  C CD  . ARG A  1  169 ? 157.883 180.293 134.244 1.00 32.91  ? 169 ARG A CD  1 
ATOM   1323  N NE  . ARG A  1  169 ? 156.986 179.621 135.174 1.00 32.91  ? 169 ARG A NE  1 
ATOM   1324  C CZ  . ARG A  1  169 ? 155.706 179.934 135.332 1.00 32.91  ? 169 ARG A CZ  1 
ATOM   1325  N NH1 . ARG A  1  169 ? 154.962 179.266 136.200 1.00 32.91  ? 169 ARG A NH1 1 
ATOM   1326  N NH2 . ARG A  1  169 ? 155.175 180.924 134.633 1.00 32.91  ? 169 ARG A NH2 1 
ATOM   1327  N N   . GLY A  1  170 ? 162.304 177.872 135.136 1.00 52.05  ? 170 GLY A N   1 
ATOM   1328  C CA  . GLY A  1  170 ? 163.023 177.616 136.368 1.00 52.05  ? 170 GLY A CA  1 
ATOM   1329  C C   . GLY A  1  170 ? 163.562 176.202 136.409 1.00 52.05  ? 170 GLY A C   1 
ATOM   1330  O O   . GLY A  1  170 ? 163.063 175.367 137.170 1.00 52.05  ? 170 GLY A O   1 
ATOM   1331  N N   . ASP A  1  171 ? 164.570 175.926 135.574 1.00 56.06  ? 171 ASP A N   1 
ATOM   1332  C CA  . ASP A  1  171 ? 165.052 174.561 135.370 1.00 56.06  ? 171 ASP A CA  1 
ATOM   1333  C C   . ASP A  1  171 ? 165.306 173.837 136.686 1.00 56.06  ? 171 ASP A C   1 
ATOM   1334  O O   . ASP A  1  171 ? 164.984 172.652 136.824 1.00 56.06  ? 171 ASP A O   1 
ATOM   1335  C CB  . ASP A  1  171 ? 166.325 174.588 134.529 1.00 56.06  ? 171 ASP A CB  1 
ATOM   1336  C CG  . ASP A  1  171 ? 166.079 175.083 133.122 1.00 56.06  ? 171 ASP A CG  1 
ATOM   1337  O OD1 . ASP A  1  171 ? 164.959 174.886 132.610 1.00 56.06  ? 171 ASP A OD1 1 
ATOM   1338  O OD2 . ASP A  1  171 ? 167.003 175.675 132.527 1.00 56.06  ? 171 ASP A OD2 1 
ATOM   1339  N N   . ASP A  1  172 ? 165.880 174.535 137.664 1.00 71.38  ? 172 ASP A N   1 
ATOM   1340  C CA  . ASP A  1  172 ? 166.115 173.920 138.964 1.00 71.38  ? 172 ASP A CA  1 
ATOM   1341  C C   . ASP A  1  172 ? 164.801 173.573 139.653 1.00 71.38  ? 172 ASP A C   1 
ATOM   1342  O O   . ASP A  1  172 ? 164.697 172.538 140.321 1.00 71.38  ? 172 ASP A O   1 
ATOM   1343  C CB  . ASP A  1  172 ? 166.949 174.854 139.842 1.00 71.38  ? 172 ASP A CB  1 
ATOM   1344  C CG  . ASP A  1  172 ? 168.361 175.047 139.317 1.00 71.38  ? 172 ASP A CG  1 
ATOM   1345  O OD1 . ASP A  1  172 ? 168.890 174.122 138.666 1.00 71.38  ? 172 ASP A OD1 1 
ATOM   1346  O OD2 . ASP A  1  172 ? 168.942 176.127 139.554 1.00 71.38  ? 172 ASP A OD2 1 
ATOM   1347  N N   . ASN A  1  173 ? 163.787 174.421 139.495 1.00 58.15  ? 173 ASN A N   1 
ATOM   1348  C CA  . ASN A  1  173 ? 162.512 174.264 140.181 1.00 58.15  ? 173 ASN A CA  1 
ATOM   1349  C C   . ASN A  1  173 ? 161.373 173.958 139.214 1.00 58.15  ? 173 ASN A C   1 
ATOM   1350  O O   . ASN A  1  173 ? 160.220 174.304 139.475 1.00 58.15  ? 173 ASN A O   1 
ATOM   1351  C CB  . ASN A  1  173 ? 162.192 175.516 140.992 1.00 58.15  ? 173 ASN A CB  1 
ATOM   1352  C CG  . ASN A  1  173 ? 163.225 175.795 142.055 1.00 58.15  ? 173 ASN A CG  1 
ATOM   1353  O OD1 . ASN A  1  173 ? 163.922 176.809 142.010 1.00 58.15  ? 173 ASN A OD1 1 
ATOM   1354  N ND2 . ASN A  1  173 ? 163.340 174.888 143.018 1.00 58.15  ? 173 ASN A ND2 1 
ATOM   1355  N N   . ALA A  1  174 ? 161.683 173.319 138.086 1.00 36.51  ? 174 ALA A N   1 
ATOM   1356  C CA  . ALA A  1  174 ? 160.640 172.987 137.123 1.00 36.51  ? 174 ALA A CA  1 
ATOM   1357  C C   . ALA A  1  174 ? 159.659 171.982 137.708 1.00 36.51  ? 174 ALA A C   1 
ATOM   1358  O O   . ALA A  1  174 ? 158.442 172.138 137.581 1.00 36.51  ? 174 ALA A O   1 
ATOM   1359  C CB  . ALA A  1  174 ? 161.264 172.447 135.839 1.00 36.51  ? 174 ALA A CB  1 
ATOM   1360  N N   . VAL A  1  175 ? 160.171 170.941 138.354 1.00 28.10  ? 175 VAL A N   1 
ATOM   1361  C CA  . VAL A  1  175 ? 159.347 169.913 138.973 1.00 28.10  ? 175 VAL A CA  1 
ATOM   1362  C C   . VAL A  1  175 ? 159.570 169.967 140.476 1.00 28.10  ? 175 VAL A C   1 
ATOM   1363  O O   . VAL A  1  175 ? 160.716 170.007 140.936 1.00 28.10  ? 175 VAL A O   1 
ATOM   1364  C CB  . VAL A  1  175 ? 159.678 168.519 138.419 1.00 28.10  ? 175 VAL A CB  1 
ATOM   1365  C CG1 . VAL A  1  175 ? 158.858 167.463 139.127 1.00 28.10  ? 175 VAL A CG1 1 
ATOM   1366  C CG2 . VAL A  1  175 ? 159.439 168.478 136.928 1.00 28.10  ? 175 VAL A CG2 1 
ATOM   1367  N N   . THR A  1  176 ? 158.483 169.971 141.237 1.00 32.70  ? 176 THR A N   1 
ATOM   1368  C CA  . THR A  1  176 ? 158.553 170.050 142.686 1.00 32.70  ? 176 THR A CA  1 
ATOM   1369  C C   . THR A  1  176 ? 157.853 168.850 143.308 1.00 32.70  ? 176 THR A C   1 
ATOM   1370  O O   . THR A  1  176 ? 157.157 168.087 142.636 1.00 32.70  ? 176 THR A O   1 
ATOM   1371  C CB  . THR A  1  176 ? 157.920 171.347 143.201 1.00 32.70  ? 176 THR A CB  1 
ATOM   1372  O OG1 . THR A  1  176 ? 156.526 171.356 142.876 1.00 32.70  ? 176 THR A OG1 1 
ATOM   1373  C CG2 . THR A  1  176 ? 158.582 172.554 142.561 1.00 32.70  ? 176 THR A CG2 1 
ATOM   1374  N N   . GLY A  1  177 ? 158.053 168.685 144.612 1.00 39.15  ? 177 GLY A N   1 
ATOM   1375  C CA  . GLY A  1  177 ? 157.332 167.674 145.356 1.00 39.15  ? 177 GLY A CA  1 
ATOM   1376  C C   . GLY A  1  177 ? 157.760 166.249 145.105 1.00 39.15  ? 177 GLY A C   1 
ATOM   1377  O O   . GLY A  1  177 ? 157.011 165.326 145.437 1.00 39.15  ? 177 GLY A O   1 
ATOM   1378  N N   . VAL A  1  178 ? 158.941 166.034 144.531 1.00 46.71  ? 178 VAL A N   1 
ATOM   1379  C CA  . VAL A  1  178 ? 159.393 164.673 144.264 1.00 46.71  ? 178 VAL A CA  1 
ATOM   1380  C C   . VAL A  1  178 ? 159.881 163.999 145.539 1.00 46.71  ? 178 VAL A C   1 
ATOM   1381  O O   . VAL A  1  178 ? 159.695 162.792 145.725 1.00 46.71  ? 178 VAL A O   1 
ATOM   1382  C CB  . VAL A  1  178 ? 160.476 164.685 143.172 1.00 46.71  ? 178 VAL A CB  1 
ATOM   1383  C CG1 . VAL A  1  178 ? 161.052 163.299 142.976 1.00 46.71  ? 178 VAL A CG1 1 
ATOM   1384  C CG2 . VAL A  1  178 ? 159.893 165.192 141.873 1.00 46.71  ? 178 VAL A CG2 1 
ATOM   1385  N N   . THR A  1  179 ? 160.502 164.761 146.442 1.00 43.65  ? 179 THR A N   1 
ATOM   1386  C CA  . THR A  1  179 ? 161.061 164.167 147.653 1.00 43.65  ? 179 THR A CA  1 
ATOM   1387  C C   . THR A  1  179 ? 159.977 163.537 148.519 1.00 43.65  ? 179 THR A C   1 
ATOM   1388  O O   . THR A  1  179 ? 160.179 162.460 149.091 1.00 43.65  ? 179 THR A O   1 
ATOM   1389  C CB  . THR A  1  179 ? 161.828 165.221 148.449 1.00 43.65  ? 179 THR A CB  1 
ATOM   1390  O OG1 . THR A  1  179 ? 160.936 166.274 148.831 1.00 43.65  ? 179 THR A OG1 1 
ATOM   1391  C CG2 . THR A  1  179 ? 162.957 165.798 147.613 1.00 43.65  ? 179 THR A CG2 1 
ATOM   1392  N N   . LYS A  1  180 ? 158.817 164.186 148.620 1.00 45.26  ? 180 LYS A N   1 
ATOM   1393  C CA  . LYS A  1  180 ? 157.742 163.666 149.455 1.00 45.26  ? 180 LYS A CA  1 
ATOM   1394  C C   . LYS A  1  180 ? 157.123 162.395 148.888 1.00 45.26  ? 180 LYS A C   1 
ATOM   1395  O O   . LYS A  1  180 ? 156.410 161.695 149.615 1.00 45.26  ? 180 LYS A O   1 
ATOM   1396  C CB  . LYS A  1  180 ? 156.661 164.730 149.640 1.00 45.26  ? 180 LYS A CB  1 
ATOM   1397  C CG  . LYS A  1  180 ? 157.122 165.942 150.429 1.00 45.26  ? 180 LYS A CG  1 
ATOM   1398  C CD  . LYS A  1  180 ? 156.010 166.963 150.574 1.00 45.26  ? 180 LYS A CD  1 
ATOM   1399  C CE  . LYS A  1  180 ? 156.496 168.190 151.322 1.00 45.26  ? 180 LYS A CE  1 
ATOM   1400  N NZ  . LYS A  1  180 ? 155.430 169.218 151.457 1.00 45.26  ? 180 LYS A NZ  1 
ATOM   1401  N N   . ILE A  1  181 ? 157.367 162.088 147.614 1.00 48.78  ? 181 ILE A N   1 
ATOM   1402  C CA  . ILE A  1  181 ? 156.844 160.864 147.018 1.00 48.78  ? 181 ILE A CA  1 
ATOM   1403  C C   . ILE A  1  181 ? 157.488 159.661 147.689 1.00 48.78  ? 181 ILE A C   1 
ATOM   1404  O O   . ILE A  1  181 ? 158.713 159.606 147.860 1.00 48.78  ? 181 ILE A O   1 
ATOM   1405  C CB  . ILE A  1  181 ? 157.103 160.844 145.506 1.00 48.78  ? 181 ILE A CB  1 
ATOM   1406  C CG1 . ILE A  1  181 ? 156.360 161.983 144.819 1.00 48.78  ? 181 ILE A CG1 1 
ATOM   1407  C CG2 . ILE A  1  181 ? 156.691 159.514 144.913 1.00 48.78  ? 181 ILE A CG2 1 
ATOM   1408  C CD1 . ILE A  1  181 ? 156.781 162.175 143.389 1.00 48.78  ? 181 ILE A CD1 1 
ATOM   1409  N N   . GLU A  1  182 ? 156.667 158.688 148.071 1.00 53.35  ? 182 GLU A N   1 
ATOM   1410  C CA  . GLU A  1  182 ? 157.170 157.444 148.643 1.00 53.35  ? 182 GLU A CA  1 
ATOM   1411  C C   . GLU A  1  182 ? 156.294 156.310 148.137 1.00 53.35  ? 182 GLU A C   1 
ATOM   1412  O O   . GLU A  1  182 ? 155.132 156.192 148.537 1.00 53.35  ? 182 GLU A O   1 
ATOM   1413  C CB  . GLU A  1  182 ? 157.178 157.495 150.169 1.00 53.35  ? 182 GLU A CB  1 
ATOM   1414  C CG  . GLU A  1  182 ? 157.797 156.271 150.828 1.00 53.35  ? 182 GLU A CG  1 
ATOM   1415  C CD  . GLU A  1  182 ? 159.284 156.136 150.545 1.00 53.35  ? 182 GLU A CD  1 
ATOM   1416  O OE1 . GLU A  1  182 ? 159.938 157.163 150.268 1.00 53.35  ? 182 GLU A OE1 1 
ATOM   1417  O OE2 . GLU A  1  182 ? 159.803 155.001 150.611 1.00 53.35  ? 182 GLU A OE2 1 
ATOM   1418  N N   . LEU A  1  183 ? 156.848 155.487 147.261 1.00 49.46  ? 183 LEU A N   1 
ATOM   1419  C CA  . LEU A  1  183 ? 156.141 154.321 146.770 1.00 49.46  ? 183 LEU A CA  1 
ATOM   1420  C C   . LEU A  1  183 ? 156.244 153.182 147.780 1.00 49.46  ? 183 LEU A C   1 
ATOM   1421  O O   . LEU A  1  183 ? 157.207 153.107 148.546 1.00 49.46  ? 183 LEU A O   1 
ATOM   1422  C CB  . LEU A  1  183 ? 156.716 153.877 145.432 1.00 49.46  ? 183 LEU A CB  1 
ATOM   1423  C CG  . LEU A  1  183 ? 156.476 154.826 144.263 1.00 49.46  ? 183 LEU A CG  1 
ATOM   1424  C CD1 . LEU A  1  183 ? 157.238 154.360 143.044 1.00 49.46  ? 183 LEU A CD1 1 
ATOM   1425  C CD2 . LEU A  1  183 ? 154.998 154.892 143.966 1.00 49.46  ? 183 LEU A CD2 1 
ATOM   1426  N N   . PRO A  1  184 ? 155.257 152.286 147.810 1.00 61.68  ? 184 PRO A N   1 
ATOM   1427  C CA  . PRO A  1  184 ? 155.324 151.182 148.776 1.00 61.68  ? 184 PRO A CA  1 
ATOM   1428  C C   . PRO A  1  184 ? 156.432 150.192 148.478 1.00 61.68  ? 184 PRO A C   1 
ATOM   1429  O O   . PRO A  1  184 ? 156.932 149.546 149.407 1.00 61.68  ? 184 PRO A O   1 
ATOM   1430  C CB  . PRO A  1  184 ? 153.939 150.535 148.665 1.00 61.68  ? 184 PRO A CB  1 
ATOM   1431  C CG  . PRO A  1  184 ? 153.487 150.868 147.286 1.00 61.68  ? 184 PRO A CG  1 
ATOM   1432  C CD  . PRO A  1  184 ? 154.037 152.230 146.988 1.00 61.68  ? 184 PRO A CD  1 
ATOM   1433  N N   . GLN A  1  185 ? 156.833 150.045 147.216 1.00 59.30  ? 185 GLN A N   1 
ATOM   1434  C CA  . GLN A  1  185 ? 157.832 149.053 146.845 1.00 59.30  ? 185 GLN A CA  1 
ATOM   1435  C C   . GLN A  1  185 ? 159.104 149.639 146.253 1.00 59.30  ? 185 GLN A C   1 
ATOM   1436  O O   . GLN A  1  185 ? 160.172 149.055 146.435 1.00 59.30  ? 185 GLN A O   1 
ATOM   1437  C CB  . GLN A  1  185 ? 157.232 148.049 145.853 1.00 59.30  ? 185 GLN A CB  1 
ATOM   1438  C CG  . GLN A  1  185 ? 158.137 146.883 145.515 1.00 59.30  ? 185 GLN A CG  1 
ATOM   1439  C CD  . GLN A  1  185 ? 157.450 145.849 144.648 1.00 59.30  ? 185 GLN A CD  1 
ATOM   1440  O OE1 . GLN A  1  185 ? 156.285 146.001 144.283 1.00 59.30  ? 185 GLN A OE1 1 
ATOM   1441  N NE2 . GLN A  1  185 ? 158.172 144.792 144.310 1.00 59.30  ? 185 GLN A NE2 1 
ATOM   1442  N N   . PHE A  1  186 ? 159.033 150.778 145.572 1.00 51.31  ? 186 PHE A N   1 
ATOM   1443  C CA  . PHE A  1  186 ? 160.197 151.363 144.924 1.00 51.31  ? 186 PHE A CA  1 
ATOM   1444  C C   . PHE A  1  186 ? 160.713 152.551 145.733 1.00 51.31  ? 186 PHE A C   1 
ATOM   1445  O O   . PHE A  1  186 ? 160.258 152.822 146.849 1.00 51.31  ? 186 PHE A O   1 
ATOM   1446  C CB  . PHE A  1  186 ? 159.870 151.795 143.493 1.00 51.31  ? 186 PHE A CB  1 
ATOM   1447  C CG  . PHE A  1  186 ? 159.602 150.662 142.553 1.00 51.31  ? 186 PHE A CG  1 
ATOM   1448  C CD1 . PHE A  1  186 ? 159.776 149.355 142.947 1.00 51.31  ? 186 PHE A CD1 1 
ATOM   1449  C CD2 . PHE A  1  186 ? 159.227 150.914 141.249 1.00 51.31  ? 186 PHE A CD2 1 
ATOM   1450  C CE1 . PHE A  1  186 ? 159.536 148.320 142.071 1.00 51.31  ? 186 PHE A CE1 1 
ATOM   1451  C CE2 . PHE A  1  186 ? 158.996 149.882 140.369 1.00 51.31  ? 186 PHE A CE2 1 
ATOM   1452  C CZ  . PHE A  1  186 ? 159.151 148.585 140.780 1.00 51.31  ? 186 PHE A CZ  1 
ATOM   1453  N N   . SER A  1  187 ? 161.686 153.259 145.164 1.00 49.65  ? 187 SER A N   1 
ATOM   1454  C CA  . SER A  1  187 ? 162.192 154.494 145.742 1.00 49.65  ? 187 SER A CA  1 
ATOM   1455  C C   . SER A  1  187 ? 162.739 155.370 144.625 1.00 49.65  ? 187 SER A C   1 
ATOM   1456  O O   . SER A  1  187 ? 163.458 154.888 143.747 1.00 49.65  ? 187 SER A O   1 
ATOM   1457  C CB  . SER A  1  187 ? 163.276 154.217 146.787 1.00 49.65  ? 187 SER A CB  1 
ATOM   1458  O OG  . SER A  1  187 ? 164.421 153.636 146.192 1.00 49.65  ? 187 SER A OG  1 
ATOM   1459  N N   . ILE A  1  188 ? 162.401 156.658 144.670 1.00 42.62  ? 188 ILE A N   1 
ATOM   1460  C CA  . ILE A  1  188 ? 162.757 157.608 143.617 1.00 42.62  ? 188 ILE A CA  1 
ATOM   1461  C C   . ILE A  1  188 ? 164.213 158.008 143.830 1.00 42.62  ? 188 ILE A C   1 
ATOM   1462  O O   . ILE A  1  188 ? 164.525 158.785 144.731 1.00 42.62  ? 188 ILE A O   1 
ATOM   1463  C CB  . ILE A  1  188 ? 161.839 158.831 143.619 1.00 42.62  ? 188 ILE A CB  1 
ATOM   1464  C CG1 . ILE A  1  188 ? 160.380 158.413 143.463 1.00 42.62  ? 188 ILE A CG1 1 
ATOM   1465  C CG2 . ILE A  1  188 ? 162.229 159.776 142.506 1.00 42.62  ? 188 ILE A CG2 1 
ATOM   1466  C CD1 . ILE A  1  188 ? 160.085 157.751 142.160 1.00 42.62  ? 188 ILE A CD1 1 
ATOM   1467  N N   . VAL A  1  189 ? 165.109 157.490 142.995 1.00 48.49  ? 189 VAL A N   1 
ATOM   1468  C CA  . VAL A  1  189 ? 166.524 157.820 143.129 1.00 48.49  ? 189 VAL A CA  1 
ATOM   1469  C C   . VAL A  1  189 ? 166.809 159.217 142.592 1.00 48.49  ? 189 VAL A C   1 
ATOM   1470  O O   . VAL A  1  189 ? 167.235 160.109 143.332 1.00 48.49  ? 189 VAL A O   1 
ATOM   1471  C CB  . VAL A  1  189 ? 167.393 156.763 142.428 1.00 48.49  ? 189 VAL A CB  1 
ATOM   1472  C CG1 . VAL A  1  189 ? 168.848 157.188 142.441 1.00 48.49  ? 189 VAL A CG1 1 
ATOM   1473  C CG2 . VAL A  1  189 ? 167.227 155.420 143.108 1.00 48.49  ? 189 VAL A CG2 1 
ATOM   1474  N N   . ASP A  1  190 ? 166.573 159.431 141.299 1.00 54.74  ? 190 ASP A N   1 
ATOM   1475  C CA  . ASP A  1  190 ? 166.932 160.693 140.671 1.00 54.74  ? 190 ASP A CA  1 
ATOM   1476  C C   . ASP A  1  190 ? 166.040 160.932 139.462 1.00 54.74  ? 190 ASP A C   1 
ATOM   1477  O O   . ASP A  1  190 ? 165.608 159.986 138.800 1.00 54.74  ? 190 ASP A O   1 
ATOM   1478  C CB  . ASP A  1  190 ? 168.404 160.696 140.250 1.00 54.74  ? 190 ASP A CB  1 
ATOM   1479  C CG  . ASP A  1  190 ? 168.896 162.072 139.861 1.00 54.74  ? 190 ASP A CG  1 
ATOM   1480  O OD1 . ASP A  1  190 ? 168.098 163.029 139.919 1.00 54.74  ? 190 ASP A OD1 1 
ATOM   1481  O OD2 . ASP A  1  190 ? 170.083 162.197 139.493 1.00 54.74  ? 190 ASP A OD2 1 
ATOM   1482  N N   . TYR A  1  191 ? 165.775 162.207 139.176 1.00 35.76  ? 191 TYR A N   1 
ATOM   1483  C CA  . TYR A  1  191 ? 165.002 162.606 138.008 1.00 35.76  ? 191 TYR A CA  1 
ATOM   1484  C C   . TYR A  1  191 ? 165.788 163.628 137.204 1.00 35.76  ? 191 TYR A C   1 
ATOM   1485  O O   . TYR A  1  191 ? 166.492 164.466 137.773 1.00 35.76  ? 191 TYR A O   1 
ATOM   1486  C CB  . TYR A  1  191 ? 163.642 163.191 138.398 1.00 35.76  ? 191 TYR A CB  1 
ATOM   1487  C CG  . TYR A  1  191 ? 163.710 164.479 139.177 1.00 35.76  ? 191 TYR A CG  1 
ATOM   1488  C CD1 . TYR A  1  191 ? 163.762 164.471 140.559 1.00 35.76  ? 191 TYR A CD1 1 
ATOM   1489  C CD2 . TYR A  1  191 ? 163.709 165.705 138.532 1.00 35.76  ? 191 TYR A CD2 1 
ATOM   1490  C CE1 . TYR A  1  191 ? 163.819 165.648 141.278 1.00 35.76  ? 191 TYR A CE1 1 
ATOM   1491  C CE2 . TYR A  1  191 ? 163.769 166.885 139.240 1.00 35.76  ? 191 TYR A CE2 1 
ATOM   1492  C CZ  . TYR A  1  191 ? 163.823 166.852 140.612 1.00 35.76  ? 191 TYR A CZ  1 
ATOM   1493  O OH  . TYR A  1  191 ? 163.881 168.026 141.323 1.00 35.76  ? 191 TYR A OH  1 
ATOM   1494  N N   . LYS A  1  192 ? 165.660 163.564 135.881 1.00 32.54  ? 192 LYS A N   1 
ATOM   1495  C CA  . LYS A  1  192 ? 166.337 164.491 134.990 1.00 32.54  ? 192 LYS A CA  1 
ATOM   1496  C C   . LYS A  1  192 ? 165.336 165.105 134.025 1.00 32.54  ? 192 LYS A C   1 
ATOM   1497  O O   . LYS A  1  192 ? 164.222 164.610 133.850 1.00 32.54  ? 192 LYS A O   1 
ATOM   1498  C CB  . LYS A  1  192 ? 167.465 163.807 134.209 1.00 32.54  ? 192 LYS A CB  1 
ATOM   1499  C CG  . LYS A  1  192 ? 168.655 163.436 135.069 1.00 32.54  ? 192 LYS A CG  1 
ATOM   1500  C CD  . LYS A  1  192 ? 169.775 162.818 134.250 1.00 32.54  ? 192 LYS A CD  1 
ATOM   1501  C CE  . LYS A  1  192 ? 170.953 162.452 135.140 1.00 32.54  ? 192 LYS A CE  1 
ATOM   1502  N NZ  . LYS A  1  192 ? 172.068 161.829 134.379 1.00 32.54  ? 192 LYS A NZ  1 
ATOM   1503  N N   . LEU A  1  193 ? 165.752 166.200 133.400 1.00 24.89  ? 193 LEU A N   1 
ATOM   1504  C CA  . LEU A  1  193 ? 164.917 166.948 132.477 1.00 24.89  ? 193 LEU A CA  1 
ATOM   1505  C C   . LEU A  1  193 ? 165.585 166.998 131.111 1.00 24.89  ? 193 LEU A C   1 
ATOM   1506  O O   . LEU A  1  193 ? 166.813 167.046 131.005 1.00 24.89  ? 193 LEU A O   1 
ATOM   1507  C CB  . LEU A  1  193 ? 164.670 168.361 132.994 1.00 24.89  ? 193 LEU A CB  1 
ATOM   1508  C CG  . LEU A  1  193 ? 163.910 168.412 134.315 1.00 24.89  ? 193 LEU A CG  1 
ATOM   1509  C CD1 . LEU A  1  193 ? 163.840 169.829 134.836 1.00 24.89  ? 193 LEU A CD1 1 
ATOM   1510  C CD2 . LEU A  1  193 ? 162.528 167.851 134.130 1.00 24.89  ? 193 LEU A CD2 1 
ATOM   1511  N N   . ILE A  1  194 ? 164.765 166.979 130.063 1.00 24.19  ? 194 ILE A N   1 
ATOM   1512  C CA  . ILE A  1  194 ? 165.250 166.897 128.692 1.00 24.19  ? 194 ILE A CA  1 
ATOM   1513  C C   . ILE A  1  194 ? 164.446 167.869 127.841 1.00 24.19  ? 194 ILE A C   1 
ATOM   1514  O O   . ILE A  1  194 ? 163.305 168.207 128.166 1.00 24.19  ? 194 ILE A O   1 
ATOM   1515  C CB  . ILE A  1  194 ? 165.136 165.457 128.145 1.00 24.19  ? 194 ILE A CB  1 
ATOM   1516  C CG1 . ILE A  1  194 ? 165.896 164.480 129.037 1.00 24.19  ? 194 ILE A CG1 1 
ATOM   1517  C CG2 . ILE A  1  194 ? 165.714 165.352 126.754 1.00 24.19  ? 194 ILE A CG2 1 
ATOM   1518  C CD1 . ILE A  1  194 ? 165.623 163.032 128.714 1.00 24.19  ? 194 ILE A CD1 1 
ATOM   1519  N N   . THR A  1  195 ? 165.052 168.335 126.752 1.00 21.23  ? 195 THR A N   1 
ATOM   1520  C CA  . THR A  1  195 ? 164.358 169.135 125.753 1.00 21.23  ? 195 THR A CA  1 
ATOM   1521  C C   . THR A  1  195 ? 164.835 168.700 124.378 1.00 21.23  ? 195 THR A C   1 
ATOM   1522  O O   . THR A  1  195 ? 166.043 168.636 124.136 1.00 21.23  ? 195 THR A O   1 
ATOM   1523  C CB  . THR A  1  195 ? 164.612 170.630 125.955 1.00 21.23  ? 195 THR A CB  1 
ATOM   1524  O OG1 . THR A  1  195 ? 164.172 171.014 127.261 1.00 21.23  ? 195 THR A OG1 1 
ATOM   1525  C CG2 . THR A  1  195 ? 163.853 171.434 124.920 1.00 21.23  ? 195 THR A CG2 1 
ATOM   1526  N N   . LYS A  1  196 ? 163.899 168.399 123.483 1.00 22.31  ? 196 LYS A N   1 
ATOM   1527  C CA  . LYS A  1  196 ? 164.243 167.806 122.200 1.00 22.31  ? 196 LYS A CA  1 
ATOM   1528  C C   . LYS A  1  196 ? 163.396 168.415 121.096 1.00 22.31  ? 196 LYS A C   1 
ATOM   1529  O O   . LYS A  1  196 ? 162.479 169.201 121.342 1.00 22.31  ? 196 LYS A O   1 
ATOM   1530  C CB  . LYS A  1  196 ? 164.048 166.287 122.215 1.00 22.31  ? 196 LYS A CB  1 
ATOM   1531  C CG  . LYS A  1  196 ? 165.005 165.551 123.118 1.00 22.31  ? 196 LYS A CG  1 
ATOM   1532  C CD  . LYS A  1  196 ? 164.855 164.053 122.973 1.00 22.31  ? 196 LYS A CD  1 
ATOM   1533  C CE  . LYS A  1  196 ? 163.596 163.564 123.656 1.00 22.31  ? 196 LYS A CE  1 
ATOM   1534  N NZ  . LYS A  1  196 ? 163.513 162.081 123.636 1.00 22.31  ? 196 LYS A NZ  1 
ATOM   1535  N N   . LYS A  1  197 ? 163.725 168.038 119.864 1.00 24.56  ? 197 LYS A N   1 
ATOM   1536  C CA  . LYS A  1  197 ? 162.915 168.339 118.692 1.00 24.56  ? 197 LYS A CA  1 
ATOM   1537  C C   . LYS A  1  197 ? 162.777 167.060 117.886 1.00 24.56  ? 197 LYS A C   1 
ATOM   1538  O O   . LYS A  1  197 ? 163.776 166.523 117.399 1.00 24.56  ? 197 LYS A O   1 
ATOM   1539  C CB  . LYS A  1  197 ? 163.544 169.446 117.844 1.00 24.56  ? 197 LYS A CB  1 
ATOM   1540  C CG  . LYS A  1  197 ? 163.523 170.804 118.503 1.00 24.56  ? 197 LYS A CG  1 
ATOM   1541  C CD  . LYS A  1  197 ? 164.090 171.867 117.586 1.00 24.56  ? 197 LYS A CD  1 
ATOM   1542  C CE  . LYS A  1  197 ? 164.078 173.227 118.259 1.00 24.56  ? 197 LYS A CE  1 
ATOM   1543  N NZ  . LYS A  1  197 ? 164.651 174.284 117.383 1.00 24.56  ? 197 LYS A NZ  1 
ATOM   1544  N N   . VAL A  1  198 ? 161.555 166.575 117.750 1.00 24.40  ? 198 VAL A N   1 
ATOM   1545  C CA  . VAL A  1  198 ? 161.281 165.296 117.111 1.00 24.40  ? 198 VAL A CA  1 
ATOM   1546  C C   . VAL A  1  198 ? 160.735 165.554 115.718 1.00 24.40  ? 198 VAL A C   1 
ATOM   1547  O O   . VAL A  1  198 ? 159.991 166.516 115.498 1.00 24.40  ? 198 VAL A O   1 
ATOM   1548  C CB  . VAL A  1  198 ? 160.292 164.472 117.952 1.00 24.40  ? 198 VAL A CB  1 
ATOM   1549  C CG1 . VAL A  1  198 ? 159.988 163.152 117.283 1.00 24.40  ? 198 VAL A CG1 1 
ATOM   1550  C CG2 . VAL A  1  198 ? 160.848 164.250 119.336 1.00 24.40  ? 198 VAL A CG2 1 
ATOM   1551  N N   . VAL A  1  199 ? 161.109 164.700 114.771 1.00 27.09  ? 199 VAL A N   1 
ATOM   1552  C CA  . VAL A  1  199 ? 160.687 164.823 113.381 1.00 27.09  ? 199 VAL A CA  1 
ATOM   1553  C C   . VAL A  1  199 ? 159.766 163.661 113.046 1.00 27.09  ? 199 VAL A C   1 
ATOM   1554  O O   . VAL A  1  199 ? 160.172 162.495 113.122 1.00 27.09  ? 199 VAL A O   1 
ATOM   1555  C CB  . VAL A  1  199 ? 161.887 164.858 112.425 1.00 27.09  ? 199 VAL A CB  1 
ATOM   1556  C CG1 . VAL A  1  199 ? 161.409 164.831 110.989 1.00 27.09  ? 199 VAL A CG1 1 
ATOM   1557  C CG2 . VAL A  1  199 ? 162.728 166.094 112.679 1.00 27.09  ? 199 VAL A CG2 1 
ATOM   1558  N N   . PHE A  1  200 ? 158.568 163.995 112.596 1.00 33.96  ? 200 PHE A N   1 
ATOM   1559  C CA  . PHE A  1  200 ? 157.638 163.000 112.102 1.00 33.96  ? 200 PHE A CA  1 
ATOM   1560  C C   . PHE A  1  200 ? 157.542 163.213 110.584 1.00 33.96  ? 200 PHE A C   1 
ATOM   1561  O O   . PHE A  1  200 ? 158.364 163.910 109.983 1.00 33.96  ? 200 PHE A O   1 
ATOM   1562  C CB  . PHE A  1  200 ? 156.280 163.119 112.779 1.00 33.96  ? 200 PHE A CB  1 
ATOM   1563  C CG  . PHE A  1  200 ? 156.254 162.562 114.169 1.00 33.96  ? 200 PHE A CG  1 
ATOM   1564  C CD1 . PHE A  1  200 ? 156.294 161.201 114.379 1.00 33.96  ? 200 PHE A CD1 1 
ATOM   1565  C CD2 . PHE A  1  200 ? 156.196 163.397 115.263 1.00 33.96  ? 200 PHE A CD2 1 
ATOM   1566  C CE1 . PHE A  1  200 ? 156.274 160.681 115.656 1.00 33.96  ? 200 PHE A CE1 1 
ATOM   1567  C CE2 . PHE A  1  200 ? 156.173 162.886 116.544 1.00 33.96  ? 200 PHE A CE2 1 
ATOM   1568  C CZ  . PHE A  1  200 ? 156.214 161.525 116.742 1.00 33.96  ? 200 PHE A CZ  1 
ATOM   1569  N N   . SER A  1  201 ? 156.550 162.617 109.948 1.00 35.78  ? 201 SER A N   1 
ATOM   1570  C CA  . SER A  1  201 ? 156.404 162.766 108.506 1.00 35.78  ? 201 SER A CA  1 
ATOM   1571  C C   . SER A  1  201 ? 155.832 164.126 108.125 1.00 35.78  ? 201 SER A C   1 
ATOM   1572  O O   . SER A  1  201 ? 156.065 164.601 107.008 1.00 35.78  ? 201 SER A O   1 
ATOM   1573  C CB  . SER A  1  201 ? 155.525 161.646 107.955 1.00 35.78  ? 201 SER A CB  1 
ATOM   1574  O OG  . SER A  1  201 ? 156.135 160.383 108.159 1.00 35.78  ? 201 SER A OG  1 
ATOM   1575  N N   . THR A  1  202 ? 155.057 164.730 109.019 1.00 33.33  ? 202 THR A N   1 
ATOM   1576  C CA  . THR A  1  202 ? 154.408 166.005 108.719 1.00 33.33  ? 202 THR A CA  1 
ATOM   1577  C C   . THR A  1  202 ? 155.191 167.264 109.071 1.00 33.33  ? 202 THR A C   1 
ATOM   1578  O O   . THR A  1  202 ? 154.939 168.325 108.505 1.00 33.33  ? 202 THR A O   1 
ATOM   1579  C CB  . THR A  1  202 ? 153.018 166.084 109.364 1.00 33.33  ? 202 THR A CB  1 
ATOM   1580  O OG1 . THR A  1  202 ? 153.151 166.035 110.787 1.00 33.33  ? 202 THR A OG1 1 
ATOM   1581  C CG2 . THR A  1  202 ? 152.166 164.924 108.905 1.00 33.33  ? 202 THR A CG2 1 
ATOM   1582  N N   . GLY A  1  203 ? 156.122 167.167 110.010 1.00 28.59  ? 203 GLY A N   1 
ATOM   1583  C CA  . GLY A  1  203 ? 156.912 168.329 110.365 1.00 28.59  ? 203 GLY A CA  1 
ATOM   1584  C C   . GLY A  1  203 ? 157.839 168.025 111.520 1.00 28.59  ? 203 GLY A C   1 
ATOM   1585  O O   . GLY A  1  203 ? 158.073 166.867 111.868 1.00 28.59  ? 203 GLY A O   1 
ATOM   1586  N N   . SER A  1  204 ? 158.376 169.092 112.105 1.00 25.40  ? 204 SER A N   1 
ATOM   1587  C CA  . SER A  1  204 ? 159.248 169.009 113.269 1.00 25.40  ? 204 SER A CA  1 
ATOM   1588  C C   . SER A  1  204 ? 158.491 169.517 114.487 1.00 25.40  ? 204 SER A C   1 
ATOM   1589  O O   . SER A  1  204 ? 158.132 170.697 114.547 1.00 25.40  ? 204 SER A O   1 
ATOM   1590  C CB  . SER A  1  204 ? 160.523 169.821 113.051 1.00 25.40  ? 204 SER A CB  1 
ATOM   1591  O OG  . SER A  1  204 ? 161.341 169.793 114.203 1.00 25.40  ? 204 SER A OG  1 
ATOM   1592  N N   . TYR A  1  205 ? 158.198 168.647 115.435 1.00 23.79  ? 205 TYR A N   1 
ATOM   1593  C CA  . TYR A  1  205 ? 157.458 169.087 116.600 1.00 23.79  ? 205 TYR A CA  1 
ATOM   1594  C C   . TYR A  1  205 ? 158.353 169.124 117.810 1.00 23.79  ? 205 TYR A C   1 
ATOM   1595  O O   . TYR A  1  205 ? 159.221 168.276 117.956 1.00 23.79  ? 205 TYR A O   1 
ATOM   1596  C CB  . TYR A  1  205 ? 156.291 168.143 116.853 1.00 23.79  ? 205 TYR A CB  1 
ATOM   1597  C CG  . TYR A  1  205 ? 155.354 168.044 115.683 1.00 23.79  ? 205 TYR A CG  1 
ATOM   1598  C CD1 . TYR A  1  205 ? 155.767 167.488 114.491 1.00 23.79  ? 205 TYR A CD1 1 
ATOM   1599  C CD2 . TYR A  1  205 ? 154.060 168.520 115.766 1.00 23.79  ? 205 TYR A CD2 1 
ATOM   1600  C CE1 . TYR A  1  205 ? 154.917 167.401 113.412 1.00 23.79  ? 205 TYR A CE1 1 
ATOM   1601  C CE2 . TYR A  1  205 ? 153.201 168.435 114.693 1.00 23.79  ? 205 TYR A CE2 1 
ATOM   1602  C CZ  . TYR A  1  205 ? 153.634 167.875 113.522 1.00 23.79  ? 205 TYR A CZ  1 
ATOM   1603  O OH  . TYR A  1  205 ? 152.788 167.788 112.447 1.00 23.79  ? 205 TYR A OH  1 
ATOM   1604  N N   . PRO A  1  206 ? 158.139 170.101 118.704 1.00 20.00  ? 206 PRO A N   1 
ATOM   1605  C CA  . PRO A  1  206 ? 158.918 170.194 119.941 1.00 20.00  ? 206 PRO A CA  1 
ATOM   1606  C C   . PRO A  1  206 ? 158.499 169.124 120.931 1.00 20.00  ? 206 PRO A C   1 
ATOM   1607  O O   . PRO A  1  206 ? 157.435 168.520 120.814 1.00 20.00  ? 206 PRO A O   1 
ATOM   1608  C CB  . PRO A  1  206 ? 158.580 171.590 120.464 1.00 20.00  ? 206 PRO A CB  1 
ATOM   1609  C CG  . PRO A  1  206 ? 157.235 171.854 119.928 1.00 20.00  ? 206 PRO A CG  1 
ATOM   1610  C CD  . PRO A  1  206 ? 157.178 171.206 118.579 1.00 20.00  ? 206 PRO A CD  1 
ATOM   1611  N N   . ARG A  1  207 ? 159.360 168.885 121.917 1.00 16.81  ? 207 ARG A N   1 
ATOM   1612  C CA  . ARG A  1  207 ? 159.083 167.865 122.919 1.00 16.81  ? 207 ARG A CA  1 
ATOM   1613  C C   . ARG A  1  207 ? 159.818 168.171 124.212 1.00 16.81  ? 207 ARG A C   1 
ATOM   1614  O O   . ARG A  1  207 ? 160.945 168.666 124.191 1.00 16.81  ? 207 ARG A O   1 
ATOM   1615  C CB  . ARG A  1  207 ? 159.478 166.470 122.427 1.00 16.81  ? 207 ARG A CB  1 
ATOM   1616  C CG  . ARG A  1  207 ? 159.259 165.387 123.463 1.00 16.81  ? 207 ARG A CG  1 
ATOM   1617  C CD  . ARG A  1  207 ? 159.523 164.009 122.918 1.00 16.81  ? 207 ARG A CD  1 
ATOM   1618  N NE  . ARG A  1  207 ? 158.527 163.640 121.924 1.00 16.81  ? 207 ARG A NE  1 
ATOM   1619  C CZ  . ARG A  1  207 ? 158.587 162.538 121.189 1.00 16.81  ? 207 ARG A CZ  1 
ATOM   1620  N NH1 . ARG A  1  207 ? 159.596 161.696 121.342 1.00 16.81  ? 207 ARG A NH1 1 
ATOM   1621  N NH2 . ARG A  1  207 ? 157.640 162.280 120.302 1.00 16.81  ? 207 ARG A NH2 1 
ATOM   1622  N N   . LEU A  1  208 ? 159.169 167.873 125.332 1.00 18.41  ? 208 LEU A N   1 
ATOM   1623  C CA  . LEU A  1  208 ? 159.787 167.889 126.645 1.00 18.41  ? 208 LEU A CA  1 
ATOM   1624  C C   . LEU A  1  208 ? 159.624 166.520 127.285 1.00 18.41  ? 208 LEU A C   1 
ATOM   1625  O O   . LEU A  1  208 ? 158.661 165.803 127.009 1.00 18.41  ? 208 LEU A O   1 
ATOM   1626  C CB  . LEU A  1  208 ? 159.174 168.955 127.540 1.00 18.41  ? 208 LEU A CB  1 
ATOM   1627  C CG  . LEU A  1  208 ? 159.421 170.386 127.087 1.00 18.41  ? 208 LEU A CG  1 
ATOM   1628  C CD1 . LEU A  1  208 ? 158.675 171.348 127.970 1.00 18.41  ? 208 LEU A CD1 1 
ATOM   1629  C CD2 . LEU A  1  208 ? 160.900 170.682 127.115 1.00 18.41  ? 208 LEU A CD2 1 
ATOM   1630  N N   . SER A  1  209 ? 160.573 166.153 128.136 1.00 20.22  ? 209 SER A N   1 
ATOM   1631  C CA  . SER A  1  209 ? 160.586 164.833 128.745 1.00 20.22  ? 209 SER A CA  1 
ATOM   1632  C C   . SER A  1  209 ? 160.832 164.942 130.238 1.00 20.22  ? 209 SER A C   1 
ATOM   1633  O O   . SER A  1  209 ? 161.562 165.825 130.693 1.00 20.22  ? 209 SER A O   1 
ATOM   1634  C CB  . SER A  1  209 ? 161.656 163.946 128.114 1.00 20.22  ? 209 SER A CB  1 
ATOM   1635  O OG  . SER A  1  209 ? 161.700 162.682 128.749 1.00 20.22  ? 209 SER A OG  1 
ATOM   1636  N N   . LEU A  1  210 ? 160.221 164.037 130.996 1.00 23.32  ? 210 LEU A N   1 
ATOM   1637  C CA  . LEU A  1  210 ? 160.461 163.904 132.426 1.00 23.32  ? 210 LEU A CA  1 
ATOM   1638  C C   . LEU A  1  210 ? 160.744 162.443 132.718 1.00 23.32  ? 210 LEU A C   1 
ATOM   1639  O O   . LEU A  1  210 ? 159.916 161.579 132.418 1.00 23.32  ? 210 LEU A O   1 
ATOM   1640  C CB  . LEU A  1  210 ? 159.265 164.395 133.241 1.00 23.32  ? 210 LEU A CB  1 
ATOM   1641  C CG  . LEU A  1  210 ? 159.429 164.254 134.751 1.00 23.32  ? 210 LEU A CG  1 
ATOM   1642  C CD1 . LEU A  1  210 ? 160.605 165.067 135.214 1.00 23.32  ? 210 LEU A CD1 1 
ATOM   1643  C CD2 . LEU A  1  210 ? 158.173 164.690 135.470 1.00 23.32  ? 210 LEU A CD2 1 
ATOM   1644  N N   . SER A  1  211 ? 161.905 162.164 133.300 1.00 35.09  ? 211 SER A N   1 
ATOM   1645  C CA  . SER A  1  211 ? 162.342 160.791 133.501 1.00 35.09  ? 211 SER A CA  1 
ATOM   1646  C C   . SER A  1  211 ? 162.976 160.659 134.872 1.00 35.09  ? 211 SER A C   1 
ATOM   1647  O O   . SER A  1  211 ? 163.847 161.455 135.231 1.00 35.09  ? 211 SER A O   1 
ATOM   1648  C CB  . SER A  1  211 ? 163.340 160.376 132.420 1.00 35.09  ? 211 SER A CB  1 
ATOM   1649  O OG  . SER A  1  211 ? 162.742 160.436 131.139 1.00 35.09  ? 211 SER A OG  1 
ATOM   1650  N N   . PHE A  1  212 ? 162.546 159.655 135.630 1.00 41.28  ? 212 PHE A N   1 
ATOM   1651  C CA  . PHE A  1  212 ? 163.093 159.408 136.953 1.00 41.28  ? 212 PHE A CA  1 
ATOM   1652  C C   . PHE A  1  212 ? 163.278 157.916 137.171 1.00 41.28  ? 212 PHE A C   1 
ATOM   1653  O O   . PHE A  1  212 ? 162.395 157.120 136.844 1.00 41.28  ? 212 PHE A O   1 
ATOM   1654  C CB  . PHE A  1  212 ? 162.207 160.015 138.049 1.00 41.28  ? 212 PHE A CB  1 
ATOM   1655  C CG  . PHE A  1  212 ? 160.765 159.618 137.966 1.00 41.28  ? 212 PHE A CG  1 
ATOM   1656  C CD1 . PHE A  1  212 ? 160.304 158.483 138.600 1.00 41.28  ? 212 PHE A CD1 1 
ATOM   1657  C CD2 . PHE A  1  212 ? 159.865 160.399 137.267 1.00 41.28  ? 212 PHE A CD2 1 
ATOM   1658  C CE1 . PHE A  1  212 ? 158.977 158.128 138.527 1.00 41.28  ? 212 PHE A CE1 1 
ATOM   1659  C CE2 . PHE A  1  212 ? 158.538 160.050 137.195 1.00 41.28  ? 212 PHE A CE2 1 
ATOM   1660  C CZ  . PHE A  1  212 ? 158.093 158.913 137.826 1.00 41.28  ? 212 PHE A CZ  1 
ATOM   1661  N N   . LYS A  1  213 ? 164.433 157.548 137.719 1.00 49.98  ? 213 LYS A N   1 
ATOM   1662  C CA  . LYS A  1  213 ? 164.767 156.147 137.908 1.00 49.98  ? 213 LYS A CA  1 
ATOM   1663  C C   . LYS A  1  213 ? 163.944 155.537 139.036 1.00 49.98  ? 213 LYS A C   1 
ATOM   1664  O O   . LYS A  1  213 ? 163.439 156.228 139.922 1.00 49.98  ? 213 LYS A O   1 
ATOM   1665  C CB  . LYS A  1  213 ? 166.254 155.980 138.211 1.00 49.98  ? 213 LYS A CB  1 
ATOM   1666  C CG  . LYS A  1  213 ? 167.158 156.181 137.014 1.00 49.98  ? 213 LYS A CG  1 
ATOM   1667  C CD  . LYS A  1  213 ? 168.630 156.172 137.401 1.00 49.98  ? 213 LYS A CD  1 
ATOM   1668  C CE  . LYS A  1  213 ? 169.239 154.788 137.276 1.00 49.98  ? 213 LYS A CE  1 
ATOM   1669  N NZ  . LYS A  1  213 ? 168.749 153.859 138.324 1.00 49.98  ? 213 LYS A NZ  1 
ATOM   1670  N N   . LEU A  1  214 ? 163.817 154.216 138.990 1.00 48.23  ? 214 LEU A N   1 
ATOM   1671  C CA  . LEU A  1  214 ? 163.133 153.452 140.019 1.00 48.23  ? 214 LEU A CA  1 
ATOM   1672  C C   . LEU A  1  214 ? 164.031 152.306 140.455 1.00 48.23  ? 214 LEU A C   1 
ATOM   1673  O O   . LEU A  1  214 ? 164.669 151.656 139.623 1.00 48.23  ? 214 LEU A O   1 
ATOM   1674  C CB  . LEU A  1  214 ? 161.796 152.910 139.514 1.00 48.23  ? 214 LEU A CB  1 
ATOM   1675  C CG  . LEU A  1  214 ? 160.739 153.958 139.178 1.00 48.23  ? 214 LEU A CG  1 
ATOM   1676  C CD1 . LEU A  1  214 ? 159.511 153.311 138.566 1.00 48.23  ? 214 LEU A CD1 1 
ATOM   1677  C CD2 . LEU A  1  214 ? 160.367 154.718 140.421 1.00 48.23  ? 214 LEU A CD2 1 
ATOM   1678  N N   . LYS A  1  215 ? 164.080 152.064 141.760 1.00 48.89  ? 215 LYS A N   1 
ATOM   1679  C CA  . LYS A  1  215 ? 164.920 151.023 142.332 1.00 48.89  ? 215 LYS A CA  1 
ATOM   1680  C C   . LYS A  1  215 ? 164.110 150.239 143.352 1.00 48.89  ? 215 LYS A C   1 
ATOM   1681  O O   . LYS A  1  215 ? 163.298 150.813 144.081 1.00 48.89  ? 215 LYS A O   1 
ATOM   1682  C CB  . LYS A  1  215 ? 166.165 151.630 142.981 1.00 48.89  ? 215 LYS A CB  1 
ATOM   1683  C CG  . LYS A  1  215 ? 167.183 150.622 143.469 1.00 48.89  ? 215 LYS A CG  1 
ATOM   1684  C CD  . LYS A  1  215 ? 168.420 151.328 143.997 1.00 48.89  ? 215 LYS A CD  1 
ATOM   1685  C CE  . LYS A  1  215 ? 169.457 150.341 144.497 1.00 48.89  ? 215 LYS A CE  1 
ATOM   1686  N NZ  . LYS A  1  215 ? 170.666 151.038 145.012 1.00 48.89  ? 215 LYS A NZ  1 
ATOM   1687  N N   . ARG A  1  216 ? 164.327 148.930 143.398 1.00 52.84  ? 216 ARG A N   1 
ATOM   1688  C CA  . ARG A  1  216 ? 163.546 148.072 144.273 1.00 52.84  ? 216 ARG A CA  1 
ATOM   1689  C C   . ARG A  1  216 ? 164.195 147.956 145.647 1.00 52.84  ? 216 ARG A C   1 
ATOM   1690  O O   . ARG A  1  216 ? 165.393 148.185 145.821 1.00 52.84  ? 216 ARG A O   1 
ATOM   1691  C CB  . ARG A  1  216 ? 163.381 146.682 143.662 1.00 52.84  ? 216 ARG A CB  1 
ATOM   1692  C CG  . ARG A  1  216 ? 162.556 146.664 142.396 1.00 52.84  ? 216 ARG A CG  1 
ATOM   1693  C CD  . ARG A  1  216 ? 162.373 145.252 141.882 1.00 52.84  ? 216 ARG A CD  1 
ATOM   1694  N NE  . ARG A  1  216 ? 161.705 145.225 140.586 1.00 52.84  ? 216 ARG A NE  1 
ATOM   1695  C CZ  . ARG A  1  216 ? 160.390 145.143 140.424 1.00 52.84  ? 216 ARG A CZ  1 
ATOM   1696  N NH1 . ARG A  1  216 ? 159.594 145.075 141.480 1.00 52.84  ? 216 ARG A NH1 1 
ATOM   1697  N NH2 . ARG A  1  216 ? 159.872 145.125 139.206 1.00 52.84  ? 216 ARG A NH2 1 
ATOM   1698  N N   . ASN A  1  217 ? 163.376 147.596 146.630 1.00 63.12  ? 217 ASN A N   1 
ATOM   1699  C CA  . ASN A  1  217 ? 163.847 147.346 147.990 1.00 63.12  ? 217 ASN A CA  1 
ATOM   1700  C C   . ASN A  1  217 ? 164.187 145.866 148.100 1.00 63.12  ? 217 ASN A C   1 
ATOM   1701  O O   . ASN A  1  217 ? 163.307 145.025 148.298 1.00 63.12  ? 217 ASN A O   1 
ATOM   1702  C CB  . ASN A  1  217 ? 162.796 147.762 149.011 1.00 63.12  ? 217 ASN A CB  1 
ATOM   1703  C CG  . ASN A  1  217 ? 162.658 149.265 149.120 1.00 63.12  ? 217 ASN A CG  1 
ATOM   1704  O OD1 . ASN A  1  217 ? 163.651 149.991 149.130 1.00 63.12  ? 217 ASN A OD1 1 
ATOM   1705  N ND2 . ASN A  1  217 ? 161.422 149.742 149.198 1.00 63.12  ? 217 ASN A ND2 1 
ATOM   1706  N N   . ILE A  1  218 ? 165.476 145.548 147.973 1.00 66.51  ? 218 ILE A N   1 
ATOM   1707  C CA  . ILE A  1  218 ? 165.902 144.155 147.923 1.00 66.51  ? 218 ILE A CA  1 
ATOM   1708  C C   . ILE A  1  218 ? 165.643 143.455 149.252 1.00 66.51  ? 218 ILE A C   1 
ATOM   1709  O O   . ILE A  1  218 ? 165.327 142.257 149.282 1.00 66.51  ? 218 ILE A O   1 
ATOM   1710  C CB  . ILE A  1  218 ? 167.386 144.087 147.524 1.00 66.51  ? 218 ILE A CB  1 
ATOM   1711  C CG1 . ILE A  1  218 ? 167.598 144.770 146.176 1.00 66.51  ? 218 ILE A CG1 1 
ATOM   1712  C CG2 . ILE A  1  218 ? 167.847 142.655 147.423 1.00 66.51  ? 218 ILE A CG2 1 
ATOM   1713  C CD1 . ILE A  1  218 ? 169.052 144.983 145.825 1.00 66.51  ? 218 ILE A CD1 1 
ATOM   1714  N N   . GLY A  1  219 ? 165.749 144.188 150.362 1.00 74.83  ? 219 GLY A N   1 
ATOM   1715  C CA  . GLY A  1  219 ? 165.562 143.603 151.678 1.00 74.83  ? 219 GLY A CA  1 
ATOM   1716  C C   . GLY A  1  219 ? 164.194 142.999 151.903 1.00 74.83  ? 219 GLY A C   1 
ATOM   1717  O O   . GLY A  1  219 ? 164.045 142.127 152.763 1.00 74.83  ? 219 GLY A O   1 
ATOM   1718  N N   . TYR A  1  220 ? 163.186 143.444 151.155 1.00 91.33  ? 220 TYR A N   1 
ATOM   1719  C CA  . TYR A  1  220 ? 161.865 142.846 151.280 1.00 91.33  ? 220 TYR A CA  1 
ATOM   1720  C C   . TYR A  1  220 ? 161.787 141.497 150.580 1.00 91.33  ? 220 TYR A C   1 
ATOM   1721  O O   . TYR A  1  220 ? 160.937 140.671 150.929 1.00 91.33  ? 220 TYR A O   1 
ATOM   1722  C CB  . TYR A  1  220 ? 160.806 143.802 150.726 1.00 91.33  ? 220 TYR A CB  1 
ATOM   1723  C CG  . TYR A  1  220 ? 159.382 143.321 150.893 1.00 91.33  ? 220 TYR A CG  1 
ATOM   1724  C CD1 . TYR A  1  220 ? 158.764 143.338 152.138 1.00 91.33  ? 220 TYR A CD1 1 
ATOM   1725  C CD2 . TYR A  1  220 ? 158.649 142.867 149.805 1.00 91.33  ? 220 TYR A CD2 1 
ATOM   1726  C CE1 . TYR A  1  220 ? 157.463 142.904 152.296 1.00 91.33  ? 220 TYR A CE1 1 
ATOM   1727  C CE2 . TYR A  1  220 ? 157.347 142.433 149.953 1.00 91.33  ? 220 TYR A CE2 1 
ATOM   1728  C CZ  . TYR A  1  220 ? 156.758 142.453 151.201 1.00 91.33  ? 220 TYR A CZ  1 
ATOM   1729  O OH  . TYR A  1  220 ? 155.461 142.021 151.353 1.00 91.33  ? 220 TYR A OH  1 
ATOM   1730  N N   . PHE A  1  221 ? 162.662 141.253 149.603 1.00 76.49  ? 221 PHE A N   1 
ATOM   1731  C CA  . PHE A  1  221 ? 162.649 140.012 148.838 1.00 76.49  ? 221 PHE A CA  1 
ATOM   1732  C C   . PHE A  1  221 ? 163.669 138.992 149.312 1.00 76.49  ? 221 PHE A C   1 
ATOM   1733  O O   . PHE A  1  221 ? 163.462 137.791 149.099 1.00 76.49  ? 221 PHE A O   1 
ATOM   1734  C CB  . PHE A  1  221 ? 162.898 140.293 147.354 1.00 76.49  ? 221 PHE A CB  1 
ATOM   1735  C CG  . PHE A  1  221 ? 161.766 140.989 146.670 1.00 76.49  ? 221 PHE A CG  1 
ATOM   1736  C CD1 . PHE A  1  221 ? 160.523 141.066 147.266 1.00 76.49  ? 221 PHE A CD1 1 
ATOM   1737  C CD2 . PHE A  1  221 ? 161.942 141.561 145.426 1.00 76.49  ? 221 PHE A CD2 1 
ATOM   1738  C CE1 . PHE A  1  221 ? 159.483 141.706 146.638 1.00 76.49  ? 221 PHE A CE1 1 
ATOM   1739  C CE2 . PHE A  1  221 ? 160.905 142.202 144.793 1.00 76.49  ? 221 PHE A CE2 1 
ATOM   1740  C CZ  . PHE A  1  221 ? 159.673 142.273 145.400 1.00 76.49  ? 221 PHE A CZ  1 
ATOM   1741  N N   . ILE A  1  222 ? 164.770 139.439 149.922 1.00 73.93  ? 222 ILE A N   1 
ATOM   1742  C CA  . ILE A  1  222 ? 165.817 138.511 150.354 1.00 73.93  ? 222 ILE A CA  1 
ATOM   1743  C C   . ILE A  1  222 ? 165.228 137.419 151.238 1.00 73.93  ? 222 ILE A C   1 
ATOM   1744  O O   . ILE A  1  222 ? 165.237 136.233 150.886 1.00 73.93  ? 222 ILE A O   1 
ATOM   1745  C CB  . ILE A  1  222 ? 166.944 139.262 151.081 1.00 73.93  ? 222 ILE A CB  1 
ATOM   1746  C CG1 . ILE A  1  222 ? 167.661 140.207 150.120 1.00 73.93  ? 222 ILE A CG1 1 
ATOM   1747  C CG2 . ILE A  1  222 ? 167.924 138.280 151.701 1.00 73.93  ? 222 ILE A CG2 1 
ATOM   1748  C CD1 . ILE A  1  222 ? 168.344 139.488 148.980 1.00 73.93  ? 222 ILE A CD1 1 
ATOM   1749  N N   . LEU A  1  223 ? 164.670 137.820 152.382 1.00 69.90  ? 223 LEU A N   1 
ATOM   1750  C CA  . LEU A  1  223 ? 164.166 136.850 153.347 1.00 69.90  ? 223 LEU A CA  1 
ATOM   1751  C C   . LEU A  1  223 ? 163.061 135.991 152.750 1.00 69.90  ? 223 LEU A C   1 
ATOM   1752  O O   . LEU A  1  223 ? 162.990 134.786 153.016 1.00 69.90  ? 223 LEU A O   1 
ATOM   1753  C CB  . LEU A  1  223 ? 163.661 137.575 154.592 1.00 69.90  ? 223 LEU A CB  1 
ATOM   1754  C CG  . LEU A  1  223 ? 164.704 138.331 155.414 1.00 69.90  ? 223 LEU A CG  1 
ATOM   1755  C CD1 . LEU A  1  223 ? 164.035 139.136 156.515 1.00 69.90  ? 223 LEU A CD1 1 
ATOM   1756  C CD2 . LEU A  1  223 ? 165.714 137.365 155.997 1.00 69.90  ? 223 LEU A CD2 1 
ATOM   1757  N N   . GLN A  1  224 ? 162.195 136.587 151.933 1.00 86.09  ? 224 GLN A N   1 
ATOM   1758  C CA  . GLN A  1  224 ? 161.020 135.874 151.456 1.00 86.09  ? 224 GLN A CA  1 
ATOM   1759  C C   . GLN A  1  224 ? 161.323 134.902 150.325 1.00 86.09  ? 224 GLN A C   1 
ATOM   1760  O O   . GLN A  1  224 ? 160.553 133.957 150.124 1.00 86.09  ? 224 GLN A O   1 
ATOM   1761  C CB  . GLN A  1  224 ? 159.952 136.869 150.998 1.00 86.09  ? 224 GLN A CB  1 
ATOM   1762  C CG  . GLN A  1  224 ? 159.435 137.774 152.105 1.00 86.09  ? 224 GLN A CG  1 
ATOM   1763  C CD  . GLN A  1  224 ? 158.790 137.002 153.239 1.00 86.09  ? 224 GLN A CD  1 
ATOM   1764  O OE1 . GLN A  1  224 ? 159.328 136.935 154.345 1.00 86.09  ? 224 GLN A OE1 1 
ATOM   1765  N NE2 . GLN A  1  224 ? 157.632 136.412 152.970 1.00 86.09  ? 224 GLN A NE2 1 
ATOM   1766  N N   . THR A  1  225 ? 162.408 135.102 149.578 1.00 76.17  ? 225 THR A N   1 
ATOM   1767  C CA  . THR A  1  225 ? 162.684 134.244 148.431 1.00 76.17  ? 225 THR A CA  1 
ATOM   1768  C C   . THR A  1  225 ? 163.981 133.463 148.556 1.00 76.17  ? 225 THR A C   1 
ATOM   1769  O O   . THR A  1  225 ? 163.976 132.239 148.388 1.00 76.17  ? 225 THR A O   1 
ATOM   1770  C CB  . THR A  1  225 ? 162.721 135.079 147.144 1.00 76.17  ? 225 THR A CB  1 
ATOM   1771  O OG1 . THR A  1  225 ? 163.796 136.022 147.221 1.00 76.17  ? 225 THR A OG1 1 
ATOM   1772  C CG2 . THR A  1  225 ? 161.415 135.826 146.957 1.00 76.17  ? 225 THR A CG2 1 
ATOM   1773  N N   . TYR A  1  226 ? 165.099 134.131 148.841 1.00 77.35  ? 226 TYR A N   1 
ATOM   1774  C CA  . TYR A  1  226 ? 166.397 133.510 148.593 1.00 77.35  ? 226 TYR A CA  1 
ATOM   1775  C C   . TYR A  1  226 ? 166.796 132.515 149.677 1.00 77.35  ? 226 TYR A C   1 
ATOM   1776  O O   . TYR A  1  226 ? 167.264 131.414 149.362 1.00 77.35  ? 226 TYR A O   1 
ATOM   1777  C CB  . TYR A  1  226 ? 167.465 134.591 148.444 1.00 77.35  ? 226 TYR A CB  1 
ATOM   1778  C CG  . TYR A  1  226 ? 167.389 135.332 147.132 1.00 77.35  ? 226 TYR A CG  1 
ATOM   1779  C CD1 . TYR A  1  226 ? 166.690 134.806 146.057 1.00 77.35  ? 226 TYR A CD1 1 
ATOM   1780  C CD2 . TYR A  1  226 ? 168.014 136.558 146.968 1.00 77.35  ? 226 TYR A CD2 1 
ATOM   1781  C CE1 . TYR A  1  226 ? 166.620 135.475 144.855 1.00 77.35  ? 226 TYR A CE1 1 
ATOM   1782  C CE2 . TYR A  1  226 ? 167.946 137.236 145.770 1.00 77.35  ? 226 TYR A CE2 1 
ATOM   1783  C CZ  . TYR A  1  226 ? 167.247 136.690 144.717 1.00 77.35  ? 226 TYR A CZ  1 
ATOM   1784  O OH  . TYR A  1  226 ? 167.176 137.360 143.520 1.00 77.35  ? 226 TYR A OH  1 
ATOM   1785  N N   . MET A  1  227 ? 166.624 132.874 150.947 1.00 79.26  ? 227 MET A N   1 
ATOM   1786  C CA  . MET A  1  227 ? 167.177 132.054 152.019 1.00 79.26  ? 227 MET A CA  1 
ATOM   1787  C C   . MET A  1  227 ? 166.619 130.634 152.122 1.00 79.26  ? 227 MET A C   1 
ATOM   1788  O O   . MET A  1  227 ? 167.354 129.770 152.628 1.00 79.26  ? 227 MET A O   1 
ATOM   1789  C CB  . MET A  1  227 ? 167.027 132.780 153.363 1.00 79.26  ? 227 MET A CB  1 
ATOM   1790  C CG  . MET A  1  227 ? 168.006 133.928 153.529 1.00 79.26  ? 227 MET A CG  1 
ATOM   1791  S SD  . MET A  1  227 ? 167.941 134.703 155.153 1.00 79.26  ? 227 MET A SD  1 
ATOM   1792  C CE  . MET A  1  227 ? 169.165 135.997 154.961 1.00 79.26  ? 227 MET A CE  1 
ATOM   1793  N N   . PRO A  1  228 ? 165.382 130.318 151.715 1.00 73.18  ? 228 PRO A N   1 
ATOM   1794  C CA  . PRO A  1  228 ? 164.985 128.896 151.725 1.00 73.18  ? 228 PRO A CA  1 
ATOM   1795  C C   . PRO A  1  228 ? 165.907 128.003 150.909 1.00 73.18  ? 228 PRO A C   1 
ATOM   1796  O O   . PRO A  1  228 ? 166.372 126.968 151.410 1.00 73.18  ? 228 PRO A O   1 
ATOM   1797  C CB  . PRO A  1  228 ? 163.560 128.933 151.160 1.00 73.18  ? 228 PRO A CB  1 
ATOM   1798  C CG  . PRO A  1  228 ? 163.054 130.263 151.546 1.00 73.18  ? 228 PRO A CG  1 
ATOM   1799  C CD  . PRO A  1  228 ? 164.225 131.191 151.440 1.00 73.18  ? 228 PRO A CD  1 
ATOM   1800  N N   . SER A  1  229 ? 166.195 128.379 149.662 1.00 73.42  ? 229 SER A N   1 
ATOM   1801  C CA  . SER A  1  229 ? 167.080 127.564 148.838 1.00 73.42  ? 229 SER A CA  1 
ATOM   1802  C C   . SER A  1  229 ? 168.489 127.521 149.416 1.00 73.42  ? 229 SER A C   1 
ATOM   1803  O O   . SER A  1  229 ? 169.169 126.493 149.333 1.00 73.42  ? 229 SER A O   1 
ATOM   1804  C CB  . SER A  1  229 ? 167.102 128.095 147.406 1.00 73.42  ? 229 SER A CB  1 
ATOM   1805  O OG  . SER A  1  229 ? 165.829 127.965 146.800 1.00 73.42  ? 229 SER A OG  1 
ATOM   1806  N N   . ILE A  1  230 ? 168.940 128.625 150.014 1.00 73.02  ? 230 ILE A N   1 
ATOM   1807  C CA  . ILE A  1  230 ? 170.263 128.650 150.631 1.00 73.02  ? 230 ILE A CA  1 
ATOM   1808  C C   . ILE A  1  230 ? 170.328 127.664 151.789 1.00 73.02  ? 230 ILE A C   1 
ATOM   1809  O O   . ILE A  1  230 ? 171.302 126.914 151.937 1.00 73.02  ? 230 ILE A O   1 
ATOM   1810  C CB  . ILE A  1  230 ? 170.608 130.079 151.087 1.00 73.02  ? 230 ILE A CB  1 
ATOM   1811  C CG1 . ILE A  1  230 ? 170.626 131.027 149.890 1.00 73.02  ? 230 ILE A CG1 1 
ATOM   1812  C CG2 . ILE A  1  230 ? 171.944 130.101 151.810 1.00 73.02  ? 230 ILE A CG2 1 
ATOM   1813  C CD1 . ILE A  1  230 ? 170.688 132.488 150.274 1.00 73.02  ? 230 ILE A CD1 1 
ATOM   1814  N N   . LEU A  1  231 ? 169.291 127.652 152.629 1.00 67.14  ? 231 LEU A N   1 
ATOM   1815  C CA  . LEU A  1  231 ? 169.255 126.722 153.750 1.00 67.14  ? 231 LEU A CA  1 
ATOM   1816  C C   . LEU A  1  231 ? 169.203 125.281 153.267 1.00 67.14  ? 231 LEU A C   1 
ATOM   1817  O O   . LEU A  1  231 ? 169.845 124.404 153.850 1.00 67.14  ? 231 LEU A O   1 
ATOM   1818  C CB  . LEU A  1  231 ? 168.062 127.025 154.655 1.00 67.14  ? 231 LEU A CB  1 
ATOM   1819  C CG  . LEU A  1  231 ? 168.104 128.337 155.434 1.00 67.14  ? 231 LEU A CG  1 
ATOM   1820  C CD1 . LEU A  1  231 ? 166.797 128.549 156.177 1.00 67.14  ? 231 LEU A CD1 1 
ATOM   1821  C CD2 . LEU A  1  231 ? 169.276 128.342 156.396 1.00 67.14  ? 231 LEU A CD2 1 
ATOM   1822  N N   . ILE A  1  232 ? 168.452 125.016 152.196 1.00 70.86  ? 232 ILE A N   1 
ATOM   1823  C CA  . ILE A  1  232 ? 168.391 123.650 151.682 1.00 70.86  ? 232 ILE A CA  1 
ATOM   1824  C C   . ILE A  1  232 ? 169.748 123.222 151.134 1.00 70.86  ? 232 ILE A C   1 
ATOM   1825  O O   . ILE A  1  232 ? 170.202 122.092 151.365 1.00 70.86  ? 232 ILE A O   1 
ATOM   1826  C CB  . ILE A  1  232 ? 167.285 123.524 150.623 1.00 70.86  ? 232 ILE A CB  1 
ATOM   1827  C CG1 . ILE A  1  232 ? 165.934 123.898 151.229 1.00 70.86  ? 232 ILE A CG1 1 
ATOM   1828  C CG2 . ILE A  1  232 ? 167.248 122.116 150.062 1.00 70.86  ? 232 ILE A CG2 1 
ATOM   1829  C CD1 . ILE A  1  232 ? 165.547 123.053 152.415 1.00 70.86  ? 232 ILE A CD1 1 
ATOM   1830  N N   . THR A  1  233 ? 170.425 124.120 150.415 1.00 76.98  ? 233 THR A N   1 
ATOM   1831  C CA  . THR A  1  233 ? 171.745 123.800 149.884 1.00 76.98  ? 233 THR A CA  1 
ATOM   1832  C C   . THR A  1  233 ? 172.737 123.524 151.005 1.00 76.98  ? 233 THR A C   1 
ATOM   1833  O O   . THR A  1  233 ? 173.514 122.564 150.934 1.00 76.98  ? 233 THR A O   1 
ATOM   1834  C CB  . THR A  1  233 ? 172.245 124.939 148.996 1.00 76.98  ? 233 THR A CB  1 
ATOM   1835  O OG1 . THR A  1  233 ? 171.344 125.121 147.897 1.00 76.98  ? 233 THR A OG1 1 
ATOM   1836  C CG2 . THR A  1  233 ? 173.631 124.628 148.460 1.00 76.98  ? 233 THR A CG2 1 
ATOM   1837  N N   . ILE A  1  234 ? 172.723 124.349 152.054 1.00 73.80  ? 234 ILE A N   1 
ATOM   1838  C CA  . ILE A  1  234 ? 173.621 124.118 153.182 1.00 73.80  ? 234 ILE A CA  1 
ATOM   1839  C C   . ILE A  1  234 ? 173.279 122.808 153.877 1.00 73.80  ? 234 ILE A C   1 
ATOM   1840  O O   . ILE A  1  234 ? 174.169 122.052 154.284 1.00 73.80  ? 234 ILE A O   1 
ATOM   1841  C CB  . ILE A  1  234 ? 173.577 125.309 154.157 1.00 73.80  ? 234 ILE A CB  1 
ATOM   1842  C CG1 . ILE A  1  234 ? 174.145 126.560 153.491 1.00 73.80  ? 234 ILE A CG1 1 
ATOM   1843  C CG2 . ILE A  1  234 ? 174.345 124.995 155.427 1.00 73.80  ? 234 ILE A CG2 1 
ATOM   1844  C CD1 . ILE A  1  234 ? 173.936 127.818 154.296 1.00 73.80  ? 234 ILE A CD1 1 
ATOM   1845  N N   . LEU A  1  235 ? 171.984 122.513 154.015 1.00 78.24  ? 235 LEU A N   1 
ATOM   1846  C CA  . LEU A  1  235 ? 171.560 121.263 154.632 1.00 78.24  ? 235 LEU A CA  1 
ATOM   1847  C C   . LEU A  1  235 ? 172.089 120.063 153.863 1.00 78.24  ? 235 LEU A C   1 
ATOM   1848  O O   . LEU A  1  235 ? 172.494 119.059 154.462 1.00 78.24  ? 235 LEU A O   1 
ATOM   1849  C CB  . LEU A  1  235 ? 170.036 121.216 154.709 1.00 78.24  ? 235 LEU A CB  1 
ATOM   1850  C CG  . LEU A  1  235 ? 169.437 119.974 155.360 1.00 78.24  ? 235 LEU A CG  1 
ATOM   1851  C CD1 . LEU A  1  235 ? 169.844 119.897 156.820 1.00 78.24  ? 235 LEU A CD1 1 
ATOM   1852  C CD2 . LEU A  1  235 ? 167.930 119.974 155.210 1.00 78.24  ? 235 LEU A CD2 1 
ATOM   1853  N N   . SER A  1  236 ? 172.098 120.149 152.533 1.00 76.45  ? 236 SER A N   1 
ATOM   1854  C CA  . SER A  1  236 ? 172.625 119.052 151.730 1.00 76.45  ? 236 SER A CA  1 
ATOM   1855  C C   . SER A  1  236 ? 174.096 118.773 152.022 1.00 76.45  ? 236 SER A C   1 
ATOM   1856  O O   . SER A  1  236 ? 174.587 117.692 151.682 1.00 76.45  ? 236 SER A O   1 
ATOM   1857  C CB  . SER A  1  236 ? 172.435 119.348 150.244 1.00 76.45  ? 236 SER A CB  1 
ATOM   1858  O OG  . SER A  1  236 ? 173.216 120.459 149.847 1.00 76.45  ? 236 SER A OG  1 
ATOM   1859  N N   . TRP A  1  237 ? 174.809 119.717 152.646 1.00 83.01  ? 237 TRP A N   1 
ATOM   1860  C CA  . TRP A  1  237 ? 176.222 119.500 152.948 1.00 83.01  ? 237 TRP A CA  1 
ATOM   1861  C C   . TRP A  1  237 ? 176.423 118.577 154.142 1.00 83.01  ? 237 TRP A C   1 
ATOM   1862  O O   . TRP A  1  237 ? 177.424 117.854 154.197 1.00 83.01  ? 237 TRP A O   1 
ATOM   1863  C CB  . TRP A  1  237 ? 176.927 120.828 153.212 1.00 83.01  ? 237 TRP A CB  1 
ATOM   1864  C CG  . TRP A  1  237 ? 177.136 121.660 152.000 1.00 83.01  ? 237 TRP A CG  1 
ATOM   1865  C CD1 . TRP A  1  237 ? 176.849 121.323 150.712 1.00 83.01  ? 237 TRP A CD1 1 
ATOM   1866  C CD2 . TRP A  1  237 ? 177.708 122.968 151.957 1.00 83.01  ? 237 TRP A CD2 1 
ATOM   1867  N NE1 . TRP A  1  237 ? 177.195 122.349 149.868 1.00 83.01  ? 237 TRP A NE1 1 
ATOM   1868  C CE2 . TRP A  1  237 ? 177.726 123.371 150.611 1.00 83.01  ? 237 TRP A CE2 1 
ATOM   1869  C CE3 . TRP A  1  237 ? 178.202 123.841 152.930 1.00 83.01  ? 237 TRP A CE3 1 
ATOM   1870  C CZ2 . TRP A  1  237 ? 178.217 124.607 150.211 1.00 83.01  ? 237 TRP A CZ2 1 
ATOM   1871  C CZ3 . TRP A  1  237 ? 178.689 125.068 152.533 1.00 83.01  ? 237 TRP A CZ3 1 
ATOM   1872  C CH2 . TRP A  1  237 ? 178.693 125.441 151.185 1.00 83.01  ? 237 TRP A CH2 1 
ATOM   1873  N N   . VAL A  1  238 ? 175.503 118.597 155.111 1.00 81.34  ? 238 VAL A N   1 
ATOM   1874  C CA  . VAL A  1  238 ? 175.665 117.799 156.322 1.00 81.34  ? 238 VAL A CA  1 
ATOM   1875  C C   . VAL A  1  238 ? 175.748 116.314 155.996 1.00 81.34  ? 238 VAL A C   1 
ATOM   1876  O O   . VAL A  1  238 ? 176.289 115.532 156.786 1.00 81.34  ? 238 VAL A O   1 
ATOM   1877  C CB  . VAL A  1  238 ? 174.511 118.107 157.301 1.00 81.34  ? 238 VAL A CB  1 
ATOM   1878  C CG1 . VAL A  1  238 ? 174.652 117.314 158.593 1.00 81.34  ? 238 VAL A CG1 1 
ATOM   1879  C CG2 . VAL A  1  238 ? 174.450 119.596 157.590 1.00 81.34  ? 238 VAL A CG2 1 
ATOM   1880  N N   . SER A  1  239 ? 175.250 115.911 154.823 1.00 79.67  ? 239 SER A N   1 
ATOM   1881  C CA  . SER A  1  239 ? 175.323 114.515 154.408 1.00 79.67  ? 239 SER A CA  1 
ATOM   1882  C C   . SER A  1  239 ? 176.753 113.991 154.420 1.00 79.67  ? 239 SER A C   1 
ATOM   1883  O O   . SER A  1  239 ? 176.979 112.815 154.722 1.00 79.67  ? 239 SER A O   1 
ATOM   1884  C CB  . SER A  1  239 ? 174.720 114.361 153.013 1.00 79.67  ? 239 SER A CB  1 
ATOM   1885  O OG  . SER A  1  239 ? 173.341 114.679 153.015 1.00 79.67  ? 239 SER A OG  1 
ATOM   1886  N N   . PHE A  1  240 ? 177.728 114.845 154.107 1.00 83.88  ? 240 PHE A N   1 
ATOM   1887  C CA  . PHE A  1  240 ? 179.114 114.394 154.050 1.00 83.88  ? 240 PHE A CA  1 
ATOM   1888  C C   . PHE A  1  240 ? 179.680 114.103 155.432 1.00 83.88  ? 240 PHE A C   1 
ATOM   1889  O O   . PHE A  1  240 ? 180.590 113.278 155.564 1.00 83.88  ? 240 PHE A O   1 
ATOM   1890  C CB  . PHE A  1  240 ? 179.974 115.435 153.338 1.00 83.88  ? 240 PHE A CB  1 
ATOM   1891  C CG  . PHE A  1  240 ? 179.681 115.559 151.876 1.00 83.88  ? 240 PHE A CG  1 
ATOM   1892  C CD1 . PHE A  1  240 ? 180.209 114.652 150.975 1.00 83.88  ? 240 PHE A CD1 1 
ATOM   1893  C CD2 . PHE A  1  240 ? 178.876 116.576 151.401 1.00 83.88  ? 240 PHE A CD2 1 
ATOM   1894  C CE1 . PHE A  1  240 ? 179.942 114.758 149.627 1.00 83.88  ? 240 PHE A CE1 1 
ATOM   1895  C CE2 . PHE A  1  240 ? 178.605 116.687 150.054 1.00 83.88  ? 240 PHE A CE2 1 
ATOM   1896  C CZ  . PHE A  1  240 ? 179.140 115.776 149.166 1.00 83.88  ? 240 PHE A CZ  1 
ATOM   1897  N N   . TRP A  1  241 ? 179.163 114.761 156.469 1.00 94.81  ? 241 TRP A N   1 
ATOM   1898  C CA  . TRP A  1  241 ? 179.737 114.588 157.799 1.00 94.81  ? 241 TRP A CA  1 
ATOM   1899  C C   . TRP A  1  241 ? 179.338 113.256 158.422 1.00 94.81  ? 241 TRP A C   1 
ATOM   1900  O O   . TRP A  1  241 ? 180.057 112.739 159.284 1.00 94.81  ? 241 TRP A O   1 
ATOM   1901  C CB  . TRP A  1  241 ? 179.325 115.749 158.700 1.00 94.81  ? 241 TRP A CB  1 
ATOM   1902  C CG  . TRP A  1  241 ? 179.899 117.059 158.261 1.00 94.81  ? 241 TRP A CG  1 
ATOM   1903  C CD1 . TRP A  1  241 ? 179.272 118.026 157.533 1.00 94.81  ? 241 TRP A CD1 1 
ATOM   1904  C CD2 . TRP A  1  241 ? 181.226 117.539 158.507 1.00 94.81  ? 241 TRP A CD2 1 
ATOM   1905  N NE1 . TRP A  1  241 ? 180.122 119.083 157.318 1.00 94.81  ? 241 TRP A NE1 1 
ATOM   1906  C CE2 . TRP A  1  241 ? 181.329 118.808 157.905 1.00 94.81  ? 241 TRP A CE2 1 
ATOM   1907  C CE3 . TRP A  1  241 ? 182.334 117.020 159.180 1.00 94.81  ? 241 TRP A CE3 1 
ATOM   1908  C CZ2 . TRP A  1  241 ? 182.495 119.564 157.957 1.00 94.81  ? 241 TRP A CZ2 1 
ATOM   1909  C CZ3 . TRP A  1  241 ? 183.490 117.773 159.230 1.00 94.81  ? 241 TRP A CZ3 1 
ATOM   1910  C CH2 . TRP A  1  241 ? 183.562 119.031 158.623 1.00 94.81  ? 241 TRP A CH2 1 
ATOM   1911  N N   . ILE A  1  242 ? 178.203 112.690 158.009 1.00 95.86  ? 242 ILE A N   1 
ATOM   1912  C CA  . ILE A  1  242 ? 177.789 111.388 158.516 1.00 95.86  ? 242 ILE A CA  1 
ATOM   1913  C C   . ILE A  1  242 ? 178.734 110.317 157.988 1.00 95.86  ? 242 ILE A C   1 
ATOM   1914  O O   . ILE A  1  242 ? 179.233 110.405 156.858 1.00 95.86  ? 242 ILE A O   1 
ATOM   1915  C CB  . ILE A  1  242 ? 176.329 111.102 158.119 1.00 95.86  ? 242 ILE A CB  1 
ATOM   1916  C CG1 . ILE A  1  242 ? 175.393 112.132 158.751 1.00 95.86  ? 242 ILE A CG1 1 
ATOM   1917  C CG2 . ILE A  1  242 ? 175.906 109.705 158.539 1.00 95.86  ? 242 ILE A CG2 1 
ATOM   1918  C CD1 . ILE A  1  242 ? 173.974 112.058 158.232 1.00 95.86  ? 242 ILE A CD1 1 
ATOM   1919  N N   . ASN A  1  243 ? 179.004 109.307 158.815 1.00 93.16  ? 243 ASN A N   1 
ATOM   1920  C CA  . ASN A  1  243 ? 179.856 108.203 158.394 1.00 93.16  ? 243 ASN A CA  1 
ATOM   1921  C C   . ASN A  1  243 ? 179.248 107.487 157.194 1.00 93.16  ? 243 ASN A C   1 
ATOM   1922  O O   . ASN A  1  243 ? 178.045 107.218 157.152 1.00 93.16  ? 243 ASN A O   1 
ATOM   1923  C CB  . ASN A  1  243 ? 180.056 107.220 159.549 1.00 93.16  ? 243 ASN A CB  1 
ATOM   1924  C CG  . ASN A  1  243 ? 181.113 106.175 159.250 1.00 93.16  ? 243 ASN A CG  1 
ATOM   1925  O OD1 . ASN A  1  243 ? 181.696 106.153 158.167 1.00 93.16  ? 243 ASN A OD1 1 
ATOM   1926  N ND2 . ASN A  1  243 ? 181.367 105.301 160.217 1.00 93.16  ? 243 ASN A ND2 1 
ATOM   1927  N N   . TYR A  1  244 ? 180.098 107.166 156.215 1.00 94.73  ? 244 TYR A N   1 
ATOM   1928  C CA  . TYR A  1  244 ? 179.636 106.553 154.976 1.00 94.73  ? 244 TYR A CA  1 
ATOM   1929  C C   . TYR A  1  244 ? 179.054 105.161 155.180 1.00 94.73  ? 244 TYR A C   1 
ATOM   1930  O O   . TYR A  1  244 ? 178.521 104.587 154.225 1.00 94.73  ? 244 TYR A O   1 
ATOM   1931  C CB  . TYR A  1  244 ? 180.780 106.493 153.961 1.00 94.73  ? 244 TYR A CB  1 
ATOM   1932  C CG  . TYR A  1  244 ? 181.956 105.649 154.395 1.00 94.73  ? 244 TYR A CG  1 
ATOM   1933  C CD1 . TYR A  1  244 ? 183.003 106.203 155.120 1.00 94.73  ? 244 TYR A CD1 1 
ATOM   1934  C CD2 . TYR A  1  244 ? 182.027 104.300 154.071 1.00 94.73  ? 244 TYR A CD2 1 
ATOM   1935  C CE1 . TYR A  1  244 ? 184.082 105.437 155.516 1.00 94.73  ? 244 TYR A CE1 1 
ATOM   1936  C CE2 . TYR A  1  244 ? 183.101 103.527 154.464 1.00 94.73  ? 244 TYR A CE2 1 
ATOM   1937  C CZ  . TYR A  1  244 ? 184.126 104.100 155.185 1.00 94.73  ? 244 TYR A CZ  1 
ATOM   1938  O OH  . TYR A  1  244 ? 185.198 103.333 155.578 1.00 94.73  ? 244 TYR A OH  1 
ATOM   1939  N N   . ASP A  1  245 ? 179.145 104.605 156.389 1.00 94.06  ? 245 ASP A N   1 
ATOM   1940  C CA  . ASP A  1  245 ? 178.533 103.309 156.650 1.00 94.06  ? 245 ASP A CA  1 
ATOM   1941  C C   . ASP A  1  245 ? 177.017 103.418 156.746 1.00 94.06  ? 245 ASP A C   1 
ATOM   1942  O O   . ASP A  1  245 ? 176.302 102.499 156.330 1.00 94.06  ? 245 ASP A O   1 
ATOM   1943  C CB  . ASP A  1  245 ? 179.105 102.714 157.936 1.00 94.06  ? 245 ASP A CB  1 
ATOM   1944  C CG  . ASP A  1  245 ? 180.581 102.393 157.822 1.00 94.06  ? 245 ASP A CG  1 
ATOM   1945  O OD1 . ASP A  1  245 ? 181.044 102.103 156.699 1.00 94.06  ? 245 ASP A OD1 1 
ATOM   1946  O OD2 . ASP A  1  245 ? 181.280 102.436 158.857 1.00 94.06  ? 245 ASP A OD2 1 
ATOM   1947  N N   . ALA A  1  246 ? 176.513 104.528 157.283 1.00 89.60  ? 246 ALA A N   1 
ATOM   1948  C CA  . ALA A  1  246 ? 175.076 104.748 157.436 1.00 89.60  ? 246 ALA A CA  1 
ATOM   1949  C C   . ALA A  1  246 ? 174.541 105.303 156.124 1.00 89.60  ? 246 ALA A C   1 
ATOM   1950  O O   . ALA A  1  246 ? 174.661 106.498 155.846 1.00 89.60  ? 246 ALA A O   1 
ATOM   1951  C CB  . ALA A  1  246 ? 174.795 105.693 158.598 1.00 89.60  ? 246 ALA A CB  1 
ATOM   1952  N N   . SER A  1  247 ? 173.945 104.431 155.313 1.00 78.51  ? 247 SER A N   1 
ATOM   1953  C CA  . SER A  1  247 ? 173.475 104.846 153.998 1.00 78.51  ? 247 SER A CA  1 
ATOM   1954  C C   . SER A  1  247 ? 172.138 105.574 154.075 1.00 78.51  ? 247 SER A C   1 
ATOM   1955  O O   . SER A  1  247 ? 171.917 106.544 153.340 1.00 78.51  ? 247 SER A O   1 
ATOM   1956  C CB  . SER A  1  247 ? 173.372 103.631 153.077 1.00 78.51  ? 247 SER A CB  1 
ATOM   1957  O OG  . SER A  1  247 ? 172.408 102.715 153.561 1.00 78.51  ? 247 SER A OG  1 
ATOM   1958  N N   . ALA A  1  248 ? 171.240 105.126 154.955 1.00 76.48  ? 248 ALA A N   1 
ATOM   1959  C CA  . ALA A  1  248 ? 169.914 105.731 155.032 1.00 76.48  ? 248 ALA A CA  1 
ATOM   1960  C C   . ALA A  1  248 ? 169.991 107.197 155.438 1.00 76.48  ? 248 ALA A C   1 
ATOM   1961  O O   . ALA A  1  248 ? 169.286 108.043 154.874 1.00 76.48  ? 248 ALA A O   1 
ATOM   1962  C CB  . ALA A  1  248 ? 169.039 104.953 156.013 1.00 76.48  ? 248 ALA A CB  1 
ATOM   1963  N N   . ALA A  1  249 ? 170.846 107.515 156.414 1.00 80.93  ? 249 ALA A N   1 
ATOM   1964  C CA  . ALA A  1  249 ? 170.933 108.881 156.919 1.00 80.93  ? 249 ALA A CA  1 
ATOM   1965  C C   . ALA A  1  249 ? 171.324 109.867 155.828 1.00 80.93  ? 249 ALA A C   1 
ATOM   1966  O O   . ALA A  1  249 ? 171.017 111.059 155.933 1.00 80.93  ? 249 ALA A O   1 
ATOM   1967  C CB  . ALA A  1  249 ? 171.928 108.954 158.077 1.00 80.93  ? 249 ALA A CB  1 
ATOM   1968  N N   . ARG A  1  250 ? 172.003 109.399 154.782 1.00 81.92  ? 250 ARG A N   1 
ATOM   1969  C CA  . ARG A  1  250 ? 172.381 110.292 153.695 1.00 81.92  ? 250 ARG A CA  1 
ATOM   1970  C C   . ARG A  1  250 ? 171.419 110.214 152.513 1.00 81.92  ? 250 ARG A C   1 
ATOM   1971  O O   . ARG A  1  250 ? 171.149 111.236 151.869 1.00 81.92  ? 250 ARG A O   1 
ATOM   1972  C CB  . ARG A  1  250 ? 173.811 109.990 153.244 1.00 81.92  ? 250 ARG A CB  1 
ATOM   1973  C CG  . ARG A  1  250 ? 174.352 110.996 152.250 1.00 81.92  ? 250 ARG A CG  1 
ATOM   1974  C CD  . ARG A  1  250 ? 175.827 110.786 151.979 1.00 81.92  ? 250 ARG A CD  1 
ATOM   1975  N NE  . ARG A  1  250 ? 176.644 110.995 153.170 1.00 81.92  ? 250 ARG A NE  1 
ATOM   1976  C CZ  . ARG A  1  250 ? 177.346 110.041 153.771 1.00 81.92  ? 250 ARG A CZ  1 
ATOM   1977  N NH1 . ARG A  1  250 ? 177.337 108.806 153.291 1.00 81.92  ? 250 ARG A NH1 1 
ATOM   1978  N NH2 . ARG A  1  250 ? 178.062 110.325 154.850 1.00 81.92  ? 250 ARG A NH2 1 
ATOM   1979  N N   . VAL A  1  251 ? 170.889 109.025 152.216 1.00 70.13  ? 251 VAL A N   1 
ATOM   1980  C CA  . VAL A  1  251 ? 169.917 108.903 151.132 1.00 70.13  ? 251 VAL A CA  1 
ATOM   1981  C C   . VAL A  1  251 ? 168.667 109.716 151.444 1.00 70.13  ? 251 VAL A C   1 
ATOM   1982  O O   . VAL A  1  251 ? 168.110 110.395 150.566 1.00 70.13  ? 251 VAL A O   1 
ATOM   1983  C CB  . VAL A  1  251 ? 169.584 107.421 150.877 1.00 70.13  ? 251 VAL A CB  1 
ATOM   1984  C CG1 . VAL A  1  251 ? 168.462 107.297 149.865 1.00 70.13  ? 251 VAL A CG1 1 
ATOM   1985  C CG2 . VAL A  1  251 ? 170.812 106.686 150.381 1.00 70.13  ? 251 VAL A CG2 1 
ATOM   1986  N N   . ALA A  1  252 ? 168.207 109.665 152.697 1.00 68.27  ? 252 ALA A N   1 
ATOM   1987  C CA  . ALA A  1  252 ? 167.033 110.435 153.089 1.00 68.27  ? 252 ALA A CA  1 
ATOM   1988  C C   . ALA A  1  252 ? 167.275 111.928 152.916 1.00 68.27  ? 252 ALA A C   1 
ATOM   1989  O O   . ALA A  1  252 ? 166.423 112.648 152.384 1.00 68.27  ? 252 ALA A O   1 
ATOM   1990  C CB  . ALA A  1  252 ? 166.652 110.113 154.533 1.00 68.27  ? 252 ALA A CB  1 
ATOM   1991  N N   . LEU A  1  253 ? 168.436 112.413 153.369 1.00 72.16  ? 253 LEU A N   1 
ATOM   1992  C CA  . LEU A  1  253 ? 168.761 113.826 153.197 1.00 72.16  ? 253 LEU A CA  1 
ATOM   1993  C C   . LEU A  1  253 ? 168.788 114.211 151.726 1.00 72.16  ? 253 LEU A C   1 
ATOM   1994  O O   . LEU A  1  253 ? 168.237 115.248 151.343 1.00 72.16  ? 253 LEU A O   1 
ATOM   1995  C CB  . LEU A  1  253 ? 170.102 114.154 153.854 1.00 72.16  ? 253 LEU A CB  1 
ATOM   1996  C CG  . LEU A  1  253 ? 170.142 114.207 155.378 1.00 72.16  ? 253 LEU A CG  1 
ATOM   1997  C CD1 . LEU A  1  253 ? 171.570 114.368 155.857 1.00 72.16  ? 253 LEU A CD1 1 
ATOM   1998  C CD2 . LEU A  1  253 ? 169.286 115.357 155.876 1.00 72.16  ? 253 LEU A CD2 1 
ATOM   1999  N N   . GLY A  1  254 ? 169.423 113.393 150.887 1.00 68.16  ? 254 GLY A N   1 
ATOM   2000  C CA  . GLY A  1  254 ? 169.472 113.712 149.469 1.00 68.16  ? 254 GLY A CA  1 
ATOM   2001  C C   . GLY A  1  254 ? 168.090 113.835 148.856 1.00 68.16  ? 254 GLY A C   1 
ATOM   2002  O O   . GLY A  1  254 ? 167.767 114.836 148.204 1.00 68.16  ? 254 GLY A O   1 
ATOM   2003  N N   . ILE A  1  255 ? 167.250 112.817 149.066 1.00 65.16  ? 255 ILE A N   1 
ATOM   2004  C CA  . ILE A  1  255 ? 165.912 112.830 148.481 1.00 65.16  ? 255 ILE A CA  1 
ATOM   2005  C C   . ILE A  1  255 ? 165.111 114.013 149.008 1.00 65.16  ? 255 ILE A C   1 
ATOM   2006  O O   . ILE A  1  255 ? 164.435 114.716 148.243 1.00 65.16  ? 255 ILE A O   1 
ATOM   2007  C CB  . ILE A  1  255 ? 165.196 111.496 148.758 1.00 65.16  ? 255 ILE A CB  1 
ATOM   2008  C CG1 . ILE A  1  255 ? 165.979 110.335 148.151 1.00 65.16  ? 255 ILE A CG1 1 
ATOM   2009  C CG2 . ILE A  1  255 ? 163.793 111.524 148.183 1.00 65.16  ? 255 ILE A CG2 1 
ATOM   2010  C CD1 . ILE A  1  255 ? 165.489 108.978 148.601 1.00 65.16  ? 255 ILE A CD1 1 
ATOM   2011  N N   . THR A  1  256 ? 165.178 114.255 150.321 1.00 69.49  ? 256 THR A N   1 
ATOM   2012  C CA  . THR A  1  256 ? 164.407 115.338 150.917 1.00 69.49  ? 256 THR A CA  1 
ATOM   2013  C C   . THR A  1  256 ? 164.836 116.687 150.365 1.00 69.49  ? 256 THR A C   1 
ATOM   2014  O O   . THR A  1  256 ? 163.989 117.520 150.025 1.00 69.49  ? 256 THR A O   1 
ATOM   2015  C CB  . THR A  1  256 ? 164.558 115.313 152.438 1.00 69.49  ? 256 THR A CB  1 
ATOM   2016  O OG1 . THR A  1  256 ? 164.100 114.054 152.947 1.00 69.49  ? 256 THR A OG1 1 
ATOM   2017  C CG2 . THR A  1  256 ? 163.747 116.433 153.071 1.00 69.49  ? 256 THR A CG2 1 
ATOM   2018  N N   . THR A  1  257 ? 166.146 116.916 150.249 1.00 71.77  ? 257 THR A N   1 
ATOM   2019  C CA  . THR A  1  257 ? 166.625 118.199 149.749 1.00 71.77  ? 257 THR A CA  1 
ATOM   2020  C C   . THR A  1  257 ? 166.248 118.407 148.289 1.00 71.77  ? 257 THR A C   1 
ATOM   2021  O O   . THR A  1  257 ? 165.844 119.510 147.903 1.00 71.77  ? 257 THR A O   1 
ATOM   2022  C CB  . THR A  1  257 ? 168.137 118.307 149.934 1.00 71.77  ? 257 THR A CB  1 
ATOM   2023  O OG1 . THR A  1  257 ? 168.779 117.196 149.296 1.00 71.77  ? 257 THR A OG1 1 
ATOM   2024  C CG2 . THR A  1  257 ? 168.497 118.339 151.413 1.00 71.77  ? 257 THR A CG2 1 
ATOM   2025  N N   . VAL A  1  258 ? 166.357 117.365 147.462 1.00 67.51  ? 258 VAL A N   1 
ATOM   2026  C CA  . VAL A  1  258 ? 165.999 117.525 146.055 1.00 67.51  ? 258 VAL A CA  1 
ATOM   2027  C C   . VAL A  1  258 ? 164.512 117.829 145.911 1.00 67.51  ? 258 VAL A C   1 
ATOM   2028  O O   . VAL A  1  258 ? 164.116 118.750 145.184 1.00 67.51  ? 258 VAL A O   1 
ATOM   2029  C CB  . VAL A  1  258 ? 166.402 116.283 145.246 1.00 67.51  ? 258 VAL A CB  1 
ATOM   2030  C CG1 . VAL A  1  258 ? 165.874 116.392 143.828 1.00 67.51  ? 258 VAL A CG1 1 
ATOM   2031  C CG2 . VAL A  1  258 ? 167.910 116.137 145.236 1.00 67.51  ? 258 VAL A CG2 1 
ATOM   2032  N N   . LEU A  1  259 ? 163.663 117.069 146.608 1.00 65.28  ? 259 LEU A N   1 
ATOM   2033  C CA  . LEU A  1  259 ? 162.228 117.310 146.496 1.00 65.28  ? 259 LEU A CA  1 
ATOM   2034  C C   . LEU A  1  259 ? 161.839 118.665 147.074 1.00 65.28  ? 259 LEU A C   1 
ATOM   2035  O O   . LEU A  1  259 ? 160.936 119.330 146.548 1.00 65.28  ? 259 LEU A O   1 
ATOM   2036  C CB  . LEU A  1  259 ? 161.459 116.181 147.177 1.00 65.28  ? 259 LEU A CB  1 
ATOM   2037  C CG  . LEU A  1  259 ? 161.643 114.834 146.474 1.00 65.28  ? 259 LEU A CG  1 
ATOM   2038  C CD1 . LEU A  1  259 ? 160.995 113.700 147.249 1.00 65.28  ? 259 LEU A CD1 1 
ATOM   2039  C CD2 . LEU A  1  259 ? 161.091 114.903 145.062 1.00 65.28  ? 259 LEU A CD2 1 
ATOM   2040  N N   . THR A  1  260 ? 162.527 119.107 148.129 1.00 68.26  ? 260 THR A N   1 
ATOM   2041  C CA  . THR A  1  260 ? 162.232 120.411 148.709 1.00 68.26  ? 260 THR A CA  1 
ATOM   2042  C C   . THR A  1  260 ? 162.624 121.535 147.762 1.00 68.26  ? 260 THR A C   1 
ATOM   2043  O O   . THR A  1  260 ? 161.883 122.514 147.614 1.00 68.26  ? 260 THR A O   1 
ATOM   2044  C CB  . THR A  1  260 ? 162.954 120.560 150.045 1.00 68.26  ? 260 THR A CB  1 
ATOM   2045  O OG1 . THR A  1  260 ? 162.552 119.503 150.923 1.00 68.26  ? 260 THR A OG1 1 
ATOM   2046  C CG2 . THR A  1  260 ? 162.614 121.894 150.683 1.00 68.26  ? 260 THR A CG2 1 
ATOM   2047  N N   . MET A  1  261 ? 163.788 121.419 147.119 1.00 71.33  ? 261 MET A N   1 
ATOM   2048  C CA  . MET A  1  261 ? 164.156 122.397 146.102 1.00 71.33  ? 261 MET A CA  1 
ATOM   2049  C C   . MET A  1  261 ? 163.139 122.418 144.972 1.00 71.33  ? 261 MET A C   1 
ATOM   2050  O O   . MET A  1  261 ? 162.776 123.490 144.478 1.00 71.33  ? 261 MET A O   1 
ATOM   2051  C CB  . MET A  1  261 ? 165.552 122.106 145.558 1.00 71.33  ? 261 MET A CB  1 
ATOM   2052  C CG  . MET A  1  261 ? 166.668 122.440 146.520 1.00 71.33  ? 261 MET A CG  1 
ATOM   2053  S SD  . MET A  1  261 ? 166.636 124.191 146.943 1.00 71.33  ? 261 MET A SD  1 
ATOM   2054  C CE  . MET A  1  261 ? 167.047 124.925 145.363 1.00 71.33  ? 261 MET A CE  1 
ATOM   2055  N N   . THR A  1  262 ? 162.658 121.244 144.557 1.00 67.79  ? 262 THR A N   1 
ATOM   2056  C CA  . THR A  1  262 ? 161.648 121.200 143.505 1.00 67.79  ? 262 THR A CA  1 
ATOM   2057  C C   . THR A  1  262 ? 160.399 121.972 143.913 1.00 67.79  ? 262 THR A C   1 
ATOM   2058  O O   . THR A  1  262 ? 159.908 122.827 143.165 1.00 67.79  ? 262 THR A O   1 
ATOM   2059  C CB  . THR A  1  262 ? 161.293 119.753 143.175 1.00 67.79  ? 262 THR A CB  1 
ATOM   2060  O OG1 . THR A  1  262 ? 162.468 119.061 142.741 1.00 67.79  ? 262 THR A OG1 1 
ATOM   2061  C CG2 . THR A  1  262 ? 160.248 119.704 142.071 1.00 67.79  ? 262 THR A CG2 1 
ATOM   2062  N N   . THR A  1  263 ? 159.879 121.692 145.111 1.00 66.83  ? 263 THR A N   1 
ATOM   2063  C CA  . THR A  1  263 ? 158.643 122.340 145.544 1.00 66.83  ? 263 THR A CA  1 
ATOM   2064  C C   . THR A  1  263 ? 158.828 123.842 145.724 1.00 66.83  ? 263 THR A C   1 
ATOM   2065  O O   . THR A  1  263 ? 157.958 124.632 145.328 1.00 66.83  ? 263 THR A O   1 
ATOM   2066  C CB  . THR A  1  263 ? 158.140 121.716 146.842 1.00 66.83  ? 263 THR A CB  1 
ATOM   2067  O OG1 . THR A  1  263 ? 159.129 121.877 147.865 1.00 66.83  ? 263 THR A OG1 1 
ATOM   2068  C CG2 . THR A  1  263 ? 157.848 120.242 146.647 1.00 66.83  ? 263 THR A CG2 1 
ATOM   2069  N N   . ILE A  1  264 ? 159.948 124.258 146.322 1.00 70.29  ? 264 ILE A N   1 
ATOM   2070  C CA  . ILE A  1  264 ? 160.183 125.684 146.517 1.00 70.29  ? 264 ILE A CA  1 
ATOM   2071  C C   . ILE A  1  264 ? 160.312 126.390 145.177 1.00 70.29  ? 264 ILE A C   1 
ATOM   2072  O O   . ILE A  1  264 ? 159.754 127.474 144.981 1.00 70.29  ? 264 ILE A O   1 
ATOM   2073  C CB  . ILE A  1  264 ? 161.421 125.922 147.397 1.00 70.29  ? 264 ILE A CB  1 
ATOM   2074  C CG1 . ILE A  1  264 ? 161.177 125.412 148.815 1.00 70.29  ? 264 ILE A CG1 1 
ATOM   2075  C CG2 . ILE A  1  264 ? 161.774 127.397 147.427 1.00 70.29  ? 264 ILE A CG2 1 
ATOM   2076  C CD1 . ILE A  1  264 ? 162.415 125.418 149.676 1.00 70.29  ? 264 ILE A CD1 1 
ATOM   2077  N N   . ASN A  1  265 ? 161.032 125.787 144.229 1.00 76.23  ? 265 ASN A N   1 
ATOM   2078  C CA  . ASN A  1  265 ? 161.166 126.394 142.912 1.00 76.23  ? 265 ASN A CA  1 
ATOM   2079  C C   . ASN A  1  265 ? 159.806 126.550 142.247 1.00 76.23  ? 265 ASN A C   1 
ATOM   2080  O O   . ASN A  1  265 ? 159.470 127.627 141.742 1.00 76.23  ? 265 ASN A O   1 
ATOM   2081  C CB  . ASN A  1  265 ? 162.101 125.553 142.044 1.00 76.23  ? 265 ASN A CB  1 
ATOM   2082  C CG  . ASN A  1  265 ? 162.488 126.250 140.760 1.00 76.23  ? 265 ASN A CG  1 
ATOM   2083  O OD1 . ASN A  1  265 ? 162.066 127.376 140.497 1.00 76.23  ? 265 ASN A OD1 1 
ATOM   2084  N ND2 . ASN A  1  265 ? 163.296 125.582 139.946 1.00 76.23  ? 265 ASN A ND2 1 
ATOM   2085  N N   . THR A  1  266 ? 158.997 125.487 142.260 1.00 72.67  ? 266 THR A N   1 
ATOM   2086  C CA  . THR A  1  266 ? 157.689 125.553 141.615 1.00 72.67  ? 266 THR A CA  1 
ATOM   2087  C C   . THR A  1  266 ? 156.819 126.642 142.232 1.00 72.67  ? 266 THR A C   1 
ATOM   2088  O O   . THR A  1  266 ? 156.270 127.493 141.518 1.00 72.67  ? 266 THR A O   1 
ATOM   2089  C CB  . THR A  1  266 ? 156.984 124.199 141.694 1.00 72.67  ? 266 THR A CB  1 
ATOM   2090  O OG1 . THR A  1  266 ? 156.857 123.801 143.063 1.00 72.67  ? 266 THR A OG1 1 
ATOM   2091  C CG2 . THR A  1  266 ? 157.755 123.144 140.921 1.00 72.67  ? 266 THR A CG2 1 
ATOM   2092  N N   . HIS A  1  267 ? 156.682 126.641 143.561 1.00 84.03  ? 267 HIS A N   1 
ATOM   2093  C CA  . HIS A  1  267 ? 155.759 127.600 144.157 1.00 84.03  ? 267 HIS A CA  1 
ATOM   2094  C C   . HIS A  1  267 ? 156.291 129.026 144.086 1.00 84.03  ? 267 HIS A C   1 
ATOM   2095  O O   . HIS A  1  267 ? 155.507 129.964 143.906 1.00 84.03  ? 267 HIS A O   1 
ATOM   2096  C CB  . HIS A  1  267 ? 155.439 127.234 145.602 1.00 84.03  ? 267 HIS A CB  1 
ATOM   2097  C CG  . HIS A  1  267 ? 154.479 128.182 146.252 1.00 84.03  ? 267 HIS A CG  1 
ATOM   2098  N ND1 . HIS A  1  267 ? 153.160 128.283 145.864 1.00 84.03  ? 267 HIS A ND1 1 
ATOM   2099  C CD2 . HIS A  1  267 ? 154.644 129.070 147.260 1.00 84.03  ? 267 HIS A CD2 1 
ATOM   2100  C CE1 . HIS A  1  267 ? 152.557 129.197 146.602 1.00 84.03  ? 267 HIS A CE1 1 
ATOM   2101  N NE2 . HIS A  1  267 ? 153.433 129.686 147.461 1.00 84.03  ? 267 HIS A NE2 1 
ATOM   2102  N N   . LEU A  1  268 ? 157.607 129.216 144.211 1.00 85.56  ? 268 LEU A N   1 
ATOM   2103  C CA  . LEU A  1  268 ? 158.167 130.553 144.072 1.00 85.56  ? 268 LEU A CA  1 
ATOM   2104  C C   . LEU A  1  268 ? 158.000 131.074 142.655 1.00 85.56  ? 268 LEU A C   1 
ATOM   2105  O O   . LEU A  1  268 ? 157.777 132.274 142.460 1.00 85.56  ? 268 LEU A O   1 
ATOM   2106  C CB  . LEU A  1  268 ? 159.643 130.543 144.469 1.00 85.56  ? 268 LEU A CB  1 
ATOM   2107  C CG  . LEU A  1  268 ? 160.349 131.895 144.506 1.00 85.56  ? 268 LEU A CG  1 
ATOM   2108  C CD1 . LEU A  1  268 ? 159.726 132.775 145.574 1.00 85.56  ? 268 LEU A CD1 1 
ATOM   2109  C CD2 . LEU A  1  268 ? 161.838 131.717 144.751 1.00 85.56  ? 268 LEU A CD2 1 
ATOM   2110  N N   . ARG A  1  269 ? 158.094 130.194 141.656 1.00 81.43  ? 269 ARG A N   1 
ATOM   2111  C CA  . ARG A  1  269 ? 157.831 130.607 140.283 1.00 81.43  ? 269 ARG A CA  1 
ATOM   2112  C C   . ARG A  1  269 ? 156.366 130.969 140.090 1.00 81.43  ? 269 ARG A C   1 
ATOM   2113  O O   . ARG A  1  269 ? 156.046 131.923 139.372 1.00 81.43  ? 269 ARG A O   1 
ATOM   2114  C CB  . ARG A  1  269 ? 158.238 129.494 139.319 1.00 81.43  ? 269 ARG A CB  1 
ATOM   2115  C CG  . ARG A  1  269 ? 158.135 129.870 137.858 1.00 81.43  ? 269 ARG A CG  1 
ATOM   2116  C CD  . ARG A  1  269 ? 158.558 128.714 136.974 1.00 81.43  ? 269 ARG A CD  1 
ATOM   2117  N NE  . ARG A  1  269 ? 159.962 128.366 137.160 1.00 81.43  ? 269 ARG A NE  1 
ATOM   2118  C CZ  . ARG A  1  269 ? 160.970 128.975 136.545 1.00 81.43  ? 269 ARG A CZ  1 
ATOM   2119  N NH1 . ARG A  1  269 ? 160.732 129.969 135.701 1.00 81.43  ? 269 ARG A NH1 1 
ATOM   2120  N NH2 . ARG A  1  269 ? 162.217 128.591 136.776 1.00 81.43  ? 269 ARG A NH2 1 
ATOM   2121  N N   . GLU A  1  270 ? 155.461 130.215 140.716 1.00 90.33  ? 270 GLU A N   1 
ATOM   2122  C CA  . GLU A  1  270 ? 154.040 130.508 140.563 1.00 90.33  ? 270 GLU A CA  1 
ATOM   2123  C C   . GLU A  1  270 ? 153.637 131.796 141.276 1.00 90.33  ? 270 GLU A C   1 
ATOM   2124  O O   . GLU A  1  270 ? 152.733 132.499 140.811 1.00 90.33  ? 270 GLU A O   1 
ATOM   2125  C CB  . GLU A  1  270 ? 153.202 129.336 141.072 1.00 90.33  ? 270 GLU A CB  1 
ATOM   2126  C CG  . GLU A  1  270 ? 153.288 128.091 140.205 1.00 90.33  ? 270 GLU A CG  1 
ATOM   2127  C CD  . GLU A  1  270 ? 152.470 126.943 140.756 1.00 90.33  ? 270 GLU A CD  1 
ATOM   2128  O OE1 . GLU A  1  270 ? 151.951 127.071 141.884 1.00 90.33  ? 270 GLU A OE1 1 
ATOM   2129  O OE2 . GLU A  1  270 ? 152.342 125.914 140.060 1.00 90.33  ? 270 GLU A OE2 1 
ATOM   2130  N N   . THR A  1  271 ? 154.284 132.122 142.398 1.00 90.12  ? 271 THR A N   1 
ATOM   2131  C CA  . THR A  1  271 ? 153.881 133.303 143.160 1.00 90.12  ? 271 THR A CA  1 
ATOM   2132  C C   . THR A  1  271 ? 154.355 134.599 142.518 1.00 90.12  ? 271 THR A C   1 
ATOM   2133  O O   . THR A  1  271 ? 153.662 135.619 142.611 1.00 90.12  ? 271 THR A O   1 
ATOM   2134  C CB  . THR A  1  271 ? 154.400 133.215 144.595 1.00 90.12  ? 271 THR A CB  1 
ATOM   2135  O OG1 . THR A  1  271 ? 155.817 133.001 144.583 1.00 90.12  ? 271 THR A OG1 1 
ATOM   2136  C CG2 . THR A  1  271 ? 153.714 132.095 145.343 1.00 90.12  ? 271 THR A CG2 1 
ATOM   2137  N N   . LEU A  1  272 ? 155.528 134.593 141.890 1.00 88.17  ? 272 LEU A N   1 
ATOM   2138  C CA  . LEU A  1  272 ? 156.027 135.797 141.245 1.00 88.17  ? 272 LEU A CA  1 
ATOM   2139  C C   . LEU A  1  272 ? 155.077 136.225 140.127 1.00 88.17  ? 272 LEU A C   1 
ATOM   2140  O O   . LEU A  1  272 ? 154.364 135.393 139.558 1.00 88.17  ? 272 LEU A O   1 
ATOM   2141  C CB  . LEU A  1  272 ? 157.428 135.561 140.686 1.00 88.17  ? 272 LEU A CB  1 
ATOM   2142  C CG  . LEU A  1  272 ? 158.517 135.336 141.733 1.00 88.17  ? 272 LEU A CG  1 
ATOM   2143  C CD1 . LEU A  1  272 ? 159.838 134.997 141.067 1.00 88.17  ? 272 LEU A CD1 1 
ATOM   2144  C CD2 . LEU A  1  272 ? 158.657 136.553 142.630 1.00 88.17  ? 272 LEU A CD2 1 
ATOM   2145  N N   . PRO A  1  273 ? 155.036 137.517 139.801 1.00 92.41  ? 273 PRO A N   1 
ATOM   2146  C CA  . PRO A  1  273 ? 154.124 137.978 138.749 1.00 92.41  ? 273 PRO A CA  1 
ATOM   2147  C C   . PRO A  1  273 ? 154.450 137.340 137.407 1.00 92.41  ? 273 PRO A C   1 
ATOM   2148  O O   . PRO A  1  273 ? 155.517 136.758 137.201 1.00 92.41  ? 273 PRO A O   1 
ATOM   2149  C CB  . PRO A  1  273 ? 154.345 139.494 138.720 1.00 92.41  ? 273 PRO A CB  1 
ATOM   2150  C CG  . PRO A  1  273 ? 155.702 139.686 139.284 1.00 92.41  ? 273 PRO A CG  1 
ATOM   2151  C CD  . PRO A  1  273 ? 155.866 138.615 140.323 1.00 92.41  ? 273 PRO A CD  1 
ATOM   2152  N N   . LYS A  1  274 ? 153.498 137.456 136.488 1.00 90.92  ? 274 LYS A N   1 
ATOM   2153  C CA  . LYS A  1  274 ? 153.544 136.729 135.225 1.00 90.92  ? 274 LYS A CA  1 
ATOM   2154  C C   . LYS A  1  274 ? 154.400 137.497 134.225 1.00 90.92  ? 274 LYS A C   1 
ATOM   2155  O O   . LYS A  1  274 ? 153.972 138.520 133.684 1.00 90.92  ? 274 LYS A O   1 
ATOM   2156  C CB  . LYS A  1  274 ? 152.124 136.514 134.707 1.00 90.92  ? 274 LYS A CB  1 
ATOM   2157  C CG  . LYS A  1  274 ? 152.017 135.665 133.460 1.00 90.92  ? 274 LYS A CG  1 
ATOM   2158  C CD  . LYS A  1  274 ? 151.815 136.525 132.227 1.00 90.92  ? 274 LYS A CD  1 
ATOM   2159  C CE  . LYS A  1  274 ? 151.626 135.668 130.988 1.00 90.92  ? 274 LYS A CE  1 
ATOM   2160  N NZ  . LYS A  1  274 ? 150.373 134.869 131.067 1.00 90.92  ? 274 LYS A NZ  1 
ATOM   2161  N N   . ILE A  1  275 ? 155.611 137.000 133.973 1.00 82.00  ? 275 ILE A N   1 
ATOM   2162  C CA  . ILE A  1  275 ? 156.519 137.587 133.000 1.00 82.00  ? 275 ILE A CA  1 
ATOM   2163  C C   . ILE A  1  275 ? 156.921 136.502 132.011 1.00 82.00  ? 275 ILE A C   1 
ATOM   2164  O O   . ILE A  1  275 ? 157.562 135.521 132.399 1.00 82.00  ? 275 ILE A O   1 
ATOM   2165  C CB  . ILE A  1  275 ? 157.770 138.204 133.649 1.00 82.00  ? 275 ILE A CB  1 
ATOM   2166  C CG1 . ILE A  1  275 ? 157.393 139.428 134.487 1.00 82.00  ? 275 ILE A CG1 1 
ATOM   2167  C CG2 . ILE A  1  275 ? 158.798 138.554 132.586 1.00 82.00  ? 275 ILE A CG2 1 
ATOM   2168  C CD1 . ILE A  1  275 ? 157.128 139.132 135.944 1.00 82.00  ? 275 ILE A CD1 1 
ATOM   2169  N N   . PRO A  1  276 ? 156.588 136.630 130.741 1.00 72.53  ? 276 PRO A N   1 
ATOM   2170  C CA  . PRO A  1  276 ? 156.800 135.521 129.803 1.00 72.53  ? 276 PRO A CA  1 
ATOM   2171  C C   . PRO A  1  276 ? 158.215 135.395 129.259 1.00 72.53  ? 276 PRO A C   1 
ATOM   2172  O O   . PRO A  1  276 ? 158.402 134.772 128.210 1.00 72.53  ? 276 PRO A O   1 
ATOM   2173  C CB  . PRO A  1  276 ? 155.807 135.832 128.675 1.00 72.53  ? 276 PRO A CB  1 
ATOM   2174  C CG  . PRO A  1  276 ? 154.802 136.756 129.287 1.00 72.53  ? 276 PRO A CG  1 
ATOM   2175  C CD  . PRO A  1  276 ? 155.592 137.587 130.240 1.00 72.53  ? 276 PRO A CD  1 
ATOM   2176  N N   . TYR A  1  277 ? 159.214 135.986 129.909 1.00 79.05  ? 277 TYR A N   1 
ATOM   2177  C CA  . TYR A  1  277 ? 160.592 135.788 129.477 1.00 79.05  ? 277 TYR A CA  1 
ATOM   2178  C C   . TYR A  1  277 ? 161.497 135.575 130.686 1.00 79.05  ? 277 TYR A C   1 
ATOM   2179  O O   . TYR A  1  277 ? 161.090 135.741 131.838 1.00 79.05  ? 277 TYR A O   1 
ATOM   2180  C CB  . TYR A  1  277 ? 161.080 136.949 128.603 1.00 79.05  ? 277 TYR A CB  1 
ATOM   2181  C CG  . TYR A  1  277 ? 161.089 138.299 129.272 1.00 79.05  ? 277 TYR A CG  1 
ATOM   2182  C CD1 . TYR A  1  277 ? 159.973 139.120 129.233 1.00 79.05  ? 277 TYR A CD1 1 
ATOM   2183  C CD2 . TYR A  1  277 ? 162.223 138.766 129.917 1.00 79.05  ? 277 TYR A CD2 1 
ATOM   2184  C CE1 . TYR A  1  277 ? 159.980 140.360 129.829 1.00 79.05  ? 277 TYR A CE1 1 
ATOM   2185  C CE2 . TYR A  1  277 ? 162.239 140.005 130.518 1.00 79.05  ? 277 TYR A CE2 1 
ATOM   2186  C CZ  . TYR A  1  277 ? 161.114 140.797 130.471 1.00 79.05  ? 277 TYR A CZ  1 
ATOM   2187  O OH  . TYR A  1  277 ? 161.126 142.033 131.069 1.00 79.05  ? 277 TYR A OH  1 
ATOM   2188  N N   . VAL A  1  278 ? 162.747 135.202 130.395 1.00 73.27  ? 278 VAL A N   1 
ATOM   2189  C CA  . VAL A  1  278 ? 163.663 134.682 131.405 1.00 73.27  ? 278 VAL A CA  1 
ATOM   2190  C C   . VAL A  1  278 ? 164.047 135.770 132.404 1.00 73.27  ? 278 VAL A C   1 
ATOM   2191  O O   . VAL A  1  278 ? 164.117 136.960 132.071 1.00 73.27  ? 278 VAL A O   1 
ATOM   2192  C CB  . VAL A  1  278 ? 164.905 134.090 130.712 1.00 73.27  ? 278 VAL A CB  1 
ATOM   2193  C CG1 . VAL A  1  278 ? 165.917 133.572 131.725 1.00 73.27  ? 278 VAL A CG1 1 
ATOM   2194  C CG2 . VAL A  1  278 ? 164.492 132.990 129.752 1.00 73.27  ? 278 VAL A CG2 1 
ATOM   2195  N N   . LYS A  1  279 ? 164.301 135.355 133.646 1.00 69.31  ? 279 LYS A N   1 
ATOM   2196  C CA  . LYS A  1  279 ? 164.699 136.240 134.732 1.00 69.31  ? 279 LYS A CA  1 
ATOM   2197  C C   . LYS A  1  279 ? 166.016 135.749 135.327 1.00 69.31  ? 279 LYS A C   1 
ATOM   2198  O O   . LYS A  1  279 ? 166.638 134.812 134.821 1.00 69.31  ? 279 LYS A O   1 
ATOM   2199  C CB  . LYS A  1  279 ? 163.607 136.320 135.803 1.00 69.31  ? 279 LYS A CB  1 
ATOM   2200  C CG  . LYS A  1  279 ? 162.308 136.917 135.303 1.00 69.31  ? 279 LYS A CG  1 
ATOM   2201  C CD  . LYS A  1  279 ? 161.300 137.051 136.425 1.00 69.31  ? 279 LYS A CD  1 
ATOM   2202  C CE  . LYS A  1  279 ? 160.783 135.697 136.871 1.00 69.31  ? 279 LYS A CE  1 
ATOM   2203  N NZ  . LYS A  1  279 ? 159.975 135.039 135.812 1.00 69.31  ? 279 LYS A NZ  1 
ATOM   2204  N N   . ALA A  1  280 ? 166.447 136.402 136.408 1.00 67.70  ? 280 ALA A N   1 
ATOM   2205  C CA  . ALA A  1  280 ? 167.691 136.055 137.090 1.00 67.70  ? 280 ALA A CA  1 
ATOM   2206  C C   . ALA A  1  280 ? 167.468 135.158 138.302 1.00 67.70  ? 280 ALA A C   1 
ATOM   2207  O O   . ALA A  1  280 ? 168.293 134.277 138.588 1.00 67.70  ? 280 ALA A O   1 
ATOM   2208  C CB  . ALA A  1  280 ? 168.423 137.326 137.522 1.00 67.70  ? 280 ALA A CB  1 
ATOM   2209  N N   . ILE A  1  281 ? 166.374 135.377 139.036 1.00 67.69  ? 281 ILE A N   1 
ATOM   2210  C CA  . ILE A  1  281 ? 166.052 134.500 140.155 1.00 67.69  ? 281 ILE A CA  1 
ATOM   2211  C C   . ILE A  1  281 ? 165.905 133.065 139.673 1.00 67.69  ? 281 ILE A C   1 
ATOM   2212  O O   . ILE A  1  281 ? 166.244 132.118 140.395 1.00 67.69  ? 281 ILE A O   1 
ATOM   2213  C CB  . ILE A  1  281 ? 164.788 135.002 140.882 1.00 67.69  ? 281 ILE A CB  1 
ATOM   2214  C CG1 . ILE A  1  281 ? 164.581 134.244 142.190 1.00 67.69  ? 281 ILE A CG1 1 
ATOM   2215  C CG2 . ILE A  1  281 ? 163.564 134.880 139.997 1.00 67.69  ? 281 ILE A CG2 1 
ATOM   2216  C CD1 . ILE A  1  281 ? 163.543 134.871 143.085 1.00 67.69  ? 281 ILE A CD1 1 
ATOM   2217  N N   . ASP A  1  282 ? 165.434 132.876 138.439 1.00 72.30  ? 282 ASP A N   1 
ATOM   2218  C CA  . ASP A  1  282 ? 165.392 131.538 137.864 1.00 72.30  ? 282 ASP A CA  1 
ATOM   2219  C C   . ASP A  1  282 ? 166.795 130.983 137.666 1.00 72.30  ? 282 ASP A C   1 
ATOM   2220  O O   . ASP A  1  282 ? 167.031 129.791 137.889 1.00 72.30  ? 282 ASP A O   1 
ATOM   2221  C CB  . ASP A  1  282 ? 164.625 131.556 136.544 1.00 72.30  ? 282 ASP A CB  1 
ATOM   2222  C CG  . ASP A  1  282 ? 163.143 131.798 136.738 1.00 72.30  ? 282 ASP A CG  1 
ATOM   2223  O OD1 . ASP A  1  282 ? 162.614 131.421 137.805 1.00 72.30  ? 282 ASP A OD1 1 
ATOM   2224  O OD2 . ASP A  1  282 ? 162.505 132.364 135.826 1.00 72.30  ? 282 ASP A OD2 1 
ATOM   2225  N N   . MET A  1  283 ? 167.742 131.831 137.257 1.00 76.72  ? 283 MET A N   1 
ATOM   2226  C CA  . MET A  1  283 ? 169.127 131.386 137.145 1.00 76.72  ? 283 MET A CA  1 
ATOM   2227  C C   . MET A  1  283 ? 169.662 130.918 138.490 1.00 76.72  ? 283 MET A C   1 
ATOM   2228  O O   . MET A  1  283 ? 170.306 129.865 138.581 1.00 76.72  ? 283 MET A O   1 
ATOM   2229  C CB  . MET A  1  283 ? 170.003 132.508 136.587 1.00 76.72  ? 283 MET A CB  1 
ATOM   2230  C CG  . MET A  1  283 ? 169.691 132.892 135.154 1.00 76.72  ? 283 MET A CG  1 
ATOM   2231  S SD  . MET A  1  283 ? 170.013 131.554 133.992 1.00 76.72  ? 283 MET A SD  1 
ATOM   2232  C CE  . MET A  1  283 ? 169.333 132.245 132.486 1.00 76.72  ? 283 MET A CE  1 
ATOM   2233  N N   . TYR A  1  284 ? 169.397 131.682 139.551 1.00 79.31  ? 284 TYR A N   1 
ATOM   2234  C CA  . TYR A  1  284 ? 169.917 131.297 140.861 1.00 79.31  ? 284 TYR A CA  1 
ATOM   2235  C C   . TYR A  1  284 ? 169.266 130.013 141.364 1.00 79.31  ? 284 TYR A C   1 
ATOM   2236  O O   . TYR A  1  284 ? 169.943 129.148 141.942 1.00 79.31  ? 284 TYR A O   1 
ATOM   2237  C CB  . TYR A  1  284 ? 169.717 132.430 141.862 1.00 79.31  ? 284 TYR A CB  1 
ATOM   2238  C CG  . TYR A  1  284 ? 170.312 132.140 143.217 1.00 79.31  ? 284 TYR A CG  1 
ATOM   2239  C CD1 . TYR A  1  284 ? 171.684 132.178 143.411 1.00 79.31  ? 284 TYR A CD1 1 
ATOM   2240  C CD2 . TYR A  1  284 ? 169.506 131.833 144.301 1.00 79.31  ? 284 TYR A CD2 1 
ATOM   2241  C CE1 . TYR A  1  284 ? 172.237 131.914 144.645 1.00 79.31  ? 284 TYR A CE1 1 
ATOM   2242  C CE2 . TYR A  1  284 ? 170.051 131.571 145.542 1.00 79.31  ? 284 TYR A CE2 1 
ATOM   2243  C CZ  . TYR A  1  284 ? 171.417 131.612 145.707 1.00 79.31  ? 284 TYR A CZ  1 
ATOM   2244  O OH  . TYR A  1  284 ? 171.968 131.351 146.939 1.00 79.31  ? 284 TYR A OH  1 
ATOM   2245  N N   . LEU A  1  285 ? 167.955 129.868 141.158 1.00 81.45  ? 285 LEU A N   1 
ATOM   2246  C CA  . LEU A  1  285 ? 167.284 128.638 141.564 1.00 81.45  ? 285 LEU A CA  1 
ATOM   2247  C C   . LEU A  1  285 ? 167.816 127.441 140.788 1.00 81.45  ? 285 LEU A C   1 
ATOM   2248  O O   . LEU A  1  285 ? 168.020 126.362 141.359 1.00 81.45  ? 285 LEU A O   1 
ATOM   2249  C CB  . LEU A  1  285 ? 165.775 128.772 141.381 1.00 81.45  ? 285 LEU A CB  1 
ATOM   2250  C CG  . LEU A  1  285 ? 165.116 129.795 142.305 1.00 81.45  ? 285 LEU A CG  1 
ATOM   2251  C CD1 . LEU A  1  285 ? 163.635 129.923 141.996 1.00 81.45  ? 285 LEU A CD1 1 
ATOM   2252  C CD2 . LEU A  1  285 ? 165.342 129.426 143.761 1.00 81.45  ? 285 LEU A CD2 1 
ATOM   2253  N N   . MET A  1  286 ? 168.053 127.612 139.485 1.00 81.69  ? 286 MET A N   1 
ATOM   2254  C CA  . MET A  1  286 ? 168.638 126.538 138.691 1.00 81.69  ? 286 MET A CA  1 
ATOM   2255  C C   . MET A  1  286 ? 170.019 126.169 139.210 1.00 81.69  ? 286 MET A C   1 
ATOM   2256  O O   . MET A  1  286 ? 170.367 124.985 139.280 1.00 81.69  ? 286 MET A O   1 
ATOM   2257  C CB  . MET A  1  286 ? 168.707 126.954 137.223 1.00 81.69  ? 286 MET A CB  1 
ATOM   2258  C CG  . MET A  1  286 ? 169.150 125.851 136.282 1.00 81.69  ? 286 MET A CG  1 
ATOM   2259  S SD  . MET A  1  286 ? 167.970 124.492 136.226 1.00 81.69  ? 286 MET A SD  1 
ATOM   2260  C CE  . MET A  1  286 ? 166.623 125.253 135.326 1.00 81.69  ? 286 MET A CE  1 
ATOM   2261  N N   . GLY A  1  287 ? 170.817 127.167 139.592 1.00 78.78  ? 287 GLY A N   1 
ATOM   2262  C CA  . GLY A  1  287 ? 172.140 126.876 140.125 1.00 78.78  ? 287 GLY A CA  1 
ATOM   2263  C C   . GLY A  1  287 ? 172.087 126.064 141.405 1.00 78.78  ? 287 GLY A C   1 
ATOM   2264  O O   . GLY A  1  287 ? 172.808 125.073 141.563 1.00 78.78  ? 287 GLY A O   1 
ATOM   2265  N N   . CYS A  1  288 ? 171.229 126.474 142.342 1.00 84.24  ? 288 CYS A N   1 
ATOM   2266  C CA  . CYS A  1  288 ? 171.121 125.733 143.597 1.00 84.24  ? 288 CYS A CA  1 
ATOM   2267  C C   . CYS A  1  288 ? 170.591 124.321 143.361 1.00 84.24  ? 288 CYS A C   1 
ATOM   2268  O O   . CYS A  1  288 ? 171.050 123.357 143.995 1.00 84.24  ? 288 CYS A O   1 
ATOM   2269  C CB  . CYS A  1  288 ? 170.230 126.487 144.581 1.00 84.24  ? 288 CYS A CB  1 
ATOM   2270  S SG  . CYS A  1  288 ? 170.935 128.043 145.163 1.00 84.24  ? 288 CYS A SG  1 
ATOM   2271  N N   . PHE A  1  289 ? 169.624 124.181 142.450 1.00 77.41  ? 289 PHE A N   1 
ATOM   2272  C CA  . PHE A  1  289 ? 169.115 122.859 142.110 1.00 77.41  ? 289 PHE A CA  1 
ATOM   2273  C C   . PHE A  1  289 ? 170.214 121.980 141.529 1.00 77.41  ? 289 PHE A C   1 
ATOM   2274  O O   . PHE A  1  289 ? 170.301 120.790 141.849 1.00 77.41  ? 289 PHE A O   1 
ATOM   2275  C CB  . PHE A  1  289 ? 167.954 122.986 141.129 1.00 77.41  ? 289 PHE A CB  1 
ATOM   2276  C CG  . PHE A  1  289 ? 167.357 121.675 140.725 1.00 77.41  ? 289 PHE A CG  1 
ATOM   2277  C CD1 . PHE A  1  289 ? 166.519 120.989 141.583 1.00 77.41  ? 289 PHE A CD1 1 
ATOM   2278  C CD2 . PHE A  1  289 ? 167.637 121.125 139.486 1.00 77.41  ? 289 PHE A CD2 1 
ATOM   2279  C CE1 . PHE A  1  289 ? 165.968 119.782 141.213 1.00 77.41  ? 289 PHE A CE1 1 
ATOM   2280  C CE2 . PHE A  1  289 ? 167.089 119.918 139.109 1.00 77.41  ? 289 PHE A CE2 1 
ATOM   2281  C CZ  . PHE A  1  289 ? 166.254 119.245 139.973 1.00 77.41  ? 289 PHE A CZ  1 
ATOM   2282  N N   . VAL A  1  290 ? 171.065 122.551 140.674 1.00 77.97  ? 290 VAL A N   1 
ATOM   2283  C CA  . VAL A  1  290 ? 172.179 121.789 140.119 1.00 77.97  ? 290 VAL A CA  1 
ATOM   2284  C C   . VAL A  1  290 ? 173.131 121.355 141.222 1.00 77.97  ? 290 VAL A C   1 
ATOM   2285  O O   . VAL A  1  290 ? 173.604 120.214 141.234 1.00 77.97  ? 290 VAL A O   1 
ATOM   2286  C CB  . VAL A  1  290 ? 172.903 122.603 139.031 1.00 77.97  ? 290 VAL A CB  1 
ATOM   2287  C CG1 . VAL A  1  290 ? 174.191 121.911 138.623 1.00 77.97  ? 290 VAL A CG1 1 
ATOM   2288  C CG2 . VAL A  1  290 ? 172.005 122.767 137.820 1.00 77.97  ? 290 VAL A CG2 1 
ATOM   2289  N N   . PHE A  1  291 ? 173.419 122.247 142.172 1.00 77.89  ? 291 PHE A N   1 
ATOM   2290  C CA  . PHE A  1  291 ? 174.301 121.874 143.277 1.00 77.89  ? 291 PHE A CA  1 
ATOM   2291  C C   . PHE A  1  291 ? 173.752 120.678 144.047 1.00 77.89  ? 291 PHE A C   1 
ATOM   2292  O O   . PHE A  1  291 ? 174.459 119.683 144.260 1.00 77.89  ? 291 PHE A O   1 
ATOM   2293  C CB  . PHE A  1  291 ? 174.524 123.058 144.217 1.00 77.89  ? 291 PHE A CB  1 
ATOM   2294  C CG  . PHE A  1  291 ? 175.515 124.061 143.705 1.00 77.89  ? 291 PHE A CG  1 
ATOM   2295  C CD1 . PHE A  1  291 ? 176.355 123.749 142.652 1.00 77.89  ? 291 PHE A CD1 1 
ATOM   2296  C CD2 . PHE A  1  291 ? 175.622 125.309 144.292 1.00 77.89  ? 291 PHE A CD2 1 
ATOM   2297  C CE1 . PHE A  1  291 ? 177.273 124.667 142.183 1.00 77.89  ? 291 PHE A CE1 1 
ATOM   2298  C CE2 . PHE A  1  291 ? 176.538 126.230 143.827 1.00 77.89  ? 291 PHE A CE2 1 
ATOM   2299  C CZ  . PHE A  1  291 ? 177.364 125.909 142.772 1.00 77.89  ? 291 PHE A CZ  1 
ATOM   2300  N N   . VAL A  1  292 ? 172.486 120.749 144.464 1.00 78.22  ? 292 VAL A N   1 
ATOM   2301  C CA  . VAL A  1  292 ? 171.952 119.671 145.297 1.00 78.22  ? 292 VAL A CA  1 
ATOM   2302  C C   . VAL A  1  292 ? 171.807 118.379 144.492 1.00 78.22  ? 292 VAL A C   1 
ATOM   2303  O O   . VAL A  1  292 ? 172.070 117.279 145.002 1.00 78.22  ? 292 VAL A O   1 
ATOM   2304  C CB  . VAL A  1  292 ? 170.627 120.095 145.956 1.00 78.22  ? 292 VAL A CB  1 
ATOM   2305  C CG1 . VAL A  1  292 ? 170.863 121.270 146.889 1.00 78.22  ? 292 VAL A CG1 1 
ATOM   2306  C CG2 . VAL A  1  292 ? 169.585 120.447 144.914 1.00 78.22  ? 292 VAL A CG2 1 
ATOM   2307  N N   . PHE A  1  293 ? 171.421 118.486 143.219 1.00 77.96  ? 293 PHE A N   1 
ATOM   2308  C CA  . PHE A  1  293 ? 171.262 117.296 142.391 1.00 77.96  ? 293 PHE A CA  1 
ATOM   2309  C C   . PHE A  1  293 ? 172.606 116.627 142.128 1.00 77.96  ? 293 PHE A C   1 
ATOM   2310  O O   . PHE A  1  293 ? 172.703 115.392 142.121 1.00 77.96  ? 293 PHE A O   1 
ATOM   2311  C CB  . PHE A  1  293 ? 170.569 117.685 141.086 1.00 77.96  ? 293 PHE A CB  1 
ATOM   2312  C CG  . PHE A  1  293 ? 170.270 116.531 140.182 1.00 77.96  ? 293 PHE A CG  1 
ATOM   2313  C CD1 . PHE A  1  293 ? 169.249 115.648 140.481 1.00 77.96  ? 293 PHE A CD1 1 
ATOM   2314  C CD2 . PHE A  1  293 ? 170.985 116.352 139.012 1.00 77.96  ? 293 PHE A CD2 1 
ATOM   2315  C CE1 . PHE A  1  293 ? 168.963 114.593 139.643 1.00 77.96  ? 293 PHE A CE1 1 
ATOM   2316  C CE2 . PHE A  1  293 ? 170.701 115.303 138.167 1.00 77.96  ? 293 PHE A CE2 1 
ATOM   2317  C CZ  . PHE A  1  293 ? 169.690 114.419 138.483 1.00 77.96  ? 293 PHE A CZ  1 
ATOM   2318  N N   . MET A  1  294 ? 173.660 117.422 141.935 1.00 84.21  ? 294 MET A N   1 
ATOM   2319  C CA  . MET A  1  294 ? 174.984 116.846 141.753 1.00 84.21  ? 294 MET A CA  1 
ATOM   2320  C C   . MET A  1  294 ? 175.519 116.249 143.043 1.00 84.21  ? 294 MET A C   1 
ATOM   2321  O O   . MET A  1  294 ? 176.256 115.264 142.995 1.00 84.21  ? 294 MET A O   1 
ATOM   2322  C CB  . MET A  1  294 ? 175.952 117.893 141.206 1.00 84.21  ? 294 MET A CB  1 
ATOM   2323  C CG  . MET A  1  294 ? 175.686 118.273 139.762 1.00 84.21  ? 294 MET A CG  1 
ATOM   2324  S SD  . MET A  1  294 ? 175.823 116.851 138.661 1.00 84.21  ? 294 MET A SD  1 
ATOM   2325  C CE  . MET A  1  294 ? 177.581 116.521 138.751 1.00 84.21  ? 294 MET A CE  1 
ATOM   2326  N N   . ALA A  1  295 ? 175.155 116.803 144.201 1.00 75.83  ? 295 ALA A N   1 
ATOM   2327  C CA  . ALA A  1  295 ? 175.524 116.146 145.454 1.00 75.83  ? 295 ALA A CA  1 
ATOM   2328  C C   . ALA A  1  295 ? 174.841 114.787 145.580 1.00 75.83  ? 295 ALA A C   1 
ATOM   2329  O O   . ALA A  1  295 ? 175.463 113.797 146.003 1.00 75.83  ? 295 ALA A O   1 
ATOM   2330  C CB  . ALA A  1  295 ? 175.171 117.039 146.642 1.00 75.83  ? 295 ALA A CB  1 
ATOM   2331  N N   . LEU A  1  296 ? 173.559 114.721 145.213 1.00 80.01  ? 296 LEU A N   1 
ATOM   2332  C CA  . LEU A  1  296 ? 172.844 113.449 145.256 1.00 80.01  ? 296 LEU A CA  1 
ATOM   2333  C C   . LEU A  1  296 ? 173.484 112.426 144.322 1.00 80.01  ? 296 LEU A C   1 
ATOM   2334  O O   . LEU A  1  296 ? 173.707 111.272 144.707 1.00 80.01  ? 296 LEU A O   1 
ATOM   2335  C CB  . LEU A  1  296 ? 171.372 113.655 144.906 1.00 80.01  ? 296 LEU A CB  1 
ATOM   2336  C CG  . LEU A  1  296 ? 170.515 112.393 145.018 1.00 80.01  ? 296 LEU A CG  1 
ATOM   2337  C CD1 . LEU A  1  296 ? 170.535 111.879 146.446 1.00 80.01  ? 296 LEU A CD1 1 
ATOM   2338  C CD2 . LEU A  1  296 ? 169.088 112.657 144.562 1.00 80.01  ? 296 LEU A CD2 1 
ATOM   2339  N N   . LEU A  1  297 ? 173.795 112.833 143.087 1.00 80.51  ? 297 LEU A N   1 
ATOM   2340  C CA  . LEU A  1  297 ? 174.464 111.912 142.168 1.00 80.51  ? 297 LEU A CA  1 
ATOM   2341  C C   . LEU A  1  297 ? 175.869 111.561 142.639 1.00 80.51  ? 297 LEU A C   1 
ATOM   2342  O O   . LEU A  1  297 ? 176.352 110.454 142.375 1.00 80.51  ? 297 LEU A O   1 
ATOM   2343  C CB  . LEU A  1  297 ? 174.517 112.495 140.758 1.00 80.51  ? 297 LEU A CB  1 
ATOM   2344  C CG  . LEU A  1  297 ? 173.194 112.593 140.004 1.00 80.51  ? 297 LEU A CG  1 
ATOM   2345  C CD1 . LEU A  1  297 ? 173.423 113.254 138.657 1.00 80.51  ? 297 LEU A CD1 1 
ATOM   2346  C CD2 . LEU A  1  297 ? 172.568 111.217 139.836 1.00 80.51  ? 297 LEU A CD2 1 
ATOM   2347  N N   . GLU A  1  298 ? 176.538 112.482 143.334 1.00 81.76  ? 298 GLU A N   1 
ATOM   2348  C CA  . GLU A  1  298 ? 177.840 112.184 143.913 1.00 81.76  ? 298 GLU A CA  1 
ATOM   2349  C C   . GLU A  1  298 ? 177.743 111.016 144.880 1.00 81.76  ? 298 GLU A C   1 
ATOM   2350  O O   . GLU A  1  298 ? 178.504 110.044 144.780 1.00 81.76  ? 298 GLU A O   1 
ATOM   2351  C CB  . GLU A  1  298 ? 178.389 113.432 144.608 1.00 81.76  ? 298 GLU A CB  1 
ATOM   2352  C CG  . GLU A  1  298 ? 179.815 113.315 145.112 1.00 81.76  ? 298 GLU A CG  1 
ATOM   2353  C CD  . GLU A  1  298 ? 179.890 112.733 146.508 1.00 81.76  ? 298 GLU A CD  1 
ATOM   2354  O OE1 . GLU A  1  298 ? 178.919 112.902 147.275 1.00 81.76  ? 298 GLU A OE1 1 
ATOM   2355  O OE2 . GLU A  1  298 ? 180.919 112.112 146.840 1.00 81.76  ? 298 GLU A OE2 1 
ATOM   2356  N N   . TYR A  1  299 ? 176.796 111.080 145.817 1.00 82.01  ? 299 TYR A N   1 
ATOM   2357  C CA  . TYR A  1  299 ? 176.651 109.938 146.717 1.00 82.01  ? 299 TYR A CA  1 
ATOM   2358  C C   . TYR A  1  299 ? 176.160 108.695 145.984 1.00 82.01  ? 299 TYR A C   1 
ATOM   2359  O O   . TYR A  1  299 ? 176.538 107.575 146.350 1.00 82.01  ? 299 TYR A O   1 
ATOM   2360  C CB  . TYR A  1  299 ? 175.714 110.243 147.879 1.00 82.01  ? 299 TYR A CB  1 
ATOM   2361  C CG  . TYR A  1  299 ? 175.560 109.038 148.780 1.00 82.01  ? 299 TYR A CG  1 
ATOM   2362  C CD1 . TYR A  1  299 ? 176.599 108.630 149.604 1.00 82.01  ? 299 TYR A CD1 1 
ATOM   2363  C CD2 . TYR A  1  299 ? 174.393 108.285 148.780 1.00 82.01  ? 299 TYR A CD2 1 
ATOM   2364  C CE1 . TYR A  1  299 ? 176.473 107.528 150.423 1.00 82.01  ? 299 TYR A CE1 1 
ATOM   2365  C CE2 . TYR A  1  299 ? 174.259 107.177 149.594 1.00 82.01  ? 299 TYR A CE2 1 
ATOM   2366  C CZ  . TYR A  1  299 ? 175.303 106.803 150.412 1.00 82.01  ? 299 TYR A CZ  1 
ATOM   2367  O OH  . TYR A  1  299 ? 175.177 105.701 151.225 1.00 82.01  ? 299 TYR A OH  1 
ATOM   2368  N N   . ALA A  1  300 ? 175.318 108.862 144.962 1.00 77.27  ? 300 ALA A N   1 
ATOM   2369  C CA  . ALA A  1  300 ? 174.840 107.703 144.215 1.00 77.27  ? 300 ALA A CA  1 
ATOM   2370  C C   . ALA A  1  300 ? 175.982 106.978 143.518 1.00 77.27  ? 300 ALA A C   1 
ATOM   2371  O O   . ALA A  1  300 ? 175.935 105.754 143.356 1.00 77.27  ? 300 ALA A O   1 
ATOM   2372  C CB  . ALA A  1  300 ? 173.782 108.129 143.198 1.00 77.27  ? 300 ALA A CB  1 
ATOM   2373  N N   . LEU A  1  301 ? 177.008 107.715 143.094 1.00 82.11  ? 301 LEU A N   1 
ATOM   2374  C CA  . LEU A  1  301 ? 178.176 107.083 142.492 1.00 82.11  ? 301 LEU A CA  1 
ATOM   2375  C C   . LEU A  1  301 ? 179.110 106.509 143.551 1.00 82.11  ? 301 LEU A C   1 
ATOM   2376  O O   . LEU A  1  301 ? 179.721 105.453 143.338 1.00 82.11  ? 301 LEU A O   1 
ATOM   2377  C CB  . LEU A  1  301 ? 178.919 108.087 141.612 1.00 82.11  ? 301 LEU A CB  1 
ATOM   2378  C CG  . LEU A  1  301 ? 180.137 107.540 140.868 1.00 82.11  ? 301 LEU A CG  1 
ATOM   2379  C CD1 . LEU A  1  301 ? 179.726 106.433 139.913 1.00 82.11  ? 301 LEU A CD1 1 
ATOM   2380  C CD2 . LEU A  1  301 ? 180.853 108.655 140.125 1.00 82.11  ? 301 LEU A CD2 1 
ATOM   2381  N N   . VAL A  1  302 ? 179.239 107.193 144.692 1.00 81.15  ? 302 VAL A N   1 
ATOM   2382  C CA  . VAL A  1  302 ? 180.053 106.658 145.781 1.00 81.15  ? 302 VAL A CA  1 
ATOM   2383  C C   . VAL A  1  302 ? 179.497 105.325 146.263 1.00 81.15  ? 302 VAL A C   1 
ATOM   2384  O O   . VAL A  1  302 ? 180.256 104.423 146.640 1.00 81.15  ? 302 VAL A O   1 
ATOM   2385  C CB  . VAL A  1  302 ? 180.155 107.680 146.930 1.00 81.15  ? 302 VAL A CB  1 
ATOM   2386  C CG1 . VAL A  1  302 ? 180.865 107.070 148.123 1.00 81.15  ? 302 VAL A CG1 1 
ATOM   2387  C CG2 . VAL A  1  302 ? 180.898 108.913 146.462 1.00 81.15  ? 302 VAL A CG2 1 
ATOM   2388  N N   . ASN A  1  303 ? 178.172 105.172 146.247 1.00 88.74  ? 303 ASN A N   1 
ATOM   2389  C CA  . ASN A  1  303 ? 177.571 103.891 146.607 1.00 88.74  ? 303 ASN A CA  1 
ATOM   2390  C C   . ASN A  1  303 ? 178.033 102.785 145.665 1.00 88.74  ? 303 ASN A C   1 
ATOM   2391  O O   . ASN A  1  303 ? 178.380 101.685 146.110 1.00 88.74  ? 303 ASN A O   1 
ATOM   2392  C CB  . ASN A  1  303 ? 176.046 104.006 146.589 1.00 88.74  ? 303 ASN A CB  1 
ATOM   2393  C CG  . ASN A  1  303 ? 175.363 102.932 147.422 1.00 88.74  ? 303 ASN A CG  1 
ATOM   2394  O OD1 . ASN A  1  303 ? 174.174 103.035 147.728 1.00 88.74  ? 303 ASN A OD1 1 
ATOM   2395  N ND2 . ASN A  1  303 ? 176.113 101.905 147.804 1.00 88.74  ? 303 ASN A ND2 1 
ATOM   2396  N N   . TYR A  1  304 ? 178.048 103.062 144.360 1.00 91.19  ? 304 TYR A N   1 
ATOM   2397  C CA  . TYR A  1  304 ? 178.433 102.040 143.392 1.00 91.19  ? 304 TYR A CA  1 
ATOM   2398  C C   . TYR A  1  304 ? 179.915 101.704 143.492 1.00 91.19  ? 304 TYR A C   1 
ATOM   2399  O O   . TYR A  1  304 ? 180.297 100.532 143.404 1.00 91.19  ? 304 TYR A O   1 
ATOM   2400  C CB  . TYR A  1  304 ? 178.084 102.500 141.977 1.00 91.19  ? 304 TYR A CB  1 
ATOM   2401  C CG  . TYR A  1  304 ? 178.434 101.497 140.901 1.00 91.19  ? 304 TYR A CG  1 
ATOM   2402  C CD1 . TYR A  1  304 ? 177.672 100.350 140.720 1.00 91.19  ? 304 TYR A CD1 1 
ATOM   2403  C CD2 . TYR A  1  304 ? 179.521 101.701 140.061 1.00 91.19  ? 304 TYR A CD2 1 
ATOM   2404  C CE1 . TYR A  1  304 ? 177.986 99.431  139.737 1.00 91.19  ? 304 TYR A CE1 1 
ATOM   2405  C CE2 . TYR A  1  304 ? 179.842 100.788 139.075 1.00 91.19  ? 304 TYR A CE2 1 
ATOM   2406  C CZ  . TYR A  1  304 ? 179.071 99.655  138.917 1.00 91.19  ? 304 TYR A CZ  1 
ATOM   2407  O OH  . TYR A  1  304 ? 179.386 98.743  137.937 1.00 91.19  ? 304 TYR A OH  1 
ATOM   2408  N N   . ILE A  1  305 ? 180.767 102.715 143.674 1.00 93.58  ? 305 ILE A N   1 
ATOM   2409  C CA  . ILE A  1  305 ? 182.201 102.444 143.717 1.00 93.58  ? 305 ILE A CA  1 
ATOM   2410  C C   . ILE A  1  305 ? 182.642 101.863 145.054 1.00 93.58  ? 305 ILE A C   1 
ATOM   2411  O O   . ILE A  1  305 ? 183.729 101.278 145.136 1.00 93.58  ? 305 ILE A O   1 
ATOM   2412  C CB  . ILE A  1  305 ? 183.023 103.706 143.414 1.00 93.58  ? 305 ILE A CB  1 
ATOM   2413  C CG1 . ILE A  1  305 ? 182.815 104.754 144.503 1.00 93.58  ? 305 ILE A CG1 1 
ATOM   2414  C CG2 . ILE A  1  305 ? 182.649 104.272 142.053 1.00 93.58  ? 305 ILE A CG2 1 
ATOM   2415  C CD1 . ILE A  1  305 ? 183.754 105.921 144.398 1.00 93.58  ? 305 ILE A CD1 1 
ATOM   2416  N N   . PHE A  1  306 ? 181.834 102.008 146.108 1.00 98.91  ? 306 PHE A N   1 
ATOM   2417  C CA  . PHE A  1  306 ? 182.214 101.452 147.403 1.00 98.91  ? 306 PHE A CA  1 
ATOM   2418  C C   . PHE A  1  306 ? 182.115 99.933  147.403 1.00 98.91  ? 306 PHE A C   1 
ATOM   2419  O O   . PHE A  1  306 ? 182.915 99.254  148.057 1.00 98.91  ? 306 PHE A O   1 
ATOM   2420  C CB  . PHE A  1  306 ? 181.346 102.046 148.510 1.00 98.91  ? 306 PHE A CB  1 
ATOM   2421  C CG  . PHE A  1  306 ? 181.666 101.517 149.879 1.00 98.91  ? 306 PHE A CG  1 
ATOM   2422  C CD1 . PHE A  1  306 ? 182.810 101.924 150.544 1.00 98.91  ? 306 PHE A CD1 1 
ATOM   2423  C CD2 . PHE A  1  306 ? 180.820 100.615 150.503 1.00 98.91  ? 306 PHE A CD2 1 
ATOM   2424  C CE1 . PHE A  1  306 ? 183.105 101.438 151.803 1.00 98.91  ? 306 PHE A CE1 1 
ATOM   2425  C CE2 . PHE A  1  306 ? 181.109 100.127 151.764 1.00 98.91  ? 306 PHE A CE2 1 
ATOM   2426  C CZ  . PHE A  1  306 ? 182.253 100.539 152.414 1.00 98.91  ? 306 PHE A CZ  1 
ATOM   2427  N N   . PHE A  1  307 ? 181.134 99.383  146.684 1.00 99.22  ? 307 PHE A N   1 
ATOM   2428  C CA  . PHE A  1  307 ? 181.034 97.933  146.563 1.00 99.22  ? 307 PHE A CA  1 
ATOM   2429  C C   . PHE A  1  307 ? 182.267 97.356  145.882 1.00 99.22  ? 307 PHE A C   1 
ATOM   2430  O O   . PHE A  1  307 ? 182.714 96.253  146.218 1.00 99.22  ? 307 PHE A O   1 
ATOM   2431  C CB  . PHE A  1  307 ? 179.770 97.554  145.793 1.00 99.22  ? 307 PHE A CB  1 
ATOM   2432  C CG  . PHE A  1  307 ? 179.575 96.074  145.645 1.00 99.22  ? 307 PHE A CG  1 
ATOM   2433  C CD1 . PHE A  1  307 ? 179.115 95.315  146.707 1.00 99.22  ? 307 PHE A CD1 1 
ATOM   2434  C CD2 . PHE A  1  307 ? 179.859 95.439  144.447 1.00 99.22  ? 307 PHE A CD2 1 
ATOM   2435  C CE1 . PHE A  1  307 ? 178.935 93.953  146.577 1.00 99.22  ? 307 PHE A CE1 1 
ATOM   2436  C CE2 . PHE A  1  307 ? 179.682 94.077  144.311 1.00 99.22  ? 307 PHE A CE2 1 
ATOM   2437  C CZ  . PHE A  1  307 ? 179.220 93.333  145.378 1.00 99.22  ? 307 PHE A CZ  1 
ATOM   2438  N N   . SER A  1  308 ? 182.829 98.088  144.919 1.00 97.09  ? 308 SER A N   1 
ATOM   2439  C CA  . SER A  1  308 ? 184.047 97.633  144.259 1.00 97.09  ? 308 SER A CA  1 
ATOM   2440  C C   . SER A  1  308 ? 185.246 97.742  145.192 1.00 97.09  ? 308 SER A C   1 
ATOM   2441  O O   . SER A  1  308 ? 185.983 96.769  145.389 1.00 97.09  ? 308 SER A O   1 
ATOM   2442  C CB  . SER A  1  308 ? 184.278 98.437  142.979 1.00 97.09  ? 308 SER A CB  1 
ATOM   2443  O OG  . SER A  1  308 ? 184.535 99.799  143.272 1.00 97.09  ? 308 SER A OG  1 
ATOM   2444  N N   . GLN A  1  309 ? 185.456 98.921  145.783 1.00 96.68  ? 309 GLN A N   1 
ATOM   2445  C CA  . GLN A  1  309 ? 186.591 99.128  146.672 1.00 96.68  ? 309 GLN A CA  1 
ATOM   2446  C C   . GLN A  1  309 ? 186.309 100.301 147.594 1.00 96.68  ? 309 GLN A C   1 
ATOM   2447  O O   . GLN A  1  309 ? 185.730 101.300 147.145 1.00 96.68  ? 309 GLN A O   1 
ATOM   2448  C CB  . GLN A  1  309 ? 187.877 99.366  145.872 1.00 96.68  ? 309 GLN A CB  1 
ATOM   2449  C CG  . GLN A  1  309 ? 187.846 100.582 144.962 1.00 96.68  ? 309 GLN A CG  1 
ATOM   2450  C CD  . GLN A  1  309 ? 189.105 100.713 144.130 1.00 96.68  ? 309 GLN A CD  1 
ATOM   2451  O OE1 . GLN A  1  309 ? 190.038 99.926  144.270 1.00 96.68  ? 309 GLN A OE1 1 
ATOM   2452  N NE2 . GLN A  1  309 ? 189.135 101.709 143.254 1.00 96.68  ? 309 GLN A NE2 1 
ATOM   2453  N N   . PRO A  1  310 ? 186.678 100.216 148.876 1.00 96.71  ? 310 PRO A N   1 
ATOM   2454  C CA  . PRO A  1  310 ? 186.394 101.326 149.799 1.00 96.71  ? 310 PRO A CA  1 
ATOM   2455  C C   . PRO A  1  310 ? 187.387 102.472 149.720 1.00 96.71  ? 310 PRO A C   1 
ATOM   2456  O O   . PRO A  1  310 ? 187.035 103.597 150.108 1.00 96.71  ? 310 PRO A O   1 
ATOM   2457  C CB  . PRO A  1  310 ? 186.450 100.653 151.177 1.00 96.71  ? 310 PRO A CB  1 
ATOM   2458  C CG  . PRO A  1  310 ? 187.400 99.519  150.987 1.00 96.71  ? 310 PRO A CG  1 
ATOM   2459  C CD  . PRO A  1  310 ? 187.194 99.027  149.578 1.00 96.71  ? 310 PRO A CD  1 
ATOM   2460  N N   . ALA A  1  311 ? 188.608 102.228 149.237 1.00 84.67  ? 311 ALA A N   1 
ATOM   2461  C CA  . ALA A  1  311 ? 189.611 103.286 149.180 1.00 84.67  ? 311 ALA A CA  1 
ATOM   2462  C C   . ALA A  1  311 ? 189.160 104.421 148.270 1.00 84.67  ? 311 ALA A C   1 
ATOM   2463  O O   . ALA A  1  311 ? 189.169 105.591 148.668 1.00 84.67  ? 311 ALA A O   1 
ATOM   2464  C CB  . ALA A  1  311 ? 190.948 102.714 148.711 1.00 84.67  ? 311 ALA A CB  1 
ATOM   2465  N N   . ARG A  1  312 ? 188.761 104.089 147.038 1.00 93.79  ? 312 ARG A N   1 
ATOM   2466  C CA  . ARG A  1  312 ? 188.279 105.103 146.104 1.00 93.79  ? 312 ARG A CA  1 
ATOM   2467  C C   . ARG A  1  312 ? 187.033 105.800 146.637 1.00 93.79  ? 312 ARG A C   1 
ATOM   2468  O O   . ARG A  1  312 ? 186.853 107.008 146.438 1.00 93.79  ? 312 ARG A O   1 
ATOM   2469  C CB  . ARG A  1  312 ? 187.996 104.461 144.744 1.00 93.79  ? 312 ARG A CB  1 
ATOM   2470  C CG  . ARG A  1  312 ? 187.437 105.408 143.693 1.00 93.79  ? 312 ARG A CG  1 
ATOM   2471  C CD  . ARG A  1  312 ? 188.462 106.446 143.266 1.00 93.79  ? 312 ARG A CD  1 
ATOM   2472  N NE  . ARG A  1  312 ? 189.591 105.844 142.563 1.00 93.79  ? 312 ARG A NE  1 
ATOM   2473  C CZ  . ARG A  1  312 ? 190.723 106.482 142.286 1.00 93.79  ? 312 ARG A CZ  1 
ATOM   2474  N NH1 . ARG A  1  312 ? 190.882 107.746 142.651 1.00 93.79  ? 312 ARG A NH1 1 
ATOM   2475  N NH2 . ARG A  1  312 ? 191.698 105.856 141.642 1.00 93.79  ? 312 ARG A NH2 1 
ATOM   2476  N N   . ALA A  1  313 ? 186.161 105.053 147.317 1.00 83.72  ? 313 ALA A N   1 
ATOM   2477  C CA  . ALA A  1  313 ? 184.940 105.643 147.854 1.00 83.72  ? 313 ALA A CA  1 
ATOM   2478  C C   . ALA A  1  313 ? 185.258 106.710 148.893 1.00 83.72  ? 313 ALA A C   1 
ATOM   2479  O O   . ALA A  1  313 ? 184.791 107.851 148.790 1.00 83.72  ? 313 ALA A O   1 
ATOM   2480  C CB  . ALA A  1  313 ? 184.050 104.553 148.451 1.00 83.72  ? 313 ALA A CB  1 
ATOM   2481  N N   . ALA A  1  314 ? 186.052 106.354 149.908 1.00 81.47  ? 314 ALA A N   1 
ATOM   2482  C CA  . ALA A  1  314 ? 186.418 107.329 150.931 1.00 81.47  ? 314 ALA A CA  1 
ATOM   2483  C C   . ALA A  1  314 ? 187.221 108.475 150.331 1.00 81.47  ? 314 ALA A C   1 
ATOM   2484  O O   . ALA A  1  314 ? 187.083 109.634 150.753 1.00 81.47  ? 314 ALA A O   1 
ATOM   2485  C CB  . ALA A  1  314 ? 187.203 106.646 152.051 1.00 81.47  ? 314 ALA A CB  1 
ATOM   2486  N N   . ALA A  1  315 ? 188.054 108.173 149.331 1.00 81.47  ? 315 ALA A N   1 
ATOM   2487  C CA  . ALA A  1  315 ? 188.785 109.215 148.626 1.00 81.47  ? 315 ALA A CA  1 
ATOM   2488  C C   . ALA A  1  315 ? 187.828 110.252 148.060 1.00 81.47  ? 315 ALA A C   1 
ATOM   2489  O O   . ALA A  1  315 ? 187.846 111.414 148.473 1.00 81.47  ? 315 ALA A O   1 
ATOM   2490  C CB  . ALA A  1  315 ? 189.639 108.597 147.518 1.00 81.47  ? 315 ALA A CB  1 
ATOM   2491  N N   . ILE A  1  316 ? 186.956 109.834 147.139 1.00 81.18  ? 316 ILE A N   1 
ATOM   2492  C CA  . ILE A  1  316 ? 186.038 110.772 146.497 1.00 81.18  ? 316 ILE A CA  1 
ATOM   2493  C C   . ILE A  1  316 ? 185.146 111.462 147.519 1.00 81.18  ? 316 ILE A C   1 
ATOM   2494  O O   . ILE A  1  316 ? 184.806 112.641 147.356 1.00 81.18  ? 316 ILE A O   1 
ATOM   2495  C CB  . ILE A  1  316 ? 185.219 110.056 145.404 1.00 81.18  ? 316 ILE A CB  1 
ATOM   2496  C CG1 . ILE A  1  316 ? 186.126 109.689 144.229 1.00 81.18  ? 316 ILE A CG1 1 
ATOM   2497  C CG2 . ILE A  1  316 ? 184.054 110.911 144.936 1.00 81.18  ? 316 ILE A CG2 1 
ATOM   2498  C CD1 . ILE A  1  316 ? 185.456 108.843 143.179 1.00 81.18  ? 316 ILE A CD1 1 
ATOM   2499  N N   . ASP A  1  317 ? 184.778 110.768 148.598 1.00 84.98  ? 317 ASP A N   1 
ATOM   2500  C CA  . ASP A  1  317 ? 183.984 111.411 149.641 1.00 84.98  ? 317 ASP A CA  1 
ATOM   2501  C C   . ASP A  1  317 ? 184.719 112.608 150.228 1.00 84.98  ? 317 ASP A C   1 
ATOM   2502  O O   . ASP A  1  317 ? 184.193 113.727 150.238 1.00 84.98  ? 317 ASP A O   1 
ATOM   2503  C CB  . ASP A  1  317 ? 183.626 110.402 150.730 1.00 84.98  ? 317 ASP A CB  1 
ATOM   2504  C CG  . ASP A  1  317 ? 182.565 109.420 150.282 1.00 84.98  ? 317 ASP A CG  1 
ATOM   2505  O OD1 . ASP A  1  317 ? 181.710 109.811 149.460 1.00 84.98  ? 317 ASP A OD1 1 
ATOM   2506  O OD2 . ASP A  1  317 ? 182.590 108.260 150.743 1.00 84.98  ? 317 ASP A OD2 1 
ATOM   2507  N N   . ARG A  1  318 ? 185.951 112.402 150.700 1.00 82.90  ? 318 ARG A N   1 
ATOM   2508  C CA  . ARG A  1  318 ? 186.684 113.522 151.287 1.00 82.90  ? 318 ARG A CA  1 
ATOM   2509  C C   . ARG A  1  318 ? 187.051 114.577 150.243 1.00 82.90  ? 318 ARG A C   1 
ATOM   2510  O O   . ARG A  1  318 ? 187.110 115.773 150.566 1.00 82.90  ? 318 ARG A O   1 
ATOM   2511  C CB  . ARG A  1  318 ? 187.925 113.012 152.021 1.00 82.90  ? 318 ARG A CB  1 
ATOM   2512  C CG  . ARG A  1  318 ? 188.963 112.336 151.149 1.00 82.90  ? 318 ARG A CG  1 
ATOM   2513  C CD  . ARG A  1  318 ? 190.132 111.853 151.988 1.00 82.90  ? 318 ARG A CD  1 
ATOM   2514  N NE  . ARG A  1  318 ? 189.733 110.816 152.937 1.00 82.90  ? 318 ARG A NE  1 
ATOM   2515  C CZ  . ARG A  1  318 ? 189.779 109.513 152.686 1.00 82.90  ? 318 ARG A CZ  1 
ATOM   2516  N NH1 . ARG A  1  318 ? 190.223 109.075 151.516 1.00 82.90  ? 318 ARG A NH1 1 
ATOM   2517  N NH2 . ARG A  1  318 ? 189.396 108.645 153.612 1.00 82.90  ? 318 ARG A NH2 1 
ATOM   2518  N N   . TRP A  1  319 ? 187.268 114.168 148.989 1.00 93.06  ? 319 TRP A N   1 
ATOM   2519  C CA  . TRP A  1  319 ? 187.540 115.143 147.938 1.00 93.06  ? 319 TRP A CA  1 
ATOM   2520  C C   . TRP A  1  319 ? 186.351 116.073 147.737 1.00 93.06  ? 319 TRP A C   1 
ATOM   2521  O O   . TRP A  1  319 ? 186.508 117.296 147.723 1.00 93.06  ? 319 TRP A O   1 
ATOM   2522  C CB  . TRP A  1  319 ? 187.912 114.450 146.622 1.00 93.06  ? 319 TRP A CB  1 
ATOM   2523  C CG  . TRP A  1  319 ? 189.299 113.853 146.601 1.00 93.06  ? 319 TRP A CG  1 
ATOM   2524  C CD1 . TRP A  1  319 ? 189.627 112.531 146.655 1.00 93.06  ? 319 TRP A CD1 1 
ATOM   2525  C CD2 . TRP A  1  319 ? 190.540 114.568 146.545 1.00 93.06  ? 319 TRP A CD2 1 
ATOM   2526  N NE1 . TRP A  1  319 ? 190.990 112.375 146.623 1.00 93.06  ? 319 TRP A NE1 1 
ATOM   2527  C CE2 . TRP A  1  319 ? 191.574 113.612 146.558 1.00 93.06  ? 319 TRP A CE2 1 
ATOM   2528  C CE3 . TRP A  1  319 ? 190.876 115.923 146.483 1.00 93.06  ? 319 TRP A CE3 1 
ATOM   2529  C CZ2 . TRP A  1  319 ? 192.918 113.967 146.509 1.00 93.06  ? 319 TRP A CZ2 1 
ATOM   2530  C CZ3 . TRP A  1  319 ? 192.212 116.274 146.434 1.00 93.06  ? 319 TRP A CZ3 1 
ATOM   2531  C CH2 . TRP A  1  319 ? 193.216 115.300 146.447 1.00 93.06  ? 319 TRP A CH2 1 
ATOM   2532  N N   . SER A  1  320 ? 185.150 115.512 147.582 1.00 87.38  ? 320 SER A N   1 
ATOM   2533  C CA  . SER A  1  320 ? 183.965 116.358 147.484 1.00 87.38  ? 320 SER A CA  1 
ATOM   2534  C C   . SER A  1  320 ? 183.766 117.194 148.743 1.00 87.38  ? 320 SER A C   1 
ATOM   2535  O O   . SER A  1  320 ? 183.330 118.351 148.656 1.00 87.38  ? 320 SER A O   1 
ATOM   2536  C CB  . SER A  1  320 ? 182.728 115.503 147.208 1.00 87.38  ? 320 SER A CB  1 
ATOM   2537  O OG  . SER A  1  320 ? 182.806 114.892 145.931 1.00 87.38  ? 320 SER A OG  1 
ATOM   2538  N N   . ARG A  1  321 ? 184.085 116.632 149.915 1.00 87.27  ? 321 ARG A N   1 
ATOM   2539  C CA  . ARG A  1  321 ? 183.989 117.391 151.160 1.00 87.27  ? 321 ARG A CA  1 
ATOM   2540  C C   . ARG A  1  321 ? 184.829 118.658 151.100 1.00 87.27  ? 321 ARG A C   1 
ATOM   2541  O O   . ARG A  1  321 ? 184.382 119.730 151.525 1.00 87.27  ? 321 ARG A O   1 
ATOM   2542  C CB  . ARG A  1  321 ? 184.430 116.531 152.345 1.00 87.27  ? 321 ARG A CB  1 
ATOM   2543  C CG  . ARG A  1  321 ? 183.500 115.385 152.692 1.00 87.27  ? 321 ARG A CG  1 
ATOM   2544  C CD  . ARG A  1  321 ? 184.050 114.564 153.849 1.00 87.27  ? 321 ARG A CD  1 
ATOM   2545  N NE  . ARG A  1  321 ? 183.202 113.417 154.158 1.00 87.27  ? 321 ARG A NE  1 
ATOM   2546  C CZ  . ARG A  1  321 ? 183.481 112.508 155.086 1.00 87.27  ? 321 ARG A CZ  1 
ATOM   2547  N NH1 . ARG A  1  321 ? 184.590 112.610 155.806 1.00 87.27  ? 321 ARG A NH1 1 
ATOM   2548  N NH2 . ARG A  1  321 ? 182.649 111.498 155.297 1.00 87.27  ? 321 ARG A NH2 1 
ATOM   2549  N N   . ILE A  1  322 ? 186.054 118.554 150.586 1.00 86.79  ? 322 ILE A N   1 
ATOM   2550  C CA  . ILE A  1  322 ? 186.915 119.732 150.517 1.00 86.79  ? 322 ILE A CA  1 
ATOM   2551  C C   . ILE A  1  322 ? 186.677 120.580 149.268 1.00 86.79  ? 322 ILE A C   1 
ATOM   2552  O O   . ILE A  1  322 ? 187.141 121.729 149.218 1.00 86.79  ? 322 ILE A O   1 
ATOM   2553  C CB  . ILE A  1  322 ? 188.401 119.338 150.621 1.00 86.79  ? 322 ILE A CB  1 
ATOM   2554  C CG1 . ILE A  1  322 ? 188.805 118.402 149.482 1.00 86.79  ? 322 ILE A CG1 1 
ATOM   2555  C CG2 . ILE A  1  322 ? 188.691 118.696 151.974 1.00 86.79  ? 322 ILE A CG2 1 
ATOM   2556  C CD1 . ILE A  1  322 ? 190.294 118.135 149.407 1.00 86.79  ? 322 ILE A CD1 1 
ATOM   2557  N N   . PHE A  1  323 ? 185.963 120.060 148.266 1.00 95.46  ? 323 PHE A N   1 
ATOM   2558  C CA  . PHE A  1  323 ? 185.641 120.876 147.096 1.00 95.46  ? 323 PHE A CA  1 
ATOM   2559  C C   . PHE A  1  323 ? 184.404 121.743 147.316 1.00 95.46  ? 323 PHE A C   1 
ATOM   2560  O O   . PHE A  1  323 ? 184.469 122.971 147.188 1.00 95.46  ? 323 PHE A O   1 
ATOM   2561  C CB  . PHE A  1  323 ? 185.437 120.013 145.842 1.00 95.46  ? 323 PHE A CB  1 
ATOM   2562  C CG  . PHE A  1  323 ? 186.713 119.545 145.195 1.00 95.46  ? 323 PHE A CG  1 
ATOM   2563  C CD1 . PHE A  1  323 ? 187.575 120.450 144.606 1.00 95.46  ? 323 PHE A CD1 1 
ATOM   2564  C CD2 . PHE A  1  323 ? 187.002 118.198 145.083 1.00 95.46  ? 323 PHE A CD2 1 
ATOM   2565  C CE1 . PHE A  1  323 ? 188.737 120.021 143.989 1.00 95.46  ? 323 PHE A CE1 1 
ATOM   2566  C CE2 . PHE A  1  323 ? 188.156 117.763 144.458 1.00 95.46  ? 323 PHE A CE2 1 
ATOM   2567  C CZ  . PHE A  1  323 ? 189.023 118.675 143.910 1.00 95.46  ? 323 PHE A CZ  1 
ATOM   2568  N N   . PHE A  1  324 ? 183.267 121.121 147.634 1.00 91.67  ? 324 PHE A N   1 
ATOM   2569  C CA  . PHE A  1  324 ? 181.974 121.788 147.467 1.00 91.67  ? 324 PHE A CA  1 
ATOM   2570  C C   . PHE A  1  324 ? 181.824 123.134 148.171 1.00 91.67  ? 324 PHE A C   1 
ATOM   2571  O O   . PHE A  1  324 ? 181.277 124.058 147.544 1.00 91.67  ? 324 PHE A O   1 
ATOM   2572  C CB  . PHE A  1  324 ? 180.834 120.852 147.892 1.00 91.67  ? 324 PHE A CB  1 
ATOM   2573  C CG  . PHE A  1  324 ? 180.506 119.802 146.876 1.00 91.67  ? 324 PHE A CG  1 
ATOM   2574  C CD1 . PHE A  1  324 ? 181.049 119.860 145.603 1.00 91.67  ? 324 PHE A CD1 1 
ATOM   2575  C CD2 . PHE A  1  324 ? 179.625 118.780 147.175 1.00 91.67  ? 324 PHE A CD2 1 
ATOM   2576  C CE1 . PHE A  1  324 ? 180.742 118.900 144.658 1.00 91.67  ? 324 PHE A CE1 1 
ATOM   2577  C CE2 . PHE A  1  324 ? 179.311 117.818 146.233 1.00 91.67  ? 324 PHE A CE2 1 
ATOM   2578  C CZ  . PHE A  1  324 ? 179.871 117.879 144.973 1.00 91.67  ? 324 PHE A CZ  1 
ATOM   2579  N N   . PRO A  1  325 ? 182.232 123.321 149.433 1.00 86.71  ? 325 PRO A N   1 
ATOM   2580  C CA  . PRO A  1  325 ? 182.054 124.652 150.043 1.00 86.71  ? 325 PRO A CA  1 
ATOM   2581  C C   . PRO A  1  325 ? 182.755 125.763 149.281 1.00 86.71  ? 325 PRO A C   1 
ATOM   2582  O O   . PRO A  1  325 ? 182.183 126.848 149.100 1.00 86.71  ? 325 PRO A O   1 
ATOM   2583  C CB  . PRO A  1  325 ? 182.636 124.471 151.452 1.00 86.71  ? 325 PRO A CB  1 
ATOM   2584  C CG  . PRO A  1  325 ? 182.514 123.017 151.724 1.00 86.71  ? 325 PRO A CG  1 
ATOM   2585  C CD  . PRO A  1  325 ? 182.759 122.347 150.406 1.00 86.71  ? 325 PRO A CD  1 
ATOM   2586  N N   . VAL A  1  326 ? 183.981 125.514 148.818 1.00 90.37  ? 326 VAL A N   1 
ATOM   2587  C CA  . VAL A  1  326 ? 184.716 126.526 148.066 1.00 90.37  ? 326 VAL A CA  1 
ATOM   2588  C C   . VAL A  1  326 ? 183.995 126.854 146.766 1.00 90.37  ? 326 VAL A C   1 
ATOM   2589  O O   . VAL A  1  326 ? 183.863 128.026 146.391 1.00 90.37  ? 326 VAL A O   1 
ATOM   2590  C CB  . VAL A  1  326 ? 186.159 126.055 147.809 1.00 90.37  ? 326 VAL A CB  1 
ATOM   2591  C CG1 . VAL A  1  326 ? 186.900 127.059 146.941 1.00 90.37  ? 326 VAL A CG1 1 
ATOM   2592  C CG2 . VAL A  1  326 ? 186.888 125.836 149.127 1.00 90.37  ? 326 VAL A CG2 1 
ATOM   2593  N N   . VAL A  1  327 ? 183.517 125.827 146.059 1.00 84.49  ? 327 VAL A N   1 
ATOM   2594  C CA  . VAL A  1  327 ? 182.822 126.046 144.793 1.00 84.49  ? 327 VAL A CA  1 
ATOM   2595  C C   . VAL A  1  327 ? 181.550 126.855 145.013 1.00 84.49  ? 327 VAL A C   1 
ATOM   2596  O O   . VAL A  1  327 ? 181.238 127.773 144.245 1.00 84.49  ? 327 VAL A O   1 
ATOM   2597  C CB  . VAL A  1  327 ? 182.526 124.699 144.109 1.00 84.49  ? 327 VAL A CB  1 
ATOM   2598  C CG1 . VAL A  1  327 ? 181.708 124.907 142.847 1.00 84.49  ? 327 VAL A CG1 1 
ATOM   2599  C CG2 . VAL A  1  327 ? 183.821 123.971 143.794 1.00 84.49  ? 327 VAL A CG2 1 
ATOM   2600  N N   . PHE A  1  328 ? 180.800 126.533 146.070 1.00 87.19  ? 328 PHE A N   1 
ATOM   2601  C CA  . PHE A  1  328 ? 179.565 127.259 146.353 1.00 87.19  ? 328 PHE A CA  1 
ATOM   2602  C C   . PHE A  1  328 ? 179.840 128.715 146.706 1.00 87.19  ? 328 PHE A C   1 
ATOM   2603  O O   . PHE A  1  328 ? 179.146 129.619 146.220 1.00 87.19  ? 328 PHE A O   1 
ATOM   2604  C CB  . PHE A  1  328 ? 178.807 126.566 147.480 1.00 87.19  ? 328 PHE A CB  1 
ATOM   2605  C CG  . PHE A  1  328 ? 177.534 127.254 147.873 1.00 87.19  ? 328 PHE A CG  1 
ATOM   2606  C CD1 . PHE A  1  328 ? 176.419 127.202 147.057 1.00 87.19  ? 328 PHE A CD1 1 
ATOM   2607  C CD2 . PHE A  1  328 ? 177.445 127.932 149.076 1.00 87.19  ? 328 PHE A CD2 1 
ATOM   2608  C CE1 . PHE A  1  328 ? 175.245 127.826 147.424 1.00 87.19  ? 328 PHE A CE1 1 
ATOM   2609  C CE2 . PHE A  1  328 ? 176.273 128.554 149.452 1.00 87.19  ? 328 PHE A CE2 1 
ATOM   2610  C CZ  . PHE A  1  328 ? 175.170 128.501 148.624 1.00 87.19  ? 328 PHE A CZ  1 
ATOM   2611  N N   . SER A  1  329 ? 180.840 128.964 147.556 1.00 84.33  ? 329 SER A N   1 
ATOM   2612  C CA  . SER A  1  329 ? 181.179 130.341 147.899 1.00 84.33  ? 329 SER A CA  1 
ATOM   2613  C C   . SER A  1  329 ? 181.634 131.116 146.669 1.00 84.33  ? 329 SER A C   1 
ATOM   2614  O O   . SER A  1  329 ? 181.264 132.283 146.487 1.00 84.33  ? 329 SER A O   1 
ATOM   2615  C CB  . SER A  1  329 ? 182.258 130.363 148.980 1.00 84.33  ? 329 SER A CB  1 
ATOM   2616  O OG  . SER A  1  329 ? 181.779 129.799 150.188 1.00 84.33  ? 329 SER A OG  1 
ATOM   2617  N N   . PHE A  1  330 ? 182.432 130.479 145.807 1.00 90.19  ? 330 PHE A N   1 
ATOM   2618  C CA  . PHE A  1  330 ? 182.862 131.124 144.572 1.00 90.19  ? 330 PHE A CA  1 
ATOM   2619  C C   . PHE A  1  330 ? 181.671 131.472 143.691 1.00 90.19  ? 330 PHE A C   1 
ATOM   2620  O O   . PHE A  1  330 ? 181.600 132.576 143.136 1.00 90.19  ? 330 PHE A O   1 
ATOM   2621  C CB  . PHE A  1  330 ? 183.837 130.213 143.828 1.00 90.19  ? 330 PHE A CB  1 
ATOM   2622  C CG  . PHE A  1  330 ? 184.344 130.787 142.539 1.00 90.19  ? 330 PHE A CG  1 
ATOM   2623  C CD1 . PHE A  1  330 ? 185.298 131.788 142.539 1.00 90.19  ? 330 PHE A CD1 1 
ATOM   2624  C CD2 . PHE A  1  330 ? 183.872 130.317 141.325 1.00 90.19  ? 330 PHE A CD2 1 
ATOM   2625  C CE1 . PHE A  1  330 ? 185.769 132.315 141.353 1.00 90.19  ? 330 PHE A CE1 1 
ATOM   2626  C CE2 . PHE A  1  330 ? 184.338 130.840 140.136 1.00 90.19  ? 330 PHE A CE2 1 
ATOM   2627  C CZ  . PHE A  1  330 ? 185.289 131.840 140.150 1.00 90.19  ? 330 PHE A CZ  1 
ATOM   2628  N N   . PHE A  1  331 ? 180.725 130.540 143.552 1.00 88.20  ? 331 PHE A N   1 
ATOM   2629  C CA  . PHE A  1  331 ? 179.547 130.799 142.730 1.00 88.20  ? 331 PHE A CA  1 
ATOM   2630  C C   . PHE A  1  331 ? 178.737 131.963 143.280 1.00 88.20  ? 331 PHE A C   1 
ATOM   2631  O O   . PHE A  1  331 ? 178.293 132.829 142.520 1.00 88.20  ? 331 PHE A O   1 
ATOM   2632  C CB  . PHE A  1  331 ? 178.680 129.546 142.639 1.00 88.20  ? 331 PHE A CB  1 
ATOM   2633  C CG  . PHE A  1  331 ? 177.449 129.724 141.799 1.00 88.20  ? 331 PHE A CG  1 
ATOM   2634  C CD1 . PHE A  1  331 ? 177.530 129.714 140.419 1.00 88.20  ? 331 PHE A CD1 1 
ATOM   2635  C CD2 . PHE A  1  331 ? 176.212 129.909 142.391 1.00 88.20  ? 331 PHE A CD2 1 
ATOM   2636  C CE1 . PHE A  1  331 ? 176.398 129.877 139.645 1.00 88.20  ? 331 PHE A CE1 1 
ATOM   2637  C CE2 . PHE A  1  331 ? 175.078 130.074 141.623 1.00 88.20  ? 331 PHE A CE2 1 
ATOM   2638  C CZ  . PHE A  1  331 ? 175.171 130.058 140.248 1.00 88.20  ? 331 PHE A CZ  1 
ATOM   2639  N N   . ASN A  1  332 ? 178.540 132.006 144.599 1.00 84.64  ? 332 ASN A N   1 
ATOM   2640  C CA  . ASN A  1  332 ? 177.781 133.108 145.184 1.00 84.64  ? 332 ASN A CA  1 
ATOM   2641  C C   . ASN A  1  332 ? 178.498 134.440 145.010 1.00 84.64  ? 332 ASN A C   1 
ATOM   2642  O O   . ASN A  1  332 ? 177.857 135.459 144.733 1.00 84.64  ? 332 ASN A O   1 
ATOM   2643  C CB  . ASN A  1  332 ? 177.498 132.843 146.659 1.00 84.64  ? 332 ASN A CB  1 
ATOM   2644  C CG  . ASN A  1  332 ? 176.471 131.759 146.862 1.00 84.64  ? 332 ASN A CG  1 
ATOM   2645  O OD1 . ASN A  1  332 ? 176.787 130.674 147.339 1.00 84.64  ? 332 ASN A OD1 1 
ATOM   2646  N ND2 . ASN A  1  332 ? 175.224 132.051 146.510 1.00 84.64  ? 332 ASN A ND2 1 
ATOM   2647  N N   . ILE A  1  333 ? 179.821 134.462 145.169 1.00 80.49  ? 333 ILE A N   1 
ATOM   2648  C CA  . ILE A  1  333 ? 180.550 135.716 144.998 1.00 80.49  ? 333 ILE A CA  1 
ATOM   2649  C C   . ILE A  1  333 ? 180.442 136.198 143.555 1.00 80.49  ? 333 ILE A C   1 
ATOM   2650  O O   . ILE A  1  333 ? 180.174 137.378 143.294 1.00 80.49  ? 333 ILE A O   1 
ATOM   2651  C CB  . ILE A  1  333 ? 182.014 135.559 145.442 1.00 80.49  ? 333 ILE A CB  1 
ATOM   2652  C CG1 . ILE A  1  333 ? 182.086 135.297 146.948 1.00 80.49  ? 333 ILE A CG1 1 
ATOM   2653  C CG2 . ILE A  1  333 ? 182.809 136.799 145.100 1.00 80.49  ? 333 ILE A CG2 1 
ATOM   2654  C CD1 . ILE A  1  333 ? 183.463 134.905 147.439 1.00 80.49  ? 333 ILE A CD1 1 
ATOM   2655  N N   . VAL A  1  334 ? 180.630 135.286 142.596 1.00 85.24  ? 334 VAL A N   1 
ATOM   2656  C CA  . VAL A  1  334 ? 180.510 135.652 141.186 1.00 85.24  ? 334 VAL A CA  1 
ATOM   2657  C C   . VAL A  1  334 ? 179.102 136.142 140.876 1.00 85.24  ? 334 VAL A C   1 
ATOM   2658  O O   . VAL A  1  334 ? 178.913 137.092 140.107 1.00 85.24  ? 334 VAL A O   1 
ATOM   2659  C CB  . VAL A  1  334 ? 180.906 134.463 140.290 1.00 85.24  ? 334 VAL A CB  1 
ATOM   2660  C CG1 . VAL A  1  334 ? 180.628 134.777 138.831 1.00 85.24  ? 334 VAL A CG1 1 
ATOM   2661  C CG2 . VAL A  1  334 ? 182.371 134.126 140.481 1.00 85.24  ? 334 VAL A CG2 1 
ATOM   2662  N N   . TYR A  1  335 ? 178.093 135.511 141.477 1.00 81.81  ? 335 TYR A N   1 
ATOM   2663  C CA  . TYR A  1  335 ? 176.710 135.899 141.224 1.00 81.81  ? 335 TYR A CA  1 
ATOM   2664  C C   . TYR A  1  335 ? 176.419 137.291 141.764 1.00 81.81  ? 335 TYR A C   1 
ATOM   2665  O O   . TYR A  1  335 ? 175.844 138.132 141.064 1.00 81.81  ? 335 TYR A O   1 
ATOM   2666  C CB  . TYR A  1  335 ? 175.768 134.876 141.855 1.00 81.81  ? 335 TYR A CB  1 
ATOM   2667  C CG  . TYR A  1  335 ? 174.304 135.155 141.634 1.00 81.81  ? 335 TYR A CG  1 
ATOM   2668  C CD1 . TYR A  1  335 ? 173.693 134.839 140.431 1.00 81.81  ? 335 TYR A CD1 1 
ATOM   2669  C CD2 . TYR A  1  335 ? 173.533 135.736 142.629 1.00 81.81  ? 335 TYR A CD2 1 
ATOM   2670  C CE1 . TYR A  1  335 ? 172.353 135.088 140.226 1.00 81.81  ? 335 TYR A CE1 1 
ATOM   2671  C CE2 . TYR A  1  335 ? 172.193 135.990 142.434 1.00 81.81  ? 335 TYR A CE2 1 
ATOM   2672  C CZ  . TYR A  1  335 ? 171.608 135.665 141.229 1.00 81.81  ? 335 TYR A CZ  1 
ATOM   2673  O OH  . TYR A  1  335 ? 170.271 135.918 141.026 1.00 81.81  ? 335 TYR A OH  1 
ATOM   2674  N N   . TRP A  1  336 ? 176.815 137.558 143.007 1.00 82.40  ? 336 TRP A N   1 
ATOM   2675  C CA  . TRP A  1  336 ? 176.416 138.804 143.648 1.00 82.40  ? 336 TRP A CA  1 
ATOM   2676  C C   . TRP A  1  336 ? 177.278 139.988 143.230 1.00 82.40  ? 336 TRP A C   1 
ATOM   2677  O O   . TRP A  1  336 ? 176.814 141.131 143.305 1.00 82.40  ? 336 TRP A O   1 
ATOM   2678  C CB  . TRP A  1  336 ? 176.430 138.645 145.167 1.00 82.40  ? 336 TRP A CB  1 
ATOM   2679  C CG  . TRP A  1  336 ? 175.324 137.767 145.661 1.00 82.40  ? 336 TRP A CG  1 
ATOM   2680  C CD1 . TRP A  1  336 ? 175.400 136.440 145.952 1.00 82.40  ? 336 TRP A CD1 1 
ATOM   2681  C CD2 . TRP A  1  336 ? 173.968 138.154 145.910 1.00 82.40  ? 336 TRP A CD2 1 
ATOM   2682  N NE1 . TRP A  1  336 ? 174.179 135.974 146.370 1.00 82.40  ? 336 TRP A NE1 1 
ATOM   2683  C CE2 . TRP A  1  336 ? 173.282 137.008 146.353 1.00 82.40  ? 336 TRP A CE2 1 
ATOM   2684  C CE3 . TRP A  1  336 ? 173.269 139.357 145.805 1.00 82.40  ? 336 TRP A CE3 1 
ATOM   2685  C CZ2 . TRP A  1  336 ? 171.934 137.030 146.690 1.00 82.40  ? 336 TRP A CZ2 1 
ATOM   2686  C CZ3 . TRP A  1  336 ? 171.930 139.377 146.141 1.00 82.40  ? 336 TRP A CZ3 1 
ATOM   2687  C CH2 . TRP A  1  336 ? 171.277 138.221 146.578 1.00 82.40  ? 336 TRP A CH2 1 
ATOM   2688  N N   . LEU A  1  337 ? 178.519 139.761 142.790 1.00 89.04  ? 337 LEU A N   1 
ATOM   2689  C CA  . LEU A  1  337 ? 179.318 140.893 142.333 1.00 89.04  ? 337 LEU A CA  1 
ATOM   2690  C C   . LEU A  1  337 ? 178.803 141.462 141.017 1.00 89.04  ? 337 LEU A C   1 
ATOM   2691  O O   . LEU A  1  337 ? 178.904 142.672 140.788 1.00 89.04  ? 337 LEU A O   1 
ATOM   2692  C CB  . LEU A  1  337 ? 180.786 140.497 142.187 1.00 89.04  ? 337 LEU A CB  1 
ATOM   2693  C CG  . LEU A  1  337 ? 181.576 140.270 143.473 1.00 89.04  ? 337 LEU A CG  1 
ATOM   2694  C CD1 . LEU A  1  337 ? 182.976 139.788 143.143 1.00 89.04  ? 337 LEU A CD1 1 
ATOM   2695  C CD2 . LEU A  1  337 ? 181.627 141.550 144.288 1.00 89.04  ? 337 LEU A CD2 1 
ATOM   2696  N N   . TYR A  1  338 ? 178.251 140.618 140.146 1.00 93.74  ? 338 TYR A N   1 
ATOM   2697  C CA  . TYR A  1  338 ? 177.875 141.084 138.817 1.00 93.74  ? 338 TYR A CA  1 
ATOM   2698  C C   . TYR A  1  338 ? 176.545 141.822 138.811 1.00 93.74  ? 338 TYR A C   1 
ATOM   2699  O O   . TYR A  1  338 ? 176.359 142.739 138.004 1.00 93.74  ? 338 TYR A O   1 
ATOM   2700  C CB  . TYR A  1  338 ? 177.834 139.909 137.842 1.00 93.74  ? 338 TYR A CB  1 
ATOM   2701  C CG  . TYR A  1  338 ? 179.204 139.352 137.538 1.00 93.74  ? 338 TYR A CG  1 
ATOM   2702  C CD1 . TYR A  1  338 ? 180.350 140.068 137.862 1.00 93.74  ? 338 TYR A CD1 1 
ATOM   2703  C CD2 . TYR A  1  338 ? 179.355 138.115 136.930 1.00 93.74  ? 338 TYR A CD2 1 
ATOM   2704  C CE1 . TYR A  1  338 ? 181.608 139.567 137.590 1.00 93.74  ? 338 TYR A CE1 1 
ATOM   2705  C CE2 . TYR A  1  338 ? 180.611 137.605 136.653 1.00 93.74  ? 338 TYR A CE2 1 
ATOM   2706  C CZ  . TYR A  1  338 ? 181.733 138.336 136.985 1.00 93.74  ? 338 TYR A CZ  1 
ATOM   2707  O OH  . TYR A  1  338 ? 182.985 137.834 136.712 1.00 93.74  ? 338 TYR A OH  1 
ATOM   2708  N N   . TYR A  1  339 ? 175.612 141.449 139.683 1.00 76.77  ? 339 TYR A N   1 
ATOM   2709  C CA  . TYR A  1  339 ? 174.323 142.126 139.696 1.00 76.77  ? 339 TYR A CA  1 
ATOM   2710  C C   . TYR A  1  339 ? 174.322 143.368 140.580 1.00 76.77  ? 339 TYR A C   1 
ATOM   2711  O O   . TYR A  1  339 ? 173.842 144.423 140.154 1.00 76.77  ? 339 TYR A O   1 
ATOM   2712  C CB  . TYR A  1  339 ? 173.222 141.157 140.132 1.00 76.77  ? 339 TYR A CB  1 
ATOM   2713  C CG  . TYR A  1  339 ? 172.901 140.120 139.079 1.00 76.77  ? 339 TYR A CG  1 
ATOM   2714  C CD1 . TYR A  1  339 ? 173.381 140.250 137.786 1.00 76.77  ? 339 TYR A CD1 1 
ATOM   2715  C CD2 . TYR A  1  339 ? 172.105 139.024 139.371 1.00 76.77  ? 339 TYR A CD2 1 
ATOM   2716  C CE1 . TYR A  1  339 ? 173.092 139.314 136.817 1.00 76.77  ? 339 TYR A CE1 1 
ATOM   2717  C CE2 . TYR A  1  339 ? 171.808 138.082 138.406 1.00 76.77  ? 339 TYR A CE2 1 
ATOM   2718  C CZ  . TYR A  1  339 ? 172.303 138.233 137.131 1.00 76.77  ? 339 TYR A CZ  1 
ATOM   2719  O OH  . TYR A  1  339 ? 172.014 137.302 136.162 1.00 76.77  ? 339 TYR A OH  1 
ATOM   2720  N N   . VAL A  1  340 ? 174.854 143.277 141.793 1.00 70.91  ? 340 VAL A N   1 
ATOM   2721  C CA  . VAL A  1  340 ? 174.939 144.447 142.656 1.00 70.91  ? 340 VAL A CA  1 
ATOM   2722  C C   . VAL A  1  340 ? 176.157 145.275 142.273 1.00 70.91  ? 340 VAL A C   1 
ATOM   2723  O O   . VAL A  1  340 ? 176.110 146.504 142.232 1.00 70.91  ? 340 VAL A O   1 
ATOM   2724  C CB  . VAL A  1  340 ? 174.994 144.054 144.139 1.00 70.91  ? 340 VAL A CB  1 
ATOM   2725  C CG1 . VAL A  1  340 ? 175.170 145.289 145.009 1.00 70.91  ? 340 VAL A CG1 1 
ATOM   2726  C CG2 . VAL A  1  340 ? 173.741 143.304 144.532 1.00 70.91  ? 340 VAL A CG2 1 
ATOM   2727  N N   . ASP B  2  10  ? 147.204 195.939 112.656 1.00 71.69  ? 10  ASP B N   1 
ATOM   2728  C CA  . ASP B  2  10  ? 146.256 194.832 112.673 1.00 71.69  ? 10  ASP B CA  1 
ATOM   2729  C C   . ASP B  2  10  ? 146.749 193.664 111.830 1.00 71.69  ? 10  ASP B C   1 
ATOM   2730  O O   . ASP B  2  10  ? 146.524 193.618 110.622 1.00 71.69  ? 10  ASP B O   1 
ATOM   2731  C CB  . ASP B  2  10  ? 144.886 195.293 112.179 1.00 71.69  ? 10  ASP B CB  1 
ATOM   2732  C CG  . ASP B  2  10  ? 144.192 196.209 113.162 1.00 71.69  ? 10  ASP B CG  1 
ATOM   2733  O OD1 . ASP B  2  10  ? 144.434 196.069 114.379 1.00 71.69  ? 10  ASP B OD1 1 
ATOM   2734  O OD2 . ASP B  2  10  ? 143.403 197.069 112.719 1.00 71.69  ? 10  ASP B OD2 1 
ATOM   2735  N N   . ASN B  2  11  ? 147.429 192.720 112.479 1.00 72.33  ? 11  ASN B N   1 
ATOM   2736  C CA  . ASN B  2  11  ? 147.904 191.533 111.780 1.00 72.33  ? 11  ASN B CA  1 
ATOM   2737  C C   . ASN B  2  11  ? 146.814 190.479 111.640 1.00 72.33  ? 11  ASN B C   1 
ATOM   2738  O O   . ASN B  2  11  ? 146.846 189.685 110.694 1.00 72.33  ? 11  ASN B O   1 
ATOM   2739  C CB  . ASN B  2  11  ? 149.113 190.944 112.507 1.00 72.33  ? 11  ASN B CB  1 
ATOM   2740  C CG  . ASN B  2  11  ? 150.303 191.883 112.514 1.00 72.33  ? 11  ASN B CG  1 
ATOM   2741  O OD1 . ASN B  2  11  ? 150.721 192.367 113.566 1.00 72.33  ? 11  ASN B OD1 1 
ATOM   2742  N ND2 . ASN B  2  11  ? 150.857 192.144 111.336 1.00 72.33  ? 11  ASN B ND2 1 
ATOM   2743  N N   . THR B  2  12  ? 145.853 190.450 112.563 1.00 60.70  ? 12  THR B N   1 
ATOM   2744  C CA  . THR B  2  12  ? 144.810 189.434 112.556 1.00 60.70  ? 12  THR B CA  1 
ATOM   2745  C C   . THR B  2  12  ? 143.557 189.851 111.800 1.00 60.70  ? 12  THR B C   1 
ATOM   2746  O O   . THR B  2  12  ? 142.755 188.982 111.439 1.00 60.70  ? 12  THR B O   1 
ATOM   2747  C CB  . THR B  2  12  ? 144.423 189.064 113.990 1.00 60.70  ? 12  THR B CB  1 
ATOM   2748  O OG1 . THR B  2  12  ? 143.947 190.230 114.673 1.00 60.70  ? 12  THR B OG1 1 
ATOM   2749  C CG2 . THR B  2  12  ? 145.620 188.494 114.732 1.00 60.70  ? 12  THR B CG2 1 
ATOM   2750  N N   . THR B  2  13  ? 143.359 191.149 111.562 1.00 59.54  ? 13  THR B N   1 
ATOM   2751  C CA  . THR B  2  13  ? 142.156 191.589 110.865 1.00 59.54  ? 13  THR B CA  1 
ATOM   2752  C C   . THR B  2  13  ? 142.111 191.059 109.437 1.00 59.54  ? 13  THR B C   1 
ATOM   2753  O O   . THR B  2  13  ? 141.026 190.811 108.901 1.00 59.54  ? 13  THR B O   1 
ATOM   2754  C CB  . THR B  2  13  ? 142.073 193.116 110.881 1.00 59.54  ? 13  THR B CB  1 
ATOM   2755  O OG1 . THR B  2  13  ? 142.058 193.574 112.239 1.00 59.54  ? 13  THR B OG1 1 
ATOM   2756  C CG2 . THR B  2  13  ? 140.806 193.596 110.190 1.00 59.54  ? 13  THR B CG2 1 
ATOM   2757  N N   . VAL B  2  14  ? 143.271 190.857 108.814 1.00 51.49  ? 14  VAL B N   1 
ATOM   2758  C CA  . VAL B  2  14  ? 143.301 190.267 107.480 1.00 51.49  ? 14  VAL B CA  1 
ATOM   2759  C C   . VAL B  2  14  ? 142.890 188.802 107.538 1.00 51.49  ? 14  VAL B C   1 
ATOM   2760  O O   . VAL B  2  14  ? 141.998 188.354 106.803 1.00 51.49  ? 14  VAL B O   1 
ATOM   2761  C CB  . VAL B  2  14  ? 144.696 190.430 106.855 1.00 51.49  ? 14  VAL B CB  1 
ATOM   2762  C CG1 . VAL B  2  14  ? 144.766 189.699 105.527 1.00 51.49  ? 14  VAL B CG1 1 
ATOM   2763  C CG2 . VAL B  2  14  ? 145.028 191.899 106.680 1.00 51.49  ? 14  VAL B CG2 1 
ATOM   2764  N N   . PHE B  2  15  ? 143.534 188.034 108.418 1.00 47.07  ? 15  PHE B N   1 
ATOM   2765  C CA  . PHE B  2  15  ? 143.280 186.601 108.478 1.00 47.07  ? 15  PHE B CA  1 
ATOM   2766  C C   . PHE B  2  15  ? 141.863 186.294 108.933 1.00 47.07  ? 15  PHE B C   1 
ATOM   2767  O O   . PHE B  2  15  ? 141.267 185.322 108.463 1.00 47.07  ? 15  PHE B O   1 
ATOM   2768  C CB  . PHE B  2  15  ? 144.286 185.931 109.404 1.00 47.07  ? 15  PHE B CB  1 
ATOM   2769  C CG  . PHE B  2  15  ? 145.692 185.993 108.906 1.00 47.07  ? 15  PHE B CG  1 
ATOM   2770  C CD1 . PHE B  2  15  ? 146.136 185.112 107.941 1.00 47.07  ? 15  PHE B CD1 1 
ATOM   2771  C CD2 . PHE B  2  15  ? 146.571 186.936 109.401 1.00 47.07  ? 15  PHE B CD2 1 
ATOM   2772  C CE1 . PHE B  2  15  ? 147.431 185.171 107.480 1.00 47.07  ? 15  PHE B CE1 1 
ATOM   2773  C CE2 . PHE B  2  15  ? 147.867 187.000 108.945 1.00 47.07  ? 15  PHE B CE2 1 
ATOM   2774  C CZ  . PHE B  2  15  ? 148.299 186.116 107.983 1.00 47.07  ? 15  PHE B CZ  1 
ATOM   2775  N N   . THR B  2  16  ? 141.305 187.099 109.838 1.00 42.93  ? 16  THR B N   1 
ATOM   2776  C CA  . THR B  2  16  ? 139.931 186.858 110.260 1.00 42.93  ? 16  THR B CA  1 
ATOM   2777  C C   . THR B  2  16  ? 138.961 187.061 109.104 1.00 42.93  ? 16  THR B C   1 
ATOM   2778  O O   . THR B  2  16  ? 137.998 186.304 108.956 1.00 42.93  ? 16  THR B O   1 
ATOM   2779  C CB  . THR B  2  16  ? 139.568 187.758 111.436 1.00 42.93  ? 16  THR B CB  1 
ATOM   2780  O OG1 . THR B  2  16  ? 140.449 187.483 112.531 1.00 42.93  ? 16  THR B OG1 1 
ATOM   2781  C CG2 . THR B  2  16  ? 138.141 187.497 111.879 1.00 42.93  ? 16  THR B CG2 1 
ATOM   2782  N N   . ARG B  2  17  ? 139.211 188.059 108.256 1.00 51.83  ? 17  ARG B N   1 
ATOM   2783  C CA  . ARG B  2  17  ? 138.381 188.234 107.070 1.00 51.83  ? 17  ARG B CA  1 
ATOM   2784  C C   . ARG B  2  17  ? 138.536 187.057 106.115 1.00 51.83  ? 17  ARG B C   1 
ATOM   2785  O O   . ARG B  2  17  ? 137.544 186.524 105.602 1.00 51.83  ? 17  ARG B O   1 
ATOM   2786  C CB  . ARG B  2  17  ? 138.736 189.545 106.373 1.00 51.83  ? 17  ARG B CB  1 
ATOM   2787  C CG  . ARG B  2  17  ? 138.315 190.779 107.146 1.00 51.83  ? 17  ARG B CG  1 
ATOM   2788  C CD  . ARG B  2  17  ? 138.744 192.043 106.431 1.00 51.83  ? 17  ARG B CD  1 
ATOM   2789  N NE  . ARG B  2  17  ? 138.340 193.241 107.159 1.00 51.83  ? 17  ARG B NE  1 
ATOM   2790  C CZ  . ARG B  2  17  ? 138.666 194.476 106.796 1.00 51.83  ? 17  ARG B CZ  1 
ATOM   2791  N NH1 . ARG B  2  17  ? 138.254 195.511 107.515 1.00 51.83  ? 17  ARG B NH1 1 
ATOM   2792  N NH2 . ARG B  2  17  ? 139.411 194.677 105.718 1.00 51.83  ? 17  ARG B NH2 1 
ATOM   2793  N N   . ILE B  2  18  ? 139.780 186.632 105.870 1.00 41.93  ? 18  ILE B N   1 
ATOM   2794  C CA  . ILE B  2  18  ? 140.012 185.515 104.954 1.00 41.93  ? 18  ILE B CA  1 
ATOM   2795  C C   . ILE B  2  18  ? 139.338 184.250 105.465 1.00 41.93  ? 18  ILE B C   1 
ATOM   2796  O O   . ILE B  2  18  ? 138.817 183.446 104.684 1.00 41.93  ? 18  ILE B O   1 
ATOM   2797  C CB  . ILE B  2  18  ? 141.520 185.300 104.735 1.00 41.93  ? 18  ILE B CB  1 
ATOM   2798  C CG1 . ILE B  2  18  ? 142.127 186.491 103.994 1.00 41.93  ? 18  ILE B CG1 1 
ATOM   2799  C CG2 . ILE B  2  18  ? 141.779 184.018 103.971 1.00 41.93  ? 18  ILE B CG2 1 
ATOM   2800  C CD1 . ILE B  2  18  ? 143.640 186.460 103.930 1.00 41.93  ? 18  ILE B CD1 1 
ATOM   2801  N N   . LEU B  2  19  ? 139.315 184.063 106.781 1.00 33.99  ? 19  LEU B N   1 
ATOM   2802  C CA  . LEU B  2  19  ? 138.814 182.825 107.354 1.00 33.99  ? 19  LEU B CA  1 
ATOM   2803  C C   . LEU B  2  19  ? 137.326 182.877 107.676 1.00 33.99  ? 19  LEU B C   1 
ATOM   2804  O O   . LEU B  2  19  ? 136.726 181.830 107.934 1.00 33.99  ? 19  LEU B O   1 
ATOM   2805  C CB  . LEU B  2  19  ? 139.622 182.481 108.607 1.00 33.99  ? 19  LEU B CB  1 
ATOM   2806  C CG  . LEU B  2  19  ? 139.460 181.093 109.211 1.00 33.99  ? 19  LEU B CG  1 
ATOM   2807  C CD1 . LEU B  2  19  ? 139.858 180.061 108.184 1.00 33.99  ? 19  LEU B CD1 1 
ATOM   2808  C CD2 . LEU B  2  19  ? 140.330 180.970 110.437 1.00 33.99  ? 19  LEU B CD2 1 
ATOM   2809  N N   . ASP B  2  20  ? 136.716 184.062 107.674 1.00 42.53  ? 20  ASP B N   1 
ATOM   2810  C CA  . ASP B  2  20  ? 135.260 184.132 107.716 1.00 42.53  ? 20  ASP B CA  1 
ATOM   2811  C C   . ASP B  2  20  ? 134.662 184.025 106.321 1.00 42.53  ? 20  ASP B C   1 
ATOM   2812  O O   . ASP B  2  20  ? 133.611 183.400 106.144 1.00 42.53  ? 20  ASP B O   1 
ATOM   2813  C CB  . ASP B  2  20  ? 134.801 185.425 108.386 1.00 42.53  ? 20  ASP B CB  1 
ATOM   2814  C CG  . ASP B  2  20  ? 135.006 185.410 109.885 1.00 42.53  ? 20  ASP B CG  1 
ATOM   2815  O OD1 . ASP B  2  20  ? 134.975 184.311 110.475 1.00 42.53  ? 20  ASP B OD1 1 
ATOM   2816  O OD2 . ASP B  2  20  ? 135.185 186.496 110.476 1.00 42.53  ? 20  ASP B OD2 1 
ATOM   2817  N N   . ARG B  2  21  ? 135.304 184.635 105.323 1.00 41.60  ? 21  ARG B N   1 
ATOM   2818  C CA  . ARG B  2  21  ? 134.820 184.492 103.954 1.00 41.60  ? 21  ARG B CA  1 
ATOM   2819  C C   . ARG B  2  21  ? 134.924 183.051 103.479 1.00 41.60  ? 21  ARG B C   1 
ATOM   2820  O O   . ARG B  2  21  ? 134.124 182.609 102.648 1.00 41.60  ? 21  ARG B O   1 
ATOM   2821  C CB  . ARG B  2  21  ? 135.605 185.411 103.023 1.00 41.60  ? 21  ARG B CB  1 
ATOM   2822  C CG  . ARG B  2  21  ? 135.139 185.387 101.580 1.00 41.60  ? 21  ARG B CG  1 
ATOM   2823  C CD  . ARG B  2  21  ? 135.938 186.369 100.750 1.00 41.60  ? 21  ARG B CD  1 
ATOM   2824  N NE  . ARG B  2  21  ? 135.671 187.745 101.154 1.00 41.60  ? 21  ARG B NE  1 
ATOM   2825  C CZ  . ARG B  2  21  ? 136.373 188.793 100.739 1.00 41.60  ? 21  ARG B CZ  1 
ATOM   2826  N NH1 . ARG B  2  21  ? 136.059 190.010 101.159 1.00 41.60  ? 21  ARG B NH1 1 
ATOM   2827  N NH2 . ARG B  2  21  ? 137.392 188.623 99.908  1.00 41.60  ? 21  ARG B NH2 1 
ATOM   2828  N N   . LEU B  2  22  ? 135.895 182.305 104.002 1.00 33.40  ? 22  LEU B N   1 
ATOM   2829  C CA  . LEU B  2  22  ? 136.078 180.916 103.603 1.00 33.40  ? 22  LEU B CA  1 
ATOM   2830  C C   . LEU B  2  22  ? 134.934 180.031 104.084 1.00 33.40  ? 22  LEU B C   1 
ATOM   2831  O O   . LEU B  2  22  ? 134.586 179.056 103.413 1.00 33.40  ? 22  LEU B O   1 
ATOM   2832  C CB  . LEU B  2  22  ? 137.424 180.419 104.128 1.00 33.40  ? 22  LEU B CB  1 
ATOM   2833  C CG  . LEU B  2  22  ? 137.939 179.028 103.788 1.00 33.40  ? 22  LEU B CG  1 
ATOM   2834  C CD1 . LEU B  2  22  ? 139.448 179.053 103.722 1.00 33.40  ? 22  LEU B CD1 1 
ATOM   2835  C CD2 . LEU B  2  22  ? 137.497 178.065 104.861 1.00 33.40  ? 22  LEU B CD2 1 
ATOM   2836  N N   . LEU B  2  23  ? 134.347 180.345 105.236 1.00 35.50  ? 23  LEU B N   1 
ATOM   2837  C CA  . LEU B  2  23  ? 133.237 179.572 105.776 1.00 35.50  ? 23  LEU B CA  1 
ATOM   2838  C C   . LEU B  2  23  ? 131.869 180.122 105.399 1.00 35.50  ? 23  LEU B C   1 
ATOM   2839  O O   . LEU B  2  23  ? 130.859 179.494 105.730 1.00 35.50  ? 23  LEU B O   1 
ATOM   2840  C CB  . LEU B  2  23  ? 133.332 179.490 107.300 1.00 35.50  ? 23  LEU B CB  1 
ATOM   2841  C CG  . LEU B  2  23  ? 134.468 178.626 107.833 1.00 35.50  ? 23  LEU B CG  1 
ATOM   2842  C CD1 . LEU B  2  23  ? 134.535 178.707 109.340 1.00 35.50  ? 23  LEU B CD1 1 
ATOM   2843  C CD2 . LEU B  2  23  ? 134.257 177.201 107.386 1.00 35.50  ? 23  LEU B CD2 1 
ATOM   2844  N N   . ASP B  2  24  ? 131.806 181.274 104.740 1.00 51.02  ? 24  ASP B N   1 
ATOM   2845  C CA  . ASP B  2  24  ? 130.519 181.857 104.385 1.00 51.02  ? 24  ASP B CA  1 
ATOM   2846  C C   . ASP B  2  24  ? 129.806 180.986 103.360 1.00 51.02  ? 24  ASP B C   1 
ATOM   2847  O O   . ASP B  2  24  ? 130.377 180.628 102.326 1.00 51.02  ? 24  ASP B O   1 
ATOM   2848  C CB  . ASP B  2  24  ? 130.714 183.268 103.833 1.00 51.02  ? 24  ASP B CB  1 
ATOM   2849  C CG  . ASP B  2  24  ? 129.409 184.023 103.685 1.00 51.02  ? 24  ASP B CG  1 
ATOM   2850  O OD1 . ASP B  2  24  ? 128.346 183.452 104.006 1.00 51.02  ? 24  ASP B OD1 1 
ATOM   2851  O OD2 . ASP B  2  24  ? 129.447 185.190 103.243 1.00 51.02  ? 24  ASP B OD2 1 
ATOM   2852  N N   . GLY B  2  25  ? 128.552 180.650 103.650 1.00 45.76  ? 25  GLY B N   1 
ATOM   2853  C CA  . GLY B  2  25  ? 127.773 179.844 102.733 1.00 45.76  ? 25  GLY B CA  1 
ATOM   2854  C C   . GLY B  2  25  ? 128.270 178.430 102.551 1.00 45.76  ? 25  GLY B C   1 
ATOM   2855  O O   . GLY B  2  25  ? 127.963 177.801 101.537 1.00 45.76  ? 25  GLY B O   1 
ATOM   2856  N N   . TYR B  2  26  ? 129.032 177.909 103.507 1.00 31.77  ? 26  TYR B N   1 
ATOM   2857  C CA  . TYR B  2  26  ? 129.598 176.569 103.419 1.00 31.77  ? 26  TYR B CA  1 
ATOM   2858  C C   . TYR B  2  26  ? 128.743 175.626 104.255 1.00 31.77  ? 26  TYR B C   1 
ATOM   2859  O O   . TYR B  2  26  ? 128.691 175.750 105.482 1.00 31.77  ? 26  TYR B O   1 
ATOM   2860  C CB  . TYR B  2  26  ? 131.048 176.568 103.894 1.00 31.77  ? 26  TYR B CB  1 
ATOM   2861  C CG  . TYR B  2  26  ? 131.722 175.228 103.771 1.00 31.77  ? 26  TYR B CG  1 
ATOM   2862  C CD1 . TYR B  2  26  ? 132.125 174.749 102.537 1.00 31.77  ? 26  TYR B CD1 1 
ATOM   2863  C CD2 . TYR B  2  26  ? 131.956 174.444 104.885 1.00 31.77  ? 26  TYR B CD2 1 
ATOM   2864  C CE1 . TYR B  2  26  ? 132.740 173.528 102.417 1.00 31.77  ? 26  TYR B CE1 1 
ATOM   2865  C CE2 . TYR B  2  26  ? 132.572 173.221 104.773 1.00 31.77  ? 26  TYR B CE2 1 
ATOM   2866  C CZ  . TYR B  2  26  ? 132.958 172.767 103.535 1.00 31.77  ? 26  TYR B CZ  1 
ATOM   2867  O OH  . TYR B  2  26  ? 133.573 171.546 103.409 1.00 31.77  ? 26  TYR B OH  1 
ATOM   2868  N N   . ASP B  2  27  ? 128.071 174.689 103.593 1.00 33.06  ? 27  ASP B N   1 
ATOM   2869  C CA  . ASP B  2  27  ? 127.180 173.747 104.262 1.00 33.06  ? 27  ASP B CA  1 
ATOM   2870  C C   . ASP B  2  27  ? 127.960 172.471 104.554 1.00 33.06  ? 27  ASP B C   1 
ATOM   2871  O O   . ASP B  2  27  ? 128.318 171.731 103.635 1.00 33.06  ? 27  ASP B O   1 
ATOM   2872  C CB  . ASP B  2  27  ? 125.956 173.464 103.396 1.00 33.06  ? 27  ASP B CB  1 
ATOM   2873  C CG  . ASP B  2  27  ? 124.853 172.755 104.155 1.00 33.06  ? 27  ASP B CG  1 
ATOM   2874  O OD1 . ASP B  2  27  ? 125.045 172.461 105.352 1.00 33.06  ? 27  ASP B OD1 1 
ATOM   2875  O OD2 . ASP B  2  27  ? 123.789 172.497 103.557 1.00 33.06  ? 27  ASP B OD2 1 
ATOM   2876  N N   . ASN B  2  28  ? 128.215 172.209 105.835 1.00 31.79  ? 28  ASN B N   1 
ATOM   2877  C CA  . ASN B  2  28  ? 129.039 171.072 106.222 1.00 31.79  ? 28  ASN B CA  1 
ATOM   2878  C C   . ASN B  2  28  ? 128.345 169.730 106.036 1.00 31.79  ? 28  ASN B C   1 
ATOM   2879  O O   . ASN B  2  28  ? 128.993 168.693 106.199 1.00 31.79  ? 28  ASN B O   1 
ATOM   2880  C CB  . ASN B  2  28  ? 129.484 171.229 107.675 1.00 31.79  ? 28  ASN B CB  1 
ATOM   2881  C CG  . ASN B  2  28  ? 128.318 171.327 108.631 1.00 31.79  ? 28  ASN B CG  1 
ATOM   2882  O OD1 . ASN B  2  28  ? 127.164 171.191 108.236 1.00 31.79  ? 28  ASN B OD1 1 
ATOM   2883  N ND2 . ASN B  2  28  ? 128.613 171.566 109.901 1.00 31.79  ? 28  ASN B ND2 1 
ATOM   2884  N N   . ARG B  2  29  ? 127.055 169.717 105.713 1.00 26.66  ? 29  ARG B N   1 
ATOM   2885  C CA  . ARG B  2  29  ? 126.321 168.466 105.576 1.00 26.66  ? 29  ARG B CA  1 
ATOM   2886  C C   . ARG B  2  29  ? 126.518 167.790 104.227 1.00 26.66  ? 29  ARG B C   1 
ATOM   2887  O O   . ARG B  2  29  ? 126.085 166.646 104.063 1.00 26.66  ? 29  ARG B O   1 
ATOM   2888  C CB  . ARG B  2  29  ? 124.831 168.712 105.800 1.00 26.66  ? 29  ARG B CB  1 
ATOM   2889  C CG  . ARG B  2  29  ? 124.468 169.052 107.224 1.00 26.66  ? 29  ARG B CG  1 
ATOM   2890  C CD  . ARG B  2  29  ? 122.968 169.131 107.380 1.00 26.66  ? 29  ARG B CD  1 
ATOM   2891  N NE  . ARG B  2  29  ? 122.421 170.207 106.566 1.00 26.66  ? 29  ARG B NE  1 
ATOM   2892  C CZ  . ARG B  2  29  ? 122.312 171.463 106.975 1.00 26.66  ? 29  ARG B CZ  1 
ATOM   2893  N NH1 . ARG B  2  29  ? 122.709 171.800 108.192 1.00 26.66  ? 29  ARG B NH1 1 
ATOM   2894  N NH2 . ARG B  2  29  ? 121.810 172.384 106.167 1.00 26.66  ? 29  ARG B NH2 1 
ATOM   2895  N N   . LEU B  2  30  ? 127.148 168.453 103.264 1.00 26.07  ? 30  LEU B N   1 
ATOM   2896  C CA  . LEU B  2  30  ? 127.268 167.942 101.903 1.00 26.07  ? 30  LEU B CA  1 
ATOM   2897  C C   . LEU B  2  30  ? 128.736 167.714 101.579 1.00 26.07  ? 30  LEU B C   1 
ATOM   2898  O O   . LEU B  2  30  ? 129.535 168.655 101.619 1.00 26.07  ? 30  LEU B O   1 
ATOM   2899  C CB  . LEU B  2  30  ? 126.645 168.912 100.900 1.00 26.07  ? 30  LEU B CB  1 
ATOM   2900  C CG  . LEU B  2  30  ? 125.136 168.855 100.682 1.00 26.07  ? 30  LEU B CG  1 
ATOM   2901  C CD1 . LEU B  2  30  ? 124.381 169.313 101.905 1.00 26.07  ? 30  LEU B CD1 1 
ATOM   2902  C CD2 . LEU B  2  30  ? 124.783 169.729 99.506  1.00 26.07  ? 30  LEU B CD2 1 
ATOM   2903  N N   . ARG B  2  31  ? 129.084 166.476 101.246 1.00 26.65  ? 31  ARG B N   1 
ATOM   2904  C CA  . ARG B  2  31  ? 130.457 166.166 100.895 1.00 26.65  ? 31  ARG B CA  1 
ATOM   2905  C C   . ARG B  2  31  ? 130.805 166.777 99.537  1.00 26.65  ? 31  ARG B C   1 
ATOM   2906  O O   . ARG B  2  31  ? 129.926 166.981 98.699  1.00 26.65  ? 31  ARG B O   1 
ATOM   2907  C CB  . ARG B  2  31  ? 130.671 164.653 100.896 1.00 26.65  ? 31  ARG B CB  1 
ATOM   2908  C CG  . ARG B  2  31  ? 129.735 163.840 100.019 1.00 26.65  ? 31  ARG B CG  1 
ATOM   2909  C CD  . ARG B  2  31  ? 130.336 163.545 98.663  1.00 26.65  ? 31  ARG B CD  1 
ATOM   2910  N NE  . ARG B  2  31  ? 129.557 162.541 97.950  1.00 26.65  ? 31  ARG B NE  1 
ATOM   2911  C CZ  . ARG B  2  31  ? 129.773 162.192 96.690  1.00 26.65  ? 31  ARG B CZ  1 
ATOM   2912  N NH1 . ARG B  2  31  ? 130.742 162.770 96.000  1.00 26.65  ? 31  ARG B NH1 1 
ATOM   2913  N NH2 . ARG B  2  31  ? 129.019 161.269 96.117  1.00 26.65  ? 31  ARG B NH2 1 
ATOM   2914  N N   . PRO B  2  32  ? 132.080 167.093 99.302  1.00 26.15  ? 32  PRO B N   1 
ATOM   2915  C CA  . PRO B  2  32  ? 132.443 167.851 98.097  1.00 26.15  ? 32  PRO B CA  1 
ATOM   2916  C C   . PRO B  2  32  ? 132.156 167.062 96.829  1.00 26.15  ? 32  PRO B C   1 
ATOM   2917  O O   . PRO B  2  32  ? 132.513 165.889 96.718  1.00 26.15  ? 32  PRO B O   1 
ATOM   2918  C CB  . PRO B  2  32  ? 133.943 168.097 98.274  1.00 26.15  ? 32  PRO B CB  1 
ATOM   2919  C CG  . PRO B  2  32  ? 134.394 166.997 99.146  1.00 26.15  ? 32  PRO B CG  1 
ATOM   2920  C CD  . PRO B  2  32  ? 133.267 166.734 100.091 1.00 26.15  ? 32  PRO B CD  1 
ATOM   2921  N N   . GLY B  2  33  ? 131.515 167.722 95.869  1.00 31.15  ? 33  GLY B N   1 
ATOM   2922  C CA  . GLY B  2  33  ? 131.139 167.066 94.634  1.00 31.15  ? 33  GLY B CA  1 
ATOM   2923  C C   . GLY B  2  33  ? 130.051 166.034 94.839  1.00 31.15  ? 33  GLY B C   1 
ATOM   2924  O O   . GLY B  2  33  ? 130.293 164.833 94.698  1.00 31.15  ? 33  GLY B O   1 
ATOM   2925  N N   . LEU B  2  34  ? 128.845 166.488 95.181  1.00 28.59  ? 34  LEU B N   1 
ATOM   2926  C CA  . LEU B  2  34  ? 127.766 165.554 95.474  1.00 28.59  ? 34  LEU B CA  1 
ATOM   2927  C C   . LEU B  2  34  ? 127.155 164.963 94.211  1.00 28.59  ? 34  LEU B C   1 
ATOM   2928  O O   . LEU B  2  34  ? 126.678 163.824 94.234  1.00 28.59  ? 34  LEU B O   1 
ATOM   2929  C CB  . LEU B  2  34  ? 126.691 166.240 96.313  1.00 28.59  ? 34  LEU B CB  1 
ATOM   2930  C CG  . LEU B  2  34  ? 125.577 165.318 96.798  1.00 28.59  ? 34  LEU B CG  1 
ATOM   2931  C CD1 . LEU B  2  34  ? 126.164 164.217 97.649  1.00 28.59  ? 34  LEU B CD1 1 
ATOM   2932  C CD2 . LEU B  2  34  ? 124.559 166.098 97.589  1.00 28.59  ? 34  LEU B CD2 1 
ATOM   2933  N N   . GLY B  2  35  ? 127.159 165.705 93.110  1.00 45.42  ? 35  GLY B N   1 
ATOM   2934  C CA  . GLY B  2  35  ? 126.661 165.181 91.855  1.00 45.42  ? 35  GLY B CA  1 
ATOM   2935  C C   . GLY B  2  35  ? 127.760 165.110 90.820  1.00 45.42  ? 35  GLY B C   1 
ATOM   2936  O O   . GLY B  2  35  ? 127.629 164.444 89.790  1.00 45.42  ? 35  GLY B O   1 
ATOM   2937  N N   . GLU B  2  36  ? 128.861 165.799 91.101  1.00 59.63  ? 36  GLU B N   1 
ATOM   2938  C CA  . GLU B  2  36  ? 130.027 165.800 90.230  1.00 59.63  ? 36  GLU B CA  1 
ATOM   2939  C C   . GLU B  2  36  ? 130.841 164.533 90.453  1.00 59.63  ? 36  GLU B C   1 
ATOM   2940  O O   . GLU B  2  36  ? 130.337 163.560 91.023  1.00 59.63  ? 36  GLU B O   1 
ATOM   2941  C CB  . GLU B  2  36  ? 130.880 167.043 90.482  1.00 59.63  ? 36  GLU B CB  1 
ATOM   2942  C CG  . GLU B  2  36  ? 130.179 168.349 90.148  1.00 59.63  ? 36  GLU B CG  1 
ATOM   2943  C CD  . GLU B  2  36  ? 131.051 169.561 90.411  1.00 59.63  ? 36  GLU B CD  1 
ATOM   2944  O OE1 . GLU B  2  36  ? 132.166 169.387 90.947  1.00 59.63  ? 36  GLU B OE1 1 
ATOM   2945  O OE2 . GLU B  2  36  ? 130.621 170.687 90.086  1.00 59.63  ? 36  GLU B OE2 1 
ATOM   2946  N N   . ARG B  2  37  ? 132.087 164.524 89.981  1.00 54.41  ? 37  ARG B N   1 
ATOM   2947  C CA  . ARG B  2  37  ? 132.976 163.379 90.147  1.00 54.41  ? 37  ARG B CA  1 
ATOM   2948  C C   . ARG B  2  37  ? 133.093 162.953 91.606  1.00 54.41  ? 37  ARG B C   1 
ATOM   2949  O O   . ARG B  2  37  ? 132.836 163.747 92.516  1.00 54.41  ? 37  ARG B O   1 
ATOM   2950  C CB  . ARG B  2  37  ? 134.364 163.697 89.584  1.00 54.41  ? 37  ARG B CB  1 
ATOM   2951  C CG  . ARG B  2  37  ? 135.294 164.431 90.543  1.00 54.41  ? 37  ARG B CG  1 
ATOM   2952  C CD  . ARG B  2  37  ? 134.857 165.865 90.801  1.00 54.41  ? 37  ARG B CD  1 
ATOM   2953  N NE  . ARG B  2  37  ? 135.821 166.578 91.635  1.00 54.41  ? 37  ARG B NE  1 
ATOM   2954  C CZ  . ARG B  2  37  ? 135.846 166.524 92.962  1.00 54.41  ? 37  ARG B CZ  1 
ATOM   2955  N NH1 . ARG B  2  37  ? 134.953 165.791 93.610  1.00 54.41  ? 37  ARG B NH1 1 
ATOM   2956  N NH2 . ARG B  2  37  ? 136.761 167.200 93.641  1.00 54.41  ? 37  ARG B NH2 1 
ATOM   2957  N N   . VAL B  2  38  ? 133.485 161.698 91.834  1.00 36.16  ? 38  VAL B N   1 
ATOM   2958  C CA  . VAL B  2  38  ? 133.540 161.166 93.189  1.00 36.16  ? 38  VAL B CA  1 
ATOM   2959  C C   . VAL B  2  38  ? 134.721 161.766 93.943  1.00 36.16  ? 38  VAL B C   1 
ATOM   2960  O O   . VAL B  2  38  ? 135.686 162.269 93.358  1.00 36.16  ? 38  VAL B O   1 
ATOM   2961  C CB  . VAL B  2  38  ? 133.629 159.633 93.161  1.00 36.16  ? 38  VAL B CB  1 
ATOM   2962  C CG1 . VAL B  2  38  ? 132.471 159.068 92.386  1.00 36.16  ? 38  VAL B CG1 1 
ATOM   2963  C CG2 . VAL B  2  38  ? 134.944 159.194 92.554  1.00 36.16  ? 38  VAL B CG2 1 
ATOM   2964  N N   . THR B  2  39  ? 134.637 161.713 95.266  1.00 35.35  ? 39  THR B N   1 
ATOM   2965  C CA  . THR B  2  39  ? 135.727 162.160 96.115  1.00 35.35  ? 39  THR B CA  1 
ATOM   2966  C C   . THR B  2  39  ? 136.702 161.014 96.338  1.00 35.35  ? 39  THR B C   1 
ATOM   2967  O O   . THR B  2  39  ? 136.357 159.840 96.197  1.00 35.35  ? 39  THR B O   1 
ATOM   2968  C CB  . THR B  2  39  ? 135.202 162.675 97.452  1.00 35.35  ? 39  THR B CB  1 
ATOM   2969  O OG1 . THR B  2  39  ? 136.271 163.285 98.180  1.00 35.35  ? 39  THR B OG1 1 
ATOM   2970  C CG2 . THR B  2  39  ? 134.647 161.538 98.270  1.00 35.35  ? 39  THR B CG2 1 
ATOM   2971  N N   . GLU B  2  40  ? 137.939 161.364 96.675  1.00 33.67  ? 40  GLU B N   1 
ATOM   2972  C CA  . GLU B  2  40  ? 138.990 160.366 96.843  1.00 33.67  ? 40  GLU B CA  1 
ATOM   2973  C C   . GLU B  2  40  ? 139.778 160.700 98.099  1.00 33.67  ? 40  GLU B C   1 
ATOM   2974  O O   . GLU B  2  40  ? 140.521 161.683 98.122  1.00 33.67  ? 40  GLU B O   1 
ATOM   2975  C CB  . GLU B  2  40  ? 139.898 160.317 95.617  1.00 33.67  ? 40  GLU B CB  1 
ATOM   2976  C CG  . GLU B  2  40  ? 140.929 159.211 95.653  1.00 33.67  ? 40  GLU B CG  1 
ATOM   2977  C CD  . GLU B  2  40  ? 141.681 159.074 94.342  1.00 33.67  ? 40  GLU B CD  1 
ATOM   2978  O OE1 . GLU B  2  40  ? 141.394 159.851 93.407  1.00 33.67  ? 40  GLU B OE1 1 
ATOM   2979  O OE2 . GLU B  2  40  ? 142.554 158.186 94.244  1.00 33.67  ? 40  GLU B OE2 1 
ATOM   2980  N N   . VAL B  2  41  ? 139.619 159.882 99.133  1.00 22.47  ? 41  VAL B N   1 
ATOM   2981  C CA  . VAL B  2  41  ? 140.247 160.104 100.429 1.00 22.47  ? 41  VAL B CA  1 
ATOM   2982  C C   . VAL B  2  41  ? 141.556 159.334 100.474 1.00 22.47  ? 41  VAL B C   1 
ATOM   2983  O O   . VAL B  2  41  ? 141.562 158.102 100.370 1.00 22.47  ? 41  VAL B O   1 
ATOM   2984  C CB  . VAL B  2  41  ? 139.322 159.668 101.572 1.00 22.47  ? 41  VAL B CB  1 
ATOM   2985  C CG1 . VAL B  2  41  ? 140.062 159.694 102.881 1.00 22.47  ? 41  VAL B CG1 1 
ATOM   2986  C CG2 . VAL B  2  41  ? 138.115 160.562 101.629 1.00 22.47  ? 41  VAL B CG2 1 
ATOM   2987  N N   . LYS B  2  42  ? 142.662 160.047 100.644 1.00 27.36  ? 42  LYS B N   1 
ATOM   2988  C CA  . LYS B  2  42  ? 143.973 159.425 100.753 1.00 27.36  ? 42  LYS B CA  1 
ATOM   2989  C C   . LYS B  2  42  ? 144.285 159.171 102.221 1.00 27.36  ? 42  LYS B C   1 
ATOM   2990  O O   . LYS B  2  42  ? 144.159 160.075 103.050 1.00 27.36  ? 42  LYS B O   1 
ATOM   2991  C CB  . LYS B  2  42  ? 145.040 160.315 100.121 1.00 27.36  ? 42  LYS B CB  1 
ATOM   2992  C CG  . LYS B  2  42  ? 144.858 160.519 98.630  1.00 27.36  ? 42  LYS B CG  1 
ATOM   2993  C CD  . LYS B  2  42  ? 145.963 161.387 98.063  1.00 27.36  ? 42  LYS B CD  1 
ATOM   2994  C CE  . LYS B  2  42  ? 145.829 161.544 96.561  1.00 27.36  ? 42  LYS B CE  1 
ATOM   2995  N NZ  . LYS B  2  42  ? 144.629 162.343 96.194  1.00 27.36  ? 42  LYS B NZ  1 
ATOM   2996  N N   . THR B  2  43  ? 144.694 157.947 102.539 1.00 43.48  ? 43  THR B N   1 
ATOM   2997  C CA  . THR B  2  43  ? 144.834 157.504 103.918 1.00 43.48  ? 43  THR B CA  1 
ATOM   2998  C C   . THR B  2  43  ? 146.285 157.148 104.212 1.00 43.48  ? 43  THR B C   1 
ATOM   2999  O O   . THR B  2  43  ? 147.061 156.842 103.305 1.00 43.48  ? 43  THR B O   1 
ATOM   3000  C CB  . THR B  2  43  ? 143.935 156.297 104.186 1.00 43.48  ? 43  THR B CB  1 
ATOM   3001  O OG1 . THR B  2  43  ? 142.605 156.603 103.763 1.00 43.48  ? 43  THR B OG1 1 
ATOM   3002  C CG2 . THR B  2  43  ? 143.884 155.980 105.659 1.00 43.48  ? 43  THR B CG2 1 
ATOM   3003  N N   . ASP B  2  44  ? 146.654 157.213 105.489 1.00 35.02  ? 44  ASP B N   1 
ATOM   3004  C CA  . ASP B  2  44  ? 147.958 156.758 105.944 1.00 35.02  ? 44  ASP B CA  1 
ATOM   3005  C C   . ASP B  2  44  ? 147.854 156.385 107.415 1.00 35.02  ? 44  ASP B C   1 
ATOM   3006  O O   . ASP B  2  44  ? 146.921 156.790 108.109 1.00 35.02  ? 44  ASP B O   1 
ATOM   3007  C CB  . ASP B  2  44  ? 149.029 157.828 105.726 1.00 35.02  ? 44  ASP B CB  1 
ATOM   3008  C CG  . ASP B  2  44  ? 150.425 157.312 105.983 1.00 35.02  ? 44  ASP B CG  1 
ATOM   3009  O OD1 . ASP B  2  44  ? 150.555 156.133 106.362 1.00 35.02  ? 44  ASP B OD1 1 
ATOM   3010  O OD2 . ASP B  2  44  ? 151.393 158.083 105.811 1.00 35.02  ? 44  ASP B OD2 1 
ATOM   3011  N N   . ILE B  2  45  ? 148.824 155.607 107.889 1.00 43.48  ? 45  ILE B N   1 
ATOM   3012  C CA  . ILE B  2  45  ? 148.862 155.152 109.274 1.00 43.48  ? 45  ILE B CA  1 
ATOM   3013  C C   . ILE B  2  45  ? 150.302 155.178 109.765 1.00 43.48  ? 45  ILE B C   1 
ATOM   3014  O O   . ILE B  2  45  ? 151.230 154.883 109.008 1.00 43.48  ? 45  ILE B O   1 
ATOM   3015  C CB  . ILE B  2  45  ? 148.254 153.743 109.419 1.00 43.48  ? 45  ILE B CB  1 
ATOM   3016  C CG1 . ILE B  2  45  ? 146.753 153.779 109.168 1.00 43.48  ? 45  ILE B CG1 1 
ATOM   3017  C CG2 . ILE B  2  45  ? 148.521 153.165 110.785 1.00 43.48  ? 45  ILE B CG2 1 
ATOM   3018  C CD1 . ILE B  2  45  ? 146.132 152.417 109.105 1.00 43.48  ? 45  ILE B CD1 1 
ATOM   3019  N N   . PHE B  2  46  ? 150.492 155.550 111.030 1.00 43.48  ? 46  PHE B N   1 
ATOM   3020  C CA  . PHE B  2  46  ? 151.808 155.558 111.665 1.00 43.48  ? 46  PHE B CA  1 
ATOM   3021  C C   . PHE B  2  46  ? 151.653 154.969 113.058 1.00 43.48  ? 46  PHE B C   1 
ATOM   3022  O O   . PHE B  2  46  ? 151.224 155.668 113.978 1.00 43.48  ? 46  PHE B O   1 
ATOM   3023  C CB  . PHE B  2  46  ? 152.373 156.975 111.739 1.00 43.48  ? 46  PHE B CB  1 
ATOM   3024  C CG  . PHE B  2  46  ? 153.737 157.056 112.357 1.00 43.48  ? 46  PHE B CG  1 
ATOM   3025  C CD1 . PHE B  2  46  ? 154.867 156.774 111.615 1.00 43.48  ? 46  PHE B CD1 1 
ATOM   3026  C CD2 . PHE B  2  46  ? 153.889 157.402 113.683 1.00 43.48  ? 46  PHE B CD2 1 
ATOM   3027  C CE1 . PHE B  2  46  ? 156.121 156.852 112.183 1.00 43.48  ? 46  PHE B CE1 1 
ATOM   3028  C CE2 . PHE B  2  46  ? 155.138 157.475 114.255 1.00 43.48  ? 46  PHE B CE2 1 
ATOM   3029  C CZ  . PHE B  2  46  ? 156.254 157.201 113.505 1.00 43.48  ? 46  PHE B CZ  1 
ATOM   3030  N N   . VAL B  2  47  ? 152.012 153.701 113.224 1.00 43.48  ? 47  VAL B N   1 
ATOM   3031  C CA  . VAL B  2  47  ? 151.800 153.006 114.490 1.00 43.48  ? 47  VAL B CA  1 
ATOM   3032  C C   . VAL B  2  47  ? 152.789 153.525 115.523 1.00 43.48  ? 47  VAL B C   1 
ATOM   3033  O O   . VAL B  2  47  ? 154.005 153.442 115.330 1.00 43.48  ? 47  VAL B O   1 
ATOM   3034  C CB  . VAL B  2  47  ? 151.938 151.490 114.316 1.00 43.48  ? 47  VAL B CB  1 
ATOM   3035  C CG1 . VAL B  2  47  ? 151.890 150.809 115.660 1.00 43.48  ? 47  VAL B CG1 1 
ATOM   3036  C CG2 . VAL B  2  47  ? 150.838 150.965 113.429 1.00 43.48  ? 47  VAL B CG2 1 
ATOM   3037  N N   . THR B  2  48  ? 152.269 154.062 116.626 1.00 31.43  ? 48  THR B N   1 
ATOM   3038  C CA  . THR B  2  48  ? 153.143 154.501 117.706 1.00 31.43  ? 48  THR B CA  1 
ATOM   3039  C C   . THR B  2  48  ? 153.630 153.327 118.541 1.00 31.43  ? 48  THR B C   1 
ATOM   3040  O O   . THR B  2  48  ? 154.814 153.260 118.885 1.00 31.43  ? 48  THR B O   1 
ATOM   3041  C CB  . THR B  2  48  ? 152.425 155.514 118.596 1.00 31.43  ? 48  THR B CB  1 
ATOM   3042  O OG1 . THR B  2  48  ? 152.085 156.671 117.826 1.00 31.43  ? 48  THR B OG1 1 
ATOM   3043  C CG2 . THR B  2  48  ? 153.315 155.934 119.744 1.00 31.43  ? 48  THR B CG2 1 
ATOM   3044  N N   . SER B  2  49  ? 152.745 152.391 118.868 1.00 23.62  ? 49  SER B N   1 
ATOM   3045  C CA  . SER B  2  49  ? 153.114 151.273 119.731 1.00 23.62  ? 49  SER B CA  1 
ATOM   3046  C C   . SER B  2  49  ? 152.109 150.153 119.542 1.00 23.62  ? 49  SER B C   1 
ATOM   3047  O O   . SER B  2  49  ? 150.918 150.344 119.801 1.00 23.62  ? 49  SER B O   1 
ATOM   3048  C CB  . SER B  2  49  ? 153.152 151.714 121.186 1.00 23.62  ? 49  SER B CB  1 
ATOM   3049  O OG  . SER B  2  49  ? 151.852 152.045 121.635 1.00 23.62  ? 49  SER B OG  1 
ATOM   3050  N N   . PHE B  2  50  ? 152.582 148.988 119.107 1.00 30.82  ? 50  PHE B N   1 
ATOM   3051  C CA  . PHE B  2  50  ? 151.720 147.824 118.923 1.00 30.82  ? 50  PHE B CA  1 
ATOM   3052  C C   . PHE B  2  50  ? 151.444 147.237 120.301 1.00 30.82  ? 50  PHE B C   1 
ATOM   3053  O O   . PHE B  2  50  ? 152.301 146.580 120.892 1.00 30.82  ? 50  PHE B O   1 
ATOM   3054  C CB  . PHE B  2  50  ? 152.378 146.814 117.994 1.00 30.82  ? 50  PHE B CB  1 
ATOM   3055  C CG  . PHE B  2  50  ? 151.489 145.678 117.611 1.00 30.82  ? 50  PHE B CG  1 
ATOM   3056  C CD1 . PHE B  2  50  ? 150.515 145.846 116.653 1.00 30.82  ? 50  PHE B CD1 1 
ATOM   3057  C CD2 . PHE B  2  50  ? 151.629 144.442 118.201 1.00 30.82  ? 50  PHE B CD2 1 
ATOM   3058  C CE1 . PHE B  2  50  ? 149.694 144.805 116.292 1.00 30.82  ? 50  PHE B CE1 1 
ATOM   3059  C CE2 . PHE B  2  50  ? 150.810 143.396 117.841 1.00 30.82  ? 50  PHE B CE2 1 
ATOM   3060  C CZ  . PHE B  2  50  ? 149.841 143.580 116.885 1.00 30.82  ? 50  PHE B CZ  1 
ATOM   3061  N N   . GLY B  2  51  ? 150.238 147.475 120.817 1.00 26.24  ? 51  GLY B N   1 
ATOM   3062  C CA  . GLY B  2  51  ? 149.941 147.232 122.201 1.00 26.24  ? 51  GLY B CA  1 
ATOM   3063  C C   . GLY B  2  51  ? 149.971 145.760 122.566 1.00 26.24  ? 51  GLY B C   1 
ATOM   3064  O O   . GLY B  2  51  ? 150.214 144.885 121.727 1.00 26.24  ? 51  GLY B O   1 
ATOM   3065  N N   . PRO B  2  52  ? 149.710 145.478 123.843 1.00 22.41  ? 52  PRO B N   1 
ATOM   3066  C CA  . PRO B  2  52  ? 149.848 144.109 124.358 1.00 22.41  ? 52  PRO B CA  1 
ATOM   3067  C C   . PRO B  2  52  ? 148.732 143.212 123.850 1.00 22.41  ? 52  PRO B C   1 
ATOM   3068  O O   . PRO B  2  52  ? 147.555 143.448 124.128 1.00 22.41  ? 52  PRO B O   1 
ATOM   3069  C CB  . PRO B  2  52  ? 149.769 144.297 125.877 1.00 22.41  ? 52  PRO B CB  1 
ATOM   3070  C CG  . PRO B  2  52  ? 148.941 145.516 126.047 1.00 22.41  ? 52  PRO B CG  1 
ATOM   3071  C CD  . PRO B  2  52  ? 149.284 146.419 124.893 1.00 22.41  ? 52  PRO B CD  1 
ATOM   3072  N N   . VAL B  2  53  ? 149.109 142.174 123.106 1.00 23.51  ? 53  VAL B N   1 
ATOM   3073  C CA  . VAL B  2  53  ? 148.143 141.179 122.665 1.00 23.51  ? 53  VAL B CA  1 
ATOM   3074  C C   . VAL B  2  53  ? 147.719 140.332 123.854 1.00 23.51  ? 53  VAL B C   1 
ATOM   3075  O O   . VAL B  2  53  ? 148.557 139.868 124.636 1.00 23.51  ? 53  VAL B O   1 
ATOM   3076  C CB  . VAL B  2  53  ? 148.738 140.308 121.552 1.00 23.51  ? 53  VAL B CB  1 
ATOM   3077  C CG1 . VAL B  2  53  ? 147.769 139.214 121.175 1.00 23.51  ? 53  VAL B CG1 1 
ATOM   3078  C CG2 . VAL B  2  53  ? 149.070 141.159 120.352 1.00 23.51  ? 53  VAL B CG2 1 
ATOM   3079  N N   . SER B  2  54  ? 146.415 140.128 123.999 1.00 40.26  ? 54  SER B N   1 
ATOM   3080  C CA  . SER B  2  54  ? 145.856 139.337 125.086 1.00 40.26  ? 54  SER B CA  1 
ATOM   3081  C C   . SER B  2  54  ? 145.328 138.029 124.515 1.00 40.26  ? 54  SER B C   1 
ATOM   3082  O O   . SER B  2  54  ? 144.467 138.036 123.630 1.00 40.26  ? 54  SER B O   1 
ATOM   3083  C CB  . SER B  2  54  ? 144.748 140.103 125.807 1.00 40.26  ? 54  SER B CB  1 
ATOM   3084  O OG  . SER B  2  54  ? 144.197 139.328 126.854 1.00 40.26  ? 54  SER B OG  1 
ATOM   3085  N N   . ASP B  2  55  ? 145.845 136.910 125.025 1.00 60.87  ? 55  ASP B N   1 
ATOM   3086  C CA  . ASP B  2  55  ? 145.462 135.607 124.492 1.00 60.87  ? 55  ASP B CA  1 
ATOM   3087  C C   . ASP B  2  55  ? 144.034 135.236 124.861 1.00 60.87  ? 55  ASP B C   1 
ATOM   3088  O O   . ASP B  2  55  ? 143.344 134.583 124.072 1.00 60.87  ? 55  ASP B O   1 
ATOM   3089  C CB  . ASP B  2  55  ? 146.426 134.534 124.991 1.00 60.87  ? 55  ASP B CB  1 
ATOM   3090  C CG  . ASP B  2  55  ? 147.808 134.664 124.388 1.00 60.87  ? 55  ASP B CG  1 
ATOM   3091  O OD1 . ASP B  2  55  ? 147.913 135.132 123.236 1.00 60.87  ? 55  ASP B OD1 1 
ATOM   3092  O OD2 . ASP B  2  55  ? 148.790 134.303 125.068 1.00 60.87  ? 55  ASP B OD2 1 
ATOM   3093  N N   . HIS B  2  56  ? 143.575 135.634 126.049 1.00 63.49  ? 56  HIS B N   1 
ATOM   3094  C CA  . HIS B  2  56  ? 142.244 135.240 126.497 1.00 63.49  ? 56  HIS B CA  1 
ATOM   3095  C C   . HIS B  2  56  ? 141.160 135.842 125.614 1.00 63.49  ? 56  HIS B C   1 
ATOM   3096  O O   . HIS B  2  56  ? 140.334 135.120 125.046 1.00 63.49  ? 56  HIS B O   1 
ATOM   3097  C CB  . HIS B  2  56  ? 142.033 135.659 127.952 1.00 63.49  ? 56  HIS B CB  1 
ATOM   3098  C CG  . HIS B  2  56  ? 142.902 134.929 128.927 1.00 63.49  ? 56  HIS B CG  1 
ATOM   3099  N ND1 . HIS B  2  56  ? 144.164 135.363 129.269 1.00 63.49  ? 56  HIS B ND1 1 
ATOM   3100  C CD2 . HIS B  2  56  ? 142.686 133.799 129.641 1.00 63.49  ? 56  HIS B CD2 1 
ATOM   3101  C CE1 . HIS B  2  56  ? 144.691 134.529 130.148 1.00 63.49  ? 56  HIS B CE1 1 
ATOM   3102  N NE2 . HIS B  2  56  ? 143.814 133.572 130.391 1.00 63.49  ? 56  HIS B NE2 1 
ATOM   3103  N N   . ASP B  2  57  ? 141.151 137.165 125.481 1.00 57.42  ? 57  ASP B N   1 
ATOM   3104  C CA  . ASP B  2  57  ? 140.055 137.853 124.816 1.00 57.42  ? 57  ASP B CA  1 
ATOM   3105  C C   . ASP B  2  57  ? 140.161 137.823 123.298 1.00 57.42  ? 57  ASP B C   1 
ATOM   3106  O O   . ASP B  2  57  ? 139.225 138.267 122.624 1.00 57.42  ? 57  ASP B O   1 
ATOM   3107  C CB  . ASP B  2  57  ? 139.992 139.303 125.294 1.00 57.42  ? 57  ASP B CB  1 
ATOM   3108  C CG  . ASP B  2  57  ? 139.646 139.415 126.762 1.00 57.42  ? 57  ASP B CG  1 
ATOM   3109  O OD1 . ASP B  2  57  ? 138.954 138.516 127.279 1.00 57.42  ? 57  ASP B OD1 1 
ATOM   3110  O OD2 . ASP B  2  57  ? 140.068 140.401 127.401 1.00 57.42  ? 57  ASP B OD2 1 
ATOM   3111  N N   . MET B  2  58  ? 141.268 137.317 122.751 1.00 49.90  ? 58  MET B N   1 
ATOM   3112  C CA  . MET B  2  58  ? 141.503 137.296 121.308 1.00 49.90  ? 58  MET B CA  1 
ATOM   3113  C C   . MET B  2  58  ? 141.474 138.704 120.719 1.00 49.90  ? 58  MET B C   1 
ATOM   3114  O O   . MET B  2  58  ? 141.027 138.915 119.591 1.00 49.90  ? 58  MET B O   1 
ATOM   3115  C CB  . MET B  2  58  ? 140.502 136.386 120.593 1.00 49.90  ? 58  MET B CB  1 
ATOM   3116  C CG  . MET B  2  58  ? 140.691 134.911 120.893 1.00 49.90  ? 58  MET B CG  1 
ATOM   3117  S SD  . MET B  2  58  ? 139.522 133.859 120.015 1.00 49.90  ? 58  MET B SD  1 
ATOM   3118  C CE  . MET B  2  58  ? 139.987 132.247 120.641 1.00 49.90  ? 58  MET B CE  1 
ATOM   3119  N N   . GLU B  2  59  ? 141.968 139.676 121.481 1.00 40.69  ? 59  GLU B N   1 
ATOM   3120  C CA  . GLU B  2  59  ? 142.018 141.059 121.039 1.00 40.69  ? 59  GLU B CA  1 
ATOM   3121  C C   . GLU B  2  59  ? 143.449 141.563 121.125 1.00 40.69  ? 59  GLU B C   1 
ATOM   3122  O O   . GLU B  2  59  ? 144.297 140.970 121.793 1.00 40.69  ? 59  GLU B O   1 
ATOM   3123  C CB  . GLU B  2  59  ? 141.111 141.965 121.877 1.00 40.69  ? 59  GLU B CB  1 
ATOM   3124  C CG  . GLU B  2  59  ? 141.609 142.196 123.289 1.00 40.69  ? 59  GLU B CG  1 
ATOM   3125  C CD  . GLU B  2  59  ? 140.680 143.077 124.100 1.00 40.69  ? 59  GLU B CD  1 
ATOM   3126  O OE1 . GLU B  2  59  ? 139.613 143.461 123.580 1.00 40.69  ? 59  GLU B OE1 1 
ATOM   3127  O OE2 . GLU B  2  59  ? 141.024 143.395 125.257 1.00 40.69  ? 59  GLU B OE2 1 
ATOM   3128  N N   . TYR B  2  60  ? 143.710 142.672 120.441 1.00 25.39  ? 60  TYR B N   1 
ATOM   3129  C CA  . TYR B  2  60  ? 145.012 143.313 120.494 1.00 25.39  ? 60  TYR B CA  1 
ATOM   3130  C C   . TYR B  2  60  ? 144.818 144.816 120.415 1.00 25.39  ? 60  TYR B C   1 
ATOM   3131  O O   . TYR B  2  60  ? 143.911 145.294 119.734 1.00 25.39  ? 60  TYR B O   1 
ATOM   3132  C CB  . TYR B  2  60  ? 145.917 142.849 119.356 1.00 25.39  ? 60  TYR B CB  1 
ATOM   3133  C CG  . TYR B  2  60  ? 145.524 143.389 118.008 1.00 25.39  ? 60  TYR B CG  1 
ATOM   3134  C CD1 . TYR B  2  60  ? 144.551 142.770 117.250 1.00 25.39  ? 60  TYR B CD1 1 
ATOM   3135  C CD2 . TYR B  2  60  ? 146.149 144.503 117.481 1.00 25.39  ? 60  TYR B CD2 1 
ATOM   3136  C CE1 . TYR B  2  60  ? 144.197 143.259 116.017 1.00 25.39  ? 60  TYR B CE1 1 
ATOM   3137  C CE2 . TYR B  2  60  ? 145.801 144.997 116.250 1.00 25.39  ? 60  TYR B CE2 1 
ATOM   3138  C CZ  . TYR B  2  60  ? 144.825 144.372 115.522 1.00 25.39  ? 60  TYR B CZ  1 
ATOM   3139  O OH  . TYR B  2  60  ? 144.476 144.862 114.287 1.00 25.39  ? 60  TYR B OH  1 
ATOM   3140  N N   . THR B  2  61  ? 145.676 145.555 121.103 1.00 23.16  ? 61  THR B N   1 
ATOM   3141  C CA  . THR B  2  61  ? 145.590 147.003 121.164 1.00 23.16  ? 61  THR B CA  1 
ATOM   3142  C C   . THR B  2  61  ? 146.628 147.627 120.241 1.00 23.16  ? 61  THR B C   1 
ATOM   3143  O O   . THR B  2  61  ? 147.709 147.076 120.035 1.00 23.16  ? 61  THR B O   1 
ATOM   3144  C CB  . THR B  2  61  ? 145.797 147.483 122.601 1.00 23.16  ? 61  THR B CB  1 
ATOM   3145  O OG1 . THR B  2  61  ? 144.818 146.868 123.447 1.00 23.16  ? 61  THR B OG1 1 
ATOM   3146  C CG2 . THR B  2  61  ? 145.656 148.987 122.706 1.00 23.16  ? 61  THR B CG2 1 
ATOM   3147  N N   . ILE B  2  62  ? 146.285 148.781 119.677 1.00 25.36  ? 62  ILE B N   1 
ATOM   3148  C CA  . ILE B  2  62  ? 147.151 149.491 118.748 1.00 25.36  ? 62  ILE B CA  1 
ATOM   3149  C C   . ILE B  2  62  ? 146.983 150.981 119.005 1.00 25.36  ? 62  ILE B C   1 
ATOM   3150  O O   . ILE B  2  62  ? 145.973 151.421 119.560 1.00 25.36  ? 62  ILE B O   1 
ATOM   3151  C CB  . ILE B  2  62  ? 146.824 149.123 117.287 1.00 25.36  ? 62  ILE B CB  1 
ATOM   3152  C CG1 . ILE B  2  62  ? 147.922 149.591 116.348 1.00 25.36  ? 62  ILE B CG1 1 
ATOM   3153  C CG2 . ILE B  2  62  ? 145.525 149.739 116.862 1.00 25.36  ? 62  ILE B CG2 1 
ATOM   3154  C CD1 . ILE B  2  62  ? 147.815 148.985 114.984 1.00 25.36  ? 62  ILE B CD1 1 
ATOM   3155  N N   . ASP B  2  63  ? 147.992 151.761 118.628 1.00 32.45  ? 63  ASP B N   1 
ATOM   3156  C CA  . ASP B  2  63  ? 148.005 153.198 118.904 1.00 32.45  ? 63  ASP B CA  1 
ATOM   3157  C C   . ASP B  2  63  ? 148.525 153.922 117.666 1.00 32.45  ? 63  ASP B C   1 
ATOM   3158  O O   . ASP B  2  63  ? 149.737 154.035 117.472 1.00 32.45  ? 63  ASP B O   1 
ATOM   3159  C CB  . ASP B  2  63  ? 148.858 153.491 120.130 1.00 32.45  ? 63  ASP B CB  1 
ATOM   3160  C CG  . ASP B  2  63  ? 148.766 154.931 120.579 1.00 32.45  ? 63  ASP B CG  1 
ATOM   3161  O OD1 . ASP B  2  63  ? 148.109 155.733 119.887 1.00 32.45  ? 63  ASP B OD1 1 
ATOM   3162  O OD2 . ASP B  2  63  ? 149.342 155.264 121.637 1.00 32.45  ? 63  ASP B OD2 1 
ATOM   3163  N N   . VAL B  2  64  ? 147.611 154.437 116.850 1.00 43.48  ? 64  VAL B N   1 
ATOM   3164  C CA  . VAL B  2  64  ? 147.942 154.920 115.517 1.00 43.48  ? 64  VAL B CA  1 
ATOM   3165  C C   . VAL B  2  64  ? 147.758 156.427 115.446 1.00 43.48  ? 64  VAL B C   1 
ATOM   3166  O O   . VAL B  2  64  ? 146.931 157.004 116.156 1.00 43.48  ? 64  VAL B O   1 
ATOM   3167  C CB  . VAL B  2  64  ? 147.077 154.221 114.450 1.00 43.48  ? 64  VAL B CB  1 
ATOM   3168  C CG1 . VAL B  2  64  ? 147.303 152.732 114.489 1.00 43.48  ? 64  VAL B CG1 1 
ATOM   3169  C CG2 . VAL B  2  64  ? 145.617 154.530 114.663 1.00 43.48  ? 64  VAL B CG2 1 
ATOM   3170  N N   . PHE B  2  65  ? 148.436 157.050 114.489 1.00 43.48  ? 65  PHE B N   1 
ATOM   3171  C CA  . PHE B  2  65  ? 148.291 158.469 114.203 1.00 43.48  ? 65  PHE B CA  1 
ATOM   3172  C C   . PHE B  2  65  ? 147.573 158.435 112.868 1.00 43.48  ? 65  PHE B C   1 
ATOM   3173  O O   . PHE B  2  65  ? 148.183 158.631 111.835 1.00 43.48  ? 65  PHE B O   1 
ATOM   3174  C CB  . PHE B  2  65  ? 149.649 159.117 114.004 1.00 43.48  ? 65  PHE B CB  1 
ATOM   3175  C CG  . PHE B  2  65  ? 150.254 159.669 115.253 1.00 43.48  ? 65  PHE B CG  1 
ATOM   3176  C CD1 . PHE B  2  65  ? 150.510 158.854 116.331 1.00 43.48  ? 65  PHE B CD1 1 
ATOM   3177  C CD2 . PHE B  2  65  ? 150.574 161.005 115.341 1.00 43.48  ? 65  PHE B CD2 1 
ATOM   3178  C CE1 . PHE B  2  65  ? 151.074 159.362 117.481 1.00 43.48  ? 65  PHE B CE1 1 
ATOM   3179  C CE2 . PHE B  2  65  ? 151.136 161.522 116.485 1.00 43.48  ? 65  PHE B CE2 1 
ATOM   3180  C CZ  . PHE B  2  65  ? 151.387 160.698 117.559 1.00 43.48  ? 65  PHE B CZ  1 
ATOM   3181  N N   . PHE B  2  66  ? 146.270 158.214 112.887 1.00 43.48  ? 66  PHE B N   1 
ATOM   3182  C CA  . PHE B  2  66  ? 145.499 158.026 111.669 1.00 43.48  ? 66  PHE B CA  1 
ATOM   3183  C C   . PHE B  2  66  ? 145.442 159.331 110.887 1.00 43.48  ? 66  PHE B C   1 
ATOM   3184  O O   . PHE B  2  66  ? 145.322 160.410 111.469 1.00 43.48  ? 66  PHE B O   1 
ATOM   3185  C CB  . PHE B  2  66  ? 144.098 157.548 112.025 1.00 43.48  ? 66  PHE B CB  1 
ATOM   3186  C CG  . PHE B  2  66  ? 143.314 157.042 110.867 1.00 43.48  ? 66  PHE B CG  1 
ATOM   3187  C CD1 . PHE B  2  66  ? 143.539 155.777 110.377 1.00 43.48  ? 66  PHE B CD1 1 
ATOM   3188  C CD2 . PHE B  2  66  ? 142.344 157.816 110.276 1.00 43.48  ? 66  PHE B CD2 1 
ATOM   3189  C CE1 . PHE B  2  66  ? 142.817 155.293 109.321 1.00 43.48  ? 66  PHE B CE1 1 
ATOM   3190  C CE2 . PHE B  2  66  ? 141.621 157.336 109.214 1.00 43.48  ? 66  PHE B CE2 1 
ATOM   3191  C CZ  . PHE B  2  66  ? 141.859 156.072 108.737 1.00 43.48  ? 66  PHE B CZ  1 
ATOM   3192  N N   . ARG B  2  67  ? 145.642 159.252 109.572 1.00 43.48  ? 67  ARG B N   1 
ATOM   3193  C CA  . ARG B  2  67  ? 145.660 160.442 108.713 1.00 43.48  ? 67  ARG B CA  1 
ATOM   3194  C C   . ARG B  2  67  ? 144.737 160.327 107.516 1.00 43.48  ? 67  ARG B C   1 
ATOM   3195  O O   . ARG B  2  67  ? 144.453 159.235 107.054 1.00 43.48  ? 67  ARG B O   1 
ATOM   3196  C CB  . ARG B  2  67  ? 147.068 160.708 108.204 1.00 43.48  ? 67  ARG B CB  1 
ATOM   3197  C CG  . ARG B  2  67  ? 148.102 160.864 109.293 1.00 43.48  ? 67  ARG B CG  1 
ATOM   3198  C CD  . ARG B  2  67  ? 149.465 161.133 108.690 1.00 43.48  ? 67  ARG B CD  1 
ATOM   3199  N NE  . ARG B  2  67  ? 150.530 160.949 109.664 1.00 43.48  ? 67  ARG B NE  1 
ATOM   3200  C CZ  . ARG B  2  67  ? 151.773 160.618 109.344 1.00 43.48  ? 67  ARG B CZ  1 
ATOM   3201  N NH1 . ARG B  2  67  ? 152.682 160.467 110.293 1.00 43.48  ? 67  ARG B NH1 1 
ATOM   3202  N NH2 . ARG B  2  67  ? 152.102 160.434 108.076 1.00 43.48  ? 67  ARG B NH2 1 
ATOM   3203  N N   . GLN B  2  68  ? 144.255 161.461 107.019 1.00 43.48  ? 68  GLN B N   1 
ATOM   3204  C CA  . GLN B  2  68  ? 143.341 161.528 105.887 1.00 43.48  ? 68  GLN B CA  1 
ATOM   3205  C C   . GLN B  2  68  ? 143.651 162.778 105.085 1.00 43.48  ? 68  GLN B C   1 
ATOM   3206  O O   . GLN B  2  68  ? 144.019 163.806 105.654 1.00 43.48  ? 68  GLN B O   1 
ATOM   3207  C CB  . GLN B  2  68  ? 141.880 161.549 106.337 1.00 43.48  ? 68  GLN B CB  1 
ATOM   3208  C CG  . GLN B  2  68  ? 141.405 160.267 106.974 1.00 43.48  ? 68  GLN B CG  1 
ATOM   3209  C CD  . GLN B  2  68  ? 139.982 160.342 107.434 1.00 43.48  ? 68  GLN B CD  1 
ATOM   3210  O OE1 . GLN B  2  68  ? 139.339 161.380 107.326 1.00 43.48  ? 68  GLN B OE1 1 
ATOM   3211  N NE2 . GLN B  2  68  ? 139.475 159.240 107.960 1.00 43.48  ? 68  GLN B NE2 1 
ATOM   3212  N N   . SER B  2  69  ? 143.508 162.692 103.767 1.00 28.42  ? 69  SER B N   1 
ATOM   3213  C CA  . SER B  2  69  ? 143.808 163.835 102.907 1.00 28.42  ? 69  SER B CA  1 
ATOM   3214  C C   . SER B  2  69  ? 142.928 163.769 101.670 1.00 28.42  ? 69  SER B C   1 
ATOM   3215  O O   . SER B  2  69  ? 143.146 162.919 100.805 1.00 28.42  ? 69  SER B O   1 
ATOM   3216  C CB  . SER B  2  69  ? 145.280 163.850 102.522 1.00 28.42  ? 69  SER B CB  1 
ATOM   3217  O OG  . SER B  2  69  ? 145.551 164.909 101.624 1.00 28.42  ? 69  SER B OG  1 
ATOM   3218  N N   . TRP B  2  70  ? 141.962 164.675 101.569 1.00 43.48  ? 70  TRP B N   1 
ATOM   3219  C CA  . TRP B  2  70  ? 141.038 164.690 100.447 1.00 43.48  ? 70  TRP B CA  1 
ATOM   3220  C C   . TRP B  2  70  ? 141.037 166.072 99.819  1.00 43.48  ? 70  TRP B C   1 
ATOM   3221  O O   . TRP B  2  70  ? 141.435 167.056 100.443 1.00 43.48  ? 70  TRP B O   1 
ATOM   3222  C CB  . TRP B  2  70  ? 139.624 164.306 100.883 1.00 43.48  ? 70  TRP B CB  1 
ATOM   3223  C CG  . TRP B  2  70  ? 139.001 165.268 101.829 1.00 43.48  ? 70  TRP B CG  1 
ATOM   3224  C CD1 . TRP B  2  70  ? 138.192 166.309 101.511 1.00 43.48  ? 70  TRP B CD1 1 
ATOM   3225  C CD2 . TRP B  2  70  ? 139.146 165.293 103.250 1.00 43.48  ? 70  TRP B CD2 1 
ATOM   3226  N NE1 . TRP B  2  70  ? 137.812 166.978 102.645 1.00 43.48  ? 70  TRP B NE1 1 
ATOM   3227  C CE2 . TRP B  2  70  ? 138.388 166.372 103.727 1.00 43.48  ? 70  TRP B CE2 1 
ATOM   3228  C CE3 . TRP B  2  70  ? 139.842 164.505 104.164 1.00 43.48  ? 70  TRP B CE3 1 
ATOM   3229  C CZ2 . TRP B  2  70  ? 138.305 166.684 105.075 1.00 43.48  ? 70  TRP B CZ2 1 
ATOM   3230  C CZ3 . TRP B  2  70  ? 139.757 164.814 105.502 1.00 43.48  ? 70  TRP B CZ3 1 
ATOM   3231  C CH2 . TRP B  2  70  ? 138.996 165.893 105.946 1.00 43.48  ? 70  TRP B CH2 1 
ATOM   3232  N N   . LYS B  2  71  ? 140.580 166.144 98.576  1.00 29.11  ? 71  LYS B N   1 
ATOM   3233  C CA  . LYS B  2  71  ? 140.620 167.385 97.812  1.00 29.11  ? 71  LYS B CA  1 
ATOM   3234  C C   . LYS B  2  71  ? 139.231 168.006 97.807  1.00 29.11  ? 71  LYS B C   1 
ATOM   3235  O O   . LYS B  2  71  ? 138.296 167.449 97.225  1.00 29.11  ? 71  LYS B O   1 
ATOM   3236  C CB  . LYS B  2  71  ? 141.118 167.138 96.392  1.00 29.11  ? 71  LYS B CB  1 
ATOM   3237  C CG  . LYS B  2  71  ? 141.311 168.412 95.599  1.00 29.11  ? 71  LYS B CG  1 
ATOM   3238  C CD  . LYS B  2  71  ? 141.886 168.138 94.228  1.00 29.11  ? 71  LYS B CD  1 
ATOM   3239  C CE  . LYS B  2  71  ? 142.177 169.437 93.502  1.00 29.11  ? 71  LYS B CE  1 
ATOM   3240  N NZ  . LYS B  2  71  ? 140.930 170.185 93.182  1.00 29.11  ? 71  LYS B NZ  1 
ATOM   3241  N N   . ASP B  2  72  ? 139.105 169.163 98.447  1.00 32.22  ? 72  ASP B N   1 
ATOM   3242  C CA  . ASP B  2  72  ? 137.843 169.879 98.567  1.00 32.22  ? 72  ASP B CA  1 
ATOM   3243  C C   . ASP B  2  72  ? 137.999 171.234 97.899  1.00 32.22  ? 72  ASP B C   1 
ATOM   3244  O O   . ASP B  2  72  ? 138.851 172.031 98.302  1.00 32.22  ? 72  ASP B O   1 
ATOM   3245  C CB  . ASP B  2  72  ? 137.449 170.037 100.035 1.00 32.22  ? 72  ASP B CB  1 
ATOM   3246  C CG  . ASP B  2  72  ? 136.046 170.561 100.208 1.00 32.22  ? 72  ASP B CG  1 
ATOM   3247  O OD1 . ASP B  2  72  ? 135.390 170.858 99.190  1.00 32.22  ? 72  ASP B OD1 1 
ATOM   3248  O OD2 . ASP B  2  72  ? 135.596 170.671 101.367 1.00 32.22  ? 72  ASP B OD2 1 
ATOM   3249  N N   . GLU B  2  73  ? 137.175 171.496 96.886  1.00 36.90  ? 73  GLU B N   1 
ATOM   3250  C CA  . GLU B  2  73  ? 137.357 172.685 96.065  1.00 36.90  ? 73  GLU B CA  1 
ATOM   3251  C C   . GLU B  2  73  ? 136.698 173.923 96.658  1.00 36.90  ? 73  GLU B C   1 
ATOM   3252  O O   . GLU B  2  73  ? 137.109 175.042 96.337  1.00 36.90  ? 73  GLU B O   1 
ATOM   3253  C CB  . GLU B  2  73  ? 136.818 172.424 94.657  1.00 36.90  ? 73  GLU B CB  1 
ATOM   3254  C CG  . GLU B  2  73  ? 137.083 173.536 93.661  1.00 36.90  ? 73  GLU B CG  1 
ATOM   3255  C CD  . GLU B  2  73  ? 136.591 173.200 92.270  1.00 36.90  ? 73  GLU B CD  1 
ATOM   3256  O OE1 . GLU B  2  73  ? 136.031 172.099 92.087  1.00 36.90  ? 73  GLU B OE1 1 
ATOM   3257  O OE2 . GLU B  2  73  ? 136.764 174.036 91.359  1.00 36.90  ? 73  GLU B OE2 1 
ATOM   3258  N N   . ARG B  2  74  ? 135.703 173.754 97.525  1.00 28.65  ? 74  ARG B N   1 
ATOM   3259  C CA  . ARG B  2  74  ? 134.994 174.897 98.084  1.00 28.65  ? 74  ARG B CA  1 
ATOM   3260  C C   . ARG B  2  74  ? 135.826 175.682 99.087  1.00 28.65  ? 74  ARG B C   1 
ATOM   3261  O O   . ARG B  2  74  ? 135.405 176.770 99.489  1.00 28.65  ? 74  ARG B O   1 
ATOM   3262  C CB  . ARG B  2  74  ? 133.706 174.429 98.755  1.00 28.65  ? 74  ARG B CB  1 
ATOM   3263  C CG  . ARG B  2  74  ? 132.707 173.793 97.812  1.00 28.65  ? 74  ARG B CG  1 
ATOM   3264  C CD  . ARG B  2  74  ? 131.508 173.279 98.575  1.00 28.65  ? 74  ARG B CD  1 
ATOM   3265  N NE  . ARG B  2  74  ? 131.894 172.202 99.479  1.00 28.65  ? 74  ARG B NE  1 
ATOM   3266  C CZ  . ARG B  2  74  ? 131.079 171.636 100.358 1.00 28.65  ? 74  ARG B CZ  1 
ATOM   3267  N NH1 . ARG B  2  74  ? 129.822 172.041 100.453 1.00 28.65  ? 74  ARG B NH1 1 
ATOM   3268  N NH2 . ARG B  2  74  ? 131.522 170.666 101.144 1.00 28.65  ? 74  ARG B NH2 1 
ATOM   3269  N N   . LEU B  2  75  ? 136.978 175.165 99.505  1.00 25.85  ? 75  LEU B N   1 
ATOM   3270  C CA  . LEU B  2  75  ? 137.780 175.787 100.547 1.00 25.85  ? 75  LEU B CA  1 
ATOM   3271  C C   . LEU B  2  75  ? 138.970 176.568 100.014 1.00 25.85  ? 75  LEU B C   1 
ATOM   3272  O O   . LEU B  2  75  ? 139.702 177.160 100.810 1.00 25.85  ? 75  LEU B O   1 
ATOM   3273  C CB  . LEU B  2  75  ? 138.280 174.731 101.533 1.00 25.85  ? 75  LEU B CB  1 
ATOM   3274  C CG  . LEU B  2  75  ? 137.235 174.030 102.392 1.00 25.85  ? 75  LEU B CG  1 
ATOM   3275  C CD1 . LEU B  2  75  ? 137.887 172.930 103.202 1.00 25.85  ? 75  LEU B CD1 1 
ATOM   3276  C CD2 . LEU B  2  75  ? 136.550 175.024 103.294 1.00 25.85  ? 75  LEU B CD2 1 
ATOM   3277  N N   . LYS B  2  76  ? 139.195 176.583 98.705  1.00 32.44  ? 76  LYS B N   1 
ATOM   3278  C CA  . LYS B  2  76  ? 140.375 177.263 98.200  1.00 32.44  ? 76  LYS B CA  1 
ATOM   3279  C C   . LYS B  2  76  ? 140.209 178.775 98.305  1.00 32.44  ? 76  LYS B C   1 
ATOM   3280  O O   . LYS B  2  76  ? 139.100 179.303 98.412  1.00 32.44  ? 76  LYS B O   1 
ATOM   3281  C CB  . LYS B  2  76  ? 140.665 176.858 96.756  1.00 32.44  ? 76  LYS B CB  1 
ATOM   3282  C CG  . LYS B  2  76  ? 139.649 177.320 95.738  1.00 32.44  ? 76  LYS B CG  1 
ATOM   3283  C CD  . LYS B  2  76  ? 140.037 176.808 94.363  1.00 32.44  ? 76  LYS B CD  1 
ATOM   3284  C CE  . LYS B  2  76  ? 139.054 177.252 93.303  1.00 32.44  ? 76  LYS B CE  1 
ATOM   3285  N NZ  . LYS B  2  76  ? 139.439 176.730 91.964  1.00 32.44  ? 76  LYS B NZ  1 
ATOM   3286  N N   . PHE B  2  77  ? 141.339 179.470 98.275  1.00 33.69  ? 77  PHE B N   1 
ATOM   3287  C CA  . PHE B  2  77  ? 141.379 180.906 98.512  1.00 33.69  ? 77  PHE B CA  1 
ATOM   3288  C C   . PHE B  2  77  ? 142.670 181.454 97.918  1.00 33.69  ? 77  PHE B C   1 
ATOM   3289  O O   . PHE B  2  77  ? 143.376 180.762 97.177  1.00 33.69  ? 77  PHE B O   1 
ATOM   3290  C CB  . PHE B  2  77  ? 141.275 181.203 100.010 1.00 33.69  ? 77  PHE B CB  1 
ATOM   3291  C CG  . PHE B  2  77  ? 142.426 180.667 100.808 1.00 33.69  ? 77  PHE B CG  1 
ATOM   3292  C CD1 . PHE B  2  77  ? 142.402 179.376 101.294 1.00 33.69  ? 77  PHE B CD1 1 
ATOM   3293  C CD2 . PHE B  2  77  ? 143.528 181.454 101.078 1.00 33.69  ? 77  PHE B CD2 1 
ATOM   3294  C CE1 . PHE B  2  77  ? 143.456 178.878 102.026 1.00 33.69  ? 77  PHE B CE1 1 
ATOM   3295  C CE2 . PHE B  2  77  ? 144.582 180.959 101.811 1.00 33.69  ? 77  PHE B CE2 1 
ATOM   3296  C CZ  . PHE B  2  77  ? 144.545 179.672 102.286 1.00 33.69  ? 77  PHE B CZ  1 
ATOM   3297  N N   . LYS B  2  78  ? 142.979 182.707 98.244  1.00 45.21  ? 78  LYS B N   1 
ATOM   3298  C CA  . LYS B  2  78  ? 144.240 183.329 97.861  1.00 45.21  ? 78  LYS B CA  1 
ATOM   3299  C C   . LYS B  2  78  ? 144.712 184.194 99.017  1.00 45.21  ? 78  LYS B C   1 
ATOM   3300  O O   . LYS B  2  78  ? 143.998 185.109 99.437  1.00 45.21  ? 78  LYS B O   1 
ATOM   3301  C CB  . LYS B  2  78  ? 144.088 184.166 96.589  1.00 45.21  ? 78  LYS B CB  1 
ATOM   3302  C CG  . LYS B  2  78  ? 145.393 184.759 96.086  1.00 45.21  ? 78  LYS B CG  1 
ATOM   3303  C CD  . LYS B  2  78  ? 145.187 185.553 94.807  1.00 45.21  ? 78  LYS B CD  1 
ATOM   3304  C CE  . LYS B  2  78  ? 144.931 184.634 93.624  1.00 45.21  ? 78  LYS B CE  1 
ATOM   3305  N NZ  . LYS B  2  78  ? 146.136 183.829 93.283  1.00 45.21  ? 78  LYS B NZ  1 
ATOM   3306  N N   . GLY B  2  79  ? 145.906 183.910 99.525  1.00 49.80  ? 79  GLY B N   1 
ATOM   3307  C CA  . GLY B  2  79  ? 146.426 184.619 100.668 1.00 49.80  ? 79  GLY B CA  1 
ATOM   3308  C C   . GLY B  2  79  ? 147.939 184.613 100.724 1.00 49.80  ? 79  GLY B C   1 
ATOM   3309  O O   . GLY B  2  79  ? 148.616 184.061 99.852  1.00 49.80  ? 79  GLY B O   1 
ATOM   3310  N N   . PRO B  2  80  ? 148.498 185.240 101.757 1.00 49.77  ? 80  PRO B N   1 
ATOM   3311  C CA  . PRO B  2  80  ? 149.960 185.315 101.876 1.00 49.77  ? 80  PRO B CA  1 
ATOM   3312  C C   . PRO B  2  80  ? 150.602 184.058 102.448 1.00 49.77  ? 80  PRO B C   1 
ATOM   3313  O O   . PRO B  2  80  ? 151.760 183.761 102.140 1.00 49.77  ? 80  PRO B O   1 
ATOM   3314  C CB  . PRO B  2  80  ? 150.166 186.512 102.809 1.00 49.77  ? 80  PRO B CB  1 
ATOM   3315  C CG  . PRO B  2  80  ? 148.933 186.543 103.640 1.00 49.77  ? 80  PRO B CG  1 
ATOM   3316  C CD  . PRO B  2  80  ? 147.815 186.089 102.748 1.00 49.77  ? 80  PRO B CD  1 
ATOM   3317  N N   . MET B  2  81  ? 149.872 183.314 103.282 1.00 55.77  ? 81  MET B N   1 
ATOM   3318  C CA  . MET B  2  81  ? 150.482 182.196 103.998 1.00 55.77  ? 81  MET B CA  1 
ATOM   3319  C C   . MET B  2  81  ? 150.655 180.974 103.103 1.00 55.77  ? 81  MET B C   1 
ATOM   3320  O O   . MET B  2  81  ? 151.694 180.306 103.150 1.00 55.77  ? 81  MET B O   1 
ATOM   3321  C CB  . MET B  2  81  ? 149.652 181.845 105.230 1.00 55.77  ? 81  MET B CB  1 
ATOM   3322  C CG  . MET B  2  81  ? 149.749 182.871 106.334 1.00 55.77  ? 81  MET B CG  1 
ATOM   3323  S SD  . MET B  2  81  ? 151.451 183.060 106.898 1.00 55.77  ? 81  MET B SD  1 
ATOM   3324  C CE  . MET B  2  81  ? 151.735 181.464 107.659 1.00 55.77  ? 81  MET B CE  1 
ATOM   3325  N N   . THR B  2  82  ? 149.624 180.637 102.325 1.00 46.97  ? 82  THR B N   1 
ATOM   3326  C CA  . THR B  2  82  ? 149.594 179.497 101.409 1.00 46.97  ? 82  THR B CA  1 
ATOM   3327  C C   . THR B  2  82  ? 149.517 178.170 102.159 1.00 46.97  ? 82  THR B C   1 
ATOM   3328  O O   . THR B  2  82  ? 149.342 177.119 101.538 1.00 46.97  ? 82  THR B O   1 
ATOM   3329  C CB  . THR B  2  82  ? 150.802 179.489 100.463 1.00 46.97  ? 82  THR B CB  1 
ATOM   3330  O OG1 . THR B  2  82  ? 152.005 179.270 101.209 1.00 46.97  ? 82  THR B OG1 1 
ATOM   3331  C CG2 . THR B  2  82  ? 150.907 180.812 99.724  1.00 46.97  ? 82  THR B CG2 1 
ATOM   3332  N N   . VAL B  2  83  ? 149.637 178.208 103.485 1.00 36.89  ? 83  VAL B N   1 
ATOM   3333  C CA  . VAL B  2  83  ? 149.388 177.061 104.355 1.00 36.89  ? 83  VAL B CA  1 
ATOM   3334  C C   . VAL B  2  83  ? 148.784 177.580 105.650 1.00 36.89  ? 83  VAL B C   1 
ATOM   3335  O O   . VAL B  2  83  ? 149.366 178.453 106.301 1.00 36.89  ? 83  VAL B O   1 
ATOM   3336  C CB  . VAL B  2  83  ? 150.663 176.253 104.664 1.00 36.89  ? 83  VAL B CB  1 
ATOM   3337  C CG1 . VAL B  2  83  ? 150.379 175.243 105.752 1.00 36.89  ? 83  VAL B CG1 1 
ATOM   3338  C CG2 . VAL B  2  83  ? 151.163 175.536 103.433 1.00 36.89  ? 83  VAL B CG2 1 
ATOM   3339  N N   . LEU B  2  84  ? 147.629 177.050 106.028 1.00 23.64  ? 84  LEU B N   1 
ATOM   3340  C CA  . LEU B  2  84  ? 146.956 177.450 107.255 1.00 23.64  ? 84  LEU B CA  1 
ATOM   3341  C C   . LEU B  2  84  ? 147.076 176.331 108.277 1.00 23.64  ? 84  LEU B C   1 
ATOM   3342  O O   . LEU B  2  84  ? 146.588 175.221 108.045 1.00 23.64  ? 84  LEU B O   1 
ATOM   3343  C CB  . LEU B  2  84  ? 145.491 177.784 106.994 1.00 23.64  ? 84  LEU B CB  1 
ATOM   3344  C CG  . LEU B  2  84  ? 145.257 179.030 106.147 1.00 23.64  ? 84  LEU B CG  1 
ATOM   3345  C CD1 . LEU B  2  84  ? 143.785 179.190 105.835 1.00 23.64  ? 84  LEU B CD1 1 
ATOM   3346  C CD2 . LEU B  2  84  ? 145.780 180.249 106.874 1.00 23.64  ? 84  LEU B CD2 1 
ATOM   3347  N N   . ARG B  2  85  ? 147.729 176.620 109.400 1.00 23.49  ? 85  ARG B N   1 
ATOM   3348  C CA  . ARG B  2  85  ? 147.822 175.682 110.516 1.00 23.49  ? 85  ARG B CA  1 
ATOM   3349  C C   . ARG B  2  85  ? 146.710 176.033 111.498 1.00 23.49  ? 85  ARG B C   1 
ATOM   3350  O O   . ARG B  2  85  ? 146.911 176.726 112.494 1.00 23.49  ? 85  ARG B O   1 
ATOM   3351  C CB  . ARG B  2  85  ? 149.195 175.753 111.168 1.00 23.49  ? 85  ARG B CB  1 
ATOM   3352  C CG  . ARG B  2  85  ? 150.320 175.276 110.286 1.00 23.49  ? 85  ARG B CG  1 
ATOM   3353  C CD  . ARG B  2  85  ? 151.652 175.419 110.986 1.00 23.49  ? 85  ARG B CD  1 
ATOM   3354  N NE  . ARG B  2  85  ? 152.737 174.925 110.150 1.00 23.49  ? 85  ARG B NE  1 
ATOM   3355  C CZ  . ARG B  2  85  ? 153.397 175.673 109.276 1.00 23.49  ? 85  ARG B CZ  1 
ATOM   3356  N NH1 . ARG B  2  85  ? 154.371 175.143 108.550 1.00 23.49  ? 85  ARG B NH1 1 
ATOM   3357  N NH2 . ARG B  2  85  ? 153.081 176.951 109.125 1.00 23.49  ? 85  ARG B NH2 1 
ATOM   3358  N N   . LEU B  2  86  ? 145.513 175.546 111.199 1.00 21.69  ? 86  LEU B N   1 
ATOM   3359  C CA  . LEU B  2  86  ? 144.346 175.938 111.964 1.00 21.69  ? 86  LEU B CA  1 
ATOM   3360  C C   . LEU B  2  86  ? 144.292 175.201 113.297 1.00 21.69  ? 86  LEU B C   1 
ATOM   3361  O O   . LEU B  2  86  ? 144.988 174.211 113.528 1.00 21.69  ? 86  LEU B O   1 
ATOM   3362  C CB  . LEU B  2  86  ? 143.081 175.682 111.161 1.00 21.69  ? 86  LEU B CB  1 
ATOM   3363  C CG  . LEU B  2  86  ? 143.050 176.562 109.921 1.00 21.69  ? 86  LEU B CG  1 
ATOM   3364  C CD1 . LEU B  2  86  ? 141.856 176.235 109.061 1.00 21.69  ? 86  LEU B CD1 1 
ATOM   3365  C CD2 . LEU B  2  86  ? 143.042 178.017 110.324 1.00 21.69  ? 86  LEU B CD2 1 
ATOM   3366  N N   . ASN B  2  87  ? 143.438 175.703 114.180 1.00 29.74  ? 87  ASN B N   1 
ATOM   3367  C CA  . ASN B  2  87  ? 143.293 175.150 115.518 1.00 29.74  ? 87  ASN B CA  1 
ATOM   3368  C C   . ASN B  2  87  ? 142.526 173.833 115.422 1.00 29.74  ? 87  ASN B C   1 
ATOM   3369  O O   . ASN B  2  87  ? 142.225 173.331 114.337 1.00 29.74  ? 87  ASN B O   1 
ATOM   3370  C CB  . ASN B  2  87  ? 142.605 176.164 116.429 1.00 29.74  ? 87  ASN B CB  1 
ATOM   3371  C CG  . ASN B  2  87  ? 142.751 175.826 117.900 1.00 29.74  ? 87  ASN B CG  1 
ATOM   3372  O OD1 . ASN B  2  87  ? 143.367 174.826 118.261 1.00 29.74  ? 87  ASN B OD1 1 
ATOM   3373  N ND2 . ASN B  2  87  ? 142.181 176.662 118.756 1.00 29.74  ? 87  ASN B ND2 1 
ATOM   3374  N N   . ASN B  2  88  ? 142.203 173.255 116.570 1.00 33.41  ? 88  ASN B N   1 
ATOM   3375  C CA  . ASN B  2  88  ? 141.483 171.994 116.625 1.00 33.41  ? 88  ASN B CA  1 
ATOM   3376  C C   . ASN B  2  88  ? 139.974 172.182 116.645 1.00 33.41  ? 88  ASN B C   1 
ATOM   3377  O O   . ASN B  2  88  ? 139.242 171.189 116.644 1.00 33.41  ? 88  ASN B O   1 
ATOM   3378  C CB  . ASN B  2  88  ? 141.922 171.211 117.861 1.00 33.41  ? 88  ASN B CB  1 
ATOM   3379  C CG  . ASN B  2  88  ? 143.430 171.070 117.951 1.00 33.41  ? 88  ASN B CG  1 
ATOM   3380  O OD1 . ASN B  2  88  ? 144.053 171.558 118.894 1.00 33.41  ? 88  ASN B OD1 1 
ATOM   3381  N ND2 . ASN B  2  88  ? 144.026 170.428 116.963 1.00 33.41  ? 88  ASN B ND2 1 
ATOM   3382  N N   . LEU B  2  89  ? 139.498 173.428 116.674 1.00 34.83  ? 89  LEU B N   1 
ATOM   3383  C CA  . LEU B  2  89  ? 138.075 173.729 116.779 1.00 34.83  ? 89  LEU B CA  1 
ATOM   3384  C C   . LEU B  2  89  ? 137.383 173.762 115.426 1.00 34.83  ? 89  LEU B C   1 
ATOM   3385  O O   . LEU B  2  89  ? 136.265 173.256 115.293 1.00 34.83  ? 89  LEU B O   1 
ATOM   3386  C CB  . LEU B  2  89  ? 137.871 175.071 117.485 1.00 34.83  ? 89  LEU B CB  1 
ATOM   3387  C CG  . LEU B  2  89  ? 138.321 175.125 118.944 1.00 34.83  ? 89  LEU B CG  1 
ATOM   3388  C CD1 . LEU B  2  89  ? 138.190 176.534 119.493 1.00 34.83  ? 89  LEU B CD1 1 
ATOM   3389  C CD2 . LEU B  2  89  ? 137.535 174.135 119.789 1.00 34.83  ? 89  LEU B CD2 1 
ATOM   3390  N N   . MET B  2  90  ? 138.024 174.350 114.418 1.00 33.11  ? 90  MET B N   1 
ATOM   3391  C CA  . MET B  2  90  ? 137.409 174.472 113.105 1.00 33.11  ? 90  MET B CA  1 
ATOM   3392  C C   . MET B  2  90  ? 137.225 173.129 112.413 1.00 33.11  ? 90  MET B C   1 
ATOM   3393  O O   . MET B  2  90  ? 136.441 173.042 111.463 1.00 33.11  ? 90  MET B O   1 
ATOM   3394  C CB  . MET B  2  90  ? 138.248 175.409 112.236 1.00 33.11  ? 90  MET B CB  1 
ATOM   3395  C CG  . MET B  2  90  ? 137.648 175.719 110.887 1.00 33.11  ? 90  MET B CG  1 
ATOM   3396  S SD  . MET B  2  90  ? 138.584 176.941 109.967 1.00 33.11  ? 90  MET B SD  1 
ATOM   3397  C CE  . MET B  2  90  ? 137.696 176.929 108.416 1.00 33.11  ? 90  MET B CE  1 
ATOM   3398  N N   . ALA B  2  91  ? 137.897 172.077 112.881 1.00 28.97  ? 91  ALA B N   1 
ATOM   3399  C CA  . ALA B  2  91  ? 137.789 170.776 112.234 1.00 28.97  ? 91  ALA B CA  1 
ATOM   3400  C C   . ALA B  2  91  ? 136.367 170.231 112.234 1.00 28.97  ? 91  ALA B C   1 
ATOM   3401  O O   . ALA B  2  91  ? 136.051 169.367 111.411 1.00 28.97  ? 91  ALA B O   1 
ATOM   3402  C CB  . ALA B  2  91  ? 138.722 169.775 112.912 1.00 28.97  ? 91  ALA B CB  1 
ATOM   3403  N N   . SER B  2  92  ? 135.508 170.702 113.133 1.00 30.57  ? 92  SER B N   1 
ATOM   3404  C CA  . SER B  2  92  ? 134.137 170.220 113.200 1.00 30.57  ? 92  SER B CA  1 
ATOM   3405  C C   . SER B  2  92  ? 133.167 171.043 112.366 1.00 30.57  ? 92  SER B C   1 
ATOM   3406  O O   . SER B  2  92  ? 132.016 170.629 112.204 1.00 30.57  ? 92  SER B O   1 
ATOM   3407  C CB  . SER B  2  92  ? 133.650 170.195 114.650 1.00 30.57  ? 92  SER B CB  1 
ATOM   3408  O OG  . SER B  2  92  ? 133.523 171.507 115.164 1.00 30.57  ? 92  SER B OG  1 
ATOM   3409  N N   . LYS B  2  93  ? 133.587 172.197 111.851 1.00 24.11  ? 93  LYS B N   1 
ATOM   3410  C CA  . LYS B  2  93  ? 132.691 173.045 111.076 1.00 24.11  ? 93  LYS B CA  1 
ATOM   3411  C C   . LYS B  2  93  ? 132.709 172.742 109.585 1.00 24.11  ? 93  LYS B C   1 
ATOM   3412  O O   . LYS B  2  93  ? 131.782 173.149 108.878 1.00 24.11  ? 93  LYS B O   1 
ATOM   3413  C CB  . LYS B  2  93  ? 133.032 174.518 111.305 1.00 24.11  ? 93  LYS B CB  1 
ATOM   3414  C CG  . LYS B  2  93  ? 132.729 174.980 112.716 1.00 24.11  ? 93  LYS B CG  1 
ATOM   3415  C CD  . LYS B  2  93  ? 133.047 176.444 112.925 1.00 24.11  ? 93  LYS B CD  1 
ATOM   3416  C CE  . LYS B  2  93  ? 132.755 176.847 114.357 1.00 24.11  ? 93  LYS B CE  1 
ATOM   3417  N NZ  . LYS B  2  93  ? 133.076 178.272 114.615 1.00 24.11  ? 93  LYS B NZ  1 
ATOM   3418  N N   . ILE B  2  94  ? 133.730 172.055 109.090 1.00 23.08  ? 94  ILE B N   1 
ATOM   3419  C CA  . ILE B  2  94  ? 133.785 171.643 107.702 1.00 23.08  ? 94  ILE B CA  1 
ATOM   3420  C C   . ILE B  2  94  ? 133.539 170.142 107.622 1.00 23.08  ? 94  ILE B C   1 
ATOM   3421  O O   . ILE B  2  94  ? 133.515 169.440 108.628 1.00 23.08  ? 94  ILE B O   1 
ATOM   3422  C CB  . ILE B  2  94  ? 135.126 172.010 107.045 1.00 23.08  ? 94  ILE B CB  1 
ATOM   3423  C CG1 . ILE B  2  94  ? 136.252 171.240 107.719 1.00 23.08  ? 94  ILE B CG1 1 
ATOM   3424  C CG2 . ILE B  2  94  ? 135.374 173.496 107.142 1.00 23.08  ? 94  ILE B CG2 1 
ATOM   3425  C CD1 . ILE B  2  94  ? 137.546 171.326 106.985 1.00 23.08  ? 94  ILE B CD1 1 
ATOM   3426  N N   . TRP B  2  95  ? 133.359 169.638 106.405 1.00 24.72  ? 95  TRP B N   1 
ATOM   3427  C CA  . TRP B  2  95  ? 133.108 168.216 106.220 1.00 24.72  ? 95  TRP B CA  1 
ATOM   3428  C C   . TRP B  2  95  ? 134.343 167.403 106.578 1.00 24.72  ? 95  TRP B C   1 
ATOM   3429  O O   . TRP B  2  95  ? 135.472 167.805 106.292 1.00 24.72  ? 95  TRP B O   1 
ATOM   3430  C CB  . TRP B  2  95  ? 132.716 167.925 104.780 1.00 24.72  ? 95  TRP B CB  1 
ATOM   3431  C CG  . TRP B  2  95  ? 132.352 166.505 104.566 1.00 24.72  ? 95  TRP B CG  1 
ATOM   3432  C CD1 . TRP B  2  95  ? 131.246 165.875 105.029 1.00 24.72  ? 95  TRP B CD1 1 
ATOM   3433  C CD2 . TRP B  2  95  ? 133.106 165.522 103.856 1.00 24.72  ? 95  TRP B CD2 1 
ATOM   3434  N NE1 . TRP B  2  95  ? 131.249 164.564 104.640 1.00 24.72  ? 95  TRP B NE1 1 
ATOM   3435  C CE2 . TRP B  2  95  ? 132.386 164.321 103.918 1.00 24.72  ? 95  TRP B CE2 1 
ATOM   3436  C CE3 . TRP B  2  95  ? 134.318 165.543 103.168 1.00 24.72  ? 95  TRP B CE3 1 
ATOM   3437  C CZ2 . TRP B  2  95  ? 132.834 163.153 103.324 1.00 24.72  ? 95  TRP B CZ2 1 
ATOM   3438  C CZ3 . TRP B  2  95  ? 134.761 164.380 102.576 1.00 24.72  ? 95  TRP B CZ3 1 
ATOM   3439  C CH2 . TRP B  2  95  ? 134.022 163.203 102.658 1.00 24.72  ? 95  TRP B CH2 1 
ATOM   3440  N N   . THR B  2  96  ? 134.125 166.248 107.212 1.00 25.43  ? 96  THR B N   1 
ATOM   3441  C CA  . THR B  2  96  ? 135.199 165.314 107.539 1.00 25.43  ? 96  THR B CA  1 
ATOM   3442  C C   . THR B  2  96  ? 134.649 163.905 107.341 1.00 25.43  ? 96  THR B C   1 
ATOM   3443  O O   . THR B  2  96  ? 133.614 163.561 107.937 1.00 25.43  ? 96  THR B O   1 
ATOM   3444  C CB  . THR B  2  96  ? 135.714 165.479 108.969 1.00 25.43  ? 96  THR B CB  1 
ATOM   3445  O OG1 . THR B  2  96  ? 134.639 165.250 109.885 1.00 25.43  ? 96  THR B OG1 1 
ATOM   3446  C CG2 . THR B  2  96  ? 136.276 166.868 109.192 1.00 25.43  ? 96  THR B CG2 1 
ATOM   3447  N N   . PRO B  2  97  ? 135.308 163.067 106.545 1.00 23.47  ? 97  PRO B N   1 
ATOM   3448  C CA  . PRO B  2  97  ? 134.737 161.754 106.236 1.00 23.47  ? 97  PRO B CA  1 
ATOM   3449  C C   . PRO B  2  97  ? 134.773 160.839 107.446 1.00 23.47  ? 97  PRO B C   1 
ATOM   3450  O O   . PRO B  2  97  ? 135.744 160.822 108.205 1.00 23.47  ? 97  PRO B O   1 
ATOM   3451  C CB  . PRO B  2  97  ? 135.642 161.235 105.118 1.00 23.47  ? 97  PRO B CB  1 
ATOM   3452  C CG  . PRO B  2  97  ? 136.937 161.873 105.385 1.00 23.47  ? 97  PRO B CG  1 
ATOM   3453  C CD  . PRO B  2  97  ? 136.633 163.240 105.933 1.00 23.47  ? 97  PRO B CD  1 
ATOM   3454  N N   . ASP B  2  98  ? 133.699 160.080 107.625 1.00 22.65  ? 98  ASP B N   1 
ATOM   3455  C CA  . ASP B  2  98  ? 133.642 159.103 108.699 1.00 22.65  ? 98  ASP B CA  1 
ATOM   3456  C C   . ASP B  2  98  ? 134.364 157.825 108.301 1.00 22.65  ? 98  ASP B C   1 
ATOM   3457  O O   . ASP B  2  98  ? 134.386 157.434 107.132 1.00 22.65  ? 98  ASP B O   1 
ATOM   3458  C CB  . ASP B  2  98  ? 132.194 158.802 109.079 1.00 22.65  ? 98  ASP B CB  1 
ATOM   3459  C CG  . ASP B  2  98  ? 131.358 158.387 107.900 1.00 22.65  ? 98  ASP B CG  1 
ATOM   3460  O OD1 . ASP B  2  98  ? 131.873 158.396 106.766 1.00 22.65  ? 98  ASP B OD1 1 
ATOM   3461  O OD2 . ASP B  2  98  ? 130.171 158.062 108.108 1.00 22.65  ? 98  ASP B OD2 1 
ATOM   3462  N N   . THR B  2  99  ? 134.978 157.180 109.292 1.00 15.21  ? 99  THR B N   1 
ATOM   3463  C CA  . THR B  2  99  ? 135.792 155.998 109.031 1.00 15.21  ? 99  THR B CA  1 
ATOM   3464  C C   . THR B  2  99  ? 135.818 155.163 110.308 1.00 15.21  ? 99  THR B C   1 
ATOM   3465  O O   . THR B  2  99  ? 136.534 155.505 111.250 1.00 15.21  ? 99  THR B O   1 
ATOM   3466  C CB  . THR B  2  99  ? 137.194 156.388 108.603 1.00 15.21  ? 99  THR B CB  1 
ATOM   3467  O OG1 . THR B  2  99  ? 137.127 157.199 107.428 1.00 15.21  ? 99  THR B OG1 1 
ATOM   3468  C CG2 . THR B  2  99  ? 138.002 155.157 108.295 1.00 15.21  ? 99  THR B CG2 1 
ATOM   3469  N N   . PHE B  2  100 ? 135.048 154.085 110.332 1.00 19.49  ? 100 PHE B N   1 
ATOM   3470  C CA  . PHE B  2  100 ? 135.034 153.203 111.486 1.00 19.49  ? 100 PHE B CA  1 
ATOM   3471  C C   . PHE B  2  100 ? 135.905 151.988 111.206 1.00 19.49  ? 100 PHE B C   1 
ATOM   3472  O O   . PHE B  2  100 ? 136.330 151.749 110.076 1.00 19.49  ? 100 PHE B O   1 
ATOM   3473  C CB  . PHE B  2  100 ? 133.613 152.764 111.818 1.00 19.49  ? 100 PHE B CB  1 
ATOM   3474  C CG  . PHE B  2  100 ? 133.085 151.707 110.908 1.00 19.49  ? 100 PHE B CG  1 
ATOM   3475  C CD1 . PHE B  2  100 ? 132.505 152.033 109.712 1.00 19.49  ? 100 PHE B CD1 1 
ATOM   3476  C CD2 . PHE B  2  100 ? 133.156 150.378 111.261 1.00 19.49  ? 100 PHE B CD2 1 
ATOM   3477  C CE1 . PHE B  2  100 ? 132.023 151.053 108.880 1.00 19.49  ? 100 PHE B CE1 1 
ATOM   3478  C CE2 . PHE B  2  100 ? 132.671 149.403 110.428 1.00 19.49  ? 100 PHE B CE2 1 
ATOM   3479  C CZ  . PHE B  2  100 ? 132.101 149.743 109.241 1.00 19.49  ? 100 PHE B CZ  1 
ATOM   3480  N N   . PHE B  2  101 ? 136.163 151.206 112.249 1.00 24.10  ? 101 PHE B N   1 
ATOM   3481  C CA  . PHE B  2  101 ? 136.963 149.995 112.126 1.00 24.10  ? 101 PHE B CA  1 
ATOM   3482  C C   . PHE B  2  101 ? 136.040 148.786 112.207 1.00 24.10  ? 101 PHE B C   1 
ATOM   3483  O O   . PHE B  2  101 ? 135.394 148.565 113.236 1.00 24.10  ? 101 PHE B O   1 
ATOM   3484  C CB  . PHE B  2  101 ? 138.041 149.926 113.206 1.00 24.10  ? 101 PHE B CB  1 
ATOM   3485  C CG  . PHE B  2  101 ? 139.081 151.005 113.099 1.00 24.10  ? 101 PHE B CG  1 
ATOM   3486  C CD1 . PHE B  2  101 ? 139.061 151.909 112.065 1.00 24.10  ? 101 PHE B CD1 1 
ATOM   3487  C CD2 . PHE B  2  101 ? 140.113 151.076 114.003 1.00 24.10  ? 101 PHE B CD2 1 
ATOM   3488  C CE1 . PHE B  2  101 ? 140.019 152.891 111.964 1.00 24.10  ? 101 PHE B CE1 1 
ATOM   3489  C CE2 . PHE B  2  101 ? 141.076 152.051 113.890 1.00 24.10  ? 101 PHE B CE2 1 
ATOM   3490  C CZ  . PHE B  2  101 ? 141.026 152.958 112.872 1.00 24.10  ? 101 PHE B CZ  1 
ATOM   3491  N N   . HIS B  2  102 ? 135.989 148.001 111.125 1.00 17.18  ? 102 HIS B N   1 
ATOM   3492  C CA  . HIS B  2  102 ? 135.042 146.892 111.034 1.00 17.18  ? 102 HIS B CA  1 
ATOM   3493  C C   . HIS B  2  102 ? 135.167 145.923 112.201 1.00 17.18  ? 102 HIS B C   1 
ATOM   3494  O O   . HIS B  2  102 ? 134.183 145.274 112.569 1.00 17.18  ? 102 HIS B O   1 
ATOM   3495  C CB  . HIS B  2  102 ? 135.236 146.134 109.723 1.00 17.18  ? 102 HIS B CB  1 
ATOM   3496  C CG  . HIS B  2  102 ? 134.809 146.893 108.507 1.00 17.18  ? 102 HIS B CG  1 
ATOM   3497  N ND1 . HIS B  2  102 ? 133.489 147.028 108.141 1.00 17.18  ? 102 HIS B ND1 1 
ATOM   3498  C CD2 . HIS B  2  102 ? 135.528 147.548 107.567 1.00 17.18  ? 102 HIS B CD2 1 
ATOM   3499  C CE1 . HIS B  2  102 ? 133.412 147.733 107.027 1.00 17.18  ? 102 HIS B CE1 1 
ATOM   3500  N NE2 . HIS B  2  102 ? 134.635 148.063 106.659 1.00 17.18  ? 102 HIS B NE2 1 
ATOM   3501  N N   . ASN B  2  103 ? 136.350 145.802 112.791 1.00 22.83  ? 103 ASN B N   1 
ATOM   3502  C CA  . ASN B  2  103 ? 136.579 144.844 113.865 1.00 22.83  ? 103 ASN B CA  1 
ATOM   3503  C C   . ASN B  2  103 ? 137.131 145.542 115.100 1.00 22.83  ? 103 ASN B C   1 
ATOM   3504  O O   . ASN B  2  103 ? 138.110 145.107 115.707 1.00 22.83  ? 103 ASN B O   1 
ATOM   3505  C CB  . ASN B  2  103 ? 137.503 143.723 113.404 1.00 22.83  ? 103 ASN B CB  1 
ATOM   3506  C CG  . ASN B  2  103 ? 138.864 144.221 112.983 1.00 22.83  ? 103 ASN B CG  1 
ATOM   3507  O OD1 . ASN B  2  103 ? 139.184 145.396 113.127 1.00 22.83  ? 103 ASN B OD1 1 
ATOM   3508  N ND2 . ASN B  2  103 ? 139.679 143.320 112.455 1.00 22.83  ? 103 ASN B ND2 1 
ATOM   3509  N N   . GLY B  2  104 ? 136.502 146.645 115.489 1.00 28.90  ? 104 GLY B N   1 
ATOM   3510  C CA  . GLY B  2  104 ? 136.916 147.353 116.682 1.00 28.90  ? 104 GLY B CA  1 
ATOM   3511  C C   . GLY B  2  104 ? 135.948 147.167 117.829 1.00 28.90  ? 104 GLY B C   1 
ATOM   3512  O O   . GLY B  2  104 ? 134.785 147.557 117.728 1.00 28.90  ? 104 GLY B O   1 
ATOM   3513  N N   . LYS B  2  105 ? 136.410 146.573 118.928 1.00 28.25  ? 105 LYS B N   1 
ATOM   3514  C CA  . LYS B  2  105 ? 135.514 146.324 120.051 1.00 28.25  ? 105 LYS B CA  1 
ATOM   3515  C C   . LYS B  2  105 ? 135.179 147.611 120.792 1.00 28.25  ? 105 LYS B C   1 
ATOM   3516  O O   . LYS B  2  105 ? 134.010 147.882 121.080 1.00 28.25  ? 105 LYS B O   1 
ATOM   3517  C CB  . LYS B  2  105 ? 136.123 145.296 120.999 1.00 28.25  ? 105 LYS B CB  1 
ATOM   3518  C CG  . LYS B  2  105 ? 136.110 143.884 120.456 1.00 28.25  ? 105 LYS B CG  1 
ATOM   3519  C CD  . LYS B  2  105 ? 136.858 142.945 121.373 1.00 28.25  ? 105 LYS B CD  1 
ATOM   3520  C CE  . LYS B  2  105 ? 136.104 142.742 122.670 1.00 28.25  ? 105 LYS B CE  1 
ATOM   3521  N NZ  . LYS B  2  105 ? 136.773 141.731 123.528 1.00 28.25  ? 105 LYS B NZ  1 
ATOM   3522  N N   . LYS B  2  106 ? 136.191 148.407 121.136 1.00 28.16  ? 106 LYS B N   1 
ATOM   3523  C CA  . LYS B  2  106 ? 135.938 149.701 121.768 1.00 28.16  ? 106 LYS B CA  1 
ATOM   3524  C C   . LYS B  2  106 ? 137.135 150.606 121.487 1.00 28.16  ? 106 LYS B C   1 
ATOM   3525  O O   . LYS B  2  106 ? 138.162 150.499 122.159 1.00 28.16  ? 106 LYS B O   1 
ATOM   3526  C CB  . LYS B  2  106 ? 135.697 149.557 123.259 1.00 28.16  ? 106 LYS B CB  1 
ATOM   3527  C CG  . LYS B  2  106 ? 135.421 150.883 123.933 1.00 28.16  ? 106 LYS B CG  1 
ATOM   3528  C CD  . LYS B  2  106 ? 135.040 150.718 125.388 1.00 28.16  ? 106 LYS B CD  1 
ATOM   3529  C CE  . LYS B  2  106 ? 134.926 152.074 126.064 1.00 28.16  ? 106 LYS B CE  1 
ATOM   3530  N NZ  . LYS B  2  106 ? 133.825 152.883 125.473 1.00 28.16  ? 106 LYS B NZ  1 
ATOM   3531  N N   . SER B  2  107 ? 136.985 151.492 120.516 1.00 28.10  ? 107 SER B N   1 
ATOM   3532  C CA  . SER B  2  107 ? 138.027 152.454 120.205 1.00 28.10  ? 107 SER B CA  1 
ATOM   3533  C C   . SER B  2  107 ? 137.772 153.754 120.947 1.00 28.10  ? 107 SER B C   1 
ATOM   3534  O O   . SER B  2  107 ? 136.626 154.124 121.211 1.00 28.10  ? 107 SER B O   1 
ATOM   3535  C CB  . SER B  2  107 ? 138.093 152.722 118.705 1.00 28.10  ? 107 SER B CB  1 
ATOM   3536  O OG  . SER B  2  107 ? 138.459 151.553 117.998 1.00 28.10  ? 107 SER B OG  1 
ATOM   3537  N N   . VAL B  2  108 ? 138.852 154.446 121.286 1.00 22.24  ? 108 VAL B N   1 
ATOM   3538  C CA  . VAL B  2  108 ? 138.767 155.717 121.989 1.00 22.24  ? 108 VAL B CA  1 
ATOM   3539  C C   . VAL B  2  108 ? 139.662 156.726 121.289 1.00 22.24  ? 108 VAL B C   1 
ATOM   3540  O O   . VAL B  2  108 ? 140.809 156.417 120.951 1.00 22.24  ? 108 VAL B O   1 
ATOM   3541  C CB  . VAL B  2  108 ? 139.146 155.574 123.475 1.00 22.24  ? 108 VAL B CB  1 
ATOM   3542  C CG1 . VAL B  2  108 ? 140.550 155.035 123.629 1.00 22.24  ? 108 VAL B CG1 1 
ATOM   3543  C CG2 . VAL B  2  108 ? 139.020 156.910 124.178 1.00 22.24  ? 108 VAL B CG2 1 
ATOM   3544  N N   . ALA B  2  109 ? 139.128 157.914 121.040 1.00 19.34  ? 109 ALA B N   1 
ATOM   3545  C CA  . ALA B  2  109 ? 139.913 159.035 120.550 1.00 19.34  ? 109 ALA B CA  1 
ATOM   3546  C C   . ALA B  2  109 ? 140.297 159.914 121.728 1.00 19.34  ? 109 ALA B C   1 
ATOM   3547  O O   . ALA B  2  109 ? 139.463 160.217 122.584 1.00 19.34  ? 109 ALA B O   1 
ATOM   3548  C CB  . ALA B  2  109 ? 139.133 159.851 119.521 1.00 19.34  ? 109 ALA B CB  1 
ATOM   3549  N N   . HIS B  2  110 ? 141.556 160.329 121.764 1.00 28.03  ? 110 HIS B N   1 
ATOM   3550  C CA  . HIS B  2  110 ? 142.083 161.048 122.913 1.00 28.03  ? 110 HIS B CA  1 
ATOM   3551  C C   . HIS B  2  110 ? 141.832 162.540 122.791 1.00 28.03  ? 110 HIS B C   1 
ATOM   3552  O O   . HIS B  2  110 ? 142.002 163.125 121.719 1.00 28.03  ? 110 HIS B O   1 
ATOM   3553  C CB  . HIS B  2  110 ? 143.579 160.819 123.076 1.00 28.03  ? 110 HIS B CB  1 
ATOM   3554  C CG  . HIS B  2  110 ? 143.938 159.447 123.540 1.00 28.03  ? 110 HIS B CG  1 
ATOM   3555  N ND1 . HIS B  2  110 ? 144.257 158.430 122.672 1.00 28.03  ? 110 HIS B ND1 1 
ATOM   3556  C CD2 . HIS B  2  110 ? 144.014 158.921 124.783 1.00 28.03  ? 110 HIS B CD2 1 
ATOM   3557  C CE1 . HIS B  2  110 ? 144.530 157.339 123.361 1.00 28.03  ? 110 HIS B CE1 1 
ATOM   3558  N NE2 . HIS B  2  110 ? 144.389 157.610 124.644 1.00 28.03  ? 110 HIS B NE2 1 
ATOM   3559  N N   . ASN B  2  111 ? 141.440 163.154 123.905 1.00 28.81  ? 111 ASN B N   1 
ATOM   3560  C CA  . ASN B  2  111 ? 141.469 164.603 124.063 1.00 28.81  ? 111 ASN B CA  1 
ATOM   3561  C C   . ASN B  2  111 ? 142.221 164.874 125.361 1.00 28.81  ? 111 ASN B C   1 
ATOM   3562  O O   . ASN B  2  111 ? 141.625 165.058 126.423 1.00 28.81  ? 111 ASN B O   1 
ATOM   3563  C CB  . ASN B  2  111 ? 140.073 165.205 124.061 1.00 28.81  ? 111 ASN B CB  1 
ATOM   3564  C CG  . ASN B  2  111 ? 139.171 164.590 125.102 1.00 28.81  ? 111 ASN B CG  1 
ATOM   3565  O OD1 . ASN B  2  111 ? 139.550 163.652 125.799 1.00 28.81  ? 111 ASN B OD1 1 
ATOM   3566  N ND2 . ASN B  2  111 ? 137.973 165.129 125.229 1.00 28.81  ? 111 ASN B ND2 1 
ATOM   3567  N N   . MET B  2  112 ? 143.550 164.906 125.281 1.00 24.27  ? 112 MET B N   1 
ATOM   3568  C CA  . MET B  2  112 ? 144.339 165.004 126.503 1.00 24.27  ? 112 MET B CA  1 
ATOM   3569  C C   . MET B  2  112 ? 144.138 166.345 127.192 1.00 24.27  ? 112 MET B C   1 
ATOM   3570  O O   . MET B  2  112 ? 143.669 166.403 128.333 1.00 24.27  ? 112 MET B O   1 
ATOM   3571  C CB  . MET B  2  112 ? 145.814 164.772 126.217 1.00 24.27  ? 112 MET B CB  1 
ATOM   3572  C CG  . MET B  2  112 ? 146.575 164.869 127.498 1.00 24.27  ? 112 MET B CG  1 
ATOM   3573  S SD  . MET B  2  112 ? 145.786 163.736 128.643 1.00 24.27  ? 112 MET B SD  1 
ATOM   3574  C CE  . MET B  2  112 ? 146.061 164.607 130.172 1.00 24.27  ? 112 MET B CE  1 
ATOM   3575  N N   . THR B  2  113 ? 144.506 167.435 126.526 1.00 23.19  ? 113 THR B N   1 
ATOM   3576  C CA  . THR B  2  113 ? 144.145 168.768 126.983 1.00 23.19  ? 113 THR B CA  1 
ATOM   3577  C C   . THR B  2  113 ? 143.223 169.485 126.015 1.00 23.19  ? 113 THR B C   1 
ATOM   3578  O O   . THR B  2  113 ? 142.433 170.329 126.438 1.00 23.19  ? 113 THR B O   1 
ATOM   3579  C CB  . THR B  2  113 ? 145.397 169.616 127.216 1.00 23.19  ? 113 THR B CB  1 
ATOM   3580  O OG1 . THR B  2  113 ? 146.105 169.758 125.983 1.00 23.19  ? 113 THR B OG1 1 
ATOM   3581  C CG2 . THR B  2  113 ? 146.296 168.944 128.230 1.00 23.19  ? 113 THR B CG2 1 
ATOM   3582  N N   . MET B  2  114 ? 143.312 169.159 124.735 1.00 35.79  ? 114 MET B N   1 
ATOM   3583  C CA  . MET B  2  114 ? 142.347 169.504 123.705 1.00 35.79  ? 114 MET B CA  1 
ATOM   3584  C C   . MET B  2  114 ? 142.312 168.340 122.731 1.00 35.79  ? 114 MET B C   1 
ATOM   3585  O O   . MET B  2  114 ? 143.248 167.536 122.694 1.00 35.79  ? 114 MET B O   1 
ATOM   3586  C CB  . MET B  2  114 ? 142.721 170.798 122.973 1.00 35.79  ? 114 MET B CB  1 
ATOM   3587  C CG  . MET B  2  114 ? 142.567 172.063 123.787 1.00 35.79  ? 114 MET B CG  1 
ATOM   3588  S SD  . MET B  2  114 ? 143.148 173.487 122.852 1.00 35.79  ? 114 MET B SD  1 
ATOM   3589  C CE  . MET B  2  114 ? 141.898 173.593 121.576 1.00 35.79  ? 114 MET B CE  1 
ATOM   3590  N N   . PRO B  2  115 ? 141.245 168.209 121.943 1.00 29.47  ? 115 PRO B N   1 
ATOM   3591  C CA  . PRO B  2  115 ? 141.201 167.126 120.956 1.00 29.47  ? 115 PRO B CA  1 
ATOM   3592  C C   . PRO B  2  115 ? 142.438 167.142 120.073 1.00 29.47  ? 115 PRO B C   1 
ATOM   3593  O O   . PRO B  2  115 ? 142.898 168.196 119.634 1.00 29.47  ? 115 PRO B O   1 
ATOM   3594  C CB  . PRO B  2  115 ? 139.928 167.427 120.160 1.00 29.47  ? 115 PRO B CB  1 
ATOM   3595  C CG  . PRO B  2  115 ? 139.077 168.161 121.108 1.00 29.47  ? 115 PRO B CG  1 
ATOM   3596  C CD  . PRO B  2  115 ? 140.009 169.007 121.919 1.00 29.47  ? 115 PRO B CD  1 
ATOM   3597  N N   . ASN B  2  116 ? 142.996 165.957 119.837 1.00 30.98  ? 116 ASN B N   1 
ATOM   3598  C CA  . ASN B  2  116 ? 144.270 165.834 119.136 1.00 30.98  ? 116 ASN B CA  1 
ATOM   3599  C C   . ASN B  2  116 ? 144.014 165.702 117.635 1.00 30.98  ? 116 ASN B C   1 
ATOM   3600  O O   . ASN B  2  116 ? 144.212 164.652 117.025 1.00 30.98  ? 116 ASN B O   1 
ATOM   3601  C CB  . ASN B  2  116 ? 145.050 164.646 119.673 1.00 30.98  ? 116 ASN B CB  1 
ATOM   3602  C CG  . ASN B  2  116 ? 145.242 164.711 121.161 1.00 30.98  ? 116 ASN B CG  1 
ATOM   3603  O OD1 . ASN B  2  116 ? 144.814 163.822 121.893 1.00 30.98  ? 116 ASN B OD1 1 
ATOM   3604  N ND2 . ASN B  2  116 ? 145.854 165.784 121.627 1.00 30.98  ? 116 ASN B ND2 1 
ATOM   3605  N N   . LYS B  2  117 ? 143.565 166.801 117.035 1.00 43.48  ? 117 LYS B N   1 
ATOM   3606  C CA  . LYS B  2  117 ? 143.224 166.806 115.619 1.00 43.48  ? 117 LYS B CA  1 
ATOM   3607  C C   . LYS B  2  117 ? 143.741 168.086 114.992 1.00 43.48  ? 117 LYS B C   1 
ATOM   3608  O O   . LYS B  2  117 ? 143.276 169.173 115.342 1.00 43.48  ? 117 LYS B O   1 
ATOM   3609  C CB  . LYS B  2  117 ? 141.712 166.699 115.418 1.00 43.48  ? 117 LYS B CB  1 
ATOM   3610  C CG  . LYS B  2  117 ? 141.106 165.422 115.955 1.00 43.48  ? 117 LYS B CG  1 
ATOM   3611  C CD  . LYS B  2  117 ? 139.667 165.256 115.507 1.00 43.48  ? 117 LYS B CD  1 
ATOM   3612  C CE  . LYS B  2  117 ? 138.668 165.789 116.515 1.00 43.48  ? 117 LYS B CE  1 
ATOM   3613  N NZ  . LYS B  2  117 ? 138.582 167.275 116.489 1.00 43.48  ? 117 LYS B NZ  1 
ATOM   3614  N N   . LEU B  2  118 ? 144.659 167.957 114.042 1.00 21.40  ? 118 LEU B N   1 
ATOM   3615  C CA  . LEU B  2  118 ? 145.206 169.111 113.351 1.00 21.40  ? 118 LEU B CA  1 
ATOM   3616  C C   . LEU B  2  118 ? 144.634 169.147 111.943 1.00 21.40  ? 118 LEU B C   1 
ATOM   3617  O O   . LEU B  2  118 ? 144.452 168.111 111.329 1.00 21.40  ? 118 LEU B O   1 
ATOM   3618  C CB  . LEU B  2  118 ? 146.723 169.025 113.304 1.00 21.40  ? 118 LEU B CB  1 
ATOM   3619  C CG  . LEU B  2  118 ? 147.284 168.167 112.182 1.00 21.40  ? 118 LEU B CG  1 
ATOM   3620  C CD1 . LEU B  2  118 ? 147.282 168.968 110.897 1.00 21.40  ? 118 LEU B CD1 1 
ATOM   3621  C CD2 . LEU B  2  118 ? 148.698 167.723 112.503 1.00 21.40  ? 118 LEU B CD2 1 
ATOM   3622  N N   . LEU B  2  119 ? 144.366 170.342 111.434 1.00 19.07  ? 119 LEU B N   1 
ATOM   3623  C CA  . LEU B  2  119 ? 143.786 170.536 110.115 1.00 19.07  ? 119 LEU B CA  1 
ATOM   3624  C C   . LEU B  2  119 ? 144.653 171.520 109.348 1.00 19.07  ? 119 LEU B C   1 
ATOM   3625  O O   . LEU B  2  119 ? 144.916 172.621 109.837 1.00 19.07  ? 119 LEU B O   1 
ATOM   3626  C CB  . LEU B  2  119 ? 142.356 171.058 110.229 1.00 19.07  ? 119 LEU B CB  1 
ATOM   3627  C CG  . LEU B  2  119 ? 141.568 171.249 108.942 1.00 19.07  ? 119 LEU B CG  1 
ATOM   3628  C CD1 . LEU B  2  119 ? 141.374 169.928 108.251 1.00 19.07  ? 119 LEU B CD1 1 
ATOM   3629  C CD2 . LEU B  2  119 ? 140.235 171.873 109.256 1.00 19.07  ? 119 LEU B CD2 1 
ATOM   3630  N N   . ARG B  2  120 ? 145.102 171.131 108.160 1.00 20.59  ? 120 ARG B N   1 
ATOM   3631  C CA  . ARG B  2  120 ? 146.007 171.947 107.356 1.00 20.59  ? 120 ARG B CA  1 
ATOM   3632  C C   . ARG B  2  120 ? 145.369 172.187 106.000 1.00 20.59  ? 120 ARG B C   1 
ATOM   3633  O O   . ARG B  2  120 ? 145.368 171.295 105.147 1.00 20.59  ? 120 ARG B O   1 
ATOM   3634  C CB  . ARG B  2  120 ? 147.358 171.262 107.190 1.00 20.59  ? 120 ARG B CB  1 
ATOM   3635  C CG  . ARG B  2  120 ? 148.114 171.073 108.473 1.00 20.59  ? 120 ARG B CG  1 
ATOM   3636  C CD  . ARG B  2  120 ? 149.441 170.398 108.214 1.00 20.59  ? 120 ARG B CD  1 
ATOM   3637  N NE  . ARG B  2  120 ? 150.110 170.053 109.458 1.00 20.59  ? 120 ARG B NE  1 
ATOM   3638  C CZ  . ARG B  2  120 ? 150.897 170.879 110.132 1.00 20.59  ? 120 ARG B CZ  1 
ATOM   3639  N NH1 . ARG B  2  120 ? 151.107 172.106 109.682 1.00 20.59  ? 120 ARG B NH1 1 
ATOM   3640  N NH2 . ARG B  2  120 ? 151.467 170.481 111.258 1.00 20.59  ? 120 ARG B NH2 1 
ATOM   3641  N N   . ILE B  2  121 ? 144.847 173.386 105.790 1.00 20.12  ? 121 ILE B N   1 
ATOM   3642  C CA  . ILE B  2  121 ? 144.186 173.744 104.544 1.00 20.12  ? 121 ILE B CA  1 
ATOM   3643  C C   . ILE B  2  121 ? 145.197 174.466 103.666 1.00 20.12  ? 121 ILE B C   1 
ATOM   3644  O O   . ILE B  2  121 ? 145.598 175.594 103.967 1.00 20.12  ? 121 ILE B O   1 
ATOM   3645  C CB  . ILE B  2  121 ? 142.951 174.612 104.796 1.00 20.12  ? 121 ILE B CB  1 
ATOM   3646  C CG1 . ILE B  2  121 ? 141.900 173.819 105.562 1.00 20.12  ? 121 ILE B CG1 1 
ATOM   3647  C CG2 . ILE B  2  121 ? 142.390 175.122 103.495 1.00 20.12  ? 121 ILE B CG2 1 
ATOM   3648  C CD1 . ILE B  2  121 ? 140.746 174.653 106.027 1.00 20.12  ? 121 ILE B CD1 1 
ATOM   3649  N N   . THR B  2  122 ? 145.609 173.827 102.577 1.00 31.66  ? 122 THR B N   1 
ATOM   3650  C CA  . THR B  2  122 ? 146.567 174.431 101.666 1.00 31.66  ? 122 THR B CA  1 
ATOM   3651  C C   . THR B  2  122 ? 145.869 175.453 100.772 1.00 31.66  ? 122 THR B C   1 
ATOM   3652  O O   . THR B  2  122 ? 144.664 175.692 100.875 1.00 31.66  ? 122 THR B O   1 
ATOM   3653  C CB  . THR B  2  122 ? 147.260 173.361 100.830 1.00 31.66  ? 122 THR B CB  1 
ATOM   3654  O OG1 . THR B  2  122 ? 146.286 172.671 100.043 1.00 31.66  ? 122 THR B OG1 1 
ATOM   3655  C CG2 . THR B  2  122 ? 147.962 172.366 101.728 1.00 31.66  ? 122 THR B CG2 1 
ATOM   3656  N N   . GLU B  2  123 ? 146.643 176.075 99.881  1.00 40.28  ? 123 GLU B N   1 
ATOM   3657  C CA  . GLU B  2  123 ? 146.076 177.083 98.993  1.00 40.28  ? 123 GLU B CA  1 
ATOM   3658  C C   . GLU B  2  123 ? 145.289 176.454 97.854  1.00 40.28  ? 123 GLU B C   1 
ATOM   3659  O O   . GLU B  2  123 ? 144.288 177.023 97.406  1.00 40.28  ? 123 GLU B O   1 
ATOM   3660  C CB  . GLU B  2  123 ? 147.182 177.976 98.437  1.00 40.28  ? 123 GLU B CB  1 
ATOM   3661  C CG  . GLU B  2  123 ? 146.676 179.091 97.543  1.00 40.28  ? 123 GLU B CG  1 
ATOM   3662  C CD  . GLU B  2  123 ? 147.782 180.007 97.068  1.00 40.28  ? 123 GLU B CD  1 
ATOM   3663  O OE1 . GLU B  2  123 ? 148.951 179.761 97.426  1.00 40.28  ? 123 GLU B OE1 1 
ATOM   3664  O OE2 . GLU B  2  123 ? 147.483 180.974 96.335  1.00 40.28  ? 123 GLU B OE2 1 
ATOM   3665  N N   . ASP B  2  124 ? 145.720 175.290 97.374  1.00 42.90  ? 124 ASP B N   1 
ATOM   3666  C CA  . ASP B  2  124 ? 144.998 174.626 96.295  1.00 42.90  ? 124 ASP B CA  1 
ATOM   3667  C C   . ASP B  2  124 ? 143.627 174.155 96.763  1.00 42.90  ? 124 ASP B C   1 
ATOM   3668  O O   . ASP B  2  124 ? 142.638 174.278 96.032  1.00 42.90  ? 124 ASP B O   1 
ATOM   3669  C CB  . ASP B  2  124 ? 145.825 173.452 95.773  1.00 42.90  ? 124 ASP B CB  1 
ATOM   3670  C CG  . ASP B  2  124 ? 145.295 172.894 94.469  1.00 42.90  ? 124 ASP B CG  1 
ATOM   3671  O OD1 . ASP B  2  124 ? 144.288 173.420 93.952  1.00 42.90  ? 124 ASP B OD1 1 
ATOM   3672  O OD2 . ASP B  2  124 ? 145.889 171.920 93.960  1.00 42.90  ? 124 ASP B OD2 1 
ATOM   3673  N N   . GLY B  2  125 ? 143.547 173.630 97.980  1.00 32.43  ? 125 GLY B N   1 
ATOM   3674  C CA  . GLY B  2  125 ? 142.314 173.080 98.500  1.00 32.43  ? 125 GLY B CA  1 
ATOM   3675  C C   . GLY B  2  125 ? 142.534 171.703 99.087  1.00 32.43  ? 125 GLY B C   1 
ATOM   3676  O O   . GLY B  2  125 ? 141.587 171.034 99.500  1.00 32.43  ? 125 GLY B O   1 
ATOM   3677  N N   . THR B  2  126 ? 143.790 171.272 99.127  1.00 30.47  ? 126 THR B N   1 
ATOM   3678  C CA  . THR B  2  126 ? 144.136 169.959 99.651  1.00 30.47  ? 126 THR B CA  1 
ATOM   3679  C C   . THR B  2  126 ? 144.213 170.023 101.168 1.00 30.47  ? 126 THR B C   1 
ATOM   3680  O O   . THR B  2  126 ? 144.935 170.858 101.720 1.00 30.47  ? 126 THR B O   1 
ATOM   3681  C CB  . THR B  2  126 ? 145.468 169.487 99.074  1.00 30.47  ? 126 THR B CB  1 
ATOM   3682  O OG1 . THR B  2  126 ? 145.364 169.373 97.651  1.00 30.47  ? 126 THR B OG1 1 
ATOM   3683  C CG2 . THR B  2  126 ? 145.850 168.143 99.657  1.00 30.47  ? 126 THR B CG2 1 
ATOM   3684  N N   . LEU B  2  127 ? 143.484 169.144 101.841 1.00 33.30  ? 127 LEU B N   1 
ATOM   3685  C CA  . LEU B  2  127 ? 143.464 169.110 103.294 1.00 33.30  ? 127 LEU B CA  1 
ATOM   3686  C C   . LEU B  2  127 ? 144.327 167.980 103.834 1.00 33.30  ? 127 LEU B C   1 
ATOM   3687  O O   . LEU B  2  127 ? 144.693 167.043 103.124 1.00 33.30  ? 127 LEU B O   1 
ATOM   3688  C CB  . LEU B  2  127 ? 142.040 168.946 103.817 1.00 33.30  ? 127 LEU B CB  1 
ATOM   3689  C CG  . LEU B  2  127 ? 141.163 170.184 103.895 1.00 33.30  ? 127 LEU B CG  1 
ATOM   3690  C CD1 . LEU B  2  127 ? 140.734 170.620 102.523 1.00 33.30  ? 127 LEU B CD1 1 
ATOM   3691  C CD2 . LEU B  2  127 ? 139.963 169.888 104.758 1.00 33.30  ? 127 LEU B CD2 1 
ATOM   3692  N N   . LEU B  2  128 ? 144.651 168.091 105.116 1.00 43.48  ? 128 LEU B N   1 
ATOM   3693  C CA  . LEU B  2  128 ? 145.226 167.006 105.894 1.00 43.48  ? 128 LEU B CA  1 
ATOM   3694  C C   . LEU B  2  128 ? 144.538 167.046 107.244 1.00 43.48  ? 128 LEU B C   1 
ATOM   3695  O O   . LEU B  2  128 ? 144.421 168.118 107.841 1.00 43.48  ? 128 LEU B O   1 
ATOM   3696  C CB  . LEU B  2  128 ? 146.739 167.158 106.053 1.00 43.48  ? 128 LEU B CB  1 
ATOM   3697  C CG  . LEU B  2  128 ? 147.485 166.036 106.774 1.00 43.48  ? 128 LEU B CG  1 
ATOM   3698  C CD1 . LEU B  2  128 ? 147.434 164.762 105.962 1.00 43.48  ? 128 LEU B CD1 1 
ATOM   3699  C CD2 . LEU B  2  128 ? 148.919 166.434 107.040 1.00 43.48  ? 128 LEU B CD2 1 
ATOM   3700  N N   . TYR B  2  129 ? 144.068 165.899 107.716 1.00 43.48  ? 129 TYR B N   1 
ATOM   3701  C CA  . TYR B  2  129 ? 143.239 165.835 108.922 1.00 43.48  ? 129 TYR B CA  1 
ATOM   3702  C C   . TYR B  2  129 ? 143.643 164.582 109.685 1.00 43.48  ? 129 TYR B C   1 
ATOM   3703  O O   . TYR B  2  129 ? 143.089 163.507 109.457 1.00 43.48  ? 129 TYR B O   1 
ATOM   3704  C CB  . TYR B  2  129 ? 141.768 165.816 108.552 1.00 43.48  ? 129 TYR B CB  1 
ATOM   3705  C CG  . TYR B  2  129 ? 140.816 165.701 109.711 1.00 43.48  ? 129 TYR B CG  1 
ATOM   3706  C CD1 . TYR B  2  129 ? 140.524 166.792 110.502 1.00 43.48  ? 129 TYR B CD1 1 
ATOM   3707  C CD2 . TYR B  2  129 ? 140.193 164.501 110.000 1.00 43.48  ? 129 TYR B CD2 1 
ATOM   3708  C CE1 . TYR B  2  129 ? 139.644 166.689 111.551 1.00 43.48  ? 129 TYR B CE1 1 
ATOM   3709  C CE2 . TYR B  2  129 ? 139.312 164.388 111.046 1.00 43.48  ? 129 TYR B CE2 1 
ATOM   3710  C CZ  . TYR B  2  129 ? 139.042 165.483 111.818 1.00 43.48  ? 129 TYR B CZ  1 
ATOM   3711  O OH  . TYR B  2  129 ? 138.160 165.367 112.861 1.00 43.48  ? 129 TYR B OH  1 
ATOM   3712  N N   . THR B  2  130 ? 144.627 164.729 110.558 1.00 25.09  ? 130 THR B N   1 
ATOM   3713  C CA  . THR B  2  130 ? 145.142 163.617 111.339 1.00 25.09  ? 130 THR B CA  1 
ATOM   3714  C C   . THR B  2  130 ? 144.545 163.560 112.734 1.00 25.09  ? 130 THR B C   1 
ATOM   3715  O O   . THR B  2  130 ? 144.130 164.567 113.277 1.00 25.09  ? 130 THR B O   1 
ATOM   3716  C CB  . THR B  2  130 ? 146.690 163.643 111.392 1.00 25.09  ? 130 THR B CB  1 
ATOM   3717  O OG1 . THR B  2  130 ? 147.160 163.371 112.718 1.00 25.09  ? 130 THR B OG1 1 
ATOM   3718  C CG2 . THR B  2  130 ? 147.215 164.992 110.978 1.00 25.09  ? 130 THR B CG2 1 
ATOM   3719  N N   . MET B  2  131 ? 144.531 162.372 113.317 1.00 31.79  ? 131 MET B N   1 
ATOM   3720  C CA  . MET B  2  131 ? 143.996 162.185 114.657 1.00 31.79  ? 131 MET B CA  1 
ATOM   3721  C C   . MET B  2  131 ? 145.002 161.430 115.511 1.00 31.79  ? 131 MET B C   1 
ATOM   3722  O O   . MET B  2  131 ? 146.157 161.274 115.113 1.00 31.79  ? 131 MET B O   1 
ATOM   3723  C CB  . MET B  2  131 ? 142.673 161.426 114.600 1.00 31.79  ? 131 MET B CB  1 
ATOM   3724  C CG  . MET B  2  131 ? 141.597 162.136 113.816 1.00 31.79  ? 131 MET B CG  1 
ATOM   3725  S SD  . MET B  2  131 ? 140.040 161.241 113.780 1.00 31.79  ? 131 MET B SD  1 
ATOM   3726  C CE  . MET B  2  131 ? 139.466 161.521 115.452 1.00 31.79  ? 131 MET B CE  1 
ATOM   3727  N N   . ARG B  2  132 ? 144.589 160.981 116.692 1.00 43.48  ? 132 ARG B N   1 
ATOM   3728  C CA  . ARG B  2  132 ? 145.367 160.020 117.460 1.00 43.48  ? 132 ARG B CA  1 
ATOM   3729  C C   . ARG B  2  132 ? 144.385 159.046 118.079 1.00 43.48  ? 132 ARG B C   1 
ATOM   3730  O O   . ARG B  2  132 ? 143.437 159.463 118.745 1.00 43.48  ? 132 ARG B O   1 
ATOM   3731  C CB  . ARG B  2  132 ? 146.225 160.693 118.537 1.00 43.48  ? 132 ARG B CB  1 
ATOM   3732  C CG  . ARG B  2  132 ? 147.180 159.743 119.253 1.00 43.48  ? 132 ARG B CG  1 
ATOM   3733  C CD  . ARG B  2  132 ? 148.146 160.490 120.160 1.00 43.48  ? 132 ARG B CD  1 
ATOM   3734  N NE  . ARG B  2  132 ? 147.512 161.093 121.323 1.00 43.48  ? 132 ARG B NE  1 
ATOM   3735  C CZ  . ARG B  2  132 ? 147.348 160.471 122.484 1.00 43.48  ? 132 ARG B CZ  1 
ATOM   3736  N NH1 . ARG B  2  132 ? 147.779 159.227 122.634 1.00 43.48  ? 132 ARG B NH1 1 
ATOM   3737  N NH2 . ARG B  2  132 ? 146.762 161.097 123.494 1.00 43.48  ? 132 ARG B NH2 1 
ATOM   3738  N N   . LEU B  2  133 ? 144.600 157.757 117.850 1.00 43.48  ? 133 LEU B N   1 
ATOM   3739  C CA  . LEU B  2  133 ? 143.646 156.734 118.241 1.00 43.48  ? 133 LEU B CA  1 
ATOM   3740  C C   . LEU B  2  133 ? 144.338 155.674 119.077 1.00 43.48  ? 133 LEU B C   1 
ATOM   3741  O O   . LEU B  2  133 ? 145.538 155.434 118.935 1.00 43.48  ? 133 LEU B O   1 
ATOM   3742  C CB  . LEU B  2  133 ? 143.017 156.074 117.021 1.00 43.48  ? 133 LEU B CB  1 
ATOM   3743  C CG  . LEU B  2  133 ? 142.192 156.984 116.127 1.00 43.48  ? 133 LEU B CG  1 
ATOM   3744  C CD1 . LEU B  2  133 ? 141.743 156.226 114.905 1.00 43.48  ? 133 LEU B CD1 1 
ATOM   3745  C CD2 . LEU B  2  133 ? 141.009 157.495 116.894 1.00 43.48  ? 133 LEU B CD2 1 
ATOM   3746  N N   . THR B  2  134 ? 143.569 155.042 119.955 1.00 29.67  ? 134 THR B N   1 
ATOM   3747  C CA  . THR B  2  134 ? 143.988 153.819 120.630 1.00 29.67  ? 134 THR B CA  1 
ATOM   3748  C C   . THR B  2  134 ? 142.871 152.809 120.438 1.00 29.67  ? 134 THR B C   1 
ATOM   3749  O O   . THR B  2  134 ? 141.762 153.005 120.941 1.00 29.67  ? 134 THR B O   1 
ATOM   3750  C CB  . THR B  2  134 ? 144.278 154.052 122.108 1.00 29.67  ? 134 THR B CB  1 
ATOM   3751  O OG1 . THR B  2  134 ? 145.423 154.900 122.235 1.00 29.67  ? 134 THR B OG1 1 
ATOM   3752  C CG2 . THR B  2  134 ? 144.549 152.738 122.809 1.00 29.67  ? 134 THR B CG2 1 
ATOM   3753  N N   . VAL B  2  135 ? 143.160 151.737 119.712 1.00 43.48  ? 135 VAL B N   1 
ATOM   3754  C CA  . VAL B  2  135 ? 142.139 150.854 119.172 1.00 43.48  ? 135 VAL B CA  1 
ATOM   3755  C C   . VAL B  2  135 ? 142.297 149.471 119.776 1.00 43.48  ? 135 VAL B C   1 
ATOM   3756  O O   . VAL B  2  135 ? 143.394 148.903 119.758 1.00 43.48  ? 135 VAL B O   1 
ATOM   3757  C CB  . VAL B  2  135 ? 142.228 150.784 117.643 1.00 43.48  ? 135 VAL B CB  1 
ATOM   3758  C CG1 . VAL B  2  135 ? 141.202 149.820 117.106 1.00 43.48  ? 135 VAL B CG1 1 
ATOM   3759  C CG2 . VAL B  2  135 ? 142.053 152.156 117.072 1.00 43.48  ? 135 VAL B CG2 1 
ATOM   3760  N N   . ARG B  2  136 ? 141.207 148.936 120.317 1.00 30.71  ? 136 ARG B N   1 
ATOM   3761  C CA  . ARG B  2  136 ? 141.171 147.561 120.807 1.00 30.71  ? 136 ARG B CA  1 
ATOM   3762  C C   . ARG B  2  136 ? 140.511 146.656 119.770 1.00 30.71  ? 136 ARG B C   1 
ATOM   3763  O O   . ARG B  2  136 ? 139.435 146.101 119.977 1.00 30.71  ? 136 ARG B O   1 
ATOM   3764  C CB  . ARG B  2  136 ? 140.438 147.492 122.139 1.00 30.71  ? 136 ARG B CB  1 
ATOM   3765  C CG  . ARG B  2  136 ? 141.184 148.068 123.314 1.00 30.71  ? 136 ARG B CG  1 
ATOM   3766  C CD  . ARG B  2  136 ? 140.304 147.980 124.538 1.00 30.71  ? 136 ARG B CD  1 
ATOM   3767  N NE  . ARG B  2  136 ? 139.973 146.594 124.845 1.00 30.71  ? 136 ARG B NE  1 
ATOM   3768  C CZ  . ARG B  2  136 ? 139.044 146.226 125.719 1.00 30.71  ? 136 ARG B CZ  1 
ATOM   3769  N NH1 . ARG B  2  136 ? 138.346 147.143 126.374 1.00 30.71  ? 136 ARG B NH1 1 
ATOM   3770  N NH2 . ARG B  2  136 ? 138.807 144.941 125.932 1.00 30.71  ? 136 ARG B NH2 1 
ATOM   3771  N N   . ALA B  2  137 ? 141.181 146.512 118.634 1.00 30.92  ? 137 ALA B N   1 
ATOM   3772  C CA  . ALA B  2  137 ? 140.674 145.621 117.605 1.00 30.92  ? 137 ALA B CA  1 
ATOM   3773  C C   . ALA B  2  137 ? 140.765 144.170 118.063 1.00 30.92  ? 137 ALA B C   1 
ATOM   3774  O O   . ALA B  2  137 ? 141.530 143.823 118.965 1.00 30.92  ? 137 ALA B O   1 
ATOM   3775  C CB  . ALA B  2  137 ? 141.446 145.808 116.302 1.00 30.92  ? 137 ALA B CB  1 
ATOM   3776  N N   . GLU B  2  138 ? 139.964 143.317 117.435 1.00 41.27  ? 138 GLU B N   1 
ATOM   3777  C CA  . GLU B  2  138 ? 139.961 141.894 117.735 1.00 41.27  ? 138 GLU B CA  1 
ATOM   3778  C C   . GLU B  2  138 ? 140.395 141.108 116.509 1.00 41.27  ? 138 GLU B C   1 
ATOM   3779  O O   . GLU B  2  138 ? 140.178 141.532 115.371 1.00 41.27  ? 138 GLU B O   1 
ATOM   3780  C CB  . GLU B  2  138 ? 138.582 141.408 118.186 1.00 41.27  ? 138 GLU B CB  1 
ATOM   3781  C CG  . GLU B  2  138 ? 137.537 141.406 117.091 1.00 41.27  ? 138 GLU B CG  1 
ATOM   3782  C CD  . GLU B  2  138 ? 136.177 140.969 117.588 1.00 41.27  ? 138 GLU B CD  1 
ATOM   3783  O OE1 . GLU B  2  138 ? 136.051 140.680 118.796 1.00 41.27  ? 138 GLU B OE1 1 
ATOM   3784  O OE2 . GLU B  2  138 ? 135.232 140.918 116.774 1.00 41.27  ? 138 GLU B OE2 1 
ATOM   3785  N N   . CYS B  2  139 ? 141.017 139.957 116.753 1.00 51.53  ? 139 CYS B N   1 
ATOM   3786  C CA  . CYS B  2  139 ? 141.492 139.093 115.692 1.00 51.53  ? 139 CYS B CA  1 
ATOM   3787  C C   . CYS B  2  139 ? 141.273 137.641 116.085 1.00 51.53  ? 139 CYS B C   1 
ATOM   3788  O O   . CYS B  2  139 ? 141.554 137.259 117.230 1.00 51.53  ? 139 CYS B O   1 
ATOM   3789  C CB  . CYS B  2  139 ? 142.978 139.329 115.391 1.00 51.53  ? 139 CYS B CB  1 
ATOM   3790  S SG  . CYS B  2  139 ? 144.127 138.969 116.745 1.00 51.53  ? 139 CYS B SG  1 
ATOM   3791  N N   . PRO B  2  140 ? 140.768 136.816 115.171 1.00 62.33  ? 140 PRO B N   1 
ATOM   3792  C CA  . PRO B  2  140 ? 140.620 135.390 115.477 1.00 62.33  ? 140 PRO B CA  1 
ATOM   3793  C C   . PRO B  2  140 ? 141.972 134.699 115.469 1.00 62.33  ? 140 PRO B C   1 
ATOM   3794  O O   . PRO B  2  140 ? 142.843 135.010 114.655 1.00 62.33  ? 140 PRO B O   1 
ATOM   3795  C CB  . PRO B  2  140 ? 139.722 134.878 114.348 1.00 62.33  ? 140 PRO B CB  1 
ATOM   3796  C CG  . PRO B  2  140 ? 140.013 135.798 113.213 1.00 62.33  ? 140 PRO B CG  1 
ATOM   3797  C CD  . PRO B  2  140 ? 140.276 137.148 113.824 1.00 62.33  ? 140 PRO B CD  1 
ATOM   3798  N N   . MET B  2  141 ? 142.141 133.753 116.386 1.00 64.84  ? 141 MET B N   1 
ATOM   3799  C CA  . MET B  2  141 ? 143.393 133.033 116.541 1.00 64.84  ? 141 MET B CA  1 
ATOM   3800  C C   . MET B  2  141 ? 143.166 131.544 116.334 1.00 64.84  ? 141 MET B C   1 
ATOM   3801  O O   . MET B  2  141 ? 142.119 131.007 116.708 1.00 64.84  ? 141 MET B O   1 
ATOM   3802  C CB  . MET B  2  141 ? 144.001 133.276 117.923 1.00 64.84  ? 141 MET B CB  1 
ATOM   3803  C CG  . MET B  2  141 ? 144.474 134.696 118.152 1.00 64.84  ? 141 MET B CG  1 
ATOM   3804  S SD  . MET B  2  141 ? 145.224 134.911 119.775 1.00 64.84  ? 141 MET B SD  1 
ATOM   3805  C CE  . MET B  2  141 ? 145.597 136.659 119.728 1.00 64.84  ? 141 MET B CE  1 
ATOM   3806  N N   . HIS B  2  142 ? 144.148 130.884 115.730 1.00 66.50  ? 142 HIS B N   1 
ATOM   3807  C CA  . HIS B  2  142 ? 144.160 129.435 115.581 1.00 66.50  ? 142 HIS B CA  1 
ATOM   3808  C C   . HIS B  2  142 ? 145.306 128.898 116.428 1.00 66.50  ? 142 HIS B C   1 
ATOM   3809  O O   . HIS B  2  142 ? 146.478 129.088 116.087 1.00 66.50  ? 142 HIS B O   1 
ATOM   3810  C CB  . HIS B  2  142 ? 144.314 129.032 114.118 1.00 66.50  ? 142 HIS B CB  1 
ATOM   3811  C CG  . HIS B  2  142 ? 143.151 129.423 113.261 1.00 66.50  ? 142 HIS B CG  1 
ATOM   3812  N ND1 . HIS B  2  142 ? 141.946 128.756 113.295 1.00 66.50  ? 142 HIS B ND1 1 
ATOM   3813  C CD2 . HIS B  2  142 ? 143.010 130.411 112.347 1.00 66.50  ? 142 HIS B CD2 1 
ATOM   3814  C CE1 . HIS B  2  142 ? 141.111 129.317 112.439 1.00 66.50  ? 142 HIS B CE1 1 
ATOM   3815  N NE2 . HIS B  2  142 ? 141.732 130.324 111.851 1.00 66.50  ? 142 HIS B NE2 1 
ATOM   3816  N N   . LEU B  2  143 ? 144.968 128.231 117.528 1.00 69.18  ? 143 LEU B N   1 
ATOM   3817  C CA  . LEU B  2  143 ? 145.956 127.760 118.486 1.00 69.18  ? 143 LEU B CA  1 
ATOM   3818  C C   . LEU B  2  143 ? 146.327 126.298 118.272 1.00 69.18  ? 143 LEU B C   1 
ATOM   3819  O O   . LEU B  2  143 ? 146.893 125.670 119.172 1.00 69.18  ? 143 LEU B O   1 
ATOM   3820  C CB  . LEU B  2  143 ? 145.446 127.977 119.908 1.00 69.18  ? 143 LEU B CB  1 
ATOM   3821  C CG  . LEU B  2  143 ? 145.240 129.443 120.278 1.00 69.18  ? 143 LEU B CG  1 
ATOM   3822  C CD1 . LEU B  2  143 ? 144.641 129.567 121.668 1.00 69.18  ? 143 LEU B CD1 1 
ATOM   3823  C CD2 . LEU B  2  143 ? 146.550 130.203 120.173 1.00 69.18  ? 143 LEU B CD2 1 
ATOM   3824  N N   . GLU B  2  144 ? 146.024 125.745 117.096 1.00 70.69  ? 144 GLU B N   1 
ATOM   3825  C CA  . GLU B  2  144 ? 146.344 124.347 116.831 1.00 70.69  ? 144 GLU B CA  1 
ATOM   3826  C C   . GLU B  2  144 ? 147.845 124.096 116.859 1.00 70.69  ? 144 GLU B C   1 
ATOM   3827  O O   . GLU B  2  144 ? 148.280 122.983 117.169 1.00 70.69  ? 144 GLU B O   1 
ATOM   3828  C CB  . GLU B  2  144 ? 145.759 123.928 115.485 1.00 70.69  ? 144 GLU B CB  1 
ATOM   3829  C CG  . GLU B  2  144 ? 144.243 123.888 115.465 1.00 70.69  ? 144 GLU B CG  1 
ATOM   3830  C CD  . GLU B  2  144 ? 143.686 123.539 114.103 1.00 70.69  ? 144 GLU B CD  1 
ATOM   3831  O OE1 . GLU B  2  144 ? 144.475 123.484 113.137 1.00 70.69  ? 144 GLU B OE1 1 
ATOM   3832  O OE2 . GLU B  2  144 ? 142.462 123.315 113.999 1.00 70.69  ? 144 GLU B OE2 1 
ATOM   3833  N N   . ASP B  2  145 ? 148.649 125.110 116.546 1.00 69.58  ? 145 ASP B N   1 
ATOM   3834  C CA  . ASP B  2  145 ? 150.099 124.983 116.541 1.00 69.58  ? 145 ASP B CA  1 
ATOM   3835  C C   . ASP B  2  145 ? 150.736 125.564 117.796 1.00 69.58  ? 145 ASP B C   1 
ATOM   3836  O O   . ASP B  2  145 ? 151.933 125.870 117.790 1.00 69.58  ? 145 ASP B O   1 
ATOM   3837  C CB  . ASP B  2  145 ? 150.680 125.653 115.296 1.00 69.58  ? 145 ASP B CB  1 
ATOM   3838  C CG  . ASP B  2  145 ? 150.280 124.949 114.017 1.00 69.58  ? 145 ASP B CG  1 
ATOM   3839  O OD1 . ASP B  2  145 ? 150.033 123.725 114.062 1.00 69.58  ? 145 ASP B OD1 1 
ATOM   3840  O OD2 . ASP B  2  145 ? 150.213 125.618 112.965 1.00 69.58  ? 145 ASP B OD2 1 
ATOM   3841  N N   . PHE B  2  146 ? 149.961 125.734 118.860 1.00 63.53  ? 146 PHE B N   1 
ATOM   3842  C CA  . PHE B  2  146 ? 150.484 126.328 120.080 1.00 63.53  ? 146 PHE B CA  1 
ATOM   3843  C C   . PHE B  2  146 ? 151.587 125.448 120.660 1.00 63.53  ? 146 PHE B C   1 
ATOM   3844  O O   . PHE B  2  146 ? 151.452 124.222 120.683 1.00 63.53  ? 146 PHE B O   1 
ATOM   3845  C CB  . PHE B  2  146 ? 149.363 126.500 121.103 1.00 63.53  ? 146 PHE B CB  1 
ATOM   3846  C CG  . PHE B  2  146 ? 149.797 127.169 122.368 1.00 63.53  ? 146 PHE B CG  1 
ATOM   3847  C CD1 . PHE B  2  146 ? 149.968 128.538 122.417 1.00 63.53  ? 146 PHE B CD1 1 
ATOM   3848  C CD2 . PHE B  2  146 ? 150.040 126.427 123.506 1.00 63.53  ? 146 PHE B CD2 1 
ATOM   3849  C CE1 . PHE B  2  146 ? 150.373 129.155 123.580 1.00 63.53  ? 146 PHE B CE1 1 
ATOM   3850  C CE2 . PHE B  2  146 ? 150.442 127.040 124.674 1.00 63.53  ? 146 PHE B CE2 1 
ATOM   3851  C CZ  . PHE B  2  146 ? 150.608 128.404 124.711 1.00 63.53  ? 146 PHE B CZ  1 
ATOM   3852  N N   . PRO B  2  147 ? 152.686 126.033 121.151 1.00 57.40  ? 147 PRO B N   1 
ATOM   3853  C CA  . PRO B  2  147 ? 152.997 127.462 121.204 1.00 57.40  ? 147 PRO B CA  1 
ATOM   3854  C C   . PRO B  2  147 ? 153.701 127.977 119.956 1.00 57.40  ? 147 PRO B C   1 
ATOM   3855  O O   . PRO B  2  147 ? 154.017 129.160 119.869 1.00 57.40  ? 147 PRO B O   1 
ATOM   3856  C CB  . PRO B  2  147 ? 153.932 127.558 122.405 1.00 57.40  ? 147 PRO B CB  1 
ATOM   3857  C CG  . PRO B  2  147 ? 154.635 126.265 122.409 1.00 57.40  ? 147 PRO B CG  1 
ATOM   3858  C CD  . PRO B  2  147 ? 153.640 125.244 121.950 1.00 57.40  ? 147 PRO B CD  1 
ATOM   3859  N N   . MET B  2  148 ? 153.934 127.095 118.992 1.00 60.16  ? 148 MET B N   1 
ATOM   3860  C CA  . MET B  2  148 ? 154.752 127.412 117.833 1.00 60.16  ? 148 MET B CA  1 
ATOM   3861  C C   . MET B  2  148 ? 153.944 128.015 116.689 1.00 60.16  ? 148 MET B C   1 
ATOM   3862  O O   . MET B  2  148 ? 154.344 127.894 115.526 1.00 60.16  ? 148 MET B O   1 
ATOM   3863  C CB  . MET B  2  148 ? 155.483 126.152 117.380 1.00 60.16  ? 148 MET B CB  1 
ATOM   3864  C CG  . MET B  2  148 ? 156.420 125.629 118.450 1.00 60.16  ? 148 MET B CG  1 
ATOM   3865  S SD  . MET B  2  148 ? 157.144 124.034 118.055 1.00 60.16  ? 148 MET B SD  1 
ATOM   3866  C CE  . MET B  2  148 ? 158.195 124.489 116.687 1.00 60.16  ? 148 MET B CE  1 
ATOM   3867  N N   . ASP B  2  149 ? 152.827 128.665 116.999 1.00 57.49  ? 149 ASP B N   1 
ATOM   3868  C CA  . ASP B  2  149 ? 151.925 129.211 115.999 1.00 57.49  ? 149 ASP B CA  1 
ATOM   3869  C C   . ASP B  2  149 ? 152.387 130.581 115.516 1.00 57.49  ? 149 ASP B C   1 
ATOM   3870  O O   . ASP B  2  149 ? 153.209 131.251 116.145 1.00 57.49  ? 149 ASP B O   1 
ATOM   3871  C CB  . ASP B  2  149 ? 150.512 129.316 116.567 1.00 57.49  ? 149 ASP B CB  1 
ATOM   3872  C CG  . ASP B  2  149 ? 150.449 130.179 117.813 1.00 57.49  ? 149 ASP B CG  1 
ATOM   3873  O OD1 . ASP B  2  149 ? 151.511 130.641 118.280 1.00 57.49  ? 149 ASP B OD1 1 
ATOM   3874  O OD2 . ASP B  2  149 ? 149.335 130.391 118.334 1.00 57.49  ? 149 ASP B OD2 1 
ATOM   3875  N N   . ALA B  2  150 ? 151.833 130.996 114.380 1.00 40.29  ? 150 ALA B N   1 
ATOM   3876  C CA  . ALA B  2  150 ? 152.044 132.329 113.833 1.00 40.29  ? 150 ALA B CA  1 
ATOM   3877  C C   . ALA B  2  150 ? 150.694 132.901 113.436 1.00 40.29  ? 150 ALA B C   1 
ATOM   3878  O O   . ALA B  2  150 ? 149.966 132.287 112.651 1.00 40.29  ? 150 ALA B O   1 
ATOM   3879  C CB  . ALA B  2  150 ? 152.988 132.299 112.629 1.00 40.29  ? 150 ALA B CB  1 
ATOM   3880  N N   . HIS B  2  151 ? 150.363 134.066 113.974 1.00 41.02  ? 151 HIS B N   1 
ATOM   3881  C CA  . HIS B  2  151 ? 149.063 134.677 113.756 1.00 41.02  ? 151 HIS B CA  1 
ATOM   3882  C C   . HIS B  2  151 ? 149.115 135.685 112.618 1.00 41.02  ? 151 HIS B C   1 
ATOM   3883  O O   . HIS B  2  151 ? 150.176 136.025 112.092 1.00 41.02  ? 151 HIS B O   1 
ATOM   3884  C CB  . HIS B  2  151 ? 148.572 135.370 115.024 1.00 41.02  ? 151 HIS B CB  1 
ATOM   3885  C CG  . HIS B  2  151 ? 148.327 134.442 116.166 1.00 41.02  ? 151 HIS B CG  1 
ATOM   3886  N ND1 . HIS B  2  151 ? 149.292 134.146 117.103 1.00 41.02  ? 151 HIS B ND1 1 
ATOM   3887  C CD2 . HIS B  2  151 ? 147.228 133.739 116.522 1.00 41.02  ? 151 HIS B CD2 1 
ATOM   3888  C CE1 . HIS B  2  151 ? 148.795 133.306 117.992 1.00 41.02  ? 151 HIS B CE1 1 
ATOM   3889  N NE2 . HIS B  2  151 ? 147.544 133.042 117.662 1.00 41.02  ? 151 HIS B NE2 1 
ATOM   3890  N N   . ALA B  2  152 ? 147.931 136.160 112.240 1.00 35.01  ? 152 ALA B N   1 
ATOM   3891  C CA  . ALA B  2  152 ? 147.779 137.301 111.337 1.00 35.01  ? 152 ALA B CA  1 
ATOM   3892  C C   . ALA B  2  152 ? 146.552 138.068 111.820 1.00 35.01  ? 152 ALA B C   1 
ATOM   3893  O O   . ALA B  2  152 ? 145.428 137.775 111.406 1.00 35.01  ? 152 ALA B O   1 
ATOM   3894  C CB  . ALA B  2  152 ? 147.639 136.857 109.890 1.00 35.01  ? 152 ALA B CB  1 
ATOM   3895  N N   . CYS B  2  153 ? 146.772 139.046 112.700 1.00 36.26  ? 153 CYS B N   1 
ATOM   3896  C CA  . CYS B  2  153 ? 145.675 139.821 113.260 1.00 36.26  ? 153 CYS B CA  1 
ATOM   3897  C C   . CYS B  2  153 ? 145.411 141.029 112.379 1.00 36.26  ? 153 CYS B C   1 
ATOM   3898  O O   . CYS B  2  153 ? 146.268 141.921 112.298 1.00 36.26  ? 153 CYS B O   1 
ATOM   3899  C CB  . CYS B  2  153 ? 145.986 140.254 114.684 1.00 36.26  ? 153 CYS B CB  1 
ATOM   3900  S SG  . CYS B  2  153 ? 145.972 138.903 115.884 1.00 36.26  ? 153 CYS B SG  1 
ATOM   3901  N N   . PRO B  2  154 ? 144.264 141.111 111.716 1.00 26.78  ? 154 PRO B N   1 
ATOM   3902  C CA  . PRO B  2  154 ? 144.031 142.177 110.744 1.00 26.78  ? 154 PRO B CA  1 
ATOM   3903  C C   . PRO B  2  154 ? 143.455 143.435 111.378 1.00 26.78  ? 154 PRO B C   1 
ATOM   3904  O O   . PRO B  2  154 ? 143.036 143.453 112.535 1.00 26.78  ? 154 PRO B O   1 
ATOM   3905  C CB  . PRO B  2  154 ? 143.011 141.544 109.790 1.00 26.78  ? 154 PRO B CB  1 
ATOM   3906  C CG  . PRO B  2  154 ? 142.236 140.644 110.661 1.00 26.78  ? 154 PRO B CG  1 
ATOM   3907  C CD  . PRO B  2  154 ? 143.203 140.094 111.674 1.00 26.78  ? 154 PRO B CD  1 
ATOM   3908  N N   . LEU B  2  155 ? 143.467 144.500 110.586 1.00 16.38  ? 155 LEU B N   1 
ATOM   3909  C CA  . LEU B  2  155 ? 142.862 145.779 110.938 1.00 16.38  ? 155 LEU B CA  1 
ATOM   3910  C C   . LEU B  2  155 ? 142.180 146.310 109.687 1.00 16.38  ? 155 LEU B C   1 
ATOM   3911  O O   . LEU B  2  155 ? 142.854 146.647 108.711 1.00 16.38  ? 155 LEU B O   1 
ATOM   3912  C CB  . LEU B  2  155 ? 143.911 146.762 111.448 1.00 16.38  ? 155 LEU B CB  1 
ATOM   3913  C CG  . LEU B  2  155 ? 143.375 148.115 111.889 1.00 16.38  ? 155 LEU B CG  1 
ATOM   3914  C CD1 . LEU B  2  155 ? 142.440 147.931 113.058 1.00 16.38  ? 155 LEU B CD1 1 
ATOM   3915  C CD2 . LEU B  2  155 ? 144.518 149.031 112.253 1.00 16.38  ? 155 LEU B CD2 1 
ATOM   3916  N N   . LYS B  2  156 ? 140.853 146.372 109.698 1.00 16.54  ? 156 LYS B N   1 
ATOM   3917  C CA  . LYS B  2  156 ? 140.088 146.722 108.505 1.00 16.54  ? 156 LYS B CA  1 
ATOM   3918  C C   . LYS B  2  156 ? 139.296 147.993 108.771 1.00 16.54  ? 156 LYS B C   1 
ATOM   3919  O O   . LYS B  2  156 ? 138.286 147.961 109.477 1.00 16.54  ? 156 LYS B O   1 
ATOM   3920  C CB  . LYS B  2  156 ? 139.163 145.580 108.096 1.00 16.54  ? 156 LYS B CB  1 
ATOM   3921  C CG  . LYS B  2  156 ? 139.897 144.362 107.574 1.00 16.54  ? 156 LYS B CG  1 
ATOM   3922  C CD  . LYS B  2  156 ? 138.942 143.325 107.010 1.00 16.54  ? 156 LYS B CD  1 
ATOM   3923  C CE  . LYS B  2  156 ? 138.650 142.226 108.011 1.00 16.54  ? 156 LYS B CE  1 
ATOM   3924  N NZ  . LYS B  2  156 ? 137.738 142.678 109.086 1.00 16.54  ? 156 LYS B NZ  1 
ATOM   3925  N N   . PHE B  2  157 ? 139.741 149.103 108.191 1.00 34.74  ? 157 PHE B N   1 
ATOM   3926  C CA  . PHE B  2  157 ? 139.056 150.381 108.317 1.00 34.74  ? 157 PHE B CA  1 
ATOM   3927  C C   . PHE B  2  157 ? 138.467 150.755 106.969 1.00 34.74  ? 157 PHE B C   1 
ATOM   3928  O O   . PHE B  2  157 ? 139.183 150.812 105.968 1.00 34.74  ? 157 PHE B O   1 
ATOM   3929  C CB  . PHE B  2  157 ? 139.997 151.472 108.825 1.00 34.74  ? 157 PHE B CB  1 
ATOM   3930  C CG  . PHE B  2  157 ? 141.138 151.779 107.910 1.00 34.74  ? 157 PHE B CG  1 
ATOM   3931  C CD1 . PHE B  2  157 ? 142.305 151.049 107.980 1.00 34.74  ? 157 PHE B CD1 1 
ATOM   3932  C CD2 . PHE B  2  157 ? 141.062 152.823 107.012 1.00 34.74  ? 157 PHE B CD2 1 
ATOM   3933  C CE1 . PHE B  2  157 ? 143.360 151.333 107.150 1.00 34.74  ? 157 PHE B CE1 1 
ATOM   3934  C CE2 . PHE B  2  157 ? 142.112 153.109 106.179 1.00 34.74  ? 157 PHE B CE2 1 
ATOM   3935  C CZ  . PHE B  2  157 ? 143.265 152.365 106.250 1.00 34.74  ? 157 PHE B CZ  1 
ATOM   3936  N N   . GLY B  2  158 ? 137.158 150.980 106.943 1.00 43.48  ? 158 GLY B N   1 
ATOM   3937  C CA  . GLY B  2  158 ? 136.470 151.363 105.730 1.00 43.48  ? 158 GLY B CA  1 
ATOM   3938  C C   . GLY B  2  158 ? 135.550 152.539 105.986 1.00 43.48  ? 158 GLY B C   1 
ATOM   3939  O O   . GLY B  2  158 ? 135.419 153.016 107.114 1.00 43.48  ? 158 GLY B O   1 
ATOM   3940  N N   . SER B  2  159 ? 134.916 152.993 104.912 1.00 21.76  ? 159 SER B N   1 
ATOM   3941  C CA  . SER B  2  159 ? 133.980 154.094 105.029 1.00 21.76  ? 159 SER B CA  1 
ATOM   3942  C C   . SER B  2  159 ? 132.712 153.624 105.727 1.00 21.76  ? 159 SER B C   1 
ATOM   3943  O O   . SER B  2  159 ? 132.565 152.458 106.096 1.00 21.76  ? 159 SER B O   1 
ATOM   3944  C CB  . SER B  2  159 ? 133.659 154.668 103.657 1.00 21.76  ? 159 SER B CB  1 
ATOM   3945  O OG  . SER B  2  159 ? 132.688 155.691 103.768 1.00 21.76  ? 159 SER B OG  1 
ATOM   3946  N N   . TYR B  2  160 ? 131.778 154.547 105.909 1.00 17.04  ? 160 TYR B N   1 
ATOM   3947  C CA  . TYR B  2  160 ? 130.494 154.213 106.499 1.00 17.04  ? 160 TYR B CA  1 
ATOM   3948  C C   . TYR B  2  160 ? 129.481 155.208 105.966 1.00 17.04  ? 160 TYR B C   1 
ATOM   3949  O O   . TYR B  2  160 ? 129.785 156.397 105.846 1.00 17.04  ? 160 TYR B O   1 
ATOM   3950  C CB  . TYR B  2  160 ? 130.558 154.252 108.028 1.00 17.04  ? 160 TYR B CB  1 
ATOM   3951  C CG  . TYR B  2  160 ? 129.351 153.683 108.739 1.00 17.04  ? 160 TYR B CG  1 
ATOM   3952  C CD1 . TYR B  2  160 ? 129.100 152.322 108.732 1.00 17.04  ? 160 TYR B CD1 1 
ATOM   3953  C CD2 . TYR B  2  160 ? 128.493 154.494 109.453 1.00 17.04  ? 160 TYR B CD2 1 
ATOM   3954  C CE1 . TYR B  2  160 ? 128.021 151.789 109.386 1.00 17.04  ? 160 TYR B CE1 1 
ATOM   3955  C CE2 . TYR B  2  160 ? 127.407 153.965 110.117 1.00 17.04  ? 160 TYR B CE2 1 
ATOM   3956  C CZ  . TYR B  2  160 ? 127.180 152.609 110.077 1.00 17.04  ? 160 TYR B CZ  1 
ATOM   3957  O OH  . TYR B  2  160 ? 126.104 152.054 110.724 1.00 17.04  ? 160 TYR B OH  1 
ATOM   3958  N N   . ALA B  2  161 ? 128.296 154.713 105.619 1.00 20.36  ? 161 ALA B N   1 
ATOM   3959  C CA  . ALA B  2  161 ? 127.205 155.465 105.007 1.00 20.36  ? 161 ALA B CA  1 
ATOM   3960  C C   . ALA B  2  161 ? 127.502 155.909 103.581 1.00 20.36  ? 161 ALA B C   1 
ATOM   3961  O O   . ALA B  2  161 ? 126.643 156.538 102.962 1.00 20.36  ? 161 ALA B O   1 
ATOM   3962  C CB  . ALA B  2  161 ? 126.811 156.702 105.825 1.00 20.36  ? 161 ALA B CB  1 
ATOM   3963  N N   . TYR B  2  162 ? 128.672 155.598 103.031 1.00 14.13  ? 162 TYR B N   1 
ATOM   3964  C CA  . TYR B  2  162 ? 129.018 155.973 101.666 1.00 14.13  ? 162 TYR B CA  1 
ATOM   3965  C C   . TYR B  2  162 ? 129.330 154.716 100.870 1.00 14.13  ? 162 TYR B C   1 
ATOM   3966  O O   . TYR B  2  162 ? 130.241 153.964 101.228 1.00 14.13  ? 162 TYR B O   1 
ATOM   3967  C CB  . TYR B  2  162 ? 130.212 156.925 101.636 1.00 14.13  ? 162 TYR B CB  1 
ATOM   3968  C CG  . TYR B  2  162 ? 129.954 158.274 102.256 1.00 14.13  ? 162 TYR B CG  1 
ATOM   3969  C CD1 . TYR B  2  162 ? 129.232 159.243 101.581 1.00 14.13  ? 162 TYR B CD1 1 
ATOM   3970  C CD2 . TYR B  2  162 ? 130.462 158.591 103.502 1.00 14.13  ? 162 TYR B CD2 1 
ATOM   3971  C CE1 . TYR B  2  162 ? 129.003 160.479 102.141 1.00 14.13  ? 162 TYR B CE1 1 
ATOM   3972  C CE2 . TYR B  2  162 ? 130.241 159.824 104.067 1.00 14.13  ? 162 TYR B CE2 1 
ATOM   3973  C CZ  . TYR B  2  162 ? 129.510 160.763 103.383 1.00 14.13  ? 162 TYR B CZ  1 
ATOM   3974  O OH  . TYR B  2  162 ? 129.290 161.994 103.947 1.00 14.13  ? 162 TYR B OH  1 
ATOM   3975  N N   . THR B  2  163 ? 128.590 154.499 99.787  1.00 22.27  ? 163 THR B N   1 
ATOM   3976  C CA  . THR B  2  163 ? 128.844 153.356 98.928  1.00 22.27  ? 163 THR B CA  1 
ATOM   3977  C C   . THR B  2  163 ? 130.137 153.571 98.144  1.00 22.27  ? 163 THR B C   1 
ATOM   3978  O O   . THR B  2  163 ? 130.823 154.584 98.284  1.00 22.27  ? 163 THR B O   1 
ATOM   3979  C CB  . THR B  2  163 ? 127.675 153.133 97.977  1.00 22.27  ? 163 THR B CB  1 
ATOM   3980  O OG1 . THR B  2  163 ? 127.563 154.257 97.099  1.00 22.27  ? 163 THR B OG1 1 
ATOM   3981  C CG2 . THR B  2  163 ? 126.385 152.992 98.751  1.00 22.27  ? 163 THR B CG2 1 
ATOM   3982  N N   . ARG B  2  164 ? 130.471 152.599 97.296  1.00 22.39  ? 164 ARG B N   1 
ATOM   3983  C CA  . ARG B  2  164 ? 131.685 152.704 96.500  1.00 22.39  ? 164 ARG B CA  1 
ATOM   3984  C C   . ARG B  2  164 ? 131.593 153.801 95.453  1.00 22.39  ? 164 ARG B C   1 
ATOM   3985  O O   . ARG B  2  164 ? 132.625 154.322 95.025  1.00 22.39  ? 164 ARG B O   1 
ATOM   3986  C CB  . ARG B  2  164 ? 131.982 151.371 95.818  1.00 22.39  ? 164 ARG B CB  1 
ATOM   3987  C CG  . ARG B  2  164 ? 133.309 151.322 95.088  1.00 22.39  ? 164 ARG B CG  1 
ATOM   3988  C CD  . ARG B  2  164 ? 133.469 150.007 94.359  1.00 22.39  ? 164 ARG B CD  1 
ATOM   3989  N NE  . ARG B  2  164 ? 132.502 149.902 93.274  1.00 22.39  ? 164 ARG B NE  1 
ATOM   3990  C CZ  . ARG B  2  164 ? 132.272 148.794 92.583  1.00 22.39  ? 164 ARG B CZ  1 
ATOM   3991  N NH1 . ARG B  2  164 ? 131.371 148.792 91.612  1.00 22.39  ? 164 ARG B NH1 1 
ATOM   3992  N NH2 . ARG B  2  164 ? 132.942 147.686 92.863  1.00 22.39  ? 164 ARG B NH2 1 
ATOM   3993  N N   . ALA B  2  165 ? 130.385 154.166 95.039  1.00 20.35  ? 165 ALA B N   1 
ATOM   3994  C CA  . ALA B  2  165 ? 130.209 155.184 94.016  1.00 20.35  ? 165 ALA B CA  1 
ATOM   3995  C C   . ALA B  2  165 ? 130.337 156.599 94.556  1.00 20.35  ? 165 ALA B C   1 
ATOM   3996  O O   . ALA B  2  165 ? 130.200 157.547 93.780  1.00 20.35  ? 165 ALA B O   1 
ATOM   3997  C CB  . ALA B  2  165 ? 128.848 155.020 93.339  1.00 20.35  ? 165 ALA B CB  1 
ATOM   3998  N N   . GLU B  2  166 ? 130.554 156.771 95.855  1.00 23.56  ? 166 GLU B N   1 
ATOM   3999  C CA  . GLU B  2  166 ? 130.628 158.099 96.449  1.00 23.56  ? 166 GLU B CA  1 
ATOM   4000  C C   . GLU B  2  166 ? 131.953 158.399 97.132  1.00 23.56  ? 166 GLU B C   1 
ATOM   4001  O O   . GLU B  2  166 ? 132.453 159.517 97.011  1.00 23.56  ? 166 GLU B O   1 
ATOM   4002  C CB  . GLU B  2  166 ? 129.480 158.285 97.445  1.00 23.56  ? 166 GLU B CB  1 
ATOM   4003  C CG  . GLU B  2  166 ? 128.113 158.302 96.776  1.00 23.56  ? 166 GLU B CG  1 
ATOM   4004  C CD  . GLU B  2  166 ? 126.973 158.462 97.760  1.00 23.56  ? 166 GLU B CD  1 
ATOM   4005  O OE1 . GLU B  2  166 ? 127.223 158.394 98.979  1.00 23.56  ? 166 GLU B OE1 1 
ATOM   4006  O OE2 . GLU B  2  166 ? 125.826 158.665 97.313  1.00 23.56  ? 166 GLU B OE2 1 
ATOM   4007  N N   . VAL B  2  167 ? 132.545 157.445 97.847  1.00 20.51  ? 167 VAL B N   1 
ATOM   4008  C CA  . VAL B  2  167 ? 133.811 157.662 98.542  1.00 20.51  ? 167 VAL B CA  1 
ATOM   4009  C C   . VAL B  2  167 ? 134.715 156.462 98.306  1.00 20.51  ? 167 VAL B C   1 
ATOM   4010  O O   . VAL B  2  167 ? 134.317 155.321 98.558  1.00 20.51  ? 167 VAL B O   1 
ATOM   4011  C CB  . VAL B  2  167 ? 133.611 157.886 100.052 1.00 20.51  ? 167 VAL B CB  1 
ATOM   4012  C CG1 . VAL B  2  167 ? 134.943 157.972 100.749 1.00 20.51  ? 167 VAL B CG1 1 
ATOM   4013  C CG2 . VAL B  2  167 ? 132.818 159.148 100.301 1.00 20.51  ? 167 VAL B CG2 1 
ATOM   4014  N N   . VAL B  2  168 ? 135.932 156.717 97.833  1.00 18.55  ? 168 VAL B N   1 
ATOM   4015  C CA  . VAL B  2  168 ? 136.891 155.672 97.501  1.00 18.55  ? 168 VAL B CA  1 
ATOM   4016  C C   . VAL B  2  168 ? 138.201 155.963 98.217  1.00 18.55  ? 168 VAL B C   1 
ATOM   4017  O O   . VAL B  2  168 ? 138.767 157.049 98.062  1.00 18.55  ? 168 VAL B O   1 
ATOM   4018  C CB  . VAL B  2  168 ? 137.122 155.578 95.983  1.00 18.55  ? 168 VAL B CB  1 
ATOM   4019  C CG1 . VAL B  2  168 ? 138.204 154.567 95.681  1.00 18.55  ? 168 VAL B CG1 1 
ATOM   4020  C CG2 . VAL B  2  168 ? 135.839 155.209 95.276  1.00 18.55  ? 168 VAL B CG2 1 
ATOM   4021  N N   . TYR B  2  169 ? 138.688 154.989 98.979  1.00 21.51  ? 169 TYR B N   1 
ATOM   4022  C CA  . TYR B  2  169 ? 139.936 155.123 99.717  1.00 21.51  ? 169 TYR B CA  1 
ATOM   4023  C C   . TYR B  2  169 ? 141.116 154.643 98.888  1.00 21.51  ? 169 TYR B C   1 
ATOM   4024  O O   . TYR B  2  169 ? 141.014 153.665 98.145  1.00 21.51  ? 169 TYR B O   1 
ATOM   4025  C CB  . TYR B  2  169 ? 139.875 154.325 101.016 1.00 21.51  ? 169 TYR B CB  1 
ATOM   4026  C CG  . TYR B  2  169 ? 138.996 154.941 102.067 1.00 21.51  ? 169 TYR B CG  1 
ATOM   4027  C CD1 . TYR B  2  169 ? 138.665 156.277 102.020 1.00 21.51  ? 169 TYR B CD1 1 
ATOM   4028  C CD2 . TYR B  2  169 ? 138.480 154.179 103.095 1.00 21.51  ? 169 TYR B CD2 1 
ATOM   4029  C CE1 . TYR B  2  169 ? 137.862 156.841 102.976 1.00 21.51  ? 169 TYR B CE1 1 
ATOM   4030  C CE2 . TYR B  2  169 ? 137.674 154.734 104.051 1.00 21.51  ? 169 TYR B CE2 1 
ATOM   4031  C CZ  . TYR B  2  169 ? 137.368 156.065 103.986 1.00 21.51  ? 169 TYR B CZ  1 
ATOM   4032  O OH  . TYR B  2  169 ? 136.562 156.621 104.945 1.00 21.51  ? 169 TYR B OH  1 
ATOM   4033  N N   . GLU B  2  170 ? 142.241 155.336 99.028  1.00 37.84  ? 170 GLU B N   1 
ATOM   4034  C CA  . GLU B  2  170 ? 143.496 154.929 98.417  1.00 37.84  ? 170 GLU B CA  1 
ATOM   4035  C C   . GLU B  2  170 ? 144.629 155.282 99.362  1.00 37.84  ? 170 GLU B C   1 
ATOM   4036  O O   . GLU B  2  170 ? 144.572 156.291 100.066 1.00 37.84  ? 170 GLU B O   1 
ATOM   4037  C CB  . GLU B  2  170 ? 143.728 155.601 97.062  1.00 37.84  ? 170 GLU B CB  1 
ATOM   4038  C CG  . GLU B  2  170 ? 142.773 155.163 95.974  1.00 37.84  ? 170 GLU B CG  1 
ATOM   4039  C CD  . GLU B  2  170 ? 142.934 153.699 95.623  1.00 37.84  ? 170 GLU B CD  1 
ATOM   4040  O OE1 . GLU B  2  170 ? 144.065 153.182 95.733  1.00 37.84  ? 170 GLU B OE1 1 
ATOM   4041  O OE2 . GLU B  2  170 ? 141.932 153.062 95.238  1.00 37.84  ? 170 GLU B OE2 1 
ATOM   4042  N N   . TRP B  2  171 ? 145.663 154.449 99.374  1.00 43.48  ? 171 TRP B N   1 
ATOM   4043  C CA  . TRP B  2  171 ? 146.792 154.713 100.250 1.00 43.48  ? 171 TRP B CA  1 
ATOM   4044  C C   . TRP B  2  171 ? 147.559 155.932 99.755  1.00 43.48  ? 171 TRP B C   1 
ATOM   4045  O O   . TRP B  2  171 ? 147.706 156.144 98.550  1.00 43.48  ? 171 TRP B O   1 
ATOM   4046  C CB  . TRP B  2  171 ? 147.711 153.501 100.320 1.00 43.48  ? 171 TRP B CB  1 
ATOM   4047  C CG  . TRP B  2  171 ? 147.074 152.303 100.928 1.00 43.48  ? 171 TRP B CG  1 
ATOM   4048  C CD1 . TRP B  2  171 ? 146.560 151.234 100.269 1.00 43.48  ? 171 TRP B CD1 1 
ATOM   4049  C CD2 . TRP B  2  171 ? 146.872 152.050 102.320 1.00 43.48  ? 171 TRP B CD2 1 
ATOM   4050  N NE1 . TRP B  2  171 ? 146.060 150.324 101.161 1.00 43.48  ? 171 TRP B NE1 1 
ATOM   4051  C CE2 . TRP B  2  171 ? 146.241 150.804 102.429 1.00 43.48  ? 171 TRP B CE2 1 
ATOM   4052  C CE3 . TRP B  2  171 ? 147.174 152.754 103.484 1.00 43.48  ? 171 TRP B CE3 1 
ATOM   4053  C CZ2 . TRP B  2  171 ? 145.898 150.249 103.651 1.00 43.48  ? 171 TRP B CZ2 1 
ATOM   4054  C CZ3 . TRP B  2  171 ? 146.832 152.199 104.698 1.00 43.48  ? 171 TRP B CZ3 1 
ATOM   4055  C CH2 . TRP B  2  171 ? 146.204 150.961 104.773 1.00 43.48  ? 171 TRP B CH2 1 
ATOM   4056  N N   . THR B  2  172 ? 148.040 156.741 100.700 1.00 32.45  ? 172 THR B N   1 
ATOM   4057  C CA  . THR B  2  172 ? 148.649 158.020 100.349 1.00 32.45  ? 172 THR B CA  1 
ATOM   4058  C C   . THR B  2  172 ? 149.913 157.821 99.528  1.00 32.45  ? 172 THR B C   1 
ATOM   4059  O O   . THR B  2  172 ? 150.069 158.407 98.453  1.00 32.45  ? 172 THR B O   1 
ATOM   4060  C CB  . THR B  2  172 ? 148.957 158.818 101.614 1.00 32.45  ? 172 THR B CB  1 
ATOM   4061  O OG1 . THR B  2  172 ? 147.744 159.060 102.336 1.00 32.45  ? 172 THR B OG1 1 
ATOM   4062  C CG2 . THR B  2  172 ? 149.600 160.143 101.257 1.00 32.45  ? 172 THR B CG2 1 
ATOM   4063  N N   . ARG B  2  173 ? 150.823 156.998 100.018 1.00 31.62  ? 173 ARG B N   1 
ATOM   4064  C CA  . ARG B  2  173 ? 152.078 156.704 99.353  1.00 31.62  ? 173 ARG B CA  1 
ATOM   4065  C C   . ARG B  2  173 ? 152.011 155.310 98.743  1.00 31.62  ? 173 ARG B C   1 
ATOM   4066  O O   . ARG B  2  173 ? 150.951 154.679 98.703  1.00 31.62  ? 173 ARG B O   1 
ATOM   4067  C CB  . ARG B  2  173 ? 153.239 156.838 100.336 1.00 31.62  ? 173 ARG B CB  1 
ATOM   4068  C CG  . ARG B  2  173 ? 153.538 158.261 100.747 1.00 31.62  ? 173 ARG B CG  1 
ATOM   4069  C CD  . ARG B  2  173 ? 154.800 158.324 101.574 1.00 31.62  ? 173 ARG B CD  1 
ATOM   4070  N NE  . ARG B  2  173 ? 154.642 157.611 102.834 1.00 31.62  ? 173 ARG B NE  1 
ATOM   4071  C CZ  . ARG B  2  173 ? 154.160 158.163 103.940 1.00 31.62  ? 173 ARG B CZ  1 
ATOM   4072  N NH1 . ARG B  2  173 ? 153.792 159.435 103.936 1.00 31.62  ? 173 ARG B NH1 1 
ATOM   4073  N NH2 . ARG B  2  173 ? 154.047 157.446 105.048 1.00 31.62  ? 173 ARG B NH2 1 
ATOM   4074  N N   . GLU B  2  174 ? 153.145 154.846 98.238  1.00 36.79  ? 174 GLU B N   1 
ATOM   4075  C CA  . GLU B  2  174 ? 153.244 153.491 97.722  1.00 36.79  ? 174 GLU B CA  1 
ATOM   4076  C C   . GLU B  2  174 ? 152.773 152.501 98.786  1.00 36.79  ? 174 GLU B C   1 
ATOM   4077  O O   . GLU B  2  174 ? 153.236 152.568 99.932  1.00 36.79  ? 174 GLU B O   1 
ATOM   4078  C CB  . GLU B  2  174 ? 154.687 153.201 97.324  1.00 36.79  ? 174 GLU B CB  1 
ATOM   4079  C CG  . GLU B  2  174 ? 155.177 154.096 96.211  1.00 36.79  ? 174 GLU B CG  1 
ATOM   4080  C CD  . GLU B  2  174 ? 156.645 153.906 95.911  1.00 36.79  ? 174 GLU B CD  1 
ATOM   4081  O OE1 . GLU B  2  174 ? 157.309 153.149 96.646  1.00 36.79  ? 174 GLU B OE1 1 
ATOM   4082  O OE2 . GLU B  2  174 ? 157.137 154.529 94.947  1.00 36.79  ? 174 GLU B OE2 1 
ATOM   4083  N N   . PRO B  2  175 ? 151.862 151.587 98.456  1.00 43.48  ? 175 PRO B N   1 
ATOM   4084  C CA  . PRO B  2  175 ? 151.221 150.768 99.496  1.00 43.48  ? 175 PRO B CA  1 
ATOM   4085  C C   . PRO B  2  175 ? 152.185 150.010 100.387 1.00 43.48  ? 175 PRO B C   1 
ATOM   4086  O O   . PRO B  2  175 ? 151.852 149.729 101.543 1.00 43.48  ? 175 PRO B O   1 
ATOM   4087  C CB  . PRO B  2  175 ? 150.344 149.813 98.681  1.00 43.48  ? 175 PRO B CB  1 
ATOM   4088  C CG  . PRO B  2  175 ? 150.077 150.543 97.425  1.00 43.48  ? 175 PRO B CG  1 
ATOM   4089  C CD  . PRO B  2  175 ? 151.327 151.295 97.120  1.00 43.48  ? 175 PRO B CD  1 
ATOM   4090  N N   . ALA B  2  176 ? 153.374 149.672 99.894  1.00 28.36  ? 176 ALA B N   1 
ATOM   4091  C CA  . ALA B  2  176 ? 154.332 148.968 100.738 1.00 28.36  ? 176 ALA B CA  1 
ATOM   4092  C C   . ALA B  2  176 ? 154.853 149.854 101.859 1.00 28.36  ? 176 ALA B C   1 
ATOM   4093  O O   . ALA B  2  176 ? 155.230 149.347 102.920 1.00 28.36  ? 176 ALA B O   1 
ATOM   4094  C CB  . ALA B  2  176 ? 155.494 148.450 99.896  1.00 28.36  ? 176 ALA B CB  1 
ATOM   4095  N N   . ARG B  2  177 ? 154.877 151.167 101.649 1.00 29.87  ? 177 ARG B N   1 
ATOM   4096  C CA  . ARG B  2  177 ? 155.448 152.105 102.604 1.00 29.87  ? 177 ARG B CA  1 
ATOM   4097  C C   . ARG B  2  177 ? 154.409 152.903 103.379 1.00 29.87  ? 177 ARG B C   1 
ATOM   4098  O O   . ARG B  2  177 ? 154.788 153.784 104.154 1.00 29.87  ? 177 ARG B O   1 
ATOM   4099  C CB  . ARG B  2  177 ? 156.383 153.081 101.886 1.00 29.87  ? 177 ARG B CB  1 
ATOM   4100  C CG  . ARG B  2  177 ? 157.659 152.480 101.342 1.00 29.87  ? 177 ARG B CG  1 
ATOM   4101  C CD  . ARG B  2  177 ? 158.433 153.549 100.596 1.00 29.87  ? 177 ARG B CD  1 
ATOM   4102  N NE  . ARG B  2  177 ? 158.839 154.631 101.488 1.00 29.87  ? 177 ARG B NE  1 
ATOM   4103  C CZ  . ARG B  2  177 ? 159.314 155.802 101.077 1.00 29.87  ? 177 ARG B CZ  1 
ATOM   4104  N NH1 . ARG B  2  177 ? 159.438 156.053 99.783  1.00 29.87  ? 177 ARG B NH1 1 
ATOM   4105  N NH2 . ARG B  2  177 ? 159.656 156.727 101.962 1.00 29.87  ? 177 ARG B NH2 1 
ATOM   4106  N N   . SER B  2  178 ? 153.117 152.648 103.175 1.00 23.97  ? 178 SER B N   1 
ATOM   4107  C CA  . SER B  2  178 ? 152.098 153.407 103.893 1.00 23.97  ? 178 SER B CA  1 
ATOM   4108  C C   . SER B  2  178 ? 152.161 153.143 105.390 1.00 23.97  ? 178 SER B C   1 
ATOM   4109  O O   . SER B  2  178 ? 152.449 154.045 106.182 1.00 23.97  ? 178 SER B O   1 
ATOM   4110  C CB  . SER B  2  178 ? 150.714 153.076 103.348 1.00 23.97  ? 178 SER B CB  1 
ATOM   4111  O OG  . SER B  2  178 ? 150.582 153.542 102.020 1.00 23.97  ? 178 SER B OG  1 
ATOM   4112  N N   . VAL B  2  179 ? 151.908 151.903 105.800 1.00 18.77  ? 179 VAL B N   1 
ATOM   4113  C CA  . VAL B  2  179 ? 151.797 151.571 107.217 1.00 18.77  ? 179 VAL B CA  1 
ATOM   4114  C C   . VAL B  2  179 ? 153.207 151.539 107.800 1.00 18.77  ? 179 VAL B C   1 
ATOM   4115  O O   . VAL B  2  179 ? 153.908 150.535 107.698 1.00 18.77  ? 179 VAL B O   1 
ATOM   4116  C CB  . VAL B  2  179 ? 151.067 150.245 107.432 1.00 18.77  ? 179 VAL B CB  1 
ATOM   4117  C CG1 . VAL B  2  179 ? 151.015 149.907 108.903 1.00 18.77  ? 179 VAL B CG1 1 
ATOM   4118  C CG2 . VAL B  2  179 ? 149.675 150.322 106.856 1.00 18.77  ? 179 VAL B CG2 1 
ATOM   4119  N N   . VAL B  2  180 ? 153.619 152.634 108.426 1.00 22.17  ? 180 VAL B N   1 
ATOM   4120  C CA  . VAL B  2  180 ? 154.949 152.764 109.011 1.00 22.17  ? 180 VAL B CA  1 
ATOM   4121  C C   . VAL B  2  180 ? 154.851 152.459 110.495 1.00 22.17  ? 180 VAL B C   1 
ATOM   4122  O O   . VAL B  2  180 ? 153.857 152.805 111.142 1.00 22.17  ? 180 VAL B O   1 
ATOM   4123  C CB  . VAL B  2  180 ? 155.516 154.174 108.771 1.00 22.17  ? 180 VAL B CB  1 
ATOM   4124  C CG1 . VAL B  2  180 ? 156.874 154.327 109.422 1.00 22.17  ? 180 VAL B CG1 1 
ATOM   4125  C CG2 . VAL B  2  180 ? 155.602 154.462 107.290 1.00 22.17  ? 180 VAL B CG2 1 
ATOM   4126  N N   . VAL B  2  181 ? 155.873 151.807 111.042 1.00 28.33  ? 181 VAL B N   1 
ATOM   4127  C CA  . VAL B  2  181 ? 155.908 151.449 112.454 1.00 28.33  ? 181 VAL B CA  1 
ATOM   4128  C C   . VAL B  2  181 ? 157.178 152.014 113.076 1.00 28.33  ? 181 VAL B C   1 
ATOM   4129  O O   . VAL B  2  181 ? 158.245 152.000 112.455 1.00 28.33  ? 181 VAL B O   1 
ATOM   4130  C CB  . VAL B  2  181 ? 155.814 149.922 112.651 1.00 28.33  ? 181 VAL B CB  1 
ATOM   4131  C CG1 . VAL B  2  181 ? 156.996 149.221 112.014 1.00 28.33  ? 181 VAL B CG1 1 
ATOM   4132  C CG2 . VAL B  2  181 ? 155.719 149.582 114.122 1.00 28.33  ? 181 VAL B CG2 1 
ATOM   4133  N N   . ALA B  2  182 ? 157.055 152.533 114.295 1.00 43.65  ? 182 ALA B N   1 
ATOM   4134  C CA  . ALA B  2  182 ? 158.187 153.146 114.969 1.00 43.65  ? 182 ALA B CA  1 
ATOM   4135  C C   . ALA B  2  182 ? 159.218 152.090 115.348 1.00 43.65  ? 182 ALA B C   1 
ATOM   4136  O O   . ALA B  2  182 ? 158.927 150.894 115.413 1.00 43.65  ? 182 ALA B O   1 
ATOM   4137  C CB  . ALA B  2  182 ? 157.727 153.902 116.213 1.00 43.65  ? 182 ALA B CB  1 
ATOM   4138  N N   . GLU B  2  183 ? 160.444 152.551 115.602 1.00 70.15  ? 183 GLU B N   1 
ATOM   4139  C CA  . GLU B  2  183 ? 161.534 151.621 115.886 1.00 70.15  ? 183 GLU B CA  1 
ATOM   4140  C C   . GLU B  2  183 ? 161.437 151.065 117.301 1.00 70.15  ? 183 GLU B C   1 
ATOM   4141  O O   . GLU B  2  183 ? 161.439 149.845 117.500 1.00 70.15  ? 183 GLU B O   1 
ATOM   4142  C CB  . GLU B  2  183 ? 162.882 152.307 115.668 1.00 70.15  ? 183 GLU B CB  1 
ATOM   4143  C CG  . GLU B  2  183 ? 163.178 152.640 114.216 1.00 70.15  ? 183 GLU B CG  1 
ATOM   4144  C CD  . GLU B  2  183 ? 164.546 153.266 114.028 1.00 70.15  ? 183 GLU B CD  1 
ATOM   4145  O OE1 . GLU B  2  183 ? 165.212 153.560 115.043 1.00 70.15  ? 183 GLU B OE1 1 
ATOM   4146  O OE2 . GLU B  2  183 ? 164.957 153.459 112.866 1.00 70.15  ? 183 GLU B OE2 1 
ATOM   4147  N N   . ASP B  2  184 ? 161.358 151.941 118.297 1.00 69.89  ? 184 ASP B N   1 
ATOM   4148  C CA  . ASP B  2  184 ? 161.315 151.528 119.692 1.00 69.89  ? 184 ASP B CA  1 
ATOM   4149  C C   . ASP B  2  184 ? 159.906 151.496 120.264 1.00 69.89  ? 184 ASP B C   1 
ATOM   4150  O O   . ASP B  2  184 ? 159.728 151.076 121.411 1.00 69.89  ? 184 ASP B O   1 
ATOM   4151  C CB  . ASP B  2  184 ? 162.194 152.452 120.542 1.00 69.89  ? 184 ASP B CB  1 
ATOM   4152  C CG  . ASP B  2  184 ? 161.756 153.904 120.477 1.00 69.89  ? 184 ASP B CG  1 
ATOM   4153  O OD1 . ASP B  2  184 ? 160.823 154.217 119.708 1.00 69.89  ? 184 ASP B OD1 1 
ATOM   4154  O OD2 . ASP B  2  184 ? 162.344 154.735 121.200 1.00 69.89  ? 184 ASP B OD2 1 
ATOM   4155  N N   . GLY B  2  185 ? 158.904 151.926 119.497 1.00 52.89  ? 185 GLY B N   1 
ATOM   4156  C CA  . GLY B  2  185 ? 157.556 151.998 120.029 1.00 52.89  ? 185 GLY B CA  1 
ATOM   4157  C C   . GLY B  2  185 ? 156.948 150.646 120.336 1.00 52.89  ? 185 GLY B C   1 
ATOM   4158  O O   . GLY B  2  185 ? 156.180 150.513 121.292 1.00 52.89  ? 185 GLY B O   1 
ATOM   4159  N N   . SER B  2  186 ? 157.275 149.631 119.541 1.00 44.11  ? 186 SER B N   1 
ATOM   4160  C CA  . SER B  2  186 ? 156.672 148.317 119.717 1.00 44.11  ? 186 SER B CA  1 
ATOM   4161  C C   . SER B  2  186 ? 156.988 147.752 121.095 1.00 44.11  ? 186 SER B C   1 
ATOM   4162  O O   . SER B  2  186 ? 158.135 147.785 121.547 1.00 44.11  ? 186 SER B O   1 
ATOM   4163  C CB  . SER B  2  186 ? 157.173 147.367 118.633 1.00 44.11  ? 186 SER B CB  1 
ATOM   4164  O OG  . SER B  2  186 ? 156.660 146.062 118.829 1.00 44.11  ? 186 SER B OG  1 
ATOM   4165  N N   . ARG B  2  187 ? 155.961 147.237 121.768 1.00 40.29  ? 187 ARG B N   1 
ATOM   4166  C CA  . ARG B  2  187 ? 156.141 146.574 123.053 1.00 40.29  ? 187 ARG B CA  1 
ATOM   4167  C C   . ARG B  2  187 ? 155.262 145.334 123.104 1.00 40.29  ? 187 ARG B C   1 
ATOM   4168  O O   . ARG B  2  187 ? 154.043 145.417 122.935 1.00 40.29  ? 187 ARG B O   1 
ATOM   4169  C CB  . ARG B  2  187 ? 155.844 147.520 124.226 1.00 40.29  ? 187 ARG B CB  1 
ATOM   4170  C CG  . ARG B  2  187 ? 154.401 147.950 124.438 1.00 40.29  ? 187 ARG B CG  1 
ATOM   4171  C CD  . ARG B  2  187 ? 154.107 149.237 123.702 1.00 40.29  ? 187 ARG B CD  1 
ATOM   4172  N NE  . ARG B  2  187 ? 152.811 149.801 124.066 1.00 40.29  ? 187 ARG B NE  1 
ATOM   4173  C CZ  . ARG B  2  187 ? 152.652 150.829 124.891 1.00 40.29  ? 187 ARG B CZ  1 
ATOM   4174  N NH1 . ARG B  2  187 ? 151.436 151.278 125.166 1.00 40.29  ? 187 ARG B NH1 1 
ATOM   4175  N NH2 . ARG B  2  187 ? 153.711 151.419 125.425 1.00 40.29  ? 187 ARG B NH2 1 
ATOM   4176  N N   . LEU B  2  188 ? 155.893 144.182 123.312 1.00 34.66  ? 188 LEU B N   1 
ATOM   4177  C CA  . LEU B  2  188 ? 155.201 142.907 123.417 1.00 34.66  ? 188 LEU B CA  1 
ATOM   4178  C C   . LEU B  2  188 ? 155.985 142.009 124.358 1.00 34.66  ? 188 LEU B C   1 
ATOM   4179  O O   . LEU B  2  188 ? 157.215 141.946 124.274 1.00 34.66  ? 188 LEU B O   1 
ATOM   4180  C CB  . LEU B  2  188 ? 155.054 142.238 122.047 1.00 34.66  ? 188 LEU B CB  1 
ATOM   4181  C CG  . LEU B  2  188 ? 154.061 142.850 121.068 1.00 34.66  ? 188 LEU B CG  1 
ATOM   4182  C CD1 . LEU B  2  188 ? 154.186 142.205 119.708 1.00 34.66  ? 188 LEU B CD1 1 
ATOM   4183  C CD2 . LEU B  2  188 ? 152.665 142.658 121.609 1.00 34.66  ? 188 LEU B CD2 1 
ATOM   4184  N N   . ASN B  2  189 ? 155.277 141.328 125.257 1.00 46.05  ? 189 ASN B N   1 
ATOM   4185  C CA  . ASN B  2  189 ? 155.931 140.358 126.126 1.00 46.05  ? 189 ASN B CA  1 
ATOM   4186  C C   . ASN B  2  189 ? 156.187 139.051 125.387 1.00 46.05  ? 189 ASN B C   1 
ATOM   4187  O O   . ASN B  2  189 ? 157.337 138.636 125.212 1.00 46.05  ? 189 ASN B O   1 
ATOM   4188  C CB  . ASN B  2  189 ? 155.080 140.105 127.371 1.00 46.05  ? 189 ASN B CB  1 
ATOM   4189  C CG  . ASN B  2  189 ? 154.940 141.331 128.239 1.00 46.05  ? 189 ASN B CG  1 
ATOM   4190  O OD1 . ASN B  2  189 ? 153.846 141.868 128.403 1.00 46.05  ? 189 ASN B OD1 1 
ATOM   4191  N ND2 . ASN B  2  189 ? 156.051 141.782 128.805 1.00 46.05  ? 189 ASN B ND2 1 
ATOM   4192  N N   . GLN B  2  190 ? 155.118 138.401 124.932 1.00 44.35  ? 190 GLN B N   1 
ATOM   4193  C CA  . GLN B  2  190 ? 155.236 137.073 124.343 1.00 44.35  ? 190 GLN B CA  1 
ATOM   4194  C C   . GLN B  2  190 ? 155.658 137.143 122.882 1.00 44.35  ? 190 GLN B C   1 
ATOM   4195  O O   . GLN B  2  190 ? 156.664 136.548 122.484 1.00 44.35  ? 190 GLN B O   1 
ATOM   4196  C CB  . GLN B  2  190 ? 153.907 136.333 124.483 1.00 44.35  ? 190 GLN B CB  1 
ATOM   4197  C CG  . GLN B  2  190 ? 153.539 136.020 125.916 1.00 44.35  ? 190 GLN B CG  1 
ATOM   4198  C CD  . GLN B  2  190 ? 152.186 135.357 126.041 1.00 44.35  ? 190 GLN B CD  1 
ATOM   4199  O OE1 . GLN B  2  190 ? 151.463 135.209 125.057 1.00 44.35  ? 190 GLN B OE1 1 
ATOM   4200  N NE2 . GLN B  2  190 ? 151.837 134.949 127.255 1.00 44.35  ? 190 GLN B NE2 1 
ATOM   4201  N N   . TYR B  2  191 ? 154.904 137.876 122.070 1.00 35.75  ? 191 TYR B N   1 
ATOM   4202  C CA  . TYR B  2  191 ? 155.078 137.835 120.629 1.00 35.75  ? 191 TYR B CA  1 
ATOM   4203  C C   . TYR B  2  191 ? 156.276 138.675 120.200 1.00 35.75  ? 191 TYR B C   1 
ATOM   4204  O O   . TYR B  2  191 ? 157.033 139.201 121.019 1.00 35.75  ? 191 TYR B O   1 
ATOM   4205  C CB  . TYR B  2  191 ? 153.809 138.313 119.936 1.00 35.75  ? 191 TYR B CB  1 
ATOM   4206  C CG  . TYR B  2  191 ? 152.636 137.393 120.125 1.00 35.75  ? 191 TYR B CG  1 
ATOM   4207  C CD1 . TYR B  2  191 ? 152.812 136.098 120.572 1.00 35.75  ? 191 TYR B CD1 1 
ATOM   4208  C CD2 . TYR B  2  191 ? 151.349 137.826 119.868 1.00 35.75  ? 191 TYR B CD2 1 
ATOM   4209  C CE1 . TYR B  2  191 ? 151.740 135.258 120.749 1.00 35.75  ? 191 TYR B CE1 1 
ATOM   4210  C CE2 . TYR B  2  191 ? 150.272 136.993 120.041 1.00 35.75  ? 191 TYR B CE2 1 
ATOM   4211  C CZ  . TYR B  2  191 ? 150.472 135.711 120.482 1.00 35.75  ? 191 TYR B CZ  1 
ATOM   4212  O OH  . TYR B  2  191 ? 149.395 134.875 120.657 1.00 35.75  ? 191 TYR B OH  1 
ATOM   4213  N N   . ASP B  2  192 ? 156.454 138.792 118.889 1.00 36.68  ? 192 ASP B N   1 
ATOM   4214  C CA  . ASP B  2  192 ? 157.528 139.597 118.324 1.00 36.68  ? 192 ASP B CA  1 
ATOM   4215  C C   . ASP B  2  192 ? 157.109 140.018 116.926 1.00 36.68  ? 192 ASP B C   1 
ATOM   4216  O O   . ASP B  2  192 ? 156.973 139.167 116.044 1.00 36.68  ? 192 ASP B O   1 
ATOM   4217  C CB  . ASP B  2  192 ? 158.838 138.813 118.287 1.00 36.68  ? 192 ASP B CB  1 
ATOM   4218  C CG  . ASP B  2  192 ? 160.031 139.688 117.974 1.00 36.68  ? 192 ASP B CG  1 
ATOM   4219  O OD1 . ASP B  2  192 ? 159.843 140.903 117.766 1.00 36.68  ? 192 ASP B OD1 1 
ATOM   4220  O OD2 . ASP B  2  192 ? 161.163 139.159 117.940 1.00 36.68  ? 192 ASP B OD2 1 
ATOM   4221  N N   . LEU B  2  193 ? 156.904 141.320 116.731 1.00 34.25  ? 193 LEU B N   1 
ATOM   4222  C CA  . LEU B  2  193 ? 156.391 141.820 115.463 1.00 34.25  ? 193 LEU B CA  1 
ATOM   4223  C C   . LEU B  2  193 ? 157.338 141.458 114.327 1.00 34.25  ? 193 LEU B C   1 
ATOM   4224  O O   . LEU B  2  193 ? 158.561 141.496 114.480 1.00 34.25  ? 193 LEU B O   1 
ATOM   4225  C CB  . LEU B  2  193 ? 156.196 143.333 115.533 1.00 34.25  ? 193 LEU B CB  1 
ATOM   4226  C CG  . LEU B  2  193 ? 155.554 143.985 114.311 1.00 34.25  ? 193 LEU B CG  1 
ATOM   4227  C CD1 . LEU B  2  193 ? 154.162 143.436 114.110 1.00 34.25  ? 193 LEU B CD1 1 
ATOM   4228  C CD2 . LEU B  2  193 ? 155.510 145.489 114.469 1.00 34.25  ? 193 LEU B CD2 1 
ATOM   4229  N N   . LEU B  2  194 ? 156.766 141.093 113.183 1.00 38.63  ? 194 LEU B N   1 
ATOM   4230  C CA  . LEU B  2  194 ? 157.550 140.568 112.074 1.00 38.63  ? 194 LEU B CA  1 
ATOM   4231  C C   . LEU B  2  194 ? 157.475 141.439 110.831 1.00 38.63  ? 194 LEU B C   1 
ATOM   4232  O O   . LEU B  2  194 ? 158.517 141.787 110.265 1.00 38.63  ? 194 LEU B O   1 
ATOM   4233  C CB  . LEU B  2  194 ? 157.094 139.137 111.757 1.00 38.63  ? 194 LEU B CB  1 
ATOM   4234  C CG  . LEU B  2  194 ? 157.939 138.346 110.764 1.00 38.63  ? 194 LEU B CG  1 
ATOM   4235  C CD1 . LEU B  2  194 ? 159.337 138.165 111.316 1.00 38.63  ? 194 LEU B CD1 1 
ATOM   4236  C CD2 . LEU B  2  194 ? 157.302 136.999 110.481 1.00 38.63  ? 194 LEU B CD2 1 
ATOM   4237  N N   . GLY B  2  195 ? 156.278 141.803 110.382 1.00 33.78  ? 195 GLY B N   1 
ATOM   4238  C CA  . GLY B  2  195 ? 156.150 142.666 109.219 1.00 33.78  ? 195 GLY B CA  1 
ATOM   4239  C C   . GLY B  2  195 ? 154.721 143.128 109.045 1.00 33.78  ? 195 GLY B C   1 
ATOM   4240  O O   . GLY B  2  195 ? 153.801 142.635 109.702 1.00 33.78  ? 195 GLY B O   1 
ATOM   4241  N N   . GLN B  2  196 ? 154.546 144.087 108.139 1.00 25.70  ? 196 GLN B N   1 
ATOM   4242  C CA  . GLN B  2  196 ? 153.236 144.621 107.803 1.00 25.70  ? 196 GLN B CA  1 
ATOM   4243  C C   . GLN B  2  196 ? 152.879 144.273 106.368 1.00 25.70  ? 196 GLN B C   1 
ATOM   4244  O O   . GLN B  2  196 ? 153.746 144.185 105.495 1.00 25.70  ? 196 GLN B O   1 
ATOM   4245  C CB  . GLN B  2  196 ? 153.176 146.135 107.976 1.00 25.70  ? 196 GLN B CB  1 
ATOM   4246  C CG  . GLN B  2  196 ? 153.263 146.598 109.403 1.00 25.70  ? 196 GLN B CG  1 
ATOM   4247  C CD  . GLN B  2  196 ? 154.685 146.663 109.894 1.00 25.70  ? 196 GLN B CD  1 
ATOM   4248  O OE1 . GLN B  2  196 ? 155.626 146.635 109.103 1.00 25.70  ? 196 GLN B OE1 1 
ATOM   4249  N NE2 . GLN B  2  196 ? 154.855 146.762 111.206 1.00 25.70  ? 196 GLN B NE2 1 
ATOM   4250  N N   . THR B  2  197 ? 151.588 144.086 106.133 1.00 19.39  ? 197 THR B N   1 
ATOM   4251  C CA  . THR B  2  197 ? 151.072 143.709 104.829 1.00 19.39  ? 197 THR B CA  1 
ATOM   4252  C C   . THR B  2  197 ? 149.772 144.457 104.589 1.00 19.39  ? 197 THR B C   1 
ATOM   4253  O O   . THR B  2  197 ? 148.935 144.552 105.489 1.00 19.39  ? 197 THR B O   1 
ATOM   4254  C CB  . THR B  2  197 ? 150.845 142.198 104.754 1.00 19.39  ? 197 THR B CB  1 
ATOM   4255  O OG1 . THR B  2  197 ? 152.095 141.523 104.926 1.00 19.39  ? 197 THR B OG1 1 
ATOM   4256  C CG2 . THR B  2  197 ? 150.244 141.809 103.428 1.00 19.39  ? 197 THR B CG2 1 
ATOM   4257  N N   . VAL B  2  198 ? 149.604 144.992 103.384 1.00 21.10  ? 198 VAL B N   1 
ATOM   4258  C CA  . VAL B  2  198 ? 148.428 145.787 103.059 1.00 21.10  ? 198 VAL B CA  1 
ATOM   4259  C C   . VAL B  2  198 ? 147.715 145.172 101.867 1.00 21.10  ? 198 VAL B C   1 
ATOM   4260  O O   . VAL B  2  198 ? 148.321 144.489 101.036 1.00 21.10  ? 198 VAL B O   1 
ATOM   4261  C CB  . VAL B  2  198 ? 148.795 147.254 102.776 1.00 21.10  ? 198 VAL B CB  1 
ATOM   4262  C CG1 . VAL B  2  198 ? 149.419 147.876 103.998 1.00 21.10  ? 198 VAL B CG1 1 
ATOM   4263  C CG2 . VAL B  2  198 ? 149.744 147.332 101.612 1.00 21.10  ? 198 VAL B CG2 1 
ATOM   4264  N N   . ASP B  2  199 ? 146.409 145.418 101.792 1.00 20.80  ? 199 ASP B N   1 
ATOM   4265  C CA  . ASP B  2  199 ? 145.567 144.882 100.731 1.00 20.80  ? 199 ASP B CA  1 
ATOM   4266  C C   . ASP B  2  199 ? 144.218 145.583 100.736 1.00 20.80  ? 199 ASP B C   1 
ATOM   4267  O O   . ASP B  2  199 ? 143.586 145.708 101.788 1.00 20.80  ? 199 ASP B O   1 
ATOM   4268  C CB  . ASP B  2  199 ? 145.375 143.376 100.903 1.00 20.80  ? 199 ASP B CB  1 
ATOM   4269  C CG  . ASP B  2  199 ? 144.635 142.743 99.742  1.00 20.80  ? 199 ASP B CG  1 
ATOM   4270  O OD1 . ASP B  2  199 ? 144.260 143.465 98.798  1.00 20.80  ? 199 ASP B OD1 1 
ATOM   4271  O OD2 . ASP B  2  199 ? 144.422 141.515 99.777  1.00 20.80  ? 199 ASP B OD2 1 
ATOM   4272  N N   . SER B  2  200 ? 143.762 146.029 99.573  1.00 23.55  ? 200 SER B N   1 
ATOM   4273  C CA  . SER B  2  200 ? 142.478 146.697 99.438  1.00 23.55  ? 200 SER B CA  1 
ATOM   4274  C C   . SER B  2  200 ? 141.492 145.773 98.745  1.00 23.55  ? 200 SER B C   1 
ATOM   4275  O O   . SER B  2  200 ? 141.846 145.076 97.792  1.00 23.55  ? 200 SER B O   1 
ATOM   4276  C CB  . SER B  2  200 ? 142.615 147.993 98.643  1.00 23.55  ? 200 SER B CB  1 
ATOM   4277  O OG  . SER B  2  200 ? 143.448 148.915 99.320  1.00 23.55  ? 200 SER B OG  1 
ATOM   4278  N N   . GLY B  2  201 ? 140.255 145.773 99.224  1.00 17.68  ? 201 GLY B N   1 
ATOM   4279  C CA  . GLY B  2  201 ? 139.239 144.933 98.629  1.00 17.68  ? 201 GLY B CA  1 
ATOM   4280  C C   . GLY B  2  201 ? 137.899 145.622 98.537  1.00 17.68  ? 201 GLY B C   1 
ATOM   4281  O O   . GLY B  2  201 ? 137.820 146.848 98.614  1.00 17.68  ? 201 GLY B O   1 
ATOM   4282  N N   . ILE B  2  202 ? 136.837 144.842 98.362  1.00 17.86  ? 202 ILE B N   1 
ATOM   4283  C CA  . ILE B  2  202 ? 135.473 145.357 98.333  1.00 17.86  ? 202 ILE B CA  1 
ATOM   4284  C C   . ILE B  2  202 ? 134.585 144.387 99.094  1.00 17.86  ? 202 ILE B C   1 
ATOM   4285  O O   . ILE B  2  202 ? 134.648 143.174 98.872  1.00 17.86  ? 202 ILE B O   1 
ATOM   4286  C CB  . ILE B  2  202 ? 134.959 145.551 96.896  1.00 17.86  ? 202 ILE B CB  1 
ATOM   4287  C CG1 . ILE B  2  202 ? 135.723 146.682 96.211  1.00 17.86  ? 202 ILE B CG1 1 
ATOM   4288  C CG2 . ILE B  2  202 ? 133.471 145.821 96.896  1.00 17.86  ? 202 ILE B CG2 1 
ATOM   4289  C CD1 . ILE B  2  202 ? 135.462 146.783 94.739  1.00 17.86  ? 202 ILE B CD1 1 
ATOM   4290  N N   . VAL B  2  203 ? 133.766 144.918 99.996  1.00 23.73  ? 203 VAL B N   1 
ATOM   4291  C CA  . VAL B  2  203 ? 132.879 144.121 100.831 1.00 23.73  ? 203 VAL B CA  1 
ATOM   4292  C C   . VAL B  2  203 ? 131.462 144.629 100.638 1.00 23.73  ? 203 VAL B C   1 
ATOM   4293  O O   . VAL B  2  203 ? 131.226 145.841 100.674 1.00 23.73  ? 203 VAL B O   1 
ATOM   4294  C CB  . VAL B  2  203 ? 133.279 144.193 102.315 1.00 23.73  ? 203 VAL B CB  1 
ATOM   4295  C CG1 . VAL B  2  203 ? 132.246 143.495 103.172 1.00 23.73  ? 203 VAL B CG1 1 
ATOM   4296  C CG2 . VAL B  2  203 ? 134.643 143.566 102.514 1.00 23.73  ? 203 VAL B CG2 1 
ATOM   4297  N N   . GLN B  2  204 ? 130.524 143.712 100.431 1.00 43.85  ? 204 GLN B N   1 
ATOM   4298  C CA  . GLN B  2  204 ? 129.128 144.061 100.222 1.00 43.85  ? 204 GLN B CA  1 
ATOM   4299  C C   . GLN B  2  204 ? 128.314 143.723 101.462 1.00 43.85  ? 204 GLN B C   1 
ATOM   4300  O O   . GLN B  2  204 ? 128.506 142.669 102.075 1.00 43.85  ? 204 GLN B O   1 
ATOM   4301  C CB  . GLN B  2  204 ? 128.552 143.337 99.006  1.00 43.85  ? 204 GLN B CB  1 
ATOM   4302  C CG  . GLN B  2  204 ? 127.128 143.737 98.690  1.00 43.85  ? 204 GLN B CG  1 
ATOM   4303  C CD  . GLN B  2  204 ? 126.609 143.095 97.427  1.00 43.85  ? 204 GLN B CD  1 
ATOM   4304  O OE1 . GLN B  2  204 ? 127.309 142.318 96.780  1.00 43.85  ? 204 GLN B OE1 1 
ATOM   4305  N NE2 . GLN B  2  204 ? 125.372 143.415 97.067  1.00 43.85  ? 204 GLN B NE2 1 
ATOM   4306  N N   . SER B  2  205 ? 127.406 144.626 101.825 1.00 45.13  ? 205 SER B N   1 
ATOM   4307  C CA  . SER B  2  205 ? 126.546 144.440 102.985 1.00 45.13  ? 205 SER B CA  1 
ATOM   4308  C C   . SER B  2  205 ? 125.105 144.779 102.631 1.00 45.13  ? 205 SER B C   1 
ATOM   4309  O O   . SER B  2  205 ? 124.770 144.924 101.452 1.00 45.13  ? 205 SER B O   1 
ATOM   4310  C CB  . SER B  2  205 ? 127.028 145.291 104.159 1.00 45.13  ? 205 SER B CB  1 
ATOM   4311  O OG  . SER B  2  205 ? 126.884 146.669 103.875 1.00 45.13  ? 205 SER B OG  1 
ATOM   4312  N N   . SER B  2  206 ? 124.245 144.895 103.646 1.00 43.29  ? 206 SER B N   1 
ATOM   4313  C CA  . SER B  2  206 ? 122.820 145.095 103.401 1.00 43.29  ? 206 SER B CA  1 
ATOM   4314  C C   . SER B  2  206 ? 122.549 146.376 102.621 1.00 43.29  ? 206 SER B C   1 
ATOM   4315  O O   . SER B  2  206 ? 121.668 146.406 101.755 1.00 43.29  ? 206 SER B O   1 
ATOM   4316  C CB  . SER B  2  206 ? 122.062 145.112 104.727 1.00 43.29  ? 206 SER B CB  1 
ATOM   4317  O OG  . SER B  2  206 ? 122.153 143.859 105.381 1.00 43.29  ? 206 SER B OG  1 
ATOM   4318  N N   . THR B  2  207 ? 123.288 147.446 102.911 1.00 40.86  ? 207 THR B N   1 
ATOM   4319  C CA  . THR B  2  207 ? 123.023 148.725 102.259 1.00 40.86  ? 207 THR B CA  1 
ATOM   4320  C C   . THR B  2  207 ? 123.545 148.741 100.826 1.00 40.86  ? 207 THR B C   1 
ATOM   4321  O O   . THR B  2  207 ? 122.775 148.905 99.875  1.00 40.86  ? 207 THR B O   1 
ATOM   4322  C CB  . THR B  2  207 ? 123.652 149.866 103.059 1.00 40.86  ? 207 THR B CB  1 
ATOM   4323  O OG1 . THR B  2  207 ? 125.076 149.728 103.046 1.00 40.86  ? 207 THR B OG1 1 
ATOM   4324  C CG2 . THR B  2  207 ? 123.168 149.826 104.491 1.00 40.86  ? 207 THR B CG2 1 
ATOM   4325  N N   . GLY B  2  208 ? 124.848 148.574 100.657 1.00 39.70  ? 208 GLY B N   1 
ATOM   4326  C CA  . GLY B  2  208 ? 125.433 148.648 99.335  1.00 39.70  ? 208 GLY B CA  1 
ATOM   4327  C C   . GLY B  2  208 ? 126.873 148.191 99.356  1.00 39.70  ? 208 GLY B C   1 
ATOM   4328  O O   . GLY B  2  208 ? 127.344 147.602 100.329 1.00 39.70  ? 208 GLY B O   1 
ATOM   4329  N N   . GLU B  2  209 ? 127.567 148.468 98.257  1.00 36.48  ? 209 GLU B N   1 
ATOM   4330  C CA  . GLU B  2  209 ? 128.959 148.061 98.109  1.00 36.48  ? 209 GLU B CA  1 
ATOM   4331  C C   . GLU B  2  209 ? 129.869 149.091 98.766  1.00 36.48  ? 209 GLU B C   1 
ATOM   4332  O O   . GLU B  2  209 ? 129.965 150.227 98.294  1.00 36.48  ? 209 GLU B O   1 
ATOM   4333  C CB  . GLU B  2  209 ? 129.306 147.910 96.633  1.00 36.48  ? 209 GLU B CB  1 
ATOM   4334  C CG  . GLU B  2  209 ? 128.551 146.804 95.928  1.00 36.48  ? 209 GLU B CG  1 
ATOM   4335  C CD  . GLU B  2  209 ? 128.876 146.737 94.450  1.00 36.48  ? 209 GLU B CD  1 
ATOM   4336  O OE1 . GLU B  2  209 ? 129.591 147.634 93.957  1.00 36.48  ? 209 GLU B OE1 1 
ATOM   4337  O OE2 . GLU B  2  209 ? 128.415 145.789 93.781  1.00 36.48  ? 209 GLU B OE2 1 
ATOM   4338  N N   . TYR B  2  210 ? 130.544 148.697 99.839  1.00 24.55  ? 210 TYR B N   1 
ATOM   4339  C CA  . TYR B  2  210 ? 131.506 149.559 100.507 1.00 24.55  ? 210 TYR B CA  1 
ATOM   4340  C C   . TYR B  2  210 ? 132.913 149.242 100.021 1.00 24.55  ? 210 TYR B C   1 
ATOM   4341  O O   . TYR B  2  210 ? 133.137 148.309 99.251  1.00 24.55  ? 210 TYR B O   1 
ATOM   4342  C CB  . TYR B  2  210 ? 131.430 149.394 102.025 1.00 24.55  ? 210 TYR B CB  1 
ATOM   4343  C CG  . TYR B  2  210 ? 130.157 149.907 102.643 1.00 24.55  ? 210 TYR B CG  1 
ATOM   4344  C CD1 . TYR B  2  210 ? 129.294 150.716 101.928 1.00 24.55  ? 210 TYR B CD1 1 
ATOM   4345  C CD2 . TYR B  2  210 ? 129.824 149.588 103.948 1.00 24.55  ? 210 TYR B CD2 1 
ATOM   4346  C CE1 . TYR B  2  210 ? 128.132 151.184 102.491 1.00 24.55  ? 210 TYR B CE1 1 
ATOM   4347  C CE2 . TYR B  2  210 ? 128.663 150.052 104.519 1.00 24.55  ? 210 TYR B CE2 1 
ATOM   4348  C CZ  . TYR B  2  210 ? 127.824 150.851 103.786 1.00 24.55  ? 210 TYR B CZ  1 
ATOM   4349  O OH  . TYR B  2  210 ? 126.663 151.318 104.350 1.00 24.55  ? 210 TYR B OH  1 
ATOM   4350  N N   . VAL B  2  211 ? 133.869 150.037 100.486 1.00 17.23  ? 211 VAL B N   1 
ATOM   4351  C CA  . VAL B  2  211 ? 135.277 149.832 100.184 1.00 17.23  ? 211 VAL B CA  1 
ATOM   4352  C C   . VAL B  2  211 ? 136.015 149.609 101.495 1.00 17.23  ? 211 VAL B C   1 
ATOM   4353  O O   . VAL B  2  211 ? 135.755 150.294 102.488 1.00 17.23  ? 211 VAL B O   1 
ATOM   4354  C CB  . VAL B  2  211 ? 135.866 151.018 99.397  1.00 17.23  ? 211 VAL B CB  1 
ATOM   4355  C CG1 . VAL B  2  211 ? 135.787 152.288 100.207 1.00 17.23  ? 211 VAL B CG1 1 
ATOM   4356  C CG2 . VAL B  2  211 ? 137.293 150.732 98.997  1.00 17.23  ? 211 VAL B CG2 1 
ATOM   4357  N N   . VAL B  2  212 ? 136.913 148.632 101.506 1.00 16.61  ? 212 VAL B N   1 
ATOM   4358  C CA  . VAL B  2  212 ? 137.560 148.179 102.729 1.00 16.61  ? 212 VAL B CA  1 
ATOM   4359  C C   . VAL B  2  212 ? 139.065 148.187 102.532 1.00 16.61  ? 212 VAL B C   1 
ATOM   4360  O O   . VAL B  2  212 ? 139.573 147.580 101.585 1.00 16.61  ? 212 VAL B O   1 
ATOM   4361  C CB  . VAL B  2  212 ? 137.086 146.773 103.132 1.00 16.61  ? 212 VAL B CB  1 
ATOM   4362  C CG1 . VAL B  2  212 ? 137.955 146.234 104.235 1.00 16.61  ? 212 VAL B CG1 1 
ATOM   4363  C CG2 . VAL B  2  212 ? 135.651 146.828 103.588 1.00 16.61  ? 212 VAL B CG2 1 
ATOM   4364  N N   . MET B  2  213 ? 139.771 148.866 103.425 1.00 18.07  ? 213 MET B N   1 
ATOM   4365  C CA  . MET B  2  213 ? 141.222 148.814 103.485 1.00 18.07  ? 213 MET B CA  1 
ATOM   4366  C C   . MET B  2  213 ? 141.614 147.794 104.541 1.00 18.07  ? 213 MET B C   1 
ATOM   4367  O O   . MET B  2  213 ? 141.117 147.849 105.668 1.00 18.07  ? 213 MET B O   1 
ATOM   4368  C CB  . MET B  2  213 ? 141.803 150.181 103.835 1.00 18.07  ? 213 MET B CB  1 
ATOM   4369  C CG  . MET B  2  213 ? 141.522 151.271 102.829 1.00 18.07  ? 213 MET B CG  1 
ATOM   4370  S SD  . MET B  2  213 ? 142.244 150.952 101.219 1.00 18.07  ? 213 MET B SD  1 
ATOM   4371  C CE  . MET B  2  213 ? 140.777 150.546 100.285 1.00 18.07  ? 213 MET B CE  1 
ATOM   4372  N N   . THR B  2  214 ? 142.485 146.862 104.182 1.00 19.42  ? 214 THR B N   1 
ATOM   4373  C CA  . THR B  2  214 ? 142.869 145.789 105.085 1.00 19.42  ? 214 THR B CA  1 
ATOM   4374  C C   . THR B  2  214 ? 144.364 145.848 105.348 1.00 19.42  ? 214 THR B C   1 
ATOM   4375  O O   . THR B  2  214 ? 145.155 146.075 104.430 1.00 19.42  ? 214 THR B O   1 
ATOM   4376  C CB  . THR B  2  214 ? 142.491 144.420 104.512 1.00 19.42  ? 214 THR B CB  1 
ATOM   4377  O OG1 . THR B  2  214 ? 141.084 144.383 104.251 1.00 19.42  ? 214 THR B OG1 1 
ATOM   4378  C CG2 . THR B  2  214 ? 142.825 143.323 105.497 1.00 19.42  ? 214 THR B CG2 1 
ATOM   4379  N N   . THR B  2  215 ? 144.744 145.653 106.606 1.00 21.76  ? 215 THR B N   1 
ATOM   4380  C CA  . THR B  2  215 ? 146.141 145.597 107.010 1.00 21.76  ? 215 THR B CA  1 
ATOM   4381  C C   . THR B  2  215 ? 146.348 144.383 107.898 1.00 21.76  ? 215 THR B C   1 
ATOM   4382  O O   . THR B  2  215 ? 145.613 144.195 108.869 1.00 21.76  ? 215 THR B O   1 
ATOM   4383  C CB  . THR B  2  215 ? 146.551 146.861 107.758 1.00 21.76  ? 215 THR B CB  1 
ATOM   4384  O OG1 . THR B  2  215 ? 146.386 147.993 106.901 1.00 21.76  ? 215 THR B OG1 1 
ATOM   4385  C CG2 . THR B  2  215 ? 147.992 146.771 108.186 1.00 21.76  ? 215 THR B CG2 1 
ATOM   4386  N N   . HIS B  2  216 ? 147.339 143.564 107.569 1.00 28.89  ? 216 HIS B N   1 
ATOM   4387  C CA  . HIS B  2  216 ? 147.642 142.365 108.335 1.00 28.89  ? 216 HIS B CA  1 
ATOM   4388  C C   . HIS B  2  216 ? 148.944 142.583 109.087 1.00 28.89  ? 216 HIS B C   1 
ATOM   4389  O O   . HIS B  2  216 ? 149.989 142.805 108.469 1.00 28.89  ? 216 HIS B O   1 
ATOM   4390  C CB  . HIS B  2  216 ? 147.757 141.142 107.430 1.00 28.89  ? 216 HIS B CB  1 
ATOM   4391  C CG  . HIS B  2  216 ? 146.485 140.777 106.735 1.00 28.89  ? 216 HIS B CG  1 
ATOM   4392  N ND1 . HIS B  2  216 ? 146.155 141.262 105.489 1.00 28.89  ? 216 HIS B ND1 1 
ATOM   4393  C CD2 . HIS B  2  216 ? 145.466 139.968 107.106 1.00 28.89  ? 216 HIS B CD2 1 
ATOM   4394  C CE1 . HIS B  2  216 ? 144.987 140.767 105.122 1.00 28.89  ? 216 HIS B CE1 1 
ATOM   4395  N NE2 . HIS B  2  216 ? 144.546 139.981 106.087 1.00 28.89  ? 216 HIS B NE2 1 
ATOM   4396  N N   . PHE B  2  217 ? 148.882 142.526 110.413 1.00 25.80  ? 217 PHE B N   1 
ATOM   4397  C CA  . PHE B  2  217 ? 150.080 142.544 111.243 1.00 25.80  ? 217 PHE B CA  1 
ATOM   4398  C C   . PHE B  2  217 ? 150.489 141.107 111.526 1.00 25.80  ? 217 PHE B C   1 
ATOM   4399  O O   . PHE B  2  217 ? 149.766 140.375 112.207 1.00 25.80  ? 217 PHE B O   1 
ATOM   4400  C CB  . PHE B  2  217 ? 149.842 143.303 112.544 1.00 25.80  ? 217 PHE B CB  1 
ATOM   4401  C CG  . PHE B  2  217 ? 149.829 144.789 112.389 1.00 25.80  ? 217 PHE B CG  1 
ATOM   4402  C CD1 . PHE B  2  217 ? 151.012 145.492 112.314 1.00 25.80  ? 217 PHE B CD1 1 
ATOM   4403  C CD2 . PHE B  2  217 ? 148.643 145.485 112.344 1.00 25.80  ? 217 PHE B CD2 1 
ATOM   4404  C CE1 . PHE B  2  217 ? 151.010 146.858 112.181 1.00 25.80  ? 217 PHE B CE1 1 
ATOM   4405  C CE2 . PHE B  2  217 ? 148.637 146.853 112.212 1.00 25.80  ? 217 PHE B CE2 1 
ATOM   4406  C CZ  . PHE B  2  217 ? 149.822 147.540 112.130 1.00 25.80  ? 217 PHE B CZ  1 
ATOM   4407  N N   . HIS B  2  218 ? 151.642 140.701 111.006 1.00 32.79  ? 218 HIS B N   1 
ATOM   4408  C CA  . HIS B  2  218 ? 152.137 139.357 111.247 1.00 32.79  ? 218 HIS B CA  1 
ATOM   4409  C C   . HIS B  2  218 ? 152.747 139.254 112.637 1.00 32.79  ? 218 HIS B C   1 
ATOM   4410  O O   . HIS B  2  218 ? 153.318 140.212 113.161 1.00 32.79  ? 218 HIS B O   1 
ATOM   4411  C CB  . HIS B  2  218 ? 153.172 138.967 110.198 1.00 32.79  ? 218 HIS B CB  1 
ATOM   4412  C CG  . HIS B  2  218 ? 152.615 138.864 108.816 1.00 32.79  ? 218 HIS B CG  1 
ATOM   4413  N ND1 . HIS B  2  218 ? 151.786 137.836 108.427 1.00 32.79  ? 218 HIS B ND1 1 
ATOM   4414  C CD2 . HIS B  2  218 ? 152.779 139.648 107.727 1.00 32.79  ? 218 HIS B CD2 1 
ATOM   4415  C CE1 . HIS B  2  218 ? 151.452 137.998 107.160 1.00 32.79  ? 218 HIS B CE1 1 
ATOM   4416  N NE2 . HIS B  2  218 ? 152.042 139.090 106.711 1.00 32.79  ? 218 HIS B NE2 1 
ATOM   4417  N N   . LEU B  2  219 ? 152.618 138.073 113.235 1.00 32.26  ? 219 LEU B N   1 
ATOM   4418  C CA  . LEU B  2  219 ? 153.111 137.843 114.582 1.00 32.26  ? 219 LEU B CA  1 
ATOM   4419  C C   . LEU B  2  219 ? 153.617 136.416 114.699 1.00 32.26  ? 219 LEU B C   1 
ATOM   4420  O O   . LEU B  2  219 ? 153.173 135.521 113.977 1.00 32.26  ? 219 LEU B O   1 
ATOM   4421  C CB  . LEU B  2  219 ? 152.026 138.099 115.630 1.00 32.26  ? 219 LEU B CB  1 
ATOM   4422  C CG  . LEU B  2  219 ? 151.598 139.550 115.811 1.00 32.26  ? 219 LEU B CG  1 
ATOM   4423  C CD1 . LEU B  2  219 ? 150.404 139.645 116.736 1.00 32.26  ? 219 LEU B CD1 1 
ATOM   4424  C CD2 . LEU B  2  219 ? 152.754 140.354 116.357 1.00 32.26  ? 219 LEU B CD2 1 
ATOM   4425  N N   . LYS B  2  220 ? 154.552 136.215 115.623 1.00 38.90  ? 220 LYS B N   1 
ATOM   4426  C CA  . LYS B  2  220 ? 155.081 134.899 115.942 1.00 38.90  ? 220 LYS B CA  1 
ATOM   4427  C C   . LYS B  2  220 ? 155.348 134.838 117.436 1.00 38.90  ? 220 LYS B C   1 
ATOM   4428  O O   . LYS B  2  220 ? 155.811 135.816 118.027 1.00 38.90  ? 220 LYS B O   1 
ATOM   4429  C CB  . LYS B  2  220 ? 156.367 134.605 115.168 1.00 38.90  ? 220 LYS B CB  1 
ATOM   4430  C CG  . LYS B  2  220 ? 156.911 133.206 115.380 1.00 38.90  ? 220 LYS B CG  1 
ATOM   4431  C CD  . LYS B  2  220 ? 158.143 132.965 114.527 1.00 38.90  ? 220 LYS B CD  1 
ATOM   4432  C CE  . LYS B  2  220 ? 158.693 131.568 114.731 1.00 38.90  ? 220 LYS B CE  1 
ATOM   4433  N NZ  . LYS B  2  220 ? 159.910 131.343 113.909 1.00 38.90  ? 220 LYS B NZ  1 
ATOM   4434  N N   . ARG B  2  221 ? 155.061 133.692 118.042 1.00 40.61  ? 221 ARG B N   1 
ATOM   4435  C CA  . ARG B  2  221 ? 155.225 133.526 119.478 1.00 40.61  ? 221 ARG B CA  1 
ATOM   4436  C C   . ARG B  2  221 ? 156.636 133.047 119.783 1.00 40.61  ? 221 ARG B C   1 
ATOM   4437  O O   . ARG B  2  221 ? 157.145 132.138 119.123 1.00 40.61  ? 221 ARG B O   1 
ATOM   4438  C CB  . ARG B  2  221 ? 154.209 132.529 120.032 1.00 40.61  ? 221 ARG B CB  1 
ATOM   4439  C CG  . ARG B  2  221 ? 154.212 132.437 121.544 1.00 40.61  ? 221 ARG B CG  1 
ATOM   4440  C CD  . ARG B  2  221 ? 153.266 131.357 122.025 1.00 40.61  ? 221 ARG B CD  1 
ATOM   4441  N NE  . ARG B  2  221 ? 151.872 131.648 121.720 1.00 40.61  ? 221 ARG B NE  1 
ATOM   4442  C CZ  . ARG B  2  221 ? 151.069 132.341 122.515 1.00 40.61  ? 221 ARG B CZ  1 
ATOM   4443  N NH1 . ARG B  2  221 ? 151.522 132.804 123.670 1.00 40.61  ? 221 ARG B NH1 1 
ATOM   4444  N NH2 . ARG B  2  221 ? 149.811 132.561 122.164 1.00 40.61  ? 221 ARG B NH2 1 
ATOM   4445  N N   . LYS B  2  222 ? 157.267 133.666 120.775 1.00 38.53  ? 222 LYS B N   1 
ATOM   4446  C CA  . LYS B  2  222 ? 158.584 133.229 121.207 1.00 38.53  ? 222 LYS B CA  1 
ATOM   4447  C C   . LYS B  2  222 ? 158.465 131.961 122.038 1.00 38.53  ? 222 LYS B C   1 
ATOM   4448  O O   . LYS B  2  222 ? 157.584 131.840 122.894 1.00 38.53  ? 222 LYS B O   1 
ATOM   4449  C CB  . LYS B  2  222 ? 159.285 134.321 122.011 1.00 38.53  ? 222 LYS B CB  1 
ATOM   4450  C CG  . LYS B  2  222 ? 159.669 135.535 121.193 1.00 38.53  ? 222 LYS B CG  1 
ATOM   4451  C CD  . LYS B  2  222 ? 160.565 136.464 121.984 1.00 38.53  ? 222 LYS B CD  1 
ATOM   4452  C CE  . LYS B  2  222 ? 159.789 137.197 123.057 1.00 38.53  ? 222 LYS B CE  1 
ATOM   4453  N NZ  . LYS B  2  222 ? 160.638 138.200 123.753 1.00 38.53  ? 222 LYS B NZ  1 
ATOM   4454  N N   . ILE B  2  223 ? 159.363 131.009 121.777 1.00 53.38  ? 223 ILE B N   1 
ATOM   4455  C CA  . ILE B  2  223 ? 159.315 129.704 122.427 1.00 53.38  ? 223 ILE B CA  1 
ATOM   4456  C C   . ILE B  2  223 ? 160.341 129.572 123.547 1.00 53.38  ? 223 ILE B C   1 
ATOM   4457  O O   . ILE B  2  223 ? 160.324 128.565 124.274 1.00 53.38  ? 223 ILE B O   1 
ATOM   4458  C CB  . ILE B  2  223 ? 159.508 128.578 121.386 1.00 53.38  ? 223 ILE B CB  1 
ATOM   4459  C CG1 . ILE B  2  223 ? 159.093 127.220 121.950 1.00 53.38  ? 223 ILE B CG1 1 
ATOM   4460  C CG2 . ILE B  2  223 ? 160.945 128.540 120.912 1.00 53.38  ? 223 ILE B CG2 1 
ATOM   4461  C CD1 . ILE B  2  223 ? 158.988 126.144 120.909 1.00 53.38  ? 223 ILE B CD1 1 
ATOM   4462  N N   . GLY B  2  224 ? 161.212 130.565 123.731 1.00 55.68  ? 224 GLY B N   1 
ATOM   4463  C CA  . GLY B  2  224 ? 162.269 130.444 124.721 1.00 55.68  ? 224 GLY B CA  1 
ATOM   4464  C C   . GLY B  2  224 ? 161.769 130.222 126.134 1.00 55.68  ? 224 GLY B C   1 
ATOM   4465  O O   . GLY B  2  224 ? 162.493 129.681 126.973 1.00 55.68  ? 224 GLY B O   1 
ATOM   4466  N N   . TYR B  2  225 ? 160.536 130.630 126.421 1.00 66.48  ? 225 TYR B N   1 
ATOM   4467  C CA  . TYR B  2  225 ? 160.006 130.543 127.776 1.00 66.48  ? 225 TYR B CA  1 
ATOM   4468  C C   . TYR B  2  225 ? 159.312 129.214 128.051 1.00 66.48  ? 225 TYR B C   1 
ATOM   4469  O O   . TYR B  2  225 ? 159.599 128.558 129.057 1.00 66.48  ? 225 TYR B O   1 
ATOM   4470  C CB  . TYR B  2  225 ? 159.039 131.699 128.026 1.00 66.48  ? 225 TYR B CB  1 
ATOM   4471  C CG  . TYR B  2  225 ? 158.452 131.723 129.416 1.00 66.48  ? 225 TYR B CG  1 
ATOM   4472  C CD1 . TYR B  2  225 ? 159.220 132.103 130.507 1.00 66.48  ? 225 TYR B CD1 1 
ATOM   4473  C CD2 . TYR B  2  225 ? 157.125 131.385 129.633 1.00 66.48  ? 225 TYR B CD2 1 
ATOM   4474  C CE1 . TYR B  2  225 ? 158.686 132.133 131.777 1.00 66.48  ? 225 TYR B CE1 1 
ATOM   4475  C CE2 . TYR B  2  225 ? 156.581 131.413 130.899 1.00 66.48  ? 225 TYR B CE2 1 
ATOM   4476  C CZ  . TYR B  2  225 ? 157.366 131.789 131.966 1.00 66.48  ? 225 TYR B CZ  1 
ATOM   4477  O OH  . TYR B  2  225 ? 156.827 131.817 133.232 1.00 66.48  ? 225 TYR B OH  1 
ATOM   4478  N N   . PHE B  2  226 ? 158.399 128.806 127.168 1.00 65.56  ? 226 PHE B N   1 
ATOM   4479  C CA  . PHE B  2  226 ? 157.607 127.604 127.398 1.00 65.56  ? 226 PHE B CA  1 
ATOM   4480  C C   . PHE B  2  226 ? 158.441 126.333 127.385 1.00 65.56  ? 226 PHE B C   1 
ATOM   4481  O O   . PHE B  2  226 ? 157.940 125.284 127.800 1.00 65.56  ? 226 PHE B O   1 
ATOM   4482  C CB  . PHE B  2  226 ? 156.493 127.510 126.358 1.00 65.56  ? 226 PHE B CB  1 
ATOM   4483  C CG  . PHE B  2  226 ? 155.437 128.562 126.514 1.00 65.56  ? 226 PHE B CG  1 
ATOM   4484  C CD1 . PHE B  2  226 ? 155.333 129.284 127.687 1.00 65.56  ? 226 PHE B CD1 1 
ATOM   4485  C CD2 . PHE B  2  226 ? 154.555 128.834 125.489 1.00 65.56  ? 226 PHE B CD2 1 
ATOM   4486  C CE1 . PHE B  2  226 ? 154.367 130.255 127.835 1.00 65.56  ? 226 PHE B CE1 1 
ATOM   4487  C CE2 . PHE B  2  226 ? 153.586 129.804 125.630 1.00 65.56  ? 226 PHE B CE2 1 
ATOM   4488  C CZ  . PHE B  2  226 ? 153.491 130.515 126.805 1.00 65.56  ? 226 PHE B CZ  1 
ATOM   4489  N N   . VAL B  2  227 ? 159.688 126.396 126.922 1.00 66.22  ? 227 VAL B N   1 
ATOM   4490  C CA  . VAL B  2  227 ? 160.575 125.244 127.032 1.00 66.22  ? 227 VAL B CA  1 
ATOM   4491  C C   . VAL B  2  227 ? 161.010 125.052 128.478 1.00 66.22  ? 227 VAL B C   1 
ATOM   4492  O O   . VAL B  2  227 ? 160.766 124.003 129.085 1.00 66.22  ? 227 VAL B O   1 
ATOM   4493  C CB  . VAL B  2  227 ? 161.783 125.400 126.094 1.00 66.22  ? 227 VAL B CB  1 
ATOM   4494  C CG1 . VAL B  2  227 ? 162.776 124.279 126.324 1.00 66.22  ? 227 VAL B CG1 1 
ATOM   4495  C CG2 . VAL B  2  227 ? 161.324 125.407 124.650 1.00 66.22  ? 227 VAL B CG2 1 
ATOM   4496  N N   . ILE B  2  228 ? 161.650 126.074 129.059 1.00 61.76  ? 228 ILE B N   1 
ATOM   4497  C CA  . ILE B  2  228 ? 162.125 125.979 130.438 1.00 61.76  ? 228 ILE B CA  1 
ATOM   4498  C C   . ILE B  2  228 ? 161.019 126.177 131.455 1.00 61.76  ? 228 ILE B C   1 
ATOM   4499  O O   . ILE B  2  228 ? 161.292 126.152 132.662 1.00 61.76  ? 228 ILE B O   1 
ATOM   4500  C CB  . ILE B  2  228 ? 163.233 127.007 130.739 1.00 61.76  ? 228 ILE B CB  1 
ATOM   4501  C CG1 . ILE B  2  228 ? 162.673 128.425 130.688 1.00 61.76  ? 228 ILE B CG1 1 
ATOM   4502  C CG2 . ILE B  2  228 ? 164.373 126.860 129.749 1.00 61.76  ? 228 ILE B CG2 1 
ATOM   4503  C CD1 . ILE B  2  228 ? 163.626 129.470 131.213 1.00 61.76  ? 228 ILE B CD1 1 
ATOM   4504  N N   . GLN B  2  229 ? 159.781 126.391 131.013 1.00 66.29  ? 229 GLN B N   1 
ATOM   4505  C CA  . GLN B  2  229 ? 158.678 126.569 131.947 1.00 66.29  ? 229 GLN B CA  1 
ATOM   4506  C C   . GLN B  2  229 ? 157.909 125.278 132.202 1.00 66.29  ? 229 GLN B C   1 
ATOM   4507  O O   . GLN B  2  229 ? 157.698 124.901 133.358 1.00 66.29  ? 229 GLN B O   1 
ATOM   4508  C CB  . GLN B  2  229 ? 157.728 127.654 131.438 1.00 66.29  ? 229 GLN B CB  1 
ATOM   4509  C CG  . GLN B  2  229 ? 156.538 127.879 132.344 1.00 66.29  ? 229 GLN B CG  1 
ATOM   4510  C CD  . GLN B  2  229 ? 156.951 128.251 133.745 1.00 66.29  ? 229 GLN B CD  1 
ATOM   4511  O OE1 . GLN B  2  229 ? 156.888 127.430 134.656 1.00 66.29  ? 229 GLN B OE1 1 
ATOM   4512  N NE2 . GLN B  2  229 ? 157.380 129.491 133.928 1.00 66.29  ? 229 GLN B NE2 1 
ATOM   4513  N N   . THR B  2  230 ? 157.475 124.603 131.151 1.00 67.94  ? 230 THR B N   1 
ATOM   4514  C CA  . THR B  2  230 ? 156.610 123.442 131.329 1.00 67.94  ? 230 THR B CA  1 
ATOM   4515  C C   . THR B  2  230 ? 157.119 122.193 130.625 1.00 67.94  ? 230 THR B C   1 
ATOM   4516  O O   . THR B  2  230 ? 157.009 121.099 131.182 1.00 67.94  ? 230 THR B O   1 
ATOM   4517  C CB  . THR B  2  230 ? 155.193 123.779 130.838 1.00 67.94  ? 230 THR B CB  1 
ATOM   4518  O OG1 . THR B  2  230 ? 154.690 124.899 131.575 1.00 67.94  ? 230 THR B OG1 1 
ATOM   4519  C CG2 . THR B  2  230 ? 154.259 122.599 131.036 1.00 67.94  ? 230 THR B CG2 1 
ATOM   4520  N N   . TYR B  2  231 ? 157.686 122.324 129.424 1.00 69.73  ? 231 TYR B N   1 
ATOM   4521  C CA  . TYR B  2  231 ? 158.134 121.139 128.700 1.00 69.73  ? 231 TYR B CA  1 
ATOM   4522  C C   . TYR B  2  231 ? 159.338 120.497 129.376 1.00 69.73  ? 231 TYR B C   1 
ATOM   4523  O O   . TYR B  2  231 ? 159.366 119.276 129.580 1.00 69.73  ? 231 TYR B O   1 
ATOM   4524  C CB  . TYR B  2  231 ? 158.464 121.495 127.251 1.00 69.73  ? 231 TYR B CB  1 
ATOM   4525  C CG  . TYR B  2  231 ? 157.254 121.808 126.403 1.00 69.73  ? 231 TYR B CG  1 
ATOM   4526  C CD1 . TYR B  2  231 ? 155.978 121.507 126.845 1.00 69.73  ? 231 TYR B CD1 1 
ATOM   4527  C CD2 . TYR B  2  231 ? 157.390 122.393 125.153 1.00 69.73  ? 231 TYR B CD2 1 
ATOM   4528  C CE1 . TYR B  2  231 ? 154.872 121.788 126.073 1.00 69.73  ? 231 TYR B CE1 1 
ATOM   4529  C CE2 . TYR B  2  231 ? 156.289 122.674 124.372 1.00 69.73  ? 231 TYR B CE2 1 
ATOM   4530  C CZ  . TYR B  2  231 ? 155.032 122.370 124.838 1.00 69.73  ? 231 TYR B CZ  1 
ATOM   4531  O OH  . TYR B  2  231 ? 153.929 122.648 124.068 1.00 69.73  ? 231 TYR B OH  1 
ATOM   4532  N N   . LEU B  2  232 ? 160.324 121.301 129.758 1.00 65.34  ? 232 LEU B N   1 
ATOM   4533  C CA  . LEU B  2  232 ? 161.536 120.752 130.350 1.00 65.34  ? 232 LEU B CA  1 
ATOM   4534  C C   . LEU B  2  232 ? 161.260 120.196 131.747 1.00 65.34  ? 232 LEU B C   1 
ATOM   4535  O O   . LEU B  2  232 ? 161.795 119.136 132.085 1.00 65.34  ? 232 LEU B O   1 
ATOM   4536  C CB  . LEU B  2  232 ? 162.651 121.800 130.388 1.00 65.34  ? 232 LEU B CB  1 
ATOM   4537  C CG  . LEU B  2  232 ? 164.013 121.255 130.810 1.00 65.34  ? 232 LEU B CG  1 
ATOM   4538  C CD1 . LEU B  2  232 ? 164.488 120.226 129.804 1.00 65.34  ? 232 LEU B CD1 1 
ATOM   4539  C CD2 . LEU B  2  232 ? 165.020 122.377 130.937 1.00 65.34  ? 232 LEU B CD2 1 
ATOM   4540  N N   . PRO B  2  233 ? 160.454 120.855 132.590 1.00 66.51  ? 233 PRO B N   1 
ATOM   4541  C CA  . PRO B  2  233 ? 160.077 120.210 133.859 1.00 66.51  ? 233 PRO B CA  1 
ATOM   4542  C C   . PRO B  2  233 ? 159.288 118.928 133.682 1.00 66.51  ? 233 PRO B C   1 
ATOM   4543  O O   . PRO B  2  233 ? 159.480 117.992 134.467 1.00 66.51  ? 233 PRO B O   1 
ATOM   4544  C CB  . PRO B  2  233 ? 159.251 121.289 134.570 1.00 66.51  ? 233 PRO B CB  1 
ATOM   4545  C CG  . PRO B  2  233 ? 159.771 122.553 134.022 1.00 66.51  ? 233 PRO B CG  1 
ATOM   4546  C CD  . PRO B  2  233 ? 160.073 122.279 132.587 1.00 66.51  ? 233 PRO B CD  1 
ATOM   4547  N N   . CYS B  2  234 ? 158.423 118.831 132.669 1.00 72.27  ? 234 CYS B N   1 
ATOM   4548  C CA  . CYS B  2  234 ? 157.678 117.589 132.497 1.00 72.27  ? 234 CYS B CA  1 
ATOM   4549  C C   . CYS B  2  234 ? 158.598 116.471 132.028 1.00 72.27  ? 234 CYS B C   1 
ATOM   4550  O O   . CYS B  2  234 ? 158.474 115.328 132.481 1.00 72.27  ? 234 CYS B O   1 
ATOM   4551  C CB  . CYS B  2  234 ? 156.530 117.779 131.505 1.00 72.27  ? 234 CYS B CB  1 
ATOM   4552  S SG  . CYS B  2  234 ? 155.138 116.621 131.713 1.00 72.27  ? 234 CYS B SG  1 
ATOM   4553  N N   . ILE B  2  235 ? 159.537 116.788 131.130 1.00 71.78  ? 235 ILE B N   1 
ATOM   4554  C CA  . ILE B  2  235 ? 160.537 115.805 130.716 1.00 71.78  ? 235 ILE B CA  1 
ATOM   4555  C C   . ILE B  2  235 ? 161.393 115.365 131.899 1.00 71.78  ? 235 ILE B C   1 
ATOM   4556  O O   . ILE B  2  235 ? 161.661 114.169 132.080 1.00 71.78  ? 235 ILE B O   1 
ATOM   4557  C CB  . ILE B  2  235 ? 161.399 116.374 129.577 1.00 71.78  ? 235 ILE B CB  1 
ATOM   4558  C CG1 . ILE B  2  235 ? 160.551 116.559 128.321 1.00 71.78  ? 235 ILE B CG1 1 
ATOM   4559  C CG2 . ILE B  2  235 ? 162.583 115.478 129.301 1.00 71.78  ? 235 ILE B CG2 1 
ATOM   4560  C CD1 . ILE B  2  235 ? 161.238 117.337 127.224 1.00 71.78  ? 235 ILE B CD1 1 
ATOM   4561  N N   . MET B  2  236 ? 161.841 116.318 132.721 1.00 73.22  ? 236 MET B N   1 
ATOM   4562  C CA  . MET B  2  236 ? 162.662 115.966 133.875 1.00 73.22  ? 236 MET B CA  1 
ATOM   4563  C C   . MET B  2  236 ? 161.889 115.107 134.869 1.00 73.22  ? 236 MET B C   1 
ATOM   4564  O O   . MET B  2  236 ? 162.446 114.170 135.445 1.00 73.22  ? 236 MET B O   1 
ATOM   4565  C CB  . MET B  2  236 ? 163.202 117.227 134.552 1.00 73.22  ? 236 MET B CB  1 
ATOM   4566  C CG  . MET B  2  236 ? 164.251 117.981 133.734 1.00 73.22  ? 236 MET B CG  1 
ATOM   4567  S SD  . MET B  2  236 ? 165.776 117.055 133.443 1.00 73.22  ? 236 MET B SD  1 
ATOM   4568  C CE  . MET B  2  236 ? 165.580 116.573 131.728 1.00 73.22  ? 236 MET B CE  1 
ATOM   4569  N N   . THR B  2  237 ? 160.600 115.390 135.068 1.00 72.04  ? 237 THR B N   1 
ATOM   4570  C CA  . THR B  2  237 ? 159.823 114.586 136.007 1.00 72.04  ? 237 THR B CA  1 
ATOM   4571  C C   . THR B  2  237 ? 159.558 113.188 135.457 1.00 72.04  ? 237 THR B C   1 
ATOM   4572  O O   . THR B  2  237 ? 159.609 112.204 136.205 1.00 72.04  ? 237 THR B O   1 
ATOM   4573  C CB  . THR B  2  237 ? 158.510 115.286 136.351 1.00 72.04  ? 237 THR B CB  1 
ATOM   4574  O OG1 . THR B  2  237 ? 158.793 116.574 136.909 1.00 72.04  ? 237 THR B OG1 1 
ATOM   4575  C CG2 . THR B  2  237 ? 157.736 114.479 137.374 1.00 72.04  ? 237 THR B CG2 1 
ATOM   4576  N N   . VAL B  2  238 ? 159.294 113.072 134.153 1.00 75.41  ? 238 VAL B N   1 
ATOM   4577  C CA  . VAL B  2  238 ? 159.116 111.746 133.564 1.00 75.41  ? 238 VAL B CA  1 
ATOM   4578  C C   . VAL B  2  238 ? 160.405 110.939 133.668 1.00 75.41  ? 238 VAL B C   1 
ATOM   4579  O O   . VAL B  2  238 ? 160.383 109.751 134.012 1.00 75.41  ? 238 VAL B O   1 
ATOM   4580  C CB  . VAL B  2  238 ? 158.634 111.855 132.106 1.00 75.41  ? 238 VAL B CB  1 
ATOM   4581  C CG1 . VAL B  2  238 ? 158.620 110.484 131.449 1.00 75.41  ? 238 VAL B CG1 1 
ATOM   4582  C CG2 . VAL B  2  238 ? 157.250 112.464 132.052 1.00 75.41  ? 238 VAL B CG2 1 
ATOM   4583  N N   . ILE B  2  239 ? 161.547 111.569 133.386 1.00 73.23  ? 239 ILE B N   1 
ATOM   4584  C CA  . ILE B  2  239 ? 162.822 110.866 133.498 1.00 73.23  ? 239 ILE B CA  1 
ATOM   4585  C C   . ILE B  2  239 ? 163.106 110.495 134.948 1.00 73.23  ? 239 ILE B C   1 
ATOM   4586  O O   . ILE B  2  239 ? 163.633 109.413 135.235 1.00 73.23  ? 239 ILE B O   1 
ATOM   4587  C CB  . ILE B  2  239 ? 163.954 111.715 132.892 1.00 73.23  ? 239 ILE B CB  1 
ATOM   4588  C CG1 . ILE B  2  239 ? 163.759 111.864 131.384 1.00 73.23  ? 239 ILE B CG1 1 
ATOM   4589  C CG2 . ILE B  2  239 ? 165.312 111.101 133.191 1.00 73.23  ? 239 ILE B CG2 1 
ATOM   4590  C CD1 . ILE B  2  239 ? 164.695 112.868 130.751 1.00 73.23  ? 239 ILE B CD1 1 
ATOM   4591  N N   . LEU B  2  240 ? 162.756 111.377 135.886 1.00 71.65  ? 240 LEU B N   1 
ATOM   4592  C CA  . LEU B  2  240 ? 162.959 111.085 137.299 1.00 71.65  ? 240 LEU B CA  1 
ATOM   4593  C C   . LEU B  2  240 ? 162.111 109.903 137.739 1.00 71.65  ? 240 LEU B C   1 
ATOM   4594  O O   . LEU B  2  240 ? 162.557 109.075 138.540 1.00 71.65  ? 240 LEU B O   1 
ATOM   4595  C CB  . LEU B  2  240 ? 162.646 112.329 138.133 1.00 71.65  ? 240 LEU B CB  1 
ATOM   4596  C CG  . LEU B  2  240 ? 162.906 112.322 139.641 1.00 71.65  ? 240 LEU B CG  1 
ATOM   4597  C CD1 . LEU B  2  240 ? 163.299 113.713 140.107 1.00 71.65  ? 240 LEU B CD1 1 
ATOM   4598  C CD2 . LEU B  2  240 ? 161.671 111.866 140.393 1.00 71.65  ? 240 LEU B CD2 1 
ATOM   4599  N N   . SER B  2  241 ? 160.894 109.790 137.203 1.00 73.22  ? 241 SER B N   1 
ATOM   4600  C CA  . SER B  2  241 ? 160.007 108.689 137.564 1.00 73.22  ? 241 SER B CA  1 
ATOM   4601  C C   . SER B  2  241 ? 160.598 107.318 137.251 1.00 73.22  ? 241 SER B C   1 
ATOM   4602  O O   . SER B  2  241 ? 160.008 106.306 137.646 1.00 73.22  ? 241 SER B O   1 
ATOM   4603  C CB  . SER B  2  241 ? 158.663 108.848 136.854 1.00 73.22  ? 241 SER B CB  1 
ATOM   4604  O OG  . SER B  2  241 ? 158.811 108.705 135.454 1.00 73.22  ? 241 SER B OG  1 
ATOM   4605  N N   . GLN B  2  242 ? 161.741 107.255 136.560 1.00 80.35  ? 242 GLN B N   1 
ATOM   4606  C CA  . GLN B  2  242 ? 162.379 105.973 136.278 1.00 80.35  ? 242 GLN B CA  1 
ATOM   4607  C C   . GLN B  2  242 ? 162.950 105.329 137.535 1.00 80.35  ? 242 GLN B C   1 
ATOM   4608  O O   . GLN B  2  242 ? 163.099 104.103 137.584 1.00 80.35  ? 242 GLN B O   1 
ATOM   4609  C CB  . GLN B  2  242 ? 163.493 106.153 135.248 1.00 80.35  ? 242 GLN B CB  1 
ATOM   4610  C CG  . GLN B  2  242 ? 163.031 106.593 133.875 1.00 80.35  ? 242 GLN B CG  1 
ATOM   4611  C CD  . GLN B  2  242 ? 164.195 106.814 132.931 1.00 80.35  ? 242 GLN B CD  1 
ATOM   4612  O OE1 . GLN B  2  242 ? 165.355 106.664 133.314 1.00 80.35  ? 242 GLN B OE1 1 
ATOM   4613  N NE2 . GLN B  2  242 ? 163.892 107.190 131.695 1.00 80.35  ? 242 GLN B NE2 1 
ATOM   4614  N N   . VAL B  2  243 ? 163.287 106.131 138.549 1.00 80.28  ? 243 VAL B N   1 
ATOM   4615  C CA  . VAL B  2  243 ? 163.969 105.607 139.730 1.00 80.28  ? 243 VAL B CA  1 
ATOM   4616  C C   . VAL B  2  243 ? 163.116 104.563 140.437 1.00 80.28  ? 243 VAL B C   1 
ATOM   4617  O O   . VAL B  2  243 ? 163.647 103.641 141.069 1.00 80.28  ? 243 VAL B O   1 
ATOM   4618  C CB  . VAL B  2  243 ? 164.353 106.764 140.674 1.00 80.28  ? 243 VAL B CB  1 
ATOM   4619  C CG1 . VAL B  2  243 ? 164.997 106.237 141.945 1.00 80.28  ? 243 VAL B CG1 1 
ATOM   4620  C CG2 . VAL B  2  243 ? 165.292 107.727 139.970 1.00 80.28  ? 243 VAL B CG2 1 
ATOM   4621  N N   . SER B  2  244 ? 161.790 104.669 140.324 1.00 79.09  ? 244 SER B N   1 
ATOM   4622  C CA  . SER B  2  244 ? 160.909 103.709 140.984 1.00 79.09  ? 244 SER B CA  1 
ATOM   4623  C C   . SER B  2  244 ? 161.201 102.281 140.536 1.00 79.09  ? 244 SER B C   1 
ATOM   4624  O O   . SER B  2  244 ? 161.108 101.341 141.334 1.00 79.09  ? 244 SER B O   1 
ATOM   4625  C CB  . SER B  2  244 ? 159.450 104.068 140.711 1.00 79.09  ? 244 SER B CB  1 
ATOM   4626  O OG  . SER B  2  244 ? 158.572 103.145 141.327 1.00 79.09  ? 244 SER B OG  1 
ATOM   4627  N N   . PHE B  2  245 ? 161.564 102.099 139.266 1.00 84.41  ? 245 PHE B N   1 
ATOM   4628  C CA  . PHE B  2  245 ? 161.806 100.755 138.752 1.00 84.41  ? 245 PHE B CA  1 
ATOM   4629  C C   . PHE B  2  245 ? 163.099 100.170 139.305 1.00 84.41  ? 245 PHE B C   1 
ATOM   4630  O O   . PHE B  2  245 ? 163.165 98.975  139.612 1.00 84.41  ? 245 PHE B O   1 
ATOM   4631  C CB  . PHE B  2  245 ? 161.848 100.784 137.227 1.00 84.41  ? 245 PHE B CB  1 
ATOM   4632  C CG  . PHE B  2  245 ? 160.556 101.204 136.597 1.00 84.41  ? 245 PHE B CG  1 
ATOM   4633  C CD1 . PHE B  2  245 ? 159.526 100.299 136.427 1.00 84.41  ? 245 PHE B CD1 1 
ATOM   4634  C CD2 . PHE B  2  245 ? 160.368 102.509 136.181 1.00 84.41  ? 245 PHE B CD2 1 
ATOM   4635  C CE1 . PHE B  2  245 ? 158.338 100.686 135.847 1.00 84.41  ? 245 PHE B CE1 1 
ATOM   4636  C CE2 . PHE B  2  245 ? 159.181 102.900 135.604 1.00 84.41  ? 245 PHE B CE2 1 
ATOM   4637  C CZ  . PHE B  2  245 ? 158.165 101.986 135.439 1.00 84.41  ? 245 PHE B CZ  1 
ATOM   4638  N N   . TRP B  2  246 ? 164.139 100.994 139.432 1.00 90.34  ? 246 TRP B N   1 
ATOM   4639  C CA  . TRP B  2  246 ? 165.444 100.519 139.869 1.00 90.34  ? 246 TRP B CA  1 
ATOM   4640  C C   . TRP B  2  246 ? 165.518 100.253 141.367 1.00 90.34  ? 246 TRP B C   1 
ATOM   4641  O O   . TRP B  2  246 ? 166.526 99.711  141.831 1.00 90.34  ? 246 TRP B O   1 
ATOM   4642  C CB  . TRP B  2  246 ? 166.523 101.528 139.471 1.00 90.34  ? 246 TRP B CB  1 
ATOM   4643  C CG  . TRP B  2  246 ? 166.707 101.653 137.987 1.00 90.34  ? 246 TRP B CG  1 
ATOM   4644  C CD1 . TRP B  2  246 ? 166.162 102.600 137.170 1.00 90.34  ? 246 TRP B CD1 1 
ATOM   4645  C CD2 . TRP B  2  246 ? 167.489 100.800 137.144 1.00 90.34  ? 246 TRP B CD2 1 
ATOM   4646  N NE1 . TRP B  2  246 ? 166.557 102.391 135.873 1.00 90.34  ? 246 TRP B NE1 1 
ATOM   4647  C CE2 . TRP B  2  246 ? 167.372 101.292 135.829 1.00 90.34  ? 246 TRP B CE2 1 
ATOM   4648  C CE3 . TRP B  2  246 ? 168.278 99.669  137.373 1.00 90.34  ? 246 TRP B CE3 1 
ATOM   4649  C CZ2 . TRP B  2  246 ? 168.013 100.693 134.749 1.00 90.34  ? 246 TRP B CZ2 1 
ATOM   4650  C CZ3 . TRP B  2  246 ? 168.914 99.076  136.299 1.00 90.34  ? 246 TRP B CZ3 1 
ATOM   4651  C CH2 . TRP B  2  246 ? 168.778 99.589  135.004 1.00 90.34  ? 246 TRP B CH2 1 
ATOM   4652  N N   . LEU B  2  247 ? 164.495 100.625 142.130 1.00 84.56  ? 247 LEU B N   1 
ATOM   4653  C CA  . LEU B  2  247 ? 164.498 100.367 143.561 1.00 84.56  ? 247 LEU B CA  1 
ATOM   4654  C C   . LEU B  2  247 ? 164.148 98.911  143.853 1.00 84.56  ? 247 LEU B C   1 
ATOM   4655  O O   . LEU B  2  247 ? 163.689 98.165  142.984 1.00 84.56  ? 247 LEU B O   1 
ATOM   4656  C CB  . LEU B  2  247 ? 163.519 101.293 144.282 1.00 84.56  ? 247 LEU B CB  1 
ATOM   4657  C CG  . LEU B  2  247 ? 163.883 102.776 144.280 1.00 84.56  ? 247 LEU B CG  1 
ATOM   4658  C CD1 . LEU B  2  247 ? 162.787 103.595 144.938 1.00 84.56  ? 247 LEU B CD1 1 
ATOM   4659  C CD2 . LEU B  2  247 ? 165.219 102.999 144.971 1.00 84.56  ? 247 LEU B CD2 1 
ATOM   4660  N N   . ASN B  2  248 ? 164.379 98.513  145.103 1.00 92.36  ? 248 ASN B N   1 
ATOM   4661  C CA  . ASN B  2  248 ? 164.047 97.164  145.537 1.00 92.36  ? 248 ASN B CA  1 
ATOM   4662  C C   . ASN B  2  248 ? 162.554 96.911  145.382 1.00 92.36  ? 248 ASN B C   1 
ATOM   4663  O O   . ASN B  2  248 ? 161.729 97.806  145.585 1.00 92.36  ? 248 ASN B O   1 
ATOM   4664  C CB  . ASN B  2  248 ? 164.469 96.960  146.993 1.00 92.36  ? 248 ASN B CB  1 
ATOM   4665  C CG  . ASN B  2  248 ? 164.343 95.517  147.444 1.00 92.36  ? 248 ASN B CG  1 
ATOM   4666  O OD1 . ASN B  2  248 ? 163.928 94.648  146.680 1.00 92.36  ? 248 ASN B OD1 1 
ATOM   4667  N ND2 . ASN B  2  248 ? 164.702 95.257  148.696 1.00 92.36  ? 248 ASN B ND2 1 
ATOM   4668  N N   . ARG B  2  249 ? 162.208 95.678  145.017 1.00 92.56  ? 249 ARG B N   1 
ATOM   4669  C CA  . ARG B  2  249 ? 160.815 95.314  144.796 1.00 92.56  ? 249 ARG B CA  1 
ATOM   4670  C C   . ARG B  2  249 ? 160.044 95.086  146.088 1.00 92.56  ? 249 ARG B C   1 
ATOM   4671  O O   . ARG B  2  249 ? 158.821 94.921  146.037 1.00 92.56  ? 249 ARG B O   1 
ATOM   4672  C CB  . ARG B  2  249 ? 160.725 94.068  143.907 1.00 92.56  ? 249 ARG B CB  1 
ATOM   4673  C CG  . ARG B  2  249 ? 161.066 92.745  144.585 1.00 92.56  ? 249 ARG B CG  1 
ATOM   4674  C CD  . ARG B  2  249 ? 162.566 92.568  144.755 1.00 92.56  ? 249 ARG B CD  1 
ATOM   4675  N NE  . ARG B  2  249 ? 163.266 92.563  143.475 1.00 92.56  ? 249 ARG B NE  1 
ATOM   4676  C CZ  . ARG B  2  249 ? 164.522 92.965  143.311 1.00 92.56  ? 249 ARG B CZ  1 
ATOM   4677  N NH1 . ARG B  2  249 ? 165.081 92.930  142.109 1.00 92.56  ? 249 ARG B NH1 1 
ATOM   4678  N NH2 . ARG B  2  249 ? 165.222 93.404  144.348 1.00 92.56  ? 249 ARG B NH2 1 
ATOM   4679  N N   . GLU B  2  250 ? 160.720 95.071  147.237 1.00 87.08  ? 250 GLU B N   1 
ATOM   4680  C CA  . GLU B  2  250 ? 160.025 94.871  148.503 1.00 87.08  ? 250 GLU B CA  1 
ATOM   4681  C C   . GLU B  2  250 ? 159.475 96.169  149.079 1.00 87.08  ? 250 GLU B C   1 
ATOM   4682  O O   . GLU B  2  250 ? 158.434 96.154  149.746 1.00 87.08  ? 250 GLU B O   1 
ATOM   4683  C CB  . GLU B  2  250 ? 160.961 94.208  149.515 1.00 87.08  ? 250 GLU B CB  1 
ATOM   4684  C CG  . GLU B  2  250 ? 161.333 92.776  149.170 1.00 87.08  ? 250 GLU B CG  1 
ATOM   4685  C CD  . GLU B  2  250 ? 162.266 92.156  150.187 1.00 87.08  ? 250 GLU B CD  1 
ATOM   4686  O OE1 . GLU B  2  250 ? 162.731 92.881  151.091 1.00 87.08  ? 250 GLU B OE1 1 
ATOM   4687  O OE2 . GLU B  2  250 ? 162.534 90.941  150.085 1.00 87.08  ? 250 GLU B OE2 1 
ATOM   4688  N N   . SER B  2  251 ? 160.145 97.291  148.835 1.00 87.64  ? 251 SER B N   1 
ATOM   4689  C CA  . SER B  2  251 ? 159.806 98.557  149.484 1.00 87.64  ? 251 SER B CA  1 
ATOM   4690  C C   . SER B  2  251 ? 158.557 99.142  148.839 1.00 87.64  ? 251 SER B C   1 
ATOM   4691  O O   . SER B  2  251 ? 158.618 99.734  147.761 1.00 87.64  ? 251 SER B O   1 
ATOM   4692  C CB  . SER B  2  251 ? 160.976 99.527  149.402 1.00 87.64  ? 251 SER B CB  1 
ATOM   4693  O OG  . SER B  2  251 ? 162.083 99.041  150.139 1.00 87.64  ? 251 SER B OG  1 
ATOM   4694  N N   . VAL B  2  252 ? 157.418 98.976  149.504 1.00 86.08  ? 252 VAL B N   1 
ATOM   4695  C CA  . VAL B  2  252 ? 156.159 99.576  149.069 1.00 86.08  ? 252 VAL B CA  1 
ATOM   4696  C C   . VAL B  2  252 ? 156.105 101.056 149.441 1.00 86.08  ? 252 VAL B C   1 
ATOM   4697  O O   . VAL B  2  252 ? 155.871 101.890 148.553 1.00 86.08  ? 252 VAL B O   1 
ATOM   4698  C CB  . VAL B  2  252 ? 154.951 98.818  149.644 1.00 86.08  ? 252 VAL B CB  1 
ATOM   4699  C CG1 . VAL B  2  252 ? 153.659 99.528  149.272 1.00 86.08  ? 252 VAL B CG1 1 
ATOM   4700  C CG2 . VAL B  2  252 ? 154.946 97.379  149.160 1.00 86.08  ? 252 VAL B CG2 1 
ATOM   4701  N N   . PRO B  2  253 ? 156.308 101.442 150.713 1.00 86.18  ? 253 PRO B N   1 
ATOM   4702  C CA  . PRO B  2  253 ? 156.109 102.859 151.071 1.00 86.18  ? 253 PRO B CA  1 
ATOM   4703  C C   . PRO B  2  253 ? 156.989 103.829 150.303 1.00 86.18  ? 253 PRO B C   1 
ATOM   4704  O O   . PRO B  2  253 ? 156.505 104.889 149.893 1.00 86.18  ? 253 PRO B O   1 
ATOM   4705  C CB  . PRO B  2  253 ? 156.424 102.887 152.573 1.00 86.18  ? 253 PRO B CB  1 
ATOM   4706  C CG  . PRO B  2  253 ? 156.174 101.514 153.034 1.00 86.18  ? 253 PRO B CG  1 
ATOM   4707  C CD  . PRO B  2  253 ? 156.614 100.638 151.910 1.00 86.18  ? 253 PRO B CD  1 
ATOM   4708  N N   . ALA B  2  254 ? 158.266 103.504 150.100 1.00 85.44  ? 254 ALA B N   1 
ATOM   4709  C CA  . ALA B  2  254 ? 159.163 104.431 149.415 1.00 85.44  ? 254 ALA B CA  1 
ATOM   4710  C C   . ALA B  2  254 ? 158.680 104.719 147.999 1.00 85.44  ? 254 ALA B C   1 
ATOM   4711  O O   . ALA B  2  254 ? 158.573 105.881 147.586 1.00 85.44  ? 254 ALA B O   1 
ATOM   4712  C CB  . ALA B  2  254 ? 160.583 103.866 149.397 1.00 85.44  ? 254 ALA B CB  1 
ATOM   4713  N N   . ARG B  2  255 ? 158.369 103.668 147.242 1.00 87.60  ? 255 ARG B N   1 
ATOM   4714  C CA  . ARG B  2  255 ? 157.932 103.874 145.868 1.00 87.60  ? 255 ARG B CA  1 
ATOM   4715  C C   . ARG B  2  255 ? 156.536 104.475 145.803 1.00 87.60  ? 255 ARG B C   1 
ATOM   4716  O O   . ARG B  2  255 ? 156.220 105.182 144.841 1.00 87.60  ? 255 ARG B O   1 
ATOM   4717  C CB  . ARG B  2  255 ? 158.004 102.562 145.092 1.00 87.60  ? 255 ARG B CB  1 
ATOM   4718  C CG  . ARG B  2  255 ? 159.433 102.088 144.883 1.00 87.60  ? 255 ARG B CG  1 
ATOM   4719  C CD  . ARG B  2  255 ? 159.504 100.800 144.089 1.00 87.60  ? 255 ARG B CD  1 
ATOM   4720  N NE  . ARG B  2  255 ? 158.938 99.676  144.823 1.00 87.60  ? 255 ARG B NE  1 
ATOM   4721  C CZ  . ARG B  2  255 ? 158.805 98.454  144.322 1.00 87.60  ? 255 ARG B CZ  1 
ATOM   4722  N NH1 . ARG B  2  255 ? 159.211 98.197  143.087 1.00 87.60  ? 255 ARG B NH1 1 
ATOM   4723  N NH2 . ARG B  2  255 ? 158.278 97.487  145.059 1.00 87.60  ? 255 ARG B NH2 1 
ATOM   4724  N N   . THR B  2  256 ? 155.693 104.238 146.812 1.00 83.79  ? 256 THR B N   1 
ATOM   4725  C CA  . THR B  2  256 ? 154.410 104.937 146.841 1.00 83.79  ? 256 THR B CA  1 
ATOM   4726  C C   . THR B  2  256 ? 154.606 106.432 147.057 1.00 83.79  ? 256 THR B C   1 
ATOM   4727  O O   . THR B  2  256 ? 153.930 107.246 146.422 1.00 83.79  ? 256 THR B O   1 
ATOM   4728  C CB  . THR B  2  256 ? 153.494 104.364 147.920 1.00 83.79  ? 256 THR B CB  1 
ATOM   4729  O OG1 . THR B  2  256 ? 154.136 104.459 149.196 1.00 83.79  ? 256 THR B OG1 1 
ATOM   4730  C CG2 . THR B  2  256 ? 153.132 102.915 147.614 1.00 83.79  ? 256 THR B CG2 1 
ATOM   4731  N N   . VAL B  2  257 ? 155.520 106.810 147.954 1.00 80.38  ? 257 VAL B N   1 
ATOM   4732  C CA  . VAL B  2  257 ? 155.877 108.219 148.110 1.00 80.38  ? 257 VAL B CA  1 
ATOM   4733  C C   . VAL B  2  257 ? 156.367 108.786 146.788 1.00 80.38  ? 257 VAL B C   1 
ATOM   4734  O O   . VAL B  2  257 ? 155.991 109.892 146.382 1.00 80.38  ? 257 VAL B O   1 
ATOM   4735  C CB  . VAL B  2  257 ? 156.946 108.383 149.204 1.00 80.38  ? 257 VAL B CB  1 
ATOM   4736  C CG1 . VAL B  2  257 ? 157.386 109.835 149.301 1.00 80.38  ? 257 VAL B CG1 1 
ATOM   4737  C CG2 . VAL B  2  257 ? 156.429 107.883 150.528 1.00 80.38  ? 257 VAL B CG2 1 
ATOM   4738  N N   . PHE B  2  258 ? 157.224 108.032 146.106 1.00 82.01  ? 258 PHE B N   1 
ATOM   4739  C CA  . PHE B  2  258 ? 157.779 108.465 144.831 1.00 82.01  ? 258 PHE B CA  1 
ATOM   4740  C C   . PHE B  2  258 ? 156.673 108.727 143.811 1.00 82.01  ? 258 PHE B C   1 
ATOM   4741  O O   . PHE B  2  258 ? 156.631 109.785 143.162 1.00 82.01  ? 258 PHE B O   1 
ATOM   4742  C CB  . PHE B  2  258 ? 158.743 107.385 144.345 1.00 82.01  ? 258 PHE B CB  1 
ATOM   4743  C CG  . PHE B  2  258 ? 159.568 107.782 143.178 1.00 82.01  ? 258 PHE B CG  1 
ATOM   4744  C CD1 . PHE B  2  258 ? 160.662 108.610 143.343 1.00 82.01  ? 258 PHE B CD1 1 
ATOM   4745  C CD2 . PHE B  2  258 ? 159.270 107.309 141.917 1.00 82.01  ? 258 PHE B CD2 1 
ATOM   4746  C CE1 . PHE B  2  258 ? 161.435 108.969 142.268 1.00 82.01  ? 258 PHE B CE1 1 
ATOM   4747  C CE2 . PHE B  2  258 ? 160.040 107.664 140.838 1.00 82.01  ? 258 PHE B CE2 1 
ATOM   4748  C CZ  . PHE B  2  258 ? 161.122 108.496 141.013 1.00 82.01  ? 258 PHE B CZ  1 
ATOM   4749  N N   . GLY B  2  259 ? 155.753 107.770 143.674 1.00 70.39  ? 259 GLY B N   1 
ATOM   4750  C CA  . GLY B  2  259 ? 154.663 107.923 142.727 1.00 70.39  ? 259 GLY B CA  1 
ATOM   4751  C C   . GLY B  2  259 ? 153.723 109.058 143.084 1.00 70.39  ? 259 GLY B C   1 
ATOM   4752  O O   . GLY B  2  259 ? 153.258 109.785 142.205 1.00 70.39  ? 259 GLY B O   1 
ATOM   4753  N N   . VAL B  2  260 ? 153.421 109.221 144.376 1.00 73.33  ? 260 VAL B N   1 
ATOM   4754  C CA  . VAL B  2  260 ? 152.574 110.333 144.803 1.00 73.33  ? 260 VAL B CA  1 
ATOM   4755  C C   . VAL B  2  260 ? 153.237 111.661 144.471 1.00 73.33  ? 260 VAL B C   1 
ATOM   4756  O O   . VAL B  2  260 ? 152.577 112.610 144.028 1.00 73.33  ? 260 VAL B O   1 
ATOM   4757  C CB  . VAL B  2  260 ? 152.249 110.218 146.305 1.00 73.33  ? 260 VAL B CB  1 
ATOM   4758  C CG1 . VAL B  2  260 ? 151.547 111.470 146.792 1.00 73.33  ? 260 VAL B CG1 1 
ATOM   4759  C CG2 . VAL B  2  260 ? 151.375 109.006 146.561 1.00 73.33  ? 260 VAL B CG2 1 
ATOM   4760  N N   . THR B  2  261 ? 154.553 111.747 144.672 1.00 70.44  ? 261 THR B N   1 
ATOM   4761  C CA  . THR B  2  261 ? 155.285 112.956 144.312 1.00 70.44  ? 261 THR B CA  1 
ATOM   4762  C C   . THR B  2  261 ? 155.123 113.263 142.831 1.00 70.44  ? 261 THR B C   1 
ATOM   4763  O O   . THR B  2  261 ? 154.776 114.389 142.446 1.00 70.44  ? 261 THR B O   1 
ATOM   4764  C CB  . THR B  2  261 ? 156.763 112.783 144.649 1.00 70.44  ? 261 THR B CB  1 
ATOM   4765  O OG1 . THR B  2  261 ? 156.896 112.376 146.014 1.00 70.44  ? 261 THR B OG1 1 
ATOM   4766  C CG2 . THR B  2  261 ? 157.507 114.091 144.444 1.00 70.44  ? 261 THR B CG2 1 
ATOM   4767  N N   . THR B  2  262 ? 155.381 112.262 141.984 1.00 69.34  ? 262 THR B N   1 
ATOM   4768  C CA  . THR B  2  262 ? 155.268 112.468 140.544 1.00 69.34  ? 262 THR B CA  1 
ATOM   4769  C C   . THR B  2  262 ? 153.855 112.883 140.149 1.00 69.34  ? 262 THR B C   1 
ATOM   4770  O O   . THR B  2  262 ? 153.673 113.800 139.340 1.00 69.34  ? 262 THR B O   1 
ATOM   4771  C CB  . THR B  2  262 ? 155.682 111.203 139.794 1.00 69.34  ? 262 THR B CB  1 
ATOM   4772  O OG1 . THR B  2  262 ? 154.821 110.121 140.167 1.00 69.34  ? 262 THR B OG1 1 
ATOM   4773  C CG2 . THR B  2  262 ? 157.122 110.842 140.119 1.00 69.34  ? 262 THR B CG2 1 
ATOM   4774  N N   . VAL B  2  263 ? 152.841 112.226 140.718 1.00 68.33  ? 263 VAL B N   1 
ATOM   4775  C CA  . VAL B  2  263 ? 151.457 112.525 140.360 1.00 68.33  ? 263 VAL B CA  1 
ATOM   4776  C C   . VAL B  2  263 ? 151.092 113.948 140.758 1.00 68.33  ? 263 VAL B C   1 
ATOM   4777  O O   . VAL B  2  263 ? 150.477 114.690 139.978 1.00 68.33  ? 263 VAL B O   1 
ATOM   4778  C CB  . VAL B  2  263 ? 150.506 111.503 141.006 1.00 68.33  ? 263 VAL B CB  1 
ATOM   4779  C CG1 . VAL B  2  263 ? 149.062 111.906 140.772 1.00 68.33  ? 263 VAL B CG1 1 
ATOM   4780  C CG2 . VAL B  2  263 ? 150.761 110.121 140.447 1.00 68.33  ? 263 VAL B CG2 1 
ATOM   4781  N N   . LEU B  2  264 ? 151.456 114.352 141.978 1.00 72.05  ? 264 LEU B N   1 
ATOM   4782  C CA  . LEU B  2  264 ? 151.115 115.691 142.440 1.00 72.05  ? 264 LEU B CA  1 
ATOM   4783  C C   . LEU B  2  264 ? 151.806 116.749 141.588 1.00 72.05  ? 264 LEU B C   1 
ATOM   4784  O O   . LEU B  2  264 ? 151.190 117.758 141.215 1.00 72.05  ? 264 LEU B O   1 
ATOM   4785  C CB  . LEU B  2  264 ? 151.486 115.836 143.918 1.00 72.05  ? 264 LEU B CB  1 
ATOM   4786  C CG  . LEU B  2  264 ? 150.913 116.990 144.748 1.00 72.05  ? 264 LEU B CG  1 
ATOM   4787  C CD1 . LEU B  2  264 ? 151.606 118.317 144.475 1.00 72.05  ? 264 LEU B CD1 1 
ATOM   4788  C CD2 . LEU B  2  264 ? 149.416 117.104 144.511 1.00 72.05  ? 264 LEU B CD2 1 
ATOM   4789  N N   . THR B  2  265 ? 153.084 116.531 141.259 1.00 71.03  ? 265 THR B N   1 
ATOM   4790  C CA  . THR B  2  265 ? 153.789 117.491 140.414 1.00 71.03  ? 265 THR B CA  1 
ATOM   4791  C C   . THR B  2  265 ? 153.152 117.583 139.034 1.00 71.03  ? 265 THR B C   1 
ATOM   4792  O O   . THR B  2  265 ? 152.950 118.686 138.511 1.00 71.03  ? 265 THR B O   1 
ATOM   4793  C CB  . THR B  2  265 ? 155.265 117.115 140.298 1.00 71.03  ? 265 THR B CB  1 
ATOM   4794  O OG1 . THR B  2  265 ? 155.873 117.160 141.595 1.00 71.03  ? 265 THR B OG1 1 
ATOM   4795  C CG2 . THR B  2  265 ? 155.988 118.080 139.368 1.00 71.03  ? 265 THR B CG2 1 
ATOM   4796  N N   . MET B  2  266 ? 152.818 116.437 138.432 1.00 70.41  ? 266 MET B N   1 
ATOM   4797  C CA  . MET B  2  266 ? 152.172 116.450 137.123 1.00 70.41  ? 266 MET B CA  1 
ATOM   4798  C C   . MET B  2  266 ? 150.856 117.215 137.155 1.00 70.41  ? 266 MET B C   1 
ATOM   4799  O O   . MET B  2  266 ? 150.572 118.011 136.252 1.00 70.41  ? 266 MET B O   1 
ATOM   4800  C CB  . MET B  2  266 ? 151.938 115.023 136.632 1.00 70.41  ? 266 MET B CB  1 
ATOM   4801  C CG  . MET B  2  266 ? 153.193 114.292 136.219 1.00 70.41  ? 266 MET B CG  1 
ATOM   4802  S SD  . MET B  2  266 ? 153.961 115.083 134.799 1.00 70.41  ? 266 MET B SD  1 
ATOM   4803  C CE  . MET B  2  266 ? 155.459 114.121 134.655 1.00 70.41  ? 266 MET B CE  1 
ATOM   4804  N N   . THR B  2  267 ? 150.036 116.986 138.182 1.00 64.69  ? 267 THR B N   1 
ATOM   4805  C CA  . THR B  2  267 ? 148.735 117.645 138.234 1.00 64.69  ? 267 THR B CA  1 
ATOM   4806  C C   . THR B  2  267 ? 148.887 119.151 138.423 1.00 64.69  ? 267 THR B C   1 
ATOM   4807  O O   . THR B  2  267 ? 148.232 119.946 137.730 1.00 64.69  ? 267 THR B O   1 
ATOM   4808  C CB  . THR B  2  267 ? 147.883 117.045 139.350 1.00 64.69  ? 267 THR B CB  1 
ATOM   4809  O OG1 . THR B  2  267 ? 147.708 115.643 139.116 1.00 64.69  ? 267 THR B OG1 1 
ATOM   4810  C CG2 . THR B  2  267 ? 146.523 117.712 139.388 1.00 64.69  ? 267 THR B CG2 1 
ATOM   4811  N N   . THR B  2  268 ? 149.741 119.565 139.367 1.00 65.77  ? 268 THR B N   1 
ATOM   4812  C CA  . THR B  2  268 ? 149.943 120.992 139.597 1.00 65.77  ? 268 THR B CA  1 
ATOM   4813  C C   . THR B  2  268 ? 150.589 121.670 138.397 1.00 65.77  ? 268 THR B C   1 
ATOM   4814  O O   . THR B  2  268 ? 150.425 122.880 138.208 1.00 65.77  ? 268 THR B O   1 
ATOM   4815  C CB  . THR B  2  268 ? 150.789 121.217 140.849 1.00 65.77  ? 268 THR B CB  1 
ATOM   4816  O OG1 . THR B  2  268 ? 152.053 120.560 140.699 1.00 65.77  ? 268 THR B OG1 1 
ATOM   4817  C CG2 . THR B  2  268 ? 150.075 120.679 142.078 1.00 65.77  ? 268 THR B CG2 1 
ATOM   4818  N N   . LEU B  2  269 ? 151.329 120.916 137.584 1.00 68.98  ? 269 LEU B N   1 
ATOM   4819  C CA  . LEU B  2  269 ? 151.860 121.469 136.346 1.00 68.98  ? 269 LEU B CA  1 
ATOM   4820  C C   . LEU B  2  269 ? 150.758 121.640 135.310 1.00 68.98  ? 269 LEU B C   1 
ATOM   4821  O O   . LEU B  2  269 ? 150.650 122.693 134.668 1.00 68.98  ? 269 LEU B O   1 
ATOM   4822  C CB  . LEU B  2  269 ? 152.965 120.559 135.813 1.00 68.98  ? 269 LEU B CB  1 
ATOM   4823  C CG  . LEU B  2  269 ? 153.651 120.992 134.523 1.00 68.98  ? 269 LEU B CG  1 
ATOM   4824  C CD1 . LEU B  2  269 ? 154.362 122.314 134.731 1.00 68.98  ? 269 LEU B CD1 1 
ATOM   4825  C CD2 . LEU B  2  269 ? 154.618 119.916 134.058 1.00 68.98  ? 269 LEU B CD2 1 
ATOM   4826  N N   . SER B  2  270 ? 149.928 120.608 135.141 1.00 69.43  ? 270 SER B N   1 
ATOM   4827  C CA  . SER B  2  270 ? 148.889 120.633 134.118 1.00 69.43  ? 270 SER B CA  1 
ATOM   4828  C C   . SER B  2  270 ? 147.878 121.740 134.379 1.00 69.43  ? 270 SER B C   1 
ATOM   4829  O O   . SER B  2  270 ? 147.395 122.382 133.436 1.00 69.43  ? 270 SER B O   1 
ATOM   4830  C CB  . SER B  2  270 ? 148.188 119.276 134.054 1.00 69.43  ? 270 SER B CB  1 
ATOM   4831  O OG  . SER B  2  270 ? 147.137 119.286 133.105 1.00 69.43  ? 270 SER B OG  1 
ATOM   4832  N N   . ILE B  2  271 ? 147.537 121.970 135.650 1.00 68.49  ? 271 ILE B N   1 
ATOM   4833  C CA  . ILE B  2  271 ? 146.560 123.010 135.979 1.00 68.49  ? 271 ILE B CA  1 
ATOM   4834  C C   . ILE B  2  271 ? 146.999 124.352 135.403 1.00 68.49  ? 271 ILE B C   1 
ATOM   4835  O O   . ILE B  2  271 ? 146.282 124.976 134.612 1.00 68.49  ? 271 ILE B O   1 
ATOM   4836  C CB  . ILE B  2  271 ? 146.342 123.096 137.499 1.00 68.49  ? 271 ILE B CB  1 
ATOM   4837  C CG1 . ILE B  2  271 ? 145.675 121.824 138.020 1.00 68.49  ? 271 ILE B CG1 1 
ATOM   4838  C CG2 . ILE B  2  271 ? 145.499 124.311 137.847 1.00 68.49  ? 271 ILE B CG2 1 
ATOM   4839  C CD1 . ILE B  2  271 ? 145.638 121.732 139.527 1.00 68.49  ? 271 ILE B CD1 1 
ATOM   4840  N N   . SER B  2  272 ? 148.198 124.803 135.773 1.00 74.53  ? 272 SER B N   1 
ATOM   4841  C CA  . SER B  2  272 ? 148.673 126.097 135.296 1.00 74.53  ? 272 SER B CA  1 
ATOM   4842  C C   . SER B  2  272 ? 148.957 126.083 133.800 1.00 74.53  ? 272 SER B C   1 
ATOM   4843  O O   . SER B  2  272 ? 148.755 127.101 133.124 1.00 74.53  ? 272 SER B O   1 
ATOM   4844  C CB  . SER B  2  272 ? 149.924 126.514 136.068 1.00 74.53  ? 272 SER B CB  1 
ATOM   4845  O OG  . SER B  2  272 ? 150.418 127.756 135.600 1.00 74.53  ? 272 SER B OG  1 
ATOM   4846  N N   . ALA B  2  273 ? 149.416 124.948 133.263 1.00 70.73  ? 273 ALA B N   1 
ATOM   4847  C CA  . ALA B  2  273 ? 149.704 124.872 131.836 1.00 70.73  ? 273 ALA B CA  1 
ATOM   4848  C C   . ALA B  2  273 ? 148.450 125.125 131.011 1.00 70.73  ? 273 ALA B C   1 
ATOM   4849  O O   . ALA B  2  273 ? 148.470 125.905 130.052 1.00 70.73  ? 273 ALA B O   1 
ATOM   4850  C CB  . ALA B  2  273 ? 150.309 123.510 131.498 1.00 70.73  ? 273 ALA B CB  1 
ATOM   4851  N N   . ARG B  2  274 ? 147.344 124.476 131.373 1.00 85.61  ? 274 ARG B N   1 
ATOM   4852  C CA  . ARG B  2  274 ? 146.090 124.710 130.668 1.00 85.61  ? 274 ARG B CA  1 
ATOM   4853  C C   . ARG B  2  274 ? 145.398 125.995 131.105 1.00 85.61  ? 274 ARG B C   1 
ATOM   4854  O O   . ARG B  2  274 ? 144.500 126.467 130.401 1.00 85.61  ? 274 ARG B O   1 
ATOM   4855  C CB  . ARG B  2  274 ? 145.154 123.511 130.849 1.00 85.61  ? 274 ARG B CB  1 
ATOM   4856  C CG  . ARG B  2  274 ? 145.630 122.268 130.111 1.00 85.61  ? 274 ARG B CG  1 
ATOM   4857  C CD  . ARG B  2  274 ? 144.706 121.077 130.306 1.00 85.61  ? 274 ARG B CD  1 
ATOM   4858  N NE  . ARG B  2  274 ? 144.768 120.535 131.660 1.00 85.61  ? 274 ARG B NE  1 
ATOM   4859  C CZ  . ARG B  2  274 ? 143.999 119.543 132.101 1.00 85.61  ? 274 ARG B CZ  1 
ATOM   4860  N NH1 . ARG B  2  274 ? 143.114 118.981 131.290 1.00 85.61  ? 274 ARG B NH1 1 
ATOM   4861  N NH2 . ARG B  2  274 ? 144.120 119.108 133.348 1.00 85.61  ? 274 ARG B NH2 1 
ATOM   4862  N N   . ASN B  2  275 ? 145.795 126.574 132.242 1.00 89.25  ? 275 ASN B N   1 
ATOM   4863  C CA  . ASN B  2  275 ? 145.224 127.853 132.652 1.00 89.25  ? 275 ASN B CA  1 
ATOM   4864  C C   . ASN B  2  275 ? 145.810 129.004 131.844 1.00 89.25  ? 275 ASN B C   1 
ATOM   4865  O O   . ASN B  2  275 ? 145.101 129.964 131.521 1.00 89.25  ? 275 ASN B O   1 
ATOM   4866  C CB  . ASN B  2  275 ? 145.460 128.075 134.147 1.00 89.25  ? 275 ASN B CB  1 
ATOM   4867  C CG  . ASN B  2  275 ? 144.507 129.094 134.749 1.00 89.25  ? 275 ASN B CG  1 
ATOM   4868  O OD1 . ASN B  2  275 ? 144.378 129.188 135.970 1.00 89.25  ? 275 ASN B OD1 1 
ATOM   4869  N ND2 . ASN B  2  275 ? 143.829 129.855 133.898 1.00 89.25  ? 275 ASN B ND2 1 
ATOM   4870  N N   . SER B  2  276 ? 147.102 128.930 131.516 1.00 87.34  ? 276 SER B N   1 
ATOM   4871  C CA  . SER B  2  276 ? 147.738 130.022 130.783 1.00 87.34  ? 276 SER B CA  1 
ATOM   4872  C C   . SER B  2  276 ? 147.149 130.190 129.387 1.00 87.34  ? 276 SER B C   1 
ATOM   4873  O O   . SER B  2  276 ? 147.224 131.280 128.808 1.00 87.34  ? 276 SER B O   1 
ATOM   4874  C CB  . SER B  2  276 ? 149.246 129.786 130.698 1.00 87.34  ? 276 SER B CB  1 
ATOM   4875  O OG  . SER B  2  276 ? 149.544 128.636 129.925 1.00 87.34  ? 276 SER B OG  1 
ATOM   4876  N N   . LEU B  2  277 ? 146.571 129.140 128.835 1.00 80.80  ? 277 LEU B N   1 
ATOM   4877  C CA  . LEU B  2  277 ? 146.021 129.071 127.493 1.00 80.80  ? 277 LEU B CA  1 
ATOM   4878  C C   . LEU B  2  277 ? 144.495 129.076 127.547 1.00 80.80  ? 277 LEU B C   1 
ATOM   4879  O O   . LEU B  2  277 ? 143.902 128.528 128.480 1.00 80.80  ? 277 LEU B O   1 
ATOM   4880  C CB  . LEU B  2  277 ? 146.524 127.798 126.799 1.00 80.80  ? 277 LEU B CB  1 
ATOM   4881  C CG  . LEU B  2  277 ? 146.468 127.536 125.288 1.00 80.80  ? 277 LEU B CG  1 
ATOM   4882  C CD1 . LEU B  2  277 ? 145.067 127.201 124.797 1.00 80.80  ? 277 LEU B CD1 1 
ATOM   4883  C CD2 . LEU B  2  277 ? 147.068 128.687 124.497 1.00 80.80  ? 277 LEU B CD2 1 
ATOM   4884  N N   . PRO B  2  278 ? 143.822 129.703 126.574 1.00 75.90  ? 278 PRO B N   1 
ATOM   4885  C CA  . PRO B  2  278 ? 142.351 129.736 126.593 1.00 75.90  ? 278 PRO B CA  1 
ATOM   4886  C C   . PRO B  2  278 ? 141.694 128.368 126.498 1.00 75.90  ? 278 PRO B C   1 
ATOM   4887  O O   . PRO B  2  278 ? 142.366 127.346 126.325 1.00 75.90  ? 278 PRO B O   1 
ATOM   4888  C CB  . PRO B  2  278 ? 142.009 130.597 125.370 1.00 75.90  ? 278 PRO B CB  1 
ATOM   4889  C CG  . PRO B  2  278 ? 143.192 131.467 125.193 1.00 75.90  ? 278 PRO B CG  1 
ATOM   4890  C CD  . PRO B  2  278 ? 144.375 130.625 125.569 1.00 75.90  ? 278 PRO B CD  1 
ATOM   4891  N N   . LYS B  2  279 ? 140.369 128.343 126.613 1.00 74.11  ? 279 LYS B N   1 
ATOM   4892  C CA  . LYS B  2  279 ? 139.595 127.105 126.616 1.00 74.11  ? 279 LYS B CA  1 
ATOM   4893  C C   . LYS B  2  279 ? 138.926 126.957 125.255 1.00 74.11  ? 279 LYS B C   1 
ATOM   4894  O O   . LYS B  2  279 ? 137.846 127.503 125.019 1.00 74.11  ? 279 LYS B O   1 
ATOM   4895  C CB  . LYS B  2  279 ? 138.569 127.111 127.744 1.00 74.11  ? 279 LYS B CB  1 
ATOM   4896  C CG  . LYS B  2  279 ? 139.176 127.101 129.136 1.00 74.11  ? 279 LYS B CG  1 
ATOM   4897  C CD  . LYS B  2  279 ? 138.108 126.934 130.203 1.00 74.11  ? 279 LYS B CD  1 
ATOM   4898  C CE  . LYS B  2  279 ? 137.297 128.207 130.380 1.00 74.11  ? 279 LYS B CE  1 
ATOM   4899  N NZ  . LYS B  2  279 ? 136.319 128.093 131.497 1.00 74.11  ? 279 LYS B NZ  1 
ATOM   4900  N N   . VAL B  2  280 ? 139.564 126.209 124.363 1.00 65.96  ? 280 VAL B N   1 
ATOM   4901  C CA  . VAL B  2  280 ? 139.030 125.962 123.033 1.00 65.96  ? 280 VAL B CA  1 
ATOM   4902  C C   . VAL B  2  280 ? 138.547 124.521 122.959 1.00 65.96  ? 280 VAL B C   1 
ATOM   4903  O O   . VAL B  2  280 ? 138.894 123.673 123.786 1.00 65.96  ? 280 VAL B O   1 
ATOM   4904  C CB  . VAL B  2  280 ? 140.066 126.250 121.929 1.00 65.96  ? 280 VAL B CB  1 
ATOM   4905  C CG1 . VAL B  2  280 ? 140.465 127.711 121.950 1.00 65.96  ? 280 VAL B CG1 1 
ATOM   4906  C CG2 . VAL B  2  280 ? 141.281 125.358 122.103 1.00 65.96  ? 280 VAL B CG2 1 
ATOM   4907  N N   . ALA B  2  281 ? 137.727 124.248 121.943 1.00 69.60  ? 281 ALA B N   1 
ATOM   4908  C CA  . ALA B  2  281 ? 137.182 122.907 121.763 1.00 69.60  ? 281 ALA B CA  1 
ATOM   4909  C C   . ALA B  2  281 ? 138.289 121.901 121.470 1.00 69.60  ? 281 ALA B C   1 
ATOM   4910  O O   . ALA B  2  281 ? 138.497 120.946 122.227 1.00 69.60  ? 281 ALA B O   1 
ATOM   4911  C CB  . ALA B  2  281 ? 136.142 122.914 120.641 1.00 69.60  ? 281 ALA B CB  1 
ATOM   4912  N N   . TYR B  2  282 ? 139.015 122.107 120.374 1.00 71.59  ? 282 TYR B N   1 
ATOM   4913  C CA  . TYR B  2  282 ? 140.068 121.186 119.978 1.00 71.59  ? 282 TYR B CA  1 
ATOM   4914  C C   . TYR B  2  282 ? 141.196 121.181 121.009 1.00 71.59  ? 282 TYR B C   1 
ATOM   4915  O O   . TYR B  2  282 ? 141.278 122.035 121.894 1.00 71.59  ? 282 TYR B O   1 
ATOM   4916  C CB  . TYR B  2  282 ? 140.606 121.558 118.597 1.00 71.59  ? 282 TYR B CB  1 
ATOM   4917  C CG  . TYR B  2  282 ? 141.207 122.943 118.533 1.00 71.59  ? 282 TYR B CG  1 
ATOM   4918  C CD1 . TYR B  2  282 ? 140.425 124.043 118.215 1.00 71.59  ? 282 TYR B CD1 1 
ATOM   4919  C CD2 . TYR B  2  282 ? 142.553 123.150 118.792 1.00 71.59  ? 282 TYR B CD2 1 
ATOM   4920  C CE1 . TYR B  2  282 ? 140.966 125.310 118.158 1.00 71.59  ? 282 TYR B CE1 1 
ATOM   4921  C CE2 . TYR B  2  282 ? 143.104 124.412 118.738 1.00 71.59  ? 282 TYR B CE2 1 
ATOM   4922  C CZ  . TYR B  2  282 ? 142.307 125.488 118.421 1.00 71.59  ? 282 TYR B CZ  1 
ATOM   4923  O OH  . TYR B  2  282 ? 142.854 126.748 118.364 1.00 71.59  ? 282 TYR B OH  1 
ATOM   4924  N N   . ALA B  2  283 ? 142.078 120.196 120.878 1.00 64.66  ? 283 ALA B N   1 
ATOM   4925  C CA  . ALA B  2  283 ? 143.200 120.023 121.788 1.00 64.66  ? 283 ALA B CA  1 
ATOM   4926  C C   . ALA B  2  283 ? 144.445 120.659 121.188 1.00 64.66  ? 283 ALA B C   1 
ATOM   4927  O O   . ALA B  2  283 ? 144.771 120.419 120.021 1.00 64.66  ? 283 ALA B O   1 
ATOM   4928  C CB  . ALA B  2  283 ? 143.446 118.543 122.076 1.00 64.66  ? 283 ALA B CB  1 
ATOM   4929  N N   . THR B  2  284 ? 145.137 121.461 121.990 1.00 68.71  ? 284 THR B N   1 
ATOM   4930  C CA  . THR B  2  284 ? 146.321 122.159 121.526 1.00 68.71  ? 284 THR B CA  1 
ATOM   4931  C C   . THR B  2  284 ? 147.478 121.182 121.334 1.00 68.71  ? 284 THR B C   1 
ATOM   4932  O O   . THR B  2  284 ? 147.408 120.006 121.695 1.00 68.71  ? 284 THR B O   1 
ATOM   4933  C CB  . THR B  2  284 ? 146.721 123.248 122.518 1.00 68.71  ? 284 THR B CB  1 
ATOM   4934  O OG1 . THR B  2  284 ? 147.104 122.642 123.758 1.00 68.71  ? 284 THR B OG1 1 
ATOM   4935  C CG2 . THR B  2  284 ? 145.554 124.182 122.768 1.00 68.71  ? 284 THR B CG2 1 
ATOM   4936  N N   . ALA B  2  285 ? 148.561 121.691 120.756 1.00 62.86  ? 285 ALA B N   1 
ATOM   4937  C CA  . ALA B  2  285 ? 149.775 120.905 120.593 1.00 62.86  ? 285 ALA B CA  1 
ATOM   4938  C C   . ALA B  2  285 ? 150.581 120.796 121.877 1.00 62.86  ? 285 ALA B C   1 
ATOM   4939  O O   . ALA B  2  285 ? 151.698 120.269 121.847 1.00 62.86  ? 285 ALA B O   1 
ATOM   4940  C CB  . ALA B  2  285 ? 150.641 121.497 119.483 1.00 62.86  ? 285 ALA B CB  1 
ATOM   4941  N N   . MET B  2  286 ? 150.058 121.300 122.991 1.00 65.46  ? 286 MET B N   1 
ATOM   4942  C CA  . MET B  2  286 ? 150.636 121.058 124.305 1.00 65.46  ? 286 MET B CA  1 
ATOM   4943  C C   . MET B  2  286 ? 149.838 120.046 125.112 1.00 65.46  ? 286 MET B C   1 
ATOM   4944  O O   . MET B  2  286 ? 150.407 119.363 125.974 1.00 65.46  ? 286 MET B O   1 
ATOM   4945  C CB  . MET B  2  286 ? 150.743 122.373 125.084 1.00 65.46  ? 286 MET B CB  1 
ATOM   4946  C CG  . MET B  2  286 ? 151.426 122.260 126.433 1.00 65.46  ? 286 MET B CG  1 
ATOM   4947  S SD  . MET B  2  286 ? 151.625 123.852 127.249 1.00 65.46  ? 286 MET B SD  1 
ATOM   4948  C CE  . MET B  2  286 ? 149.930 124.213 127.688 1.00 65.46  ? 286 MET B CE  1 
ATOM   4949  N N   . ASP B  2  287 ? 148.534 119.933 124.842 1.00 68.35  ? 287 ASP B N   1 
ATOM   4950  C CA  . ASP B  2  287 ? 147.730 118.906 125.494 1.00 68.35  ? 287 ASP B CA  1 
ATOM   4951  C C   . ASP B  2  287 ? 148.256 117.515 125.182 1.00 68.35  ? 287 ASP B C   1 
ATOM   4952  O O   . ASP B  2  287 ? 148.234 116.634 126.043 1.00 68.35  ? 287 ASP B O   1 
ATOM   4953  C CB  . ASP B  2  287 ? 146.266 119.021 125.073 1.00 68.35  ? 287 ASP B CB  1 
ATOM   4954  C CG  . ASP B  2  287 ? 145.576 120.220 125.684 1.00 68.35  ? 287 ASP B CG  1 
ATOM   4955  O OD1 . ASP B  2  287 ? 145.979 120.640 126.788 1.00 68.35  ? 287 ASP B OD1 1 
ATOM   4956  O OD2 . ASP B  2  287 ? 144.624 120.736 125.062 1.00 68.35  ? 287 ASP B OD2 1 
ATOM   4957  N N   . TRP B  2  288 ? 148.743 117.297 123.959 1.00 75.23  ? 288 TRP B N   1 
ATOM   4958  C CA  . TRP B  2  288 ? 149.271 115.981 123.616 1.00 75.23  ? 288 TRP B CA  1 
ATOM   4959  C C   . TRP B  2  288 ? 150.531 115.668 124.412 1.00 75.23  ? 288 TRP B C   1 
ATOM   4960  O O   . TRP B  2  288 ? 150.694 114.549 124.913 1.00 75.23  ? 288 TRP B O   1 
ATOM   4961  C CB  . TRP B  2  288 ? 149.544 115.893 122.116 1.00 75.23  ? 288 TRP B CB  1 
ATOM   4962  C CG  . TRP B  2  288 ? 148.299 115.947 121.295 1.00 75.23  ? 288 TRP B CG  1 
ATOM   4963  C CD1 . TRP B  2  288 ? 147.801 117.028 120.635 1.00 75.23  ? 288 TRP B CD1 1 
ATOM   4964  C CD2 . TRP B  2  288 ? 147.376 114.879 121.069 1.00 75.23  ? 288 TRP B CD2 1 
ATOM   4965  N NE1 . TRP B  2  288 ? 146.631 116.697 119.998 1.00 75.23  ? 288 TRP B NE1 1 
ATOM   4966  C CE2 . TRP B  2  288 ? 146.347 115.382 120.252 1.00 75.23  ? 288 TRP B CE2 1 
ATOM   4967  C CE3 . TRP B  2  288 ? 147.322 113.544 121.474 1.00 75.23  ? 288 TRP B CE3 1 
ATOM   4968  C CZ2 . TRP B  2  288 ? 145.277 114.598 119.832 1.00 75.23  ? 288 TRP B CZ2 1 
ATOM   4969  C CZ3 . TRP B  2  288 ? 146.261 112.767 121.056 1.00 75.23  ? 288 TRP B CZ3 1 
ATOM   4970  C CH2 . TRP B  2  288 ? 145.252 113.296 120.244 1.00 75.23  ? 288 TRP B CH2 1 
ATOM   4971  N N   . PHE B  2  289 ? 151.427 116.644 124.551 1.00 72.52  ? 289 PHE B N   1 
ATOM   4972  C CA  . PHE B  2  289 ? 152.641 116.421 125.329 1.00 72.52  ? 289 PHE B CA  1 
ATOM   4973  C C   . PHE B  2  289 ? 152.314 116.166 126.797 1.00 72.52  ? 289 PHE B C   1 
ATOM   4974  O O   . PHE B  2  289 ? 152.889 115.264 127.427 1.00 72.52  ? 289 PHE B O   1 
ATOM   4975  C CB  . PHE B  2  289 ? 153.569 117.622 125.187 1.00 72.52  ? 289 PHE B CB  1 
ATOM   4976  C CG  . PHE B  2  289 ? 154.910 117.422 125.810 1.00 72.52  ? 289 PHE B CG  1 
ATOM   4977  C CD1 . PHE B  2  289 ? 155.885 116.697 125.153 1.00 72.52  ? 289 PHE B CD1 1 
ATOM   4978  C CD2 . PHE B  2  289 ? 155.194 117.946 127.054 1.00 72.52  ? 289 PHE B CD2 1 
ATOM   4979  C CE1 . PHE B  2  289 ? 157.121 116.512 125.718 1.00 72.52  ? 289 PHE B CE1 1 
ATOM   4980  C CE2 . PHE B  2  289 ? 156.429 117.761 127.626 1.00 72.52  ? 289 PHE B CE2 1 
ATOM   4981  C CZ  . PHE B  2  289 ? 157.394 117.042 126.957 1.00 72.52  ? 289 PHE B CZ  1 
ATOM   4982  N N   . ILE B  2  290 ? 151.392 116.953 127.360 1.00 69.43  ? 290 ILE B N   1 
ATOM   4983  C CA  . ILE B  2  290 ? 150.984 116.738 128.746 1.00 69.43  ? 290 ILE B CA  1 
ATOM   4984  C C   . ILE B  2  290 ? 150.348 115.366 128.904 1.00 69.43  ? 290 ILE B C   1 
ATOM   4985  O O   . ILE B  2  290 ? 150.616 114.650 129.875 1.00 69.43  ? 290 ILE B O   1 
ATOM   4986  C CB  . ILE B  2  290 ? 150.030 117.853 129.213 1.00 69.43  ? 290 ILE B CB  1 
ATOM   4987  C CG1 . ILE B  2  290 ? 150.754 119.196 129.265 1.00 69.43  ? 290 ILE B CG1 1 
ATOM   4988  C CG2 . ILE B  2  290 ? 149.441 117.520 130.572 1.00 69.43  ? 290 ILE B CG2 1 
ATOM   4989  C CD1 . ILE B  2  290 ? 149.827 120.366 129.486 1.00 69.43  ? 290 ILE B CD1 1 
ATOM   4990  N N   . ALA B  2  291 ? 149.514 114.967 127.943 1.00 65.79  ? 291 ALA B N   1 
ATOM   4991  C CA  . ALA B  2  291 ? 148.854 113.672 128.023 1.00 65.79  ? 291 ALA B CA  1 
ATOM   4992  C C   . ALA B  2  291 ? 149.845 112.530 127.892 1.00 65.79  ? 291 ALA B C   1 
ATOM   4993  O O   . ALA B  2  291 ? 149.620 111.461 128.458 1.00 65.79  ? 291 ALA B O   1 
ATOM   4994  C CB  . ALA B  2  291 ? 147.776 113.558 126.949 1.00 65.79  ? 291 ALA B CB  1 
ATOM   4995  N N   . VAL B  2  292 ? 150.949 112.732 127.173 1.00 69.55  ? 292 VAL B N   1 
ATOM   4996  C CA  . VAL B  2  292 ? 151.952 111.675 127.076 1.00 69.55  ? 292 VAL B CA  1 
ATOM   4997  C C   . VAL B  2  292 ? 152.752 111.561 128.369 1.00 69.55  ? 292 VAL B C   1 
ATOM   4998  O O   . VAL B  2  292 ? 152.994 110.450 128.861 1.00 69.55  ? 292 VAL B O   1 
ATOM   4999  C CB  . VAL B  2  292 ? 152.853 111.902 125.853 1.00 69.55  ? 292 VAL B CB  1 
ATOM   5000  C CG1 . VAL B  2  292 ? 154.030 110.953 125.892 1.00 69.55  ? 292 VAL B CG1 1 
ATOM   5001  C CG2 . VAL B  2  292 ? 152.039 111.658 124.605 1.00 69.55  ? 292 VAL B CG2 1 
ATOM   5002  N N   . CYS B  2  293 ? 153.180 112.694 128.938 1.00 77.85  ? 293 CYS B N   1 
ATOM   5003  C CA  . CYS B  2  293 ? 153.705 112.671 130.305 1.00 77.85  ? 293 CYS B CA  1 
ATOM   5004  C C   . CYS B  2  293 ? 152.769 111.893 131.224 1.00 77.85  ? 293 CYS B C   1 
ATOM   5005  O O   . CYS B  2  293 ? 153.188 111.000 131.973 1.00 77.85  ? 293 CYS B O   1 
ATOM   5006  C CB  . CYS B  2  293 ? 153.867 114.094 130.847 1.00 77.85  ? 293 CYS B CB  1 
ATOM   5007  S SG  . CYS B  2  293 ? 155.227 115.170 130.286 1.00 77.85  ? 293 CYS B SG  1 
ATOM   5008  N N   . TYR B  2  294 ? 151.482 112.224 131.148 1.00 81.43  ? 294 TYR B N   1 
ATOM   5009  C CA  . TYR B  2  294 ? 150.474 111.691 132.053 1.00 81.43  ? 294 TYR B CA  1 
ATOM   5010  C C   . TYR B  2  294 ? 150.304 110.190 131.862 1.00 81.43  ? 294 TYR B C   1 
ATOM   5011  O O   . TYR B  2  294 ? 150.248 109.424 132.834 1.00 81.43  ? 294 TYR B O   1 
ATOM   5012  C CB  . TYR B  2  294 ? 149.172 112.444 131.789 1.00 81.43  ? 294 TYR B CB  1 
ATOM   5013  C CG  . TYR B  2  294 ? 148.062 112.214 132.764 1.00 81.43  ? 294 TYR B CG  1 
ATOM   5014  C CD1 . TYR B  2  294 ? 148.109 112.776 134.027 1.00 81.43  ? 294 TYR B CD1 1 
ATOM   5015  C CD2 . TYR B  2  294 ? 146.946 111.469 132.411 1.00 81.43  ? 294 TYR B CD2 1 
ATOM   5016  C CE1 . TYR B  2  294 ? 147.094 112.586 134.919 1.00 81.43  ? 294 TYR B CE1 1 
ATOM   5017  C CE2 . TYR B  2  294 ? 145.915 111.280 133.300 1.00 81.43  ? 294 TYR B CE2 1 
ATOM   5018  C CZ  . TYR B  2  294 ? 145.997 111.849 134.550 1.00 81.43  ? 294 TYR B CZ  1 
ATOM   5019  O OH  . TYR B  2  294 ? 144.994 111.663 135.455 1.00 81.43  ? 294 TYR B OH  1 
ATOM   5020  N N   . ALA B  2  295 ? 150.231 109.753 130.604 1.00 73.34  ? 295 ALA B N   1 
ATOM   5021  C CA  . ALA B  2  295 ? 150.072 108.339 130.305 1.00 73.34  ? 295 ALA B CA  1 
ATOM   5022  C C   . ALA B  2  295 ? 151.286 107.545 130.754 1.00 73.34  ? 295 ALA B C   1 
ATOM   5023  O O   . ALA B  2  295 ? 151.137 106.457 131.312 1.00 73.34  ? 295 ALA B O   1 
ATOM   5024  C CB  . ALA B  2  295 ? 149.820 108.131 128.811 1.00 73.34  ? 295 ALA B CB  1 
ATOM   5025  N N   . PHE B  2  296 ? 152.496 108.071 130.543 1.00 72.75  ? 296 PHE B N   1 
ATOM   5026  C CA  . PHE B  2  296 ? 153.677 107.341 130.995 1.00 72.75  ? 296 PHE B CA  1 
ATOM   5027  C C   . PHE B  2  296 ? 153.733 107.240 132.516 1.00 72.75  ? 296 PHE B C   1 
ATOM   5028  O O   . PHE B  2  296 ? 154.035 106.169 133.059 1.00 72.75  ? 296 PHE B O   1 
ATOM   5029  C CB  . PHE B  2  296 ? 154.951 107.980 130.446 1.00 72.75  ? 296 PHE B CB  1 
ATOM   5030  C CG  . PHE B  2  296 ? 155.212 107.658 129.005 1.00 72.75  ? 296 PHE B CG  1 
ATOM   5031  C CD1 . PHE B  2  296 ? 154.481 106.674 128.364 1.00 72.75  ? 296 PHE B CD1 1 
ATOM   5032  C CD2 . PHE B  2  296 ? 156.206 108.310 128.303 1.00 72.75  ? 296 PHE B CD2 1 
ATOM   5033  C CE1 . PHE B  2  296 ? 154.720 106.365 127.044 1.00 72.75  ? 296 PHE B CE1 1 
ATOM   5034  C CE2 . PHE B  2  296 ? 156.450 108.003 126.982 1.00 72.75  ? 296 PHE B CE2 1 
ATOM   5035  C CZ  . PHE B  2  296 ? 155.707 107.030 126.352 1.00 72.75  ? 296 PHE B CZ  1 
ATOM   5036  N N   . VAL B  2  297 ? 153.430 108.331 133.226 1.00 75.76  ? 297 VAL B N   1 
ATOM   5037  C CA  . VAL B  2  297 ? 153.538 108.277 134.682 1.00 75.76  ? 297 VAL B CA  1 
ATOM   5038  C C   . VAL B  2  297 ? 152.483 107.340 135.265 1.00 75.76  ? 297 VAL B C   1 
ATOM   5039  O O   . VAL B  2  297 ? 152.776 106.544 136.168 1.00 75.76  ? 297 VAL B O   1 
ATOM   5040  C CB  . VAL B  2  297 ? 153.468 109.687 135.303 1.00 75.76  ? 297 VAL B CB  1 
ATOM   5041  C CG1 . VAL B  2  297 ? 154.631 110.538 134.816 1.00 75.76  ? 297 VAL B CG1 1 
ATOM   5042  C CG2 . VAL B  2  297 ? 152.149 110.366 135.009 1.00 75.76  ? 297 VAL B CG2 1 
ATOM   5043  N N   . PHE B  2  298 ? 151.255 107.370 134.737 1.00 77.76  ? 298 PHE B N   1 
ATOM   5044  C CA  . PHE B  2  298 ? 150.264 106.444 135.272 1.00 77.76  ? 298 PHE B CA  1 
ATOM   5045  C C   . PHE B  2  298 ? 150.454 105.016 134.786 1.00 77.76  ? 298 PHE B C   1 
ATOM   5046  O O   . PHE B  2  298 ? 150.039 104.086 135.483 1.00 77.76  ? 298 PHE B O   1 
ATOM   5047  C CB  . PHE B  2  298 ? 148.839 106.913 134.975 1.00 77.76  ? 298 PHE B CB  1 
ATOM   5048  C CG  . PHE B  2  298 ? 148.361 107.993 135.905 1.00 77.76  ? 298 PHE B CG  1 
ATOM   5049  C CD1 . PHE B  2  298 ? 149.141 108.401 136.966 1.00 77.76  ? 298 PHE B CD1 1 
ATOM   5050  C CD2 . PHE B  2  298 ? 147.105 108.538 135.770 1.00 77.76  ? 298 PHE B CD2 1 
ATOM   5051  C CE1 . PHE B  2  298 ? 148.702 109.376 137.839 1.00 77.76  ? 298 PHE B CE1 1 
ATOM   5052  C CE2 . PHE B  2  298 ? 146.669 109.518 136.641 1.00 77.76  ? 298 PHE B CE2 1 
ATOM   5053  C CZ  . PHE B  2  298 ? 147.465 109.925 137.680 1.00 77.76  ? 298 PHE B CZ  1 
ATOM   5054  N N   . SER B  2  299 ? 151.094 104.808 133.638 1.00 74.26  ? 299 SER B N   1 
ATOM   5055  C CA  . SER B  2  299 ? 151.474 103.454 133.262 1.00 74.26  ? 299 SER B CA  1 
ATOM   5056  C C   . SER B  2  299 ? 152.513 102.903 134.225 1.00 74.26  ? 299 SER B C   1 
ATOM   5057  O O   . SER B  2  299 ? 152.434 101.739 134.634 1.00 74.26  ? 299 SER B O   1 
ATOM   5058  C CB  . SER B  2  299 ? 152.003 103.436 131.829 1.00 74.26  ? 299 SER B CB  1 
ATOM   5059  O OG  . SER B  2  299 ? 153.206 104.176 131.732 1.00 74.26  ? 299 SER B OG  1 
ATOM   5060  N N   . ALA B  2  300 ? 153.486 103.732 134.609 1.00 71.00  ? 300 ALA B N   1 
ATOM   5061  C CA  . ALA B  2  300 ? 154.447 103.313 135.625 1.00 71.00  ? 300 ALA B CA  1 
ATOM   5062  C C   . ALA B  2  300 ? 153.750 103.020 136.947 1.00 71.00  ? 300 ALA B C   1 
ATOM   5063  O O   . ALA B  2  300 ? 154.114 102.074 137.656 1.00 71.00  ? 300 ALA B O   1 
ATOM   5064  C CB  . ALA B  2  300 ? 155.519 104.386 135.807 1.00 71.00  ? 300 ALA B CB  1 
ATOM   5065  N N   . LEU B  2  301 ? 152.731 103.813 137.287 1.00 72.28  ? 301 LEU B N   1 
ATOM   5066  C CA  . LEU B  2  301 ? 151.995 103.578 138.527 1.00 72.28  ? 301 LEU B CA  1 
ATOM   5067  C C   . LEU B  2  301 ? 151.230 102.257 138.486 1.00 72.28  ? 301 LEU B C   1 
ATOM   5068  O O   . LEU B  2  301 ? 151.233 101.504 139.466 1.00 72.28  ? 301 LEU B O   1 
ATOM   5069  C CB  . LEU B  2  301 ? 151.047 104.744 138.800 1.00 72.28  ? 301 LEU B CB  1 
ATOM   5070  C CG  . LEU B  2  301 ? 150.283 104.695 140.121 1.00 72.28  ? 301 LEU B CG  1 
ATOM   5071  C CD1 . LEU B  2  301 ? 151.251 104.700 141.290 1.00 72.28  ? 301 LEU B CD1 1 
ATOM   5072  C CD2 . LEU B  2  301 ? 149.330 105.872 140.214 1.00 72.28  ? 301 LEU B CD2 1 
ATOM   5073  N N   . ILE B  2  302 ? 150.570 101.957 137.365 1.00 74.86  ? 302 ILE B N   1 
ATOM   5074  C CA  . ILE B  2  302 ? 149.852 100.689 137.237 1.00 74.86  ? 302 ILE B CA  1 
ATOM   5075  C C   . ILE B  2  302 ? 150.828 99.518  137.253 1.00 74.86  ? 302 ILE B C   1 
ATOM   5076  O O   . ILE B  2  302 ? 150.541 98.454  137.819 1.00 74.86  ? 302 ILE B O   1 
ATOM   5077  C CB  . ILE B  2  302 ? 148.986 100.691 135.963 1.00 74.86  ? 302 ILE B CB  1 
ATOM   5078  C CG1 . ILE B  2  302 ? 147.883 101.745 136.068 1.00 74.86  ? 302 ILE B CG1 1 
ATOM   5079  C CG2 . ILE B  2  302 ? 148.388 99.318  135.715 1.00 74.86  ? 302 ILE B CG2 1 
ATOM   5080  C CD1 . ILE B  2  302 ? 147.139 101.978 134.773 1.00 74.86  ? 302 ILE B CD1 1 
ATOM   5081  N N   . GLU B  2  303 ? 151.993 99.693  136.626 1.00 82.31  ? 303 GLU B N   1 
ATOM   5082  C CA  . GLU B  2  303 ? 153.033 98.670  136.667 1.00 82.31  ? 303 GLU B CA  1 
ATOM   5083  C C   . GLU B  2  303 ? 153.461 98.384  138.101 1.00 82.31  ? 303 GLU B C   1 
ATOM   5084  O O   . GLU B  2  303 ? 153.546 97.223  138.518 1.00 82.31  ? 303 GLU B O   1 
ATOM   5085  C CB  . GLU B  2  303 ? 154.222 99.123  135.819 1.00 82.31  ? 303 GLU B CB  1 
ATOM   5086  C CG  . GLU B  2  303 ? 155.303 98.081  135.596 1.00 82.31  ? 303 GLU B CG  1 
ATOM   5087  C CD  . GLU B  2  303 ? 156.296 98.019  136.740 1.00 82.31  ? 303 GLU B CD  1 
ATOM   5088  O OE1 . GLU B  2  303 ? 156.416 99.017  137.479 1.00 82.31  ? 303 GLU B OE1 1 
ATOM   5089  O OE2 . GLU B  2  303 ? 156.978 96.986  136.887 1.00 82.31  ? 303 GLU B OE2 1 
ATOM   5090  N N   . PHE B  2  304 ? 153.748 99.437  138.868 1.00 85.06  ? 304 PHE B N   1 
ATOM   5091  C CA  . PHE B  2  304 ? 154.066 99.259  140.282 1.00 85.06  ? 304 PHE B CA  1 
ATOM   5092  C C   . PHE B  2  304 ? 152.936 98.558  141.025 1.00 85.06  ? 304 PHE B C   1 
ATOM   5093  O O   . PHE B  2  304 ? 153.182 97.672  141.853 1.00 85.06  ? 304 PHE B O   1 
ATOM   5094  C CB  . PHE B  2  304 ? 154.363 100.607 140.931 1.00 85.06  ? 304 PHE B CB  1 
ATOM   5095  C CG  . PHE B  2  304 ? 154.519 100.532 142.418 1.00 85.06  ? 304 PHE B CG  1 
ATOM   5096  C CD1 . PHE B  2  304 ? 155.643 99.964  142.986 1.00 85.06  ? 304 PHE B CD1 1 
ATOM   5097  C CD2 . PHE B  2  304 ? 153.534 101.028 143.251 1.00 85.06  ? 304 PHE B CD2 1 
ATOM   5098  C CE1 . PHE B  2  304 ? 155.779 99.893  144.359 1.00 85.06  ? 304 PHE B CE1 1 
ATOM   5099  C CE2 . PHE B  2  304 ? 153.667 100.960 144.622 1.00 85.06  ? 304 PHE B CE2 1 
ATOM   5100  C CZ  . PHE B  2  304 ? 154.791 100.393 145.176 1.00 85.06  ? 304 PHE B CZ  1 
ATOM   5101  N N   . ALA B  2  305 ? 151.692 98.951  140.749 1.00 84.94  ? 305 ALA B N   1 
ATOM   5102  C CA  . ALA B  2  305 ? 150.556 98.379  141.463 1.00 84.94  ? 305 ALA B CA  1 
ATOM   5103  C C   . ALA B  2  305 ? 150.424 96.886  141.193 1.00 84.94  ? 305 ALA B C   1 
ATOM   5104  O O   . ALA B  2  305 ? 150.111 96.109  142.102 1.00 84.94  ? 305 ALA B O   1 
ATOM   5105  C CB  . ALA B  2  305 ? 149.274 99.111  141.073 1.00 84.94  ? 305 ALA B CB  1 
ATOM   5106  N N   . THR B  2  306 ? 150.653 96.464  139.949 1.00 86.01  ? 306 THR B N   1 
ATOM   5107  C CA  . THR B  2  306 ? 150.525 95.044  139.641 1.00 86.01  ? 306 THR B CA  1 
ATOM   5108  C C   . THR B  2  306 ? 151.743 94.248  140.098 1.00 86.01  ? 306 THR B C   1 
ATOM   5109  O O   . THR B  2  306 ? 151.611 93.066  140.439 1.00 86.01  ? 306 THR B O   1 
ATOM   5110  C CB  . THR B  2  306 ? 150.273 94.837  138.144 1.00 86.01  ? 306 THR B CB  1 
ATOM   5111  O OG1 . THR B  2  306 ? 149.964 93.459  137.899 1.00 86.01  ? 306 THR B OG1 1 
ATOM   5112  C CG2 . THR B  2  306 ? 151.484 95.227  137.319 1.00 86.01  ? 306 THR B CG2 1 
ATOM   5113  N N   . VAL B  2  307 ? 152.924 94.871  140.139 1.00 87.75  ? 307 VAL B N   1 
ATOM   5114  C CA  . VAL B  2  307 ? 154.090 94.180  140.678 1.00 87.75  ? 307 VAL B CA  1 
ATOM   5115  C C   . VAL B  2  307 ? 153.934 93.963  142.176 1.00 87.75  ? 307 VAL B C   1 
ATOM   5116  O O   . VAL B  2  307 ? 154.322 92.916  142.710 1.00 87.75  ? 307 VAL B O   1 
ATOM   5117  C CB  . VAL B  2  307 ? 155.377 94.955  140.342 1.00 87.75  ? 307 VAL B CB  1 
ATOM   5118  C CG1 . VAL B  2  307 ? 156.565 94.360  141.078 1.00 87.75  ? 307 VAL B CG1 1 
ATOM   5119  C CG2 . VAL B  2  307 ? 155.629 94.914  138.850 1.00 87.75  ? 307 VAL B CG2 1 
ATOM   5120  N N   . ASN B  2  308 ? 153.346 94.938  142.876 1.00 94.17  ? 308 ASN B N   1 
ATOM   5121  C CA  . ASN B  2  308 ? 153.131 94.789  144.312 1.00 94.17  ? 308 ASN B CA  1 
ATOM   5122  C C   . ASN B  2  308 ? 152.251 93.585  144.623 1.00 94.17  ? 308 ASN B C   1 
ATOM   5123  O O   . ASN B  2  308 ? 152.328 93.030  145.725 1.00 94.17  ? 308 ASN B O   1 
ATOM   5124  C CB  . ASN B  2  308 ? 152.512 96.066  144.882 1.00 94.17  ? 308 ASN B CB  1 
ATOM   5125  C CG  . ASN B  2  308 ? 152.757 96.225  146.371 1.00 94.17  ? 308 ASN B CG  1 
ATOM   5126  O OD1 . ASN B  2  308 ? 152.580 97.310  146.924 1.00 94.17  ? 308 ASN B OD1 1 
ATOM   5127  N ND2 . ASN B  2  308 ? 153.176 95.149  147.025 1.00 94.17  ? 308 ASN B ND2 1 
ATOM   5128  N N   . TYR B  2  309 ? 151.414 93.168  143.674 1.00 95.16  ? 309 TYR B N   1 
ATOM   5129  C CA  . TYR B  2  309 ? 150.580 91.987  143.850 1.00 95.16  ? 309 TYR B CA  1 
ATOM   5130  C C   . TYR B  2  309 ? 151.260 90.714  143.360 1.00 95.16  ? 309 TYR B C   1 
ATOM   5131  O O   . TYR B  2  309 ? 151.120 89.660  143.988 1.00 95.16  ? 309 TYR B O   1 
ATOM   5132  C CB  . TYR B  2  309 ? 149.245 92.170  143.124 1.00 95.16  ? 309 TYR B CB  1 
ATOM   5133  C CG  . TYR B  2  309 ? 148.296 91.002  143.277 1.00 95.16  ? 309 TYR B CG  1 
ATOM   5134  C CD1 . TYR B  2  309 ? 147.587 90.809  144.455 1.00 95.16  ? 309 TYR B CD1 1 
ATOM   5135  C CD2 . TYR B  2  309 ? 148.112 90.092  142.245 1.00 95.16  ? 309 TYR B CD2 1 
ATOM   5136  C CE1 . TYR B  2  309 ? 146.718 89.743  144.599 1.00 95.16  ? 309 TYR B CE1 1 
ATOM   5137  C CE2 . TYR B  2  309 ? 147.246 89.024  142.380 1.00 95.16  ? 309 TYR B CE2 1 
ATOM   5138  C CZ  . TYR B  2  309 ? 146.553 88.854  143.559 1.00 95.16  ? 309 TYR B CZ  1 
ATOM   5139  O OH  . TYR B  2  309 ? 145.690 87.791  143.698 1.00 95.16  ? 309 TYR B OH  1 
ATOM   5140  N N   . PHE B  2  310 ? 151.991 90.785  142.246 1.00 99.62  ? 310 PHE B N   1 
ATOM   5141  C CA  . PHE B  2  310 ? 152.593 89.582  141.684 1.00 99.62  ? 310 PHE B CA  1 
ATOM   5142  C C   . PHE B  2  310 ? 153.855 89.136  142.409 1.00 99.62  ? 310 PHE B C   1 
ATOM   5143  O O   . PHE B  2  310 ? 154.204 87.954  142.328 1.00 99.62  ? 310 PHE B O   1 
ATOM   5144  C CB  . PHE B  2  310 ? 152.914 89.781  140.203 1.00 99.62  ? 310 PHE B CB  1 
ATOM   5145  C CG  . PHE B  2  310 ? 151.707 89.772  139.315 1.00 99.62  ? 310 PHE B CG  1 
ATOM   5146  C CD1 . PHE B  2  310 ? 150.488 89.322  139.789 1.00 99.62  ? 310 PHE B CD1 1 
ATOM   5147  C CD2 . PHE B  2  310 ? 151.795 90.198  138.003 1.00 99.62  ? 310 PHE B CD2 1 
ATOM   5148  C CE1 . PHE B  2  310 ? 149.377 89.310  138.973 1.00 99.62  ? 310 PHE B CE1 1 
ATOM   5149  C CE2 . PHE B  2  310 ? 150.687 90.186  137.181 1.00 99.62  ? 310 PHE B CE2 1 
ATOM   5150  C CZ  . PHE B  2  310 ? 149.475 89.742  137.667 1.00 99.62  ? 310 PHE B CZ  1 
ATOM   5151  N N   . THR B  2  311 ? 154.546 90.036  143.113 1.00 101.46 ? 311 THR B N   1 
ATOM   5152  C CA  . THR B  2  311 ? 155.820 89.661  143.717 1.00 101.46 ? 311 THR B CA  1 
ATOM   5153  C C   . THR B  2  311 ? 155.666 88.652  144.849 1.00 101.46 ? 311 THR B C   1 
ATOM   5154  O O   . THR B  2  311 ? 156.651 88.007  145.221 1.00 101.46 ? 311 THR B O   1 
ATOM   5155  C CB  . THR B  2  311 ? 156.554 90.902  144.230 1.00 101.46 ? 311 THR B CB  1 
ATOM   5156  O OG1 . THR B  2  311 ? 157.871 90.536  144.664 1.00 101.46 ? 311 THR B OG1 1 
ATOM   5157  C CG2 . THR B  2  311 ? 155.799 91.526  145.394 1.00 101.46 ? 311 THR B CG2 1 
ATOM   5158  N N   . LYS B  2  312 ? 154.461 88.497  145.400 1.00 94.39  ? 312 LYS B N   1 
ATOM   5159  C CA  . LYS B  2  312 ? 154.277 87.569  146.511 1.00 94.39  ? 312 LYS B CA  1 
ATOM   5160  C C   . LYS B  2  312 ? 154.321 86.120  146.042 1.00 94.39  ? 312 LYS B C   1 
ATOM   5161  O O   . LYS B  2  312 ? 154.977 85.279  146.668 1.00 94.39  ? 312 LYS B O   1 
ATOM   5162  C CB  . LYS B  2  312 ? 152.956 87.856  147.224 1.00 94.39  ? 312 LYS B CB  1 
ATOM   5163  C CG  . LYS B  2  312 ? 152.910 89.193  147.938 1.00 94.39  ? 312 LYS B CG  1 
ATOM   5164  C CD  . LYS B  2  312 ? 151.637 89.331  148.759 1.00 94.39  ? 312 LYS B CD  1 
ATOM   5165  C CE  . LYS B  2  312 ? 150.427 89.567  147.871 1.00 94.39  ? 312 LYS B CE  1 
ATOM   5166  N NZ  . LYS B  2  312 ? 149.195 89.818  148.670 1.00 94.39  ? 312 LYS B NZ  1 
ATOM   5167  N N   . SER B  2  313 ? 153.631 85.809  144.943 1.00 94.66  ? 313 SER B N   1 
ATOM   5168  C CA  . SER B  2  313 ? 153.528 84.423  144.497 1.00 94.66  ? 313 SER B CA  1 
ATOM   5169  C C   . SER B  2  313 ? 154.851 83.923  143.928 1.00 94.66  ? 313 SER B C   1 
ATOM   5170  O O   . SER B  2  313 ? 155.311 82.829  144.272 1.00 94.66  ? 313 SER B O   1 
ATOM   5171  C CB  . SER B  2  313 ? 152.412 84.286  143.463 1.00 94.66  ? 313 SER B CB  1 
ATOM   5172  O OG  . SER B  2  313 ? 152.731 84.987  142.274 1.00 94.66  ? 313 SER B OG  1 
ATOM   5173  N N   . GLN B  2  314 ? 155.477 84.711  143.051 1.00 88.77  ? 314 GLN B N   1 
ATOM   5174  C CA  . GLN B  2  314 ? 156.736 84.308  142.451 1.00 88.77  ? 314 GLN B CA  1 
ATOM   5175  C C   . GLN B  2  314 ? 157.595 85.546  142.237 1.00 88.77  ? 314 GLN B C   1 
ATOM   5176  O O   . GLN B  2  314 ? 157.114 86.523  141.642 1.00 88.77  ? 314 GLN B O   1 
ATOM   5177  C CB  . GLN B  2  314 ? 156.528 83.579  141.124 1.00 88.77  ? 314 GLN B CB  1 
ATOM   5178  C CG  . GLN B  2  314 ? 157.801 83.006  140.522 1.00 88.77  ? 314 GLN B CG  1 
ATOM   5179  C CD  . GLN B  2  314 ? 157.541 82.220  139.251 1.00 88.77  ? 314 GLN B CD  1 
ATOM   5180  O OE1 . GLN B  2  314 ? 156.408 82.145  138.775 1.00 88.77  ? 314 GLN B OE1 1 
ATOM   5181  N NE2 . GLN B  2  314 ? 158.589 81.621  138.700 1.00 88.77  ? 314 GLN B NE2 1 
ATOM   5182  N N   . PRO B  2  315 ? 158.844 85.542  142.700 1.00 90.52  ? 315 PRO B N   1 
ATOM   5183  C CA  . PRO B  2  315 ? 159.696 86.728  142.539 1.00 90.52  ? 315 PRO B CA  1 
ATOM   5184  C C   . PRO B  2  315 ? 160.211 86.893  141.118 1.00 90.52  ? 315 PRO B C   1 
ATOM   5185  O O   . PRO B  2  315 ? 160.492 88.014  140.676 1.00 90.52  ? 315 PRO B O   1 
ATOM   5186  C CB  . PRO B  2  315 ? 160.843 86.464  143.521 1.00 90.52  ? 315 PRO B CB  1 
ATOM   5187  C CG  . PRO B  2  315 ? 160.919 84.979  143.604 1.00 90.52  ? 315 PRO B CG  1 
ATOM   5188  C CD  . PRO B  2  315 ? 159.506 84.481  143.477 1.00 90.52  ? 315 PRO B CD  1 
ATOM   5189  N N   . ALA B  2  316 ? 160.342 85.775  140.397 1.00 83.18  ? 316 ALA B N   1 
ATOM   5190  C CA  . ALA B  2  316 ? 160.845 85.830  139.030 1.00 83.18  ? 316 ALA B CA  1 
ATOM   5191  C C   . ALA B  2  316 ? 159.936 86.656  138.130 1.00 83.18  ? 316 ALA B C   1 
ATOM   5192  O O   . ALA B  2  316 ? 160.420 87.344  137.225 1.00 83.18  ? 316 ALA B O   1 
ATOM   5193  C CB  . ALA B  2  316 ? 161.009 84.417  138.471 1.00 83.18  ? 316 ALA B CB  1 
ATOM   5194  N N   . ARG B  2  317 ? 158.624 86.615  138.373 1.00 85.15  ? 317 ARG B N   1 
ATOM   5195  C CA  . ARG B  2  317 ? 157.694 87.407  137.574 1.00 85.15  ? 317 ARG B CA  1 
ATOM   5196  C C   . ARG B  2  317 ? 157.975 88.896  137.725 1.00 85.15  ? 317 ARG B C   1 
ATOM   5197  O O   . ARG B  2  317 ? 158.102 89.619  136.731 1.00 85.15  ? 317 ARG B O   1 
ATOM   5198  C CB  . ARG B  2  317 ? 156.255 87.086  137.976 1.00 85.15  ? 317 ARG B CB  1 
ATOM   5199  C CG  . ARG B  2  317 ? 155.821 85.671  137.641 1.00 85.15  ? 317 ARG B CG  1 
ATOM   5200  C CD  . ARG B  2  317 ? 154.397 85.408  138.106 1.00 85.15  ? 317 ARG B CD  1 
ATOM   5201  N NE  . ARG B  2  317 ? 153.980 84.032  137.844 1.00 85.15  ? 317 ARG B NE  1 
ATOM   5202  C CZ  . ARG B  2  317 ? 152.812 83.521  138.221 1.00 85.15  ? 317 ARG B CZ  1 
ATOM   5203  N NH1 . ARG B  2  317 ? 151.939 84.270  138.879 1.00 85.15  ? 317 ARG B NH1 1 
ATOM   5204  N NH2 . ARG B  2  317 ? 152.518 82.259  137.941 1.00 85.15  ? 317 ARG B NH2 1 
ATOM   5205  N N   . ALA B  2  318 ? 158.081 89.373  138.968 1.00 82.48  ? 318 ALA B N   1 
ATOM   5206  C CA  . ALA B  2  318 ? 158.363 90.786  139.198 1.00 82.48  ? 318 ALA B CA  1 
ATOM   5207  C C   . ALA B  2  318 ? 159.741 91.167  138.672 1.00 82.48  ? 318 ALA B C   1 
ATOM   5208  O O   . ALA B  2  318 ? 159.925 92.258  138.112 1.00 82.48  ? 318 ALA B O   1 
ATOM   5209  C CB  . ALA B  2  318 ? 158.249 91.107  140.687 1.00 82.48  ? 318 ALA B CB  1 
ATOM   5210  N N   . ALA B  2  319 ? 160.725 90.282  138.848 1.00 82.68  ? 319 ALA B N   1 
ATOM   5211  C CA  . ALA B  2  319 ? 162.060 90.547  138.323 1.00 82.68  ? 319 ALA B CA  1 
ATOM   5212  C C   . ALA B  2  319 ? 162.024 90.734  136.811 1.00 82.68  ? 319 ALA B C   1 
ATOM   5213  O O   . ALA B  2  319 ? 162.623 91.673  136.275 1.00 82.68  ? 319 ALA B O   1 
ATOM   5214  C CB  . ALA B  2  319 ? 163.008 89.410  138.707 1.00 82.68  ? 319 ALA B CB  1 
ATOM   5215  N N   . LYS B  2  320 ? 161.306 89.854  136.109 1.00 81.57  ? 320 LYS B N   1 
ATOM   5216  C CA  . LYS B  2  320 ? 161.210 89.963  134.658 1.00 81.57  ? 320 LYS B CA  1 
ATOM   5217  C C   . LYS B  2  320 ? 160.437 91.211  134.243 1.00 81.57  ? 320 LYS B C   1 
ATOM   5218  O O   . LYS B  2  320 ? 160.788 91.863  133.252 1.00 81.57  ? 320 LYS B O   1 
ATOM   5219  C CB  . LYS B  2  320 ? 160.557 88.706  134.086 1.00 81.57  ? 320 LYS B CB  1 
ATOM   5220  C CG  . LYS B  2  320 ? 160.521 88.659  132.571 1.00 81.57  ? 320 LYS B CG  1 
ATOM   5221  C CD  . LYS B  2  320 ? 159.930 87.352  132.076 1.00 81.57  ? 320 LYS B CD  1 
ATOM   5222  C CE  . LYS B  2  320 ? 159.880 87.313  130.559 1.00 81.57  ? 320 LYS B CE  1 
ATOM   5223  N NZ  . LYS B  2  320 ? 159.292 86.042  130.053 1.00 81.57  ? 320 LYS B NZ  1 
ATOM   5224  N N   . ILE B  2  321 ? 159.386 91.563  134.989 1.00 78.11  ? 321 ILE B N   1 
ATOM   5225  C CA  . ILE B  2  321 ? 158.622 92.767  134.669 1.00 78.11  ? 321 ILE B CA  1 
ATOM   5226  C C   . ILE B  2  321 ? 159.513 93.999  134.758 1.00 78.11  ? 321 ILE B C   1 
ATOM   5227  O O   . ILE B  2  321 ? 159.496 94.867  133.876 1.00 78.11  ? 321 ILE B O   1 
ATOM   5228  C CB  . ILE B  2  321 ? 157.394 92.892  135.587 1.00 78.11  ? 321 ILE B CB  1 
ATOM   5229  C CG1 . ILE B  2  321 ? 156.400 91.767  135.314 1.00 78.11  ? 321 ILE B CG1 1 
ATOM   5230  C CG2 . ILE B  2  321 ? 156.718 94.231  135.386 1.00 78.11  ? 321 ILE B CG2 1 
ATOM   5231  C CD1 . ILE B  2  321 ? 155.294 91.681  136.341 1.00 78.11  ? 321 ILE B CD1 1 
ATOM   5232  N N   . ASP B  2  322 ? 160.306 94.096  135.828 1.00 84.76  ? 322 ASP B N   1 
ATOM   5233  C CA  . ASP B  2  322 ? 161.234 95.217  135.942 1.00 84.76  ? 322 ASP B CA  1 
ATOM   5234  C C   . ASP B  2  322 ? 162.279 95.184  134.833 1.00 84.76  ? 322 ASP B C   1 
ATOM   5235  O O   . ASP B  2  322 ? 162.585 96.219  134.224 1.00 84.76  ? 322 ASP B O   1 
ATOM   5236  C CB  . ASP B  2  322 ? 161.907 95.210  137.315 1.00 84.76  ? 322 ASP B CB  1 
ATOM   5237  C CG  . ASP B  2  322 ? 160.967 95.628  138.427 1.00 84.76  ? 322 ASP B CG  1 
ATOM   5238  O OD1 . ASP B  2  322 ? 160.052 96.434  138.161 1.00 84.76  ? 322 ASP B OD1 1 
ATOM   5239  O OD2 . ASP B  2  322 ? 161.141 95.151  139.568 1.00 84.76  ? 322 ASP B OD2 1 
ATOM   5240  N N   . ARG B  2  323 ? 162.834 94.000  134.554 1.00 81.88  ? 323 ARG B N   1 
ATOM   5241  C CA  . ARG B  2  323 ? 163.869 93.878  133.532 1.00 81.88  ? 323 ARG B CA  1 
ATOM   5242  C C   . ARG B  2  323 ? 163.354 94.284  132.159 1.00 81.88  ? 323 ARG B C   1 
ATOM   5243  O O   . ARG B  2  323 ? 164.130 94.740  131.312 1.00 81.88  ? 323 ARG B O   1 
ATOM   5244  C CB  . ARG B  2  323 ? 164.400 92.442  133.510 1.00 81.88  ? 323 ARG B CB  1 
ATOM   5245  C CG  . ARG B  2  323 ? 165.595 92.206  132.598 1.00 81.88  ? 323 ARG B CG  1 
ATOM   5246  C CD  . ARG B  2  323 ? 165.177 91.642  131.248 1.00 81.88  ? 323 ARG B CD  1 
ATOM   5247  N NE  . ARG B  2  323 ? 166.329 91.371  130.393 1.00 81.88  ? 323 ARG B NE  1 
ATOM   5248  C CZ  . ARG B  2  323 ? 166.913 92.282  129.623 1.00 81.88  ? 323 ARG B CZ  1 
ATOM   5249  N NH1 . ARG B  2  323 ? 167.957 91.951  128.876 1.00 81.88  ? 323 ARG B NH1 1 
ATOM   5250  N NH2 . ARG B  2  323 ? 166.452 93.524  129.600 1.00 81.88  ? 323 ARG B NH2 1 
ATOM   5251  N N   . LEU B  2  324 ? 162.054 94.123  131.919 1.00 81.20  ? 324 LEU B N   1 
ATOM   5252  C CA  . LEU B  2  324 ? 161.479 94.567  130.654 1.00 81.20  ? 324 LEU B CA  1 
ATOM   5253  C C   . LEU B  2  324 ? 161.189 96.066  130.669 1.00 81.20  ? 324 LEU B C   1 
ATOM   5254  O O   . LEU B  2  324 ? 161.545 96.786  129.727 1.00 81.20  ? 324 LEU B O   1 
ATOM   5255  C CB  . LEU B  2  324 ? 160.205 93.773  130.355 1.00 81.20  ? 324 LEU B CB  1 
ATOM   5256  C CG  . LEU B  2  324 ? 160.379 92.278  130.083 1.00 81.20  ? 324 LEU B CG  1 
ATOM   5257  C CD1 . LEU B  2  324 ? 159.027 91.593  129.981 1.00 81.20  ? 324 LEU B CD1 1 
ATOM   5258  C CD2 . LEU B  2  324 ? 161.191 92.053  128.818 1.00 81.20  ? 324 LEU B CD2 1 
ATOM   5259  N N   . SER B  2  325 ? 160.559 96.555  131.742 1.00 80.06  ? 325 SER B N   1 
ATOM   5260  C CA  . SER B  2  325 ? 160.112 97.944  131.776 1.00 80.06  ? 325 SER B CA  1 
ATOM   5261  C C   . SER B  2  325 ? 161.285 98.917  131.756 1.00 80.06  ? 325 SER B C   1 
ATOM   5262  O O   . SER B  2  325 ? 161.201 99.981  131.124 1.00 80.06  ? 325 SER B O   1 
ATOM   5263  C CB  . SER B  2  325 ? 159.246 98.181  133.012 1.00 80.06  ? 325 SER B CB  1 
ATOM   5264  O OG  . SER B  2  325 ? 158.070 97.392  132.971 1.00 80.06  ? 325 SER B OG  1 
ATOM   5265  N N   . ARG B  2  326 ? 162.386 98.564  132.433 1.00 85.34  ? 326 ARG B N   1 
ATOM   5266  C CA  . ARG B  2  326 ? 163.530 99.469  132.534 1.00 85.34  ? 326 ARG B CA  1 
ATOM   5267  C C   . ARG B  2  326 ? 164.050 99.881  131.163 1.00 85.34  ? 326 ARG B C   1 
ATOM   5268  O O   . ARG B  2  326 ? 164.545 101.000 130.991 1.00 85.34  ? 326 ARG B O   1 
ATOM   5269  C CB  . ARG B  2  326 ? 164.646 98.815  133.348 1.00 85.34  ? 326 ARG B CB  1 
ATOM   5270  C CG  . ARG B  2  326 ? 164.357 98.711  134.832 1.00 85.34  ? 326 ARG B CG  1 
ATOM   5271  C CD  . ARG B  2  326 ? 165.474 97.977  135.554 1.00 85.34  ? 326 ARG B CD  1 
ATOM   5272  N NE  . ARG B  2  326 ? 165.220 97.870  136.987 1.00 85.34  ? 326 ARG B NE  1 
ATOM   5273  C CZ  . ARG B  2  326 ? 165.989 97.193  137.833 1.00 85.34  ? 326 ARG B CZ  1 
ATOM   5274  N NH1 . ARG B  2  326 ? 167.060 96.550  137.389 1.00 85.34  ? 326 ARG B NH1 1 
ATOM   5275  N NH2 . ARG B  2  326 ? 165.683 97.154  139.122 1.00 85.34  ? 326 ARG B NH2 1 
ATOM   5276  N N   . ILE B  2  327 ? 163.961 98.991  130.180 1.00 87.72  ? 327 ILE B N   1 
ATOM   5277  C CA  . ILE B  2  327 ? 164.379 99.341  128.828 1.00 87.72  ? 327 ILE B CA  1 
ATOM   5278  C C   . ILE B  2  327 ? 163.195 99.779  127.968 1.00 87.72  ? 327 ILE B C   1 
ATOM   5279  O O   . ILE B  2  327 ? 163.366 100.582 127.044 1.00 87.72  ? 327 ILE B O   1 
ATOM   5280  C CB  . ILE B  2  327 ? 165.140 98.163  128.192 1.00 87.72  ? 327 ILE B CB  1 
ATOM   5281  C CG1 . ILE B  2  327 ? 166.427 97.891  128.970 1.00 87.72  ? 327 ILE B CG1 1 
ATOM   5282  C CG2 . ILE B  2  327 ? 165.477 98.438  126.734 1.00 87.72  ? 327 ILE B CG2 1 
ATOM   5283  C CD1 . ILE B  2  327 ? 167.134 96.621  128.558 1.00 87.72  ? 327 ILE B CD1 1 
ATOM   5284  N N   . ALA B  2  328 ? 161.985 99.304  128.273 1.00 81.39  ? 328 ALA B N   1 
ATOM   5285  C CA  . ALA B  2  328 ? 160.836 99.637  127.437 1.00 81.39  ? 328 ALA B CA  1 
ATOM   5286  C C   . ALA B  2  328 ? 160.457 101.111 127.557 1.00 81.39  ? 328 ALA B C   1 
ATOM   5287  O O   . ALA B  2  328 ? 160.284 101.798 126.545 1.00 81.39  ? 328 ALA B O   1 
ATOM   5288  C CB  . ALA B  2  328 ? 159.649 98.746  127.802 1.00 81.39  ? 328 ALA B CB  1 
ATOM   5289  N N   . PHE B  2  329 ? 160.321 101.619 128.788 1.00 78.00  ? 329 PHE B N   1 
ATOM   5290  C CA  . PHE B  2  329 ? 159.737 102.953 128.948 1.00 78.00  ? 329 PHE B CA  1 
ATOM   5291  C C   . PHE B  2  329 ? 160.650 104.076 128.461 1.00 78.00  ? 329 PHE B C   1 
ATOM   5292  O O   . PHE B  2  329 ? 160.183 104.922 127.673 1.00 78.00  ? 329 PHE B O   1 
ATOM   5293  C CB  . PHE B  2  329 ? 159.298 103.164 130.401 1.00 78.00  ? 329 PHE B CB  1 
ATOM   5294  C CG  . PHE B  2  329 ? 158.049 102.414 130.773 1.00 78.00  ? 329 PHE B CG  1 
ATOM   5295  C CD1 . PHE B  2  329 ? 157.238 101.863 129.796 1.00 78.00  ? 329 PHE B CD1 1 
ATOM   5296  C CD2 . PHE B  2  329 ? 157.678 102.273 132.097 1.00 78.00  ? 329 PHE B CD2 1 
ATOM   5297  C CE1 . PHE B  2  329 ? 156.087 101.178 130.135 1.00 78.00  ? 329 PHE B CE1 1 
ATOM   5298  C CE2 . PHE B  2  329 ? 156.529 101.589 132.441 1.00 78.00  ? 329 PHE B CE2 1 
ATOM   5299  C CZ  . PHE B  2  329 ? 155.733 101.041 131.459 1.00 78.00  ? 329 PHE B CZ  1 
ATOM   5300  N N   . PRO B  2  330 ? 161.920 104.172 128.882 1.00 74.79  ? 330 PRO B N   1 
ATOM   5301  C CA  . PRO B  2  330 ? 162.739 105.310 128.426 1.00 74.79  ? 330 PRO B CA  1 
ATOM   5302  C C   . PRO B  2  330 ? 162.915 105.367 126.920 1.00 74.79  ? 330 PRO B C   1 
ATOM   5303  O O   . PRO B  2  330 ? 162.902 106.461 126.337 1.00 74.79  ? 330 PRO B O   1 
ATOM   5304  C CB  . PRO B  2  330 ? 164.078 105.084 129.142 1.00 74.79  ? 330 PRO B CB  1 
ATOM   5305  C CG  . PRO B  2  330 ? 163.744 104.246 130.317 1.00 74.79  ? 330 PRO B CG  1 
ATOM   5306  C CD  . PRO B  2  330 ? 162.651 103.339 129.852 1.00 74.79  ? 330 PRO B CD  1 
ATOM   5307  N N   . LEU B  2  331 ? 163.082 104.214 126.270 1.00 76.10  ? 331 LEU B N   1 
ATOM   5308  C CA  . LEU B  2  331 ? 163.230 104.202 124.820 1.00 76.10  ? 331 LEU B CA  1 
ATOM   5309  C C   . LEU B  2  331 ? 161.977 104.732 124.135 1.00 76.10  ? 331 LEU B C   1 
ATOM   5310  O O   . LEU B  2  331 ? 162.064 105.490 123.161 1.00 76.10  ? 331 LEU B O   1 
ATOM   5311  C CB  . LEU B  2  331 ? 163.553 102.789 124.338 1.00 76.10  ? 331 LEU B CB  1 
ATOM   5312  C CG  . LEU B  2  331 ? 163.808 102.650 122.838 1.00 76.10  ? 331 LEU B CG  1 
ATOM   5313  C CD1 . LEU B  2  331 ? 165.019 103.472 122.431 1.00 76.10  ? 331 LEU B CD1 1 
ATOM   5314  C CD2 . LEU B  2  331 ? 163.994 101.191 122.459 1.00 76.10  ? 331 LEU B CD2 1 
ATOM   5315  N N   . LEU B  2  332 ? 160.798 104.351 124.637 1.00 75.58  ? 332 LEU B N   1 
ATOM   5316  C CA  . LEU B  2  332 ? 159.557 104.856 124.059 1.00 75.58  ? 332 LEU B CA  1 
ATOM   5317  C C   . LEU B  2  332 ? 159.419 106.359 124.260 1.00 75.58  ? 332 LEU B C   1 
ATOM   5318  O O   . LEU B  2  332 ? 158.981 107.070 123.348 1.00 75.58  ? 332 LEU B O   1 
ATOM   5319  C CB  . LEU B  2  332 ? 158.354 104.127 124.654 1.00 75.58  ? 332 LEU B CB  1 
ATOM   5320  C CG  . LEU B  2  332 ? 158.181 102.665 124.245 1.00 75.58  ? 332 LEU B CG  1 
ATOM   5321  C CD1 . LEU B  2  332 ? 157.028 102.032 125.004 1.00 75.58  ? 332 LEU B CD1 1 
ATOM   5322  C CD2 . LEU B  2  332 ? 157.960 102.562 122.746 1.00 75.58  ? 332 LEU B CD2 1 
ATOM   5323  N N   . PHE B  2  333 ? 159.785 106.868 125.439 1.00 74.76  ? 333 PHE B N   1 
ATOM   5324  C CA  . PHE B  2  333 ? 159.689 108.312 125.642 1.00 74.76  ? 333 PHE B CA  1 
ATOM   5325  C C   . PHE B  2  333 ? 160.653 109.064 124.729 1.00 74.76  ? 333 PHE B C   1 
ATOM   5326  O O   . PHE B  2  333 ? 160.312 110.127 124.191 1.00 74.76  ? 333 PHE B O   1 
ATOM   5327  C CB  . PHE B  2  333 ? 159.939 108.664 127.106 1.00 74.76  ? 333 PHE B CB  1 
ATOM   5328  C CG  . PHE B  2  333 ? 159.786 110.128 127.409 1.00 74.76  ? 333 PHE B CG  1 
ATOM   5329  C CD1 . PHE B  2  333 ? 158.532 110.720 127.424 1.00 74.76  ? 333 PHE B CD1 1 
ATOM   5330  C CD2 . PHE B  2  333 ? 160.891 110.911 127.691 1.00 74.76  ? 333 PHE B CD2 1 
ATOM   5331  C CE1 . PHE B  2  333 ? 158.385 112.065 127.702 1.00 74.76  ? 333 PHE B CE1 1 
ATOM   5332  C CE2 . PHE B  2  333 ? 160.750 112.257 127.974 1.00 74.76  ? 333 PHE B CE2 1 
ATOM   5333  C CZ  . PHE B  2  333 ? 159.495 112.834 127.979 1.00 74.76  ? 333 PHE B CZ  1 
ATOM   5334  N N   . GLY B  2  334 ? 161.856 108.523 124.529 1.00 66.17  ? 334 GLY B N   1 
ATOM   5335  C CA  . GLY B  2  334 ? 162.789 109.150 123.605 1.00 66.17  ? 334 GLY B CA  1 
ATOM   5336  C C   . GLY B  2  334 ? 162.284 109.144 122.174 1.00 66.17  ? 334 GLY B C   1 
ATOM   5337  O O   . GLY B  2  334 ? 162.387 110.148 121.462 1.00 66.17  ? 334 GLY B O   1 
ATOM   5338  N N   . ILE B  2  335 ? 161.725 108.013 121.735 1.00 75.96  ? 335 ILE B N   1 
ATOM   5339  C CA  . ILE B  2  335 ? 161.148 107.940 120.396 1.00 75.96  ? 335 ILE B CA  1 
ATOM   5340  C C   . ILE B  2  335 ? 159.997 108.928 120.255 1.00 75.96  ? 335 ILE B C   1 
ATOM   5341  O O   . ILE B  2  335 ? 159.806 109.538 119.194 1.00 75.96  ? 335 ILE B O   1 
ATOM   5342  C CB  . ILE B  2  335 ? 160.707 106.499 120.080 1.00 75.96  ? 335 ILE B CB  1 
ATOM   5343  C CG1 . ILE B  2  335 ? 161.929 105.590 119.943 1.00 75.96  ? 335 ILE B CG1 1 
ATOM   5344  C CG2 . ILE B  2  335 ? 159.851 106.451 118.824 1.00 75.96  ? 335 ILE B CG2 1 
ATOM   5345  C CD1 . ILE B  2  335 ? 161.590 104.124 119.857 1.00 75.96  ? 335 ILE B CD1 1 
ATOM   5346  N N   . PHE B  2  336 ? 159.222 109.121 121.324 1.00 75.53  ? 336 PHE B N   1 
ATOM   5347  C CA  . PHE B  2  336 ? 158.119 110.070 121.237 1.00 75.53  ? 336 PHE B CA  1 
ATOM   5348  C C   . PHE B  2  336 ? 158.620 111.503 121.122 1.00 75.53  ? 336 PHE B C   1 
ATOM   5349  O O   . PHE B  2  336 ? 158.047 112.299 120.373 1.00 75.53  ? 336 PHE B O   1 
ATOM   5350  C CB  . PHE B  2  336 ? 157.183 109.947 122.431 1.00 75.53  ? 336 PHE B CB  1 
ATOM   5351  C CG  . PHE B  2  336 ? 156.072 110.939 122.391 1.00 75.53  ? 336 PHE B CG  1 
ATOM   5352  C CD1 . PHE B  2  336 ? 155.023 110.775 121.506 1.00 75.53  ? 336 PHE B CD1 1 
ATOM   5353  C CD2 . PHE B  2  336 ? 156.100 112.064 123.192 1.00 75.53  ? 336 PHE B CD2 1 
ATOM   5354  C CE1 . PHE B  2  336 ? 154.008 111.695 121.443 1.00 75.53  ? 336 PHE B CE1 1 
ATOM   5355  C CE2 . PHE B  2  336 ? 155.087 112.987 123.135 1.00 75.53  ? 336 PHE B CE2 1 
ATOM   5356  C CZ  . PHE B  2  336 ? 154.042 112.807 122.253 1.00 75.53  ? 336 PHE B CZ  1 
ATOM   5357  N N   . ASN B  2  337 ? 159.659 111.865 121.878 1.00 75.83  ? 337 ASN B N   1 
ATOM   5358  C CA  . ASN B  2  337 ? 160.262 113.182 121.681 1.00 75.83  ? 337 ASN B CA  1 
ATOM   5359  C C   . ASN B  2  337 ? 160.762 113.343 120.251 1.00 75.83  ? 337 ASN B C   1 
ATOM   5360  O O   . ASN B  2  337 ? 160.598 114.409 119.638 1.00 75.83  ? 337 ASN B O   1 
ATOM   5361  C CB  . ASN B  2  337 ? 161.405 113.406 122.670 1.00 75.83  ? 337 ASN B CB  1 
ATOM   5362  C CG  . ASN B  2  337 ? 160.919 113.590 124.087 1.00 75.83  ? 337 ASN B CG  1 
ATOM   5363  O OD1 . ASN B  2  337 ? 161.175 112.760 124.957 1.00 75.83  ? 337 ASN B OD1 1 
ATOM   5364  N ND2 . ASN B  2  337 ? 160.220 114.692 124.332 1.00 75.83  ? 337 ASN B ND2 1 
ATOM   5365  N N   . LEU B  2  338 ? 161.374 112.289 119.707 1.00 74.96  ? 338 LEU B N   1 
ATOM   5366  C CA  . LEU B  2  338 ? 161.847 112.324 118.327 1.00 74.96  ? 338 LEU B CA  1 
ATOM   5367  C C   . LEU B  2  338 ? 160.704 112.613 117.362 1.00 74.96  ? 338 LEU B C   1 
ATOM   5368  O O   . LEU B  2  338 ? 160.835 113.441 116.454 1.00 74.96  ? 338 LEU B O   1 
ATOM   5369  C CB  . LEU B  2  338 ? 162.523 110.998 117.979 1.00 74.96  ? 338 LEU B CB  1 
ATOM   5370  C CG  . LEU B  2  338 ? 163.095 110.854 116.569 1.00 74.96  ? 338 LEU B CG  1 
ATOM   5371  C CD1 . LEU B  2  338 ? 164.197 111.873 116.327 1.00 74.96  ? 338 LEU B CD1 1 
ATOM   5372  C CD2 . LEU B  2  338 ? 163.608 109.439 116.348 1.00 74.96  ? 338 LEU B CD2 1 
ATOM   5373  N N   . VAL B  2  339 ? 159.571 111.936 117.547 1.00 78.08  ? 339 VAL B N   1 
ATOM   5374  C CA  . VAL B  2  339 ? 158.438 112.131 116.647 1.00 78.08  ? 339 VAL B CA  1 
ATOM   5375  C C   . VAL B  2  339 ? 157.823 113.511 116.847 1.00 78.08  ? 339 VAL B C   1 
ATOM   5376  O O   . VAL B  2  339 ? 157.369 114.150 115.889 1.00 78.08  ? 339 VAL B O   1 
ATOM   5377  C CB  . VAL B  2  339 ? 157.399 111.012 116.844 1.00 78.08  ? 339 VAL B CB  1 
ATOM   5378  C CG1 . VAL B  2  339 ? 156.164 111.269 115.993 1.00 78.08  ? 339 VAL B CG1 1 
ATOM   5379  C CG2 . VAL B  2  339 ? 158.004 109.660 116.507 1.00 78.08  ? 339 VAL B CG2 1 
ATOM   5380  N N   . TYR B  2  340 ? 157.812 114.002 118.086 1.00 78.55  ? 340 TYR B N   1 
ATOM   5381  C CA  . TYR B  2  340 ? 157.119 115.248 118.391 1.00 78.55  ? 340 TYR B CA  1 
ATOM   5382  C C   . TYR B  2  340 ? 157.887 116.454 117.868 1.00 78.55  ? 340 TYR B C   1 
ATOM   5383  O O   . TYR B  2  340 ? 157.401 117.187 117.000 1.00 78.55  ? 340 TYR B O   1 
ATOM   5384  C CB  . TYR B  2  340 ? 156.909 115.369 119.901 1.00 78.55  ? 340 TYR B CB  1 
ATOM   5385  C CG  . TYR B  2  340 ? 156.132 116.595 120.316 1.00 78.55  ? 340 TYR B CG  1 
ATOM   5386  C CD1 . TYR B  2  340 ? 154.748 116.617 120.249 1.00 78.55  ? 340 TYR B CD1 1 
ATOM   5387  C CD2 . TYR B  2  340 ? 156.784 117.737 120.755 1.00 78.55  ? 340 TYR B CD2 1 
ATOM   5388  C CE1 . TYR B  2  340 ? 154.034 117.734 120.625 1.00 78.55  ? 340 TYR B CE1 1 
ATOM   5389  C CE2 . TYR B  2  340 ? 156.079 118.860 121.127 1.00 78.55  ? 340 TYR B CE2 1 
ATOM   5390  C CZ  . TYR B  2  340 ? 154.704 118.854 121.060 1.00 78.55  ? 340 TYR B CZ  1 
ATOM   5391  O OH  . TYR B  2  340 ? 153.993 119.972 121.432 1.00 78.55  ? 340 TYR B OH  1 
ATOM   5392  N N   . TRP B  2  341 ? 159.101 116.670 118.379 1.00 79.60  ? 341 TRP B N   1 
ATOM   5393  C CA  . TRP B  2  341 ? 159.780 117.933 118.109 1.00 79.60  ? 341 TRP B CA  1 
ATOM   5394  C C   . TRP B  2  341 ? 160.191 118.093 116.654 1.00 79.60  ? 341 TRP B C   1 
ATOM   5395  O O   . TRP B  2  341 ? 160.518 119.209 116.238 1.00 79.60  ? 341 TRP B O   1 
ATOM   5396  C CB  . TRP B  2  341 ? 161.009 118.086 119.002 1.00 79.60  ? 341 TRP B CB  1 
ATOM   5397  C CG  . TRP B  2  341 ? 160.682 118.326 120.434 1.00 79.60  ? 341 TRP B CG  1 
ATOM   5398  C CD1 . TRP B  2  341 ? 160.698 117.412 121.444 1.00 79.60  ? 341 TRP B CD1 1 
ATOM   5399  C CD2 . TRP B  2  341 ? 160.275 119.565 121.020 1.00 79.60  ? 341 TRP B CD2 1 
ATOM   5400  N NE1 . TRP B  2  341 ? 160.334 118.006 122.627 1.00 79.60  ? 341 TRP B NE1 1 
ATOM   5401  C CE2 . TRP B  2  341 ? 160.068 119.329 122.392 1.00 79.60  ? 341 TRP B CE2 1 
ATOM   5402  C CE3 . TRP B  2  341 ? 160.067 120.851 120.519 1.00 79.60  ? 341 TRP B CE3 1 
ATOM   5403  C CZ2 . TRP B  2  341 ? 159.664 120.331 123.267 1.00 79.60  ? 341 TRP B CZ2 1 
ATOM   5404  C CZ3 . TRP B  2  341 ? 159.666 121.843 121.389 1.00 79.60  ? 341 TRP B CZ3 1 
ATOM   5405  C CH2 . TRP B  2  341 ? 159.470 121.579 122.746 1.00 79.60  ? 341 TRP B CH2 1 
ATOM   5406  N N   . ALA B  2  342 ? 160.187 117.015 115.872 1.00 78.97  ? 342 ALA B N   1 
ATOM   5407  C CA  . ALA B  2  342 ? 160.659 117.110 114.495 1.00 78.97  ? 342 ALA B CA  1 
ATOM   5408  C C   . ALA B  2  342 ? 159.640 117.803 113.598 1.00 78.97  ? 342 ALA B C   1 
ATOM   5409  O O   . ALA B  2  342 ? 160.015 118.552 112.689 1.00 78.97  ? 342 ALA B O   1 
ATOM   5410  C CB  . ALA B  2  342 ? 160.987 115.718 113.958 1.00 78.97  ? 342 ALA B CB  1 
ATOM   5411  N N   . THR B  2  343 ? 158.350 117.570 113.839 1.00 77.18  ? 343 THR B N   1 
ATOM   5412  C CA  . THR B  2  343 ? 157.330 117.990 112.883 1.00 77.18  ? 343 THR B CA  1 
ATOM   5413  C C   . THR B  2  343 ? 157.103 119.497 112.921 1.00 77.18  ? 343 THR B C   1 
ATOM   5414  O O   . THR B  2  343 ? 157.067 120.154 111.874 1.00 77.18  ? 343 THR B O   1 
ATOM   5415  C CB  . THR B  2  343 ? 156.023 117.245 113.156 1.00 77.18  ? 343 THR B CB  1 
ATOM   5416  O OG1 . THR B  2  343 ? 156.232 115.838 112.986 1.00 77.18  ? 343 THR B OG1 1 
ATOM   5417  C CG2 . THR B  2  343 ? 154.935 117.707 112.205 1.00 77.18  ? 343 THR B CG2 1 
ATOM   5418  N N   . TYR B  2  344 ? 156.951 120.065 114.119 1.00 68.72  ? 344 TYR B N   1 
ATOM   5419  C CA  . TYR B  2  344 ? 156.475 121.441 114.234 1.00 68.72  ? 344 TYR B CA  1 
ATOM   5420  C C   . TYR B  2  344 ? 157.487 122.441 113.683 1.00 68.72  ? 344 TYR B C   1 
ATOM   5421  O O   . TYR B  2  344 ? 157.120 123.360 112.943 1.00 68.72  ? 344 TYR B O   1 
ATOM   5422  C CB  . TYR B  2  344 ? 156.131 121.748 115.688 1.00 68.72  ? 344 TYR B CB  1 
ATOM   5423  C CG  . TYR B  2  344 ? 154.870 121.064 116.154 1.00 68.72  ? 344 TYR B CG  1 
ATOM   5424  C CD1 . TYR B  2  344 ? 153.960 120.557 115.240 1.00 68.72  ? 344 TYR B CD1 1 
ATOM   5425  C CD2 . TYR B  2  344 ? 154.593 120.915 117.503 1.00 68.72  ? 344 TYR B CD2 1 
ATOM   5426  C CE1 . TYR B  2  344 ? 152.808 119.931 115.654 1.00 68.72  ? 344 TYR B CE1 1 
ATOM   5427  C CE2 . TYR B  2  344 ? 153.443 120.285 117.926 1.00 68.72  ? 344 TYR B CE2 1 
ATOM   5428  C CZ  . TYR B  2  344 ? 152.553 119.798 116.996 1.00 68.72  ? 344 TYR B CZ  1 
ATOM   5429  O OH  . TYR B  2  344 ? 151.403 119.170 117.408 1.00 68.72  ? 344 TYR B OH  1 
ATOM   5430  N N   . LEU B  2  345 ? 158.759 122.291 114.038 1.00 71.95  ? 345 LEU B N   1 
ATOM   5431  C CA  . LEU B  2  345 ? 159.800 123.154 113.481 1.00 71.95  ? 345 LEU B CA  1 
ATOM   5432  C C   . LEU B  2  345 ? 159.884 123.014 111.964 1.00 71.95  ? 345 LEU B C   1 
ATOM   5433  O O   . LEU B  2  345 ? 159.457 123.902 111.224 1.00 71.95  ? 345 LEU B O   1 
ATOM   5434  C CB  . LEU B  2  345 ? 161.160 122.841 114.109 1.00 71.95  ? 345 LEU B CB  1 
ATOM   5435  C CG  . LEU B  2  345 ? 161.407 123.294 115.546 1.00 71.95  ? 345 LEU B CG  1 
ATOM   5436  C CD1 . LEU B  2  345 ? 162.676 122.668 116.085 1.00 71.95  ? 345 LEU B CD1 1 
ATOM   5437  C CD2 . LEU B  2  345 ? 161.518 124.808 115.590 1.00 71.95  ? 345 LEU B CD2 1 
ATOM   5438  N N   . ASN C  1  8   ? 123.676 168.405 90.293  1.00 58.92  ? 8   ASN C N   1 
ATOM   5439  C CA  . ASN C  1  8   ? 124.324 169.691 90.518  1.00 58.92  ? 8   ASN C CA  1 
ATOM   5440  C C   . ASN C  1  8   ? 124.548 169.907 92.010  1.00 58.92  ? 8   ASN C C   1 
ATOM   5441  O O   . ASN C  1  8   ? 124.014 169.173 92.839  1.00 58.92  ? 8   ASN C O   1 
ATOM   5442  C CB  . ASN C  1  8   ? 123.484 170.827 89.926  1.00 58.92  ? 8   ASN C CB  1 
ATOM   5443  C CG  . ASN C  1  8   ? 124.225 172.153 89.893  1.00 58.92  ? 8   ASN C CG  1 
ATOM   5444  O OD1 . ASN C  1  8   ? 125.361 172.255 90.356  1.00 58.92  ? 8   ASN C OD1 1 
ATOM   5445  N ND2 . ASN C  1  8   ? 123.584 173.175 89.341  1.00 58.92  ? 8   ASN C ND2 1 
ATOM   5446  N N   . MET C  1  9   ? 125.349 170.916 92.342  1.00 61.55  ? 9   MET C N   1 
ATOM   5447  C CA  . MET C  1  9   ? 125.690 171.224 93.724  1.00 61.55  ? 9   MET C CA  1 
ATOM   5448  C C   . MET C  1  9   ? 124.885 172.380 94.301  1.00 61.55  ? 9   MET C C   1 
ATOM   5449  O O   . MET C  1  9   ? 124.740 172.463 95.525  1.00 61.55  ? 9   MET C O   1 
ATOM   5450  C CB  . MET C  1  9   ? 127.187 171.542 93.826  1.00 61.55  ? 9   MET C CB  1 
ATOM   5451  C CG  . MET C  1  9   ? 127.715 171.737 95.232  1.00 61.55  ? 9   MET C CG  1 
ATOM   5452  S SD  . MET C  1  9   ? 127.639 170.252 96.241  1.00 61.55  ? 9   MET C SD  1 
ATOM   5453  C CE  . MET C  1  9   ? 127.701 170.982 97.872  1.00 61.55  ? 9   MET C CE  1 
ATOM   5454  N N   . SER C  1  10  ? 124.350 173.264 93.457  1.00 62.98  ? 10  SER C N   1 
ATOM   5455  C CA  . SER C  1  10  ? 123.612 174.415 93.965  1.00 62.98  ? 10  SER C CA  1 
ATOM   5456  C C   . SER C  1  10  ? 122.187 174.048 94.360  1.00 62.98  ? 10  SER C C   1 
ATOM   5457  O O   . SER C  1  10  ? 121.664 174.571 95.349  1.00 62.98  ? 10  SER C O   1 
ATOM   5458  C CB  . SER C  1  10  ? 123.602 175.533 92.923  1.00 62.98  ? 10  SER C CB  1 
ATOM   5459  O OG  . SER C  1  10  ? 124.912 176.017 92.687  1.00 62.98  ? 10  SER C OG  1 
ATOM   5460  N N   . LEU C  1  11  ? 121.544 173.159 93.599  1.00 55.76  ? 11  LEU C N   1 
ATOM   5461  C CA  . LEU C  1  11  ? 120.164 172.789 93.897  1.00 55.76  ? 11  LEU C CA  1 
ATOM   5462  C C   . LEU C  1  11  ? 120.050 172.110 95.253  1.00 55.76  ? 11  LEU C C   1 
ATOM   5463  O O   . LEU C  1  11  ? 119.108 172.373 96.012  1.00 55.76  ? 11  LEU C O   1 
ATOM   5464  C CB  . LEU C  1  11  ? 119.620 171.869 92.806  1.00 55.76  ? 11  LEU C CB  1 
ATOM   5465  C CG  . LEU C  1  11  ? 119.442 172.452 91.407  1.00 55.76  ? 11  LEU C CG  1 
ATOM   5466  C CD1 . LEU C  1  11  ? 119.042 171.358 90.431  1.00 55.76  ? 11  LEU C CD1 1 
ATOM   5467  C CD2 . LEU C  1  11  ? 118.409 173.566 91.422  1.00 55.76  ? 11  LEU C CD2 1 
ATOM   5468  N N   . VAL C  1  12  ? 120.999 171.228 95.571  1.00 47.29  ? 12  VAL C N   1 
ATOM   5469  C CA  . VAL C  1  12  ? 120.879 170.406 96.769  1.00 47.29  ? 12  VAL C CA  1 
ATOM   5470  C C   . VAL C  1  12  ? 120.946 171.268 98.020  1.00 47.29  ? 12  VAL C C   1 
ATOM   5471  O O   . VAL C  1  12  ? 120.245 171.009 99.006  1.00 47.29  ? 12  VAL C O   1 
ATOM   5472  C CB  . VAL C  1  12  ? 121.963 169.315 96.773  1.00 47.29  ? 12  VAL C CB  1 
ATOM   5473  C CG1 . VAL C  1  12  ? 121.844 168.468 98.016  1.00 47.29  ? 12  VAL C CG1 1 
ATOM   5474  C CG2 . VAL C  1  12  ? 121.851 168.457 95.531  1.00 47.29  ? 12  VAL C CG2 1 
ATOM   5475  N N   . LYS C  1  13  ? 121.780 172.310 98.002  1.00 46.92  ? 13  LYS C N   1 
ATOM   5476  C CA  . LYS C  1  13  ? 121.906 173.172 99.173  1.00 46.92  ? 13  LYS C CA  1 
ATOM   5477  C C   . LYS C  1  13  ? 120.575 173.825 99.517  1.00 46.92  ? 13  LYS C C   1 
ATOM   5478  O O   . LYS C  1  13  ? 120.100 173.729 100.655 1.00 46.92  ? 13  LYS C O   1 
ATOM   5479  C CB  . LYS C  1  13  ? 122.976 174.234 98.937  1.00 46.92  ? 13  LYS C CB  1 
ATOM   5480  C CG  . LYS C  1  13  ? 123.227 175.103 100.152 1.00 46.92  ? 13  LYS C CG  1 
ATOM   5481  C CD  . LYS C  1  13  ? 124.313 176.128 99.892  1.00 46.92  ? 13  LYS C CD  1 
ATOM   5482  C CE  . LYS C  1  13  ? 124.623 176.916 101.152 1.00 46.92  ? 13  LYS C CE  1 
ATOM   5483  N NZ  . LYS C  1  13  ? 123.469 177.754 101.577 1.00 46.92  ? 13  LYS C NZ  1 
ATOM   5484  N N   . GLU C  1  14  ? 119.951 174.489 98.540  1.00 50.82  ? 14  GLU C N   1 
ATOM   5485  C CA  . GLU C  1  14  ? 118.680 175.150 98.810  1.00 50.82  ? 14  GLU C CA  1 
ATOM   5486  C C   . GLU C  1  14  ? 117.575 174.144 99.102  1.00 50.82  ? 14  GLU C C   1 
ATOM   5487  O O   . GLU C  1  14  ? 116.685 174.429 99.912  1.00 50.82  ? 14  GLU C O   1 
ATOM   5488  C CB  . GLU C  1  14  ? 118.288 176.059 97.644  1.00 50.82  ? 14  GLU C CB  1 
ATOM   5489  C CG  . GLU C  1  14  ? 117.969 175.341 96.347  1.00 50.82  ? 14  GLU C CG  1 
ATOM   5490  C CD  . GLU C  1  14  ? 117.647 176.299 95.216  1.00 50.82  ? 14  GLU C CD  1 
ATOM   5491  O OE1 . GLU C  1  14  ? 117.692 177.526 95.440  1.00 50.82  ? 14  GLU C OE1 1 
ATOM   5492  O OE2 . GLU C  1  14  ? 117.349 175.824 94.100  1.00 50.82  ? 14  GLU C OE2 1 
ATOM   5493  N N   . THR C  1  15  ? 117.623 172.960 98.485  1.00 47.63  ? 15  THR C N   1 
ATOM   5494  C CA  . THR C  1  15  ? 116.613 171.948 98.773  1.00 47.63  ? 15  THR C CA  1 
ATOM   5495  C C   . THR C  1  15  ? 116.683 171.506 100.229 1.00 47.63  ? 15  THR C C   1 
ATOM   5496  O O   . THR C  1  15  ? 115.664 171.463 100.928 1.00 47.63  ? 15  THR C O   1 
ATOM   5497  C CB  . THR C  1  15  ? 116.784 170.752 97.842  1.00 47.63  ? 15  THR C CB  1 
ATOM   5498  O OG1 . THR C  1  15  ? 116.638 171.183 96.486  1.00 47.63  ? 15  THR C OG1 1 
ATOM   5499  C CG2 . THR C  1  15  ? 115.736 169.702 98.143  1.00 47.63  ? 15  THR C CG2 1 
ATOM   5500  N N   . VAL C  1  16  ? 117.886 171.180 100.707 1.00 44.07  ? 16  VAL C N   1 
ATOM   5501  C CA  . VAL C  1  16  ? 118.046 170.788 102.105 1.00 44.07  ? 16  VAL C CA  1 
ATOM   5502  C C   . VAL C  1  16  ? 117.667 171.937 103.028 1.00 44.07  ? 16  VAL C C   1 
ATOM   5503  O O   . VAL C  1  16  ? 117.017 171.733 104.064 1.00 44.07  ? 16  VAL C O   1 
ATOM   5504  C CB  . VAL C  1  16  ? 119.484 170.301 102.364 1.00 44.07  ? 16  VAL C CB  1 
ATOM   5505  C CG1 . VAL C  1  16  ? 119.700 170.052 103.840 1.00 44.07  ? 16  VAL C CG1 1 
ATOM   5506  C CG2 . VAL C  1  16  ? 119.754 169.035 101.579 1.00 44.07  ? 16  VAL C CG2 1 
ATOM   5507  N N   . ASP C  1  17  ? 118.051 173.164 102.668 1.00 51.69  ? 17  ASP C N   1 
ATOM   5508  C CA  . ASP C  1  17  ? 117.737 174.304 103.523 1.00 51.69  ? 17  ASP C CA  1 
ATOM   5509  C C   . ASP C  1  17  ? 116.235 174.501 103.663 1.00 51.69  ? 17  ASP C C   1 
ATOM   5510  O O   . ASP C  1  17  ? 115.745 174.794 104.759 1.00 51.69  ? 17  ASP C O   1 
ATOM   5511  C CB  . ASP C  1  17  ? 118.395 175.572 102.983 1.00 51.69  ? 17  ASP C CB  1 
ATOM   5512  C CG  . ASP C  1  17  ? 119.884 175.610 103.249 1.00 51.69  ? 17  ASP C CG  1 
ATOM   5513  O OD1 . ASP C  1  17  ? 120.318 175.019 104.259 1.00 51.69  ? 17  ASP C OD1 1 
ATOM   5514  O OD2 . ASP C  1  17  ? 120.620 176.237 102.457 1.00 51.69  ? 17  ASP C OD2 1 
ATOM   5515  N N   . ARG C  1  18  ? 115.482 174.347 102.574 1.00 48.84  ? 18  ARG C N   1 
ATOM   5516  C CA  . ARG C  1  18  ? 114.042 174.532 102.695 1.00 48.84  ? 18  ARG C CA  1 
ATOM   5517  C C   . ARG C  1  18  ? 113.341 173.315 103.280 1.00 48.84  ? 18  ARG C C   1 
ATOM   5518  O O   . ARG C  1  18  ? 112.238 173.457 103.816 1.00 48.84  ? 18  ARG C O   1 
ATOM   5519  C CB  . ARG C  1  18  ? 113.410 174.894 101.349 1.00 48.84  ? 18  ARG C CB  1 
ATOM   5520  C CG  . ARG C  1  18  ? 113.416 173.804 100.305 1.00 48.84  ? 18  ARG C CG  1 
ATOM   5521  C CD  . ARG C  1  18  ? 112.627 174.260 99.089  1.00 48.84  ? 18  ARG C CD  1 
ATOM   5522  N NE  . ARG C  1  18  ? 112.674 173.296 97.996  1.00 48.84  ? 18  ARG C NE  1 
ATOM   5523  C CZ  . ARG C  1  18  ? 111.855 172.257 97.882  1.00 48.84  ? 18  ARG C CZ  1 
ATOM   5524  N NH1 . ARG C  1  18  ? 110.929 172.036 98.803  1.00 48.84  ? 18  ARG C NH1 1 
ATOM   5525  N NH2 . ARG C  1  18  ? 111.968 171.433 96.850  1.00 48.84  ? 18  ARG C NH2 1 
ATOM   5526  N N   . LEU C  1  19  ? 113.944 172.128 103.197 1.00 45.84  ? 19  LEU C N   1 
ATOM   5527  C CA  . LEU C  1  19  ? 113.390 170.988 103.920 1.00 45.84  ? 19  LEU C CA  1 
ATOM   5528  C C   . LEU C  1  19  ? 113.515 171.189 105.423 1.00 45.84  ? 19  LEU C C   1 
ATOM   5529  O O   . LEU C  1  19  ? 112.518 171.167 106.152 1.00 45.84  ? 19  LEU C O   1 
ATOM   5530  C CB  . LEU C  1  19  ? 114.083 169.692 103.500 1.00 45.84  ? 19  LEU C CB  1 
ATOM   5531  C CG  . LEU C  1  19  ? 113.771 169.169 102.104 1.00 45.84  ? 19  LEU C CG  1 
ATOM   5532  C CD1 . LEU C  1  19  ? 114.607 167.939 101.808 1.00 45.84  ? 19  LEU C CD1 1 
ATOM   5533  C CD2 . LEU C  1  19  ? 112.291 168.861 101.987 1.00 45.84  ? 19  LEU C CD2 1 
ATOM   5534  N N   . LEU C  1  20  ? 114.736 171.398 105.904 1.00 42.61  ? 20  LEU C N   1 
ATOM   5535  C CA  . LEU C  1  20  ? 114.993 171.478 107.335 1.00 42.61  ? 20  LEU C CA  1 
ATOM   5536  C C   . LEU C  1  20  ? 114.696 172.847 107.928 1.00 42.61  ? 20  LEU C C   1 
ATOM   5537  O O   . LEU C  1  20  ? 115.175 173.143 109.028 1.00 42.61  ? 20  LEU C O   1 
ATOM   5538  C CB  . LEU C  1  20  ? 116.439 171.084 107.634 1.00 42.61  ? 20  LEU C CB  1 
ATOM   5539  C CG  . LEU C  1  20  ? 116.702 169.587 107.772 1.00 42.61  ? 20  LEU C CG  1 
ATOM   5540  C CD1 . LEU C  1  20  ? 116.556 168.854 106.457 1.00 42.61  ? 20  LEU C CD1 1 
ATOM   5541  C CD2 . LEU C  1  20  ? 118.088 169.398 108.312 1.00 42.61  ? 20  LEU C CD2 1 
ATOM   5542  N N   . LYS C  1  21  ? 113.937 173.691 107.237 1.00 50.90  ? 21  LYS C N   1 
ATOM   5543  C CA  . LYS C  1  21  ? 113.444 174.941 107.796 1.00 50.90  ? 21  LYS C CA  1 
ATOM   5544  C C   . LYS C  1  21  ? 111.940 174.826 107.992 1.00 50.90  ? 21  LYS C C   1 
ATOM   5545  O O   . LYS C  1  21  ? 111.214 174.473 107.057 1.00 50.90  ? 21  LYS C O   1 
ATOM   5546  C CB  . LYS C  1  21  ? 113.777 176.127 106.891 1.00 50.90  ? 21  LYS C CB  1 
ATOM   5547  C CG  . LYS C  1  21  ? 113.309 177.466 107.431 1.00 50.90  ? 21  LYS C CG  1 
ATOM   5548  C CD  . LYS C  1  21  ? 113.804 178.610 106.563 1.00 50.90  ? 21  LYS C CD  1 
ATOM   5549  C CE  . LYS C  1  21  ? 113.103 178.620 105.214 1.00 50.90  ? 21  LYS C CE  1 
ATOM   5550  N NZ  . LYS C  1  21  ? 111.656 178.949 105.336 1.00 50.90  ? 21  LYS C NZ  1 
ATOM   5551  N N   . GLY C  1  22  ? 111.478 175.125 109.201 1.00 52.77  ? 22  GLY C N   1 
ATOM   5552  C CA  . GLY C  1  22  ? 110.095 174.885 109.547 1.00 52.77  ? 22  GLY C CA  1 
ATOM   5553  C C   . GLY C  1  22  ? 109.775 173.451 109.889 1.00 52.77  ? 22  GLY C C   1 
ATOM   5554  O O   . GLY C  1  22  ? 108.597 173.117 110.058 1.00 52.77  ? 22  GLY C O   1 
ATOM   5555  N N   . TYR C  1  23  ? 110.785 172.592 109.994 1.00 36.47  ? 23  TYR C N   1 
ATOM   5556  C CA  . TYR C  1  23  ? 110.595 171.193 110.355 1.00 36.47  ? 23  TYR C CA  1 
ATOM   5557  C C   . TYR C  1  23  ? 110.618 171.090 111.873 1.00 36.47  ? 23  TYR C C   1 
ATOM   5558  O O   . TYR C  1  23  ? 111.662 171.296 112.500 1.00 36.47  ? 23  TYR C O   1 
ATOM   5559  C CB  . TYR C  1  23  ? 111.682 170.326 109.729 1.00 36.47  ? 23  TYR C CB  1 
ATOM   5560  C CG  . TYR C  1  23  ? 111.529 168.856 110.012 1.00 36.47  ? 23  TYR C CG  1 
ATOM   5561  C CD1 . TYR C  1  23  ? 110.578 168.103 109.350 1.00 36.47  ? 23  TYR C CD1 1 
ATOM   5562  C CD2 . TYR C  1  23  ? 112.342 168.219 110.932 1.00 36.47  ? 23  TYR C CD2 1 
ATOM   5563  C CE1 . TYR C  1  23  ? 110.433 166.759 109.600 1.00 36.47  ? 23  TYR C CE1 1 
ATOM   5564  C CE2 . TYR C  1  23  ? 112.205 166.873 111.188 1.00 36.47  ? 23  TYR C CE2 1 
ATOM   5565  C CZ  . TYR C  1  23  ? 111.248 166.148 110.518 1.00 36.47  ? 23  TYR C CZ  1 
ATOM   5566  O OH  . TYR C  1  23  ? 111.101 164.806 110.767 1.00 36.47  ? 23  TYR C OH  1 
ATOM   5567  N N   . ASP C  1  24  ? 109.473 170.769 112.465 1.00 34.85  ? 24  ASP C N   1 
ATOM   5568  C CA  . ASP C  1  24  ? 109.334 170.751 113.914 1.00 34.85  ? 24  ASP C CA  1 
ATOM   5569  C C   . ASP C  1  24  ? 109.647 169.350 114.428 1.00 34.85  ? 24  ASP C C   1 
ATOM   5570  O O   . ASP C  1  24  ? 108.917 168.398 114.138 1.00 34.85  ? 24  ASP C O   1 
ATOM   5571  C CB  . ASP C  1  24  ? 107.926 171.182 114.319 1.00 34.85  ? 24  ASP C CB  1 
ATOM   5572  C CG  . ASP C  1  24  ? 107.831 171.546 115.782 1.00 34.85  ? 24  ASP C CG  1 
ATOM   5573  O OD1 . ASP C  1  24  ? 108.855 171.450 116.489 1.00 34.85  ? 24  ASP C OD1 1 
ATOM   5574  O OD2 . ASP C  1  24  ? 106.733 171.939 116.225 1.00 34.85  ? 24  ASP C OD2 1 
ATOM   5575  N N   . ILE C  1  25  ? 110.728 169.232 115.201 1.00 29.34  ? 25  ILE C N   1 
ATOM   5576  C CA  . ILE C  1  25  ? 111.212 167.927 115.624 1.00 29.34  ? 25  ILE C CA  1 
ATOM   5577  C C   . ILE C  1  25  ? 110.297 167.270 116.649 1.00 29.34  ? 25  ILE C C   1 
ATOM   5578  O O   . ILE C  1  25  ? 110.295 166.042 116.773 1.00 29.34  ? 25  ILE C O   1 
ATOM   5579  C CB  . ILE C  1  25  ? 112.642 168.064 116.178 1.00 29.34  ? 25  ILE C CB  1 
ATOM   5580  C CG1 . ILE C  1  25  ? 113.251 166.694 116.466 1.00 29.34  ? 25  ILE C CG1 1 
ATOM   5581  C CG2 . ILE C  1  25  ? 112.656 168.929 117.418 1.00 29.34  ? 25  ILE C CG2 1 
ATOM   5582  C CD1 . ILE C  1  25  ? 114.730 166.736 116.738 1.00 29.34  ? 25  ILE C CD1 1 
ATOM   5583  N N   . ARG C  1  26  ? 109.499 168.050 117.376 1.00 29.68  ? 26  ARG C N   1 
ATOM   5584  C CA  . ARG C  1  26  ? 108.721 167.488 118.473 1.00 29.68  ? 26  ARG C CA  1 
ATOM   5585  C C   . ARG C  1  26  ? 107.521 166.684 117.997 1.00 29.68  ? 26  ARG C C   1 
ATOM   5586  O O   . ARG C  1  26  ? 106.978 165.893 118.773 1.00 29.68  ? 26  ARG C O   1 
ATOM   5587  C CB  . ARG C  1  26  ? 108.263 168.609 119.400 1.00 29.68  ? 26  ARG C CB  1 
ATOM   5588  C CG  . ARG C  1  26  ? 109.405 169.258 120.141 1.00 29.68  ? 26  ARG C CG  1 
ATOM   5589  C CD  . ARG C  1  26  ? 108.913 170.307 121.101 1.00 29.68  ? 26  ARG C CD  1 
ATOM   5590  N NE  . ARG C  1  26  ? 108.268 171.398 120.385 1.00 29.68  ? 26  ARG C NE  1 
ATOM   5591  C CZ  . ARG C  1  26  ? 108.916 172.437 119.873 1.00 29.68  ? 26  ARG C CZ  1 
ATOM   5592  N NH1 . ARG C  1  26  ? 110.232 172.521 119.995 1.00 29.68  ? 26  ARG C NH1 1 
ATOM   5593  N NH2 . ARG C  1  26  ? 108.249 173.388 119.236 1.00 29.68  ? 26  ARG C NH2 1 
ATOM   5594  N N   . LEU C  1  27  ? 107.095 166.860 116.752 1.00 30.13  ? 27  LEU C N   1 
ATOM   5595  C CA  . LEU C  1  27  ? 105.905 166.204 116.229 1.00 30.13  ? 27  LEU C CA  1 
ATOM   5596  C C   . LEU C  1  27  ? 106.317 165.097 115.271 1.00 30.13  ? 27  LEU C C   1 
ATOM   5597  O O   . LEU C  1  27  ? 106.939 165.363 114.238 1.00 30.13  ? 27  LEU C O   1 
ATOM   5598  C CB  . LEU C  1  27  ? 104.994 167.208 115.526 1.00 30.13  ? 27  LEU C CB  1 
ATOM   5599  C CG  . LEU C  1  27  ? 104.069 168.049 116.403 1.00 30.13  ? 27  LEU C CG  1 
ATOM   5600  C CD1 . LEU C  1  27  ? 104.840 169.068 117.217 1.00 30.13  ? 27  LEU C CD1 1 
ATOM   5601  C CD2 . LEU C  1  27  ? 103.050 168.743 115.527 1.00 30.13  ? 27  LEU C CD2 1 
ATOM   5602  N N   . ARG C  1  28  ? 105.962 163.865 115.610 1.00 27.67  ? 28  ARG C N   1 
ATOM   5603  C CA  . ARG C  1  28  ? 106.259 162.738 114.747 1.00 27.67  ? 28  ARG C CA  1 
ATOM   5604  C C   . ARG C  1  28  ? 105.355 162.774 113.514 1.00 27.67  ? 28  ARG C C   1 
ATOM   5605  O O   . ARG C  1  28  ? 104.248 163.312 113.569 1.00 27.67  ? 28  ARG C O   1 
ATOM   5606  C CB  . ARG C  1  28  ? 106.077 161.436 115.521 1.00 27.67  ? 28  ARG C CB  1 
ATOM   5607  C CG  . ARG C  1  28  ? 104.704 161.255 116.128 1.00 27.67  ? 28  ARG C CG  1 
ATOM   5608  C CD  . ARG C  1  28  ? 103.813 160.419 115.244 1.00 27.67  ? 28  ARG C CD  1 
ATOM   5609  N NE  . ARG C  1  28  ? 102.517 160.176 115.859 1.00 27.67  ? 28  ARG C NE  1 
ATOM   5610  C CZ  . ARG C  1  28  ? 101.524 159.533 115.260 1.00 27.67  ? 28  ARG C CZ  1 
ATOM   5611  N NH1 . ARG C  1  28  ? 101.688 159.063 114.034 1.00 27.67  ? 28  ARG C NH1 1 
ATOM   5612  N NH2 . ARG C  1  28  ? 100.370 159.361 115.882 1.00 27.67  ? 28  ARG C NH2 1 
ATOM   5613  N N   . PRO C  1  29  ? 105.804 162.211 112.390 1.00 33.47  ? 29  PRO C N   1 
ATOM   5614  C CA  . PRO C  1  29  ? 105.025 162.326 111.153 1.00 33.47  ? 29  PRO C CA  1 
ATOM   5615  C C   . PRO C  1  29  ? 103.653 161.689 111.294 1.00 33.47  ? 29  PRO C C   1 
ATOM   5616  O O   . PRO C  1  29  ? 103.474 160.702 112.010 1.00 33.47  ? 29  PRO C O   1 
ATOM   5617  C CB  . PRO C  1  29  ? 105.881 161.581 110.125 1.00 33.47  ? 29  PRO C CB  1 
ATOM   5618  C CG  . PRO C  1  29  ? 106.676 160.629 110.927 1.00 33.47  ? 29  PRO C CG  1 
ATOM   5619  C CD  . PRO C  1  29  ? 106.971 161.331 112.216 1.00 33.47  ? 29  PRO C CD  1 
ATOM   5620  N N   . ASP C  1  30  ? 102.682 162.271 110.591 1.00 45.04  ? 30  ASP C N   1 
ATOM   5621  C CA  . ASP C  1  30  ? 101.280 161.871 110.696 1.00 45.04  ? 30  ASP C CA  1 
ATOM   5622  C C   . ASP C  1  30  ? 100.806 161.969 112.147 1.00 45.04  ? 30  ASP C C   1 
ATOM   5623  O O   . ASP C  1  30  ? 100.470 160.975 112.791 1.00 45.04  ? 30  ASP C O   1 
ATOM   5624  C CB  . ASP C  1  30  ? 101.067 160.463 110.133 1.00 45.04  ? 30  ASP C CB  1 
ATOM   5625  C CG  . ASP C  1  30  ? 101.271 160.400 108.637 1.00 45.04  ? 30  ASP C CG  1 
ATOM   5626  O OD1 . ASP C  1  30  ? 101.031 161.424 107.963 1.00 45.04  ? 30  ASP C OD1 1 
ATOM   5627  O OD2 . ASP C  1  30  ? 101.672 159.330 108.134 1.00 45.04  ? 30  ASP C OD2 1 
ATOM   5628  N N   . PHE C  1  31  ? 100.798 163.201 112.657 1.00 39.51  ? 31  PHE C N   1 
ATOM   5629  C CA  . PHE C  1  31  ? 100.538 163.400 114.079 1.00 39.51  ? 31  PHE C CA  1 
ATOM   5630  C C   . PHE C  1  31  ? 99.076  163.156 114.420 1.00 39.51  ? 31  PHE C C   1 
ATOM   5631  O O   . PHE C  1  31  ? 98.767  162.557 115.457 1.00 39.51  ? 31  PHE C O   1 
ATOM   5632  C CB  . PHE C  1  31  ? 100.950 164.806 114.498 1.00 39.51  ? 31  PHE C CB  1 
ATOM   5633  C CG  . PHE C  1  31  ? 100.862 165.041 115.974 1.00 39.51  ? 31  PHE C CG  1 
ATOM   5634  C CD1 . PHE C  1  31  ? 101.815 164.517 116.823 1.00 39.51  ? 31  PHE C CD1 1 
ATOM   5635  C CD2 . PHE C  1  31  ? 99.836  165.786 116.514 1.00 39.51  ? 31  PHE C CD2 1 
ATOM   5636  C CE1 . PHE C  1  31  ? 101.746 164.726 118.178 1.00 39.51  ? 31  PHE C CE1 1 
ATOM   5637  C CE2 . PHE C  1  31  ? 99.764  165.999 117.873 1.00 39.51  ? 31  PHE C CE2 1 
ATOM   5638  C CZ  . PHE C  1  31  ? 100.720 165.467 118.704 1.00 39.51  ? 31  PHE C CZ  1 
ATOM   5639  N N   . GLY C  1  32  ? 98.160  163.613 113.567 1.00 53.50  ? 32  GLY C N   1 
ATOM   5640  C CA  . GLY C  1  32  ? 96.748  163.471 113.869 1.00 53.50  ? 32  GLY C CA  1 
ATOM   5641  C C   . GLY C  1  32  ? 96.151  162.147 113.449 1.00 53.50  ? 32  GLY C C   1 
ATOM   5642  O O   . GLY C  1  32  ? 95.217  161.659 114.091 1.00 53.50  ? 32  GLY C O   1 
ATOM   5643  N N   . GLY C  1  33  ? 96.669  161.546 112.382 1.00 52.78  ? 33  GLY C N   1 
ATOM   5644  C CA  . GLY C  1  33  ? 96.033  160.399 111.782 1.00 52.78  ? 33  GLY C CA  1 
ATOM   5645  C C   . GLY C  1  33  ? 96.655  159.062 112.129 1.00 52.78  ? 33  GLY C C   1 
ATOM   5646  O O   . GLY C  1  33  ? 96.984  158.773 113.283 1.00 52.78  ? 33  GLY C O   1 
ATOM   5647  N N   . PRO C  1  34  ? 96.824  158.222 111.114 1.00 51.65  ? 34  PRO C N   1 
ATOM   5648  C CA  . PRO C  1  34  ? 97.207  156.822 111.337 1.00 51.65  ? 34  PRO C CA  1 
ATOM   5649  C C   . PRO C  1  34  ? 98.598  156.707 111.930 1.00 51.65  ? 34  PRO C C   1 
ATOM   5650  O O   . PRO C  1  34  ? 99.343  157.695 111.988 1.00 51.65  ? 34  PRO C O   1 
ATOM   5651  C CB  . PRO C  1  34  ? 97.156  156.222 109.923 1.00 51.65  ? 34  PRO C CB  1 
ATOM   5652  C CG  . PRO C  1  34  ? 96.250  157.124 109.158 1.00 51.65  ? 34  PRO C CG  1 
ATOM   5653  C CD  . PRO C  1  34  ? 96.509  158.490 109.702 1.00 51.65  ? 34  PRO C CD  1 
ATOM   5654  N N   . PRO C  1  35  ? 98.986  155.519 112.385 1.00 32.56  ? 35  PRO C N   1 
ATOM   5655  C CA  . PRO C  1  35  ? 100.349 155.325 112.880 1.00 32.56  ? 35  PRO C CA  1 
ATOM   5656  C C   . PRO C  1  35  ? 101.352 155.239 111.741 1.00 32.56  ? 35  PRO C C   1 
ATOM   5657  O O   . PRO C  1  35  ? 101.003 155.046 110.576 1.00 32.56  ? 35  PRO C O   1 
ATOM   5658  C CB  . PRO C  1  35  ? 100.265 153.995 113.632 1.00 32.56  ? 35  PRO C CB  1 
ATOM   5659  C CG  . PRO C  1  35  ? 99.167  153.270 112.966 1.00 32.56  ? 35  PRO C CG  1 
ATOM   5660  C CD  . PRO C  1  35  ? 98.163  154.313 112.574 1.00 32.56  ? 35  PRO C CD  1 
ATOM   5661  N N   . VAL C  1  36  ? 102.622 155.386 112.106 1.00 26.85  ? 36  VAL C N   1 
ATOM   5662  C CA  . VAL C  1  36  ? 103.731 155.339 111.161 1.00 26.85  ? 36  VAL C CA  1 
ATOM   5663  C C   . VAL C  1  36  ? 104.387 153.970 111.240 1.00 26.85  ? 36  VAL C C   1 
ATOM   5664  O O   . VAL C  1  36  ? 104.519 153.391 112.324 1.00 26.85  ? 36  VAL C O   1 
ATOM   5665  C CB  . VAL C  1  36  ? 104.744 156.466 111.440 1.00 26.85  ? 36  VAL C CB  1 
ATOM   5666  C CG1 . VAL C  1  36  ? 105.368 156.298 112.805 1.00 26.85  ? 36  VAL C CG1 1 
ATOM   5667  C CG2 . VAL C  1  36  ? 105.810 156.491 110.375 1.00 26.85  ? 36  VAL C CG2 1 
ATOM   5668  N N   . ALA C  1  37  ? 104.784 153.440 110.089 1.00 22.83  ? 37  ALA C N   1 
ATOM   5669  C CA  . ALA C  1  37  ? 105.347 152.099 110.008 1.00 22.83  ? 37  ALA C CA  1 
ATOM   5670  C C   . ALA C  1  37  ? 106.864 152.192 110.095 1.00 22.83  ? 37  ALA C C   1 
ATOM   5671  O O   . ALA C  1  37  ? 107.515 152.695 109.176 1.00 22.83  ? 37  ALA C O   1 
ATOM   5672  C CB  . ALA C  1  37  ? 104.913 151.414 108.716 1.00 22.83  ? 37  ALA C CB  1 
ATOM   5673  N N   . VAL C  1  38  ? 107.424 151.701 111.194 1.00 24.16  ? 38  VAL C N   1 
ATOM   5674  C CA  . VAL C  1  38  ? 108.865 151.647 111.401 1.00 24.16  ? 38  VAL C CA  1 
ATOM   5675  C C   . VAL C  1  38  ? 109.301 150.201 111.245 1.00 24.16  ? 38  VAL C C   1 
ATOM   5676  O O   . VAL C  1  38  ? 108.926 149.345 112.054 1.00 24.16  ? 38  VAL C O   1 
ATOM   5677  C CB  . VAL C  1  38  ? 109.256 152.184 112.783 1.00 24.16  ? 38  VAL C CB  1 
ATOM   5678  C CG1 . VAL C  1  38  ? 110.721 151.946 113.036 1.00 24.16  ? 38  VAL C CG1 1 
ATOM   5679  C CG2 . VAL C  1  38  ? 108.942 153.652 112.880 1.00 24.16  ? 38  VAL C CG2 1 
ATOM   5680  N N   . GLY C  1  39  ? 110.093 149.926 110.215 1.00 21.64  ? 39  GLY C N   1 
ATOM   5681  C CA  . GLY C  1  39  ? 110.564 148.577 109.980 1.00 21.64  ? 39  GLY C CA  1 
ATOM   5682  C C   . GLY C  1  39  ? 112.020 148.404 110.347 1.00 21.64  ? 39  GLY C C   1 
ATOM   5683  O O   . GLY C  1  39  ? 112.886 149.078 109.786 1.00 21.64  ? 39  GLY C O   1 
ATOM   5684  N N   . MET C  1  40  ? 112.306 147.503 111.278 1.00 21.80  ? 40  MET C N   1 
ATOM   5685  C CA  . MET C  1  40  ? 113.646 147.343 111.819 1.00 21.80  ? 40  MET C CA  1 
ATOM   5686  C C   . MET C  1  40  ? 114.355 146.150 111.196 1.00 21.80  ? 40  MET C C   1 
ATOM   5687  O O   . MET C  1  40  ? 113.735 145.125 110.908 1.00 21.80  ? 40  MET C O   1 
ATOM   5688  C CB  . MET C  1  40  ? 113.602 147.197 113.338 1.00 21.80  ? 40  MET C CB  1 
ATOM   5689  C CG  . MET C  1  40  ? 113.273 148.500 114.031 1.00 21.80  ? 40  MET C CG  1 
ATOM   5690  S SD  . MET C  1  40  ? 113.326 148.430 115.824 1.00 21.80  ? 40  MET C SD  1 
ATOM   5691  C CE  . MET C  1  40  ? 111.767 147.639 116.165 1.00 21.80  ? 40  MET C CE  1 
ATOM   5692  N N   . ASN C  1  41  ? 115.658 146.301 110.983 1.00 21.88  ? 41  ASN C N   1 
ATOM   5693  C CA  . ASN C  1  41  ? 116.500 145.283 110.372 1.00 21.88  ? 41  ASN C CA  1 
ATOM   5694  C C   . ASN C  1  41  ? 117.804 145.202 111.148 1.00 21.88  ? 41  ASN C C   1 
ATOM   5695  O O   . ASN C  1  41  ? 118.440 146.229 111.395 1.00 21.88  ? 41  ASN C O   1 
ATOM   5696  C CB  . ASN C  1  41  ? 116.773 145.611 108.903 1.00 21.88  ? 41  ASN C CB  1 
ATOM   5697  C CG  . ASN C  1  41  ? 117.526 144.513 108.190 1.00 21.88  ? 41  ASN C CG  1 
ATOM   5698  O OD1 . ASN C  1  41  ? 117.886 143.504 108.787 1.00 21.88  ? 41  ASN C OD1 1 
ATOM   5699  N ND2 . ASN C  1  41  ? 117.768 144.704 106.901 1.00 21.88  ? 41  ASN C ND2 1 
ATOM   5700  N N   . ILE C  1  42  ? 118.207 143.991 111.520 1.00 23.52  ? 42  ILE C N   1 
ATOM   5701  C CA  . ILE C  1  42  ? 119.378 143.775 112.360 1.00 23.52  ? 42  ILE C CA  1 
ATOM   5702  C C   . ILE C  1  42  ? 120.397 142.941 111.602 1.00 23.52  ? 42  ILE C C   1 
ATOM   5703  O O   . ILE C  1  42  ? 120.040 141.971 110.927 1.00 23.52  ? 42  ILE C O   1 
ATOM   5704  C CB  . ILE C  1  42  ? 119.004 143.095 113.690 1.00 23.52  ? 42  ILE C CB  1 
ATOM   5705  C CG1 . ILE C  1  42  ? 118.194 144.039 114.568 1.00 23.52  ? 42  ILE C CG1 1 
ATOM   5706  C CG2 . ILE C  1  42  ? 120.234 142.624 114.429 1.00 23.52  ? 42  ILE C CG2 1 
ATOM   5707  C CD1 . ILE C  1  42  ? 117.641 143.375 115.800 1.00 23.52  ? 42  ILE C CD1 1 
ATOM   5708  N N   . ASP C  1  43  ? 121.666 143.319 111.721 1.00 25.09  ? 43  ASP C N   1 
ATOM   5709  C CA  . ASP C  1  43  ? 122.778 142.543 111.188 1.00 25.09  ? 43  ASP C CA  1 
ATOM   5710  C C   . ASP C  1  43  ? 123.799 142.356 112.299 1.00 25.09  ? 43  ASP C C   1 
ATOM   5711  O O   . ASP C  1  43  ? 124.405 143.329 112.754 1.00 25.09  ? 43  ASP C O   1 
ATOM   5712  C CB  . ASP C  1  43  ? 123.408 143.247 109.987 1.00 25.09  ? 43  ASP C CB  1 
ATOM   5713  C CG  . ASP C  1  43  ? 124.429 142.388 109.282 1.00 25.09  ? 43  ASP C CG  1 
ATOM   5714  O OD1 . ASP C  1  43  ? 124.655 141.244 109.726 1.00 25.09  ? 43  ASP C OD1 1 
ATOM   5715  O OD2 . ASP C  1  43  ? 125.013 142.859 108.285 1.00 25.09  ? 43  ASP C OD2 1 
ATOM   5716  N N   . ILE C  1  44  ? 123.997 141.115 112.722 1.00 20.52  ? 44  ILE C N   1 
ATOM   5717  C CA  . ILE C  1  44  ? 124.842 140.805 113.868 1.00 20.52  ? 44  ILE C CA  1 
ATOM   5718  C C   . ILE C  1  44  ? 126.276 140.607 113.402 1.00 20.52  ? 44  ILE C C   1 
ATOM   5719  O O   . ILE C  1  44  ? 126.525 139.940 112.393 1.00 20.52  ? 44  ILE C O   1 
ATOM   5720  C CB  . ILE C  1  44  ? 124.322 139.562 114.606 1.00 20.52  ? 44  ILE C CB  1 
ATOM   5721  C CG1 . ILE C  1  44  ? 122.990 139.875 115.277 1.00 20.52  ? 44  ILE C CG1 1 
ATOM   5722  C CG2 . ILE C  1  44  ? 125.326 139.075 115.623 1.00 20.52  ? 44  ILE C CG2 1 
ATOM   5723  C CD1 . ILE C  1  44  ? 122.298 138.665 115.814 1.00 20.52  ? 44  ILE C CD1 1 
ATOM   5724  N N   . ALA C  1  45  ? 127.222 141.195 114.133 1.00 17.27  ? 45  ALA C N   1 
ATOM   5725  C CA  . ALA C  1  45  ? 128.638 141.087 113.809 1.00 17.27  ? 45  ALA C CA  1 
ATOM   5726  C C   . ALA C  1  45  ? 129.361 140.056 114.665 1.00 17.27  ? 45  ALA C C   1 
ATOM   5727  O O   . ALA C  1  45  ? 130.090 139.218 114.130 1.00 17.27  ? 45  ALA C O   1 
ATOM   5728  C CB  . ALA C  1  45  ? 129.321 142.451 113.951 1.00 17.27  ? 45  ALA C CB  1 
ATOM   5729  N N   . SER C  1  46  ? 129.186 140.099 115.984 1.00 22.84  ? 46  SER C N   1 
ATOM   5730  C CA  . SER C  1  46  ? 129.858 139.139 116.847 1.00 22.84  ? 46  SER C CA  1 
ATOM   5731  C C   . SER C  1  46  ? 129.177 139.096 118.205 1.00 22.84  ? 46  SER C C   1 
ATOM   5732  O O   . SER C  1  46  ? 128.616 140.092 118.665 1.00 22.84  ? 46  SER C O   1 
ATOM   5733  C CB  . SER C  1  46  ? 131.338 139.483 117.024 1.00 22.84  ? 46  SER C CB  1 
ATOM   5734  O OG  . SER C  1  46  ? 131.492 140.685 117.756 1.00 22.84  ? 46  SER C OG  1 
ATOM   5735  N N   . ILE C  1  47  ? 129.240 137.929 118.839 1.00 25.79  ? 47  ILE C N   1 
ATOM   5736  C CA  . ILE C  1  47  ? 128.779 137.728 120.208 1.00 25.79  ? 47  ILE C CA  1 
ATOM   5737  C C   . ILE C  1  47  ? 130.014 137.408 121.037 1.00 25.79  ? 47  ILE C C   1 
ATOM   5738  O O   . ILE C  1  47  ? 130.525 136.284 121.006 1.00 25.79  ? 47  ILE C O   1 
ATOM   5739  C CB  . ILE C  1  47  ? 127.730 136.618 120.310 1.00 25.79  ? 47  ILE C CB  1 
ATOM   5740  C CG1 . ILE C  1  47  ? 126.448 137.025 119.592 1.00 25.79  ? 47  ILE C CG1 1 
ATOM   5741  C CG2 . ILE C  1  47  ? 127.441 136.288 121.757 1.00 25.79  ? 47  ILE C CG2 1 
ATOM   5742  C CD1 . ILE C  1  47  ? 125.449 135.908 119.477 1.00 25.79  ? 47  ILE C CD1 1 
ATOM   5743  N N   . ASP C  1  48  ? 130.500 138.398 121.780 1.00 40.24  ? 48  ASP C N   1 
ATOM   5744  C CA  . ASP C  1  48  ? 131.815 138.326 122.404 1.00 40.24  ? 48  ASP C CA  1 
ATOM   5745  C C   . ASP C  1  48  ? 131.934 137.212 123.433 1.00 40.24  ? 48  ASP C C   1 
ATOM   5746  O O   . ASP C  1  48  ? 132.714 136.273 123.248 1.00 40.24  ? 48  ASP C O   1 
ATOM   5747  C CB  . ASP C  1  48  ? 132.158 139.665 123.059 1.00 40.24  ? 48  ASP C CB  1 
ATOM   5748  C CG  . ASP C  1  48  ? 132.383 140.771 122.046 1.00 40.24  ? 48  ASP C CG  1 
ATOM   5749  O OD1 . ASP C  1  48  ? 132.825 140.468 120.918 1.00 40.24  ? 48  ASP C OD1 1 
ATOM   5750  O OD2 . ASP C  1  48  ? 132.114 141.945 122.374 1.00 40.24  ? 48  ASP C OD2 1 
ATOM   5751  N N   . MET C  1  49  ? 131.169 137.299 124.517 1.00 40.05  ? 49  MET C N   1 
ATOM   5752  C CA  . MET C  1  49  ? 131.396 136.428 125.657 1.00 40.05  ? 49  MET C CA  1 
ATOM   5753  C C   . MET C  1  49  ? 130.073 136.099 126.322 1.00 40.05  ? 49  MET C C   1 
ATOM   5754  O O   . MET C  1  49  ? 129.131 136.893 126.295 1.00 40.05  ? 49  MET C O   1 
ATOM   5755  C CB  . MET C  1  49  ? 132.340 137.079 126.670 1.00 40.05  ? 49  MET C CB  1 
ATOM   5756  C CG  . MET C  1  49  ? 131.761 138.314 127.331 1.00 40.05  ? 49  MET C CG  1 
ATOM   5757  S SD  . MET C  1  49  ? 132.913 139.115 128.459 1.00 40.05  ? 49  MET C SD  1 
ATOM   5758  C CE  . MET C  1  49  ? 132.946 137.938 129.807 1.00 40.05  ? 49  MET C CE  1 
ATOM   5759  N N   . VAL C  1  50  ? 130.014 134.917 126.922 1.00 36.50  ? 50  VAL C N   1 
ATOM   5760  C CA  . VAL C  1  50  ? 128.860 134.469 127.687 1.00 36.50  ? 50  VAL C CA  1 
ATOM   5761  C C   . VAL C  1  50  ? 129.356 134.081 129.068 1.00 36.50  ? 50  VAL C C   1 
ATOM   5762  O O   . VAL C  1  50  ? 130.200 133.187 129.199 1.00 36.50  ? 50  VAL C O   1 
ATOM   5763  C CB  . VAL C  1  50  ? 128.146 133.294 127.007 1.00 36.50  ? 50  VAL C CB  1 
ATOM   5764  C CG1 . VAL C  1  50  ? 127.095 132.733 127.917 1.00 36.50  ? 50  VAL C CG1 1 
ATOM   5765  C CG2 . VAL C  1  50  ? 127.522 133.743 125.704 1.00 36.50  ? 50  VAL C CG2 1 
ATOM   5766  N N   . SER C  1  51  ? 128.834 134.743 130.095 1.00 39.46  ? 51  SER C N   1 
ATOM   5767  C CA  . SER C  1  51  ? 129.337 134.605 131.457 1.00 39.46  ? 51  SER C CA  1 
ATOM   5768  C C   . SER C  1  51  ? 128.205 134.130 132.357 1.00 39.46  ? 51  SER C C   1 
ATOM   5769  O O   . SER C  1  51  ? 127.222 134.850 132.556 1.00 39.46  ? 51  SER C O   1 
ATOM   5770  C CB  . SER C  1  51  ? 129.913 135.929 131.953 1.00 39.46  ? 51  SER C CB  1 
ATOM   5771  O OG  . SER C  1  51  ? 130.373 135.817 133.285 1.00 39.46  ? 51  SER C OG  1 
ATOM   5772  N N   . GLU C  1  52  ? 128.344 132.920 132.901 1.00 45.24  ? 52  GLU C N   1 
ATOM   5773  C CA  . GLU C  1  52  ? 127.331 132.403 133.813 1.00 45.24  ? 52  GLU C CA  1 
ATOM   5774  C C   . GLU C  1  52  ? 127.405 133.055 135.185 1.00 45.24  ? 52  GLU C C   1 
ATOM   5775  O O   . GLU C  1  52  ? 126.438 132.970 135.949 1.00 45.24  ? 52  GLU C O   1 
ATOM   5776  C CB  . GLU C  1  52  ? 127.466 130.889 133.970 1.00 45.24  ? 52  GLU C CB  1 
ATOM   5777  C CG  . GLU C  1  52  ? 127.222 130.097 132.706 1.00 45.24  ? 52  GLU C CG  1 
ATOM   5778  C CD  . GLU C  1  52  ? 128.478 129.937 131.876 1.00 45.24  ? 52  GLU C CD  1 
ATOM   5779  O OE1 . GLU C  1  52  ? 129.549 130.394 132.327 1.00 45.24  ? 52  GLU C OE1 1 
ATOM   5780  O OE2 . GLU C  1  52  ? 128.399 129.350 130.776 1.00 45.24  ? 52  GLU C OE2 1 
ATOM   5781  N N   . VAL C  1  53  ? 128.530 133.688 135.519 1.00 40.23  ? 53  VAL C N   1 
ATOM   5782  C CA  . VAL C  1  53  ? 128.656 134.353 136.813 1.00 40.23  ? 53  VAL C CA  1 
ATOM   5783  C C   . VAL C  1  53  ? 127.686 135.523 136.901 1.00 40.23  ? 53  VAL C C   1 
ATOM   5784  O O   . VAL C  1  53  ? 126.979 135.696 137.900 1.00 40.23  ? 53  VAL C O   1 
ATOM   5785  C CB  . VAL C  1  53  ? 130.109 134.807 137.041 1.00 40.23  ? 53  VAL C CB  1 
ATOM   5786  C CG1 . VAL C  1  53  ? 130.224 135.587 138.336 1.00 40.23  ? 53  VAL C CG1 1 
ATOM   5787  C CG2 . VAL C  1  53  ? 131.039 133.610 137.050 1.00 40.23  ? 53  VAL C CG2 1 
ATOM   5788  N N   . ASN C  1  54  ? 127.629 136.336 135.849 1.00 35.89  ? 54  ASN C N   1 
ATOM   5789  C CA  . ASN C  1  54  ? 126.777 137.514 135.820 1.00 35.89  ? 54  ASN C CA  1 
ATOM   5790  C C   . ASN C  1  54  ? 125.482 137.297 135.052 1.00 35.89  ? 54  ASN C C   1 
ATOM   5791  O O   . ASN C  1  54  ? 124.584 138.142 135.136 1.00 35.89  ? 54  ASN C O   1 
ATOM   5792  C CB  . ASN C  1  54  ? 127.536 138.688 135.199 1.00 35.89  ? 54  ASN C CB  1 
ATOM   5793  C CG  . ASN C  1  54  ? 128.690 139.143 136.052 1.00 35.89  ? 54  ASN C CG  1 
ATOM   5794  O OD1 . ASN C  1  54  ? 128.566 139.255 137.270 1.00 35.89  ? 54  ASN C OD1 1 
ATOM   5795  N ND2 . ASN C  1  54  ? 129.829 139.396 135.422 1.00 35.89  ? 54  ASN C ND2 1 
ATOM   5796  N N   . MET C  1  55  ? 125.368 136.199 134.306 1.00 40.27  ? 55  MET C N   1 
ATOM   5797  C CA  . MET C  1  55  ? 124.189 135.899 133.498 1.00 40.27  ? 55  MET C CA  1 
ATOM   5798  C C   . MET C  1  55  ? 123.937 137.001 132.468 1.00 40.27  ? 55  MET C C   1 
ATOM   5799  O O   . MET C  1  55  ? 122.888 137.644 132.446 1.00 40.27  ? 55  MET C O   1 
ATOM   5800  C CB  . MET C  1  55  ? 122.960 135.672 134.385 1.00 40.27  ? 55  MET C CB  1 
ATOM   5801  C CG  . MET C  1  55  ? 123.036 134.401 135.209 1.00 40.27  ? 55  MET C CG  1 
ATOM   5802  S SD  . MET C  1  55  ? 121.584 134.130 136.237 1.00 40.27  ? 55  MET C SD  1 
ATOM   5803  C CE  . MET C  1  55  ? 122.055 132.624 137.084 1.00 40.27  ? 55  MET C CE  1 
ATOM   5804  N N   . ASP C  1  56  ? 124.930 137.210 131.607 1.00 36.00  ? 56  ASP C N   1 
ATOM   5805  C CA  . ASP C  1  56  ? 124.813 138.201 130.550 1.00 36.00  ? 56  ASP C CA  1 
ATOM   5806  C C   . ASP C  1  56  ? 125.726 137.832 129.392 1.00 36.00  ? 56  ASP C C   1 
ATOM   5807  O O   . ASP C  1  56  ? 126.772 137.210 129.580 1.00 36.00  ? 56  ASP C O   1 
ATOM   5808  C CB  . ASP C  1  56  ? 125.136 139.611 131.061 1.00 36.00  ? 56  ASP C CB  1 
ATOM   5809  C CG  . ASP C  1  56  ? 126.530 139.723 131.648 1.00 36.00  ? 56  ASP C CG  1 
ATOM   5810  O OD1 . ASP C  1  56  ? 127.218 138.693 131.777 1.00 36.00  ? 56  ASP C OD1 1 
ATOM   5811  O OD2 . ASP C  1  56  ? 126.942 140.855 131.976 1.00 36.00  ? 56  ASP C OD2 1 
ATOM   5812  N N   . TYR C  1  57  ? 125.311 138.212 128.188 1.00 26.06  ? 57  TYR C N   1 
ATOM   5813  C CA  . TYR C  1  57  ? 126.098 137.999 126.984 1.00 26.06  ? 57  TYR C CA  1 
ATOM   5814  C C   . TYR C  1  57  ? 126.184 139.308 126.221 1.00 26.06  ? 57  TYR C C   1 
ATOM   5815  O O   . TYR C  1  57  ? 125.222 140.077 126.194 1.00 26.06  ? 57  TYR C O   1 
ATOM   5816  C CB  . TYR C  1  57  ? 125.480 136.923 126.098 1.00 26.06  ? 57  TYR C CB  1 
ATOM   5817  C CG  . TYR C  1  57  ? 124.171 137.336 125.481 1.00 26.06  ? 57  TYR C CG  1 
ATOM   5818  C CD1 . TYR C  1  57  ? 122.984 137.176 126.165 1.00 26.06  ? 57  TYR C CD1 1 
ATOM   5819  C CD2 . TYR C  1  57  ? 124.123 137.874 124.210 1.00 26.06  ? 57  TYR C CD2 1 
ATOM   5820  C CE1 . TYR C  1  57  ? 121.789 137.552 125.607 1.00 26.06  ? 57  TYR C CE1 1 
ATOM   5821  C CE2 . TYR C  1  57  ? 122.934 138.248 123.646 1.00 26.06  ? 57  TYR C CE2 1 
ATOM   5822  C CZ  . TYR C  1  57  ? 121.770 138.086 124.347 1.00 26.06  ? 57  TYR C CZ  1 
ATOM   5823  O OH  . TYR C  1  57  ? 120.573 138.458 123.787 1.00 26.06  ? 57  TYR C OH  1 
ATOM   5824  N N   . THR C  1  58  ? 127.327 139.555 125.595 1.00 24.30  ? 58  THR C N   1 
ATOM   5825  C CA  . THR C  1  58  ? 127.578 140.794 124.874 1.00 24.30  ? 58  THR C CA  1 
ATOM   5826  C C   . THR C  1  58  ? 127.567 140.540 123.376 1.00 24.30  ? 58  THR C C   1 
ATOM   5827  O O   . THR C  1  58  ? 128.299 139.675 122.888 1.00 24.30  ? 58  THR C O   1 
ATOM   5828  C CB  . THR C  1  58  ? 128.922 141.392 125.281 1.00 24.30  ? 58  THR C CB  1 
ATOM   5829  O OG1 . THR C  1  58  ? 128.875 141.786 126.657 1.00 24.30  ? 58  THR C OG1 1 
ATOM   5830  C CG2 . THR C  1  58  ? 129.258 142.586 124.414 1.00 24.30  ? 58  THR C CG2 1 
ATOM   5831  N N   . LEU C  1  59  ? 126.755 141.301 122.648 1.00 20.17  ? 59  LEU C N   1 
ATOM   5832  C CA  . LEU C  1  59  ? 126.710 141.219 121.198 1.00 20.17  ? 59  LEU C CA  1 
ATOM   5833  C C   . LEU C  1  59  ? 126.965 142.591 120.593 1.00 20.17  ? 59  LEU C C   1 
ATOM   5834  O O   . LEU C  1  59  ? 126.742 143.619 121.235 1.00 20.17  ? 59  LEU C O   1 
ATOM   5835  C CB  . LEU C  1  59  ? 125.368 140.667 120.703 1.00 20.17  ? 59  LEU C CB  1 
ATOM   5836  C CG  . LEU C  1  59  ? 124.064 141.404 120.991 1.00 20.17  ? 59  LEU C CG  1 
ATOM   5837  C CD1 . LEU C  1  59  ? 123.801 142.480 119.965 1.00 20.17  ? 59  LEU C CD1 1 
ATOM   5838  C CD2 . LEU C  1  59  ? 122.923 140.420 120.992 1.00 20.17  ? 59  LEU C CD2 1 
ATOM   5839  N N   . THR C  1  60  ? 127.434 142.598 119.347 1.00 24.84  ? 60  THR C N   1 
ATOM   5840  C CA  . THR C  1  60  ? 127.663 143.825 118.592 1.00 24.84  ? 60  THR C CA  1 
ATOM   5841  C C   . THR C  1  60  ? 127.011 143.676 117.229 1.00 24.84  ? 60  THR C C   1 
ATOM   5842  O O   . THR C  1  60  ? 127.342 142.752 116.482 1.00 24.84  ? 60  THR C O   1 
ATOM   5843  C CB  . THR C  1  60  ? 129.156 144.116 118.437 1.00 24.84  ? 60  THR C CB  1 
ATOM   5844  O OG1 . THR C  1  60  ? 129.746 144.309 119.727 1.00 24.84  ? 60  THR C OG1 1 
ATOM   5845  C CG2 . THR C  1  60  ? 129.365 145.356 117.598 1.00 24.84  ? 60  THR C CG2 1 
ATOM   5846  N N   . MET C  1  61  ? 126.105 144.590 116.896 1.00 43.48  ? 61  MET C N   1 
ATOM   5847  C CA  . MET C  1  61  ? 125.241 144.419 115.740 1.00 43.48  ? 61  MET C CA  1 
ATOM   5848  C C   . MET C  1  61  ? 125.064 145.732 114.998 1.00 43.48  ? 61  MET C C   1 
ATOM   5849  O O   . MET C  1  61  ? 125.179 146.810 115.579 1.00 43.48  ? 61  MET C O   1 
ATOM   5850  C CB  . MET C  1  61  ? 123.880 143.877 116.166 1.00 43.48  ? 61  MET C CB  1 
ATOM   5851  C CG  . MET C  1  61  ? 123.149 144.760 117.149 1.00 43.48  ? 61  MET C CG  1 
ATOM   5852  S SD  . MET C  1  61  ? 121.586 144.030 117.652 1.00 43.48  ? 61  MET C SD  1 
ATOM   5853  C CE  . MET C  1  61  ? 121.040 145.208 118.874 1.00 43.48  ? 61  MET C CE  1 
ATOM   5854  N N   . TYR C  1  62  ? 124.774 145.629 113.703 1.00 43.48  ? 62  TYR C N   1 
ATOM   5855  C CA  . TYR C  1  62  ? 124.476 146.792 112.874 1.00 43.48  ? 62  TYR C CA  1 
ATOM   5856  C C   . TYR C  1  62  ? 122.964 146.964 112.837 1.00 43.48  ? 62  TYR C C   1 
ATOM   5857  O O   . TYR C  1  62  ? 122.271 146.255 112.106 1.00 43.48  ? 62  TYR C O   1 
ATOM   5858  C CB  . TYR C  1  62  ? 125.025 146.633 111.460 1.00 43.48  ? 62  TYR C CB  1 
ATOM   5859  C CG  . TYR C  1  62  ? 126.526 146.542 111.356 1.00 43.48  ? 62  TYR C CG  1 
ATOM   5860  C CD1 . TYR C  1  62  ? 127.335 146.789 112.448 1.00 43.48  ? 62  TYR C CD1 1 
ATOM   5861  C CD2 . TYR C  1  62  ? 127.135 146.226 110.154 1.00 43.48  ? 62  TYR C CD2 1 
ATOM   5862  C CE1 . TYR C  1  62  ? 128.703 146.704 112.352 1.00 43.48  ? 62  TYR C CE1 1 
ATOM   5863  C CE2 . TYR C  1  62  ? 128.501 146.143 110.049 1.00 43.48  ? 62  TYR C CE2 1 
ATOM   5864  C CZ  . TYR C  1  62  ? 129.280 146.384 111.151 1.00 43.48  ? 62  TYR C CZ  1 
ATOM   5865  O OH  . TYR C  1  62  ? 130.645 146.301 111.054 1.00 43.48  ? 62  TYR C OH  1 
ATOM   5866  N N   . PHE C  1  63  ? 122.458 147.918 113.601 1.00 31.69  ? 63  PHE C N   1 
ATOM   5867  C CA  . PHE C  1  63  ? 121.027 148.099 113.799 1.00 31.69  ? 63  PHE C CA  1 
ATOM   5868  C C   . PHE C  1  63  ? 120.516 149.124 112.797 1.00 31.69  ? 63  PHE C C   1 
ATOM   5869  O O   . PHE C  1  63  ? 121.037 150.240 112.734 1.00 31.69  ? 63  PHE C O   1 
ATOM   5870  C CB  . PHE C  1  63  ? 120.763 148.560 115.229 1.00 31.69  ? 63  PHE C CB  1 
ATOM   5871  C CG  . PHE C  1  63  ? 119.323 148.622 115.599 1.00 31.69  ? 63  PHE C CG  1 
ATOM   5872  C CD1 . PHE C  1  63  ? 118.622 147.470 115.870 1.00 31.69  ? 63  PHE C CD1 1 
ATOM   5873  C CD2 . PHE C  1  63  ? 118.681 149.834 115.716 1.00 31.69  ? 63  PHE C CD2 1 
ATOM   5874  C CE1 . PHE C  1  63  ? 117.301 147.521 116.232 1.00 31.69  ? 63  PHE C CE1 1 
ATOM   5875  C CE2 . PHE C  1  63  ? 117.360 149.892 116.078 1.00 31.69  ? 63  PHE C CE2 1 
ATOM   5876  C CZ  . PHE C  1  63  ? 116.669 148.734 116.338 1.00 31.69  ? 63  PHE C CZ  1 
ATOM   5877  N N   . GLN C  1  64  ? 119.504 148.750 112.020 1.00 19.03  ? 64  GLN C N   1 
ATOM   5878  C CA  . GLN C  1  64  ? 118.962 149.615 110.981 1.00 19.03  ? 64  GLN C CA  1 
ATOM   5879  C C   . GLN C  1  64  ? 117.448 149.641 111.069 1.00 19.03  ? 64  GLN C C   1 
ATOM   5880  O O   . GLN C  1  64  ? 116.825 148.631 111.402 1.00 19.03  ? 64  GLN C O   1 
ATOM   5881  C CB  . GLN C  1  64  ? 119.370 149.139 109.594 1.00 19.03  ? 64  GLN C CB  1 
ATOM   5882  C CG  . GLN C  1  64  ? 120.854 149.152 109.350 1.00 19.03  ? 64  GLN C CG  1 
ATOM   5883  C CD  . GLN C  1  64  ? 121.197 148.725 107.949 1.00 19.03  ? 64  GLN C CD  1 
ATOM   5884  O OE1 . GLN C  1  64  ? 120.314 148.409 107.155 1.00 19.03  ? 64  GLN C OE1 1 
ATOM   5885  N NE2 . GLN C  1  64  ? 122.485 148.702 107.635 1.00 19.03  ? 64  GLN C NE2 1 
ATOM   5886  N N   . GLN C  1  65  ? 116.855 150.786 110.743 1.00 32.88  ? 65  GLN C N   1 
ATOM   5887  C CA  . GLN C  1  65  ? 115.409 150.934 110.836 1.00 32.88  ? 65  GLN C CA  1 
ATOM   5888  C C   . GLN C  1  65  ? 114.956 152.067 109.930 1.00 32.88  ? 65  GLN C C   1 
ATOM   5889  O O   . GLN C  1  65  ? 115.455 153.188 110.043 1.00 32.88  ? 65  GLN C O   1 
ATOM   5890  C CB  . GLN C  1  65  ? 114.993 151.175 112.288 1.00 32.88  ? 65  GLN C CB  1 
ATOM   5891  C CG  . GLN C  1  65  ? 115.688 152.337 112.954 1.00 32.88  ? 65  GLN C CG  1 
ATOM   5892  C CD  . GLN C  1  65  ? 115.346 152.448 114.419 1.00 32.88  ? 65  GLN C CD  1 
ATOM   5893  O OE1 . GLN C  1  65  ? 114.495 151.721 114.922 1.00 32.88  ? 65  GLN C OE1 1 
ATOM   5894  N NE2 . GLN C  1  65  ? 116.024 153.345 115.119 1.00 32.88  ? 65  GLN C NE2 1 
ATOM   5895  N N   . ALA C  1  66  ? 114.012 151.775 109.039 1.00 20.05  ? 66  ALA C N   1 
ATOM   5896  C CA  . ALA C  1  66  ? 113.587 152.705 108.003 1.00 20.05  ? 66  ALA C CA  1 
ATOM   5897  C C   . ALA C  1  66  ? 112.086 152.923 108.081 1.00 20.05  ? 66  ALA C C   1 
ATOM   5898  O O   . ALA C  1  66  ? 111.319 151.959 108.137 1.00 20.05  ? 66  ALA C O   1 
ATOM   5899  C CB  . ALA C  1  66  ? 113.963 152.182 106.619 1.00 20.05  ? 66  ALA C CB  1 
ATOM   5900  N N   . TRP C  1  67  ? 111.670 154.186 108.063 1.00 43.48  ? 67  TRP C N   1 
ATOM   5901  C CA  . TRP C  1  67  ? 110.266 154.560 108.120 1.00 43.48  ? 67  TRP C CA  1 
ATOM   5902  C C   . TRP C  1  67  ? 109.976 155.560 107.014 1.00 43.48  ? 67  TRP C C   1 
ATOM   5903  O O   . TRP C  1  67  ? 110.882 156.037 106.329 1.00 43.48  ? 67  TRP C O   1 
ATOM   5904  C CB  . TRP C  1  67  ? 109.904 155.158 109.478 1.00 43.48  ? 67  TRP C CB  1 
ATOM   5905  C CG  . TRP C  1  67  ? 110.599 156.435 109.753 1.00 43.48  ? 67  TRP C CG  1 
ATOM   5906  C CD1 . TRP C  1  67  ? 110.145 157.684 109.479 1.00 43.48  ? 67  TRP C CD1 1 
ATOM   5907  C CD2 . TRP C  1  67  ? 111.893 156.597 110.335 1.00 43.48  ? 67  TRP C CD2 1 
ATOM   5908  N NE1 . TRP C  1  67  ? 111.067 158.620 109.871 1.00 43.48  ? 67  TRP C NE1 1 
ATOM   5909  C CE2 . TRP C  1  67  ? 112.154 157.974 110.395 1.00 43.48  ? 67  TRP C CE2 1 
ATOM   5910  C CE3 . TRP C  1  67  ? 112.854 155.709 110.818 1.00 43.48  ? 67  TRP C CE3 1 
ATOM   5911  C CZ2 . TRP C  1  67  ? 113.332 158.485 110.917 1.00 43.48  ? 67  TRP C CZ2 1 
ATOM   5912  C CZ3 . TRP C  1  67  ? 114.021 156.218 111.331 1.00 43.48  ? 67  TRP C CZ3 1 
ATOM   5913  C CH2 . TRP C  1  67  ? 114.252 157.592 111.379 1.00 43.48  ? 67  TRP C CH2 1 
ATOM   5914  N N   . ARG C  1  68  ? 108.701 155.894 106.846 1.00 33.50  ? 68  ARG C N   1 
ATOM   5915  C CA  . ARG C  1  68  ? 108.268 156.773 105.769 1.00 33.50  ? 68  ARG C CA  1 
ATOM   5916  C C   . ARG C  1  68  ? 107.765 158.087 106.342 1.00 33.50  ? 68  ARG C C   1 
ATOM   5917  O O   . ARG C  1  68  ? 106.875 158.097 107.196 1.00 33.50  ? 68  ARG C O   1 
ATOM   5918  C CB  . ARG C  1  68  ? 107.176 156.122 104.923 1.00 33.50  ? 68  ARG C CB  1 
ATOM   5919  C CG  . ARG C  1  68  ? 106.815 156.955 103.713 1.00 33.50  ? 68  ARG C CG  1 
ATOM   5920  C CD  . ARG C  1  68  ? 105.795 156.277 102.828 1.00 33.50  ? 68  ARG C CD  1 
ATOM   5921  N NE  . ARG C  1  68  ? 105.541 157.077 101.638 1.00 33.50  ? 68  ARG C NE  1 
ATOM   5922  C CZ  . ARG C  1  68  ? 104.640 158.050 101.577 1.00 33.50  ? 68  ARG C CZ  1 
ATOM   5923  N NH1 . ARG C  1  68  ? 103.908 158.341 102.642 1.00 33.50  ? 68  ARG C NH1 1 
ATOM   5924  N NH2 . ARG C  1  68  ? 104.474 158.734 100.454 1.00 33.50  ? 68  ARG C NH2 1 
ATOM   5925  N N   . ASP C  1  69  ? 108.320 159.191 105.852 1.00 32.41  ? 69  ASP C N   1 
ATOM   5926  C CA  . ASP C  1  69  ? 108.044 160.520 106.380 1.00 32.41  ? 69  ASP C CA  1 
ATOM   5927  C C   . ASP C  1  69  ? 107.817 161.467 105.214 1.00 32.41  ? 69  ASP C C   1 
ATOM   5928  O O   . ASP C  1  69  ? 108.735 161.715 104.429 1.00 32.41  ? 69  ASP C O   1 
ATOM   5929  C CB  . ASP C  1  69  ? 109.204 161.000 107.255 1.00 32.41  ? 69  ASP C CB  1 
ATOM   5930  C CG  . ASP C  1  69  ? 108.885 162.269 108.004 1.00 32.41  ? 69  ASP C CG  1 
ATOM   5931  O OD1 . ASP C  1  69  ? 107.791 162.828 107.793 1.00 32.41  ? 69  ASP C OD1 1 
ATOM   5932  O OD2 . ASP C  1  69  ? 109.728 162.705 108.816 1.00 32.41  ? 69  ASP C OD2 1 
ATOM   5933  N N   . LYS C  1  70  ? 106.600 162.005 105.112 1.00 29.22  ? 70  LYS C N   1 
ATOM   5934  C CA  . LYS C  1  70  ? 106.237 162.803 103.945 1.00 29.22  ? 70  LYS C CA  1 
ATOM   5935  C C   . LYS C  1  70  ? 106.908 164.169 103.952 1.00 29.22  ? 70  LYS C C   1 
ATOM   5936  O O   . LYS C  1  70  ? 107.115 164.758 102.887 1.00 29.22  ? 70  LYS C O   1 
ATOM   5937  C CB  . LYS C  1  70  ? 104.722 162.971 103.874 1.00 29.22  ? 70  LYS C CB  1 
ATOM   5938  C CG  . LYS C  1  70  ? 103.961 161.692 103.592 1.00 29.22  ? 70  LYS C CG  1 
ATOM   5939  C CD  . LYS C  1  70  ? 102.469 161.960 103.533 1.00 29.22  ? 70  LYS C CD  1 
ATOM   5940  C CE  . LYS C  1  70  ? 101.682 160.685 103.298 1.00 29.22  ? 70  LYS C CE  1 
ATOM   5941  N NZ  . LYS C  1  70  ? 100.218 160.949 103.255 1.00 29.22  ? 70  LYS C NZ  1 
ATOM   5942  N N   . ARG C  1  71  ? 107.244 164.693 105.131 1.00 28.54  ? 71  ARG C N   1 
ATOM   5943  C CA  . ARG C  1  71  ? 107.817 166.032 105.199 1.00 28.54  ? 71  ARG C CA  1 
ATOM   5944  C C   . ARG C  1  71  ? 109.206 166.088 104.583 1.00 28.54  ? 71  ARG C C   1 
ATOM   5945  O O   . ARG C  1  71  ? 109.641 167.155 104.140 1.00 28.54  ? 71  ARG C O   1 
ATOM   5946  C CB  . ARG C  1  71  ? 107.860 166.508 106.647 1.00 28.54  ? 71  ARG C CB  1 
ATOM   5947  C CG  . ARG C  1  71  ? 106.488 166.729 107.247 1.00 28.54  ? 71  ARG C CG  1 
ATOM   5948  C CD  . ARG C  1  71  ? 106.585 167.073 108.716 1.00 28.54  ? 71  ARG C CD  1 
ATOM   5949  N NE  . ARG C  1  71  ? 107.100 165.946 109.485 1.00 28.54  ? 71  ARG C NE  1 
ATOM   5950  C CZ  . ARG C  1  71  ? 107.377 165.991 110.781 1.00 28.54  ? 71  ARG C CZ  1 
ATOM   5951  N NH1 . ARG C  1  71  ? 107.180 167.109 111.462 1.00 28.54  ? 71  ARG C NH1 1 
ATOM   5952  N NH2 . ARG C  1  71  ? 107.846 164.917 111.396 1.00 28.54  ? 71  ARG C NH2 1 
ATOM   5953  N N   . LEU C  1  72  ? 109.917 164.965 104.548 1.00 31.60  ? 72  LEU C N   1 
ATOM   5954  C CA  . LEU C  1  72  ? 111.241 164.912 103.932 1.00 31.60  ? 72  LEU C CA  1 
ATOM   5955  C C   . LEU C  1  72  ? 111.141 164.403 102.494 1.00 31.60  ? 72  LEU C C   1 
ATOM   5956  O O   . LEU C  1  72  ? 111.746 163.407 102.108 1.00 31.60  ? 72  LEU C O   1 
ATOM   5957  C CB  . LEU C  1  72  ? 112.173 164.040 104.761 1.00 31.60  ? 72  LEU C CB  1 
ATOM   5958  C CG  . LEU C  1  72  ? 112.471 164.571 106.157 1.00 31.60  ? 72  LEU C CG  1 
ATOM   5959  C CD1 . LEU C  1  72  ? 113.303 163.572 106.930 1.00 31.60  ? 72  LEU C CD1 1 
ATOM   5960  C CD2 . LEU C  1  72  ? 113.178 165.903 106.065 1.00 31.60  ? 72  LEU C CD2 1 
ATOM   5961  N N   . SER C  1  73  ? 110.355 165.117 101.695 1.00 37.48  ? 73  SER C N   1 
ATOM   5962  C CA  . SER C  1  73  ? 110.113 164.749 100.309 1.00 37.48  ? 73  SER C CA  1 
ATOM   5963  C C   . SER C  1  73  ? 110.520 165.885 99.384  1.00 37.48  ? 73  SER C C   1 
ATOM   5964  O O   . SER C  1  73  ? 110.191 167.048 99.629  1.00 37.48  ? 73  SER C O   1 
ATOM   5965  C CB  . SER C  1  73  ? 108.646 164.402 100.082 1.00 37.48  ? 73  SER C CB  1 
ATOM   5966  O OG  . SER C  1  73  ? 108.416 164.081 98.724  1.00 37.48  ? 73  SER C OG  1 
ATOM   5967  N N   . TYR C  1  74  ? 111.234 165.537 98.318  1.00 43.94  ? 74  TYR C N   1 
ATOM   5968  C CA  . TYR C  1  74  ? 111.682 166.499 97.325  1.00 43.94  ? 74  TYR C CA  1 
ATOM   5969  C C   . TYR C  1  74  ? 111.507 165.901 95.938  1.00 43.94  ? 74  TYR C C   1 
ATOM   5970  O O   . TYR C  1  74  ? 111.540 164.681 95.764  1.00 43.94  ? 74  TYR C O   1 
ATOM   5971  C CB  . TYR C  1  74  ? 113.140 166.909 97.561  1.00 43.94  ? 74  TYR C CB  1 
ATOM   5972  C CG  . TYR C  1  74  ? 114.115 165.757 97.518  1.00 43.94  ? 74  TYR C CG  1 
ATOM   5973  C CD1 . TYR C  1  74  ? 114.411 165.034 98.661  1.00 43.94  ? 74  TYR C CD1 1 
ATOM   5974  C CD2 . TYR C  1  74  ? 114.744 165.398 96.340  1.00 43.94  ? 74  TYR C CD2 1 
ATOM   5975  C CE1 . TYR C  1  74  ? 115.300 163.985 98.629  1.00 43.94  ? 74  TYR C CE1 1 
ATOM   5976  C CE2 . TYR C  1  74  ? 115.632 164.350 96.301  1.00 43.94  ? 74  TYR C CE2 1 
ATOM   5977  C CZ  . TYR C  1  74  ? 115.905 163.649 97.447  1.00 43.94  ? 74  TYR C CZ  1 
ATOM   5978  O OH  . TYR C  1  74  ? 116.792 162.603 97.409  1.00 43.94  ? 74  TYR C OH  1 
ATOM   5979  N N   . ASN C  1  75  ? 111.319 166.775 94.950  1.00 56.70  ? 75  ASN C N   1 
ATOM   5980  C CA  . ASN C  1  75  ? 111.033 166.352 93.585  1.00 56.70  ? 75  ASN C CA  1 
ATOM   5981  C C   . ASN C  1  75  ? 111.995 166.942 92.562  1.00 56.70  ? 75  ASN C C   1 
ATOM   5982  O O   . ASN C  1  75  ? 111.723 166.866 91.358  1.00 56.70  ? 75  ASN C O   1 
ATOM   5983  C CB  . ASN C  1  75  ? 109.594 166.716 93.214  1.00 56.70  ? 75  ASN C CB  1 
ATOM   5984  C CG  . ASN C  1  75  ? 108.575 165.887 93.963  1.00 56.70  ? 75  ASN C CG  1 
ATOM   5985  O OD1 . ASN C  1  75  ? 108.738 164.677 94.120  1.00 56.70  ? 75  ASN C OD1 1 
ATOM   5986  N ND2 . ASN C  1  75  ? 107.516 166.534 94.434  1.00 56.70  ? 75  ASN C ND2 1 
ATOM   5987  N N   . VAL C  1  76  ? 113.103 167.530 93.000  1.00 57.63  ? 76  VAL C N   1 
ATOM   5988  C CA  . VAL C  1  76  ? 114.020 168.203 92.086  1.00 57.63  ? 76  VAL C CA  1 
ATOM   5989  C C   . VAL C  1  76  ? 115.137 167.276 91.622  1.00 57.63  ? 76  VAL C C   1 
ATOM   5990  O O   . VAL C  1  76  ? 115.455 167.217 90.432  1.00 57.63  ? 76  VAL C O   1 
ATOM   5991  C CB  . VAL C  1  76  ? 114.582 169.471 92.759  1.00 57.63  ? 76  VAL C CB  1 
ATOM   5992  C CG1 . VAL C  1  76  ? 115.597 170.143 91.856  1.00 57.63  ? 76  VAL C CG1 1 
ATOM   5993  C CG2 . VAL C  1  76  ? 113.454 170.424 93.106  1.00 57.63  ? 76  VAL C CG2 1 
ATOM   5994  N N   . ILE C  1  77  ? 115.748 166.540 92.545  1.00 55.10  ? 77  ILE C N   1 
ATOM   5995  C CA  . ILE C  1  77  ? 116.927 165.731 92.240  1.00 55.10  ? 77  ILE C CA  1 
ATOM   5996  C C   . ILE C  1  77  ? 116.540 164.257 92.243  1.00 55.10  ? 77  ILE C C   1 
ATOM   5997  O O   . ILE C  1  77  ? 115.770 163.823 93.111  1.00 55.10  ? 77  ILE C O   1 
ATOM   5998  C CB  . ILE C  1  77  ? 118.059 166.001 93.244  1.00 55.10  ? 77  ILE C CB  1 
ATOM   5999  C CG1 . ILE C  1  77  ? 118.478 167.470 93.211  1.00 55.10  ? 77  ILE C CG1 1 
ATOM   6000  C CG2 . ILE C  1  77  ? 119.258 165.116 92.962  1.00 55.10  ? 77  ILE C CG2 1 
ATOM   6001  C CD1 . ILE C  1  77  ? 117.764 168.333 94.226  1.00 55.10  ? 77  ILE C CD1 1 
ATOM   6002  N N   . PRO C  1  78  ? 117.034 163.451 91.299  1.00 62.86  ? 78  PRO C N   1 
ATOM   6003  C CA  . PRO C  1  78  ? 116.750 162.010 91.337  1.00 62.86  ? 78  PRO C CA  1 
ATOM   6004  C C   . PRO C  1  78  ? 117.664 161.212 92.255  1.00 62.86  ? 78  PRO C C   1 
ATOM   6005  O O   . PRO C  1  78  ? 117.391 160.026 92.484  1.00 62.86  ? 78  PRO C O   1 
ATOM   6006  C CB  . PRO C  1  78  ? 116.943 161.584 89.878  1.00 62.86  ? 78  PRO C CB  1 
ATOM   6007  C CG  . PRO C  1  78  ? 117.943 162.548 89.350  1.00 62.86  ? 78  PRO C CG  1 
ATOM   6008  C CD  . PRO C  1  78  ? 117.671 163.857 90.034  1.00 62.86  ? 78  PRO C CD  1 
ATOM   6009  N N   . LEU C  1  79  ? 118.732 161.808 92.781  1.00 56.10  ? 79  LEU C N   1 
ATOM   6010  C CA  . LEU C  1  79  ? 119.701 161.060 93.566  1.00 56.10  ? 79  LEU C CA  1 
ATOM   6011  C C   . LEU C  1  79  ? 119.145 160.710 94.946  1.00 56.10  ? 79  LEU C C   1 
ATOM   6012  O O   . LEU C  1  79  ? 118.100 161.204 95.378  1.00 56.10  ? 79  LEU C O   1 
ATOM   6013  C CB  . LEU C  1  79  ? 120.996 161.853 93.717  1.00 56.10  ? 79  LEU C CB  1 
ATOM   6014  C CG  . LEU C  1  79  ? 121.772 162.085 92.423  1.00 56.10  ? 79  LEU C CG  1 
ATOM   6015  C CD1 . LEU C  1  79  ? 122.980 162.966 92.679  1.00 56.10  ? 79  LEU C CD1 1 
ATOM   6016  C CD2 . LEU C  1  79  ? 122.184 160.759 91.807  1.00 56.10  ? 79  LEU C CD2 1 
ATOM   6017  N N   . ASN C  1  80  ? 119.870 159.834 95.639  1.00 47.40  ? 80  ASN C N   1 
ATOM   6018  C CA  . ASN C  1  80  ? 119.585 159.473 97.025  1.00 47.40  ? 80  ASN C CA  1 
ATOM   6019  C C   . ASN C  1  80  ? 120.525 160.270 97.918  1.00 47.40  ? 80  ASN C C   1 
ATOM   6020  O O   . ASN C  1  80  ? 121.693 159.912 98.084  1.00 47.40  ? 80  ASN C O   1 
ATOM   6021  C CB  . ASN C  1  80  ? 119.747 157.974 97.243  1.00 47.40  ? 80  ASN C CB  1 
ATOM   6022  C CG  . ASN C  1  80  ? 118.631 157.179 96.614  1.00 47.40  ? 80  ASN C CG  1 
ATOM   6023  O OD1 . ASN C  1  80  ? 117.467 157.565 96.690  1.00 47.40  ? 80  ASN C OD1 1 
ATOM   6024  N ND2 . ASN C  1  80  ? 118.973 156.063 95.989  1.00 47.40  ? 80  ASN C ND2 1 
ATOM   6025  N N   . LEU C  1  81  ? 120.010 161.350 98.496  1.00 32.09  ? 81  LEU C N   1 
ATOM   6026  C CA  . LEU C  1  81  ? 120.828 162.198 99.347  1.00 32.09  ? 81  LEU C CA  1 
ATOM   6027  C C   . LEU C  1  81  ? 121.329 161.418 100.550 1.00 32.09  ? 81  LEU C C   1 
ATOM   6028  O O   . LEU C  1  81  ? 120.547 160.801 101.276 1.00 32.09  ? 81  LEU C O   1 
ATOM   6029  C CB  . LEU C  1  81  ? 120.024 163.409 99.807  1.00 32.09  ? 81  LEU C CB  1 
ATOM   6030  C CG  . LEU C  1  81  ? 119.630 164.390 98.711  1.00 32.09  ? 81  LEU C CG  1 
ATOM   6031  C CD1 . LEU C  1  81  ? 118.733 165.472 99.276  1.00 32.09  ? 81  LEU C CD1 1 
ATOM   6032  C CD2 . LEU C  1  81  ? 120.870 164.989 98.086  1.00 32.09  ? 81  LEU C CD2 1 
ATOM   6033  N N   . THR C  1  82  ? 122.641 161.437 100.750 1.00 24.12  ? 82  THR C N   1 
ATOM   6034  C CA  . THR C  1  82  ? 123.272 160.826 101.913 1.00 24.12  ? 82  THR C CA  1 
ATOM   6035  C C   . THR C  1  82  ? 123.877 161.943 102.748 1.00 24.12  ? 82  THR C C   1 
ATOM   6036  O O   . THR C  1  82  ? 124.928 162.489 102.397 1.00 24.12  ? 82  THR C O   1 
ATOM   6037  C CB  . THR C  1  82  ? 124.338 159.816 101.505 1.00 24.12  ? 82  THR C CB  1 
ATOM   6038  O OG1 . THR C  1  82  ? 123.738 158.768 100.737 1.00 24.12  ? 82  THR C OG1 1 
ATOM   6039  C CG2 . THR C  1  82  ? 124.988 159.228 102.735 1.00 24.12  ? 82  THR C CG2 1 
ATOM   6040  N N   . LEU C  1  83  ? 123.223 162.275 103.849 1.00 15.88  ? 83  LEU C N   1 
ATOM   6041  C CA  . LEU C  1  83  ? 123.633 163.400 104.667 1.00 15.88  ? 83  LEU C CA  1 
ATOM   6042  C C   . LEU C  1  83  ? 124.689 162.970 105.676 1.00 15.88  ? 83  LEU C C   1 
ATOM   6043  O O   . LEU C  1  83  ? 124.861 161.787 105.971 1.00 15.88  ? 83  LEU C O   1 
ATOM   6044  C CB  . LEU C  1  83  ? 122.429 163.991 105.388 1.00 15.88  ? 83  LEU C CB  1 
ATOM   6045  C CG  . LEU C  1  83  ? 121.367 164.562 104.459 1.00 15.88  ? 83  LEU C CG  1 
ATOM   6046  C CD1 . LEU C  1  83  ? 120.153 164.997 105.248 1.00 15.88  ? 83  LEU C CD1 1 
ATOM   6047  C CD2 . LEU C  1  83  ? 121.934 165.715 103.662 1.00 15.88  ? 83  LEU C CD2 1 
ATOM   6048  N N   . ASP C  1  84  ? 125.407 163.955 106.197 1.00 20.98  ? 84  ASP C N   1 
ATOM   6049  C CA  . ASP C  1  84  ? 126.397 163.696 107.227 1.00 20.98  ? 84  ASP C CA  1 
ATOM   6050  C C   . ASP C  1  84  ? 125.696 163.429 108.551 1.00 20.98  ? 84  ASP C C   1 
ATOM   6051  O O   . ASP C  1  84  ? 124.598 163.926 108.803 1.00 20.98  ? 84  ASP C O   1 
ATOM   6052  C CB  . ASP C  1  84  ? 127.356 164.878 107.351 1.00 20.98  ? 84  ASP C CB  1 
ATOM   6053  C CG  . ASP C  1  84  ? 128.551 164.569 108.221 1.00 20.98  ? 84  ASP C CG  1 
ATOM   6054  O OD1 . ASP C  1  84  ? 129.426 163.797 107.777 1.00 20.98  ? 84  ASP C OD1 1 
ATOM   6055  O OD2 . ASP C  1  84  ? 128.628 165.108 109.343 1.00 20.98  ? 84  ASP C OD2 1 
ATOM   6056  N N   . ASN C  1  85  ? 126.340 162.633 109.401 1.00 17.65  ? 85  ASN C N   1 
ATOM   6057  C CA  . ASN C  1  85  ? 125.679 162.136 110.603 1.00 17.65  ? 85  ASN C CA  1 
ATOM   6058  C C   . ASN C  1  85  ? 125.355 163.221 111.623 1.00 17.65  ? 85  ASN C C   1 
ATOM   6059  O O   . ASN C  1  85  ? 124.768 162.898 112.659 1.00 17.65  ? 85  ASN C O   1 
ATOM   6060  C CB  . ASN C  1  85  ? 126.533 161.052 111.256 1.00 17.65  ? 85  ASN C CB  1 
ATOM   6061  C CG  . ASN C  1  85  ? 127.896 161.552 111.667 1.00 17.65  ? 85  ASN C CG  1 
ATOM   6062  O OD1 . ASN C  1  85  ? 128.195 162.738 111.563 1.00 17.65  ? 85  ASN C OD1 1 
ATOM   6063  N ND2 . ASN C  1  85  ? 128.737 160.645 112.138 1.00 17.65  ? 85  ASN C ND2 1 
ATOM   6064  N N   . ARG C  1  86  ? 125.727 164.478 111.379 1.00 19.14  ? 86  ARG C N   1 
ATOM   6065  C CA  . ARG C  1  86  ? 125.327 165.551 112.281 1.00 19.14  ? 86  ARG C CA  1 
ATOM   6066  C C   . ARG C  1  86  ? 123.854 165.894 112.142 1.00 19.14  ? 86  ARG C C   1 
ATOM   6067  O O   . ARG C  1  86  ? 123.269 166.451 113.075 1.00 19.14  ? 86  ARG C O   1 
ATOM   6068  C CB  . ARG C  1  86  ? 126.159 166.805 112.026 1.00 19.14  ? 86  ARG C CB  1 
ATOM   6069  C CG  . ARG C  1  86  ? 127.624 166.665 112.372 1.00 19.14  ? 86  ARG C CG  1 
ATOM   6070  C CD  . ARG C  1  86  ? 128.382 167.935 112.045 1.00 19.14  ? 86  ARG C CD  1 
ATOM   6071  N NE  . ARG C  1  86  ? 129.804 167.792 112.330 1.00 19.14  ? 86  ARG C NE  1 
ATOM   6072  C CZ  . ARG C  1  86  ? 130.692 167.333 111.455 1.00 19.14  ? 86  ARG C CZ  1 
ATOM   6073  N NH1 . ARG C  1  86  ? 130.304 166.970 110.242 1.00 19.14  ? 86  ARG C NH1 1 
ATOM   6074  N NH2 . ARG C  1  86  ? 131.969 167.234 111.794 1.00 19.14  ? 86  ARG C NH2 1 
ATOM   6075  N N   . VAL C  1  87  ? 123.245 165.577 110.999 1.00 17.48  ? 87  VAL C N   1 
ATOM   6076  C CA  . VAL C  1  87  ? 121.880 166.010 110.734 1.00 17.48  ? 87  VAL C CA  1 
ATOM   6077  C C   . VAL C  1  87  ? 120.852 165.194 111.506 1.00 17.48  ? 87  VAL C C   1 
ATOM   6078  O O   . VAL C  1  87  ? 119.712 165.643 111.667 1.00 17.48  ? 87  VAL C O   1 
ATOM   6079  C CB  . VAL C  1  87  ? 121.588 165.939 109.227 1.00 17.48  ? 87  VAL C CB  1 
ATOM   6080  C CG1 . VAL C  1  87  ? 121.425 164.505 108.794 1.00 17.48  ? 87  VAL C CG1 1 
ATOM   6081  C CG2 . VAL C  1  87  ? 120.372 166.752 108.877 1.00 17.48  ? 87  VAL C CG2 1 
ATOM   6082  N N   . ALA C  1  88  ? 121.220 164.013 112.008 1.00 19.45  ? 88  ALA C N   1 
ATOM   6083  C CA  . ALA C  1  88  ? 120.262 163.191 112.737 1.00 19.45  ? 88  ALA C CA  1 
ATOM   6084  C C   . ALA C  1  88  ? 119.817 163.835 114.041 1.00 19.45  ? 88  ALA C C   1 
ATOM   6085  O O   . ALA C  1  88  ? 118.821 163.398 114.623 1.00 19.45  ? 88  ALA C O   1 
ATOM   6086  C CB  . ALA C  1  88  ? 120.853 161.811 113.017 1.00 19.45  ? 88  ALA C CB  1 
ATOM   6087  N N   . ASP C  1  89  ? 120.530 164.856 114.513 1.00 29.80  ? 89  ASP C N   1 
ATOM   6088  C CA  . ASP C  1  89  ? 120.096 165.575 115.702 1.00 29.80  ? 89  ASP C CA  1 
ATOM   6089  C C   . ASP C  1  89  ? 118.917 166.493 115.423 1.00 29.80  ? 89  ASP C C   1 
ATOM   6090  O O   . ASP C  1  89  ? 118.288 166.975 116.368 1.00 29.80  ? 89  ASP C O   1 
ATOM   6091  C CB  . ASP C  1  89  ? 121.256 166.386 116.278 1.00 29.80  ? 89  ASP C CB  1 
ATOM   6092  C CG  . ASP C  1  89  ? 122.326 165.511 116.901 1.00 29.80  ? 89  ASP C CG  1 
ATOM   6093  O OD1 . ASP C  1  89  ? 121.986 164.425 117.412 1.00 29.80  ? 89  ASP C OD1 1 
ATOM   6094  O OD2 . ASP C  1  89  ? 123.510 165.909 116.880 1.00 29.80  ? 89  ASP C OD2 1 
ATOM   6095  N N   . GLN C  1  90  ? 118.616 166.758 114.155 1.00 25.28  ? 90  GLN C N   1 
ATOM   6096  C CA  . GLN C  1  90  ? 117.536 167.663 113.791 1.00 25.28  ? 90  GLN C CA  1 
ATOM   6097  C C   . GLN C  1  90  ? 116.296 166.953 113.275 1.00 25.28  ? 90  GLN C C   1 
ATOM   6098  O O   . GLN C  1  90  ? 115.194 167.490 113.407 1.00 25.28  ? 90  GLN C O   1 
ATOM   6099  C CB  . GLN C  1  90  ? 118.025 168.659 112.738 1.00 25.28  ? 90  GLN C CB  1 
ATOM   6100  C CG  . GLN C  1  90  ? 119.120 169.564 113.264 1.00 25.28  ? 90  GLN C CG  1 
ATOM   6101  C CD  . GLN C  1  90  ? 119.655 170.502 112.213 1.00 25.28  ? 90  GLN C CD  1 
ATOM   6102  O OE1 . GLN C  1  90  ? 119.248 170.447 111.057 1.00 25.28  ? 90  GLN C OE1 1 
ATOM   6103  N NE2 . GLN C  1  90  ? 120.579 171.371 112.606 1.00 25.28  ? 90  GLN C NE2 1 
ATOM   6104  N N   . LEU C  1  91  ? 116.441 165.767 112.693 1.00 20.07  ? 91  LEU C N   1 
ATOM   6105  C CA  . LEU C  1  91  ? 115.302 165.025 112.179 1.00 20.07  ? 91  LEU C CA  1 
ATOM   6106  C C   . LEU C  1  91  ? 114.555 164.325 113.310 1.00 20.07  ? 91  LEU C C   1 
ATOM   6107  O O   . LEU C  1  91  ? 114.946 164.372 114.478 1.00 20.07  ? 91  LEU C O   1 
ATOM   6108  C CB  . LEU C  1  91  ? 115.752 163.996 111.149 1.00 20.07  ? 91  LEU C CB  1 
ATOM   6109  C CG  . LEU C  1  91  ? 116.429 164.558 109.905 1.00 20.07  ? 91  LEU C CG  1 
ATOM   6110  C CD1 . LEU C  1  91  ? 116.867 163.420 109.010 1.00 20.07  ? 91  LEU C CD1 1 
ATOM   6111  C CD2 . LEU C  1  91  ? 115.502 165.504 109.175 1.00 20.07  ? 91  LEU C CD2 1 
ATOM   6112  N N   . TRP C  1  92  ? 113.456 163.671 112.951 1.00 22.83  ? 92  TRP C N   1 
ATOM   6113  C CA  . TRP C  1  92  ? 112.772 162.793 113.883 1.00 22.83  ? 92  TRP C CA  1 
ATOM   6114  C C   . TRP C  1  92  ? 113.399 161.406 113.840 1.00 22.83  ? 92  TRP C C   1 
ATOM   6115  O O   . TRP C  1  92  ? 113.867 160.951 112.795 1.00 22.83  ? 92  TRP C O   1 
ATOM   6116  C CB  . TRP C  1  92  ? 111.288 162.696 113.546 1.00 22.83  ? 92  TRP C CB  1 
ATOM   6117  C CG  . TRP C  1  92  ? 110.517 161.919 114.549 1.00 22.83  ? 92  TRP C CG  1 
ATOM   6118  C CD1 . TRP C  1  92  ? 110.242 162.290 115.825 1.00 22.83  ? 92  TRP C CD1 1 
ATOM   6119  C CD2 . TRP C  1  92  ? 109.942 160.621 114.376 1.00 22.83  ? 92  TRP C CD2 1 
ATOM   6120  N NE1 . TRP C  1  92  ? 109.516 161.315 116.456 1.00 22.83  ? 92  TRP C NE1 1 
ATOM   6121  C CE2 . TRP C  1  92  ? 109.320 160.277 115.586 1.00 22.83  ? 92  TRP C CE2 1 
ATOM   6122  C CE3 . TRP C  1  92  ? 109.885 159.721 113.311 1.00 22.83  ? 92  TRP C CE3 1 
ATOM   6123  C CZ2 . TRP C  1  92  ? 108.655 159.074 115.763 1.00 22.83  ? 92  TRP C CZ2 1 
ATOM   6124  C CZ3 . TRP C  1  92  ? 109.220 158.527 113.490 1.00 22.83  ? 92  TRP C CZ3 1 
ATOM   6125  C CH2 . TRP C  1  92  ? 108.616 158.214 114.705 1.00 22.83  ? 92  TRP C CH2 1 
ATOM   6126  N N   . VAL C  1  93  ? 113.412 160.736 114.989 1.00 18.33  ? 93  VAL C N   1 
ATOM   6127  C CA  . VAL C  1  93  ? 113.930 159.372 115.095 1.00 18.33  ? 93  VAL C CA  1 
ATOM   6128  C C   . VAL C  1  93  ? 113.091 158.574 116.087 1.00 18.33  ? 93  VAL C C   1 
ATOM   6129  O O   . VAL C  1  93  ? 112.921 159.001 117.236 1.00 18.33  ? 93  VAL C O   1 
ATOM   6130  C CB  . VAL C  1  93  ? 115.413 159.365 115.496 1.00 18.33  ? 93  VAL C CB  1 
ATOM   6131  C CG1 . VAL C  1  93  ? 116.281 159.794 114.340 1.00 18.33  ? 93  VAL C CG1 1 
ATOM   6132  C CG2 . VAL C  1  93  ? 115.642 160.303 116.662 1.00 18.33  ? 93  VAL C CG2 1 
ATOM   6133  N N   . PRO C  1  94  ? 112.549 157.421 115.697 1.00 17.65  ? 94  PRO C N   1 
ATOM   6134  C CA  . PRO C  1  94  ? 111.717 156.646 116.624 1.00 17.65  ? 94  PRO C CA  1 
ATOM   6135  C C   . PRO C  1  94  ? 112.560 156.052 117.742 1.00 17.65  ? 94  PRO C C   1 
ATOM   6136  O O   . PRO C  1  94  ? 113.528 155.332 117.490 1.00 17.65  ? 94  PRO C O   1 
ATOM   6137  C CB  . PRO C  1  94  ? 111.116 155.558 115.730 1.00 17.65  ? 94  PRO C CB  1 
ATOM   6138  C CG  . PRO C  1  94  ? 112.103 155.398 114.637 1.00 17.65  ? 94  PRO C CG  1 
ATOM   6139  C CD  . PRO C  1  94  ? 112.670 156.764 114.389 1.00 17.65  ? 94  PRO C CD  1 
ATOM   6140  N N   . ASP C  1  95  ? 112.178 156.348 118.980 1.00 24.31  ? 95  ASP C N   1 
ATOM   6141  C CA  . ASP C  1  95  ? 112.941 155.928 120.147 1.00 24.31  ? 95  ASP C CA  1 
ATOM   6142  C C   . ASP C  1  95  ? 112.589 154.492 120.513 1.00 24.31  ? 95  ASP C C   1 
ATOM   6143  O O   . ASP C  1  95  ? 111.429 154.179 120.792 1.00 24.31  ? 95  ASP C O   1 
ATOM   6144  C CB  . ASP C  1  95  ? 112.696 156.873 121.321 1.00 24.31  ? 95  ASP C CB  1 
ATOM   6145  C CG  . ASP C  1  95  ? 111.229 157.089 121.601 1.00 24.31  ? 95  ASP C CG  1 
ATOM   6146  O OD1 . ASP C  1  95  ? 110.392 156.602 120.815 1.00 24.31  ? 95  ASP C OD1 1 
ATOM   6147  O OD2 . ASP C  1  95  ? 110.912 157.757 122.608 1.00 24.31  ? 95  ASP C OD2 1 
ATOM   6148  N N   . THR C  1  96  ? 113.595 153.621 120.501 1.00 15.90  ? 96  THR C N   1 
ATOM   6149  C CA  . THR C  1  96  ? 113.429 152.206 120.803 1.00 15.90  ? 96  THR C CA  1 
ATOM   6150  C C   . THR C  1  96  ? 114.491 151.810 121.811 1.00 15.90  ? 96  THR C C   1 
ATOM   6151  O O   . THR C  1  96  ? 115.685 151.925 121.526 1.00 15.90  ? 96  THR C O   1 
ATOM   6152  C CB  . THR C  1  96  ? 113.569 151.354 119.546 1.00 15.90  ? 96  THR C CB  1 
ATOM   6153  O OG1 . THR C  1  96  ? 114.917 151.437 119.079 1.00 15.90  ? 96  THR C OG1 1 
ATOM   6154  C CG2 . THR C  1  96  ? 112.668 151.869 118.457 1.00 15.90  ? 96  THR C CG2 1 
ATOM   6155  N N   . TYR C  1  97  ? 114.070 151.326 122.970 1.00 20.95  ? 97  TYR C N   1 
ATOM   6156  C CA  . TYR C  1  97  ? 115.012 150.903 123.990 1.00 20.95  ? 97  TYR C CA  1 
ATOM   6157  C C   . TYR C  1  97  ? 114.957 149.396 124.131 1.00 20.95  ? 97  TYR C C   1 
ATOM   6158  O O   . TYR C  1  97  ? 113.951 148.781 123.824 1.00 20.95  ? 97  TYR C O   1 
ATOM   6159  C CB  . TYR C  1  97  ? 114.696 151.560 125.319 1.00 20.95  ? 97  TYR C CB  1 
ATOM   6160  C CG  . TYR C  1  97  ? 113.470 151.004 125.977 1.00 20.95  ? 97  TYR C CG  1 
ATOM   6161  C CD1 . TYR C  1  97  ? 112.213 151.367 125.550 1.00 20.95  ? 97  TYR C CD1 1 
ATOM   6162  C CD2 . TYR C  1  97  ? 113.569 150.120 127.031 1.00 20.95  ? 97  TYR C CD2 1 
ATOM   6163  C CE1 . TYR C  1  97  ? 111.084 150.869 126.154 1.00 20.95  ? 97  TYR C CE1 1 
ATOM   6164  C CE2 . TYR C  1  97  ? 112.444 149.611 127.639 1.00 20.95  ? 97  TYR C CE2 1 
ATOM   6165  C CZ  . TYR C  1  97  ? 111.206 149.993 127.195 1.00 20.95  ? 97  TYR C CZ  1 
ATOM   6166  O OH  . TYR C  1  97  ? 110.082 149.491 127.794 1.00 20.95  ? 97  TYR C OH  1 
ATOM   6167  N N   . PHE C  1  98  ? 116.037 148.811 124.624 1.00 25.23  ? 98  PHE C N   1 
ATOM   6168  C CA  . PHE C  1  98  ? 116.157 147.367 124.777 1.00 25.23  ? 98  PHE C CA  1 
ATOM   6169  C C   . PHE C  1  98  ? 115.730 147.014 126.193 1.00 25.23  ? 98  PHE C C   1 
ATOM   6170  O O   . PHE C  1  98  ? 116.425 147.351 127.156 1.00 25.23  ? 98  PHE C O   1 
ATOM   6171  C CB  . PHE C  1  98  ? 117.583 146.904 124.504 1.00 25.23  ? 98  PHE C CB  1 
ATOM   6172  C CG  . PHE C  1  98  ? 118.053 147.195 123.120 1.00 25.23  ? 98  PHE C CG  1 
ATOM   6173  C CD1 . PHE C  1  98  ? 117.174 147.606 122.146 1.00 25.23  ? 98  PHE C CD1 1 
ATOM   6174  C CD2 . PHE C  1  98  ? 119.379 147.050 122.792 1.00 25.23  ? 98  PHE C CD2 1 
ATOM   6175  C CE1 . PHE C  1  98  ? 117.607 147.875 120.882 1.00 25.23  ? 98  PHE C CE1 1 
ATOM   6176  C CE2 . PHE C  1  98  ? 119.811 147.316 121.526 1.00 25.23  ? 98  PHE C CE2 1 
ATOM   6177  C CZ  . PHE C  1  98  ? 118.922 147.729 120.571 1.00 25.23  ? 98  PHE C CZ  1 
ATOM   6178  N N   . LEU C  1  99  ? 114.595 146.325 126.319 1.00 17.43  ? 99  LEU C N   1 
ATOM   6179  C CA  . LEU C  1  99  ? 113.993 146.121 127.632 1.00 17.43  ? 99  LEU C CA  1 
ATOM   6180  C C   . LEU C  1  99  ? 114.937 145.417 128.595 1.00 17.43  ? 99  LEU C C   1 
ATOM   6181  O O   . LEU C  1  99  ? 114.819 145.595 129.811 1.00 17.43  ? 99  LEU C O   1 
ATOM   6182  C CB  . LEU C  1  99  ? 112.694 145.332 127.502 1.00 17.43  ? 99  LEU C CB  1 
ATOM   6183  C CG  . LEU C  1  99  ? 111.924 145.158 128.810 1.00 17.43  ? 99  LEU C CG  1 
ATOM   6184  C CD1 . LEU C  1  99  ? 111.432 146.494 129.323 1.00 17.43  ? 99  LEU C CD1 1 
ATOM   6185  C CD2 . LEU C  1  99  ? 110.776 144.188 128.649 1.00 17.43  ? 99  LEU C CD2 1 
ATOM   6186  N N   . ASN C  1  100 ? 115.885 144.632 128.088 1.00 17.31  ? 100 ASN C N   1 
ATOM   6187  C CA  . ASN C  1  100 ? 116.861 143.950 128.940 1.00 17.31  ? 100 ASN C CA  1 
ATOM   6188  C C   . ASN C  1  100 ? 118.282 144.270 128.478 1.00 17.31  ? 100 ASN C C   1 
ATOM   6189  O O   . ASN C  1  100 ? 118.887 143.532 127.698 1.00 17.31  ? 100 ASN C O   1 
ATOM   6190  C CB  . ASN C  1  100 ? 116.593 142.444 128.982 1.00 17.31  ? 100 ASN C CB  1 
ATOM   6191  C CG  . ASN C  1  100 ? 116.556 141.809 127.611 1.00 17.31  ? 100 ASN C CG  1 
ATOM   6192  O OD1 . ASN C  1  100 ? 116.775 142.466 126.598 1.00 17.31  ? 100 ASN C OD1 1 
ATOM   6193  N ND2 . ASN C  1  100 ? 116.285 140.513 127.574 1.00 17.31  ? 100 ASN C ND2 1 
ATOM   6194  N N   . ASP C  1  101 ? 118.827 145.374 128.981 1.00 21.60  ? 101 ASP C N   1 
ATOM   6195  C CA  . ASP C  1  101 ? 120.228 145.704 128.782 1.00 21.60  ? 101 ASP C CA  1 
ATOM   6196  C C   . ASP C  1  101 ? 120.782 146.319 130.056 1.00 21.60  ? 101 ASP C C   1 
ATOM   6197  O O   . ASP C  1  101 ? 120.042 146.878 130.866 1.00 21.60  ? 101 ASP C O   1 
ATOM   6198  C CB  . ASP C  1  101 ? 120.447 146.652 127.593 1.00 21.60  ? 101 ASP C CB  1 
ATOM   6199  C CG  . ASP C  1  101 ? 119.730 147.975 127.752 1.00 21.60  ? 101 ASP C CG  1 
ATOM   6200  O OD1 . ASP C  1  101 ? 118.950 148.137 128.709 1.00 21.60  ? 101 ASP C OD1 1 
ATOM   6201  O OD2 . ASP C  1  101 ? 119.956 148.871 126.914 1.00 21.60  ? 101 ASP C OD2 1 
ATOM   6202  N N   . LYS C  1  102 ? 122.086 146.176 130.244 1.00 18.90  ? 102 LYS C N   1 
ATOM   6203  C CA  . LYS C  1  102 ? 122.775 146.705 131.411 1.00 18.90  ? 102 LYS C CA  1 
ATOM   6204  C C   . LYS C  1  102 ? 123.735 147.829 131.069 1.00 18.90  ? 102 LYS C C   1 
ATOM   6205  O O   . LYS C  1  102 ? 123.750 148.853 131.753 1.00 18.90  ? 102 LYS C O   1 
ATOM   6206  C CB  . LYS C  1  102 ? 123.522 145.573 132.117 1.00 18.90  ? 102 LYS C CB  1 
ATOM   6207  C CG  . LYS C  1  102 ? 122.586 144.557 132.745 1.00 18.90  ? 102 LYS C CG  1 
ATOM   6208  C CD  . LYS C  1  102 ? 123.305 143.292 133.170 1.00 18.90  ? 102 LYS C CD  1 
ATOM   6209  C CE  . LYS C  1  102 ? 124.211 143.530 134.353 1.00 18.90  ? 102 LYS C CE  1 
ATOM   6210  N NZ  . LYS C  1  102 ? 124.792 142.254 134.842 1.00 18.90  ? 102 LYS C NZ  1 
ATOM   6211  N N   . LYS C  1  103 ? 124.531 147.664 130.018 1.00 26.87  ? 103 LYS C N   1 
ATOM   6212  C CA  . LYS C  1  103 ? 125.391 148.715 129.500 1.00 26.87  ? 103 LYS C CA  1 
ATOM   6213  C C   . LYS C  1  103 ? 125.420 148.598 127.987 1.00 26.87  ? 103 LYS C C   1 
ATOM   6214  O O   . LYS C  1  103 ? 125.577 147.498 127.452 1.00 26.87  ? 103 LYS C O   1 
ATOM   6215  C CB  . LYS C  1  103 ? 126.818 148.611 130.055 1.00 26.87  ? 103 LYS C CB  1 
ATOM   6216  C CG  . LYS C  1  103 ? 126.943 148.912 131.536 1.00 26.87  ? 103 LYS C CG  1 
ATOM   6217  C CD  . LYS C  1  103 ? 128.357 148.670 132.039 1.00 26.87  ? 103 LYS C CD  1 
ATOM   6218  C CE  . LYS C  1  103 ? 129.190 149.942 131.990 1.00 26.87  ? 103 LYS C CE  1 
ATOM   6219  N NZ  . LYS C  1  103 ? 129.499 150.374 130.599 1.00 26.87  ? 103 LYS C NZ  1 
ATOM   6220  N N   . SER C  1  104 ? 125.270 149.725 127.299 1.00 20.39  ? 104 SER C N   1 
ATOM   6221  C CA  . SER C  1  104 ? 125.279 149.712 125.845 1.00 20.39  ? 104 SER C CA  1 
ATOM   6222  C C   . SER C  1  104 ? 125.649 151.096 125.345 1.00 20.39  ? 104 SER C C   1 
ATOM   6223  O O   . SER C  1  104 ? 125.190 152.097 125.895 1.00 20.39  ? 104 SER C O   1 
ATOM   6224  C CB  . SER C  1  104 ? 123.922 149.288 125.283 1.00 20.39  ? 104 SER C CB  1 
ATOM   6225  O OG  . SER C  1  104 ? 122.923 150.242 125.591 1.00 20.39  ? 104 SER C OG  1 
ATOM   6226  N N   . PHE C  1  105 ? 126.476 151.147 124.304 1.00 26.39  ? 105 PHE C N   1 
ATOM   6227  C CA  . PHE C  1  105 ? 127.002 152.417 123.829 1.00 26.39  ? 105 PHE C CA  1 
ATOM   6228  C C   . PHE C  1  105 ? 127.242 152.361 122.331 1.00 26.39  ? 105 PHE C C   1 
ATOM   6229  O O   . PHE C  1  105 ? 127.732 151.358 121.811 1.00 26.39  ? 105 PHE C O   1 
ATOM   6230  C CB  . PHE C  1  105 ? 128.301 152.778 124.549 1.00 26.39  ? 105 PHE C CB  1 
ATOM   6231  C CG  . PHE C  1  105 ? 129.410 151.800 124.317 1.00 26.39  ? 105 PHE C CG  1 
ATOM   6232  C CD1 . PHE C  1  105 ? 129.514 150.669 125.099 1.00 26.39  ? 105 PHE C CD1 1 
ATOM   6233  C CD2 . PHE C  1  105 ? 130.363 152.020 123.343 1.00 26.39  ? 105 PHE C CD2 1 
ATOM   6234  C CE1 . PHE C  1  105 ? 130.530 149.765 124.902 1.00 26.39  ? 105 PHE C CE1 1 
ATOM   6235  C CE2 . PHE C  1  105 ? 131.384 151.118 123.144 1.00 26.39  ? 105 PHE C CE2 1 
ATOM   6236  C CZ  . PHE C  1  105 ? 131.467 149.990 123.926 1.00 26.39  ? 105 PHE C CZ  1 
ATOM   6237  N N   . VAL C  1  106 ? 126.903 153.447 121.650 1.00 43.48  ? 106 VAL C N   1 
ATOM   6238  C CA  . VAL C  1  106 ? 127.172 153.587 120.225 1.00 43.48  ? 106 VAL C CA  1 
ATOM   6239  C C   . VAL C  1  106 ? 128.646 153.911 120.042 1.00 43.48  ? 106 VAL C C   1 
ATOM   6240  O O   . VAL C  1  106 ? 129.154 154.868 120.634 1.00 43.48  ? 106 VAL C O   1 
ATOM   6241  C CB  . VAL C  1  106 ? 126.286 154.683 119.622 1.00 43.48  ? 106 VAL C CB  1 
ATOM   6242  C CG1 . VAL C  1  106 ? 126.610 154.881 118.168 1.00 43.48  ? 106 VAL C CG1 1 
ATOM   6243  C CG2 . VAL C  1  106 ? 124.832 154.336 119.809 1.00 43.48  ? 106 VAL C CG2 1 
ATOM   6244  N N   . HIS C  1  107 ? 129.339 153.117 119.227 1.00 28.76  ? 107 HIS C N   1 
ATOM   6245  C CA  . HIS C  1  107 ? 130.783 153.274 119.098 1.00 28.76  ? 107 HIS C CA  1 
ATOM   6246  C C   . HIS C  1  107 ? 131.134 154.664 118.584 1.00 28.76  ? 107 HIS C C   1 
ATOM   6247  O O   . HIS C  1  107 ? 130.359 155.302 117.870 1.00 28.76  ? 107 HIS C O   1 
ATOM   6248  C CB  . HIS C  1  107 ? 131.364 152.216 118.166 1.00 28.76  ? 107 HIS C CB  1 
ATOM   6249  C CG  . HIS C  1  107 ? 131.216 150.819 118.671 1.00 28.76  ? 107 HIS C CG  1 
ATOM   6250  N ND1 . HIS C  1  107 ? 131.960 150.323 119.718 1.00 28.76  ? 107 HIS C ND1 1 
ATOM   6251  C CD2 . HIS C  1  107 ? 130.418 149.805 118.264 1.00 28.76  ? 107 HIS C CD2 1 
ATOM   6252  C CE1 . HIS C  1  107 ? 131.621 149.067 119.939 1.00 28.76  ? 107 HIS C CE1 1 
ATOM   6253  N NE2 . HIS C  1  107 ? 130.688 148.727 119.069 1.00 28.76  ? 107 HIS C NE2 1 
ATOM   6254  N N   . GLY C  1  108 ? 132.315 155.136 118.965 1.00 15.36  ? 108 GLY C N   1 
ATOM   6255  C CA  . GLY C  1  108 ? 132.749 156.472 118.614 1.00 15.36  ? 108 GLY C CA  1 
ATOM   6256  C C   . GLY C  1  108 ? 134.154 156.529 118.054 1.00 15.36  ? 108 GLY C C   1 
ATOM   6257  O O   . GLY C  1  108 ? 134.916 157.434 118.404 1.00 15.36  ? 108 GLY C O   1 
ATOM   6258  N N   . VAL C  1  109 ? 134.508 155.568 117.194 1.00 23.70  ? 109 VAL C N   1 
ATOM   6259  C CA  . VAL C  1  109 ? 135.903 155.369 116.797 1.00 23.70  ? 109 VAL C CA  1 
ATOM   6260  C C   . VAL C  1  109 ? 136.507 156.662 116.269 1.00 23.70  ? 109 VAL C C   1 
ATOM   6261  O O   . VAL C  1  109 ? 137.472 157.192 116.828 1.00 23.70  ? 109 VAL C O   1 
ATOM   6262  C CB  . VAL C  1  109 ? 136.015 154.247 115.755 1.00 23.70  ? 109 VAL C CB  1 
ATOM   6263  C CG1 . VAL C  1  109 ? 137.455 154.107 115.313 1.00 23.70  ? 109 VAL C CG1 1 
ATOM   6264  C CG2 . VAL C  1  109 ? 135.494 152.939 116.325 1.00 23.70  ? 109 VAL C CG2 1 
ATOM   6265  N N   . THR C  1  110 ? 135.954 157.185 115.184 1.00 20.46  ? 110 THR C N   1 
ATOM   6266  C CA  . THR C  1  110 ? 136.376 158.487 114.681 1.00 20.46  ? 110 THR C CA  1 
ATOM   6267  C C   . THR C  1  110 ? 135.265 159.520 114.717 1.00 20.46  ? 110 THR C C   1 
ATOM   6268  O O   . THR C  1  110 ? 135.516 160.677 115.057 1.00 20.46  ? 110 THR C O   1 
ATOM   6269  C CB  . THR C  1  110 ? 136.917 158.366 113.257 1.00 20.46  ? 110 THR C CB  1 
ATOM   6270  O OG1 . THR C  1  110 ? 135.900 157.835 112.403 1.00 20.46  ? 110 THR C OG1 1 
ATOM   6271  C CG2 . THR C  1  110 ? 138.118 157.453 113.234 1.00 20.46  ? 110 THR C CG2 1 
ATOM   6272  N N   . VAL C  1  111 ? 134.045 159.134 114.369 1.00 23.04  ? 111 VAL C N   1 
ATOM   6273  C CA  . VAL C  1  111 ? 132.843 159.893 114.664 1.00 23.04  ? 111 VAL C CA  1 
ATOM   6274  C C   . VAL C  1  111 ? 131.788 158.901 115.133 1.00 23.04  ? 111 VAL C C   1 
ATOM   6275  O O   . VAL C  1  111 ? 132.019 157.692 115.152 1.00 23.04  ? 111 VAL C O   1 
ATOM   6276  C CB  . VAL C  1  111 ? 132.332 160.688 113.449 1.00 23.04  ? 111 VAL C CB  1 
ATOM   6277  C CG1 . VAL C  1  111 ? 133.383 161.673 112.965 1.00 23.04  ? 111 VAL C CG1 1 
ATOM   6278  C CG2 . VAL C  1  111 ? 131.932 159.736 112.362 1.00 23.04  ? 111 VAL C CG2 1 
ATOM   6279  N N   . LYS C  1  112 ? 130.624 159.412 115.519 1.00 22.56  ? 112 LYS C N   1 
ATOM   6280  C CA  . LYS C  1  112 ? 129.551 158.506 115.897 1.00 22.56  ? 112 LYS C CA  1 
ATOM   6281  C C   . LYS C  1  112 ? 129.131 157.685 114.686 1.00 22.56  ? 112 LYS C C   1 
ATOM   6282  O O   . LYS C  1  112 ? 129.103 158.179 113.558 1.00 22.56  ? 112 LYS C O   1 
ATOM   6283  C CB  . LYS C  1  112 ? 128.367 159.274 116.477 1.00 22.56  ? 112 LYS C CB  1 
ATOM   6284  C CG  . LYS C  1  112 ? 128.681 159.912 117.812 1.00 22.56  ? 112 LYS C CG  1 
ATOM   6285  C CD  . LYS C  1  112 ? 127.474 160.600 118.411 1.00 22.56  ? 112 LYS C CD  1 
ATOM   6286  C CE  . LYS C  1  112 ? 126.503 159.581 118.977 1.00 22.56  ? 112 LYS C CE  1 
ATOM   6287  N NZ  . LYS C  1  112 ? 127.076 158.894 120.166 1.00 22.56  ? 112 LYS C NZ  1 
ATOM   6288  N N   . ASN C  1  113 ? 128.836 156.413 114.924 1.00 28.79  ? 113 ASN C N   1 
ATOM   6289  C CA  . ASN C  1  113 ? 128.593 155.465 113.843 1.00 28.79  ? 113 ASN C CA  1 
ATOM   6290  C C   . ASN C  1  113 ? 127.094 155.368 113.569 1.00 28.79  ? 113 ASN C C   1 
ATOM   6291  O O   . ASN C  1  113 ? 126.409 154.434 113.983 1.00 28.79  ? 113 ASN C O   1 
ATOM   6292  C CB  . ASN C  1  113 ? 129.186 154.111 114.196 1.00 28.79  ? 113 ASN C CB  1 
ATOM   6293  C CG  . ASN C  1  113 ? 130.668 154.178 114.410 1.00 28.79  ? 113 ASN C CG  1 
ATOM   6294  O OD1 . ASN C  1  113 ? 131.160 153.938 115.506 1.00 28.79  ? 113 ASN C OD1 1 
ATOM   6295  N ND2 . ASN C  1  113 ? 131.395 154.524 113.364 1.00 28.79  ? 113 ASN C ND2 1 
ATOM   6296  N N   . ARG C  1  114 ? 126.580 156.376 112.870 1.00 43.48  ? 114 ARG C N   1 
ATOM   6297  C CA  . ARG C  1  114 ? 125.207 156.332 112.397 1.00 43.48  ? 114 ARG C CA  1 
ATOM   6298  C C   . ARG C  1  114 ? 125.113 157.013 111.044 1.00 43.48  ? 114 ARG C C   1 
ATOM   6299  O O   . ARG C  1  114 ? 125.907 157.896 110.719 1.00 43.48  ? 114 ARG C O   1 
ATOM   6300  C CB  . ARG C  1  114 ? 124.226 156.985 113.373 1.00 43.48  ? 114 ARG C CB  1 
ATOM   6301  C CG  . ARG C  1  114 ? 124.354 158.475 113.527 1.00 43.48  ? 114 ARG C CG  1 
ATOM   6302  C CD  . ARG C  1  114 ? 123.321 158.968 114.519 1.00 43.48  ? 114 ARG C CD  1 
ATOM   6303  N NE  . ARG C  1  114 ? 123.348 160.415 114.668 1.00 43.48  ? 114 ARG C NE  1 
ATOM   6304  C CZ  . ARG C  1  114 ? 124.102 161.054 115.551 1.00 43.48  ? 114 ARG C CZ  1 
ATOM   6305  N NH1 . ARG C  1  114 ? 124.883 160.370 116.367 1.00 43.48  ? 114 ARG C NH1 1 
ATOM   6306  N NH2 . ARG C  1  114 ? 124.069 162.374 115.624 1.00 43.48  ? 114 ARG C NH2 1 
ATOM   6307  N N   . MET C  1  115 ? 124.130 156.588 110.258 1.00 28.10  ? 115 MET C N   1 
ATOM   6308  C CA  . MET C  1  115 ? 123.935 157.087 108.910 1.00 28.10  ? 115 MET C CA  1 
ATOM   6309  C C   . MET C  1  115 ? 122.553 157.704 108.769 1.00 28.10  ? 115 MET C C   1 
ATOM   6310  O O   . MET C  1  115 ? 121.647 157.443 109.561 1.00 28.10  ? 115 MET C O   1 
ATOM   6311  C CB  . MET C  1  115 ? 124.077 155.973 107.875 1.00 28.10  ? 115 MET C CB  1 
ATOM   6312  C CG  . MET C  1  115 ? 122.935 154.983 107.903 1.00 28.10  ? 115 MET C CG  1 
ATOM   6313  S SD  . MET C  1  115 ? 123.089 153.664 106.687 1.00 28.10  ? 115 MET C SD  1 
ATOM   6314  C CE  . MET C  1  115 ? 124.320 152.626 107.460 1.00 28.10  ? 115 MET C CE  1 
ATOM   6315  N N   . ILE C  1  116 ? 122.402 158.524 107.737 1.00 21.38  ? 116 ILE C N   1 
ATOM   6316  C CA  . ILE C  1  116 ? 121.112 159.049 107.310 1.00 21.38  ? 116 ILE C CA  1 
ATOM   6317  C C   . ILE C  1  116 ? 121.062 158.964 105.795 1.00 21.38  ? 116 ILE C C   1 
ATOM   6318  O O   . ILE C  1  116 ? 122.000 159.394 105.118 1.00 21.38  ? 116 ILE C O   1 
ATOM   6319  C CB  . ILE C  1  116 ? 120.887 160.497 107.774 1.00 21.38  ? 116 ILE C CB  1 
ATOM   6320  C CG1 . ILE C  1  116 ? 120.792 160.562 109.289 1.00 21.38  ? 116 ILE C CG1 1 
ATOM   6321  C CG2 . ILE C  1  116 ? 119.620 161.043 107.168 1.00 21.38  ? 116 ILE C CG2 1 
ATOM   6322  C CD1 . ILE C  1  116 ? 119.587 159.859 109.818 1.00 21.38  ? 116 ILE C CD1 1 
ATOM   6323  N N   . ARG C  1  117 ? 119.979 158.410 105.261 1.00 22.88  ? 117 ARG C N   1 
ATOM   6324  C CA  . ARG C  1  117 ? 119.862 158.178 103.825 1.00 22.88  ? 117 ARG C CA  1 
ATOM   6325  C C   . ARG C  1  117 ? 118.425 158.474 103.420 1.00 22.88  ? 117 ARG C C   1 
ATOM   6326  O O   . ARG C  1  117 ? 117.548 157.624 103.579 1.00 22.88  ? 117 ARG C O   1 
ATOM   6327  C CB  . ARG C  1  117 ? 120.247 156.748 103.478 1.00 22.88  ? 117 ARG C CB  1 
ATOM   6328  C CG  . ARG C  1  117 ? 120.309 156.458 101.996 1.00 22.88  ? 117 ARG C CG  1 
ATOM   6329  C CD  . ARG C  1  117 ? 120.667 155.007 101.759 1.00 22.88  ? 117 ARG C CD  1 
ATOM   6330  N NE  . ARG C  1  117 ? 121.972 154.687 102.320 1.00 22.88  ? 117 ARG C NE  1 
ATOM   6331  C CZ  . ARG C  1  117 ? 123.119 154.885 101.688 1.00 22.88  ? 117 ARG C CZ  1 
ATOM   6332  N NH1 . ARG C  1  117 ? 123.121 155.396 100.467 1.00 22.88  ? 117 ARG C NH1 1 
ATOM   6333  N NH2 . ARG C  1  117 ? 124.261 154.566 102.274 1.00 22.88  ? 117 ARG C NH2 1 
ATOM   6334  N N   . LEU C  1  118 ? 118.188 159.665 102.888 1.00 24.29  ? 118 LEU C N   1 
ATOM   6335  C CA  . LEU C  1  118 ? 116.849 160.038 102.459 1.00 24.29  ? 118 LEU C CA  1 
ATOM   6336  C C   . LEU C  1  118 ? 116.530 159.316 101.151 1.00 24.29  ? 118 LEU C C   1 
ATOM   6337  O O   . LEU C  1  118 ? 117.281 158.462 100.676 1.00 24.29  ? 118 LEU C O   1 
ATOM   6338  C CB  . LEU C  1  118 ? 116.736 161.551 102.325 1.00 24.29  ? 118 LEU C CB  1 
ATOM   6339  C CG  . LEU C  1  118 ? 116.913 162.349 103.615 1.00 24.29  ? 118 LEU C CG  1 
ATOM   6340  C CD1 . LEU C  1  118 ? 116.872 163.835 103.335 1.00 24.29  ? 118 LEU C CD1 1 
ATOM   6341  C CD2 . LEU C  1  118 ? 115.855 161.972 104.614 1.00 24.29  ? 118 LEU C CD2 1 
ATOM   6342  N N   . HIS C  1  119 ? 115.393 159.652 100.560 1.00 34.72  ? 119 HIS C N   1 
ATOM   6343  C CA  . HIS C  1  119 ? 114.950 159.059 99.307  1.00 34.72  ? 119 HIS C CA  1 
ATOM   6344  C C   . HIS C  1  119 ? 114.025 160.051 98.626  1.00 34.72  ? 119 HIS C C   1 
ATOM   6345  O O   . HIS C  1  119 ? 113.638 161.062 99.222  1.00 34.72  ? 119 HIS C O   1 
ATOM   6346  C CB  . HIS C  1  119 ? 114.249 157.714 99.541  1.00 34.72  ? 119 HIS C CB  1 
ATOM   6347  C CG  . HIS C  1  119 ? 115.185 156.584 99.831  1.00 34.72  ? 119 HIS C CG  1 
ATOM   6348  N ND1 . HIS C  1  119 ? 115.605 156.270 101.105 1.00 34.72  ? 119 HIS C ND1 1 
ATOM   6349  C CD2 . HIS C  1  119 ? 115.778 155.688 99.009  1.00 34.72  ? 119 HIS C CD2 1 
ATOM   6350  C CE1 . HIS C  1  119 ? 116.419 155.231 101.054 1.00 34.72  ? 119 HIS C CE1 1 
ATOM   6351  N NE2 . HIS C  1  119 ? 116.541 154.859 99.794  1.00 34.72  ? 119 HIS C NE2 1 
ATOM   6352  N N   . PRO C  1  120 ? 113.667 159.809 97.360  1.00 39.13  ? 120 PRO C N   1 
ATOM   6353  C CA  . PRO C  1  120 ? 112.751 160.746 96.695  1.00 39.13  ? 120 PRO C CA  1 
ATOM   6354  C C   . PRO C  1  120 ? 111.349 160.750 97.279  1.00 39.13  ? 120 PRO C C   1 
ATOM   6355  O O   . PRO C  1  120 ? 110.713 161.810 97.304  1.00 39.13  ? 120 PRO C O   1 
ATOM   6356  C CB  . PRO C  1  120 ? 112.758 160.271 95.236  1.00 39.13  ? 120 PRO C CB  1 
ATOM   6357  C CG  . PRO C  1  120 ? 113.183 158.854 95.299  1.00 39.13  ? 120 PRO C CG  1 
ATOM   6358  C CD  . PRO C  1  120 ? 114.157 158.779 96.429  1.00 39.13  ? 120 PRO C CD  1 
ATOM   6359  N N   . ASP C  1  121 ? 110.841 159.611 97.748  1.00 40.41  ? 121 ASP C N   1 
ATOM   6360  C CA  . ASP C  1  121 ? 109.487 159.538 98.280  1.00 40.41  ? 121 ASP C CA  1 
ATOM   6361  C C   . ASP C  1  121 ? 109.430 159.708 99.795  1.00 40.41  ? 121 ASP C C   1 
ATOM   6362  O O   . ASP C  1  121 ? 108.424 159.344 100.412 1.00 40.41  ? 121 ASP C O   1 
ATOM   6363  C CB  . ASP C  1  121 ? 108.825 158.220 97.871  1.00 40.41  ? 121 ASP C CB  1 
ATOM   6364  C CG  . ASP C  1  121 ? 109.556 157.005 98.404  1.00 40.41  ? 121 ASP C CG  1 
ATOM   6365  O OD1 . ASP C  1  121 ? 110.621 157.167 99.031  1.00 40.41  ? 121 ASP C OD1 1 
ATOM   6366  O OD2 . ASP C  1  121 ? 109.060 155.879 98.194  1.00 40.41  ? 121 ASP C OD2 1 
ATOM   6367  N N   . GLY C  1  122 ? 110.485 160.241 100.407 1.00 31.68  ? 122 GLY C N   1 
ATOM   6368  C CA  . GLY C  1  122 ? 110.474 160.523 101.827 1.00 31.68  ? 122 GLY C CA  1 
ATOM   6369  C C   . GLY C  1  122 ? 110.830 159.367 102.733 1.00 31.68  ? 122 GLY C C   1 
ATOM   6370  O O   . GLY C  1  122 ? 110.598 159.459 103.942 1.00 31.68  ? 122 GLY C O   1 
ATOM   6371  N N   . THR C  1  123 ? 111.387 158.286 102.199 1.00 26.01  ? 123 THR C N   1 
ATOM   6372  C CA  . THR C  1  123 ? 111.702 157.098 102.990 1.00 26.01  ? 123 THR C CA  1 
ATOM   6373  C C   . THR C  1  123 ? 113.085 157.264 103.608 1.00 26.01  ? 123 THR C C   1 
ATOM   6374  O O   . THR C  1  123 ? 114.101 157.091 102.935 1.00 26.01  ? 123 THR C O   1 
ATOM   6375  C CB  . THR C  1  123 ? 111.630 155.847 102.122 1.00 26.01  ? 123 THR C CB  1 
ATOM   6376  O OG1 . THR C  1  123 ? 110.303 155.699 101.605 1.00 26.01  ? 123 THR C OG1 1 
ATOM   6377  C CG2 . THR C  1  123 ? 111.991 154.617 102.928 1.00 26.01  ? 123 THR C CG2 1 
ATOM   6378  N N   . VAL C  1  124 ? 113.125 157.593 104.892 1.00 30.12  ? 124 VAL C N   1 
ATOM   6379  C CA  . VAL C  1  124 ? 114.382 157.730 105.618 1.00 30.12  ? 124 VAL C CA  1 
ATOM   6380  C C   . VAL C  1  124 ? 114.910 156.345 105.962 1.00 30.12  ? 124 VAL C C   1 
ATOM   6381  O O   . VAL C  1  124 ? 114.148 155.381 106.063 1.00 30.12  ? 124 VAL C O   1 
ATOM   6382  C CB  . VAL C  1  124 ? 114.169 158.587 106.880 1.00 30.12  ? 124 VAL C CB  1 
ATOM   6383  C CG1 . VAL C  1  124 ? 115.457 158.760 107.655 1.00 30.12  ? 124 VAL C CG1 1 
ATOM   6384  C CG2 . VAL C  1  124 ? 113.583 159.928 106.508 1.00 30.12  ? 124 VAL C CG2 1 
ATOM   6385  N N   . LEU C  1  125 ? 116.227 156.230 106.122 1.00 43.48  ? 125 LEU C N   1 
ATOM   6386  C CA  . LEU C  1  125 ? 116.844 154.993 106.595 1.00 43.48  ? 125 LEU C CA  1 
ATOM   6387  C C   . LEU C  1  125 ? 117.904 155.362 107.621 1.00 43.48  ? 125 LEU C C   1 
ATOM   6388  O O   . LEU C  1  125 ? 118.924 155.959 107.272 1.00 43.48  ? 125 LEU C O   1 
ATOM   6389  C CB  . LEU C  1  125 ? 117.444 154.197 105.439 1.00 43.48  ? 125 LEU C CB  1 
ATOM   6390  C CG  . LEU C  1  125 ? 117.945 152.788 105.741 1.00 43.48  ? 125 LEU C CG  1 
ATOM   6391  C CD1 . LEU C  1  125 ? 117.757 151.909 104.529 1.00 43.48  ? 125 LEU C CD1 1 
ATOM   6392  C CD2 . LEU C  1  125 ? 119.405 152.813 106.118 1.00 43.48  ? 125 LEU C CD2 1 
ATOM   6393  N N   . TYR C  1  126 ? 117.675 154.986 108.874 1.00 43.48  ? 126 TYR C N   1 
ATOM   6394  C CA  . TYR C  1  126 ? 118.496 155.393 110.011 1.00 43.48  ? 126 TYR C CA  1 
ATOM   6395  C C   . TYR C  1  126 ? 119.149 154.156 110.603 1.00 43.48  ? 126 TYR C C   1 
ATOM   6396  O O   . TYR C  1  126 ? 118.458 153.290 111.145 1.00 43.48  ? 126 TYR C O   1 
ATOM   6397  C CB  . TYR C  1  126 ? 117.631 156.099 111.049 1.00 43.48  ? 126 TYR C CB  1 
ATOM   6398  C CG  . TYR C  1  126 ? 118.335 156.515 112.315 1.00 43.48  ? 126 TYR C CG  1 
ATOM   6399  C CD1 . TYR C  1  126 ? 119.083 157.673 112.368 1.00 43.48  ? 126 TYR C CD1 1 
ATOM   6400  C CD2 . TYR C  1  126 ? 118.232 155.753 113.464 1.00 43.48  ? 126 TYR C CD2 1 
ATOM   6401  C CE1 . TYR C  1  126 ? 119.714 158.059 113.526 1.00 43.48  ? 126 TYR C CE1 1 
ATOM   6402  C CE2 . TYR C  1  126 ? 118.857 156.128 114.624 1.00 43.48  ? 126 TYR C CE2 1 
ATOM   6403  C CZ  . TYR C  1  126 ? 119.599 157.281 114.649 1.00 43.48  ? 126 TYR C CZ  1 
ATOM   6404  O OH  . TYR C  1  126 ? 120.227 157.656 115.810 1.00 43.48  ? 126 TYR C OH  1 
ATOM   6405  N N   . GLY C  1  127 ? 120.471 154.074 110.521 1.00 30.89  ? 127 GLY C N   1 
ATOM   6406  C CA  . GLY C  1  127 ? 121.150 152.908 111.048 1.00 30.89  ? 127 GLY C CA  1 
ATOM   6407  C C   . GLY C  1  127 ? 122.287 153.217 111.997 1.00 30.89  ? 127 GLY C C   1 
ATOM   6408  O O   . GLY C  1  127 ? 123.225 153.925 111.630 1.00 30.89  ? 127 GLY C O   1 
ATOM   6409  N N   . LEU C  1  128 ? 122.227 152.681 113.209 1.00 43.48  ? 128 LEU C N   1 
ATOM   6410  C CA  . LEU C  1  128 ? 123.240 152.905 114.223 1.00 43.48  ? 128 LEU C CA  1 
ATOM   6411  C C   . LEU C  1  128 ? 124.308 151.822 114.141 1.00 43.48  ? 128 LEU C C   1 
ATOM   6412  O O   . LEU C  1  128 ? 124.362 151.040 113.192 1.00 43.48  ? 128 LEU C O   1 
ATOM   6413  C CB  . LEU C  1  128 ? 122.600 152.933 115.607 1.00 43.48  ? 128 LEU C CB  1 
ATOM   6414  C CG  . LEU C  1  128 ? 121.719 154.125 115.949 1.00 43.48  ? 128 LEU C CG  1 
ATOM   6415  C CD1 . LEU C  1  128 ? 120.986 153.863 117.239 1.00 43.48  ? 128 LEU C CD1 1 
ATOM   6416  C CD2 . LEU C  1  128 ? 122.573 155.357 116.091 1.00 43.48  ? 128 LEU C CD2 1 
ATOM   6417  N N   . ARG C  1  129 ? 125.185 151.785 115.143 1.00 43.48  ? 129 ARG C N   1 
ATOM   6418  C CA  . ARG C  1  129 ? 126.108 150.667 115.325 1.00 43.48  ? 129 ARG C CA  1 
ATOM   6419  C C   . ARG C  1  129 ? 126.362 150.548 116.822 1.00 43.48  ? 129 ARG C C   1 
ATOM   6420  O O   . ARG C  1  129 ? 127.250 151.213 117.359 1.00 43.48  ? 129 ARG C O   1 
ATOM   6421  C CB  . ARG C  1  129 ? 127.400 150.866 114.552 1.00 43.48  ? 129 ARG C CB  1 
ATOM   6422  C CG  . ARG C  1  129 ? 128.375 149.721 114.719 1.00 43.48  ? 129 ARG C CG  1 
ATOM   6423  C CD  . ARG C  1  129 ? 129.576 149.878 113.818 1.00 43.48  ? 129 ARG C CD  1 
ATOM   6424  N NE  . ARG C  1  129 ? 130.514 148.776 113.977 1.00 43.48  ? 129 ARG C NE  1 
ATOM   6425  C CZ  . ARG C  1  129 ? 131.553 148.800 114.798 1.00 43.48  ? 129 ARG C CZ  1 
ATOM   6426  N NH1 . ARG C  1  129 ? 131.797 149.877 115.527 1.00 43.48  ? 129 ARG C NH1 1 
ATOM   6427  N NH2 . ARG C  1  129 ? 132.355 147.752 114.882 1.00 43.48  ? 129 ARG C NH2 1 
ATOM   6428  N N   . ILE C  1  130 ? 125.596 149.686 117.478 1.00 28.59  ? 130 ILE C N   1 
ATOM   6429  C CA  . ILE C  1  130 ? 125.516 149.665 118.931 1.00 28.59  ? 130 ILE C CA  1 
ATOM   6430  C C   . ILE C  1  130 ? 126.182 148.414 119.478 1.00 28.59  ? 130 ILE C C   1 
ATOM   6431  O O   . ILE C  1  130 ? 126.652 147.568 118.715 1.00 28.59  ? 130 ILE C O   1 
ATOM   6432  C CB  . ILE C  1  130 ? 124.050 149.757 119.369 1.00 28.59  ? 130 ILE C CB  1 
ATOM   6433  C CG1 . ILE C  1  130 ? 123.259 148.644 118.709 1.00 28.59  ? 130 ILE C CG1 1 
ATOM   6434  C CG2 . ILE C  1  130 ? 123.458 151.082 118.972 1.00 28.59  ? 130 ILE C CG2 1 
ATOM   6435  C CD1 . ILE C  1  130 ? 121.824 148.659 119.072 1.00 28.59  ? 130 ILE C CD1 1 
ATOM   6436  N N   . THR C  1  131 ? 126.237 148.293 120.802 1.00 15.33  ? 131 THR C N   1 
ATOM   6437  C CA  . THR C  1  131 ? 126.901 147.159 121.442 1.00 15.33  ? 131 THR C CA  1 
ATOM   6438  C C   . THR C  1  131 ? 126.226 146.939 122.791 1.00 15.33  ? 131 THR C C   1 
ATOM   6439  O O   . THR C  1  131 ? 126.537 147.634 123.759 1.00 15.33  ? 131 THR C O   1 
ATOM   6440  C CB  . THR C  1  131 ? 128.389 147.416 121.603 1.00 15.33  ? 131 THR C CB  1 
ATOM   6441  O OG1 . THR C  1  131 ? 128.983 147.581 120.312 1.00 15.33  ? 131 THR C OG1 1 
ATOM   6442  C CG2 . THR C  1  131 ? 129.051 146.258 122.313 1.00 15.33  ? 131 THR C CG2 1 
ATOM   6443  N N   . THR C  1  132 ? 125.324 145.970 122.849 1.00 20.60  ? 132 THR C N   1 
ATOM   6444  C CA  . THR C  1  132 ? 124.473 145.764 124.011 1.00 20.60  ? 132 THR C CA  1 
ATOM   6445  C C   . THR C  1  132 ? 124.992 144.609 124.853 1.00 20.60  ? 132 THR C C   1 
ATOM   6446  O O   . THR C  1  132 ? 125.298 143.538 124.325 1.00 20.60  ? 132 THR C O   1 
ATOM   6447  C CB  . THR C  1  132 ? 123.035 145.490 123.575 1.00 20.60  ? 132 THR C CB  1 
ATOM   6448  O OG1 . THR C  1  132 ? 122.531 146.627 122.870 1.00 20.60  ? 132 THR C OG1 1 
ATOM   6449  C CG2 . THR C  1  132 ? 122.158 145.221 124.773 1.00 20.60  ? 132 THR C CG2 1 
ATOM   6450  N N   . THR C  1  133 ? 125.106 144.838 126.157 1.00 19.22  ? 133 THR C N   1 
ATOM   6451  C CA  . THR C  1  133 ? 125.408 143.775 127.107 1.00 19.22  ? 133 THR C CA  1 
ATOM   6452  C C   . THR C  1  133 ? 124.105 143.307 127.753 1.00 19.22  ? 133 THR C C   1 
ATOM   6453  O O   . THR C  1  133 ? 123.810 143.570 128.916 1.00 19.22  ? 133 THR C O   1 
ATOM   6454  C CB  . THR C  1  133 ? 126.420 144.261 128.138 1.00 19.22  ? 133 THR C CB  1 
ATOM   6455  O OG1 . THR C  1  133 ? 127.594 144.718 127.459 1.00 19.22  ? 133 THR C OG1 1 
ATOM   6456  C CG2 . THR C  1  133 ? 126.819 143.138 129.073 1.00 19.22  ? 133 THR C CG2 1 
ATOM   6457  N N   . ALA C  1  134 ? 123.306 142.613 126.951 1.00 22.25  ? 134 ALA C N   1 
ATOM   6458  C CA  . ALA C  1  134 ? 121.997 142.167 127.395 1.00 22.25  ? 134 ALA C CA  1 
ATOM   6459  C C   . ALA C  1  134 ? 122.125 141.157 128.529 1.00 22.25  ? 134 ALA C C   1 
ATOM   6460  O O   . ALA C  1  134 ? 123.199 140.618 128.798 1.00 22.25  ? 134 ALA C O   1 
ATOM   6461  C CB  . ALA C  1  134 ? 121.219 141.551 126.235 1.00 22.25  ? 134 ALA C CB  1 
ATOM   6462  N N   . ALA C  1  135 ? 121.004 140.906 129.200 1.00 31.16  ? 135 ALA C N   1 
ATOM   6463  C CA  . ALA C  1  135 ? 120.934 139.936 130.285 1.00 31.16  ? 135 ALA C CA  1 
ATOM   6464  C C   . ALA C  1  135 ? 119.845 138.923 129.967 1.00 31.16  ? 135 ALA C C   1 
ATOM   6465  O O   . ALA C  1  135 ? 118.690 139.300 129.745 1.00 31.16  ? 135 ALA C O   1 
ATOM   6466  C CB  . ALA C  1  135 ? 120.658 140.623 131.622 1.00 31.16  ? 135 ALA C CB  1 
ATOM   6467  N N   . CYS C  1  136 ? 120.213 137.646 129.939 1.00 51.87  ? 136 CYS C N   1 
ATOM   6468  C CA  . CYS C  1  136 ? 119.283 136.566 129.643 1.00 51.87  ? 136 CYS C CA  1 
ATOM   6469  C C   . CYS C  1  136 ? 119.326 135.555 130.776 1.00 51.87  ? 136 CYS C C   1 
ATOM   6470  O O   . CYS C  1  136 ? 120.409 135.167 131.223 1.00 51.87  ? 136 CYS C O   1 
ATOM   6471  C CB  . CYS C  1  136 ? 119.613 135.887 128.307 1.00 51.87  ? 136 CYS C CB  1 
ATOM   6472  S SG  . CYS C  1  136 ? 121.216 135.044 128.229 1.00 51.87  ? 136 CYS C SG  1 
ATOM   6473  N N   . MET C  1  137 ? 118.153 135.141 131.247 1.00 68.48  ? 137 MET C N   1 
ATOM   6474  C CA  . MET C  1  137 ? 118.082 134.125 132.288 1.00 68.48  ? 137 MET C CA  1 
ATOM   6475  C C   . MET C  1  137 ? 118.687 132.819 131.803 1.00 68.48  ? 137 MET C C   1 
ATOM   6476  O O   . MET C  1  137 ? 118.238 132.246 130.806 1.00 68.48  ? 137 MET C O   1 
ATOM   6477  C CB  . MET C  1  137 ? 116.635 133.906 132.720 1.00 68.48  ? 137 MET C CB  1 
ATOM   6478  C CG  . MET C  1  137 ? 116.105 134.996 133.614 1.00 68.48  ? 137 MET C CG  1 
ATOM   6479  S SD  . MET C  1  137 ? 117.089 135.052 135.117 1.00 68.48  ? 137 MET C SD  1 
ATOM   6480  C CE  . MET C  1  137 ? 116.627 133.497 135.871 1.00 68.48  ? 137 MET C CE  1 
ATOM   6481  N N   . MET C  1  138 ? 119.710 132.354 132.509 1.00 63.34  ? 138 MET C N   1 
ATOM   6482  C CA  . MET C  1  138 ? 120.355 131.085 132.220 1.00 63.34  ? 138 MET C CA  1 
ATOM   6483  C C   . MET C  1  138 ? 119.976 130.092 133.304 1.00 63.34  ? 138 MET C C   1 
ATOM   6484  O O   . MET C  1  138 ? 120.033 130.415 134.494 1.00 63.34  ? 138 MET C O   1 
ATOM   6485  C CB  . MET C  1  138 ? 121.873 131.245 132.147 1.00 63.34  ? 138 MET C CB  1 
ATOM   6486  C CG  . MET C  1  138 ? 122.316 132.128 131.013 1.00 63.34  ? 138 MET C CG  1 
ATOM   6487  S SD  . MET C  1  138 ? 124.096 132.333 130.929 1.00 63.34  ? 138 MET C SD  1 
ATOM   6488  C CE  . MET C  1  138 ? 124.188 133.550 129.626 1.00 63.34  ? 138 MET C CE  1 
ATOM   6489  N N   . ASP C  1  139 ? 119.573 128.898 132.890 1.00 66.01  ? 139 ASP C N   1 
ATOM   6490  C CA  . ASP C  1  139 ? 119.210 127.825 133.804 1.00 66.01  ? 139 ASP C CA  1 
ATOM   6491  C C   . ASP C  1  139 ? 120.326 126.793 133.783 1.00 66.01  ? 139 ASP C C   1 
ATOM   6492  O O   . ASP C  1  139 ? 120.587 126.180 132.743 1.00 66.01  ? 139 ASP C O   1 
ATOM   6493  C CB  . ASP C  1  139 ? 117.874 127.201 133.406 1.00 66.01  ? 139 ASP C CB  1 
ATOM   6494  C CG  . ASP C  1  139 ? 117.328 126.270 134.463 1.00 66.01  ? 139 ASP C CG  1 
ATOM   6495  O OD1 . ASP C  1  139 ? 118.000 126.082 135.495 1.00 66.01  ? 139 ASP C OD1 1 
ATOM   6496  O OD2 . ASP C  1  139 ? 116.222 125.727 134.262 1.00 66.01  ? 139 ASP C OD2 1 
ATOM   6497  N N   . LEU C  1  140 ? 120.986 126.607 134.924 1.00 60.89  ? 140 LEU C N   1 
ATOM   6498  C CA  . LEU C  1  140 ? 122.112 125.691 135.026 1.00 60.89  ? 140 LEU C CA  1 
ATOM   6499  C C   . LEU C  1  140 ? 121.789 124.447 135.837 1.00 60.89  ? 140 LEU C C   1 
ATOM   6500  O O   . LEU C  1  140 ? 122.711 123.759 136.285 1.00 60.89  ? 140 LEU C O   1 
ATOM   6501  C CB  . LEU C  1  140 ? 123.325 126.402 135.623 1.00 60.89  ? 140 LEU C CB  1 
ATOM   6502  C CG  . LEU C  1  140 ? 123.903 127.495 134.730 1.00 60.89  ? 140 LEU C CG  1 
ATOM   6503  C CD1 . LEU C  1  140 ? 125.063 128.210 135.402 1.00 60.89  ? 140 LEU C CD1 1 
ATOM   6504  C CD2 . LEU C  1  140 ? 124.332 126.898 133.414 1.00 60.89  ? 140 LEU C CD2 1 
ATOM   6505  N N   . ARG C  1  141 ? 120.508 124.143 136.046 1.00 66.09  ? 141 ARG C N   1 
ATOM   6506  C CA  . ARG C  1  141 ? 120.157 122.902 136.724 1.00 66.09  ? 141 ARG C CA  1 
ATOM   6507  C C   . ARG C  1  141 ? 120.717 121.699 135.978 1.00 66.09  ? 141 ARG C C   1 
ATOM   6508  O O   . ARG C  1  141 ? 121.217 120.753 136.595 1.00 66.09  ? 141 ARG C O   1 
ATOM   6509  C CB  . ARG C  1  141 ? 118.641 122.783 136.867 1.00 66.09  ? 141 ARG C CB  1 
ATOM   6510  C CG  . ARG C  1  141 ? 118.003 123.865 137.712 1.00 66.09  ? 141 ARG C CG  1 
ATOM   6511  C CD  . ARG C  1  141 ? 118.355 123.711 139.177 1.00 66.09  ? 141 ARG C CD  1 
ATOM   6512  N NE  . ARG C  1  141 ? 117.764 124.779 139.976 1.00 66.09  ? 141 ARG C NE  1 
ATOM   6513  C CZ  . ARG C  1  141 ? 116.547 124.726 140.505 1.00 66.09  ? 141 ARG C CZ  1 
ATOM   6514  N NH1 . ARG C  1  141 ? 115.790 123.655 140.316 1.00 66.09  ? 141 ARG C NH1 1 
ATOM   6515  N NH2 . ARG C  1  141 ? 116.086 125.743 141.219 1.00 66.09  ? 141 ARG C NH2 1 
ATOM   6516  N N   . ARG C  1  142 ? 120.653 121.720 134.652 1.00 64.12  ? 142 ARG C N   1 
ATOM   6517  C CA  . ARG C  1  142 ? 121.136 120.614 133.841 1.00 64.12  ? 142 ARG C CA  1 
ATOM   6518  C C   . ARG C  1  142 ? 122.592 120.775 133.426 1.00 64.12  ? 142 ARG C C   1 
ATOM   6519  O O   . ARG C  1  142 ? 123.094 119.957 132.650 1.00 64.12  ? 142 ARG C O   1 
ATOM   6520  C CB  . ARG C  1  142 ? 120.248 120.449 132.604 1.00 64.12  ? 142 ARG C CB  1 
ATOM   6521  C CG  . ARG C  1  142 ? 118.816 120.063 132.944 1.00 64.12  ? 142 ARG C CG  1 
ATOM   6522  C CD  . ARG C  1  142 ? 117.947 119.960 131.704 1.00 64.12  ? 142 ARG C CD  1 
ATOM   6523  N NE  . ARG C  1  142 ? 118.340 118.844 130.853 1.00 64.12  ? 142 ARG C NE  1 
ATOM   6524  C CZ  . ARG C  1  142 ? 117.865 117.612 130.987 1.00 64.12  ? 142 ARG C CZ  1 
ATOM   6525  N NH1 . ARG C  1  142 ? 116.980 117.345 131.936 1.00 64.12  ? 142 ARG C NH1 1 
ATOM   6526  N NH2 . ARG C  1  142 ? 118.273 116.651 130.172 1.00 64.12  ? 142 ARG C NH2 1 
ATOM   6527  N N   . TYR C  1  143 ? 123.270 121.807 133.918 1.00 56.73  ? 143 TYR C N   1 
ATOM   6528  C CA  . TYR C  1  143 ? 124.691 121.978 133.655 1.00 56.73  ? 143 TYR C CA  1 
ATOM   6529  C C   . TYR C  1  143 ? 125.444 120.718 134.074 1.00 56.73  ? 143 TYR C C   1 
ATOM   6530  O O   . TYR C  1  143 ? 125.089 120.093 135.079 1.00 56.73  ? 143 TYR C O   1 
ATOM   6531  C CB  . TYR C  1  143 ? 125.214 123.188 134.430 1.00 56.73  ? 143 TYR C CB  1 
ATOM   6532  C CG  . TYR C  1  143 ? 126.663 123.546 134.199 1.00 56.73  ? 143 TYR C CG  1 
ATOM   6533  C CD1 . TYR C  1  143 ? 127.050 124.290 133.094 1.00 56.73  ? 143 TYR C CD1 1 
ATOM   6534  C CD2 . TYR C  1  143 ? 127.642 123.146 135.093 1.00 56.73  ? 143 TYR C CD2 1 
ATOM   6535  C CE1 . TYR C  1  143 ? 128.374 124.625 132.889 1.00 56.73  ? 143 TYR C CE1 1 
ATOM   6536  C CE2 . TYR C  1  143 ? 128.966 123.474 134.894 1.00 56.73  ? 143 TYR C CE2 1 
ATOM   6537  C CZ  . TYR C  1  143 ? 129.327 124.211 133.792 1.00 56.73  ? 143 TYR C CZ  1 
ATOM   6538  O OH  . TYR C  1  143 ? 130.647 124.536 133.597 1.00 56.73  ? 143 TYR C OH  1 
ATOM   6539  N N   . PRO C  1  144 ? 126.488 120.308 133.336 1.00 60.88  ? 144 PRO C N   1 
ATOM   6540  C CA  . PRO C  1  144 ? 127.105 120.902 132.145 1.00 60.88  ? 144 PRO C CA  1 
ATOM   6541  C C   . PRO C  1  144 ? 126.292 120.819 130.854 1.00 60.88  ? 144 PRO C C   1 
ATOM   6542  O O   . PRO C  1  144 ? 126.378 121.739 130.052 1.00 60.88  ? 144 PRO C O   1 
ATOM   6543  C CB  . PRO C  1  144 ? 128.401 120.104 131.994 1.00 60.88  ? 144 PRO C CB  1 
ATOM   6544  C CG  . PRO C  1  144 ? 128.113 118.808 132.619 1.00 60.88  ? 144 PRO C CG  1 
ATOM   6545  C CD  . PRO C  1  144 ? 127.207 119.100 133.771 1.00 60.88  ? 144 PRO C CD  1 
ATOM   6546  N N   . LEU C  1  145 ? 125.529 119.755 130.631 1.00 62.01  ? 145 LEU C N   1 
ATOM   6547  C CA  . LEU C  1  145 ? 124.816 119.575 129.366 1.00 62.01  ? 145 LEU C CA  1 
ATOM   6548  C C   . LEU C  1  145 ? 123.428 120.195 129.487 1.00 62.01  ? 145 LEU C C   1 
ATOM   6549  O O   . LEU C  1  145 ? 122.498 119.571 130.004 1.00 62.01  ? 145 LEU C O   1 
ATOM   6550  C CB  . LEU C  1  145 ? 124.742 118.100 128.982 1.00 62.01  ? 145 LEU C CB  1 
ATOM   6551  C CG  . LEU C  1  145 ? 125.981 117.540 128.278 1.00 62.01  ? 145 LEU C CG  1 
ATOM   6552  C CD1 . LEU C  1  145 ? 127.142 117.376 129.239 1.00 62.01  ? 145 LEU C CD1 1 
ATOM   6553  C CD2 . LEU C  1  145 ? 125.662 116.222 127.591 1.00 62.01  ? 145 LEU C CD2 1 
ATOM   6554  N N   . ASP C  1  146 ? 123.284 121.416 128.976 1.00 64.46  ? 146 ASP C N   1 
ATOM   6555  C CA  . ASP C  1  146 ? 122.037 122.157 129.094 1.00 64.46  ? 146 ASP C CA  1 
ATOM   6556  C C   . ASP C  1  146 ? 121.819 122.996 127.844 1.00 64.46  ? 146 ASP C C   1 
ATOM   6557  O O   . ASP C  1  146 ? 122.732 123.203 127.040 1.00 64.46  ? 146 ASP C O   1 
ATOM   6558  C CB  . ASP C  1  146 ? 122.029 123.053 130.336 1.00 64.46  ? 146 ASP C CB  1 
ATOM   6559  C CG  . ASP C  1  146 ? 123.154 124.071 130.331 1.00 64.46  ? 146 ASP C CG  1 
ATOM   6560  O OD1 . ASP C  1  146 ? 124.021 124.016 129.436 1.00 64.46  ? 146 ASP C OD1 1 
ATOM   6561  O OD2 . ASP C  1  146 ? 123.164 124.941 131.222 1.00 64.46  ? 146 ASP C OD2 1 
ATOM   6562  N N   . GLU C  1  147 ? 120.586 123.461 127.684 1.00 66.63  ? 147 GLU C N   1 
ATOM   6563  C CA  . GLU C  1  147 ? 120.207 124.359 126.603 1.00 66.63  ? 147 GLU C CA  1 
ATOM   6564  C C   . GLU C  1  147 ? 119.744 125.682 127.195 1.00 66.63  ? 147 GLU C C   1 
ATOM   6565  O O   . GLU C  1  147 ? 118.901 125.698 128.097 1.00 66.63  ? 147 GLU C O   1 
ATOM   6566  C CB  . GLU C  1  147 ? 119.101 123.741 125.748 1.00 66.63  ? 147 GLU C CB  1 
ATOM   6567  C CG  . GLU C  1  147 ? 119.547 122.516 124.979 1.00 66.63  ? 147 GLU C CG  1 
ATOM   6568  C CD  . GLU C  1  147 ? 118.425 121.882 124.185 1.00 66.63  ? 147 GLU C CD  1 
ATOM   6569  O OE1 . GLU C  1  147 ? 117.265 122.317 124.338 1.00 66.63  ? 147 GLU C OE1 1 
ATOM   6570  O OE2 . GLU C  1  147 ? 118.703 120.947 123.406 1.00 66.63  ? 147 GLU C OE2 1 
ATOM   6571  N N   . GLN C  1  148 ? 120.284 126.784 126.685 1.00 60.79  ? 148 GLN C N   1 
ATOM   6572  C CA  . GLN C  1  148 ? 119.941 128.113 127.166 1.00 60.79  ? 148 GLN C CA  1 
ATOM   6573  C C   . GLN C  1  148 ? 119.294 128.907 126.044 1.00 60.79  ? 148 GLN C C   1 
ATOM   6574  O O   . GLN C  1  148 ? 119.780 128.902 124.910 1.00 60.79  ? 148 GLN C O   1 
ATOM   6575  C CB  . GLN C  1  148 ? 121.171 128.848 127.690 1.00 60.79  ? 148 GLN C CB  1 
ATOM   6576  C CG  . GLN C  1  148 ? 121.763 128.221 128.930 1.00 60.79  ? 148 GLN C CG  1 
ATOM   6577  C CD  . GLN C  1  148 ? 122.949 128.996 129.456 1.00 60.79  ? 148 GLN C CD  1 
ATOM   6578  O OE1 . GLN C  1  148 ? 123.364 129.994 128.869 1.00 60.79  ? 148 GLN C OE1 1 
ATOM   6579  N NE2 . GLN C  1  148 ? 123.505 128.539 130.568 1.00 60.79  ? 148 GLN C NE2 1 
ATOM   6580  N N   . ASN C  1  149 ? 118.194 129.576 126.366 1.00 43.82  ? 149 ASN C N   1 
ATOM   6581  C CA  . ASN C  1  149 ? 117.433 130.396 125.432 1.00 43.82  ? 149 ASN C CA  1 
ATOM   6582  C C   . ASN C  1  149 ? 117.573 131.851 125.859 1.00 43.82  ? 149 ASN C C   1 
ATOM   6583  O O   . ASN C  1  149 ? 116.937 132.281 126.825 1.00 43.82  ? 149 ASN C O   1 
ATOM   6584  C CB  . ASN C  1  149 ? 115.974 129.941 125.425 1.00 43.82  ? 149 ASN C CB  1 
ATOM   6585  C CG  . ASN C  1  149 ? 115.106 130.728 124.472 1.00 43.82  ? 149 ASN C CG  1 
ATOM   6586  O OD1 . ASN C  1  149 ? 115.569 131.626 123.777 1.00 43.82  ? 149 ASN C OD1 1 
ATOM   6587  N ND2 . ASN C  1  149 ? 113.824 130.393 124.450 1.00 43.82  ? 149 ASN C ND2 1 
ATOM   6588  N N   . CYS C  1  150 ? 118.394 132.609 125.139 1.00 35.82  ? 150 CYS C N   1 
ATOM   6589  C CA  . CYS C  1  150 ? 118.612 134.017 125.439 1.00 35.82  ? 150 CYS C CA  1 
ATOM   6590  C C   . CYS C  1  150 ? 117.871 134.892 124.437 1.00 35.82  ? 150 CYS C C   1 
ATOM   6591  O O   . CYS C  1  150 ? 117.671 134.511 123.281 1.00 35.82  ? 150 CYS C O   1 
ATOM   6592  C CB  . CYS C  1  150 ? 120.101 134.363 125.443 1.00 35.82  ? 150 CYS C CB  1 
ATOM   6593  S SG  . CYS C  1  150 ? 121.020 133.601 126.804 1.00 35.82  ? 150 CYS C SG  1 
ATOM   6594  N N   . THR C  1  151 ? 117.476 136.077 124.893 1.00 25.68  ? 151 THR C N   1 
ATOM   6595  C CA  . THR C  1  151 ? 116.507 136.907 124.196 1.00 25.68  ? 151 THR C CA  1 
ATOM   6596  C C   . THR C  1  151 ? 117.080 138.310 124.032 1.00 25.68  ? 151 THR C C   1 
ATOM   6597  O O   . THR C  1  151 ? 118.116 138.650 124.606 1.00 25.68  ? 151 THR C O   1 
ATOM   6598  C CB  . THR C  1  151 ? 115.180 136.930 124.975 1.00 25.68  ? 151 THR C CB  1 
ATOM   6599  O OG1 . THR C  1  151 ? 114.812 135.588 125.304 1.00 25.68  ? 151 THR C OG1 1 
ATOM   6600  C CG2 . THR C  1  151 ? 114.049 137.508 124.146 1.00 25.68  ? 151 THR C CG2 1 
ATOM   6601  N N   . LEU C  1  152 ? 116.408 139.124 123.220 1.00 18.24  ? 152 LEU C N   1 
ATOM   6602  C CA  . LEU C  1  152 ? 116.726 140.542 123.079 1.00 18.24  ? 152 LEU C CA  1 
ATOM   6603  C C   . LEU C  1  152 ? 115.447 141.249 122.659 1.00 18.24  ? 152 LEU C C   1 
ATOM   6604  O O   . LEU C  1  152 ? 115.049 141.155 121.496 1.00 18.24  ? 152 LEU C O   1 
ATOM   6605  C CB  . LEU C  1  152 ? 117.826 140.763 122.051 1.00 18.24  ? 152 LEU C CB  1 
ATOM   6606  C CG  . LEU C  1  152 ? 118.214 142.223 121.848 1.00 18.24  ? 152 LEU C CG  1 
ATOM   6607  C CD1 . LEU C  1  152 ? 118.849 142.779 123.102 1.00 18.24  ? 152 LEU C CD1 1 
ATOM   6608  C CD2 . LEU C  1  152 ? 119.136 142.370 120.660 1.00 18.24  ? 152 LEU C CD2 1 
ATOM   6609  N N   . GLU C  1  153 ? 114.807 141.957 123.583 1.00 22.10  ? 153 GLU C N   1 
ATOM   6610  C CA  . GLU C  1  153 ? 113.482 142.513 123.344 1.00 22.10  ? 153 GLU C CA  1 
ATOM   6611  C C   . GLU C  1  153 ? 113.593 143.986 122.977 1.00 22.10  ? 153 GLU C C   1 
ATOM   6612  O O   . GLU C  1  153 ? 114.152 144.781 123.738 1.00 22.10  ? 153 GLU C O   1 
ATOM   6613  C CB  . GLU C  1  153 ? 112.589 142.325 124.566 1.00 22.10  ? 153 GLU C CB  1 
ATOM   6614  C CG  . GLU C  1  153 ? 112.333 140.868 124.894 1.00 22.10  ? 153 GLU C CG  1 
ATOM   6615  C CD  . GLU C  1  153 ? 111.372 140.686 126.046 1.00 22.10  ? 153 GLU C CD  1 
ATOM   6616  O OE1 . GLU C  1  153 ? 110.937 141.701 126.625 1.00 22.10  ? 153 GLU C OE1 1 
ATOM   6617  O OE2 . GLU C  1  153 ? 111.061 139.524 126.379 1.00 22.10  ? 153 GLU C OE2 1 
ATOM   6618  N N   . ILE C  1  154 ? 113.050 144.342 121.818 1.00 21.38  ? 154 ILE C N   1 
ATOM   6619  C CA  . ILE C  1  154 ? 113.076 145.699 121.290 1.00 21.38  ? 154 ILE C CA  1 
ATOM   6620  C C   . ILE C  1  154 ? 111.661 146.251 121.326 1.00 21.38  ? 154 ILE C C   1 
ATOM   6621  O O   . ILE C  1  154 ? 110.737 145.617 120.808 1.00 21.38  ? 154 ILE C O   1 
ATOM   6622  C CB  . ILE C  1  154 ? 113.618 145.720 119.855 1.00 21.38  ? 154 ILE C CB  1 
ATOM   6623  C CG1 . ILE C  1  154 ? 115.050 145.206 119.824 1.00 21.38  ? 154 ILE C CG1 1 
ATOM   6624  C CG2 . ILE C  1  154 ? 113.543 147.110 119.292 1.00 21.38  ? 154 ILE C CG2 1 
ATOM   6625  C CD1 . ILE C  1  154 ? 115.549 144.921 118.440 1.00 21.38  ? 154 ILE C CD1 1 
ATOM   6626  N N   . GLU C  1  155 ? 111.515 147.456 121.827 1.00 20.16  ? 155 GLU C N   1 
ATOM   6627  C CA  . GLU C  1  155 ? 110.206 148.028 121.867 1.00 20.16  ? 155 GLU C CA  1 
ATOM   6628  C C   . GLU C  1  155 ? 110.313 149.518 121.940 1.00 20.16  ? 155 GLU C C   1 
ATOM   6629  O O   . GLU C  1  155 ? 111.359 150.054 122.269 1.00 20.16  ? 155 GLU C O   1 
ATOM   6630  C CB  . GLU C  1  155 ? 109.466 147.500 123.090 1.00 20.16  ? 155 GLU C CB  1 
ATOM   6631  C CG  . GLU C  1  155 ? 109.969 147.982 124.430 1.00 20.16  ? 155 GLU C CG  1 
ATOM   6632  C CD  . GLU C  1  155 ? 109.200 147.342 125.569 1.00 20.16  ? 155 GLU C CD  1 
ATOM   6633  O OE1 . GLU C  1  155 ? 108.013 147.014 125.374 1.00 20.16  ? 155 GLU C OE1 1 
ATOM   6634  O OE2 . GLU C  1  155 ? 109.779 147.162 126.659 1.00 20.16  ? 155 GLU C OE2 1 
ATOM   6635  N N   . SER C  1  156 ? 109.211 150.193 121.638 1.00 15.15  ? 156 SER C N   1 
ATOM   6636  C CA  . SER C  1  156 ? 109.130 151.636 121.763 1.00 15.15  ? 156 SER C CA  1 
ATOM   6637  C C   . SER C  1  156 ? 108.949 152.024 123.223 1.00 15.15  ? 156 SER C C   1 
ATOM   6638  O O   . SER C  1  156 ? 108.644 151.193 124.079 1.00 15.15  ? 156 SER C O   1 
ATOM   6639  C CB  . SER C  1  156 ? 107.978 152.178 120.927 1.00 15.15  ? 156 SER C CB  1 
ATOM   6640  O OG  . SER C  1  156 ? 107.844 153.573 121.109 1.00 15.15  ? 156 SER C OG  1 
ATOM   6641  N N   . TYR C  1  157 ? 109.111 153.312 123.499 1.00 16.94  ? 157 TYR C N   1 
ATOM   6642  C CA  . TYR C  1  157 ? 108.988 153.796 124.862 1.00 16.94  ? 157 TYR C CA  1 
ATOM   6643  C C   . TYR C  1  157 ? 108.024 154.950 125.047 1.00 16.94  ? 157 TYR C C   1 
ATOM   6644  O O   . TYR C  1  157 ? 107.278 154.981 126.014 1.00 16.94  ? 157 TYR C O   1 
ATOM   6645  C CB  . TYR C  1  157 ? 110.348 154.202 125.405 1.00 16.94  ? 157 TYR C CB  1 
ATOM   6646  C CG  . TYR C  1  157 ? 110.320 154.478 126.879 1.00 16.94  ? 157 TYR C CG  1 
ATOM   6647  C CD1 . TYR C  1  157 ? 109.660 153.627 127.743 1.00 16.94  ? 157 TYR C CD1 1 
ATOM   6648  C CD2 . TYR C  1  157 ? 110.958 155.579 127.409 1.00 16.94  ? 157 TYR C CD2 1 
ATOM   6649  C CE1 . TYR C  1  157 ? 109.628 153.869 129.096 1.00 16.94  ? 157 TYR C CE1 1 
ATOM   6650  C CE2 . TYR C  1  157 ? 110.934 155.829 128.761 1.00 16.94  ? 157 TYR C CE2 1 
ATOM   6651  C CZ  . TYR C  1  157 ? 110.266 154.968 129.597 1.00 16.94  ? 157 TYR C CZ  1 
ATOM   6652  O OH  . TYR C  1  157 ? 110.236 155.209 130.946 1.00 16.94  ? 157 TYR C OH  1 
ATOM   6653  N N   . GLY C  1  158 ? 108.040 155.906 124.132 1.00 18.08  ? 158 GLY C N   1 
ATOM   6654  C CA  . GLY C  1  158 ? 107.160 157.048 124.265 1.00 18.08  ? 158 GLY C CA  1 
ATOM   6655  C C   . GLY C  1  158 ? 105.868 156.990 123.491 1.00 18.08  ? 158 GLY C C   1 
ATOM   6656  O O   . GLY C  1  158 ? 105.007 157.850 123.690 1.00 18.08  ? 158 GLY C O   1 
ATOM   6657  N N   . TYR C  1  159 ? 105.694 156.004 122.616 1.00 22.84  ? 159 TYR C N   1 
ATOM   6658  C CA  . TYR C  1  159 ? 104.534 155.940 121.742 1.00 22.84  ? 159 TYR C CA  1 
ATOM   6659  C C   . TYR C  1  159 ? 103.805 154.618 121.932 1.00 22.84  ? 159 TYR C C   1 
ATOM   6660  O O   . TYR C  1  159 ? 104.432 153.559 121.999 1.00 22.84  ? 159 TYR C O   1 
ATOM   6661  C CB  . TYR C  1  159 ? 104.951 156.102 120.286 1.00 22.84  ? 159 TYR C CB  1 
ATOM   6662  C CG  . TYR C  1  159 ? 105.617 157.424 120.015 1.00 22.84  ? 159 TYR C CG  1 
ATOM   6663  C CD1 . TYR C  1  159 ? 104.871 158.576 119.848 1.00 22.84  ? 159 TYR C CD1 1 
ATOM   6664  C CD2 . TYR C  1  159 ? 106.996 157.521 119.943 1.00 22.84  ? 159 TYR C CD2 1 
ATOM   6665  C CE1 . TYR C  1  159 ? 105.478 159.787 119.610 1.00 22.84  ? 159 TYR C CE1 1 
ATOM   6666  C CE2 . TYR C  1  159 ? 107.611 158.725 119.706 1.00 22.84  ? 159 TYR C CE2 1 
ATOM   6667  C CZ  . TYR C  1  159 ? 106.849 159.855 119.540 1.00 22.84  ? 159 TYR C CZ  1 
ATOM   6668  O OH  . TYR C  1  159 ? 107.461 161.060 119.301 1.00 22.84  ? 159 TYR C OH  1 
ATOM   6669  N N   . THR C  1  160 ? 102.481 154.686 122.007 1.00 21.44  ? 160 THR C N   1 
ATOM   6670  C CA  . THR C  1  160 ? 101.664 153.499 122.201 1.00 21.44  ? 160 THR C CA  1 
ATOM   6671  C C   . THR C  1  160 ? 101.475 152.794 120.863 1.00 21.44  ? 160 THR C C   1 
ATOM   6672  O O   . THR C  1  160 ? 102.054 153.176 119.844 1.00 21.44  ? 160 THR C O   1 
ATOM   6673  C CB  . THR C  1  160 ? 100.326 153.870 122.827 1.00 21.44  ? 160 THR C CB  1 
ATOM   6674  O OG1 . THR C  1  160 ? 99.574  154.657 121.900 1.00 21.44  ? 160 THR C OG1 1 
ATOM   6675  C CG2 . THR C  1  160 ? 100.544 154.682 124.083 1.00 21.44  ? 160 THR C CG2 1 
ATOM   6676  N N   . THR C  1  161 ? 100.642 151.753 120.844 1.00 23.39  ? 161 THR C N   1 
ATOM   6677  C CA  . THR C  1  161 ? 100.393 151.039 119.599 1.00 23.39  ? 161 THR C CA  1 
ATOM   6678  C C   . THR C  1  161 ? 99.502  151.816 118.647 1.00 23.39  ? 161 THR C C   1 
ATOM   6679  O O   . THR C  1  161 ? 99.271  151.352 117.529 1.00 23.39  ? 161 THR C O   1 
ATOM   6680  C CB  . THR C  1  161 ? 99.752  149.682 119.870 1.00 23.39  ? 161 THR C CB  1 
ATOM   6681  O OG1 . THR C  1  161 ? 99.711  148.929 118.654 1.00 23.39  ? 161 THR C OG1 1 
ATOM   6682  C CG2 . THR C  1  161 ? 98.340  149.868 120.369 1.00 23.39  ? 161 THR C CG2 1 
ATOM   6683  N N   . ASP C  1  162 ? 98.988  152.970 119.064 1.00 30.34  ? 162 ASP C N   1 
ATOM   6684  C CA  . ASP C  1  162 ? 98.151  153.777 118.190 1.00 30.34  ? 162 ASP C CA  1 
ATOM   6685  C C   . ASP C  1  162 ? 98.957  154.720 117.312 1.00 30.34  ? 162 ASP C C   1 
ATOM   6686  O O   . ASP C  1  162 ? 98.410  155.262 116.349 1.00 30.34  ? 162 ASP C O   1 
ATOM   6687  C CB  . ASP C  1  162 ? 97.151  154.585 119.017 1.00 30.34  ? 162 ASP C CB  1 
ATOM   6688  C CG  . ASP C  1  162 ? 96.148  153.709 119.739 1.00 30.34  ? 162 ASP C CG  1 
ATOM   6689  O OD1 . ASP C  1  162 ? 95.862  152.601 119.244 1.00 30.34  ? 162 ASP C OD1 1 
ATOM   6690  O OD2 . ASP C  1  162 ? 95.640  154.128 120.801 1.00 30.34  ? 162 ASP C OD2 1 
ATOM   6691  N N   . ASP C  1  163 ? 100.238 154.926 117.619 1.00 26.61  ? 163 ASP C N   1 
ATOM   6692  C CA  . ASP C  1  163 ? 101.049 155.906 116.911 1.00 26.61  ? 163 ASP C CA  1 
ATOM   6693  C C   . ASP C  1  163 ? 102.213 155.316 116.132 1.00 26.61  ? 163 ASP C C   1 
ATOM   6694  O O   . ASP C  1  163 ? 102.711 155.976 115.216 1.00 26.61  ? 163 ASP C O   1 
ATOM   6695  C CB  . ASP C  1  163 ? 101.601 156.948 117.891 1.00 26.61  ? 163 ASP C CB  1 
ATOM   6696  C CG  . ASP C  1  163 ? 100.516 157.806 118.496 1.00 26.61  ? 163 ASP C CG  1 
ATOM   6697  O OD1 . ASP C  1  163 ? 99.471  157.991 117.842 1.00 26.61  ? 163 ASP C OD1 1 
ATOM   6698  O OD2 . ASP C  1  163 ? 100.707 158.302 119.623 1.00 26.61  ? 163 ASP C OD2 1 
ATOM   6699  N N   . ILE C  1  164 ? 102.668 154.111 116.467 1.00 21.62  ? 164 ILE C N   1 
ATOM   6700  C CA  . ILE C  1  164 ? 103.834 153.529 115.819 1.00 21.62  ? 164 ILE C CA  1 
ATOM   6701  C C   . ILE C  1  164 ? 103.626 152.027 115.682 1.00 21.62  ? 164 ILE C C   1 
ATOM   6702  O O   . ILE C  1  164 ? 102.886 151.411 116.453 1.00 21.62  ? 164 ILE C O   1 
ATOM   6703  C CB  . ILE C  1  164 ? 105.120 153.852 116.607 1.00 21.62  ? 164 ILE C CB  1 
ATOM   6704  C CG1 . ILE C  1  164 ? 106.359 153.582 115.763 1.00 21.62  ? 164 ILE C CG1 1 
ATOM   6705  C CG2 . ILE C  1  164 ? 105.178 153.040 117.874 1.00 21.62  ? 164 ILE C CG2 1 
ATOM   6706  C CD1 . ILE C  1  164 ? 107.617 154.150 116.358 1.00 21.62  ? 164 ILE C CD1 1 
ATOM   6707  N N   . GLU C  1  165 ? 104.267 151.441 114.673 1.00 25.71  ? 165 GLU C N   1 
ATOM   6708  C CA  . GLU C  1  165 ? 104.168 150.015 114.400 1.00 25.71  ? 165 GLU C CA  1 
ATOM   6709  C C   . GLU C  1  165 ? 105.545 149.467 114.065 1.00 25.71  ? 165 GLU C C   1 
ATOM   6710  O O   . GLU C  1  165 ? 106.306 150.096 113.327 1.00 25.71  ? 165 GLU C O   1 
ATOM   6711  C CB  . GLU C  1  165 ? 103.213 149.732 113.240 1.00 25.71  ? 165 GLU C CB  1 
ATOM   6712  C CG  . GLU C  1  165 ? 101.766 150.054 113.527 1.00 25.71  ? 165 GLU C CG  1 
ATOM   6713  C CD  . GLU C  1  165 ? 101.176 149.154 114.588 1.00 25.71  ? 165 GLU C CD  1 
ATOM   6714  O OE1 . GLU C  1  165 ? 101.625 147.995 114.703 1.00 25.71  ? 165 GLU C OE1 1 
ATOM   6715  O OE2 . GLU C  1  165 ? 100.254 149.600 115.301 1.00 25.71  ? 165 GLU C OE2 1 
ATOM   6716  N N   . PHE C  1  166 ? 105.854 148.289 114.593 1.00 18.23  ? 166 PHE C N   1 
ATOM   6717  C CA  . PHE C  1  166 ? 107.126 147.627 114.349 1.00 18.23  ? 166 PHE C CA  1 
ATOM   6718  C C   . PHE C  1  166 ? 106.889 146.319 113.613 1.00 18.23  ? 166 PHE C C   1 
ATOM   6719  O O   . PHE C  1  166 ? 105.900 145.628 113.868 1.00 18.23  ? 166 PHE C O   1 
ATOM   6720  C CB  . PHE C  1  166 ? 107.870 147.354 115.657 1.00 18.23  ? 166 PHE C CB  1 
ATOM   6721  C CG  . PHE C  1  166 ? 108.438 148.580 116.306 1.00 18.23  ? 166 PHE C CG  1 
ATOM   6722  C CD1 . PHE C  1  166 ? 108.604 149.744 115.592 1.00 18.23  ? 166 PHE C CD1 1 
ATOM   6723  C CD2 . PHE C  1  166 ? 108.807 148.565 117.634 1.00 18.23  ? 166 PHE C CD2 1 
ATOM   6724  C CE1 . PHE C  1  166 ? 109.128 150.863 116.190 1.00 18.23  ? 166 PHE C CE1 1 
ATOM   6725  C CE2 . PHE C  1  166 ? 109.329 149.681 118.230 1.00 18.23  ? 166 PHE C CE2 1 
ATOM   6726  C CZ  . PHE C  1  166 ? 109.486 150.830 117.510 1.00 18.23  ? 166 PHE C CZ  1 
ATOM   6727  N N   . TYR C  1  167 ? 107.801 145.981 112.703 1.00 21.69  ? 167 TYR C N   1 
ATOM   6728  C CA  . TYR C  1  167 ? 107.743 144.717 111.982 1.00 21.69  ? 167 TYR C CA  1 
ATOM   6729  C C   . TYR C  1  167 ? 109.074 144.490 111.290 1.00 21.69  ? 167 TYR C C   1 
ATOM   6730  O O   . TYR C  1  167 ? 109.675 145.436 110.781 1.00 21.69  ? 167 TYR C O   1 
ATOM   6731  C CB  . TYR C  1  167 ? 106.612 144.708 110.950 1.00 21.69  ? 167 TYR C CB  1 
ATOM   6732  C CG  . TYR C  1  167 ? 106.793 145.706 109.833 1.00 21.69  ? 167 TYR C CG  1 
ATOM   6733  C CD1 . TYR C  1  167 ? 106.321 147.000 109.955 1.00 21.69  ? 167 TYR C CD1 1 
ATOM   6734  C CD2 . TYR C  1  167 ? 107.419 145.350 108.649 1.00 21.69  ? 167 TYR C CD2 1 
ATOM   6735  C CE1 . TYR C  1  167 ? 106.477 147.915 108.938 1.00 21.69  ? 167 TYR C CE1 1 
ATOM   6736  C CE2 . TYR C  1  167 ? 107.581 146.259 107.628 1.00 21.69  ? 167 TYR C CE2 1 
ATOM   6737  C CZ  . TYR C  1  167 ? 107.107 147.539 107.777 1.00 21.69  ? 167 TYR C CZ  1 
ATOM   6738  O OH  . TYR C  1  167 ? 107.266 148.448 106.760 1.00 21.69  ? 167 TYR C OH  1 
ATOM   6739  N N   . TRP C  1  168 ? 109.519 143.238 111.267 1.00 22.16  ? 168 TRP C N   1 
ATOM   6740  C CA  . TRP C  1  168 ? 110.775 142.912 110.610 1.00 22.16  ? 168 TRP C CA  1 
ATOM   6741  C C   . TRP C  1  168 ? 110.626 143.082 109.105 1.00 22.16  ? 168 TRP C C   1 
ATOM   6742  O O   . TRP C  1  168 ? 109.591 142.743 108.529 1.00 22.16  ? 168 TRP C O   1 
ATOM   6743  C CB  . TRP C  1  168 ? 111.188 141.484 110.945 1.00 22.16  ? 168 TRP C CB  1 
ATOM   6744  C CG  . TRP C  1  168 ? 111.380 141.263 112.401 1.00 22.16  ? 168 TRP C CG  1 
ATOM   6745  C CD1 . TRP C  1  168 ? 110.480 140.730 113.263 1.00 22.16  ? 168 TRP C CD1 1 
ATOM   6746  C CD2 . TRP C  1  168 ? 112.541 141.576 113.176 1.00 22.16  ? 168 TRP C CD2 1 
ATOM   6747  N NE1 . TRP C  1  168 ? 111.004 140.685 114.528 1.00 22.16  ? 168 TRP C NE1 1 
ATOM   6748  C CE2 . TRP C  1  168 ? 112.271 141.202 114.500 1.00 22.16  ? 168 TRP C CE2 1 
ATOM   6749  C CE3 . TRP C  1  168 ? 113.781 142.137 112.879 1.00 22.16  ? 168 TRP C CE3 1 
ATOM   6750  C CZ2 . TRP C  1  168 ? 113.193 141.367 115.525 1.00 22.16  ? 168 TRP C CZ2 1 
ATOM   6751  C CZ3 . TRP C  1  168 ? 114.696 142.300 113.900 1.00 22.16  ? 168 TRP C CZ3 1 
ATOM   6752  C CH2 . TRP C  1  168 ? 114.397 141.917 115.205 1.00 22.16  ? 168 TRP C CH2 1 
ATOM   6753  N N   . ARG C  1  169 ? 111.665 143.617 108.464 1.00 32.93  ? 169 ARG C N   1 
ATOM   6754  C CA  . ARG C  1  169 ? 111.606 143.912 107.032 1.00 32.93  ? 169 ARG C CA  1 
ATOM   6755  C C   . ARG C  1  169 ? 112.100 142.689 106.266 1.00 32.93  ? 169 ARG C C   1 
ATOM   6756  O O   . ARG C  1  169 ? 113.234 142.620 105.788 1.00 32.93  ? 169 ARG C O   1 
ATOM   6757  C CB  . ARG C  1  169 ? 112.413 145.160 106.705 1.00 32.93  ? 169 ARG C CB  1 
ATOM   6758  C CG  . ARG C  1  169 ? 112.247 145.627 105.274 1.00 32.93  ? 169 ARG C CG  1 
ATOM   6759  C CD  . ARG C  1  169 ? 112.981 146.929 105.008 1.00 32.93  ? 169 ARG C CD  1 
ATOM   6760  N NE  . ARG C  1  169 ? 114.430 146.779 105.062 1.00 32.93  ? 169 ARG C NE  1 
ATOM   6761  C CZ  . ARG C  1  169 ? 115.281 147.795 104.999 1.00 32.93  ? 169 ARG C CZ  1 
ATOM   6762  N NH1 . ARG C  1  169 ? 116.586 147.578 105.053 1.00 32.93  ? 169 ARG C NH1 1 
ATOM   6763  N NH2 . ARG C  1  169 ? 114.822 149.030 104.875 1.00 32.93  ? 169 ARG C NH2 1 
ATOM   6764  N N   . GLY C  1  170 ? 111.212 141.705 106.153 1.00 47.35  ? 170 GLY C N   1 
ATOM   6765  C CA  . GLY C  1  170 ? 111.524 140.441 105.515 1.00 47.35  ? 170 GLY C CA  1 
ATOM   6766  C C   . GLY C  1  170 ? 111.901 139.389 106.535 1.00 47.35  ? 170 GLY C C   1 
ATOM   6767  O O   . GLY C  1  170 ? 113.023 139.394 107.048 1.00 47.35  ? 170 GLY C O   1 
ATOM   6768  N N   . ASP C  1  171 ? 110.979 138.469 106.827 1.00 56.08  ? 171 ASP C N   1 
ATOM   6769  C CA  . ASP C  1  171 ? 111.197 137.528 107.920 1.00 56.08  ? 171 ASP C CA  1 
ATOM   6770  C C   . ASP C  1  171 ? 112.360 136.587 107.641 1.00 56.08  ? 171 ASP C C   1 
ATOM   6771  O O   . ASP C  1  171 ? 112.975 136.070 108.580 1.00 56.08  ? 171 ASP C O   1 
ATOM   6772  C CB  . ASP C  1  171 ? 109.923 136.731 108.187 1.00 56.08  ? 171 ASP C CB  1 
ATOM   6773  C CG  . ASP C  1  171 ? 108.813 137.588 108.761 1.00 56.08  ? 171 ASP C CG  1 
ATOM   6774  O OD1 . ASP C  1  171 ? 109.125 138.593 109.429 1.00 56.08  ? 171 ASP C OD1 1 
ATOM   6775  O OD2 . ASP C  1  171 ? 107.629 137.254 108.549 1.00 56.08  ? 171 ASP C OD2 1 
ATOM   6776  N N   . ASP C  1  172 ? 112.674 136.347 106.368 1.00 59.81  ? 172 ASP C N   1 
ATOM   6777  C CA  . ASP C  1  172 ? 113.799 135.478 106.045 1.00 59.81  ? 172 ASP C CA  1 
ATOM   6778  C C   . ASP C  1  172 ? 115.129 136.175 106.298 1.00 59.81  ? 172 ASP C C   1 
ATOM   6779  O O   . ASP C  1  172 ? 116.044 135.585 106.884 1.00 59.81  ? 172 ASP C O   1 
ATOM   6780  C CB  . ASP C  1  172 ? 113.707 135.015 104.592 1.00 59.81  ? 172 ASP C CB  1 
ATOM   6781  C CG  . ASP C  1  172 ? 112.598 134.006 104.370 1.00 59.81  ? 172 ASP C CG  1 
ATOM   6782  O OD1 . ASP C  1  172 ? 112.295 133.238 105.308 1.00 59.81  ? 172 ASP C OD1 1 
ATOM   6783  O OD2 . ASP C  1  172 ? 112.030 133.980 103.258 1.00 59.81  ? 172 ASP C OD2 1 
ATOM   6784  N N   . ASN C  1  173 ? 115.254 137.429 105.872 1.00 47.58  ? 173 ASN C N   1 
ATOM   6785  C CA  . ASN C  1  173 ? 116.514 138.156 105.943 1.00 47.58  ? 173 ASN C CA  1 
ATOM   6786  C C   . ASN C  1  173 ? 116.464 139.304 106.947 1.00 47.58  ? 173 ASN C C   1 
ATOM   6787  O O   . ASN C  1  173 ? 117.171 140.301 106.792 1.00 47.58  ? 173 ASN C O   1 
ATOM   6788  C CB  . ASN C  1  173 ? 116.902 138.673 104.561 1.00 47.58  ? 173 ASN C CB  1 
ATOM   6789  C CG  . ASN C  1  173 ? 117.262 137.557 103.608 1.00 47.58  ? 173 ASN C CG  1 
ATOM   6790  O OD1 . ASN C  1  173 ? 117.928 136.595 103.987 1.00 47.58  ? 173 ASN C OD1 1 
ATOM   6791  N ND2 . ASN C  1  173 ? 116.822 137.678 102.362 1.00 47.58  ? 173 ASN C ND2 1 
ATOM   6792  N N   . ALA C  1  174 ? 115.628 139.182 107.977 1.00 28.95  ? 174 ALA C N   1 
ATOM   6793  C CA  . ALA C  1  174 ? 115.598 140.214 109.005 1.00 28.95  ? 174 ALA C CA  1 
ATOM   6794  C C   . ALA C  1  174 ? 116.869 140.209 109.837 1.00 28.95  ? 174 ALA C C   1 
ATOM   6795  O O   . ALA C  1  174 ? 117.310 141.266 110.296 1.00 28.95  ? 174 ALA C O   1 
ATOM   6796  C CB  . ALA C  1  174 ? 114.381 140.031 109.905 1.00 28.95  ? 174 ALA C CB  1 
ATOM   6797  N N   . VAL C  1  175 ? 117.466 139.041 110.048 1.00 24.19  ? 175 VAL C N   1 
ATOM   6798  C CA  . VAL C  1  175 ? 118.703 138.908 110.804 1.00 24.19  ? 175 VAL C CA  1 
ATOM   6799  C C   . VAL C  1  175 ? 119.691 138.124 109.959 1.00 24.19  ? 175 VAL C C   1 
ATOM   6800  O O   . VAL C  1  175 ? 119.372 137.031 109.480 1.00 24.19  ? 175 VAL C O   1 
ATOM   6801  C CB  . VAL C  1  175 ? 118.477 138.200 112.151 1.00 24.19  ? 175 VAL C CB  1 
ATOM   6802  C CG1 . VAL C  1  175 ? 119.793 138.007 112.864 1.00 24.19  ? 175 VAL C CG1 1 
ATOM   6803  C CG2 . VAL C  1  175 ? 117.519 138.994 113.003 1.00 24.19  ? 175 VAL C CG2 1 
ATOM   6804  N N   . THR C  1  176 ? 120.885 138.672 109.780 1.00 26.30  ? 176 THR C N   1 
ATOM   6805  C CA  . THR C  1  176 ? 121.920 138.027 108.990 1.00 26.30  ? 176 THR C CA  1 
ATOM   6806  C C   . THR C  1  176 ? 123.170 137.862 109.840 1.00 26.30  ? 176 THR C C   1 
ATOM   6807  O O   . THR C  1  176 ? 123.280 138.407 110.939 1.00 26.30  ? 176 THR C O   1 
ATOM   6808  C CB  . THR C  1  176 ? 122.242 138.828 107.724 1.00 26.30  ? 176 THR C CB  1 
ATOM   6809  O OG1 . THR C  1  176 ? 122.735 140.121 108.090 1.00 26.30  ? 176 THR C OG1 1 
ATOM   6810  C CG2 . THR C  1  176 ? 121.000 138.993 106.869 1.00 26.30  ? 176 THR C CG2 1 
ATOM   6811  N N   . GLY C  1  177 ? 124.117 137.088 109.324 1.00 29.76  ? 177 GLY C N   1 
ATOM   6812  C CA  . GLY C  1  177 ? 125.382 136.910 109.997 1.00 29.76  ? 177 GLY C CA  1 
ATOM   6813  C C   . GLY C  1  177 ? 125.386 135.896 111.117 1.00 29.76  ? 177 GLY C C   1 
ATOM   6814  O O   . GLY C  1  177 ? 126.448 135.657 111.704 1.00 29.76  ? 177 GLY C O   1 
ATOM   6815  N N   . VAL C  1  178 ? 124.243 135.287 111.436 1.00 37.64  ? 178 VAL C N   1 
ATOM   6816  C CA  . VAL C  1  178 ? 124.228 134.285 112.495 1.00 37.64  ? 178 VAL C CA  1 
ATOM   6817  C C   . VAL C  1  178 ? 124.854 132.985 112.011 1.00 37.64  ? 178 VAL C C   1 
ATOM   6818  O O   . VAL C  1  178 ? 125.417 132.224 112.805 1.00 37.64  ? 178 VAL C O   1 
ATOM   6819  C CB  . VAL C  1  178 ? 122.792 134.072 113.003 1.00 37.64  ? 178 VAL C CB  1 
ATOM   6820  C CG1 . VAL C  1  178 ? 122.751 132.988 114.058 1.00 37.64  ? 178 VAL C CG1 1 
ATOM   6821  C CG2 . VAL C  1  178 ? 122.244 135.363 113.563 1.00 37.64  ? 178 VAL C CG2 1 
ATOM   6822  N N   . THR C  1  179 ? 124.794 132.717 110.708 1.00 45.19  ? 179 THR C N   1 
ATOM   6823  C CA  . THR C  1  179 ? 125.396 131.503 110.174 1.00 45.19  ? 179 THR C CA  1 
ATOM   6824  C C   . THR C  1  179 ? 126.915 131.516 110.272 1.00 45.19  ? 179 THR C C   1 
ATOM   6825  O O   . THR C  1  179 ? 127.540 130.461 110.125 1.00 45.19  ? 179 THR C O   1 
ATOM   6826  C CB  . THR C  1  179 ? 124.977 131.306 108.719 1.00 45.19  ? 179 THR C CB  1 
ATOM   6827  O OG1 . THR C  1  179 ? 125.434 132.415 107.937 1.00 45.19  ? 179 THR C OG1 1 
ATOM   6828  C CG2 . THR C  1  179 ? 123.465 131.208 108.610 1.00 45.19  ? 179 THR C CG2 1 
ATOM   6829  N N   . LYS C  1  180 ? 127.520 132.679 110.516 1.00 49.29  ? 180 LYS C N   1 
ATOM   6830  C CA  . LYS C  1  180 ? 128.968 132.801 110.561 1.00 49.29  ? 180 LYS C CA  1 
ATOM   6831  C C   . LYS C  1  180 ? 129.528 133.008 111.960 1.00 49.29  ? 180 LYS C C   1 
ATOM   6832  O O   . LYS C  1  180 ? 130.731 132.813 112.154 1.00 49.29  ? 180 LYS C O   1 
ATOM   6833  C CB  . LYS C  1  180 ? 129.427 133.966 109.674 1.00 49.29  ? 180 LYS C CB  1 
ATOM   6834  C CG  . LYS C  1  180 ? 129.077 133.792 108.208 1.00 49.29  ? 180 LYS C CG  1 
ATOM   6835  C CD  . LYS C  1  180 ? 129.549 134.974 107.386 1.00 49.29  ? 180 LYS C CD  1 
ATOM   6836  C CE  . LYS C  1  180 ? 129.207 134.794 105.918 1.00 49.29  ? 180 LYS C CE  1 
ATOM   6837  N NZ  . LYS C  1  180 ? 127.737 134.852 105.689 1.00 49.29  ? 180 LYS C NZ  1 
ATOM   6838  N N   . ILE C  1  181 ? 128.696 133.403 112.928 1.00 50.76  ? 181 ILE C N   1 
ATOM   6839  C CA  . ILE C  1  181 ? 129.190 133.647 114.278 1.00 50.76  ? 181 ILE C CA  1 
ATOM   6840  C C   . ILE C  1  181 ? 129.821 132.385 114.846 1.00 50.76  ? 181 ILE C C   1 
ATOM   6841  O O   . ILE C  1  181 ? 129.348 131.264 114.616 1.00 50.76  ? 181 ILE C O   1 
ATOM   6842  C CB  . ILE C  1  181 ? 128.061 134.166 115.183 1.00 50.76  ? 181 ILE C CB  1 
ATOM   6843  C CG1 . ILE C  1  181 ? 128.621 134.556 116.545 1.00 50.76  ? 181 ILE C CG1 1 
ATOM   6844  C CG2 . ILE C  1  181 ? 126.985 133.122 115.365 1.00 50.76  ? 181 ILE C CG2 1 
ATOM   6845  C CD1 . ILE C  1  181 ? 129.651 135.631 116.474 1.00 50.76  ? 181 ILE C CD1 1 
ATOM   6846  N N   . GLU C  1  182 ? 130.917 132.564 115.579 1.00 70.69  ? 182 GLU C N   1 
ATOM   6847  C CA  . GLU C  1  182 ? 131.645 131.461 116.190 1.00 70.69  ? 182 GLU C CA  1 
ATOM   6848  C C   . GLU C  1  182 ? 131.848 131.764 117.665 1.00 70.69  ? 182 GLU C C   1 
ATOM   6849  O O   . GLU C  1  182 ? 132.462 132.776 118.016 1.00 70.69  ? 182 GLU C O   1 
ATOM   6850  C CB  . GLU C  1  182 ? 132.992 131.236 115.499 1.00 70.69  ? 182 GLU C CB  1 
ATOM   6851  C CG  . GLU C  1  182 ? 132.874 130.729 114.070 1.00 70.69  ? 182 GLU C CG  1 
ATOM   6852  C CD  . GLU C  1  182 ? 132.297 129.326 113.993 1.00 70.69  ? 182 GLU C CD  1 
ATOM   6853  O OE1 . GLU C  1  182 ? 132.531 128.531 114.929 1.00 70.69  ? 182 GLU C OE1 1 
ATOM   6854  O OE2 . GLU C  1  182 ? 131.611 129.016 112.995 1.00 70.69  ? 182 GLU C OE2 1 
ATOM   6855  N N   . LEU C  1  183 ? 131.332 130.892 118.519 1.00 56.21  ? 183 LEU C N   1 
ATOM   6856  C CA  . LEU C  1  183 ? 131.570 131.025 119.945 1.00 56.21  ? 183 LEU C CA  1 
ATOM   6857  C C   . LEU C  1  183 ? 132.643 130.045 120.393 1.00 56.21  ? 183 LEU C C   1 
ATOM   6858  O O   . LEU C  1  183 ? 132.739 128.940 119.848 1.00 56.21  ? 183 LEU C O   1 
ATOM   6859  C CB  . LEU C  1  183 ? 130.289 130.772 120.737 1.00 56.21  ? 183 LEU C CB  1 
ATOM   6860  C CG  . LEU C  1  183 ? 129.240 131.862 120.566 1.00 56.21  ? 183 LEU C CG  1 
ATOM   6861  C CD1 . LEU C  1  183 ? 127.949 131.493 121.256 1.00 56.21  ? 183 LEU C CD1 1 
ATOM   6862  C CD2 . LEU C  1  183 ? 129.787 133.148 121.126 1.00 56.21  ? 183 LEU C CD2 1 
ATOM   6863  N N   . PRO C  1  184 ? 133.466 130.424 121.371 1.00 57.39  ? 184 PRO C N   1 
ATOM   6864  C CA  . PRO C  1  184 ? 134.517 129.504 121.821 1.00 57.39  ? 184 PRO C CA  1 
ATOM   6865  C C   . PRO C  1  184 ? 133.965 128.237 122.438 1.00 57.39  ? 184 PRO C C   1 
ATOM   6866  O O   . PRO C  1  184 ? 134.576 127.172 122.296 1.00 57.39  ? 184 PRO C O   1 
ATOM   6867  C CB  . PRO C  1  184 ? 135.295 130.340 122.843 1.00 57.39  ? 184 PRO C CB  1 
ATOM   6868  C CG  . PRO C  1  184 ? 134.295 131.313 123.359 1.00 57.39  ? 184 PRO C CG  1 
ATOM   6869  C CD  . PRO C  1  184 ? 133.403 131.641 122.197 1.00 57.39  ? 184 PRO C CD  1 
ATOM   6870  N N   . GLN C  1  185 ? 132.822 128.319 123.111 1.00 54.94  ? 185 GLN C N   1 
ATOM   6871  C CA  . GLN C  1  185 ? 132.270 127.202 123.862 1.00 54.94  ? 185 GLN C CA  1 
ATOM   6872  C C   . GLN C  1  185 ? 130.910 126.751 123.350 1.00 54.94  ? 185 GLN C C   1 
ATOM   6873  O O   . GLN C  1  185 ? 130.719 125.566 123.068 1.00 54.94  ? 185 GLN C O   1 
ATOM   6874  C CB  . GLN C  1  185 ? 132.179 127.592 125.341 1.00 54.94  ? 185 GLN C CB  1 
ATOM   6875  C CG  . GLN C  1  185 ? 131.720 126.492 126.261 1.00 54.94  ? 185 GLN C CG  1 
ATOM   6876  C CD  . GLN C  1  185 ? 131.724 126.938 127.704 1.00 54.94  ? 185 GLN C CD  1 
ATOM   6877  O OE1 . GLN C  1  185 ? 132.074 128.077 128.010 1.00 54.94  ? 185 GLN C OE1 1 
ATOM   6878  N NE2 . GLN C  1  185 ? 131.322 126.048 128.600 1.00 54.94  ? 185 GLN C NE2 1 
ATOM   6879  N N   . PHE C  1  186 ? 129.960 127.672 123.211 1.00 52.60  ? 186 PHE C N   1 
ATOM   6880  C CA  . PHE C  1  186 ? 128.609 127.343 122.786 1.00 52.60  ? 186 PHE C CA  1 
ATOM   6881  C C   . PHE C  1  186 ? 128.560 127.114 121.277 1.00 52.60  ? 186 PHE C C   1 
ATOM   6882  O O   . PHE C  1  186 ? 129.575 127.149 120.577 1.00 52.60  ? 186 PHE C O   1 
ATOM   6883  C CB  . PHE C  1  186 ? 127.646 128.456 123.186 1.00 52.60  ? 186 PHE C CB  1 
ATOM   6884  C CG  . PHE C  1  186 ? 127.439 128.579 124.660 1.00 52.60  ? 186 PHE C CG  1 
ATOM   6885  C CD1 . PHE C  1  186 ? 126.473 127.832 125.302 1.00 52.60  ? 186 PHE C CD1 1 
ATOM   6886  C CD2 . PHE C  1  186 ? 128.220 129.434 125.406 1.00 52.60  ? 186 PHE C CD2 1 
ATOM   6887  C CE1 . PHE C  1  186 ? 126.282 127.950 126.659 1.00 52.60  ? 186 PHE C CE1 1 
ATOM   6888  C CE2 . PHE C  1  186 ? 128.036 129.550 126.762 1.00 52.60  ? 186 PHE C CE2 1 
ATOM   6889  C CZ  . PHE C  1  186 ? 127.066 128.807 127.389 1.00 52.60  ? 186 PHE C CZ  1 
ATOM   6890  N N   . SER C  1  187 ? 127.354 126.874 120.770 1.00 49.99  ? 187 SER C N   1 
ATOM   6891  C CA  . SER C  1  187 ? 127.126 126.711 119.342 1.00 49.99  ? 187 SER C CA  1 
ATOM   6892  C C   . SER C  1  187 ? 125.684 127.083 119.037 1.00 49.99  ? 187 SER C C   1 
ATOM   6893  O O   . SER C  1  187 ? 124.771 126.642 119.739 1.00 49.99  ? 187 SER C O   1 
ATOM   6894  C CB  . SER C  1  187 ? 127.413 125.276 118.898 1.00 49.99  ? 187 SER C CB  1 
ATOM   6895  O OG  . SER C  1  187 ? 126.492 124.378 119.487 1.00 49.99  ? 187 SER C OG  1 
ATOM   6896  N N   . ILE C  1  188 ? 125.484 127.893 117.997 1.00 42.43  ? 188 ILE C N   1 
ATOM   6897  C CA  . ILE C  1  188 ? 124.140 128.320 117.630 1.00 42.43  ? 188 ILE C CA  1 
ATOM   6898  C C   . ILE C  1  188 ? 123.369 127.139 117.056 1.00 42.43  ? 188 ILE C C   1 
ATOM   6899  O O   . ILE C  1  188 ? 123.934 126.277 116.372 1.00 42.43  ? 188 ILE C O   1 
ATOM   6900  C CB  . ILE C  1  188 ? 124.205 129.483 116.628 1.00 42.43  ? 188 ILE C CB  1 
ATOM   6901  C CG1 . ILE C  1  188 ? 125.010 130.637 117.214 1.00 42.43  ? 188 ILE C CG1 1 
ATOM   6902  C CG2 . ILE C  1  188 ? 122.816 129.976 116.291 1.00 42.43  ? 188 ILE C CG2 1 
ATOM   6903  C CD1 . ILE C  1  188 ? 124.390 131.234 118.440 1.00 42.43  ? 188 ILE C CD1 1 
ATOM   6904  N N   . VAL C  1  189 ? 122.070 127.089 117.339 1.00 45.74  ? 189 VAL C N   1 
ATOM   6905  C CA  . VAL C  1  189 ? 121.229 126.003 116.855 1.00 45.74  ? 189 VAL C CA  1 
ATOM   6906  C C   . VAL C  1  189 ? 120.136 126.545 115.945 1.00 45.74  ? 189 VAL C C   1 
ATOM   6907  O O   . VAL C  1  189 ? 120.019 126.132 114.787 1.00 45.74  ? 189 VAL C O   1 
ATOM   6908  C CB  . VAL C  1  189 ? 120.620 125.216 118.026 1.00 45.74  ? 189 VAL C CB  1 
ATOM   6909  C CG1 . VAL C  1  189 ? 119.653 124.167 117.512 1.00 45.74  ? 189 VAL C CG1 1 
ATOM   6910  C CG2 . VAL C  1  189 ? 121.714 124.574 118.853 1.00 45.74  ? 189 VAL C CG2 1 
ATOM   6911  N N   . ASP C  1  190 ? 119.325 127.464 116.463 1.00 51.14  ? 190 ASP C N   1 
ATOM   6912  C CA  . ASP C  1  190 ? 118.196 127.993 115.712 1.00 51.14  ? 190 ASP C CA  1 
ATOM   6913  C C   . ASP C  1  190 ? 117.785 129.326 116.317 1.00 51.14  ? 190 ASP C C   1 
ATOM   6914  O O   . ASP C  1  190 ? 117.825 129.493 117.537 1.00 51.14  ? 190 ASP C O   1 
ATOM   6915  C CB  . ASP C  1  190 ? 117.017 127.014 115.732 1.00 51.14  ? 190 ASP C CB  1 
ATOM   6916  C CG  . ASP C  1  190 ? 115.912 127.409 114.775 1.00 51.14  ? 190 ASP C CG  1 
ATOM   6917  O OD1 . ASP C  1  190 ? 116.050 128.446 114.095 1.00 51.14  ? 190 ASP C OD1 1 
ATOM   6918  O OD2 . ASP C  1  190 ? 114.901 126.680 114.705 1.00 51.14  ? 190 ASP C OD2 1 
ATOM   6919  N N   . TYR C  1  191 ? 117.385 130.264 115.462 1.00 39.21  ? 191 TYR C N   1 
ATOM   6920  C CA  . TYR C  1  191 ? 116.915 131.567 115.908 1.00 39.21  ? 191 TYR C CA  1 
ATOM   6921  C C   . TYR C  1  191 ? 115.543 131.850 115.320 1.00 39.21  ? 191 TYR C C   1 
ATOM   6922  O O   . TYR C  1  191 ? 115.280 131.535 114.158 1.00 39.21  ? 191 TYR C O   1 
ATOM   6923  C CB  . TYR C  1  191 ? 117.893 132.682 115.526 1.00 39.21  ? 191 TYR C CB  1 
ATOM   6924  C CG  . TYR C  1  191 ? 118.074 132.894 114.045 1.00 39.21  ? 191 TYR C CG  1 
ATOM   6925  C CD1 . TYR C  1  191 ? 119.047 132.207 113.342 1.00 39.21  ? 191 TYR C CD1 1 
ATOM   6926  C CD2 . TYR C  1  191 ? 117.290 133.803 113.356 1.00 39.21  ? 191 TYR C CD2 1 
ATOM   6927  C CE1 . TYR C  1  191 ? 119.223 132.407 111.987 1.00 39.21  ? 191 TYR C CE1 1 
ATOM   6928  C CE2 . TYR C  1  191 ? 117.456 134.007 112.004 1.00 39.21  ? 191 TYR C CE2 1 
ATOM   6929  C CZ  . TYR C  1  191 ? 118.424 133.309 111.324 1.00 39.21  ? 191 TYR C CZ  1 
ATOM   6930  O OH  . TYR C  1  191 ? 118.591 133.514 109.975 1.00 39.21  ? 191 TYR C OH  1 
ATOM   6931  N N   . LYS C  1  192 ? 114.672 132.450 116.127 1.00 32.28  ? 192 LYS C N   1 
ATOM   6932  C CA  . LYS C  1  192 ? 113.311 132.760 115.722 1.00 32.28  ? 192 LYS C CA  1 
ATOM   6933  C C   . LYS C  1  192 ? 113.047 134.253 115.850 1.00 32.28  ? 192 LYS C C   1 
ATOM   6934  O O   . LYS C  1  192 ? 113.739 134.970 116.575 1.00 32.28  ? 192 LYS C O   1 
ATOM   6935  C CB  . LYS C  1  192 ? 112.286 131.986 116.556 1.00 32.28  ? 192 LYS C CB  1 
ATOM   6936  C CG  . LYS C  1  192 ? 112.260 130.500 116.276 1.00 32.28  ? 192 LYS C CG  1 
ATOM   6937  C CD  . LYS C  1  192 ? 111.174 129.809 117.078 1.00 32.28  ? 192 LYS C CD  1 
ATOM   6938  C CE  . LYS C  1  192 ? 111.146 128.318 116.788 1.00 32.28  ? 192 LYS C CE  1 
ATOM   6939  N NZ  . LYS C  1  192 ? 110.087 127.616 117.564 1.00 32.28  ? 192 LYS C NZ  1 
ATOM   6940  N N   . LEU C  1  193 ? 112.025 134.710 115.136 1.00 24.11  ? 193 LEU C N   1 
ATOM   6941  C CA  . LEU C  1  193 ? 111.629 136.110 115.114 1.00 24.11  ? 193 LEU C CA  1 
ATOM   6942  C C   . LEU C  1  193 ? 110.170 136.212 115.530 1.00 24.11  ? 193 LEU C C   1 
ATOM   6943  O O   . LEU C  1  193 ? 109.321 135.489 115.003 1.00 24.11  ? 193 LEU C O   1 
ATOM   6944  C CB  . LEU C  1  193 ? 111.829 136.703 113.724 1.00 24.11  ? 193 LEU C CB  1 
ATOM   6945  C CG  . LEU C  1  193 ? 113.279 136.661 113.259 1.00 24.11  ? 193 LEU C CG  1 
ATOM   6946  C CD1 . LEU C  1  193 ? 113.384 137.093 111.816 1.00 24.11  ? 193 LEU C CD1 1 
ATOM   6947  C CD2 . LEU C  1  193 ? 114.126 137.535 114.142 1.00 24.11  ? 193 LEU C CD2 1 
ATOM   6948  N N   . ILE C  1  194 ? 109.879 137.108 116.467 1.00 19.77  ? 194 ILE C N   1 
ATOM   6949  C CA  . ILE C  1  194 ? 108.551 137.206 117.055 1.00 19.77  ? 194 ILE C CA  1 
ATOM   6950  C C   . ILE C  1  194 ? 108.070 138.645 116.954 1.00 19.77  ? 194 ILE C C   1 
ATOM   6951  O O   . ILE C  1  194 ? 108.868 139.586 116.942 1.00 19.77  ? 194 ILE C O   1 
ATOM   6952  C CB  . ILE C  1  194 ? 108.559 136.729 118.522 1.00 19.77  ? 194 ILE C CB  1 
ATOM   6953  C CG1 . ILE C  1  194 ? 109.085 135.301 118.606 1.00 19.77  ? 194 ILE C CG1 1 
ATOM   6954  C CG2 . ILE C  1  194 ? 107.170 136.757 119.113 1.00 19.77  ? 194 ILE C CG2 1 
ATOM   6955  C CD1 . ILE C  1  194 ? 109.370 134.848 120.011 1.00 19.77  ? 194 ILE C CD1 1 
ATOM   6956  N N   . THR C  1  195 ? 106.752 138.813 116.864 1.00 16.39  ? 195 THR C N   1 
ATOM   6957  C CA  . THR C  1  195 ? 106.108 140.119 116.919 1.00 16.39  ? 195 THR C CA  1 
ATOM   6958  C C   . THR C  1  195 ? 104.956 140.037 117.906 1.00 16.39  ? 195 THR C C   1 
ATOM   6959  O O   . THR C  1  195 ? 104.083 139.175 117.768 1.00 16.39  ? 195 THR C O   1 
ATOM   6960  C CB  . THR C  1  195 ? 105.605 140.546 115.541 1.00 16.39  ? 195 THR C CB  1 
ATOM   6961  O OG1 . THR C  1  195 ? 106.710 140.629 114.635 1.00 16.39  ? 195 THR C OG1 1 
ATOM   6962  C CG2 . THR C  1  195 ? 104.916 141.894 115.626 1.00 16.39  ? 195 THR C CG2 1 
ATOM   6963  N N   . LYS C  1  196 ? 104.947 140.923 118.896 1.00 17.26  ? 196 LYS C N   1 
ATOM   6964  C CA  . LYS C  1  196 ? 103.964 140.870 119.968 1.00 17.26  ? 196 LYS C CA  1 
ATOM   6965  C C   . LYS C  1  196 ? 103.393 142.257 120.218 1.00 17.26  ? 196 LYS C C   1 
ATOM   6966  O O   . LYS C  1  196 ? 103.721 143.227 119.531 1.00 17.26  ? 196 LYS C O   1 
ATOM   6967  C CB  . LYS C  1  196 ? 104.577 140.323 121.261 1.00 17.26  ? 196 LYS C CB  1 
ATOM   6968  C CG  . LYS C  1  196 ? 105.017 138.887 121.194 1.00 17.26  ? 196 LYS C CG  1 
ATOM   6969  C CD  . LYS C  1  196 ? 105.389 138.382 122.575 1.00 17.26  ? 196 LYS C CD  1 
ATOM   6970  C CE  . LYS C  1  196 ? 106.697 138.979 123.049 1.00 17.26  ? 196 LYS C CE  1 
ATOM   6971  N NZ  . LYS C  1  196 ? 107.110 138.400 124.353 1.00 17.26  ? 196 LYS C NZ  1 
ATOM   6972  N N   . LYS C  1  197 ? 102.524 142.336 121.223 1.00 21.32  ? 197 LYS C N   1 
ATOM   6973  C CA  . LYS C  1  197 ? 102.004 143.599 121.732 1.00 21.32  ? 197 LYS C CA  1 
ATOM   6974  C C   . LYS C  1  197 ? 101.894 143.479 123.242 1.00 21.32  ? 197 LYS C C   1 
ATOM   6975  O O   . LYS C  1  197 ? 101.162 142.624 123.744 1.00 21.32  ? 197 LYS C O   1 
ATOM   6976  C CB  . LYS C  1  197 ? 100.645 143.943 121.117 1.00 21.32  ? 197 LYS C CB  1 
ATOM   6977  C CG  . LYS C  1  197 ? 100.711 144.313 119.652 1.00 21.32  ? 197 LYS C CG  1 
ATOM   6978  C CD  . LYS C  1  197 ? 99.347  144.678 119.112 1.00 21.32  ? 197 LYS C CD  1 
ATOM   6979  C CE  . LYS C  1  197 ? 99.424  145.018 117.634 1.00 21.32  ? 197 LYS C CE  1 
ATOM   6980  N NZ  . LYS C  1  197 ? 98.091  145.370 117.073 1.00 21.32  ? 197 LYS C NZ  1 
ATOM   6981  N N   . VAL C  1  198 ? 102.621 144.327 123.960 1.00 20.88  ? 198 VAL C N   1 
ATOM   6982  C CA  . VAL C  1  198 ? 102.703 144.266 125.412 1.00 20.88  ? 198 VAL C CA  1 
ATOM   6983  C C   . VAL C  1  198 ? 101.885 145.405 125.996 1.00 20.88  ? 198 VAL C C   1 
ATOM   6984  O O   . VAL C  1  198 ? 101.896 146.523 125.468 1.00 20.88  ? 198 VAL C O   1 
ATOM   6985  C CB  . VAL C  1  198 ? 104.166 144.336 125.881 1.00 20.88  ? 198 VAL C CB  1 
ATOM   6986  C CG1 . VAL C  1  198 ? 104.245 144.311 127.392 1.00 20.88  ? 198 VAL C CG1 1 
ATOM   6987  C CG2 . VAL C  1  198 ? 104.943 143.191 125.285 1.00 20.88  ? 198 VAL C CG2 1 
ATOM   6988  N N   . VAL C  1  199 ? 101.175 145.122 127.084 1.00 23.72  ? 199 VAL C N   1 
ATOM   6989  C CA  . VAL C  1  199 ? 100.285 146.084 127.719 1.00 23.72  ? 199 VAL C CA  1 
ATOM   6990  C C   . VAL C  1  199 ? 100.795 146.349 129.127 1.00 23.72  ? 199 VAL C C   1 
ATOM   6991  O O   . VAL C  1  199 ? 100.732 145.467 129.994 1.00 23.72  ? 199 VAL C O   1 
ATOM   6992  C CB  . VAL C  1  199 ? 98.835  145.589 127.749 1.00 23.72  ? 199 VAL C CB  1 
ATOM   6993  C CG1 . VAL C  1  199 ? 97.969  146.564 128.522 1.00 23.72  ? 199 VAL C CG1 1 
ATOM   6994  C CG2 . VAL C  1  199 ? 98.313  145.408 126.338 1.00 23.72  ? 199 VAL C CG2 1 
ATOM   6995  N N   . PHE C  1  200 ? 101.218 147.580 129.375 1.00 25.52  ? 200 PHE C N   1 
ATOM   6996  C CA  . PHE C  1  200 ? 101.625 147.979 130.710 1.00 25.52  ? 200 PHE C CA  1 
ATOM   6997  C C   . PHE C  1  200 ? 100.448 148.728 131.336 1.00 25.52  ? 200 PHE C C   1 
ATOM   6998  O O   . PHE C  1  200 ? 99.315  148.616 130.870 1.00 25.52  ? 200 PHE C O   1 
ATOM   6999  C CB  . PHE C  1  200 ? 102.881 148.838 130.673 1.00 25.52  ? 200 PHE C CB  1 
ATOM   7000  C CG  . PHE C  1  200 ? 104.138 148.045 130.522 1.00 25.52  ? 200 PHE C CG  1 
ATOM   7001  C CD1 . PHE C  1  200 ? 104.775 147.524 131.628 1.00 25.52  ? 200 PHE C CD1 1 
ATOM   7002  C CD2 . PHE C  1  200 ? 104.674 147.807 129.276 1.00 25.52  ? 200 PHE C CD2 1 
ATOM   7003  C CE1 . PHE C  1  200 ? 105.931 146.784 131.494 1.00 25.52  ? 200 PHE C CE1 1 
ATOM   7004  C CE2 . PHE C  1  200 ? 105.829 147.071 129.132 1.00 25.52  ? 200 PHE C CE2 1 
ATOM   7005  C CZ  . PHE C  1  200 ? 106.459 146.557 130.243 1.00 25.52  ? 200 PHE C CZ  1 
ATOM   7006  N N   . SER C  1  201 ? 100.699 149.495 132.386 1.00 37.21  ? 201 SER C N   1 
ATOM   7007  C CA  . SER C  1  201 ? 99.628  150.228 133.047 1.00 37.21  ? 201 SER C CA  1 
ATOM   7008  C C   . SER C  1  201 ? 99.220  151.489 132.297 1.00 37.21  ? 201 SER C C   1 
ATOM   7009  O O   . SER C  1  201 ? 98.137  152.021 132.556 1.00 37.21  ? 201 SER C O   1 
ATOM   7010  C CB  . SER C  1  201 ? 100.045 150.581 134.472 1.00 37.21  ? 201 SER C CB  1 
ATOM   7011  O OG  . SER C  1  201 ? 100.251 149.410 135.239 1.00 37.21  ? 201 SER C OG  1 
ATOM   7012  N N   . THR C  1  202 ? 100.056 151.973 131.386 1.00 34.75  ? 202 THR C N   1 
ATOM   7013  C CA  . THR C  1  202 ? 99.726  153.193 130.653 1.00 34.75  ? 202 THR C CA  1 
ATOM   7014  C C   . THR C  1  202 ? 99.137  152.963 129.263 1.00 34.75  ? 202 THR C C   1 
ATOM   7015  O O   . THR C  1  202 ? 98.306  153.743 128.806 1.00 34.75  ? 202 THR C O   1 
ATOM   7016  C CB  . THR C  1  202 ? 100.928 154.143 130.549 1.00 34.75  ? 202 THR C CB  1 
ATOM   7017  O OG1 . THR C  1  202 ? 102.033 153.450 129.964 1.00 34.75  ? 202 THR C OG1 1 
ATOM   7018  C CG2 . THR C  1  202 ? 101.321 154.632 131.921 1.00 34.75  ? 202 THR C CG2 1 
ATOM   7019  N N   . GLY C  1  203 ? 99.565  151.909 128.581 1.00 30.60  ? 203 GLY C N   1 
ATOM   7020  C CA  . GLY C  1  203 ? 99.024  151.635 127.269 1.00 30.60  ? 203 GLY C CA  1 
ATOM   7021  C C   . GLY C  1  203 ? 99.435  150.276 126.755 1.00 30.60  ? 203 GLY C C   1 
ATOM   7022  O O   . GLY C  1  203 ? 99.816  149.391 127.521 1.00 30.60  ? 203 GLY C O   1 
ATOM   7023  N N   . SER C  1  204 ? 99.332  150.120 125.439 1.00 23.88  ? 204 SER C N   1 
ATOM   7024  C CA  . SER C  1  204 ? 99.710  148.897 124.740 1.00 23.88  ? 204 SER C CA  1 
ATOM   7025  C C   . SER C  1  204 ? 100.903 149.212 123.849 1.00 23.88  ? 204 SER C C   1 
ATOM   7026  O O   . SER C  1  204 ? 100.769 149.954 122.871 1.00 23.88  ? 204 SER C O   1 
ATOM   7027  C CB  . SER C  1  204 ? 98.537  148.365 123.925 1.00 23.88  ? 204 SER C CB  1 
ATOM   7028  O OG  . SER C  1  204 ? 98.913  147.221 123.183 1.00 23.88  ? 204 SER C OG  1 
ATOM   7029  N N   . TYR C  1  205 ? 102.093 148.749 124.216 1.00 21.23  ? 205 TYR C N   1 
ATOM   7030  C CA  . TYR C  1  205 ? 103.302 149.048 123.448 1.00 21.23  ? 205 TYR C CA  1 
ATOM   7031  C C   . TYR C  1  205 ? 103.716 147.925 122.517 1.00 21.23  ? 205 TYR C C   1 
ATOM   7032  O O   . TYR C  1  205 ? 103.583 146.760 122.867 1.00 21.23  ? 205 TYR C O   1 
ATOM   7033  C CB  . TYR C  1  205 ? 104.452 149.353 124.401 1.00 21.23  ? 205 TYR C CB  1 
ATOM   7034  C CG  . TYR C  1  205 ? 104.218 150.553 125.278 1.00 21.23  ? 205 TYR C CG  1 
ATOM   7035  C CD1 . TYR C  1  205 ? 103.061 150.678 126.016 1.00 21.23  ? 205 TYR C CD1 1 
ATOM   7036  C CD2 . TYR C  1  205 ? 105.154 151.561 125.364 1.00 21.23  ? 205 TYR C CD2 1 
ATOM   7037  C CE1 . TYR C  1  205 ? 102.839 151.773 126.813 1.00 21.23  ? 205 TYR C CE1 1 
ATOM   7038  C CE2 . TYR C  1  205 ? 104.946 152.659 126.165 1.00 21.23  ? 205 TYR C CE2 1 
ATOM   7039  C CZ  . TYR C  1  205 ? 103.787 152.759 126.884 1.00 21.23  ? 205 TYR C CZ  1 
ATOM   7040  O OH  . TYR C  1  205 ? 103.568 153.850 127.683 1.00 21.23  ? 205 TYR C OH  1 
ATOM   7041  N N   . PRO C  1  206 ? 104.229 148.271 121.326 1.00 17.50  ? 206 PRO C N   1 
ATOM   7042  C CA  . PRO C  1  206 ? 104.666 147.249 120.371 1.00 17.50  ? 206 PRO C CA  1 
ATOM   7043  C C   . PRO C  1  206 ? 106.037 146.710 120.729 1.00 17.50  ? 206 PRO C C   1 
ATOM   7044  O O   . PRO C  1  206 ? 106.929 147.455 121.133 1.00 17.50  ? 206 PRO C O   1 
ATOM   7045  C CB  . PRO C  1  206 ? 104.709 148.011 119.045 1.00 17.50  ? 206 PRO C CB  1 
ATOM   7046  C CG  . PRO C  1  206 ? 105.016 149.394 119.451 1.00 17.50  ? 206 PRO C CG  1 
ATOM   7047  C CD  . PRO C  1  206 ? 104.341 149.625 120.767 1.00 17.50  ? 206 PRO C CD  1 
ATOM   7048  N N   . ARG C  1  207 ? 106.209 145.403 120.564 1.00 15.39  ? 207 ARG C N   1 
ATOM   7049  C CA  . ARG C  1  207 ? 107.459 144.744 120.908 1.00 15.39  ? 207 ARG C CA  1 
ATOM   7050  C C   . ARG C  1  207 ? 107.907 143.836 119.777 1.00 15.39  ? 207 ARG C C   1 
ATOM   7051  O O   . ARG C  1  207 ? 107.080 143.233 119.091 1.00 15.39  ? 207 ARG C O   1 
ATOM   7052  C CB  . ARG C  1  207 ? 107.327 143.924 122.192 1.00 15.39  ? 207 ARG C CB  1 
ATOM   7053  C CG  . ARG C  1  207 ? 108.610 143.226 122.588 1.00 15.39  ? 207 ARG C CG  1 
ATOM   7054  C CD  . ARG C  1  207 ? 108.494 142.517 123.913 1.00 15.39  ? 207 ARG C CD  1 
ATOM   7055  N NE  . ARG C  1  207 ? 108.314 143.471 124.996 1.00 15.39  ? 207 ARG C NE  1 
ATOM   7056  C CZ  . ARG C  1  207 ? 108.116 143.132 126.263 1.00 15.39  ? 207 ARG C CZ  1 
ATOM   7057  N NH1 . ARG C  1  207 ? 108.084 141.855 126.612 1.00 15.39  ? 207 ARG C NH1 1 
ATOM   7058  N NH2 . ARG C  1  207 ? 107.951 144.072 127.180 1.00 15.39  ? 207 ARG C NH2 1 
ATOM   7059  N N   . LEU C  1  208 ? 109.218 143.753 119.581 1.00 15.10  ? 208 LEU C N   1 
ATOM   7060  C CA  . LEU C  1  208 ? 109.827 142.754 118.722 1.00 15.10  ? 208 LEU C CA  1 
ATOM   7061  C C   . LEU C  1  208 ? 110.881 142.008 119.519 1.00 15.10  ? 208 LEU C C   1 
ATOM   7062  O O   . LEU C  1  208 ? 111.465 142.550 120.458 1.00 15.10  ? 208 LEU C O   1 
ATOM   7063  C CB  . LEU C  1  208 ? 110.457 143.369 117.485 1.00 15.10  ? 208 LEU C CB  1 
ATOM   7064  C CG  . LEU C  1  208 ? 109.468 144.051 116.556 1.00 15.10  ? 208 LEU C CG  1 
ATOM   7065  C CD1 . LEU C  1  208 ? 110.197 144.597 115.356 1.00 15.10  ? 208 LEU C CD1 1 
ATOM   7066  C CD2 . LEU C  1  208 ? 108.392 143.080 116.145 1.00 15.10  ? 208 LEU C CD2 1 
ATOM   7067  N N   . SER C  1  209 ? 111.126 140.762 119.139 1.00 16.32  ? 209 SER C N   1 
ATOM   7068  C CA  . SER C  1  209 ? 111.978 139.890 119.926 1.00 16.32  ? 209 SER C CA  1 
ATOM   7069  C C   . SER C  1  209 ? 112.925 139.113 119.030 1.00 16.32  ? 209 SER C C   1 
ATOM   7070  O O   . SER C  1  209 ? 112.553 138.688 117.935 1.00 16.32  ? 209 SER C O   1 
ATOM   7071  C CB  . SER C  1  209 ? 111.143 138.919 120.755 1.00 16.32  ? 209 SER C CB  1 
ATOM   7072  O OG  . SER C  1  209 ? 111.971 138.029 121.476 1.00 16.32  ? 209 SER C OG  1 
ATOM   7073  N N   . LEU C  1  210 ? 114.150 138.937 119.507 1.00 17.99  ? 210 LEU C N   1 
ATOM   7074  C CA  . LEU C  1  210 ? 115.140 138.077 118.880 1.00 17.99  ? 210 LEU C CA  1 
ATOM   7075  C C   . LEU C  1  210 ? 115.522 137.000 119.882 1.00 17.99  ? 210 LEU C C   1 
ATOM   7076  O O   . LEU C  1  210 ? 115.837 137.310 121.035 1.00 17.99  ? 210 LEU C O   1 
ATOM   7077  C CB  . LEU C  1  210 ? 116.370 138.876 118.455 1.00 17.99  ? 210 LEU C CB  1 
ATOM   7078  C CG  . LEU C  1  210 ? 117.454 138.109 117.710 1.00 17.99  ? 210 LEU C CG  1 
ATOM   7079  C CD1 . LEU C  1  210 ? 116.920 137.631 116.389 1.00 17.99  ? 210 LEU C CD1 1 
ATOM   7080  C CD2 . LEU C  1  210 ? 118.674 138.979 117.510 1.00 17.99  ? 210 LEU C CD2 1 
ATOM   7081  N N   . SER C  1  211 ? 115.479 135.741 119.459 1.00 29.35  ? 211 SER C N   1 
ATOM   7082  C CA  . SER C  1  211 ? 115.720 134.634 120.373 1.00 29.35  ? 211 SER C CA  1 
ATOM   7083  C C   . SER C  1  211 ? 116.458 133.522 119.650 1.00 29.35  ? 211 SER C C   1 
ATOM   7084  O O   . SER C  1  211 ? 116.089 133.167 118.528 1.00 29.35  ? 211 SER C O   1 
ATOM   7085  C CB  . SER C  1  211 ? 114.404 134.104 120.938 1.00 29.35  ? 211 SER C CB  1 
ATOM   7086  O OG  . SER C  1  211 ? 113.736 135.107 121.676 1.00 29.35  ? 211 SER C OG  1 
ATOM   7087  N N   . PHE C  1  212 ? 117.488 132.972 120.290 1.00 34.65  ? 212 PHE C N   1 
ATOM   7088  C CA  . PHE C  1  212 ? 118.249 131.872 119.704 1.00 34.65  ? 212 PHE C CA  1 
ATOM   7089  C C   . PHE C  1  212 ? 118.858 131.008 120.798 1.00 34.65  ? 212 PHE C C   1 
ATOM   7090  O O   . PHE C  1  212 ? 119.572 131.513 121.667 1.00 34.65  ? 212 PHE C O   1 
ATOM   7091  C CB  . PHE C  1  212 ? 119.322 132.395 118.741 1.00 34.65  ? 212 PHE C CB  1 
ATOM   7092  C CG  . PHE C  1  212 ? 120.195 133.477 119.308 1.00 34.65  ? 212 PHE C CG  1 
ATOM   7093  C CD1 . PHE C  1  212 ? 119.849 134.806 119.157 1.00 34.65  ? 212 PHE C CD1 1 
ATOM   7094  C CD2 . PHE C  1  212 ? 121.378 133.174 119.948 1.00 34.65  ? 212 PHE C CD2 1 
ATOM   7095  C CE1 . PHE C  1  212 ? 120.651 135.805 119.656 1.00 34.65  ? 212 PHE C CE1 1 
ATOM   7096  C CE2 . PHE C  1  212 ? 122.181 134.172 120.450 1.00 34.65  ? 212 PHE C CE2 1 
ATOM   7097  C CZ  . PHE C  1  212 ? 121.817 135.488 120.302 1.00 34.65  ? 212 PHE C CZ  1 
ATOM   7098  N N   . LYS C  1  213 ? 118.563 129.709 120.748 1.00 48.27  ? 213 LYS C N   1 
ATOM   7099  C CA  . LYS C  1  213 ? 119.018 128.761 121.756 1.00 48.27  ? 213 LYS C CA  1 
ATOM   7100  C C   . LYS C  1  213 ? 120.525 128.542 121.671 1.00 48.27  ? 213 LYS C C   1 
ATOM   7101  O O   . LYS C  1  213 ? 121.147 128.717 120.619 1.00 48.27  ? 213 LYS C O   1 
ATOM   7102  C CB  . LYS C  1  213 ? 118.298 127.424 121.589 1.00 48.27  ? 213 LYS C CB  1 
ATOM   7103  C CG  . LYS C  1  213 ? 116.834 127.457 121.987 1.00 48.27  ? 213 LYS C CG  1 
ATOM   7104  C CD  . LYS C  1  213 ? 116.117 126.162 121.635 1.00 48.27  ? 213 LYS C CD  1 
ATOM   7105  C CE  . LYS C  1  213 ? 116.138 125.177 122.788 1.00 48.27  ? 213 LYS C CE  1 
ATOM   7106  N NZ  . LYS C  1  213 ? 117.493 124.609 123.010 1.00 48.27  ? 213 LYS C NZ  1 
ATOM   7107  N N   . LEU C  1  214 ? 121.114 128.155 122.799 1.00 57.15  ? 214 LEU C N   1 
ATOM   7108  C CA  . LEU C  1  214 ? 122.536 127.855 122.888 1.00 57.15  ? 214 LEU C CA  1 
ATOM   7109  C C   . LEU C  1  214 ? 122.732 126.470 123.491 1.00 57.15  ? 214 LEU C C   1 
ATOM   7110  O O   . LEU C  1  214 ? 122.070 126.110 124.470 1.00 57.15  ? 214 LEU C O   1 
ATOM   7111  C CB  . LEU C  1  214 ? 123.263 128.901 123.736 1.00 57.15  ? 214 LEU C CB  1 
ATOM   7112  C CG  . LEU C  1  214 ? 123.271 130.325 123.183 1.00 57.15  ? 214 LEU C CG  1 
ATOM   7113  C CD1 . LEU C  1  214 ? 123.908 131.281 124.173 1.00 57.15  ? 214 LEU C CD1 1 
ATOM   7114  C CD2 . LEU C  1  214 ? 124.009 130.352 121.871 1.00 57.15  ? 214 LEU C CD2 1 
ATOM   7115  N N   . LYS C  1  215 ? 123.648 125.697 122.910 1.00 62.78  ? 215 LYS C N   1 
ATOM   7116  C CA  . LYS C  1  215 ? 123.963 124.360 123.397 1.00 62.78  ? 215 LYS C CA  1 
ATOM   7117  C C   . LYS C  1  215 ? 125.468 124.227 123.568 1.00 62.78  ? 215 LYS C C   1 
ATOM   7118  O O   . LYS C  1  215 ? 126.231 124.582 122.665 1.00 62.78  ? 215 LYS C O   1 
ATOM   7119  C CB  . LYS C  1  215 ? 123.447 123.278 122.446 1.00 62.78  ? 215 LYS C CB  1 
ATOM   7120  C CG  . LYS C  1  215 ? 123.661 121.869 122.972 1.00 62.78  ? 215 LYS C CG  1 
ATOM   7121  C CD  . LYS C  1  215 ? 123.067 120.817 122.051 1.00 62.78  ? 215 LYS C CD  1 
ATOM   7122  C CE  . LYS C  1  215 ? 123.307 119.420 122.605 1.00 62.78  ? 215 LYS C CE  1 
ATOM   7123  N NZ  . LYS C  1  215 ? 122.748 118.361 121.721 1.00 62.78  ? 215 LYS C NZ  1 
ATOM   7124  N N   . ARG C  1  216 ? 125.888 123.710 124.719 1.00 53.90  ? 216 ARG C N   1 
ATOM   7125  C CA  . ARG C  1  216 ? 127.300 123.614 125.050 1.00 53.90  ? 216 ARG C CA  1 
ATOM   7126  C C   . ARG C  1  216 ? 127.953 122.431 124.342 1.00 53.90  ? 216 ARG C C   1 
ATOM   7127  O O   . ARG C  1  216 ? 127.294 121.474 123.927 1.00 53.90  ? 216 ARG C O   1 
ATOM   7128  C CB  . ARG C  1  216 ? 127.494 123.453 126.555 1.00 53.90  ? 216 ARG C CB  1 
ATOM   7129  C CG  . ARG C  1  216 ? 127.047 124.632 127.373 1.00 53.90  ? 216 ARG C CG  1 
ATOM   7130  C CD  . ARG C  1  216 ? 127.296 124.391 128.842 1.00 53.90  ? 216 ARG C CD  1 
ATOM   7131  N NE  . ARG C  1  216 ? 126.698 125.432 129.667 1.00 53.90  ? 216 ARG C NE  1 
ATOM   7132  C CZ  . ARG C  1  216 ? 127.324 126.540 130.039 1.00 53.90  ? 216 ARG C CZ  1 
ATOM   7133  N NH1 . ARG C  1  216 ? 128.576 126.751 129.661 1.00 53.90  ? 216 ARG C NH1 1 
ATOM   7134  N NH2 . ARG C  1  216 ? 126.698 127.434 130.789 1.00 53.90  ? 216 ARG C NH2 1 
ATOM   7135  N N   . ASN C  1  217 ? 129.276 122.501 124.226 1.00 68.77  ? 217 ASN C N   1 
ATOM   7136  C CA  . ASN C  1  217 ? 130.047 121.346 123.803 1.00 68.77  ? 217 ASN C CA  1 
ATOM   7137  C C   . ASN C  1  217 ? 130.126 120.330 124.939 1.00 68.77  ? 217 ASN C C   1 
ATOM   7138  O O   . ASN C  1  217 ? 129.959 120.658 126.116 1.00 68.77  ? 217 ASN C O   1 
ATOM   7139  C CB  . ASN C  1  217 ? 131.445 121.766 123.355 1.00 68.77  ? 217 ASN C CB  1 
ATOM   7140  C CG  . ASN C  1  217 ? 131.430 122.493 122.029 1.00 68.77  ? 217 ASN C CG  1 
ATOM   7141  O OD1 . ASN C  1  217 ? 130.707 122.108 121.110 1.00 68.77  ? 217 ASN C OD1 1 
ATOM   7142  N ND2 . ASN C  1  217 ? 132.227 123.547 121.920 1.00 68.77  ? 217 ASN C ND2 1 
ATOM   7143  N N   . ILE C  1  218 ? 130.390 119.080 124.575 1.00 72.78  ? 218 ILE C N   1 
ATOM   7144  C CA  . ILE C  1  218 ? 130.206 117.944 125.468 1.00 72.78  ? 218 ILE C CA  1 
ATOM   7145  C C   . ILE C  1  218 ? 131.538 117.327 125.883 1.00 72.78  ? 218 ILE C C   1 
ATOM   7146  O O   . ILE C  1  218 ? 131.801 117.142 127.071 1.00 72.78  ? 218 ILE C O   1 
ATOM   7147  C CB  . ILE C  1  218 ? 129.288 116.884 124.822 1.00 72.78  ? 218 ILE C CB  1 
ATOM   7148  C CG1 . ILE C  1  218 ? 127.916 117.483 124.523 1.00 72.78  ? 218 ILE C CG1 1 
ATOM   7149  C CG2 . ILE C  1  218 ? 129.150 115.678 125.729 1.00 72.78  ? 218 ILE C CG2 1 
ATOM   7150  C CD1 . ILE C  1  218 ? 127.048 116.597 123.657 1.00 72.78  ? 218 ILE C CD1 1 
ATOM   7151  N N   . GLY C  1  219 ? 132.394 117.007 124.911 1.00 88.17  ? 219 GLY C N   1 
ATOM   7152  C CA  . GLY C  1  219 ? 133.502 116.103 125.173 1.00 88.17  ? 219 GLY C CA  1 
ATOM   7153  C C   . GLY C  1  219 ? 134.537 116.630 126.147 1.00 88.17  ? 219 GLY C C   1 
ATOM   7154  O O   . GLY C  1  219 ? 135.240 115.845 126.789 1.00 88.17  ? 219 GLY C O   1 
ATOM   7155  N N   . TYR C  1  220 ? 134.651 117.951 126.276 1.00 103.17 ? 220 TYR C N   1 
ATOM   7156  C CA  . TYR C  1  220 ? 135.763 118.514 127.036 1.00 103.17 ? 220 TYR C CA  1 
ATOM   7157  C C   . TYR C  1  220 ? 135.526 118.405 128.540 1.00 103.17 ? 220 TYR C C   1 
ATOM   7158  O O   . TYR C  1  220 ? 136.421 118.000 129.290 1.00 103.17 ? 220 TYR C O   1 
ATOM   7159  C CB  . TYR C  1  220 ? 135.992 119.966 126.617 1.00 103.17 ? 220 TYR C CB  1 
ATOM   7160  C CG  . TYR C  1  220 ? 137.223 120.605 127.221 1.00 103.17 ? 220 TYR C CG  1 
ATOM   7161  C CD1 . TYR C  1  220 ? 138.495 120.254 126.785 1.00 103.17 ? 220 TYR C CD1 1 
ATOM   7162  C CD2 . TYR C  1  220 ? 137.114 121.574 128.207 1.00 103.17 ? 220 TYR C CD2 1 
ATOM   7163  C CE1 . TYR C  1  220 ? 139.622 120.837 127.328 1.00 103.17 ? 220 TYR C CE1 1 
ATOM   7164  C CE2 . TYR C  1  220 ? 138.235 122.165 128.755 1.00 103.17 ? 220 TYR C CE2 1 
ATOM   7165  C CZ  . TYR C  1  220 ? 139.486 121.793 128.311 1.00 103.17 ? 220 TYR C CZ  1 
ATOM   7166  O OH  . TYR C  1  220 ? 140.605 122.378 128.854 1.00 103.17 ? 220 TYR C OH  1 
ATOM   7167  N N   . PHE C  1  221 ? 134.320 118.745 128.999 1.00 95.53  ? 221 PHE C N   1 
ATOM   7168  C CA  . PHE C  1  221 ? 134.062 118.840 130.433 1.00 95.53  ? 221 PHE C CA  1 
ATOM   7169  C C   . PHE C  1  221 ? 133.853 117.484 131.093 1.00 95.53  ? 221 PHE C C   1 
ATOM   7170  O O   . PHE C  1  221 ? 134.163 117.325 132.281 1.00 95.53  ? 221 PHE C O   1 
ATOM   7171  C CB  . PHE C  1  221 ? 132.835 119.714 130.689 1.00 95.53  ? 221 PHE C CB  1 
ATOM   7172  C CG  . PHE C  1  221 ? 133.049 121.163 130.382 1.00 95.53  ? 221 PHE C CG  1 
ATOM   7173  C CD1 . PHE C  1  221 ? 134.326 121.672 130.233 1.00 95.53  ? 221 PHE C CD1 1 
ATOM   7174  C CD2 . PHE C  1  221 ? 131.972 122.019 130.241 1.00 95.53  ? 221 PHE C CD2 1 
ATOM   7175  C CE1 . PHE C  1  221 ? 134.526 123.009 129.950 1.00 95.53  ? 221 PHE C CE1 1 
ATOM   7176  C CE2 . PHE C  1  221 ? 132.166 123.355 129.959 1.00 95.53  ? 221 PHE C CE2 1 
ATOM   7177  C CZ  . PHE C  1  221 ? 133.445 123.851 129.813 1.00 95.53  ? 221 PHE C CZ  1 
ATOM   7178  N N   . ILE C  1  222 ? 133.308 116.514 130.357 1.00 83.09  ? 222 ILE C N   1 
ATOM   7179  C CA  . ILE C  1  222 ? 132.928 115.242 130.965 1.00 83.09  ? 222 ILE C CA  1 
ATOM   7180  C C   . ILE C  1  222 ? 134.155 114.523 131.505 1.00 83.09  ? 222 ILE C C   1 
ATOM   7181  O O   . ILE C  1  222 ? 134.191 114.102 132.668 1.00 83.09  ? 222 ILE C O   1 
ATOM   7182  C CB  . ILE C  1  222 ? 132.165 114.373 129.953 1.00 83.09  ? 222 ILE C CB  1 
ATOM   7183  C CG1 . ILE C  1  222 ? 130.927 115.118 129.459 1.00 83.09  ? 222 ILE C CG1 1 
ATOM   7184  C CG2 . ILE C  1  222 ? 131.782 113.043 130.578 1.00 83.09  ? 222 ILE C CG2 1 
ATOM   7185  C CD1 . ILE C  1  222 ? 129.973 115.482 130.561 1.00 83.09  ? 222 ILE C CD1 1 
ATOM   7186  N N   . LEU C  1  223 ? 135.180 114.368 130.666 1.00 95.33  ? 223 LEU C N   1 
ATOM   7187  C CA  . LEU C  1  223 ? 136.402 113.713 131.119 1.00 95.33  ? 223 LEU C CA  1 
ATOM   7188  C C   . LEU C  1  223 ? 137.037 114.479 132.269 1.00 95.33  ? 223 LEU C C   1 
ATOM   7189  O O   . LEU C  1  223 ? 137.543 113.876 133.221 1.00 95.33  ? 223 LEU C O   1 
ATOM   7190  C CB  . LEU C  1  223 ? 137.392 113.573 129.962 1.00 95.33  ? 223 LEU C CB  1 
ATOM   7191  C CG  . LEU C  1  223 ? 137.168 112.460 128.934 1.00 95.33  ? 223 LEU C CG  1 
ATOM   7192  C CD1 . LEU C  1  223 ? 136.021 112.791 127.988 1.00 95.33  ? 223 LEU C CD1 1 
ATOM   7193  C CD2 . LEU C  1  223 ? 138.446 112.186 128.156 1.00 95.33  ? 223 LEU C CD2 1 
ATOM   7194  N N   . GLN C  1  224 ? 136.998 115.811 132.210 1.00 95.28  ? 224 GLN C N   1 
ATOM   7195  C CA  . GLN C  1  224 ? 137.643 116.620 133.239 1.00 95.28  ? 224 GLN C CA  1 
ATOM   7196  C C   . GLN C  1  224 ? 136.971 116.447 134.594 1.00 95.28  ? 224 GLN C C   1 
ATOM   7197  O O   . GLN C  1  224 ? 137.649 116.423 135.627 1.00 95.28  ? 224 GLN C O   1 
ATOM   7198  C CB  . GLN C  1  224 ? 137.635 118.093 132.829 1.00 95.28  ? 224 GLN C CB  1 
ATOM   7199  C CG  . GLN C  1  224 ? 138.500 118.429 131.624 1.00 95.28  ? 224 GLN C CG  1 
ATOM   7200  C CD  . GLN C  1  224 ? 139.976 118.218 131.886 1.00 95.28  ? 224 GLN C CD  1 
ATOM   7201  O OE1 . GLN C  1  224 ? 140.595 117.309 131.334 1.00 95.28  ? 224 GLN C OE1 1 
ATOM   7202  N NE2 . GLN C  1  224 ? 140.548 119.058 132.739 1.00 95.28  ? 224 GLN C NE2 1 
ATOM   7203  N N   . THR C  1  225 ? 135.644 116.327 134.616 1.00 83.36  ? 225 THR C N   1 
ATOM   7204  C CA  . THR C  1  225 ? 134.913 116.354 135.879 1.00 83.36  ? 225 THR C CA  1 
ATOM   7205  C C   . THR C  1  225 ? 134.522 114.974 136.400 1.00 83.36  ? 225 THR C C   1 
ATOM   7206  O O   . THR C  1  225 ? 134.780 114.666 137.566 1.00 83.36  ? 225 THR C O   1 
ATOM   7207  C CB  . THR C  1  225 ? 133.657 117.224 135.744 1.00 83.36  ? 225 THR C CB  1 
ATOM   7208  O OG1 . THR C  1  225 ? 132.813 116.692 134.716 1.00 83.36  ? 225 THR C OG1 1 
ATOM   7209  C CG2 . THR C  1  225 ? 134.031 118.654 135.399 1.00 83.36  ? 225 THR C CG2 1 
ATOM   7210  N N   . TYR C  1  226 ? 133.898 114.133 135.571 1.00 78.27  ? 226 TYR C N   1 
ATOM   7211  C CA  . TYR C  1  226 ? 133.210 112.959 136.104 1.00 78.27  ? 226 TYR C CA  1 
ATOM   7212  C C   . TYR C  1  226 ? 134.155 111.816 136.465 1.00 78.27  ? 226 TYR C C   1 
ATOM   7213  O O   . TYR C  1  226 ? 133.938 111.135 137.472 1.00 78.27  ? 226 TYR C O   1 
ATOM   7214  C CB  . TYR C  1  226 ? 132.156 112.479 135.111 1.00 78.27  ? 226 TYR C CB  1 
ATOM   7215  C CG  . TYR C  1  226 ? 130.950 113.380 135.052 1.00 78.27  ? 226 TYR C CG  1 
ATOM   7216  C CD1 . TYR C  1  226 ? 129.960 113.297 136.018 1.00 78.27  ? 226 TYR C CD1 1 
ATOM   7217  C CD2 . TYR C  1  226 ? 130.799 114.313 134.038 1.00 78.27  ? 226 TYR C CD2 1 
ATOM   7218  C CE1 . TYR C  1  226 ? 128.855 114.114 135.976 1.00 78.27  ? 226 TYR C CE1 1 
ATOM   7219  C CE2 . TYR C  1  226 ? 129.694 115.136 133.990 1.00 78.27  ? 226 TYR C CE2 1 
ATOM   7220  C CZ  . TYR C  1  226 ? 128.725 115.031 134.961 1.00 78.27  ? 226 TYR C CZ  1 
ATOM   7221  O OH  . TYR C  1  226 ? 127.621 115.846 134.921 1.00 78.27  ? 226 TYR C OH  1 
ATOM   7222  N N   . MET C  1  227 ? 135.191 111.580 135.663 1.00 91.36  ? 227 MET C N   1 
ATOM   7223  C CA  . MET C  1  227 ? 136.022 110.385 135.826 1.00 91.36  ? 227 MET C CA  1 
ATOM   7224  C C   . MET C  1  227 ? 136.587 110.183 137.230 1.00 91.36  ? 227 MET C C   1 
ATOM   7225  O O   . MET C  1  227 ? 136.548 109.042 137.720 1.00 91.36  ? 227 MET C O   1 
ATOM   7226  C CB  . MET C  1  227 ? 137.156 110.413 134.793 1.00 91.36  ? 227 MET C CB  1 
ATOM   7227  C CG  . MET C  1  227 ? 136.683 110.314 133.353 1.00 91.36  ? 227 MET C CG  1 
ATOM   7228  S SD  . MET C  1  227 ? 135.731 108.815 133.039 1.00 91.36  ? 227 MET C SD  1 
ATOM   7229  C CE  . MET C  1  227 ? 136.995 107.561 133.220 1.00 91.36  ? 227 MET C CE  1 
ATOM   7230  N N   . PRO C  1  228 ? 137.133 111.199 137.916 1.00 73.81  ? 228 PRO C N   1 
ATOM   7231  C CA  . PRO C  1  228 ? 137.768 110.929 139.220 1.00 73.81  ? 228 PRO C CA  1 
ATOM   7232  C C   . PRO C  1  228 ? 136.852 110.272 140.238 1.00 73.81  ? 228 PRO C C   1 
ATOM   7233  O O   . PRO C  1  228 ? 137.298 109.393 140.986 1.00 73.81  ? 228 PRO C O   1 
ATOM   7234  C CB  . PRO C  1  228 ? 138.217 112.321 139.680 1.00 73.81  ? 228 PRO C CB  1 
ATOM   7235  C CG  . PRO C  1  228 ? 138.397 113.081 138.431 1.00 73.81  ? 228 PRO C CG  1 
ATOM   7236  C CD  . PRO C  1  228 ? 137.321 112.604 137.514 1.00 73.81  ? 228 PRO C CD  1 
ATOM   7237  N N   . SER C  1  229 ? 135.580 110.663 140.290 1.00 63.16  ? 229 SER C N   1 
ATOM   7238  C CA  . SER C  1  229 ? 134.679 110.061 141.266 1.00 63.16  ? 229 SER C CA  1 
ATOM   7239  C C   . SER C  1  229 ? 134.412 108.598 140.943 1.00 63.16  ? 229 SER C C   1 
ATOM   7240  O O   . SER C  1  229 ? 134.348 107.755 141.847 1.00 63.16  ? 229 SER C O   1 
ATOM   7241  C CB  . SER C  1  229 ? 133.374 110.843 141.316 1.00 63.16  ? 229 SER C CB  1 
ATOM   7242  O OG  . SER C  1  229 ? 133.622 112.173 141.716 1.00 63.16  ? 229 SER C OG  1 
ATOM   7243  N N   . ILE C  1  230 ? 134.247 108.280 139.659 1.00 65.70  ? 230 ILE C N   1 
ATOM   7244  C CA  . ILE C  1  230 ? 134.066 106.890 139.261 1.00 65.70  ? 230 ILE C CA  1 
ATOM   7245  C C   . ILE C  1  230 ? 135.297 106.077 139.634 1.00 65.70  ? 230 ILE C C   1 
ATOM   7246  O O   . ILE C  1  230 ? 135.191 104.938 140.108 1.00 65.70  ? 230 ILE C O   1 
ATOM   7247  C CB  . ILE C  1  230 ? 133.767 106.808 137.754 1.00 65.70  ? 230 ILE C CB  1 
ATOM   7248  C CG1 . ILE C  1  230 ? 132.522 107.626 137.414 1.00 65.70  ? 230 ILE C CG1 1 
ATOM   7249  C CG2 . ILE C  1  230 ? 133.563 105.368 137.334 1.00 65.70  ? 230 ILE C CG2 1 
ATOM   7250  C CD1 . ILE C  1  230 ? 132.304 107.815 135.930 1.00 65.70  ? 230 ILE C CD1 1 
ATOM   7251  N N   . LEU C  1  231 ? 136.484 106.661 139.449 1.00 62.90  ? 231 LEU C N   1 
ATOM   7252  C CA  . LEU C  1  231 ? 137.710 105.968 139.829 1.00 62.90  ? 231 LEU C CA  1 
ATOM   7253  C C   . LEU C  1  231 ? 137.763 105.726 141.330 1.00 62.90  ? 231 LEU C C   1 
ATOM   7254  O O   . LEU C  1  231 ? 138.184 104.654 141.779 1.00 62.90  ? 231 LEU C O   1 
ATOM   7255  C CB  . LEU C  1  231 ? 138.932 106.765 139.387 1.00 62.90  ? 231 LEU C CB  1 
ATOM   7256  C CG  . LEU C  1  231 ? 139.147 106.978 137.894 1.00 62.90  ? 231 LEU C CG  1 
ATOM   7257  C CD1 . LEU C  1  231 ? 140.374 107.837 137.715 1.00 62.90  ? 231 LEU C CD1 1 
ATOM   7258  C CD2 . LEU C  1  231 ? 139.287 105.660 137.158 1.00 62.90  ? 231 LEU C CD2 1 
ATOM   7259  N N   . ILE C  1  232 ? 137.349 106.715 142.123 1.00 63.93  ? 232 ILE C N   1 
ATOM   7260  C CA  . ILE C  1  232 ? 137.372 106.551 143.573 1.00 63.93  ? 232 ILE C CA  1 
ATOM   7261  C C   . ILE C  1  232 ? 136.386 105.477 144.009 1.00 63.93  ? 232 ILE C C   1 
ATOM   7262  O O   . ILE C  1  232 ? 136.678 104.674 144.903 1.00 63.93  ? 232 ILE C O   1 
ATOM   7263  C CB  . ILE C  1  232 ? 137.096 107.893 144.270 1.00 63.93  ? 232 ILE C CB  1 
ATOM   7264  C CG1 . ILE C  1  232 ? 138.216 108.881 143.961 1.00 63.93  ? 232 ILE C CG1 1 
ATOM   7265  C CG2 . ILE C  1  232 ? 136.960 107.702 145.768 1.00 63.93  ? 232 ILE C CG2 1 
ATOM   7266  C CD1 . ILE C  1  232 ? 139.570 108.414 144.435 1.00 63.93  ? 232 ILE C CD1 1 
ATOM   7267  N N   . THR C  1  233 ? 135.210 105.434 143.386 1.00 64.51  ? 233 THR C N   1 
ATOM   7268  C CA  . THR C  1  233 ? 134.245 104.394 143.730 1.00 64.51  ? 233 THR C CA  1 
ATOM   7269  C C   . THR C  1  233 ? 134.772 103.010 143.367 1.00 64.51  ? 233 THR C C   1 
ATOM   7270  O O   . THR C  1  233 ? 134.623 102.053 144.141 1.00 64.51  ? 233 THR C O   1 
ATOM   7271  C CB  . THR C  1  233 ? 132.913 104.664 143.038 1.00 64.51  ? 233 THR C CB  1 
ATOM   7272  O OG1 . THR C  1  233 ? 132.396 105.922 143.485 1.00 64.51  ? 233 THR C OG1 1 
ATOM   7273  C CG2 . THR C  1  233 ? 131.913 103.568 143.366 1.00 64.51  ? 233 THR C CG2 1 
ATOM   7274  N N   . ILE C  1  234 ? 135.419 102.885 142.207 1.00 63.76  ? 234 ILE C N   1 
ATOM   7275  C CA  . ILE C  1  234 ? 135.975 101.590 141.826 1.00 63.76  ? 234 ILE C CA  1 
ATOM   7276  C C   . ILE C  1  234 ? 137.099 101.188 142.775 1.00 63.76  ? 234 ILE C C   1 
ATOM   7277  O O   . ILE C  1  234 ? 137.225 100.016 143.151 1.00 63.76  ? 234 ILE C O   1 
ATOM   7278  C CB  . ILE C  1  234 ? 136.446 101.619 140.363 1.00 63.76  ? 234 ILE C CB  1 
ATOM   7279  C CG1 . ILE C  1  234 ? 135.255 101.827 139.427 1.00 63.76  ? 234 ILE C CG1 1 
ATOM   7280  C CG2 . ILE C  1  234 ? 137.166 100.333 140.009 1.00 63.76  ? 234 ILE C CG2 1 
ATOM   7281  C CD1 . ILE C  1  234 ? 135.648 102.119 137.996 1.00 63.76  ? 234 ILE C CD1 1 
ATOM   7282  N N   . LEU C  1  235 ? 137.927 102.148 143.190 1.00 61.61  ? 235 LEU C N   1 
ATOM   7283  C CA  . LEU C  1  235 ? 138.983 101.833 144.144 1.00 61.61  ? 235 LEU C CA  1 
ATOM   7284  C C   . LEU C  1  235 ? 138.408 101.425 145.492 1.00 61.61  ? 235 LEU C C   1 
ATOM   7285  O O   . LEU C  1  235 ? 138.955 100.539 146.156 1.00 61.61  ? 235 LEU C O   1 
ATOM   7286  C CB  . LEU C  1  235 ? 139.921 103.026 144.303 1.00 61.61  ? 235 LEU C CB  1 
ATOM   7287  C CG  . LEU C  1  235 ? 141.117 102.791 145.221 1.00 61.61  ? 235 LEU C CG  1 
ATOM   7288  C CD1 . LEU C  1  235 ? 141.984 101.680 144.664 1.00 61.61  ? 235 LEU C CD1 1 
ATOM   7289  C CD2 . LEU C  1  235 ? 141.921 104.066 145.394 1.00 61.61  ? 235 LEU C CD2 1 
ATOM   7290  N N   . SER C  1  236 ? 137.306 102.047 145.907 1.00 67.92  ? 236 SER C N   1 
ATOM   7291  C CA  . SER C  1  236 ? 136.636 101.612 147.126 1.00 67.92  ? 236 SER C CA  1 
ATOM   7292  C C   . SER C  1  236 ? 136.107 100.195 146.973 1.00 67.92  ? 236 SER C C   1 
ATOM   7293  O O   . SER C  1  236 ? 136.077 99.425  147.939 1.00 67.92  ? 236 SER C O   1 
ATOM   7294  C CB  . SER C  1  236 ? 135.506 102.576 147.480 1.00 67.92  ? 236 SER C CB  1 
ATOM   7295  O OG  . SER C  1  236 ? 134.484 102.542 146.499 1.00 67.92  ? 236 SER C OG  1 
ATOM   7296  N N   . TRP C  1  237 ? 135.677 99.836  145.763 1.00 72.33  ? 237 TRP C N   1 
ATOM   7297  C CA  . TRP C  1  237 ? 135.285 98.454  145.499 1.00 72.33  ? 237 TRP C CA  1 
ATOM   7298  C C   . TRP C  1  237 ? 136.470 97.503  145.613 1.00 72.33  ? 237 TRP C C   1 
ATOM   7299  O O   . TRP C  1  237 ? 136.314 96.361  146.059 1.00 72.33  ? 237 TRP C O   1 
ATOM   7300  C CB  . TRP C  1  237 ? 134.667 98.340  144.111 1.00 72.33  ? 237 TRP C CB  1 
ATOM   7301  C CG  . TRP C  1  237 ? 133.309 98.899  144.008 1.00 72.33  ? 237 TRP C CG  1 
ATOM   7302  C CD1 . TRP C  1  237 ? 132.490 99.261  145.034 1.00 72.33  ? 237 TRP C CD1 1 
ATOM   7303  C CD2 . TRP C  1  237 ? 132.600 99.183  142.804 1.00 72.33  ? 237 TRP C CD2 1 
ATOM   7304  N NE1 . TRP C  1  237 ? 131.304 99.741  144.540 1.00 72.33  ? 237 TRP C NE1 1 
ATOM   7305  C CE2 . TRP C  1  237 ? 131.349 99.705  143.172 1.00 72.33  ? 237 TRP C CE2 1 
ATOM   7306  C CE3 . TRP C  1  237 ? 132.900 99.041  141.447 1.00 72.33  ? 237 TRP C CE3 1 
ATOM   7307  C CZ2 . TRP C  1  237 ? 130.400 100.087 142.234 1.00 72.33  ? 237 TRP C CZ2 1 
ATOM   7308  C CZ3 . TRP C  1  237 ? 131.957 99.420  140.519 1.00 72.33  ? 237 TRP C CZ3 1 
ATOM   7309  C CH2 . TRP C  1  237 ? 130.722 99.936  140.915 1.00 72.33  ? 237 TRP C CH2 1 
ATOM   7310  N N   . VAL C  1  238 ? 137.654 97.950  145.185 1.00 69.06  ? 238 VAL C N   1 
ATOM   7311  C CA  . VAL C  1  238 ? 138.844 97.095  145.189 1.00 69.06  ? 238 VAL C CA  1 
ATOM   7312  C C   . VAL C  1  238 ? 139.083 96.478  146.562 1.00 69.06  ? 238 VAL C C   1 
ATOM   7313  O O   . VAL C  1  238 ? 139.649 95.384  146.674 1.00 69.06  ? 238 VAL C O   1 
ATOM   7314  C CB  . VAL C  1  238 ? 140.074 97.898  144.707 1.00 69.06  ? 238 VAL C CB  1 
ATOM   7315  C CG1 . VAL C  1  238 ? 141.355 97.095  144.864 1.00 69.06  ? 238 VAL C CG1 1 
ATOM   7316  C CG2 . VAL C  1  238 ? 139.900 98.311  143.256 1.00 69.06  ? 238 VAL C CG2 1 
ATOM   7317  N N   . SER C  1  239 ? 138.616 97.139  147.620 1.00 69.14  ? 239 SER C N   1 
ATOM   7318  C CA  . SER C  1  239 ? 138.919 96.700  148.976 1.00 69.14  ? 239 SER C CA  1 
ATOM   7319  C C   . SER C  1  239 ? 138.203 95.414  149.368 1.00 69.14  ? 239 SER C C   1 
ATOM   7320  O O   . SER C  1  239 ? 138.626 94.760  150.325 1.00 69.14  ? 239 SER C O   1 
ATOM   7321  C CB  . SER C  1  239 ? 138.558 97.803  149.968 1.00 69.14  ? 239 SER C CB  1 
ATOM   7322  O OG  . SER C  1  239 ? 139.332 98.964  149.732 1.00 69.14  ? 239 SER C OG  1 
ATOM   7323  N N   . PHE C  1  240 ? 137.135 95.033  148.663 1.00 77.94  ? 240 PHE C N   1 
ATOM   7324  C CA  . PHE C  1  240 ? 136.332 93.897  149.112 1.00 77.94  ? 240 PHE C CA  1 
ATOM   7325  C C   . PHE C  1  240 ? 137.057 92.571  148.913 1.00 77.94  ? 240 PHE C C   1 
ATOM   7326  O O   . PHE C  1  240 ? 136.924 91.658  149.737 1.00 77.94  ? 240 PHE C O   1 
ATOM   7327  C CB  . PHE C  1  240 ? 134.988 93.879  148.389 1.00 77.94  ? 240 PHE C CB  1 
ATOM   7328  C CG  . PHE C  1  240 ? 134.078 95.006  148.771 1.00 77.94  ? 240 PHE C CG  1 
ATOM   7329  C CD1 . PHE C  1  240 ? 133.381 94.974  149.965 1.00 77.94  ? 240 PHE C CD1 1 
ATOM   7330  C CD2 . PHE C  1  240 ? 133.903 96.087  147.926 1.00 77.94  ? 240 PHE C CD2 1 
ATOM   7331  C CE1 . PHE C  1  240 ? 132.539 96.006  150.316 1.00 77.94  ? 240 PHE C CE1 1 
ATOM   7332  C CE2 . PHE C  1  240 ? 133.061 97.121  148.270 1.00 77.94  ? 240 PHE C CE2 1 
ATOM   7333  C CZ  . PHE C  1  240 ? 132.378 97.081  149.466 1.00 77.94  ? 240 PHE C CZ  1 
ATOM   7334  N N   . TRP C  1  241 ? 137.823 92.440  147.828 1.00 88.40  ? 241 TRP C N   1 
ATOM   7335  C CA  . TRP C  1  241 ? 138.482 91.170  147.543 1.00 88.40  ? 241 TRP C CA  1 
ATOM   7336  C C   . TRP C  1  241 ? 139.484 90.798  148.625 1.00 88.40  ? 241 TRP C C   1 
ATOM   7337  O O   . TRP C  1  241 ? 139.761 89.611  148.830 1.00 88.40  ? 241 TRP C O   1 
ATOM   7338  C CB  . TRP C  1  241 ? 139.182 91.236  146.187 1.00 88.40  ? 241 TRP C CB  1 
ATOM   7339  C CG  . TRP C  1  241 ? 138.250 91.353  145.028 1.00 88.40  ? 241 TRP C CG  1 
ATOM   7340  C CD1 . TRP C  1  241 ? 136.897 91.179  145.040 1.00 88.40  ? 241 TRP C CD1 1 
ATOM   7341  C CD2 . TRP C  1  241 ? 138.598 91.707  143.688 1.00 88.40  ? 241 TRP C CD2 1 
ATOM   7342  N NE1 . TRP C  1  241 ? 136.383 91.386  143.784 1.00 88.40  ? 241 TRP C NE1 1 
ATOM   7343  C CE2 . TRP C  1  241 ? 137.408 91.714  142.936 1.00 88.40  ? 241 TRP C CE2 1 
ATOM   7344  C CE3 . TRP C  1  241 ? 139.803 92.013  143.048 1.00 88.40  ? 241 TRP C CE3 1 
ATOM   7345  C CZ2 . TRP C  1  241 ? 137.388 92.013  141.578 1.00 88.40  ? 241 TRP C CZ2 1 
ATOM   7346  C CZ3 . TRP C  1  241 ? 139.781 92.310  141.700 1.00 88.40  ? 241 TRP C CZ3 1 
ATOM   7347  C CH2 . TRP C  1  241 ? 138.582 92.309  140.979 1.00 88.40  ? 241 TRP C CH2 1 
ATOM   7348  N N   . ILE C  1  242 ? 140.036 91.793  149.323 1.00 80.70  ? 242 ILE C N   1 
ATOM   7349  C CA  . ILE C  1  242 ? 141.091 91.531  150.294 1.00 80.70  ? 242 ILE C CA  1 
ATOM   7350  C C   . ILE C  1  242 ? 140.562 90.664  151.427 1.00 80.70  ? 242 ILE C C   1 
ATOM   7351  O O   . ILE C  1  242 ? 139.431 90.836  151.898 1.00 80.70  ? 242 ILE C O   1 
ATOM   7352  C CB  . ILE C  1  242 ? 141.669 92.857  150.816 1.00 80.70  ? 242 ILE C CB  1 
ATOM   7353  C CG1 . ILE C  1  242 ? 142.386 93.596  149.686 1.00 80.70  ? 242 ILE C CG1 1 
ATOM   7354  C CG2 . ILE C  1  242 ? 142.612 92.624  151.982 1.00 80.70  ? 242 ILE C CG2 1 
ATOM   7355  C CD1 . ILE C  1  242 ? 142.796 95.003  150.040 1.00 80.70  ? 242 ILE C CD1 1 
ATOM   7356  N N   . ASN C  1  243 ? 141.385 89.708  151.855 1.00 85.42  ? 243 ASN C N   1 
ATOM   7357  C CA  . ASN C  1  243 ? 141.029 88.823  152.954 1.00 85.42  ? 243 ASN C CA  1 
ATOM   7358  C C   . ASN C  1  243 ? 140.708 89.626  154.210 1.00 85.42  ? 243 ASN C C   1 
ATOM   7359  O O   . ASN C  1  243 ? 141.226 90.724  154.425 1.00 85.42  ? 243 ASN C O   1 
ATOM   7360  C CB  . ASN C  1  243 ? 142.176 87.849  153.231 1.00 85.42  ? 243 ASN C CB  1 
ATOM   7361  C CG  . ASN C  1  243 ? 141.798 86.760  154.215 1.00 85.42  ? 243 ASN C CG  1 
ATOM   7362  O OD1 . ASN C  1  243 ? 140.674 86.715  154.712 1.00 85.42  ? 243 ASN C OD1 1 
ATOM   7363  N ND2 . ASN C  1  243 ? 142.743 85.874  154.503 1.00 85.42  ? 243 ASN C ND2 1 
ATOM   7364  N N   . TYR C  1  244 ? 139.835 89.064  155.045 1.00 87.33  ? 244 TYR C N   1 
ATOM   7365  C CA  . TYR C  1  244 ? 139.477 89.687  156.313 1.00 87.33  ? 244 TYR C CA  1 
ATOM   7366  C C   . TYR C  1  244 ? 140.568 89.556  157.366 1.00 87.33  ? 244 TYR C C   1 
ATOM   7367  O O   . TYR C  1  244 ? 140.419 90.113  158.459 1.00 87.33  ? 244 TYR C O   1 
ATOM   7368  C CB  . TYR C  1  244 ? 138.172 89.091  156.851 1.00 87.33  ? 244 TYR C CB  1 
ATOM   7369  C CG  . TYR C  1  244 ? 138.239 87.608  157.131 1.00 87.33  ? 244 TYR C CG  1 
ATOM   7370  C CD1 . TYR C  1  244 ? 138.721 87.130  158.343 1.00 87.33  ? 244 TYR C CD1 1 
ATOM   7371  C CD2 . TYR C  1  244 ? 137.833 86.684  156.178 1.00 87.33  ? 244 TYR C CD2 1 
ATOM   7372  C CE1 . TYR C  1  244 ? 138.795 85.775  158.599 1.00 87.33  ? 244 TYR C CE1 1 
ATOM   7373  C CE2 . TYR C  1  244 ? 137.894 85.325  156.428 1.00 87.33  ? 244 TYR C CE2 1 
ATOM   7374  C CZ  . TYR C  1  244 ? 138.376 84.876  157.640 1.00 87.33  ? 244 TYR C CZ  1 
ATOM   7375  O OH  . TYR C  1  244 ? 138.442 83.526  157.894 1.00 87.33  ? 244 TYR C OH  1 
ATOM   7376  N N   . ASP C  1  245 ? 141.647 88.830  157.076 1.00 83.46  ? 245 ASP C N   1 
ATOM   7377  C CA  . ASP C  1  245 ? 142.723 88.684  158.049 1.00 83.46  ? 245 ASP C CA  1 
ATOM   7378  C C   . ASP C  1  245 ? 143.502 89.984  158.201 1.00 83.46  ? 245 ASP C C   1 
ATOM   7379  O O   . ASP C  1  245 ? 143.705 90.472  159.319 1.00 83.46  ? 245 ASP C O   1 
ATOM   7380  C CB  . ASP C  1  245 ? 143.648 87.542  157.632 1.00 83.46  ? 245 ASP C CB  1 
ATOM   7381  C CG  . ASP C  1  245 ? 142.964 86.193  157.689 1.00 83.46  ? 245 ASP C CG  1 
ATOM   7382  O OD1 . ASP C  1  245 ? 142.043 86.030  158.516 1.00 83.46  ? 245 ASP C OD1 1 
ATOM   7383  O OD2 . ASP C  1  245 ? 143.345 85.297  156.907 1.00 83.46  ? 245 ASP C OD2 1 
ATOM   7384  N N   . ALA C  1  246 ? 143.940 90.564  157.083 1.00 77.64  ? 246 ALA C N   1 
ATOM   7385  C CA  . ALA C  1  246 ? 144.661 91.836  157.097 1.00 77.64  ? 246 ALA C CA  1 
ATOM   7386  C C   . ALA C  1  246 ? 143.633 92.961  157.091 1.00 77.64  ? 246 ALA C C   1 
ATOM   7387  O O   . ALA C  1  246 ? 143.386 93.623  156.082 1.00 77.64  ? 246 ALA C O   1 
ATOM   7388  C CB  . ALA C  1  246 ? 145.615 91.928  155.914 1.00 77.64  ? 246 ALA C CB  1 
ATOM   7389  N N   . SER C  1  247 ? 143.023 93.174  158.257 1.00 80.19  ? 247 SER C N   1 
ATOM   7390  C CA  . SER C  1  247 ? 141.951 94.158  158.360 1.00 80.19  ? 247 SER C CA  1 
ATOM   7391  C C   . SER C  1  247 ? 142.473 95.583  158.235 1.00 80.19  ? 247 SER C C   1 
ATOM   7392  O O   . SER C  1  247 ? 141.778 96.449  157.687 1.00 80.19  ? 247 SER C O   1 
ATOM   7393  C CB  . SER C  1  247 ? 141.208 93.980  159.683 1.00 80.19  ? 247 SER C CB  1 
ATOM   7394  O OG  . SER C  1  247 ? 142.049 94.273  160.784 1.00 80.19  ? 247 SER C OG  1 
ATOM   7395  N N   . ALA C  1  248 ? 143.686 95.842  158.731 1.00 75.93  ? 248 ALA C N   1 
ATOM   7396  C CA  . ALA C  1  248 ? 144.216 97.201  158.733 1.00 75.93  ? 248 ALA C CA  1 
ATOM   7397  C C   . ALA C  1  248 ? 144.316 97.762  157.322 1.00 75.93  ? 248 ALA C C   1 
ATOM   7398  O O   . ALA C  1  248 ? 144.079 98.955  157.103 1.00 75.93  ? 248 ALA C O   1 
ATOM   7399  C CB  . ALA C  1  248 ? 145.580 97.231  159.421 1.00 75.93  ? 248 ALA C CB  1 
ATOM   7400  N N   . ALA C  1  249 ? 144.654 96.915  156.348 1.00 70.92  ? 249 ALA C N   1 
ATOM   7401  C CA  . ALA C  1  249 ? 144.781 97.386  154.973 1.00 70.92  ? 249 ALA C CA  1 
ATOM   7402  C C   . ALA C  1  249 ? 143.445 97.885  154.435 1.00 70.92  ? 249 ALA C C   1 
ATOM   7403  O O   . ALA C  1  249 ? 143.358 98.983  153.870 1.00 70.92  ? 249 ALA C O   1 
ATOM   7404  C CB  . ALA C  1  249 ? 145.340 96.272  154.089 1.00 70.92  ? 249 ALA C CB  1 
ATOM   7405  N N   . ARG C  1  250 ? 142.385 97.094  154.607 1.00 73.58  ? 250 ARG C N   1 
ATOM   7406  C CA  . ARG C  1  250 ? 141.091 97.527  154.097 1.00 73.58  ? 250 ARG C CA  1 
ATOM   7407  C C   . ARG C  1  250 ? 140.550 98.711  154.888 1.00 73.58  ? 250 ARG C C   1 
ATOM   7408  O O   . ARG C  1  250 ? 139.852 99.558  154.323 1.00 73.58  ? 250 ARG C O   1 
ATOM   7409  C CB  . ARG C  1  250 ? 140.083 96.379  154.112 1.00 73.58  ? 250 ARG C CB  1 
ATOM   7410  C CG  . ARG C  1  250 ? 138.773 96.751  153.430 1.00 73.58  ? 250 ARG C CG  1 
ATOM   7411  C CD  . ARG C  1  250 ? 137.753 95.639  153.470 1.00 73.58  ? 250 ARG C CD  1 
ATOM   7412  N NE  . ARG C  1  250 ? 138.092 94.491  152.640 1.00 73.58  ? 250 ARG C NE  1 
ATOM   7413  C CZ  . ARG C  1  250 ? 137.444 93.332  152.691 1.00 73.58  ? 250 ARG C CZ  1 
ATOM   7414  N NH1 . ARG C  1  250 ? 136.435 93.171  153.537 1.00 73.58  ? 250 ARG C NH1 1 
ATOM   7415  N NH2 . ARG C  1  250 ? 137.805 92.333  151.899 1.00 73.58  ? 250 ARG C NH2 1 
ATOM   7416  N N   . VAL C  1  251 ? 140.862 98.798  156.183 1.00 64.70  ? 251 VAL C N   1 
ATOM   7417  C CA  . VAL C  1  251 ? 140.472 99.980  156.949 1.00 64.70  ? 251 VAL C CA  1 
ATOM   7418  C C   . VAL C  1  251 ? 141.136 101.224 156.372 1.00 64.70  ? 251 VAL C C   1 
ATOM   7419  O O   . VAL C  1  251 ? 140.482 102.249 156.129 1.00 64.70  ? 251 VAL C O   1 
ATOM   7420  C CB  . VAL C  1  251 ? 140.815 99.797  158.438 1.00 64.70  ? 251 VAL C CB  1 
ATOM   7421  C CG1 . VAL C  1  251 ? 140.564 101.084 159.194 1.00 64.70  ? 251 VAL C CG1 1 
ATOM   7422  C CG2 . VAL C  1  251 ? 139.988 98.677  159.033 1.00 64.70  ? 251 VAL C CG2 1 
ATOM   7423  N N   . ALA C  1  252 ? 142.448 101.148 156.143 1.00 56.23  ? 252 ALA C N   1 
ATOM   7424  C CA  . ALA C  1  252 ? 143.168 102.273 155.559 1.00 56.23  ? 252 ALA C CA  1 
ATOM   7425  C C   . ALA C  1  252 ? 142.587 102.655 154.206 1.00 56.23  ? 252 ALA C C   1 
ATOM   7426  O O   . ALA C  1  252 ? 142.453 103.843 153.895 1.00 56.23  ? 252 ALA C O   1 
ATOM   7427  C CB  . ALA C  1  252 ? 144.650 101.931 155.430 1.00 56.23  ? 252 ALA C CB  1 
ATOM   7428  N N   . LEU C  1  253 ? 142.221 101.661 153.394 1.00 60.37  ? 253 LEU C N   1 
ATOM   7429  C CA  . LEU C  1  253 ? 141.650 101.960 152.083 1.00 60.37  ? 253 LEU C CA  1 
ATOM   7430  C C   . LEU C  1  253 ? 140.294 102.644 152.210 1.00 60.37  ? 253 LEU C C   1 
ATOM   7431  O O   . LEU C  1  253 ? 140.030 103.651 151.541 1.00 60.37  ? 253 LEU C O   1 
ATOM   7432  C CB  . LEU C  1  253 ? 141.533 100.683 151.255 1.00 60.37  ? 253 LEU C CB  1 
ATOM   7433  C CG  . LEU C  1  253 ? 142.860 100.071 150.815 1.00 60.37  ? 253 LEU C CG  1 
ATOM   7434  C CD1 . LEU C  1  253 ? 142.629 98.748  150.110 1.00 60.37  ? 253 LEU C CD1 1 
ATOM   7435  C CD2 . LEU C  1  253 ? 143.606 101.039 149.916 1.00 60.37  ? 253 LEU C CD2 1 
ATOM   7436  N N   . GLY C  1  254 ? 139.413 102.103 153.054 1.00 54.28  ? 254 GLY C N   1 
ATOM   7437  C CA  . GLY C  1  254 ? 138.102 102.694 153.244 1.00 54.28  ? 254 GLY C CA  1 
ATOM   7438  C C   . GLY C  1  254 ? 138.136 104.079 153.848 1.00 54.28  ? 254 GLY C C   1 
ATOM   7439  O O   . GLY C  1  254 ? 137.173 104.837 153.690 1.00 54.28  ? 254 GLY C O   1 
ATOM   7440  N N   . ILE C  1  255 ? 139.215 104.424 154.546 1.00 53.46  ? 255 ILE C N   1 
ATOM   7441  C CA  . ILE C  1  255 ? 139.360 105.782 155.061 1.00 53.46  ? 255 ILE C CA  1 
ATOM   7442  C C   . ILE C  1  255 ? 139.919 106.712 153.988 1.00 53.46  ? 255 ILE C C   1 
ATOM   7443  O O   . ILE C  1  255 ? 139.435 107.841 153.790 1.00 53.46  ? 255 ILE C O   1 
ATOM   7444  C CB  . ILE C  1  255 ? 140.257 105.770 156.309 1.00 53.46  ? 255 ILE C CB  1 
ATOM   7445  C CG1 . ILE C  1  255 ? 139.637 104.929 157.418 1.00 53.46  ? 255 ILE C CG1 1 
ATOM   7446  C CG2 . ILE C  1  255 ? 140.463 107.156 156.808 1.00 53.46  ? 255 ILE C CG2 1 
ATOM   7447  C CD1 . ILE C  1  255 ? 140.608 104.638 158.533 1.00 53.46  ? 255 ILE C CD1 1 
ATOM   7448  N N   . THR C  1  256 ? 140.967 106.254 153.298 1.00 53.52  ? 256 THR C N   1 
ATOM   7449  C CA  . THR C  1  256 ? 141.621 107.079 152.295 1.00 53.52  ? 256 THR C CA  1 
ATOM   7450  C C   . THR C  1  256 ? 140.669 107.418 151.160 1.00 53.52  ? 256 THR C C   1 
ATOM   7451  O O   . THR C  1  256 ? 140.705 108.531 150.629 1.00 53.52  ? 256 THR C O   1 
ATOM   7452  C CB  . THR C  1  256 ? 142.860 106.365 151.764 1.00 53.52  ? 256 THR C CB  1 
ATOM   7453  O OG1 . THR C  1  256 ? 143.759 106.106 152.848 1.00 53.52  ? 256 THR C OG1 1 
ATOM   7454  C CG2 . THR C  1  256 ? 143.565 107.216 150.726 1.00 53.52  ? 256 THR C CG2 1 
ATOM   7455  N N   . THR C  1  257 ? 139.805 106.476 150.775 1.00 56.89  ? 257 THR C N   1 
ATOM   7456  C CA  . THR C  1  257 ? 138.830 106.776 149.732 1.00 56.89  ? 257 THR C CA  1 
ATOM   7457  C C   . THR C  1  257 ? 137.898 107.902 150.156 1.00 56.89  ? 257 THR C C   1 
ATOM   7458  O O   . THR C  1  257 ? 137.623 108.815 149.371 1.00 56.89  ? 257 THR C O   1 
ATOM   7459  C CB  . THR C  1  257 ? 138.025 105.529 149.372 1.00 56.89  ? 257 THR C CB  1 
ATOM   7460  O OG1 . THR C  1  257 ? 137.395 105.007 150.547 1.00 56.89  ? 257 THR C OG1 1 
ATOM   7461  C CG2 . THR C  1  257 ? 138.920 104.471 148.748 1.00 56.89  ? 257 THR C CG2 1 
ATOM   7462  N N   . VAL C  1  258 ? 137.408 107.858 151.397 1.00 55.36  ? 258 VAL C N   1 
ATOM   7463  C CA  . VAL C  1  258 ? 136.505 108.900 151.880 1.00 55.36  ? 258 VAL C CA  1 
ATOM   7464  C C   . VAL C  1  258 ? 137.182 110.260 151.829 1.00 55.36  ? 258 VAL C C   1 
ATOM   7465  O O   . VAL C  1  258 ? 136.625 111.236 151.305 1.00 55.36  ? 258 VAL C O   1 
ATOM   7466  C CB  . VAL C  1  258 ? 136.017 108.574 153.302 1.00 55.36  ? 258 VAL C CB  1 
ATOM   7467  C CG1 . VAL C  1  258 ? 135.260 109.755 153.880 1.00 55.36  ? 258 VAL C CG1 1 
ATOM   7468  C CG2 . VAL C  1  258 ? 135.133 107.344 153.281 1.00 55.36  ? 258 VAL C CG2 1 
ATOM   7469  N N   . LEU C  1  259 ? 138.398 110.351 152.370 1.00 55.75  ? 259 LEU C N   1 
ATOM   7470  C CA  . LEU C  1  259 ? 139.005 111.679 152.412 1.00 55.75  ? 259 LEU C CA  1 
ATOM   7471  C C   . LEU C  1  259 ? 139.440 112.146 151.026 1.00 55.75  ? 259 LEU C C   1 
ATOM   7472  O O   . LEU C  1  259 ? 139.345 113.341 150.722 1.00 55.75  ? 259 LEU C O   1 
ATOM   7473  C CB  . LEU C  1  259 ? 140.168 111.725 153.400 1.00 55.75  ? 259 LEU C CB  1 
ATOM   7474  C CG  . LEU C  1  259 ? 140.658 113.165 153.600 1.00 55.75  ? 259 LEU C CG  1 
ATOM   7475  C CD1 . LEU C  1  259 ? 140.985 113.443 155.047 1.00 55.75  ? 259 LEU C CD1 1 
ATOM   7476  C CD2 . LEU C  1  259 ? 141.882 113.447 152.741 1.00 55.75  ? 259 LEU C CD2 1 
ATOM   7477  N N   . THR C  1  260 ? 139.894 111.233 150.167 1.00 56.36  ? 260 THR C N   1 
ATOM   7478  C CA  . THR C  1  260 ? 140.240 111.620 148.807 1.00 56.36  ? 260 THR C CA  1 
ATOM   7479  C C   . THR C  1  260 ? 139.014 112.120 148.056 1.00 56.36  ? 260 THR C C   1 
ATOM   7480  O O   . THR C  1  260 ? 139.095 113.098 147.305 1.00 56.36  ? 260 THR C O   1 
ATOM   7481  C CB  . THR C  1  260 ? 140.879 110.441 148.076 1.00 56.36  ? 260 THR C CB  1 
ATOM   7482  O OG1 . THR C  1  260 ? 142.053 110.027 148.784 1.00 56.36  ? 260 THR C OG1 1 
ATOM   7483  C CG2 . THR C  1  260 ? 141.268 110.838 146.667 1.00 56.36  ? 260 THR C CG2 1 
ATOM   7484  N N   . MET C  1  261 ? 137.864 111.475 148.261 1.00 59.07  ? 261 MET C N   1 
ATOM   7485  C CA  . MET C  1  261 ? 136.636 111.939 147.626 1.00 59.07  ? 261 MET C CA  1 
ATOM   7486  C C   . MET C  1  261 ? 136.242 113.318 148.133 1.00 59.07  ? 261 MET C C   1 
ATOM   7487  O O   . MET C  1  261 ? 135.832 114.181 147.345 1.00 59.07  ? 261 MET C O   1 
ATOM   7488  C CB  . MET C  1  261 ? 135.511 110.936 147.868 1.00 59.07  ? 261 MET C CB  1 
ATOM   7489  C CG  . MET C  1  261 ? 134.222 111.283 147.160 1.00 59.07  ? 261 MET C CG  1 
ATOM   7490  S SD  . MET C  1  261 ? 134.404 111.254 145.372 1.00 59.07  ? 261 MET C SD  1 
ATOM   7491  C CE  . MET C  1  261 ? 133.079 112.356 144.896 1.00 59.07  ? 261 MET C CE  1 
ATOM   7492  N N   . THR C  1  262 ? 136.354 113.545 149.444 1.00 57.79  ? 262 THR C N   1 
ATOM   7493  C CA  . THR C  1  262 ? 136.034 114.865 149.977 1.00 57.79  ? 262 THR C CA  1 
ATOM   7494  C C   . THR C  1  262 ? 136.949 115.935 149.390 1.00 57.79  ? 262 THR C C   1 
ATOM   7495  O O   . THR C  1  262 ? 136.489 117.024 149.023 1.00 57.79  ? 262 THR C O   1 
ATOM   7496  C CB  . THR C  1  262 ? 136.122 114.857 151.502 1.00 57.79  ? 262 THR C CB  1 
ATOM   7497  O OG1 . THR C  1  262 ? 135.171 113.925 152.028 1.00 57.79  ? 262 THR C OG1 1 
ATOM   7498  C CG2 . THR C  1  262 ? 135.823 116.236 152.056 1.00 57.79  ? 262 THR C CG2 1 
ATOM   7499  N N   . THR C  1  263 ? 138.245 115.639 149.277 1.00 61.28  ? 263 THR C N   1 
ATOM   7500  C CA  . THR C  1  263 ? 139.169 116.620 148.714 1.00 61.28  ? 263 THR C CA  1 
ATOM   7501  C C   . THR C  1  263 ? 138.886 116.869 147.239 1.00 61.28  ? 263 THR C C   1 
ATOM   7502  O O   . THR C  1  263 ? 138.980 118.009 146.771 1.00 61.28  ? 263 THR C O   1 
ATOM   7503  C CB  . THR C  1  263 ? 140.613 116.166 148.902 1.00 61.28  ? 263 THR C CB  1 
ATOM   7504  O OG1 . THR C  1  263 ? 140.800 114.893 148.273 1.00 61.28  ? 263 THR C OG1 1 
ATOM   7505  C CG2 . THR C  1  263 ? 140.956 116.070 150.377 1.00 61.28  ? 263 THR C CG2 1 
ATOM   7506  N N   . ILE C  1  264 ? 138.550 115.818 146.487 1.00 67.54  ? 264 ILE C N   1 
ATOM   7507  C CA  . ILE C  1  264 ? 138.197 116.000 145.081 1.00 67.54  ? 264 ILE C CA  1 
ATOM   7508  C C   . ILE C  1  264 ? 136.975 116.893 144.951 1.00 67.54  ? 264 ILE C C   1 
ATOM   7509  O O   . ILE C  1  264 ? 136.936 117.797 144.109 1.00 67.54  ? 264 ILE C O   1 
ATOM   7510  C CB  . ILE C  1  264 ? 137.978 114.639 144.397 1.00 67.54  ? 264 ILE C CB  1 
ATOM   7511  C CG1 . ILE C  1  264 ? 139.304 113.892 144.258 1.00 67.54  ? 264 ILE C CG1 1 
ATOM   7512  C CG2 . ILE C  1  264 ? 137.306 114.821 143.049 1.00 67.54  ? 264 ILE C CG2 1 
ATOM   7513  C CD1 . ILE C  1  264 ? 139.152 112.466 143.791 1.00 67.54  ? 264 ILE C CD1 1 
ATOM   7514  N N   . ASN C  1  265 ? 135.961 116.661 145.786 1.00 66.04  ? 265 ASN C N   1 
ATOM   7515  C CA  . ASN C  1  265 ? 134.770 117.504 145.759 1.00 66.04  ? 265 ASN C CA  1 
ATOM   7516  C C   . ASN C  1  265 ? 135.119 118.956 146.064 1.00 66.04  ? 265 ASN C C   1 
ATOM   7517  O O   . ASN C  1  265 ? 134.691 119.874 145.351 1.00 66.04  ? 265 ASN C O   1 
ATOM   7518  C CB  . ASN C  1  265 ? 133.740 116.976 146.755 1.00 66.04  ? 265 ASN C CB  1 
ATOM   7519  C CG  . ASN C  1  265 ? 132.400 117.670 146.634 1.00 66.04  ? 265 ASN C CG  1 
ATOM   7520  O OD1 . ASN C  1  265 ? 132.213 118.550 145.796 1.00 66.04  ? 265 ASN C OD1 1 
ATOM   7521  N ND2 . ASN C  1  265 ? 131.458 117.281 147.484 1.00 66.04  ? 265 ASN C ND2 1 
ATOM   7522  N N   . THR C  1  266 ? 135.896 119.185 147.125 1.00 64.42  ? 266 THR C N   1 
ATOM   7523  C CA  . THR C  1  266 ? 136.223 120.555 147.508 1.00 64.42  ? 266 THR C CA  1 
ATOM   7524  C C   . THR C  1  266 ? 137.038 121.258 146.431 1.00 64.42  ? 266 THR C C   1 
ATOM   7525  O O   . THR C  1  266 ? 136.834 122.448 146.170 1.00 64.42  ? 266 THR C O   1 
ATOM   7526  C CB  . THR C  1  266 ? 136.970 120.573 148.839 1.00 64.42  ? 266 THR C CB  1 
ATOM   7527  O OG1 . THR C  1  266 ? 138.159 119.782 148.733 1.00 64.42  ? 266 THR C OG1 1 
ATOM   7528  C CG2 . THR C  1  266 ? 136.089 120.029 149.952 1.00 64.42  ? 266 THR C CG2 1 
ATOM   7529  N N   . HIS C  1  267 ? 137.966 120.544 145.791 1.00 74.61  ? 267 HIS C N   1 
ATOM   7530  C CA  . HIS C  1  267 ? 138.762 121.172 144.742 1.00 74.61  ? 267 HIS C CA  1 
ATOM   7531  C C   . HIS C  1  267 ? 137.930 121.431 143.494 1.00 74.61  ? 267 HIS C C   1 
ATOM   7532  O O   . HIS C  1  267 ? 138.139 122.433 142.801 1.00 74.61  ? 267 HIS C O   1 
ATOM   7533  C CB  . HIS C  1  267 ? 139.973 120.313 144.396 1.00 74.61  ? 267 HIS C CB  1 
ATOM   7534  C CG  . HIS C  1  267 ? 140.841 120.911 143.333 1.00 74.61  ? 267 HIS C CG  1 
ATOM   7535  N ND1 . HIS C  1  267 ? 141.690 121.969 143.576 1.00 74.61  ? 267 HIS C ND1 1 
ATOM   7536  C CD2 . HIS C  1  267 ? 140.973 120.617 142.018 1.00 74.61  ? 267 HIS C CD2 1 
ATOM   7537  C CE1 . HIS C  1  267 ? 142.319 122.291 142.460 1.00 74.61  ? 267 HIS C CE1 1 
ATOM   7538  N NE2 . HIS C  1  267 ? 141.901 121.487 141.499 1.00 74.61  ? 267 HIS C NE2 1 
ATOM   7539  N N   . LEU C  1  268 ? 136.987 120.541 143.186 1.00 72.82  ? 268 LEU C N   1 
ATOM   7540  C CA  . LEU C  1  268 ? 136.150 120.745 142.012 1.00 72.82  ? 268 LEU C CA  1 
ATOM   7541  C C   . LEU C  1  268 ? 135.162 121.881 142.222 1.00 72.82  ? 268 LEU C C   1 
ATOM   7542  O O   . LEU C  1  268 ? 134.754 122.533 141.254 1.00 72.82  ? 268 LEU C O   1 
ATOM   7543  C CB  . LEU C  1  268 ? 135.412 119.455 141.665 1.00 72.82  ? 268 LEU C CB  1 
ATOM   7544  C CG  . LEU C  1  268 ? 134.521 119.503 140.427 1.00 72.82  ? 268 LEU C CG  1 
ATOM   7545  C CD1 . LEU C  1  268 ? 135.345 119.828 139.199 1.00 72.82  ? 268 LEU C CD1 1 
ATOM   7546  C CD2 . LEU C  1  268 ? 133.796 118.184 140.251 1.00 72.82  ? 268 LEU C CD2 1 
ATOM   7547  N N   . ARG C  1  269 ? 134.774 122.142 143.467 1.00 74.52  ? 269 ARG C N   1 
ATOM   7548  C CA  . ARG C  1  269 ? 133.819 123.216 143.708 1.00 74.52  ? 269 ARG C CA  1 
ATOM   7549  C C   . ARG C  1  269 ? 134.418 124.608 143.544 1.00 74.52  ? 269 ARG C C   1 
ATOM   7550  O O   . ARG C  1  269 ? 133.698 125.591 143.749 1.00 74.52  ? 269 ARG C O   1 
ATOM   7551  C CB  . ARG C  1  269 ? 133.209 123.068 145.101 1.00 74.52  ? 269 ARG C CB  1 
ATOM   7552  C CG  . ARG C  1  269 ? 132.304 121.855 145.229 1.00 74.52  ? 269 ARG C CG  1 
ATOM   7553  C CD  . ARG C  1  269 ? 131.732 121.720 146.626 1.00 74.52  ? 269 ARG C CD  1 
ATOM   7554  N NE  . ARG C  1  269 ? 130.986 120.476 146.785 1.00 74.52  ? 269 ARG C NE  1 
ATOM   7555  C CZ  . ARG C  1  269 ? 129.692 120.341 146.520 1.00 74.52  ? 269 ARG C CZ  1 
ATOM   7556  N NH1 . ARG C  1  269 ? 128.990 121.377 146.083 1.00 74.52  ? 269 ARG C NH1 1 
ATOM   7557  N NH2 . ARG C  1  269 ? 129.098 119.168 146.694 1.00 74.52  ? 269 ARG C NH2 1 
ATOM   7558  N N   . GLU C  1  270 ? 135.696 124.730 143.190 1.00 75.62  ? 270 GLU C N   1 
ATOM   7559  C CA  . GLU C  1  270 ? 136.300 126.032 142.930 1.00 75.62  ? 270 GLU C CA  1 
ATOM   7560  C C   . GLU C  1  270 ? 136.389 126.364 141.446 1.00 75.62  ? 270 GLU C C   1 
ATOM   7561  O O   . GLU C  1  270 ? 135.967 127.447 141.032 1.00 75.62  ? 270 GLU C O   1 
ATOM   7562  C CB  . GLU C  1  270 ? 137.694 126.108 143.559 1.00 75.62  ? 270 GLU C CB  1 
ATOM   7563  C CG  . GLU C  1  270 ? 137.684 126.143 145.071 1.00 75.62  ? 270 GLU C CG  1 
ATOM   7564  C CD  . GLU C  1  270 ? 139.076 126.253 145.651 1.00 75.62  ? 270 GLU C CD  1 
ATOM   7565  O OE1 . GLU C  1  270 ? 140.053 126.195 144.875 1.00 75.62  ? 270 GLU C OE1 1 
ATOM   7566  O OE2 . GLU C  1  270 ? 139.196 126.394 146.884 1.00 75.62  ? 270 GLU C OE2 1 
ATOM   7567  N N   . THR C  1  271 ? 136.935 125.457 140.632 1.00 74.07  ? 271 THR C N   1 
ATOM   7568  C CA  . THR C  1  271 ? 137.122 125.762 139.216 1.00 74.07  ? 271 THR C CA  1 
ATOM   7569  C C   . THR C  1  271 ? 135.794 125.916 138.487 1.00 74.07  ? 271 THR C C   1 
ATOM   7570  O O   . THR C  1  271 ? 135.724 126.624 137.477 1.00 74.07  ? 271 THR C O   1 
ATOM   7571  C CB  . THR C  1  271 ? 137.965 124.681 138.542 1.00 74.07  ? 271 THR C CB  1 
ATOM   7572  O OG1 . THR C  1  271 ? 137.281 123.426 138.617 1.00 74.07  ? 271 THR C OG1 1 
ATOM   7573  C CG2 . THR C  1  271 ? 139.316 124.556 139.226 1.00 74.07  ? 271 THR C CG2 1 
ATOM   7574  N N   . LEU C  1  272 ? 134.742 125.263 138.968 1.00 65.46  ? 272 LEU C N   1 
ATOM   7575  C CA  . LEU C  1  272 ? 133.428 125.437 138.381 1.00 65.46  ? 272 LEU C CA  1 
ATOM   7576  C C   . LEU C  1  272 ? 132.918 126.854 138.637 1.00 65.46  ? 272 LEU C C   1 
ATOM   7577  O O   . LEU C  1  272 ? 133.340 127.512 139.590 1.00 65.46  ? 272 LEU C O   1 
ATOM   7578  C CB  . LEU C  1  272 ? 132.452 124.413 138.953 1.00 65.46  ? 272 LEU C CB  1 
ATOM   7579  C CG  . LEU C  1  272 ? 132.718 122.959 138.575 1.00 65.46  ? 272 LEU C CG  1 
ATOM   7580  C CD1 . LEU C  1  272 ? 131.729 122.044 139.273 1.00 65.46  ? 272 LEU C CD1 1 
ATOM   7581  C CD2 . LEU C  1  272 ? 132.650 122.786 137.070 1.00 65.46  ? 272 LEU C CD2 1 
ATOM   7582  N N   . PRO C  1  273 ? 132.015 127.349 137.792 1.00 64.56  ? 273 PRO C N   1 
ATOM   7583  C CA  . PRO C  1  273 ? 131.470 128.694 138.013 1.00 64.56  ? 273 PRO C CA  1 
ATOM   7584  C C   . PRO C  1  273 ? 130.672 128.751 139.305 1.00 64.56  ? 273 PRO C C   1 
ATOM   7585  O O   . PRO C  1  273 ? 129.846 127.881 139.586 1.00 64.56  ? 273 PRO C O   1 
ATOM   7586  C CB  . PRO C  1  273 ? 130.583 128.920 136.785 1.00 64.56  ? 273 PRO C CB  1 
ATOM   7587  C CG  . PRO C  1  273 ? 130.215 127.554 136.333 1.00 64.56  ? 273 PRO C CG  1 
ATOM   7588  C CD  . PRO C  1  273 ? 131.413 126.701 136.615 1.00 64.56  ? 273 PRO C CD  1 
ATOM   7589  N N   . LYS C  1  274 ? 130.926 129.790 140.094 1.00 66.81  ? 274 LYS C N   1 
ATOM   7590  C CA  . LYS C  1  274 ? 130.320 129.927 141.415 1.00 66.81  ? 274 LYS C CA  1 
ATOM   7591  C C   . LYS C  1  274 ? 128.869 130.360 141.247 1.00 66.81  ? 274 LYS C C   1 
ATOM   7592  O O   . LYS C  1  274 ? 128.581 131.536 141.022 1.00 66.81  ? 274 LYS C O   1 
ATOM   7593  C CB  . LYS C  1  274 ? 131.112 130.918 142.261 1.00 66.81  ? 274 LYS C CB  1 
ATOM   7594  C CG  . LYS C  1  274 ? 130.627 131.052 143.696 1.00 66.81  ? 274 LYS C CG  1 
ATOM   7595  C CD  . LYS C  1  274 ? 129.766 132.292 143.878 1.00 66.81  ? 274 LYS C CD  1 
ATOM   7596  C CE  . LYS C  1  274 ? 129.292 132.433 145.314 1.00 66.81  ? 274 LYS C CE  1 
ATOM   7597  N NZ  . LYS C  1  274 ? 130.424 132.669 146.251 1.00 66.81  ? 274 LYS C NZ  1 
ATOM   7598  N N   . ILE C  1  275 ? 127.947 129.402 141.348 1.00 64.00  ? 275 ILE C N   1 
ATOM   7599  C CA  . ILE C  1  275 ? 126.519 129.675 141.321 1.00 64.00  ? 275 ILE C CA  1 
ATOM   7600  C C   . ILE C  1  275 ? 125.885 129.069 142.568 1.00 64.00  ? 275 ILE C C   1 
ATOM   7601  O O   . ILE C  1  275 ? 126.089 127.886 142.852 1.00 64.00  ? 275 ILE C O   1 
ATOM   7602  C CB  . ILE C  1  275 ? 125.836 129.146 140.048 1.00 64.00  ? 275 ILE C CB  1 
ATOM   7603  C CG1 . ILE C  1  275 ? 126.074 127.649 139.875 1.00 64.00  ? 275 ILE C CG1 1 
ATOM   7604  C CG2 . ILE C  1  275 ? 126.343 129.890 138.830 1.00 64.00  ? 275 ILE C CG2 1 
ATOM   7605  C CD1 . ILE C  1  275 ? 125.227 127.040 138.797 1.00 64.00  ? 275 ILE C CD1 1 
ATOM   7606  N N   . PRO C  1  276 ? 125.156 129.833 143.357 1.00 60.17  ? 276 PRO C N   1 
ATOM   7607  C CA  . PRO C  1  276 ? 124.762 129.360 144.690 1.00 60.17  ? 276 PRO C CA  1 
ATOM   7608  C C   . PRO C  1  276 ? 123.522 128.480 144.753 1.00 60.17  ? 276 PRO C C   1 
ATOM   7609  O O   . PRO C  1  276 ? 122.951 128.336 145.836 1.00 60.17  ? 276 PRO C O   1 
ATOM   7610  C CB  . PRO C  1  276 ? 124.535 130.667 145.460 1.00 60.17  ? 276 PRO C CB  1 
ATOM   7611  C CG  . PRO C  1  276 ? 125.285 131.706 144.687 1.00 60.17  ? 276 PRO C CG  1 
ATOM   7612  C CD  . PRO C  1  276 ? 125.123 131.298 143.266 1.00 60.17  ? 276 PRO C CD  1 
ATOM   7613  N N   . TYR C  1  277 ? 123.070 127.901 143.645 1.00 62.75  ? 277 TYR C N   1 
ATOM   7614  C CA  . TYR C  1  277 ? 121.939 126.986 143.705 1.00 62.75  ? 277 TYR C CA  1 
ATOM   7615  C C   . TYR C  1  277 ? 122.332 125.608 143.184 1.00 62.75  ? 277 TYR C C   1 
ATOM   7616  O O   . TYR C  1  277 ? 123.360 125.436 142.524 1.00 62.75  ? 277 TYR C O   1 
ATOM   7617  C CB  . TYR C  1  277 ? 120.731 127.525 142.933 1.00 62.75  ? 277 TYR C CB  1 
ATOM   7618  C CG  . TYR C  1  277 ? 120.947 127.699 141.454 1.00 62.75  ? 277 TYR C CG  1 
ATOM   7619  C CD1 . TYR C  1  277 ? 121.472 128.876 140.950 1.00 62.75  ? 277 TYR C CD1 1 
ATOM   7620  C CD2 . TYR C  1  277 ? 120.597 126.701 140.560 1.00 62.75  ? 277 TYR C CD2 1 
ATOM   7621  C CE1 . TYR C  1  277 ? 121.662 129.049 139.600 1.00 62.75  ? 277 TYR C CE1 1 
ATOM   7622  C CE2 . TYR C  1  277 ? 120.783 126.865 139.205 1.00 62.75  ? 277 TYR C CE2 1 
ATOM   7623  C CZ  . TYR C  1  277 ? 121.315 128.042 138.732 1.00 62.75  ? 277 TYR C CZ  1 
ATOM   7624  O OH  . TYR C  1  277 ? 121.504 128.214 137.383 1.00 62.75  ? 277 TYR C OH  1 
ATOM   7625  N N   . VAL C  1  278 ? 121.481 124.627 143.491 1.00 63.49  ? 278 VAL C N   1 
ATOM   7626  C CA  . VAL C  1  278 ? 121.820 123.221 143.301 1.00 63.49  ? 278 VAL C CA  1 
ATOM   7627  C C   . VAL C  1  278 ? 121.993 122.906 141.822 1.00 63.49  ? 278 VAL C C   1 
ATOM   7628  O O   . VAL C  1  278 ? 121.241 123.393 140.968 1.00 63.49  ? 278 VAL C O   1 
ATOM   7629  C CB  . VAL C  1  278 ? 120.738 122.330 143.934 1.00 63.49  ? 278 VAL C CB  1 
ATOM   7630  C CG1 . VAL C  1  278 ? 120.999 120.867 143.635 1.00 63.49  ? 278 VAL C CG1 1 
ATOM   7631  C CG2 . VAL C  1  278 ? 120.681 122.559 145.428 1.00 63.49  ? 278 VAL C CG2 1 
ATOM   7632  N N   . LYS C  1  279 ? 122.990 122.084 141.516 1.00 65.02  ? 279 LYS C N   1 
ATOM   7633  C CA  . LYS C  1  279 ? 123.259 121.590 140.175 1.00 65.02  ? 279 LYS C CA  1 
ATOM   7634  C C   . LYS C  1  279 ? 123.040 120.078 140.142 1.00 65.02  ? 279 LYS C C   1 
ATOM   7635  O O   . LYS C  1  279 ? 122.576 119.475 141.112 1.00 65.02  ? 279 LYS C O   1 
ATOM   7636  C CB  . LYS C  1  279 ? 124.680 121.955 139.743 1.00 65.02  ? 279 LYS C CB  1 
ATOM   7637  C CG  . LYS C  1  279 ? 124.898 123.430 139.502 1.00 65.02  ? 279 LYS C CG  1 
ATOM   7638  C CD  . LYS C  1  279 ? 126.301 123.699 138.995 1.00 65.02  ? 279 LYS C CD  1 
ATOM   7639  C CE  . LYS C  1  279 ? 127.214 124.164 140.113 1.00 65.02  ? 279 LYS C CE  1 
ATOM   7640  N NZ  . LYS C  1  279 ? 127.607 123.061 141.025 1.00 65.02  ? 279 LYS C NZ  1 
ATOM   7641  N N   . ALA C  1  280 ? 123.374 119.469 139.007 1.00 64.82  ? 280 ALA C N   1 
ATOM   7642  C CA  . ALA C  1  280 ? 123.331 118.020 138.869 1.00 64.82  ? 280 ALA C CA  1 
ATOM   7643  C C   . ALA C  1  280 ? 124.650 117.367 139.256 1.00 64.82  ? 280 ALA C C   1 
ATOM   7644  O O   . ALA C  1  280 ? 124.657 116.296 139.876 1.00 64.82  ? 280 ALA C O   1 
ATOM   7645  C CB  . ALA C  1  280 ? 122.968 117.639 137.433 1.00 64.82  ? 280 ALA C CB  1 
ATOM   7646  N N   . ILE C  1  281 ? 125.771 117.995 138.892 1.00 69.46  ? 281 ILE C N   1 
ATOM   7647  C CA  . ILE C  1  281 ? 127.080 117.442 139.219 1.00 69.46  ? 281 ILE C CA  1 
ATOM   7648  C C   . ILE C  1  281 ? 127.267 117.342 140.728 1.00 69.46  ? 281 ILE C C   1 
ATOM   7649  O O   . ILE C  1  281 ? 127.912 116.409 141.221 1.00 69.46  ? 281 ILE C O   1 
ATOM   7650  C CB  . ILE C  1  281 ? 128.188 118.279 138.547 1.00 69.46  ? 281 ILE C CB  1 
ATOM   7651  C CG1 . ILE C  1  281 ? 129.541 117.586 138.666 1.00 69.46  ? 281 ILE C CG1 1 
ATOM   7652  C CG2 . ILE C  1  281 ? 128.253 119.678 139.131 1.00 69.46  ? 281 ILE C CG2 1 
ATOM   7653  C CD1 . ILE C  1  281 ? 130.596 118.184 137.769 1.00 69.46  ? 281 ILE C CD1 1 
ATOM   7654  N N   . ASP C  1  282 ? 126.682 118.272 141.489 1.00 81.03  ? 282 ASP C N   1 
ATOM   7655  C CA  . ASP C  1  282 ? 126.768 118.188 142.943 1.00 81.03  ? 282 ASP C CA  1 
ATOM   7656  C C   . ASP C  1  282 ? 125.989 116.993 143.477 1.00 81.03  ? 282 ASP C C   1 
ATOM   7657  O O   . ASP C  1  282 ? 126.460 116.294 144.382 1.00 81.03  ? 282 ASP C O   1 
ATOM   7658  C CB  . ASP C  1  282 ? 126.270 119.482 143.582 1.00 81.03  ? 282 ASP C CB  1 
ATOM   7659  C CG  . ASP C  1  282 ? 127.251 120.623 143.421 1.00 81.03  ? 282 ASP C CG  1 
ATOM   7660  O OD1 . ASP C  1  282 ? 128.467 120.352 143.340 1.00 81.03  ? 282 ASP C OD1 1 
ATOM   7661  O OD2 . ASP C  1  282 ? 126.809 121.790 143.384 1.00 81.03  ? 282 ASP C OD2 1 
ATOM   7662  N N   . MET C  1  283 ? 124.796 116.741 142.932 1.00 80.14  ? 283 MET C N   1 
ATOM   7663  C CA  . MET C  1  283 ? 124.046 115.557 143.336 1.00 80.14  ? 283 MET C CA  1 
ATOM   7664  C C   . MET C  1  283 ? 124.815 114.288 142.997 1.00 80.14  ? 283 MET C C   1 
ATOM   7665  O O   . MET C  1  283 ? 124.821 113.328 143.775 1.00 80.14  ? 283 MET C O   1 
ATOM   7666  C CB  . MET C  1  283 ? 122.674 115.548 142.668 1.00 80.14  ? 283 MET C CB  1 
ATOM   7667  C CG  . MET C  1  283 ? 121.781 116.701 143.087 1.00 80.14  ? 283 MET C CG  1 
ATOM   7668  S SD  . MET C  1  283 ? 121.469 116.733 144.859 1.00 80.14  ? 283 MET C SD  1 
ATOM   7669  C CE  . MET C  1  283 ? 120.443 115.282 145.046 1.00 80.14  ? 283 MET C CE  1 
ATOM   7670  N N   . TYR C  1  284 ? 125.489 114.278 141.848 1.00 73.60  ? 284 TYR C N   1 
ATOM   7671  C CA  . TYR C  1  284 ? 126.279 113.117 141.450 1.00 73.60  ? 284 TYR C CA  1 
ATOM   7672  C C   . TYR C  1  284 ? 127.429 112.873 142.424 1.00 73.60  ? 284 TYR C C   1 
ATOM   7673  O O   . TYR C  1  284 ? 127.662 111.739 142.874 1.00 73.60  ? 284 TYR C O   1 
ATOM   7674  C CB  . TYR C  1  284 ? 126.794 113.338 140.029 1.00 73.60  ? 284 TYR C CB  1 
ATOM   7675  C CG  . TYR C  1  284 ? 127.520 112.175 139.410 1.00 73.60  ? 284 TYR C CG  1 
ATOM   7676  C CD1 . TYR C  1  284 ? 126.829 111.065 138.957 1.00 73.60  ? 284 TYR C CD1 1 
ATOM   7677  C CD2 . TYR C  1  284 ? 128.895 112.204 139.243 1.00 73.60  ? 284 TYR C CD2 1 
ATOM   7678  C CE1 . TYR C  1  284 ? 127.488 110.005 138.376 1.00 73.60  ? 284 TYR C CE1 1 
ATOM   7679  C CE2 . TYR C  1  284 ? 129.563 111.150 138.664 1.00 73.60  ? 284 TYR C CE2 1 
ATOM   7680  C CZ  . TYR C  1  284 ? 128.856 110.053 138.231 1.00 73.60  ? 284 TYR C CZ  1 
ATOM   7681  O OH  . TYR C  1  284 ? 129.520 108.999 137.652 1.00 73.60  ? 284 TYR C OH  1 
ATOM   7682  N N   . LEU C  1  285 ? 128.160 113.936 142.765 1.00 69.95  ? 285 LEU C N   1 
ATOM   7683  C CA  . LEU C  1  285 ? 129.270 113.796 143.700 1.00 69.95  ? 285 LEU C CA  1 
ATOM   7684  C C   . LEU C  1  285 ? 128.780 113.351 145.073 1.00 69.95  ? 285 LEU C C   1 
ATOM   7685  O O   . LEU C  1  285 ? 129.418 112.515 145.728 1.00 69.95  ? 285 LEU C O   1 
ATOM   7686  C CB  . LEU C  1  285 ? 130.039 115.111 143.800 1.00 69.95  ? 285 LEU C CB  1 
ATOM   7687  C CG  . LEU C  1  285 ? 130.697 115.576 142.501 1.00 69.95  ? 285 LEU C CG  1 
ATOM   7688  C CD1 . LEU C  1  285 ? 131.371 116.925 142.683 1.00 69.95  ? 285 LEU C CD1 1 
ATOM   7689  C CD2 . LEU C  1  285 ? 131.678 114.547 142.002 1.00 69.95  ? 285 LEU C CD2 1 
ATOM   7690  N N   . MET C  1  286 ? 127.645 113.890 145.526 1.00 73.59  ? 286 MET C N   1 
ATOM   7691  C CA  . MET C  1  286 ? 127.103 113.461 146.810 1.00 73.59  ? 286 MET C CA  1 
ATOM   7692  C C   . MET C  1  286 ? 126.676 111.999 146.764 1.00 73.59  ? 286 MET C C   1 
ATOM   7693  O O   . MET C  1  286 ? 126.820 111.270 147.752 1.00 73.59  ? 286 MET C O   1 
ATOM   7694  C CB  . MET C  1  286 ? 125.931 114.348 147.223 1.00 73.59  ? 286 MET C CB  1 
ATOM   7695  C CG  . MET C  1  286 ? 125.442 114.054 148.627 1.00 73.59  ? 286 MET C CG  1 
ATOM   7696  S SD  . MET C  1  286 ? 126.711 114.447 149.844 1.00 73.59  ? 286 MET C SD  1 
ATOM   7697  C CE  . MET C  1  286 ? 126.303 113.292 151.149 1.00 73.59  ? 286 MET C CE  1 
ATOM   7698  N N   . GLY C  1  287 ? 126.156 111.549 145.622 1.00 63.97  ? 287 GLY C N   1 
ATOM   7699  C CA  . GLY C  1  287 ? 125.837 110.139 145.481 1.00 63.97  ? 287 GLY C CA  1 
ATOM   7700  C C   . GLY C  1  287 ? 127.060 109.258 145.641 1.00 63.97  ? 287 GLY C C   1 
ATOM   7701  O O   . GLY C  1  287 ? 127.030 108.252 146.356 1.00 63.97  ? 287 GLY C O   1 
ATOM   7702  N N   . CYS C  1  288 ? 128.158 109.628 144.978 1.00 62.57  ? 288 CYS C N   1 
ATOM   7703  C CA  . CYS C  1  288 ? 129.384 108.841 145.113 1.00 62.57  ? 288 CYS C CA  1 
ATOM   7704  C C   . CYS C  1  288 ? 129.891 108.848 146.553 1.00 62.57  ? 288 CYS C C   1 
ATOM   7705  O O   . CYS C  1  288 ? 130.377 107.823 147.063 1.00 62.57  ? 288 CYS C O   1 
ATOM   7706  C CB  . CYS C  1  288 ? 130.456 109.363 144.161 1.00 62.57  ? 288 CYS C CB  1 
ATOM   7707  S SG  . CYS C  1  288 ? 130.068 109.126 142.416 1.00 62.57  ? 288 CYS C SG  1 
ATOM   7708  N N   . PHE C  1  289 ? 129.795 110.001 147.220 1.00 60.83  ? 289 PHE C N   1 
ATOM   7709  C CA  . PHE C  1  289 ? 130.174 110.081 148.627 1.00 60.83  ? 289 PHE C CA  1 
ATOM   7710  C C   . PHE C  1  289 ? 129.345 109.119 149.469 1.00 60.83  ? 289 PHE C C   1 
ATOM   7711  O O   . PHE C  1  289 ? 129.876 108.422 150.345 1.00 60.83  ? 289 PHE C O   1 
ATOM   7712  C CB  . PHE C  1  289 ? 130.009 111.517 149.120 1.00 60.83  ? 289 PHE C CB  1 
ATOM   7713  C CG  . PHE C  1  289 ? 130.478 111.741 150.525 1.00 60.83  ? 289 PHE C CG  1 
ATOM   7714  C CD1 . PHE C  1  289 ? 131.826 111.835 150.809 1.00 60.83  ? 289 PHE C CD1 1 
ATOM   7715  C CD2 . PHE C  1  289 ? 129.571 111.877 151.559 1.00 60.83  ? 289 PHE C CD2 1 
ATOM   7716  C CE1 . PHE C  1  289 ? 132.263 112.050 152.098 1.00 60.83  ? 289 PHE C CE1 1 
ATOM   7717  C CE2 . PHE C  1  289 ? 130.002 112.092 152.851 1.00 60.83  ? 289 PHE C CE2 1 
ATOM   7718  C CZ  . PHE C  1  289 ? 131.351 112.178 153.120 1.00 60.83  ? 289 PHE C CZ  1 
ATOM   7719  N N   . VAL C  1  290 ? 128.039 109.057 149.204 1.00 64.91  ? 290 VAL C N   1 
ATOM   7720  C CA  . VAL C  1  290 ? 127.176 108.129 149.928 1.00 64.91  ? 290 VAL C CA  1 
ATOM   7721  C C   . VAL C  1  290 ? 127.592 106.690 149.656 1.00 64.91  ? 290 VAL C C   1 
ATOM   7722  O O   . VAL C  1  290 ? 127.592 105.851 150.564 1.00 64.91  ? 290 VAL C O   1 
ATOM   7723  C CB  . VAL C  1  290 ? 125.700 108.372 149.568 1.00 64.91  ? 290 VAL C CB  1 
ATOM   7724  C CG1 . VAL C  1  290 ? 124.823 107.294 150.172 1.00 64.91  ? 290 VAL C CG1 1 
ATOM   7725  C CG2 . VAL C  1  290 ? 125.261 109.732 150.067 1.00 64.91  ? 290 VAL C CG2 1 
ATOM   7726  N N   . PHE C  1  291 ? 127.957 106.380 148.409 1.00 68.68  ? 291 PHE C N   1 
ATOM   7727  C CA  . PHE C  1  291 ? 128.397 105.020 148.100 1.00 68.68  ? 291 PHE C CA  1 
ATOM   7728  C C   . PHE C  1  291 ? 129.607 104.624 148.937 1.00 68.68  ? 291 PHE C C   1 
ATOM   7729  O O   . PHE C  1  291 ? 129.617 103.559 149.571 1.00 68.68  ? 291 PHE C O   1 
ATOM   7730  C CB  . PHE C  1  291 ? 128.720 104.862 146.614 1.00 68.68  ? 291 PHE C CB  1 
ATOM   7731  C CG  . PHE C  1  291 ? 127.514 104.729 145.737 1.00 68.68  ? 291 PHE C CG  1 
ATOM   7732  C CD1 . PHE C  1  291 ? 126.755 103.576 145.764 1.00 68.68  ? 291 PHE C CD1 1 
ATOM   7733  C CD2 . PHE C  1  291 ? 127.177 105.721 144.839 1.00 68.68  ? 291 PHE C CD2 1 
ATOM   7734  C CE1 . PHE C  1  291 ? 125.651 103.440 144.950 1.00 68.68  ? 291 PHE C CE1 1 
ATOM   7735  C CE2 . PHE C  1  291 ? 126.077 105.588 144.017 1.00 68.68  ? 291 PHE C CE2 1 
ATOM   7736  C CZ  . PHE C  1  291 ? 125.315 104.447 144.071 1.00 68.68  ? 291 PHE C CZ  1 
ATOM   7737  N N   . VAL C  1  292 ? 130.645 105.463 148.943 1.00 65.41  ? 292 VAL C N   1 
ATOM   7738  C CA  . VAL C  1  292 ? 131.861 105.074 149.656 1.00 65.41  ? 292 VAL C CA  1 
ATOM   7739  C C   . VAL C  1  292 ? 131.604 105.010 151.160 1.00 65.41  ? 292 VAL C C   1 
ATOM   7740  O O   . VAL C  1  292 ? 132.139 104.136 151.861 1.00 65.41  ? 292 VAL C O   1 
ATOM   7741  C CB  . VAL C  1  292 ? 133.031 106.012 149.308 1.00 65.41  ? 292 VAL C CB  1 
ATOM   7742  C CG1 . VAL C  1  292 ? 133.352 105.922 147.828 1.00 65.41  ? 292 VAL C CG1 1 
ATOM   7743  C CG2 . VAL C  1  292 ? 132.723 107.438 149.693 1.00 65.41  ? 292 VAL C CG2 1 
ATOM   7744  N N   . PHE C  1  293 ? 130.757 105.903 151.676 1.00 63.45  ? 293 PHE C N   1 
ATOM   7745  C CA  . PHE C  1  293 ? 130.441 105.864 153.099 1.00 63.45  ? 293 PHE C CA  1 
ATOM   7746  C C   . PHE C  1  293 ? 129.687 104.590 153.466 1.00 63.45  ? 293 PHE C C   1 
ATOM   7747  O O   . PHE C  1  293 ? 129.962 103.972 154.505 1.00 63.45  ? 293 PHE C O   1 
ATOM   7748  C CB  . PHE C  1  293 ? 129.639 107.105 153.477 1.00 63.45  ? 293 PHE C CB  1 
ATOM   7749  C CG  . PHE C  1  293 ? 129.298 107.186 154.927 1.00 63.45  ? 293 PHE C CG  1 
ATOM   7750  C CD1 . PHE C  1  293 ? 130.269 107.480 155.862 1.00 63.45  ? 293 PHE C CD1 1 
ATOM   7751  C CD2 . PHE C  1  293 ? 128.000 106.995 155.352 1.00 63.45  ? 293 PHE C CD2 1 
ATOM   7752  C CE1 . PHE C  1  293 ? 129.955 107.562 157.198 1.00 63.45  ? 293 PHE C CE1 1 
ATOM   7753  C CE2 . PHE C  1  293 ? 127.678 107.082 156.684 1.00 63.45  ? 293 PHE C CE2 1 
ATOM   7754  C CZ  . PHE C  1  293 ? 128.657 107.362 157.610 1.00 63.45  ? 293 PHE C CZ  1 
ATOM   7755  N N   . MET C  1  294 ? 128.739 104.176 152.621 1.00 76.52  ? 294 MET C N   1 
ATOM   7756  C CA  . MET C  1  294 ? 128.025 102.929 152.867 1.00 76.52  ? 294 MET C CA  1 
ATOM   7757  C C   . MET C  1  294 ? 128.968 101.738 152.816 1.00 76.52  ? 294 MET C C   1 
ATOM   7758  O O   . MET C  1  294 ? 128.837 100.801 153.611 1.00 76.52  ? 294 MET C O   1 
ATOM   7759  C CB  . MET C  1  294 ? 126.892 102.757 151.855 1.00 76.52  ? 294 MET C CB  1 
ATOM   7760  C CG  . MET C  1  294 ? 125.754 103.744 152.023 1.00 76.52  ? 294 MET C CG  1 
ATOM   7761  S SD  . MET C  1  294 ? 124.957 103.594 153.630 1.00 76.52  ? 294 MET C SD  1 
ATOM   7762  C CE  . MET C  1  294 ? 124.179 101.990 153.464 1.00 76.52  ? 294 MET C CE  1 
ATOM   7763  N N   . ALA C  1  295 ? 129.927 101.754 151.888 1.00 65.97  ? 295 ALA C N   1 
ATOM   7764  C CA  . ALA C  1  295 ? 130.896 100.662 151.823 1.00 65.97  ? 295 ALA C CA  1 
ATOM   7765  C C   . ALA C  1  295 ? 131.708 100.569 153.109 1.00 65.97  ? 295 ALA C C   1 
ATOM   7766  O O   . ALA C  1  295 ? 131.931 99.471  153.642 1.00 65.97  ? 295 ALA C O   1 
ATOM   7767  C CB  . ALA C  1  295 ? 131.818 100.848 150.620 1.00 65.97  ? 295 ALA C CB  1 
ATOM   7768  N N   . LEU C  1  296 ? 132.150 101.714 153.632 1.00 63.04  ? 296 LEU C N   1 
ATOM   7769  C CA  . LEU C  1  296 ? 132.951 101.679 154.852 1.00 63.04  ? 296 LEU C CA  1 
ATOM   7770  C C   . LEU C  1  296 ? 132.125 101.217 156.049 1.00 63.04  ? 296 LEU C C   1 
ATOM   7771  O O   . LEU C  1  296 ? 132.612 100.439 156.882 1.00 63.04  ? 296 LEU C O   1 
ATOM   7772  C CB  . LEU C  1  296 ? 133.581 103.045 155.108 1.00 63.04  ? 296 LEU C CB  1 
ATOM   7773  C CG  . LEU C  1  296 ? 134.546 103.090 156.289 1.00 63.04  ? 296 LEU C CG  1 
ATOM   7774  C CD1 . LEU C  1  296 ? 135.617 102.043 156.102 1.00 63.04  ? 296 LEU C CD1 1 
ATOM   7775  C CD2 . LEU C  1  296 ? 135.183 104.458 156.376 1.00 63.04  ? 296 LEU C CD2 1 
ATOM   7776  N N   . LEU C  1  297 ? 130.869 101.667 156.151 1.00 71.33  ? 297 LEU C N   1 
ATOM   7777  C CA  . LEU C  1  297 ? 130.008 101.166 157.223 1.00 71.33  ? 297 LEU C CA  1 
ATOM   7778  C C   . LEU C  1  297 ? 129.780 99.665  157.097 1.00 71.33  ? 297 LEU C C   1 
ATOM   7779  O O   . LEU C  1  297 ? 129.742 98.945  158.104 1.00 71.33  ? 297 LEU C O   1 
ATOM   7780  C CB  . LEU C  1  297 ? 128.665 101.890 157.228 1.00 71.33  ? 297 LEU C CB  1 
ATOM   7781  C CG  . LEU C  1  297 ? 128.617 103.348 157.664 1.00 71.33  ? 297 LEU C CG  1 
ATOM   7782  C CD1 . LEU C  1  297 ? 127.192 103.850 157.535 1.00 71.33  ? 297 LEU C CD1 1 
ATOM   7783  C CD2 . LEU C  1  297 ? 129.116 103.488 159.088 1.00 71.33  ? 297 LEU C CD2 1 
ATOM   7784  N N   . GLU C  1  298 ? 129.601 99.180  155.868 1.00 75.30  ? 298 GLU C N   1 
ATOM   7785  C CA  . GLU C  1  298 ? 129.426 97.751  155.643 1.00 75.30  ? 298 GLU C CA  1 
ATOM   7786  C C   . GLU C  1  298 ? 130.627 96.971  156.154 1.00 75.30  ? 298 GLU C C   1 
ATOM   7787  O O   . GLU C  1  298 ? 130.477 95.944  156.830 1.00 75.30  ? 298 GLU C O   1 
ATOM   7788  C CB  . GLU C  1  298 ? 129.196 97.494  154.154 1.00 75.30  ? 298 GLU C CB  1 
ATOM   7789  C CG  . GLU C  1  298 ? 128.867 96.064  153.792 1.00 75.30  ? 298 GLU C CG  1 
ATOM   7790  C CD  . GLU C  1  298 ? 130.108 95.237  153.537 1.00 75.30  ? 298 GLU C CD  1 
ATOM   7791  O OE1 . GLU C  1  298 ? 131.138 95.820  153.138 1.00 75.30  ? 298 GLU C OE1 1 
ATOM   7792  O OE2 . GLU C  1  298 ? 130.052 94.005  153.722 1.00 75.30  ? 298 GLU C OE2 1 
ATOM   7793  N N   . TYR C  1  299 ? 131.834 97.448  155.848 1.00 80.23  ? 299 TYR C N   1 
ATOM   7794  C CA  . TYR C  1  299 ? 133.007 96.732  156.336 1.00 80.23  ? 299 TYR C CA  1 
ATOM   7795  C C   . TYR C  1  299 ? 133.121 96.806  157.852 1.00 80.23  ? 299 TYR C C   1 
ATOM   7796  O O   . TYR C  1  299 ? 133.573 95.849  158.488 1.00 80.23  ? 299 TYR C O   1 
ATOM   7797  C CB  . TYR C  1  299 ? 134.291 97.246  155.698 1.00 80.23  ? 299 TYR C CB  1 
ATOM   7798  C CG  . TYR C  1  299 ? 135.479 96.516  156.271 1.00 80.23  ? 299 TYR C CG  1 
ATOM   7799  C CD1 . TYR C  1  299 ? 135.663 95.165  156.018 1.00 80.23  ? 299 TYR C CD1 1 
ATOM   7800  C CD2 . TYR C  1  299 ? 136.398 97.163  157.084 1.00 80.23  ? 299 TYR C CD2 1 
ATOM   7801  C CE1 . TYR C  1  299 ? 136.734 94.479  156.543 1.00 80.23  ? 299 TYR C CE1 1 
ATOM   7802  C CE2 . TYR C  1  299 ? 137.477 96.484  157.614 1.00 80.23  ? 299 TYR C CE2 1 
ATOM   7803  C CZ  . TYR C  1  299 ? 137.639 95.141  157.338 1.00 80.23  ? 299 TYR C CZ  1 
ATOM   7804  O OH  . TYR C  1  299 ? 138.707 94.450  157.857 1.00 80.23  ? 299 TYR C OH  1 
ATOM   7805  N N   . ALA C  1  300 ? 132.741 97.935  158.451 1.00 73.79  ? 300 ALA C N   1 
ATOM   7806  C CA  . ALA C  1  300 ? 132.756 98.018  159.910 1.00 73.79  ? 300 ALA C CA  1 
ATOM   7807  C C   . ALA C  1  300 ? 131.828 96.975  160.521 1.00 73.79  ? 300 ALA C C   1 
ATOM   7808  O O   . ALA C  1  300 ? 132.188 96.283  161.485 1.00 73.79  ? 300 ALA C O   1 
ATOM   7809  C CB  . ALA C  1  300 ? 132.364 99.424  160.362 1.00 73.79  ? 300 ALA C CB  1 
ATOM   7810  N N   . LEU C  1  301 ? 130.625 96.844  159.959 1.00 80.56  ? 301 LEU C N   1 
ATOM   7811  C CA  . LEU C  1  301 ? 129.686 95.833  160.434 1.00 80.56  ? 301 LEU C CA  1 
ATOM   7812  C C   . LEU C  1  301 ? 130.274 94.434  160.298 1.00 80.56  ? 301 LEU C C   1 
ATOM   7813  O O   . LEU C  1  301 ? 130.195 93.619  161.226 1.00 80.56  ? 301 LEU C O   1 
ATOM   7814  C CB  . LEU C  1  301 ? 128.370 95.938  159.666 1.00 80.56  ? 301 LEU C CB  1 
ATOM   7815  C CG  . LEU C  1  301 ? 127.272 94.965  160.093 1.00 80.56  ? 301 LEU C CG  1 
ATOM   7816  C CD1 . LEU C  1  301 ? 126.867 95.221  161.533 1.00 80.56  ? 301 LEU C CD1 1 
ATOM   7817  C CD2 . LEU C  1  301 ? 126.074 95.080  159.168 1.00 80.56  ? 301 LEU C CD2 1 
ATOM   7818  N N   . VAL C  1  302 ? 130.866 94.139  159.138 1.00 79.11  ? 302 VAL C N   1 
ATOM   7819  C CA  . VAL C  1  302 ? 131.441 92.814  158.911 1.00 79.11  ? 302 VAL C CA  1 
ATOM   7820  C C   . VAL C  1  302 ? 132.553 92.531  159.913 1.00 79.11  ? 302 VAL C C   1 
ATOM   7821  O O   . VAL C  1  302 ? 132.656 91.422  160.452 1.00 79.11  ? 302 VAL C O   1 
ATOM   7822  C CB  . VAL C  1  302 ? 131.940 92.690  157.460 1.00 79.11  ? 302 VAL C CB  1 
ATOM   7823  C CG1 . VAL C  1  302 ? 132.716 91.401  157.272 1.00 79.11  ? 302 VAL C CG1 1 
ATOM   7824  C CG2 . VAL C  1  302 ? 130.768 92.734  156.504 1.00 79.11  ? 302 VAL C CG2 1 
ATOM   7825  N N   . ASN C  1  303 ? 133.397 93.526  160.185 1.00 76.91  ? 303 ASN C N   1 
ATOM   7826  C CA  . ASN C  1  303 ? 134.495 93.326  161.122 1.00 76.91  ? 303 ASN C CA  1 
ATOM   7827  C C   . ASN C  1  303 ? 133.987 93.129  162.543 1.00 76.91  ? 303 ASN C C   1 
ATOM   7828  O O   . ASN C  1  303 ? 134.619 92.413  163.328 1.00 76.91  ? 303 ASN C O   1 
ATOM   7829  C CB  . ASN C  1  303 ? 135.460 94.509  161.060 1.00 76.91  ? 303 ASN C CB  1 
ATOM   7830  C CG  . ASN C  1  303 ? 136.852 94.161  161.559 1.00 76.91  ? 303 ASN C CG  1 
ATOM   7831  O OD1 . ASN C  1  303 ? 137.810 94.896  161.319 1.00 76.91  ? 303 ASN C OD1 1 
ATOM   7832  N ND2 . ASN C  1  303 ? 136.973 93.033  162.248 1.00 76.91  ? 303 ASN C ND2 1 
ATOM   7833  N N   . TYR C  1  304 ? 132.863 93.752  162.900 1.00 84.25  ? 304 TYR C N   1 
ATOM   7834  C CA  . TYR C  1  304 ? 132.361 93.554  164.257 1.00 84.25  ? 304 TYR C CA  1 
ATOM   7835  C C   . TYR C  1  304 ? 131.656 92.213  164.422 1.00 84.25  ? 304 TYR C C   1 
ATOM   7836  O O   . TYR C  1  304 ? 131.821 91.550  165.451 1.00 84.25  ? 304 TYR C O   1 
ATOM   7837  C CB  . TYR C  1  304 ? 131.419 94.685  164.662 1.00 84.25  ? 304 TYR C CB  1 
ATOM   7838  C CG  . TYR C  1  304 ? 130.871 94.510  166.063 1.00 84.25  ? 304 TYR C CG  1 
ATOM   7839  C CD1 . TYR C  1  304 ? 131.676 94.718  167.174 1.00 84.25  ? 304 TYR C CD1 1 
ATOM   7840  C CD2 . TYR C  1  304 ? 129.551 94.131  166.274 1.00 84.25  ? 304 TYR C CD2 1 
ATOM   7841  C CE1 . TYR C  1  304 ? 131.183 94.557  168.454 1.00 84.25  ? 304 TYR C CE1 1 
ATOM   7842  C CE2 . TYR C  1  304 ? 129.049 93.969  167.552 1.00 84.25  ? 304 TYR C CE2 1 
ATOM   7843  C CZ  . TYR C  1  304 ? 129.869 94.184  168.637 1.00 84.25  ? 304 TYR C CZ  1 
ATOM   7844  O OH  . TYR C  1  304 ? 129.376 94.024  169.910 1.00 84.25  ? 304 TYR C OH  1 
ATOM   7845  N N   . ILE C  1  305 ? 130.858 91.798  163.434 1.00 83.61  ? 305 ILE C N   1 
ATOM   7846  C CA  . ILE C  1  305 ? 130.039 90.597  163.606 1.00 83.61  ? 305 ILE C CA  1 
ATOM   7847  C C   . ILE C  1  305 ? 130.781 89.304  163.312 1.00 83.61  ? 305 ILE C C   1 
ATOM   7848  O O   . ILE C  1  305 ? 130.241 88.225  163.581 1.00 83.61  ? 305 ILE C O   1 
ATOM   7849  C CB  . ILE C  1  305 ? 128.787 90.644  162.712 1.00 83.61  ? 305 ILE C CB  1 
ATOM   7850  C CG1 . ILE C  1  305 ? 129.187 90.629  161.236 1.00 83.61  ? 305 ILE C CG1 1 
ATOM   7851  C CG2 . ILE C  1  305 ? 127.954 91.873  163.028 1.00 83.61  ? 305 ILE C CG2 1 
ATOM   7852  C CD1 . ILE C  1  305 ? 128.021 90.489  160.288 1.00 83.61  ? 305 ILE C CD1 1 
ATOM   7853  N N   . PHE C  1  306 ? 131.998 89.377  162.769 1.00 91.99  ? 306 PHE C N   1 
ATOM   7854  C CA  . PHE C  1  306 ? 132.671 88.166  162.308 1.00 91.99  ? 306 PHE C CA  1 
ATOM   7855  C C   . PHE C  1  306 ? 133.020 87.230  163.458 1.00 91.99  ? 306 PHE C C   1 
ATOM   7856  O O   . PHE C  1  306 ? 132.885 86.008  163.329 1.00 91.99  ? 306 PHE C O   1 
ATOM   7857  C CB  . PHE C  1  306 ? 133.937 88.519  161.530 1.00 91.99  ? 306 PHE C CB  1 
ATOM   7858  C CG  . PHE C  1  306 ? 134.698 87.316  161.059 1.00 91.99  ? 306 PHE C CG  1 
ATOM   7859  C CD1 . PHE C  1  306 ? 134.261 86.591  159.966 1.00 91.99  ? 306 PHE C CD1 1 
ATOM   7860  C CD2 . PHE C  1  306 ? 135.832 86.891  161.729 1.00 91.99  ? 306 PHE C CD2 1 
ATOM   7861  C CE1 . PHE C  1  306 ? 134.949 85.478  159.536 1.00 91.99  ? 306 PHE C CE1 1 
ATOM   7862  C CE2 . PHE C  1  306 ? 136.522 85.776  161.304 1.00 91.99  ? 306 PHE C CE2 1 
ATOM   7863  C CZ  . PHE C  1  306 ? 136.076 85.067  160.208 1.00 91.99  ? 306 PHE C CZ  1 
ATOM   7864  N N   . PHE C  1  307 ? 133.485 87.778  164.582 1.00 89.23  ? 307 PHE C N   1 
ATOM   7865  C CA  . PHE C  1  307 ? 134.031 86.931  165.638 1.00 89.23  ? 307 PHE C CA  1 
ATOM   7866  C C   . PHE C  1  307 ? 132.980 85.997  166.224 1.00 89.23  ? 307 PHE C C   1 
ATOM   7867  O O   . PHE C  1  307 ? 133.323 84.938  166.761 1.00 89.23  ? 307 PHE C O   1 
ATOM   7868  C CB  . PHE C  1  307 ? 134.645 87.794  166.738 1.00 89.23  ? 307 PHE C CB  1 
ATOM   7869  C CG  . PHE C  1  307 ? 135.336 87.003  167.808 1.00 89.23  ? 307 PHE C CG  1 
ATOM   7870  C CD1 . PHE C  1  307 ? 136.582 86.447  167.578 1.00 89.23  ? 307 PHE C CD1 1 
ATOM   7871  C CD2 . PHE C  1  307 ? 134.738 86.809  169.041 1.00 89.23  ? 307 PHE C CD2 1 
ATOM   7872  C CE1 . PHE C  1  307 ? 137.222 85.717  168.558 1.00 89.23  ? 307 PHE C CE1 1 
ATOM   7873  C CE2 . PHE C  1  307 ? 135.373 86.080  170.026 1.00 89.23  ? 307 PHE C CE2 1 
ATOM   7874  C CZ  . PHE C  1  307 ? 136.617 85.533  169.784 1.00 89.23  ? 307 PHE C CZ  1 
ATOM   7875  N N   . SER C  1  308 ? 131.701 86.363  166.133 1.00 83.04  ? 308 SER C N   1 
ATOM   7876  C CA  . SER C  1  308 ? 130.649 85.485  166.629 1.00 83.04  ? 308 SER C CA  1 
ATOM   7877  C C   . SER C  1  308 ? 130.291 84.409  165.610 1.00 83.04  ? 308 SER C C   1 
ATOM   7878  O O   . SER C  1  308 ? 130.076 83.249  165.978 1.00 83.04  ? 308 SER C O   1 
ATOM   7879  C CB  . SER C  1  308 ? 129.411 86.302  166.997 1.00 83.04  ? 308 SER C CB  1 
ATOM   7880  O OG  . SER C  1  308 ? 128.828 86.890  165.849 1.00 83.04  ? 308 SER C OG  1 
ATOM   7881  N N   . GLN C  1  309 ? 130.219 84.773  164.333 1.00 88.19  ? 309 GLN C N   1 
ATOM   7882  C CA  . GLN C  1  309 ? 129.833 83.844  163.278 1.00 88.19  ? 309 GLN C CA  1 
ATOM   7883  C C   . GLN C  1  309 ? 130.607 84.124  161.994 1.00 88.19  ? 309 GLN C C   1 
ATOM   7884  O O   . GLN C  1  309 ? 130.514 85.223  161.434 1.00 88.19  ? 309 GLN C O   1 
ATOM   7885  C CB  . GLN C  1  309 ? 128.319 83.916  163.055 1.00 88.19  ? 309 GLN C CB  1 
ATOM   7886  C CG  . GLN C  1  309 ? 127.789 85.308  162.736 1.00 88.19  ? 309 GLN C CG  1 
ATOM   7887  C CD  . GLN C  1  309 ? 126.278 85.352  162.626 1.00 88.19  ? 309 GLN C CD  1 
ATOM   7888  O OE1 . GLN C  1  309 ? 125.605 84.325  162.716 1.00 88.19  ? 309 GLN C OE1 1 
ATOM   7889  N NE2 . GLN C  1  309 ? 125.736 86.549  162.438 1.00 88.19  ? 309 GLN C NE2 1 
ATOM   7890  N N   . PRO C  1  310 ? 131.394 83.164  161.504 1.00 89.64  ? 310 PRO C N   1 
ATOM   7891  C CA  . PRO C  1  310 ? 132.213 83.415  160.308 1.00 89.64  ? 310 PRO C CA  1 
ATOM   7892  C C   . PRO C  1  310 ? 131.443 83.283  159.002 1.00 89.64  ? 310 PRO C C   1 
ATOM   7893  O O   . PRO C  1  310 ? 131.767 83.954  158.015 1.00 89.64  ? 310 PRO C O   1 
ATOM   7894  C CB  . PRO C  1  310 ? 133.313 82.352  160.416 1.00 89.64  ? 310 PRO C CB  1 
ATOM   7895  C CG  . PRO C  1  310 ? 132.670 81.239  161.169 1.00 89.64  ? 310 PRO C CG  1 
ATOM   7896  C CD  . PRO C  1  310 ? 131.729 81.882  162.147 1.00 89.64  ? 310 PRO C CD  1 
ATOM   7897  N N   . ALA C  1  311 ? 130.419 82.424  158.984 1.00 83.85  ? 311 ALA C N   1 
ATOM   7898  C CA  . ALA C  1  311 ? 129.680 82.189  157.747 1.00 83.85  ? 311 ALA C CA  1 
ATOM   7899  C C   . ALA C  1  311 ? 128.872 83.410  157.334 1.00 83.85  ? 311 ALA C C   1 
ATOM   7900  O O   . ALA C  1  311 ? 128.696 83.658  156.135 1.00 83.85  ? 311 ALA C O   1 
ATOM   7901  C CB  . ALA C  1  311 ? 128.764 80.976  157.900 1.00 83.85  ? 311 ALA C CB  1 
ATOM   7902  N N   . ARG C  1  312 ? 128.395 84.192  158.304 1.00 84.30  ? 312 ARG C N   1 
ATOM   7903  C CA  . ARG C  1  312 ? 127.680 85.421  157.982 1.00 84.30  ? 312 ARG C CA  1 
ATOM   7904  C C   . ARG C  1  312 ? 128.547 86.351  157.143 1.00 84.30  ? 312 ARG C C   1 
ATOM   7905  O O   . ARG C  1  312 ? 128.133 86.810  156.072 1.00 84.30  ? 312 ARG C O   1 
ATOM   7906  C CB  . ARG C  1  312 ? 127.231 86.110  159.269 1.00 84.30  ? 312 ARG C CB  1 
ATOM   7907  C CG  . ARG C  1  312 ? 126.522 87.432  159.058 1.00 84.30  ? 312 ARG C CG  1 
ATOM   7908  C CD  . ARG C  1  312 ? 125.201 87.243  158.343 1.00 84.30  ? 312 ARG C CD  1 
ATOM   7909  N NE  . ARG C  1  312 ? 124.236 86.506  159.151 1.00 84.30  ? 312 ARG C NE  1 
ATOM   7910  C CZ  . ARG C  1  312 ? 123.102 86.003  158.677 1.00 84.30  ? 312 ARG C CZ  1 
ATOM   7911  N NH1 . ARG C  1  312 ? 122.792 86.156  157.397 1.00 84.30  ? 312 ARG C NH1 1 
ATOM   7912  N NH2 . ARG C  1  312 ? 122.279 85.346  159.482 1.00 84.30  ? 312 ARG C NH2 1 
ATOM   7913  N N   . ALA C  1  313 ? 129.771 86.616  157.602 1.00 77.94  ? 313 ALA C N   1 
ATOM   7914  C CA  . ALA C  1  313 ? 130.665 87.496  156.859 1.00 77.94  ? 313 ALA C CA  1 
ATOM   7915  C C   . ALA C  1  313 ? 131.133 86.850  155.560 1.00 77.94  ? 313 ALA C C   1 
ATOM   7916  O O   . ALA C  1  313 ? 131.280 87.534  154.539 1.00 77.94  ? 313 ALA C O   1 
ATOM   7917  C CB  . ALA C  1  313 ? 131.860 87.879  157.727 1.00 77.94  ? 313 ALA C CB  1 
ATOM   7918  N N   . ALA C  1  314 ? 131.389 85.539  155.581 1.00 77.71  ? 314 ALA C N   1 
ATOM   7919  C CA  . ALA C  1  314 ? 131.831 84.861  154.367 1.00 77.71  ? 314 ALA C CA  1 
ATOM   7920  C C   . ALA C  1  314 ? 130.759 84.892  153.286 1.00 77.71  ? 314 ALA C C   1 
ATOM   7921  O O   . ALA C  1  314 ? 131.077 84.811  152.094 1.00 77.71  ? 314 ALA C O   1 
ATOM   7922  C CB  . ALA C  1  314 ? 132.230 83.421  154.680 1.00 77.71  ? 314 ALA C CB  1 
ATOM   7923  N N   . ALA C  1  315 ? 129.489 84.986  153.679 1.00 86.27  ? 315 ALA C N   1 
ATOM   7924  C CA  . ALA C  1  315 ? 128.425 85.190  152.703 1.00 86.27  ? 315 ALA C CA  1 
ATOM   7925  C C   . ALA C  1  315 ? 128.327 86.654  152.291 1.00 86.27  ? 315 ALA C C   1 
ATOM   7926  O O   . ALA C  1  315 ? 128.216 86.964  151.099 1.00 86.27  ? 315 ALA C O   1 
ATOM   7927  C CB  . ALA C  1  315 ? 127.091 84.698  153.265 1.00 86.27  ? 315 ALA C CB  1 
ATOM   7928  N N   . ILE C  1  316 ? 128.364 87.564  153.269 1.00 84.48  ? 316 ILE C N   1 
ATOM   7929  C CA  . ILE C  1  316 ? 128.175 88.984  152.984 1.00 84.48  ? 316 ILE C CA  1 
ATOM   7930  C C   . ILE C  1  316 ? 129.241 89.510  152.037 1.00 84.48  ? 316 ILE C C   1 
ATOM   7931  O O   . ILE C  1  316 ? 128.953 90.354  151.183 1.00 84.48  ? 316 ILE C O   1 
ATOM   7932  C CB  . ILE C  1  316 ? 128.129 89.787  154.299 1.00 84.48  ? 316 ILE C CB  1 
ATOM   7933  C CG1 . ILE C  1  316 ? 126.836 89.477  155.057 1.00 84.48  ? 316 ILE C CG1 1 
ATOM   7934  C CG2 . ILE C  1  316 ? 128.260 91.275  154.038 1.00 84.48  ? 316 ILE C CG2 1 
ATOM   7935  C CD1 . ILE C  1  316 ? 126.799 90.036  156.456 1.00 84.48  ? 316 ILE C CD1 1 
ATOM   7936  N N   . ASP C  1  317 ? 130.477 89.020  152.148 1.00 92.18  ? 317 ASP C N   1 
ATOM   7937  C CA  . ASP C  1  317 ? 131.515 89.464  151.221 1.00 92.18  ? 317 ASP C CA  1 
ATOM   7938  C C   . ASP C  1  317 ? 131.145 89.130  149.779 1.00 92.18  ? 317 ASP C C   1 
ATOM   7939  O O   . ASP C  1  317 ? 131.168 90.002  148.899 1.00 92.18  ? 317 ASP C O   1 
ATOM   7940  C CB  . ASP C  1  317 ? 132.861 88.840  151.589 1.00 92.18  ? 317 ASP C CB  1 
ATOM   7941  C CG  . ASP C  1  317 ? 133.477 89.469  152.822 1.00 92.18  ? 317 ASP C CG  1 
ATOM   7942  O OD1 . ASP C  1  317 ? 133.219 90.665  153.072 1.00 92.18  ? 317 ASP C OD1 1 
ATOM   7943  O OD2 . ASP C  1  317 ? 134.228 88.772  153.536 1.00 92.18  ? 317 ASP C OD2 1 
ATOM   7944  N N   . ARG C  1  318 ? 130.793 87.868  149.519 1.00 91.23  ? 318 ARG C N   1 
ATOM   7945  C CA  . ARG C  1  318 ? 130.493 87.455  148.155 1.00 91.23  ? 318 ARG C CA  1 
ATOM   7946  C C   . ARG C  1  318 ? 129.185 88.043  147.645 1.00 91.23  ? 318 ARG C C   1 
ATOM   7947  O O   . ARG C  1  318 ? 129.022 88.183  146.429 1.00 91.23  ? 318 ARG C O   1 
ATOM   7948  C CB  . ARG C  1  318 ? 130.461 85.928  148.053 1.00 91.23  ? 318 ARG C CB  1 
ATOM   7949  C CG  . ARG C  1  318 ? 129.289 85.272  148.755 1.00 91.23  ? 318 ARG C CG  1 
ATOM   7950  C CD  . ARG C  1  318 ? 129.378 83.759  148.685 1.00 91.23  ? 318 ARG C CD  1 
ATOM   7951  N NE  . ARG C  1  318 ? 130.477 83.236  149.488 1.00 91.23  ? 318 ARG C NE  1 
ATOM   7952  C CZ  . ARG C  1  318 ? 130.873 81.967  149.471 1.00 91.23  ? 318 ARG C CZ  1 
ATOM   7953  N NH1 . ARG C  1  318 ? 130.260 81.091  148.688 1.00 91.23  ? 318 ARG C NH1 1 
ATOM   7954  N NH2 . ARG C  1  318 ? 131.882 81.574  150.235 1.00 91.23  ? 318 ARG C NH2 1 
ATOM   7955  N N   . TRP C  1  319 ? 128.250 88.394  148.535 1.00 90.83  ? 319 TRP C N   1 
ATOM   7956  C CA  . TRP C  1  319 ? 127.038 89.058  148.062 1.00 90.83  ? 319 TRP C CA  1 
ATOM   7957  C C   . TRP C  1  319 ? 127.292 90.532  147.761 1.00 90.83  ? 319 TRP C C   1 
ATOM   7958  O O   . TRP C  1  319 ? 126.768 91.066  146.777 1.00 90.83  ? 319 TRP C O   1 
ATOM   7959  C CB  . TRP C  1  319 ? 125.899 88.916  149.073 1.00 90.83  ? 319 TRP C CB  1 
ATOM   7960  C CG  . TRP C  1  319 ? 125.335 87.528  149.186 1.00 90.83  ? 319 TRP C CG  1 
ATOM   7961  C CD1 . TRP C  1  319 ? 125.574 86.627  150.179 1.00 90.83  ? 319 TRP C CD1 1 
ATOM   7962  C CD2 . TRP C  1  319 ? 124.444 86.880  148.268 1.00 90.83  ? 319 TRP C CD2 1 
ATOM   7963  N NE1 . TRP C  1  319 ? 124.887 85.464  149.946 1.00 90.83  ? 319 TRP C NE1 1 
ATOM   7964  C CE2 . TRP C  1  319 ? 124.186 85.592  148.777 1.00 90.83  ? 319 TRP C CE2 1 
ATOM   7965  C CE3 . TRP C  1  319 ? 123.839 87.263  147.068 1.00 90.83  ? 319 TRP C CE3 1 
ATOM   7966  C CZ2 . TRP C  1  319 ? 123.351 84.687  148.131 1.00 90.83  ? 319 TRP C CZ2 1 
ATOM   7967  C CZ3 . TRP C  1  319 ? 123.009 86.361  146.428 1.00 90.83  ? 319 TRP C CZ3 1 
ATOM   7968  C CH2 . TRP C  1  319 ? 122.774 85.089  146.961 1.00 90.83  ? 319 TRP C CH2 1 
ATOM   7969  N N   . SER C  1  320 ? 128.098 91.204  148.586 1.00 84.39  ? 320 SER C N   1 
ATOM   7970  C CA  . SER C  1  320 ? 128.374 92.617  148.356 1.00 84.39  ? 320 SER C CA  1 
ATOM   7971  C C   . SER C  1  320 ? 129.209 92.820  147.102 1.00 84.39  ? 320 SER C C   1 
ATOM   7972  O O   . SER C  1  320 ? 128.972 93.770  146.341 1.00 84.39  ? 320 SER C O   1 
ATOM   7973  C CB  . SER C  1  320 ? 129.082 93.216  149.569 1.00 84.39  ? 320 SER C CB  1 
ATOM   7974  O OG  . SER C  1  320 ? 128.248 93.194  150.713 1.00 84.39  ? 320 SER C OG  1 
ATOM   7975  N N   . ARG C  1  321 ? 130.188 91.936  146.867 1.00 85.91  ? 321 ARG C N   1 
ATOM   7976  C CA  . ARG C  1  321 ? 131.021 92.051  145.674 1.00 85.91  ? 321 ARG C CA  1 
ATOM   7977  C C   . ARG C  1  321 ? 130.190 92.152  144.404 1.00 85.91  ? 321 ARG C C   1 
ATOM   7978  O O   . ARG C  1  321 ? 130.598 92.814  143.444 1.00 85.91  ? 321 ARG C O   1 
ATOM   7979  C CB  . ARG C  1  321 ? 131.971 90.856  145.568 1.00 85.91  ? 321 ARG C CB  1 
ATOM   7980  C CG  . ARG C  1  321 ? 133.090 90.822  146.593 1.00 85.91  ? 321 ARG C CG  1 
ATOM   7981  C CD  . ARG C  1  321 ? 133.966 89.599  146.377 1.00 85.91  ? 321 ARG C CD  1 
ATOM   7982  N NE  . ARG C  1  321 ? 135.028 89.495  147.371 1.00 85.91  ? 321 ARG C NE  1 
ATOM   7983  C CZ  . ARG C  1  321 ? 135.898 88.493  147.427 1.00 85.91  ? 321 ARG C CZ  1 
ATOM   7984  N NH1 . ARG C  1  321 ? 135.832 87.508  146.543 1.00 85.91  ? 321 ARG C NH1 1 
ATOM   7985  N NH2 . ARG C  1  321 ? 136.833 88.472  148.366 1.00 85.91  ? 321 ARG C NH2 1 
ATOM   7986  N N   . ILE C  1  322 ? 129.021 91.512  144.379 1.00 84.64  ? 322 ILE C N   1 
ATOM   7987  C CA  . ILE C  1  322 ? 128.172 91.535  143.195 1.00 84.64  ? 322 ILE C CA  1 
ATOM   7988  C C   . ILE C  1  322 ? 126.992 92.490  143.322 1.00 84.64  ? 322 ILE C C   1 
ATOM   7989  O O   . ILE C  1  322 ? 126.383 92.834  142.298 1.00 84.64  ? 322 ILE C O   1 
ATOM   7990  C CB  . ILE C  1  322 ? 127.667 90.119  142.851 1.00 84.64  ? 322 ILE C CB  1 
ATOM   7991  C CG1 . ILE C  1  322 ? 126.821 89.557  143.994 1.00 84.64  ? 322 ILE C CG1 1 
ATOM   7992  C CG2 . ILE C  1  322 ? 128.837 89.200  142.541 1.00 84.64  ? 322 ILE C CG2 1 
ATOM   7993  C CD1 . ILE C  1  322 ? 126.098 88.275  143.646 1.00 84.64  ? 322 ILE C CD1 1 
ATOM   7994  N N   . PHE C  1  323 ? 126.644 92.925  144.533 1.00 87.70  ? 323 PHE C N   1 
ATOM   7995  C CA  . PHE C  1  323 ? 125.538 93.864  144.680 1.00 87.70  ? 323 PHE C CA  1 
ATOM   7996  C C   . PHE C  1  323 ? 125.951 95.325  144.572 1.00 87.70  ? 323 PHE C C   1 
ATOM   7997  O O   . PHE C  1  323 ? 125.150 96.142  144.105 1.00 87.70  ? 323 PHE C O   1 
ATOM   7998  C CB  . PHE C  1  323 ? 124.810 93.636  146.005 1.00 87.70  ? 323 PHE C CB  1 
ATOM   7999  C CG  . PHE C  1  323 ? 123.871 92.468  145.981 1.00 87.70  ? 323 PHE C CG  1 
ATOM   8000  C CD1 . PHE C  1  323 ? 123.497 91.895  144.779 1.00 87.70  ? 323 PHE C CD1 1 
ATOM   8001  C CD2 . PHE C  1  323 ? 123.342 91.956  147.153 1.00 87.70  ? 323 PHE C CD2 1 
ATOM   8002  C CE1 . PHE C  1  323 ? 122.627 90.826  144.747 1.00 87.70  ? 323 PHE C CE1 1 
ATOM   8003  C CE2 . PHE C  1  323 ? 122.468 90.886  147.127 1.00 87.70  ? 323 PHE C CE2 1 
ATOM   8004  C CZ  . PHE C  1  323 ? 122.112 90.320  145.922 1.00 87.70  ? 323 PHE C CZ  1 
ATOM   8005  N N   . PHE C  1  324 ? 127.164 95.694  144.994 1.00 82.76  ? 324 PHE C N   1 
ATOM   8006  C CA  . PHE C  1  324 ? 127.584 97.085  144.819 1.00 82.76  ? 324 PHE C CA  1 
ATOM   8007  C C   . PHE C  1  324 ? 127.634 97.505  143.354 1.00 82.76  ? 324 PHE C C   1 
ATOM   8008  O O   . PHE C  1  324 ? 126.989 98.508  142.996 1.00 82.76  ? 324 PHE C O   1 
ATOM   8009  C CB  . PHE C  1  324 ? 128.913 97.334  145.538 1.00 82.76  ? 324 PHE C CB  1 
ATOM   8010  C CG  . PHE C  1  324 ? 128.767 97.589  147.010 1.00 82.76  ? 324 PHE C CG  1 
ATOM   8011  C CD1 . PHE C  1  324 ? 128.418 98.845  147.468 1.00 82.76  ? 324 PHE C CD1 1 
ATOM   8012  C CD2 . PHE C  1  324 ? 128.977 96.586  147.934 1.00 82.76  ? 324 PHE C CD2 1 
ATOM   8013  C CE1 . PHE C  1  324 ? 128.282 99.096  148.818 1.00 82.76  ? 324 PHE C CE1 1 
ATOM   8014  C CE2 . PHE C  1  324 ? 128.839 96.834  149.290 1.00 82.76  ? 324 PHE C CE2 1 
ATOM   8015  C CZ  . PHE C  1  324 ? 128.493 98.091  149.729 1.00 82.76  ? 324 PHE C CZ  1 
ATOM   8016  N N   . PRO C  1  325 ? 128.359 96.814  142.465 1.00 77.40  ? 325 PRO C N   1 
ATOM   8017  C CA  . PRO C  1  325 ? 128.410 97.281  141.070 1.00 77.40  ? 325 PRO C CA  1 
ATOM   8018  C C   . PRO C  1  325 ? 127.055 97.312  140.390 1.00 77.40  ? 325 PRO C C   1 
ATOM   8019  O O   . PRO C  1  325 ? 126.816 98.194  139.558 1.00 77.40  ? 325 PRO C O   1 
ATOM   8020  C CB  . PRO C  1  325 ? 129.355 96.276  140.398 1.00 77.40  ? 325 PRO C CB  1 
ATOM   8021  C CG  . PRO C  1  325 ? 130.167 95.719  141.506 1.00 77.40  ? 325 PRO C CG  1 
ATOM   8022  C CD  . PRO C  1  325 ? 129.224 95.638  142.663 1.00 77.40  ? 325 PRO C CD  1 
ATOM   8023  N N   . VAL C  1  326 ? 126.152 96.390  140.728 1.00 78.80  ? 326 VAL C N   1 
ATOM   8024  C CA  . VAL C  1  326 ? 124.832 96.381  140.103 1.00 78.80  ? 326 VAL C CA  1 
ATOM   8025  C C   . VAL C  1  326 ? 124.059 97.643  140.466 1.00 78.80  ? 326 VAL C C   1 
ATOM   8026  O O   . VAL C  1  326 ? 123.507 98.325  139.594 1.00 78.80  ? 326 VAL C O   1 
ATOM   8027  C CB  . VAL C  1  326 ? 124.057 95.112  140.498 1.00 78.80  ? 326 VAL C CB  1 
ATOM   8028  C CG1 . VAL C  1  326 ? 122.621 95.200  140.016 1.00 78.80  ? 326 VAL C CG1 1 
ATOM   8029  C CG2 . VAL C  1  326 ? 124.728 93.888  139.907 1.00 78.80  ? 326 VAL C CG2 1 
ATOM   8030  N N   . VAL C  1  327 ? 124.001 97.967  141.759 1.00 78.84  ? 327 VAL C N   1 
ATOM   8031  C CA  . VAL C  1  327 ? 123.280 99.162  142.189 1.00 78.84  ? 327 VAL C CA  1 
ATOM   8032  C C   . VAL C  1  327 ? 123.936 100.411 141.618 1.00 78.84  ? 327 VAL C C   1 
ATOM   8033  O O   . VAL C  1  327 ? 123.252 101.361 141.216 1.00 78.84  ? 327 VAL C O   1 
ATOM   8034  C CB  . VAL C  1  327 ? 123.199 99.217  143.725 1.00 78.84  ? 327 VAL C CB  1 
ATOM   8035  C CG1 . VAL C  1  327 ? 122.545 100.509 144.176 1.00 78.84  ? 327 VAL C CG1 1 
ATOM   8036  C CG2 . VAL C  1  327 ? 122.432 98.020  144.253 1.00 78.84  ? 327 VAL C CG2 1 
ATOM   8037  N N   . PHE C  1  328 ? 125.268 100.424 141.552 1.00 76.14  ? 328 PHE C N   1 
ATOM   8038  C CA  . PHE C  1  328 ? 125.970 101.589 141.023 1.00 76.14  ? 328 PHE C CA  1 
ATOM   8039  C C   . PHE C  1  328 ? 125.641 101.803 139.549 1.00 76.14  ? 328 PHE C C   1 
ATOM   8040  O O   . PHE C  1  328 ? 125.334 102.924 139.122 1.00 76.14  ? 328 PHE C O   1 
ATOM   8041  C CB  . PHE C  1  328 ? 127.472 101.415 141.230 1.00 76.14  ? 328 PHE C CB  1 
ATOM   8042  C CG  . PHE C  1  328 ? 128.290 102.604 140.828 1.00 76.14  ? 328 PHE C CG  1 
ATOM   8043  C CD1 . PHE C  1  328 ? 128.311 103.742 141.613 1.00 76.14  ? 328 PHE C CD1 1 
ATOM   8044  C CD2 . PHE C  1  328 ? 129.063 102.573 139.682 1.00 76.14  ? 328 PHE C CD2 1 
ATOM   8045  C CE1 . PHE C  1  328 ? 129.073 104.834 141.252 1.00 76.14  ? 328 PHE C CE1 1 
ATOM   8046  C CE2 . PHE C  1  328 ? 129.831 103.659 139.319 1.00 76.14  ? 328 PHE C CE2 1 
ATOM   8047  C CZ  . PHE C  1  328 ? 129.832 104.793 140.102 1.00 76.14  ? 328 PHE C CZ  1 
ATOM   8048  N N   . SER C  1  329 ? 125.686 100.729 138.757 1.00 74.59  ? 329 SER C N   1 
ATOM   8049  C CA  . SER C  1  329 ? 125.375 100.846 137.338 1.00 74.59  ? 329 SER C CA  1 
ATOM   8050  C C   . SER C  1  329 ? 123.911 101.202 137.119 1.00 74.59  ? 329 SER C C   1 
ATOM   8051  O O   . SER C  1  329 ? 123.588 101.965 136.205 1.00 74.59  ? 329 SER C O   1 
ATOM   8052  C CB  . SER C  1  329 ? 125.730 99.551  136.611 1.00 74.59  ? 329 SER C CB  1 
ATOM   8053  O OG  . SER C  1  329 ? 127.128 99.323  136.640 1.00 74.59  ? 329 SER C OG  1 
ATOM   8054  N N   . PHE C  1  330 ? 123.010 100.668 137.947 1.00 79.60  ? 330 PHE C N   1 
ATOM   8055  C CA  . PHE C  1  330 ? 121.599 101.025 137.827 1.00 79.60  ? 330 PHE C CA  1 
ATOM   8056  C C   . PHE C  1  330 ? 121.382 102.506 138.114 1.00 79.60  ? 330 PHE C C   1 
ATOM   8057  O O   . PHE C  1  330 ? 120.661 103.195 137.377 1.00 79.60  ? 330 PHE C O   1 
ATOM   8058  C CB  . PHE C  1  330 ? 120.768 100.157 138.771 1.00 79.60  ? 330 PHE C CB  1 
ATOM   8059  C CG  . PHE C  1  330 ? 119.296 100.443 138.728 1.00 79.60  ? 330 PHE C CG  1 
ATOM   8060  C CD1 . PHE C  1  330 ? 118.536 100.070 137.634 1.00 79.60  ? 330 PHE C CD1 1 
ATOM   8061  C CD2 . PHE C  1  330 ? 118.667 101.056 139.798 1.00 79.60  ? 330 PHE C CD2 1 
ATOM   8062  C CE1 . PHE C  1  330 ? 117.178 100.325 137.596 1.00 79.60  ? 330 PHE C CE1 1 
ATOM   8063  C CE2 . PHE C  1  330 ? 117.309 101.311 139.767 1.00 79.60  ? 330 PHE C CE2 1 
ATOM   8064  C CZ  . PHE C  1  330 ? 116.564 100.945 138.665 1.00 79.60  ? 330 PHE C CZ  1 
ATOM   8065  N N   . PHE C  1  331 ? 122.007 103.012 139.179 1.00 79.20  ? 331 PHE C N   1 
ATOM   8066  C CA  . PHE C  1  331 ? 121.911 104.431 139.498 1.00 79.20  ? 331 PHE C CA  1 
ATOM   8067  C C   . PHE C  1  331 ? 122.452 105.290 138.363 1.00 79.20  ? 331 PHE C C   1 
ATOM   8068  O O   . PHE C  1  331 ? 121.835 106.293 137.987 1.00 79.20  ? 331 PHE C O   1 
ATOM   8069  C CB  . PHE C  1  331 ? 122.661 104.716 140.798 1.00 79.20  ? 331 PHE C CB  1 
ATOM   8070  C CG  . PHE C  1  331 ? 122.642 106.156 141.207 1.00 79.20  ? 331 PHE C CG  1 
ATOM   8071  C CD1 . PHE C  1  331 ? 121.499 106.719 141.741 1.00 79.20  ? 331 PHE C CD1 1 
ATOM   8072  C CD2 . PHE C  1  331 ? 123.772 106.944 141.068 1.00 79.20  ? 331 PHE C CD2 1 
ATOM   8073  C CE1 . PHE C  1  331 ? 121.481 108.046 142.121 1.00 79.20  ? 331 PHE C CE1 1 
ATOM   8074  C CE2 . PHE C  1  331 ? 123.760 108.271 141.448 1.00 79.20  ? 331 PHE C CE2 1 
ATOM   8075  C CZ  . PHE C  1  331 ? 122.612 108.823 141.976 1.00 79.20  ? 331 PHE C CZ  1 
ATOM   8076  N N   . ASN C  1  332 ? 123.599 104.907 137.796 1.00 76.43  ? 332 ASN C N   1 
ATOM   8077  C CA  . ASN C  1  332 ? 124.161 105.692 136.701 1.00 76.43  ? 332 ASN C CA  1 
ATOM   8078  C C   . ASN C  1  332 ? 123.285 105.631 135.456 1.00 76.43  ? 332 ASN C C   1 
ATOM   8079  O O   . ASN C  1  332 ? 123.156 106.626 134.737 1.00 76.43  ? 332 ASN C O   1 
ATOM   8080  C CB  . ASN C  1  332 ? 125.576 105.223 136.382 1.00 76.43  ? 332 ASN C CB  1 
ATOM   8081  C CG  . ASN C  1  332 ? 126.571 105.651 137.428 1.00 76.43  ? 332 ASN C CG  1 
ATOM   8082  O OD1 . ASN C  1  332 ? 126.524 106.775 137.925 1.00 76.43  ? 332 ASN C OD1 1 
ATOM   8083  N ND2 . ASN C  1  332 ? 127.483 104.757 137.769 1.00 76.43  ? 332 ASN C ND2 1 
ATOM   8084  N N   . ILE C  1  333 ? 122.684 104.475 135.174 1.00 73.78  ? 333 ILE C N   1 
ATOM   8085  C CA  . ILE C  1  333 ? 121.792 104.376 134.023 1.00 73.78  ? 333 ILE C CA  1 
ATOM   8086  C C   . ILE C  1  333 ? 120.603 105.307 134.199 1.00 73.78  ? 333 ILE C C   1 
ATOM   8087  O O   . ILE C  1  333 ? 120.222 106.032 133.275 1.00 73.78  ? 333 ILE C O   1 
ATOM   8088  C CB  . ILE C  1  333 ? 121.345 102.920 133.801 1.00 73.78  ? 333 ILE C CB  1 
ATOM   8089  C CG1 . ILE C  1  333 ? 122.518 102.075 133.297 1.00 73.78  ? 333 ILE C CG1 1 
ATOM   8090  C CG2 . ILE C  1  333 ? 120.170 102.862 132.836 1.00 73.78  ? 333 ILE C CG2 1 
ATOM   8091  C CD1 . ILE C  1  333 ? 122.247 100.591 133.292 1.00 73.78  ? 333 ILE C CD1 1 
ATOM   8092  N N   . VAL C  1  334 ? 120.009 105.316 135.395 1.00 76.95  ? 334 VAL C N   1 
ATOM   8093  C CA  . VAL C  1  334 ? 118.892 106.227 135.646 1.00 76.95  ? 334 VAL C CA  1 
ATOM   8094  C C   . VAL C  1  334 ? 119.338 107.676 135.491 1.00 76.95  ? 334 VAL C C   1 
ATOM   8095  O O   . VAL C  1  334 ? 118.653 108.495 134.857 1.00 76.95  ? 334 VAL C O   1 
ATOM   8096  C CB  . VAL C  1  334 ? 118.289 105.968 137.037 1.00 76.95  ? 334 VAL C CB  1 
ATOM   8097  C CG1 . VAL C  1  334 ? 117.245 107.020 137.356 1.00 76.95  ? 334 VAL C CG1 1 
ATOM   8098  C CG2 . VAL C  1  334 ? 117.673 104.584 137.087 1.00 76.95  ? 334 VAL C CG2 1 
ATOM   8099  N N   . TYR C  1  335 ? 120.510 108.006 136.037 1.00 79.73  ? 335 TYR C N   1 
ATOM   8100  C CA  . TYR C  1  335 ? 120.998 109.378 135.977 1.00 79.73  ? 335 TYR C CA  1 
ATOM   8101  C C   . TYR C  1  335 ? 121.198 109.828 134.537 1.00 79.73  ? 335 TYR C C   1 
ATOM   8102  O O   . TYR C  1  335 ? 120.720 110.895 134.139 1.00 79.73  ? 335 TYR C O   1 
ATOM   8103  C CB  . TYR C  1  335 ? 122.300 109.503 136.763 1.00 79.73  ? 335 TYR C CB  1 
ATOM   8104  C CG  . TYR C  1  335 ? 122.885 110.894 136.766 1.00 79.73  ? 335 TYR C CG  1 
ATOM   8105  C CD1 . TYR C  1  335 ? 122.359 111.885 137.576 1.00 79.73  ? 335 TYR C CD1 1 
ATOM   8106  C CD2 . TYR C  1  335 ? 123.961 111.216 135.951 1.00 79.73  ? 335 TYR C CD2 1 
ATOM   8107  C CE1 . TYR C  1  335 ? 122.890 113.155 137.581 1.00 79.73  ? 335 TYR C CE1 1 
ATOM   8108  C CE2 . TYR C  1  335 ? 124.499 112.484 135.948 1.00 79.73  ? 335 TYR C CE2 1 
ATOM   8109  C CZ  . TYR C  1  335 ? 123.959 113.450 136.764 1.00 79.73  ? 335 TYR C CZ  1 
ATOM   8110  O OH  . TYR C  1  335 ? 124.491 114.717 136.763 1.00 79.73  ? 335 TYR C OH  1 
ATOM   8111  N N   . TRP C  1  336 ? 121.903 109.027 133.740 1.00 79.93  ? 336 TRP C N   1 
ATOM   8112  C CA  . TRP C  1  336 ? 122.212 109.408 132.369 1.00 79.93  ? 336 TRP C CA  1 
ATOM   8113  C C   . TRP C  1  336 ? 121.036 109.228 131.416 1.00 79.93  ? 336 TRP C C   1 
ATOM   8114  O O   . TRP C  1  336 ? 121.091 109.732 130.290 1.00 79.93  ? 336 TRP C O   1 
ATOM   8115  C CB  . TRP C  1  336 ? 123.422 108.620 131.876 1.00 79.93  ? 336 TRP C CB  1 
ATOM   8116  C CG  . TRP C  1  336 ? 124.680 108.999 132.593 1.00 79.93  ? 336 TRP C CG  1 
ATOM   8117  C CD1 . TRP C  1  336 ? 125.210 108.389 133.689 1.00 79.93  ? 336 TRP C CD1 1 
ATOM   8118  C CD2 . TRP C  1  336 ? 125.570 110.069 132.264 1.00 79.93  ? 336 TRP C CD2 1 
ATOM   8119  N NE1 . TRP C  1  336 ? 126.370 109.012 134.067 1.00 79.93  ? 336 TRP C NE1 1 
ATOM   8120  C CE2 . TRP C  1  336 ? 126.615 110.047 133.206 1.00 79.93  ? 336 TRP C CE2 1 
ATOM   8121  C CE3 . TRP C  1  336 ? 125.587 111.042 131.264 1.00 79.93  ? 336 TRP C CE3 1 
ATOM   8122  C CZ2 . TRP C  1  336 ? 127.664 110.958 133.179 1.00 79.93  ? 336 TRP C CZ2 1 
ATOM   8123  C CZ3 . TRP C  1  336 ? 126.630 111.948 131.239 1.00 79.93  ? 336 TRP C CZ3 1 
ATOM   8124  C CH2 . TRP C  1  336 ? 127.653 111.899 132.190 1.00 79.93  ? 336 TRP C CH2 1 
ATOM   8125  N N   . LEU C  1  337 ? 119.985 108.513 131.822 1.00 79.75  ? 337 LEU C N   1 
ATOM   8126  C CA  . LEU C  1  337 ? 118.750 108.553 131.048 1.00 79.75  ? 337 LEU C CA  1 
ATOM   8127  C C   . LEU C  1  337 ? 117.961 109.821 131.341 1.00 79.75  ? 337 LEU C C   1 
ATOM   8128  O O   . LEU C  1  337 ? 117.316 110.374 130.444 1.00 79.75  ? 337 LEU C O   1 
ATOM   8129  C CB  . LEU C  1  337 ? 117.894 107.315 131.327 1.00 79.75  ? 337 LEU C CB  1 
ATOM   8130  C CG  . LEU C  1  337 ? 118.335 105.980 130.723 1.00 79.75  ? 337 LEU C CG  1 
ATOM   8131  C CD1 . LEU C  1  337 ? 117.473 104.848 131.255 1.00 79.75  ? 337 LEU C CD1 1 
ATOM   8132  C CD2 . LEU C  1  337 ? 118.259 106.033 129.206 1.00 79.75  ? 337 LEU C CD2 1 
ATOM   8133  N N   . TYR C  1  338 ? 117.997 110.300 132.585 1.00 83.17  ? 338 TYR C N   1 
ATOM   8134  C CA  . TYR C  1  338 ? 117.181 111.459 132.931 1.00 83.17  ? 338 TYR C CA  1 
ATOM   8135  C C   . TYR C  1  338 ? 117.853 112.801 132.652 1.00 83.17  ? 338 TYR C C   1 
ATOM   8136  O O   . TYR C  1  338 ? 117.151 113.780 132.381 1.00 83.17  ? 338 TYR C O   1 
ATOM   8137  C CB  . TYR C  1  338 ? 116.750 111.384 134.399 1.00 83.17  ? 338 TYR C CB  1 
ATOM   8138  C CG  . TYR C  1  338 ? 115.638 110.384 134.638 1.00 83.17  ? 338 TYR C CG  1 
ATOM   8139  C CD1 . TYR C  1  338 ? 114.903 109.875 133.577 1.00 83.17  ? 338 TYR C CD1 1 
ATOM   8140  C CD2 . TYR C  1  338 ? 115.312 109.961 135.921 1.00 83.17  ? 338 TYR C CD2 1 
ATOM   8141  C CE1 . TYR C  1  338 ? 113.882 108.969 133.783 1.00 83.17  ? 338 TYR C CE1 1 
ATOM   8142  C CE2 . TYR C  1  338 ? 114.289 109.054 136.137 1.00 83.17  ? 338 TYR C CE2 1 
ATOM   8143  C CZ  . TYR C  1  338 ? 113.579 108.562 135.064 1.00 83.17  ? 338 TYR C CZ  1 
ATOM   8144  O OH  . TYR C  1  338 ? 112.562 107.659 135.272 1.00 83.17  ? 338 TYR C OH  1 
ATOM   8145  N N   . TYR C  1  339 ? 119.180 112.888 132.712 1.00 87.24  ? 339 TYR C N   1 
ATOM   8146  C CA  . TYR C  1  339 ? 119.891 114.143 132.476 1.00 87.24  ? 339 TYR C CA  1 
ATOM   8147  C C   . TYR C  1  339 ? 120.724 114.138 131.195 1.00 87.24  ? 339 TYR C C   1 
ATOM   8148  O O   . TYR C  1  339 ? 121.826 114.688 131.162 1.00 87.24  ? 339 TYR C O   1 
ATOM   8149  C CB  . TYR C  1  339 ? 120.780 114.499 133.663 1.00 87.24  ? 339 TYR C CB  1 
ATOM   8150  C CG  . TYR C  1  339 ? 120.030 115.034 134.857 1.00 87.24  ? 339 TYR C CG  1 
ATOM   8151  C CD1 . TYR C  1  339 ? 118.697 115.392 134.757 1.00 87.24  ? 339 TYR C CD1 1 
ATOM   8152  C CD2 . TYR C  1  339 ? 120.666 115.215 136.075 1.00 87.24  ? 339 TYR C CD2 1 
ATOM   8153  C CE1 . TYR C  1  339 ? 118.010 115.891 135.843 1.00 87.24  ? 339 TYR C CE1 1 
ATOM   8154  C CE2 . TYR C  1  339 ? 119.989 115.713 137.167 1.00 87.24  ? 339 TYR C CE2 1 
ATOM   8155  C CZ  . TYR C  1  339 ? 118.662 116.051 137.045 1.00 87.24  ? 339 TYR C CZ  1 
ATOM   8156  O OH  . TYR C  1  339 ? 117.982 116.550 138.132 1.00 87.24  ? 339 TYR C OH  1 
ATOM   8157  N N   . VAL C  1  340 ? 120.220 113.527 130.128 1.00 83.50  ? 340 VAL C N   1 
ATOM   8158  C CA  . VAL C  1  340 ? 120.874 113.633 128.822 1.00 83.50  ? 340 VAL C CA  1 
ATOM   8159  C C   . VAL C  1  340 ? 119.839 113.905 127.734 1.00 83.50  ? 340 VAL C C   1 
ATOM   8160  O O   . VAL C  1  340 ? 120.050 114.737 126.851 1.00 83.50  ? 340 VAL C O   1 
ATOM   8161  C CB  . VAL C  1  340 ? 121.697 112.373 128.486 1.00 83.50  ? 340 VAL C CB  1 
ATOM   8162  C CG1 . VAL C  1  340 ? 122.219 112.450 127.062 1.00 83.50  ? 340 VAL C CG1 1 
ATOM   8163  C CG2 . VAL C  1  340 ? 122.858 112.221 129.449 1.00 83.50  ? 340 VAL C CG2 1 
ATOM   8164  N N   . ASP D  2  10  ? 99.596  170.721 106.057 1.00 80.01  ? 10  ASP D N   1 
ATOM   8165  C CA  . ASP D  2  10  ? 99.440  171.745 107.082 1.00 80.01  ? 10  ASP D CA  1 
ATOM   8166  C C   . ASP D  2  10  ? 98.742  171.187 108.317 1.00 80.01  ? 10  ASP D C   1 
ATOM   8167  O O   . ASP D  2  10  ? 98.391  171.934 109.230 1.00 80.01  ? 10  ASP D O   1 
ATOM   8168  C CB  . ASP D  2  10  ? 98.658  172.939 106.534 1.00 80.01  ? 10  ASP D CB  1 
ATOM   8169  C CG  . ASP D  2  10  ? 99.434  173.717 105.490 1.00 80.01  ? 10  ASP D CG  1 
ATOM   8170  O OD1 . ASP D  2  10  ? 100.682 173.717 105.551 1.00 80.01  ? 10  ASP D OD1 1 
ATOM   8171  O OD2 . ASP D  2  10  ? 98.796  174.332 104.611 1.00 80.01  ? 10  ASP D OD2 1 
ATOM   8172  N N   . ASN D  2  11  ? 98.544  169.867 108.340 1.00 75.79  ? 11  ASN D N   1 
ATOM   8173  C CA  . ASN D  2  11  ? 97.874  169.232 109.469 1.00 75.79  ? 11  ASN D CA  1 
ATOM   8174  C C   . ASN D  2  11  ? 98.687  169.319 110.754 1.00 75.79  ? 11  ASN D C   1 
ATOM   8175  O O   . ASN D  2  11  ? 98.134  169.107 111.837 1.00 75.79  ? 11  ASN D O   1 
ATOM   8176  C CB  . ASN D  2  11  ? 97.568  167.770 109.143 1.00 75.79  ? 11  ASN D CB  1 
ATOM   8177  C CG  . ASN D  2  11  ? 96.600  167.621 107.983 1.00 75.79  ? 11  ASN D CG  1 
ATOM   8178  O OD1 . ASN D  2  11  ? 96.954  167.100 106.925 1.00 75.79  ? 11  ASN D OD1 1 
ATOM   8179  N ND2 . ASN D  2  11  ? 95.371  168.082 108.178 1.00 75.79  ? 11  ASN D ND2 1 
ATOM   8180  N N   . THR D  2  12  ? 99.983  169.614 110.658 1.00 76.81  ? 12  THR D N   1 
ATOM   8181  C CA  . THR D  2  12  ? 100.823 169.791 111.834 1.00 76.81  ? 12  THR D CA  1 
ATOM   8182  C C   . THR D  2  12  ? 100.965 171.248 112.251 1.00 76.81  ? 12  THR D C   1 
ATOM   8183  O O   . THR D  2  12  ? 101.438 171.515 113.364 1.00 76.81  ? 12  THR D O   1 
ATOM   8184  C CB  . THR D  2  12  ? 102.217 169.209 111.584 1.00 76.81  ? 12  THR D CB  1 
ATOM   8185  O OG1 . THR D  2  12  ? 102.845 169.918 110.510 1.00 76.81  ? 12  THR D OG1 1 
ATOM   8186  C CG2 . THR D  2  12  ? 102.119 167.737 111.222 1.00 76.81  ? 12  THR D CG2 1 
ATOM   8187  N N   . THR D  2  13  ? 100.585 172.190 111.385 1.00 66.81  ? 13  THR D N   1 
ATOM   8188  C CA  . THR D  2  13  ? 100.761 173.600 111.710 1.00 66.81  ? 13  THR D CA  1 
ATOM   8189  C C   . THR D  2  13  ? 99.891  174.008 112.889 1.00 66.81  ? 13  THR D C   1 
ATOM   8190  O O   . THR D  2  13  ? 100.320 174.801 113.735 1.00 66.81  ? 13  THR D O   1 
ATOM   8191  C CB  . THR D  2  13  ? 100.446 174.467 110.494 1.00 66.81  ? 13  THR D CB  1 
ATOM   8192  O OG1 . THR D  2  13  ? 101.293 174.085 109.405 1.00 66.81  ? 13  THR D OG1 1 
ATOM   8193  C CG2 . THR D  2  13  ? 100.685 175.934 110.814 1.00 66.81  ? 13  THR D CG2 1 
ATOM   8194  N N   . VAL D  2  14  ? 98.670  173.477 112.966 1.00 56.40  ? 14  VAL D N   1 
ATOM   8195  C CA  . VAL D  2  14  ? 97.795  173.803 114.088 1.00 56.40  ? 14  VAL D CA  1 
ATOM   8196  C C   . VAL D  2  14  ? 98.426  173.362 115.399 1.00 56.40  ? 14  VAL D C   1 
ATOM   8197  O O   . VAL D  2  14  ? 98.436  174.110 116.385 1.00 56.40  ? 14  VAL D O   1 
ATOM   8198  C CB  . VAL D  2  14  ? 96.408  173.169 113.887 1.00 56.40  ? 14  VAL D CB  1 
ATOM   8199  C CG1 . VAL D  2  14  ? 95.561  173.356 115.130 1.00 56.40  ? 14  VAL D CG1 1 
ATOM   8200  C CG2 . VAL D  2  14  ? 95.726  173.785 112.683 1.00 56.40  ? 14  VAL D CG2 1 
ATOM   8201  N N   . PHE D  2  15  ? 99.002  172.160 115.421 1.00 52.58  ? 15  PHE D N   1 
ATOM   8202  C CA  . PHE D  2  15  ? 99.605  171.669 116.652 1.00 52.58  ? 15  PHE D CA  1 
ATOM   8203  C C   . PHE D  2  15  ? 100.872 172.438 116.991 1.00 52.58  ? 15  PHE D C   1 
ATOM   8204  O O   . PHE D  2  15  ? 101.136 172.710 118.166 1.00 52.58  ? 15  PHE D O   1 
ATOM   8205  C CB  . PHE D  2  15  ? 99.901  170.175 116.537 1.00 52.58  ? 15  PHE D CB  1 
ATOM   8206  C CG  . PHE D  2  15  ? 98.674  169.322 116.440 1.00 52.58  ? 15  PHE D CG  1 
ATOM   8207  C CD1 . PHE D  2  15  ? 97.953  168.993 117.572 1.00 52.58  ? 15  PHE D CD1 1 
ATOM   8208  C CD2 . PHE D  2  15  ? 98.242  168.849 115.215 1.00 52.58  ? 15  PHE D CD2 1 
ATOM   8209  C CE1 . PHE D  2  15  ? 96.824  168.209 117.484 1.00 52.58  ? 15  PHE D CE1 1 
ATOM   8210  C CE2 . PHE D  2  15  ? 97.114  168.065 115.121 1.00 52.58  ? 15  PHE D CE2 1 
ATOM   8211  C CZ  . PHE D  2  15  ? 96.404  167.745 116.257 1.00 52.58  ? 15  PHE D CZ  1 
ATOM   8212  N N   . THR D  2  16  ? 101.658 172.814 115.982 1.00 43.33  ? 16  THR D N   1 
ATOM   8213  C CA  . THR D  2  16  ? 102.860 173.593 116.260 1.00 43.33  ? 16  THR D CA  1 
ATOM   8214  C C   . THR D  2  16  ? 102.506 174.968 116.812 1.00 43.33  ? 16  THR D C   1 
ATOM   8215  O O   . THR D  2  16  ? 103.169 175.460 117.732 1.00 43.33  ? 16  THR D O   1 
ATOM   8216  C CB  . THR D  2  16  ? 103.714 173.726 115.003 1.00 43.33  ? 16  THR D CB  1 
ATOM   8217  O OG1 . THR D  2  16  ? 104.104 172.424 114.550 1.00 43.33  ? 16  THR D OG1 1 
ATOM   8218  C CG2 . THR D  2  16  ? 104.961 174.540 115.296 1.00 43.33  ? 16  THR D CG2 1 
ATOM   8219  N N   . ARG D  2  17  ? 101.463 175.600 116.271 1.00 46.81  ? 17  ARG D N   1 
ATOM   8220  C CA  . ARG D  2  17  ? 101.017 176.879 116.815 1.00 46.81  ? 17  ARG D CA  1 
ATOM   8221  C C   . ARG D  2  17  ? 100.518 176.722 118.243 1.00 46.81  ? 17  ARG D C   1 
ATOM   8222  O O   . ARG D  2  17  ? 100.843 177.539 119.113 1.00 46.81  ? 17  ARG D O   1 
ATOM   8223  C CB  . ARG D  2  17  ? 99.923  177.484 115.939 1.00 46.81  ? 17  ARG D CB  1 
ATOM   8224  C CG  . ARG D  2  17  ? 100.399 177.994 114.594 1.00 46.81  ? 17  ARG D CG  1 
ATOM   8225  C CD  . ARG D  2  17  ? 99.239  178.578 113.802 1.00 46.81  ? 17  ARG D CD  1 
ATOM   8226  N NE  . ARG D  2  17  ? 99.657  179.064 112.491 1.00 46.81  ? 17  ARG D NE  1 
ATOM   8227  C CZ  . ARG D  2  17  ? 98.827  179.552 111.576 1.00 46.81  ? 17  ARG D CZ  1 
ATOM   8228  N NH1 . ARG D  2  17  ? 99.297  179.973 110.410 1.00 46.81  ? 17  ARG D NH1 1 
ATOM   8229  N NH2 . ARG D  2  17  ? 97.526  179.617 111.823 1.00 46.81  ? 17  ARG D NH2 1 
ATOM   8230  N N   . ILE D  2  18  ? 99.722  175.681 118.503 1.00 40.76  ? 18  ILE D N   1 
ATOM   8231  C CA  . ILE D  2  18  ? 99.261  175.422 119.865 1.00 40.76  ? 18  ILE D CA  1 
ATOM   8232  C C   . ILE D  2  18  ? 100.445 175.285 120.811 1.00 40.76  ? 18  ILE D C   1 
ATOM   8233  O O   . ILE D  2  18  ? 100.468 175.875 121.895 1.00 40.76  ? 18  ILE D O   1 
ATOM   8234  C CB  . ILE D  2  18  ? 98.367  174.170 119.905 1.00 40.76  ? 18  ILE D CB  1 
ATOM   8235  C CG1 . ILE D  2  18  ? 97.011  174.459 119.261 1.00 40.76  ? 18  ILE D CG1 1 
ATOM   8236  C CG2 . ILE D  2  18  ? 98.213  173.663 121.323 1.00 40.76  ? 18  ILE D CG2 1 
ATOM   8237  C CD1 . ILE D  2  18  ? 96.154  173.225 119.066 1.00 40.76  ? 18  ILE D CD1 1 
ATOM   8238  N N   . LEU D  2  19  ? 101.458 174.523 120.404 1.00 35.37  ? 19  LEU D N   1 
ATOM   8239  C CA  . LEU D  2  19  ? 102.571 174.242 121.302 1.00 35.37  ? 19  LEU D CA  1 
ATOM   8240  C C   . LEU D  2  19  ? 103.431 175.481 121.524 1.00 35.37  ? 19  LEU D C   1 
ATOM   8241  O O   . LEU D  2  19  ? 103.861 175.753 122.653 1.00 35.37  ? 19  LEU D O   1 
ATOM   8242  C CB  . LEU D  2  19  ? 103.394 173.088 120.738 1.00 35.37  ? 19  LEU D CB  1 
ATOM   8243  C CG  . LEU D  2  19  ? 104.419 172.428 121.643 1.00 35.37  ? 19  LEU D CG  1 
ATOM   8244  C CD1 . LEU D  2  19  ? 103.710 171.836 122.834 1.00 35.37  ? 19  LEU D CD1 1 
ATOM   8245  C CD2 . LEU D  2  19  ? 105.115 171.341 120.871 1.00 35.37  ? 19  LEU D CD2 1 
ATOM   8246  N N   . ASP D  2  20  ? 103.682 176.254 120.466 1.00 41.91  ? 20  ASP D N   1 
ATOM   8247  C CA  . ASP D  2  20  ? 104.467 177.474 120.615 1.00 41.91  ? 20  ASP D CA  1 
ATOM   8248  C C   . ASP D  2  20  ? 103.739 178.499 121.474 1.00 41.91  ? 20  ASP D C   1 
ATOM   8249  O O   . ASP D  2  20  ? 104.373 179.231 122.241 1.00 41.91  ? 20  ASP D O   1 
ATOM   8250  C CB  . ASP D  2  20  ? 104.797 178.060 119.244 1.00 41.91  ? 20  ASP D CB  1 
ATOM   8251  C CG  . ASP D  2  20  ? 105.801 177.221 118.481 1.00 41.91  ? 20  ASP D CG  1 
ATOM   8252  O OD1 . ASP D  2  20  ? 106.637 176.561 119.132 1.00 41.91  ? 20  ASP D OD1 1 
ATOM   8253  O OD2 . ASP D  2  20  ? 105.755 177.221 117.233 1.00 41.91  ? 20  ASP D OD2 1 
ATOM   8254  N N   . ARG D  2  21  ? 102.412 178.575 121.358 1.00 45.28  ? 21  ARG D N   1 
ATOM   8255  C CA  . ARG D  2  21  ? 101.656 179.431 122.264 1.00 45.28  ? 21  ARG D CA  1 
ATOM   8256  C C   . ARG D  2  21  ? 101.691 178.894 123.687 1.00 45.28  ? 21  ARG D C   1 
ATOM   8257  O O   . ARG D  2  21  ? 101.668 179.672 124.647 1.00 45.28  ? 21  ARG D O   1 
ATOM   8258  C CB  . ARG D  2  21  ? 100.213 179.563 121.782 1.00 45.28  ? 21  ARG D CB  1 
ATOM   8259  C CG  . ARG D  2  21  ? 99.356  180.481 122.630 1.00 45.28  ? 21  ARG D CG  1 
ATOM   8260  C CD  . ARG D  2  21  ? 97.956  180.598 122.057 1.00 45.28  ? 21  ARG D CD  1 
ATOM   8261  N NE  . ARG D  2  21  ? 97.942  181.310 120.784 1.00 45.28  ? 21  ARG D NE  1 
ATOM   8262  C CZ  . ARG D  2  21  ? 96.883  181.386 119.984 1.00 45.28  ? 21  ARG D CZ  1 
ATOM   8263  N NH1 . ARG D  2  21  ? 96.958  182.057 118.844 1.00 45.28  ? 21  ARG D NH1 1 
ATOM   8264  N NH2 . ARG D  2  21  ? 95.750  180.786 120.323 1.00 45.28  ? 21  ARG D NH2 1 
ATOM   8265  N N   . LEU D  2  22  ? 101.749 177.572 123.836 1.00 35.53  ? 22  LEU D N   1 
ATOM   8266  C CA  . LEU D  2  22  ? 101.824 176.963 125.157 1.00 35.53  ? 22  LEU D CA  1 
ATOM   8267  C C   . LEU D  2  22  ? 103.124 177.323 125.864 1.00 35.53  ? 22  LEU D C   1 
ATOM   8268  O O   . LEU D  2  22  ? 103.117 177.646 127.056 1.00 35.53  ? 22  LEU D O   1 
ATOM   8269  C CB  . LEU D  2  22  ? 101.667 175.449 125.019 1.00 35.53  ? 22  LEU D CB  1 
ATOM   8270  C CG  . LEU D  2  22  ? 101.650 174.529 126.229 1.00 35.53  ? 22  LEU D CG  1 
ATOM   8271  C CD1 . LEU D  2  22  ? 100.759 173.343 125.946 1.00 35.53  ? 22  LEU D CD1 1 
ATOM   8272  C CD2 . LEU D  2  22  ? 103.057 174.052 126.485 1.00 35.53  ? 22  LEU D CD2 1 
ATOM   8273  N N   . LEU D  2  23  ? 104.248 177.275 125.151 1.00 36.67  ? 23  LEU D N   1 
ATOM   8274  C CA  . LEU D  2  23  ? 105.537 177.617 125.747 1.00 36.67  ? 23  LEU D CA  1 
ATOM   8275  C C   . LEU D  2  23  ? 105.836 179.110 125.742 1.00 36.67  ? 23  LEU D C   1 
ATOM   8276  O O   . LEU D  2  23  ? 106.960 179.494 126.081 1.00 36.67  ? 23  LEU D O   1 
ATOM   8277  C CB  . LEU D  2  23  ? 106.673 176.880 125.037 1.00 36.67  ? 23  LEU D CB  1 
ATOM   8278  C CG  . LEU D  2  23  ? 106.765 175.388 125.319 1.00 36.67  ? 23  LEU D CG  1 
ATOM   8279  C CD1 . LEU D  2  23  ? 107.864 174.760 124.492 1.00 36.67  ? 23  LEU D CD1 1 
ATOM   8280  C CD2 . LEU D  2  23  ? 107.030 175.204 126.789 1.00 36.67  ? 23  LEU D CD2 1 
ATOM   8281  N N   . ASP D  2  24  ? 104.880 179.957 125.373 1.00 51.39  ? 24  ASP D N   1 
ATOM   8282  C CA  . ASP D  2  24  ? 105.129 181.394 125.326 1.00 51.39  ? 24  ASP D CA  1 
ATOM   8283  C C   . ASP D  2  24  ? 105.221 181.939 126.745 1.00 51.39  ? 24  ASP D C   1 
ATOM   8284  O O   . ASP D  2  24  ? 104.216 182.008 127.459 1.00 51.39  ? 24  ASP D O   1 
ATOM   8285  C CB  . ASP D  2  24  ? 104.025 182.098 124.543 1.00 51.39  ? 24  ASP D CB  1 
ATOM   8286  C CG  . ASP D  2  24  ? 104.352 183.549 124.250 1.00 51.39  ? 24  ASP D CG  1 
ATOM   8287  O OD1 . ASP D  2  24  ? 105.430 184.018 124.670 1.00 51.39  ? 24  ASP D OD1 1 
ATOM   8288  O OD2 . ASP D  2  24  ? 103.528 184.224 123.599 1.00 51.39  ? 24  ASP D OD2 1 
ATOM   8289  N N   . GLY D  2  25  ? 106.422 182.333 127.153 1.00 46.27  ? 25  GLY D N   1 
ATOM   8290  C CA  . GLY D  2  25  ? 106.616 182.914 128.466 1.00 46.27  ? 25  GLY D CA  1 
ATOM   8291  C C   . GLY D  2  25  ? 106.399 181.939 129.603 1.00 46.27  ? 25  GLY D C   1 
ATOM   8292  O O   . GLY D  2  25  ? 105.695 182.246 130.568 1.00 46.27  ? 25  GLY D O   1 
ATOM   8293  N N   . TYR D  2  26  ? 106.996 180.756 129.502 1.00 38.40  ? 26  TYR D N   1 
ATOM   8294  C CA  . TYR D  2  26  ? 106.933 179.759 130.559 1.00 38.40  ? 26  TYR D CA  1 
ATOM   8295  C C   . TYR D  2  26  ? 108.267 179.744 131.290 1.00 38.40  ? 26  TYR D C   1 
ATOM   8296  O O   . TYR D  2  26  ? 109.320 179.592 130.663 1.00 38.40  ? 26  TYR D O   1 
ATOM   8297  C CB  . TYR D  2  26  ? 106.617 178.375 129.996 1.00 38.40  ? 26  TYR D CB  1 
ATOM   8298  C CG  . TYR D  2  26  ? 106.359 177.345 131.063 1.00 38.40  ? 26  TYR D CG  1 
ATOM   8299  C CD1 . TYR D  2  26  ? 105.166 177.337 131.762 1.00 38.40  ? 26  TYR D CD1 1 
ATOM   8300  C CD2 . TYR D  2  26  ? 107.305 176.389 131.380 1.00 38.40  ? 26  TYR D CD2 1 
ATOM   8301  C CE1 . TYR D  2  26  ? 104.920 176.405 132.743 1.00 38.40  ? 26  TYR D CE1 1 
ATOM   8302  C CE2 . TYR D  2  26  ? 107.067 175.451 132.362 1.00 38.40  ? 26  TYR D CE2 1 
ATOM   8303  C CZ  . TYR D  2  26  ? 105.872 175.467 133.042 1.00 38.40  ? 26  TYR D CZ  1 
ATOM   8304  O OH  . TYR D  2  26  ? 105.620 174.541 134.023 1.00 38.40  ? 26  TYR D OH  1 
ATOM   8305  N N   . ASP D  2  27  ? 108.222 179.908 132.606 1.00 39.19  ? 27  ASP D N   1 
ATOM   8306  C CA  . ASP D  2  27  ? 109.420 180.061 133.421 1.00 39.19  ? 27  ASP D CA  1 
ATOM   8307  C C   . ASP D  2  27  ? 109.638 178.767 134.194 1.00 39.19  ? 27  ASP D C   1 
ATOM   8308  O O   . ASP D  2  27  ? 108.946 178.503 135.182 1.00 39.19  ? 27  ASP D O   1 
ATOM   8309  C CB  . ASP D  2  27  ? 109.279 181.257 134.357 1.00 39.19  ? 27  ASP D CB  1 
ATOM   8310  C CG  . ASP D  2  27  ? 110.601 181.700 134.938 1.00 39.19  ? 27  ASP D CG  1 
ATOM   8311  O OD1 . ASP D  2  27  ? 111.632 181.067 134.635 1.00 39.19  ? 27  ASP D OD1 1 
ATOM   8312  O OD2 . ASP D  2  27  ? 110.609 182.692 135.695 1.00 39.19  ? 27  ASP D OD2 1 
ATOM   8313  N N   . ASN D  2  28  ? 110.607 177.966 133.748 1.00 34.23  ? 28  ASN D N   1 
ATOM   8314  C CA  . ASN D  2  28  ? 110.796 176.631 134.299 1.00 34.23  ? 28  ASN D CA  1 
ATOM   8315  C C   . ASN D  2  28  ? 111.416 176.636 135.688 1.00 34.23  ? 28  ASN D C   1 
ATOM   8316  O O   . ASN D  2  28  ? 111.414 175.596 136.353 1.00 34.23  ? 28  ASN D O   1 
ATOM   8317  C CB  . ASN D  2  28  ? 111.655 175.805 133.350 1.00 34.23  ? 28  ASN D CB  1 
ATOM   8318  C CG  . ASN D  2  28  ? 112.967 176.475 133.033 1.00 34.23  ? 28  ASN D CG  1 
ATOM   8319  O OD1 . ASN D  2  28  ? 113.284 177.527 133.581 1.00 34.23  ? 28  ASN D OD1 1 
ATOM   8320  N ND2 . ASN D  2  28  ? 113.742 175.871 132.142 1.00 34.23  ? 28  ASN D ND2 1 
ATOM   8321  N N   . ARG D  2  29  ? 111.952 177.766 136.141 1.00 32.72  ? 29  ARG D N   1 
ATOM   8322  C CA  . ARG D  2  29  ? 112.559 177.815 137.464 1.00 32.72  ? 29  ARG D CA  1 
ATOM   8323  C C   . ARG D  2  29  ? 111.524 177.855 138.577 1.00 32.72  ? 29  ARG D C   1 
ATOM   8324  O O   . ARG D  2  29  ? 111.866 177.589 139.733 1.00 32.72  ? 29  ARG D O   1 
ATOM   8325  C CB  . ARG D  2  29  ? 113.469 179.032 137.568 1.00 32.72  ? 29  ARG D CB  1 
ATOM   8326  C CG  . ARG D  2  29  ? 114.680 178.962 136.675 1.00 32.72  ? 29  ARG D CG  1 
ATOM   8327  C CD  . ARG D  2  29  ? 115.560 180.171 136.881 1.00 32.72  ? 29  ARG D CD  1 
ATOM   8328  N NE  . ARG D  2  29  ? 114.867 181.396 136.497 1.00 32.72  ? 29  ARG D NE  1 
ATOM   8329  C CZ  . ARG D  2  29  ? 114.862 181.892 135.266 1.00 32.72  ? 29  ARG D CZ  1 
ATOM   8330  N NH1 . ARG D  2  29  ? 115.516 181.266 134.300 1.00 32.72  ? 29  ARG D NH1 1 
ATOM   8331  N NH2 . ARG D  2  29  ? 114.208 183.011 135.000 1.00 32.72  ? 29  ARG D NH2 1 
ATOM   8332  N N   . LEU D  2  30  ? 110.281 178.194 138.262 1.00 26.67  ? 30  LEU D N   1 
ATOM   8333  C CA  . LEU D  2  30  ? 109.222 178.321 139.252 1.00 26.67  ? 30  LEU D CA  1 
ATOM   8334  C C   . LEU D  2  30  ? 108.280 177.131 139.159 1.00 26.67  ? 30  LEU D C   1 
ATOM   8335  O O   . LEU D  2  30  ? 107.725 176.855 138.092 1.00 26.67  ? 30  LEU D O   1 
ATOM   8336  C CB  . LEU D  2  30  ? 108.443 179.619 139.051 1.00 26.67  ? 30  LEU D CB  1 
ATOM   8337  C CG  . LEU D  2  30  ? 109.023 180.898 139.647 1.00 26.67  ? 30  LEU D CG  1 
ATOM   8338  C CD1 . LEU D  2  30  ? 110.289 181.322 138.937 1.00 26.67  ? 30  LEU D CD1 1 
ATOM   8339  C CD2 . LEU D  2  30  ? 107.984 181.994 139.562 1.00 26.67  ? 30  LEU D CD2 1 
ATOM   8340  N N   . ARG D  2  31  ? 108.097 176.439 140.276 1.00 23.96  ? 31  ARG D N   1 
ATOM   8341  C CA  . ARG D  2  31  ? 107.163 175.335 140.323 1.00 23.96  ? 31  ARG D CA  1 
ATOM   8342  C C   . ARG D  2  31  ? 105.739 175.843 140.116 1.00 23.96  ? 31  ARG D C   1 
ATOM   8343  O O   . ARG D  2  31  ? 105.450 177.016 140.353 1.00 23.96  ? 31  ARG D O   1 
ATOM   8344  C CB  . ARG D  2  31  ? 107.285 174.606 141.657 1.00 23.96  ? 31  ARG D CB  1 
ATOM   8345  C CG  . ARG D  2  31  ? 106.957 175.457 142.860 1.00 23.96  ? 31  ARG D CG  1 
ATOM   8346  C CD  . ARG D  2  31  ? 107.088 174.654 144.131 1.00 23.96  ? 31  ARG D CD  1 
ATOM   8347  N NE  . ARG D  2  31  ? 106.894 175.485 145.308 1.00 23.96  ? 31  ARG D NE  1 
ATOM   8348  C CZ  . ARG D  2  31  ? 105.711 175.733 145.851 1.00 23.96  ? 31  ARG D CZ  1 
ATOM   8349  N NH1 . ARG D  2  31  ? 104.616 175.211 145.321 1.00 23.96  ? 31  ARG D NH1 1 
ATOM   8350  N NH2 . ARG D  2  31  ? 105.619 176.506 146.921 1.00 23.96  ? 31  ARG D NH2 1 
ATOM   8351  N N   . PRO D  2  32  ? 104.832 174.983 139.655 1.00 25.48  ? 32  PRO D N   1 
ATOM   8352  C CA  . PRO D  2  32  ? 103.453 175.427 139.422 1.00 25.48  ? 32  PRO D CA  1 
ATOM   8353  C C   . PRO D  2  32  ? 102.767 175.799 140.725 1.00 25.48  ? 32  PRO D C   1 
ATOM   8354  O O   . PRO D  2  32  ? 102.814 175.051 141.702 1.00 25.48  ? 32  PRO D O   1 
ATOM   8355  C CB  . PRO D  2  32  ? 102.796 174.209 138.772 1.00 25.48  ? 32  PRO D CB  1 
ATOM   8356  C CG  . PRO D  2  32  ? 103.610 173.064 139.220 1.00 25.48  ? 32  PRO D CG  1 
ATOM   8357  C CD  . PRO D  2  32  ? 105.011 173.566 139.309 1.00 25.48  ? 32  PRO D CD  1 
ATOM   8358  N N   . GLY D  2  33  ? 102.117 176.958 140.728 1.00 29.90  ? 33  GLY D N   1 
ATOM   8359  C CA  . GLY D  2  33  ? 101.464 177.444 141.924 1.00 29.90  ? 33  GLY D CA  1 
ATOM   8360  C C   . GLY D  2  33  ? 102.455 177.814 143.004 1.00 29.90  ? 33  GLY D C   1 
ATOM   8361  O O   . GLY D  2  33  ? 102.515 177.165 144.051 1.00 29.90  ? 33  GLY D O   1 
ATOM   8362  N N   . LEU D  2  34  ? 103.245 178.857 142.757 1.00 29.90  ? 34  LEU D N   1 
ATOM   8363  C CA  . LEU D  2  34  ? 104.256 179.257 143.727 1.00 29.90  ? 34  LEU D CA  1 
ATOM   8364  C C   . LEU D  2  34  ? 103.617 179.841 144.980 1.00 29.90  ? 34  LEU D C   1 
ATOM   8365  O O   . LEU D  2  34  ? 103.839 179.349 146.092 1.00 29.90  ? 34  LEU D O   1 
ATOM   8366  C CB  . LEU D  2  34  ? 105.221 180.254 143.092 1.00 29.90  ? 34  LEU D CB  1 
ATOM   8367  C CG  . LEU D  2  34  ? 106.340 180.721 144.014 1.00 29.90  ? 34  LEU D CG  1 
ATOM   8368  C CD1 . LEU D  2  34  ? 107.156 179.543 144.493 1.00 29.90  ? 34  LEU D CD1 1 
ATOM   8369  C CD2 . LEU D  2  34  ? 107.223 181.690 143.278 1.00 29.90  ? 34  LEU D CD2 1 
ATOM   8370  N N   . GLY D  2  35  ? 102.818 180.895 144.822 1.00 45.11  ? 35  GLY D N   1 
ATOM   8371  C CA  . GLY D  2  35  ? 102.134 181.482 145.959 1.00 45.11  ? 35  GLY D CA  1 
ATOM   8372  C C   . GLY D  2  35  ? 100.861 180.779 146.368 1.00 45.11  ? 35  GLY D C   1 
ATOM   8373  O O   . GLY D  2  35  ? 100.331 181.054 147.448 1.00 45.11  ? 35  GLY D O   1 
ATOM   8374  N N   . GLU D  2  36  ? 100.368 179.878 145.532 1.00 49.45  ? 36  GLU D N   1 
ATOM   8375  C CA  . GLU D  2  36  ? 99.134  179.149 145.781 1.00 49.45  ? 36  GLU D CA  1 
ATOM   8376  C C   . GLU D  2  36  ? 99.462  177.844 146.511 1.00 49.45  ? 36  GLU D C   1 
ATOM   8377  O O   . GLU D  2  36  ? 100.545 177.692 147.080 1.00 49.45  ? 36  GLU D O   1 
ATOM   8378  C CB  . GLU D  2  36  ? 98.394  178.927 144.461 1.00 49.45  ? 36  GLU D CB  1 
ATOM   8379  C CG  . GLU D  2  36  ? 97.946  180.212 143.792 1.00 49.45  ? 36  GLU D CG  1 
ATOM   8380  C CD  . GLU D  2  36  ? 97.247  179.966 142.472 1.00 49.45  ? 36  GLU D CD  1 
ATOM   8381  O OE1 . GLU D  2  36  ? 97.194  178.798 142.035 1.00 49.45  ? 36  GLU D OE1 1 
ATOM   8382  O OE2 . GLU D  2  36  ? 96.756  180.941 141.868 1.00 49.45  ? 36  GLU D OE2 1 
ATOM   8383  N N   . ARG D  2  37  ? 98.517  176.904 146.524 1.00 39.53  ? 37  ARG D N   1 
ATOM   8384  C CA  . ARG D  2  37  ? 98.678  175.611 147.179 1.00 39.53  ? 37  ARG D CA  1 
ATOM   8385  C C   . ARG D  2  37  ? 99.952  174.883 146.767 1.00 39.53  ? 37  ARG D C   1 
ATOM   8386  O O   . ARG D  2  37  ? 100.527 175.158 145.710 1.00 39.53  ? 37  ARG D O   1 
ATOM   8387  C CB  . ARG D  2  37  ? 97.471  174.716 146.887 1.00 39.53  ? 37  ARG D CB  1 
ATOM   8388  C CG  . ARG D  2  37  ? 97.512  174.018 145.530 1.00 39.53  ? 37  ARG D CG  1 
ATOM   8389  C CD  . ARG D  2  37  ? 97.247  174.981 144.383 1.00 39.53  ? 37  ARG D CD  1 
ATOM   8390  N NE  . ARG D  2  37  ? 97.230  174.304 143.091 1.00 39.53  ? 37  ARG D NE  1 
ATOM   8391  C CZ  . ARG D  2  37  ? 98.310  174.082 142.350 1.00 39.53  ? 37  ARG D CZ  1 
ATOM   8392  N NH1 . ARG D  2  37  ? 99.496  174.497 142.767 1.00 39.53  ? 37  ARG D NH1 1 
ATOM   8393  N NH2 . ARG D  2  37  ? 98.203  173.455 141.188 1.00 39.53  ? 37  ARG D NH2 1 
ATOM   8394  N N   . VAL D  2  38  ? 100.391 173.945 147.608 1.00 28.20  ? 38  VAL D N   1 
ATOM   8395  C CA  . VAL D  2  38  ? 101.617 173.201 147.356 1.00 28.20  ? 38  VAL D CA  1 
ATOM   8396  C C   . VAL D  2  38  ? 101.444 172.299 146.141 1.00 28.20  ? 38  VAL D C   1 
ATOM   8397  O O   . VAL D  2  38  ? 100.331 171.887 145.793 1.00 28.20  ? 38  VAL D O   1 
ATOM   8398  C CB  . VAL D  2  38  ? 101.994 172.378 148.599 1.00 28.20  ? 38  VAL D CB  1 
ATOM   8399  C CG1 . VAL D  2  38  ? 102.167 173.287 149.791 1.00 28.20  ? 38  VAL D CG1 1 
ATOM   8400  C CG2 . VAL D  2  38  ? 100.933 171.334 148.881 1.00 28.20  ? 38  VAL D CG2 1 
ATOM   8401  N N   . THR D  2  39  ? 102.558 171.986 145.485 1.00 25.70  ? 39  THR D N   1 
ATOM   8402  C CA  . THR D  2  39  ? 102.544 171.027 144.390 1.00 25.70  ? 39  THR D CA  1 
ATOM   8403  C C   . THR D  2  39  ? 102.520 169.616 144.955 1.00 25.70  ? 39  THR D C   1 
ATOM   8404  O O   . THR D  2  39  ? 103.280 169.298 145.873 1.00 25.70  ? 39  THR D O   1 
ATOM   8405  C CB  . THR D  2  39  ? 103.764 171.213 143.495 1.00 25.70  ? 39  THR D CB  1 
ATOM   8406  O OG1 . THR D  2  39  ? 103.744 172.528 142.932 1.00 25.70  ? 39  THR D OG1 1 
ATOM   8407  C CG2 . THR D  2  39  ? 103.758 170.197 142.379 1.00 25.70  ? 39  THR D CG2 1 
ATOM   8408  N N   . GLU D  2  40  ? 101.650 168.770 144.414 1.00 29.85  ? 40  GLU D N   1 
ATOM   8409  C CA  . GLU D  2  40  ? 101.428 167.430 144.951 1.00 29.85  ? 40  GLU D CA  1 
ATOM   8410  C C   . GLU D  2  40  ? 101.807 166.399 143.894 1.00 29.85  ? 40  GLU D C   1 
ATOM   8411  O O   . GLU D  2  40  ? 100.962 165.947 143.119 1.00 29.85  ? 40  GLU D O   1 
ATOM   8412  C CB  . GLU D  2  40  ? 99.984  167.270 145.399 1.00 29.85  ? 40  GLU D CB  1 
ATOM   8413  C CG  . GLU D  2  40  ? 99.677  165.939 146.053 1.00 29.85  ? 40  GLU D CG  1 
ATOM   8414  C CD  . GLU D  2  40  ? 98.262  165.868 146.591 1.00 29.85  ? 40  GLU D CD  1 
ATOM   8415  O OE1 . GLU D  2  40  ? 97.521  166.864 146.454 1.00 29.85  ? 40  GLU D OE1 1 
ATOM   8416  O OE2 . GLU D  2  40  ? 97.889  164.816 147.149 1.00 29.85  ? 40  GLU D OE2 1 
ATOM   8417  N N   . VAL D  2  41  ? 103.084 166.020 143.876 1.00 21.95  ? 41  VAL D N   1 
ATOM   8418  C CA  . VAL D  2  41  ? 103.558 164.996 142.959 1.00 21.95  ? 41  VAL D CA  1 
ATOM   8419  C C   . VAL D  2  41  ? 102.992 163.643 143.360 1.00 21.95  ? 41  VAL D C   1 
ATOM   8420  O O   . VAL D  2  41  ? 102.872 163.328 144.550 1.00 21.95  ? 41  VAL D O   1 
ATOM   8421  C CB  . VAL D  2  41  ? 105.093 164.974 142.949 1.00 21.95  ? 41  VAL D CB  1 
ATOM   8422  C CG1 . VAL D  2  41  ? 105.605 163.812 142.146 1.00 21.95  ? 41  VAL D CG1 1 
ATOM   8423  C CG2 . VAL D  2  41  ? 105.622 166.264 142.384 1.00 21.95  ? 41  VAL D CG2 1 
ATOM   8424  N N   . LYS D  2  42  ? 102.634 162.836 142.367 1.00 20.35  ? 42  LYS D N   1 
ATOM   8425  C CA  . LYS D  2  42  ? 102.171 161.474 142.583 1.00 20.35  ? 42  LYS D CA  1 
ATOM   8426  C C   . LYS D  2  42  ? 103.185 160.510 141.990 1.00 20.35  ? 42  LYS D C   1 
ATOM   8427  O O   . LYS D  2  42  ? 103.623 160.694 140.851 1.00 20.35  ? 42  LYS D O   1 
ATOM   8428  C CB  . LYS D  2  42  ? 100.799 161.257 141.951 1.00 20.35  ? 42  LYS D CB  1 
ATOM   8429  C CG  . LYS D  2  42  ? 99.703  162.075 142.586 1.00 20.35  ? 42  LYS D CG  1 
ATOM   8430  C CD  . LYS D  2  42  ? 98.369  161.774 141.945 1.00 20.35  ? 42  LYS D CD  1 
ATOM   8431  C CE  . LYS D  2  42  ? 97.273  162.623 142.547 1.00 20.35  ? 42  LYS D CE  1 
ATOM   8432  N NZ  . LYS D  2  42  ? 95.963  162.343 141.907 1.00 20.35  ? 42  LYS D NZ  1 
ATOM   8433  N N   . THR D  2  43  ? 103.552 159.485 142.750 1.00 23.28  ? 43  THR D N   1 
ATOM   8434  C CA  . THR D  2  43  ? 104.624 158.581 142.368 1.00 23.28  ? 43  THR D CA  1 
ATOM   8435  C C   . THR D  2  43  ? 104.083 157.168 142.207 1.00 23.28  ? 43  THR D C   1 
ATOM   8436  O O   . THR D  2  43  ? 103.085 156.794 142.824 1.00 23.28  ? 43  THR D O   1 
ATOM   8437  C CB  . THR D  2  43  ? 105.738 158.598 143.411 1.00 23.28  ? 43  THR D CB  1 
ATOM   8438  O OG1 . THR D  2  43  ? 106.166 159.946 143.611 1.00 23.28  ? 43  THR D OG1 1 
ATOM   8439  C CG2 . THR D  2  43  ? 106.924 157.804 142.938 1.00 23.28  ? 43  THR D CG2 1 
ATOM   8440  N N   . ASP D  2  44  ? 104.743 156.392 141.354 1.00 25.94  ? 44  ASP D N   1 
ATOM   8441  C CA  . ASP D  2  44  ? 104.405 154.992 141.160 1.00 25.94  ? 44  ASP D CA  1 
ATOM   8442  C C   . ASP D  2  44  ? 105.610 154.296 140.552 1.00 25.94  ? 44  ASP D C   1 
ATOM   8443  O O   . ASP D  2  44  ? 106.246 154.837 139.647 1.00 25.94  ? 44  ASP D O   1 
ATOM   8444  C CB  . ASP D  2  44  ? 103.182 154.840 140.253 1.00 25.94  ? 44  ASP D CB  1 
ATOM   8445  C CG  . ASP D  2  44  ? 102.700 153.410 140.163 1.00 25.94  ? 44  ASP D CG  1 
ATOM   8446  O OD1 . ASP D  2  44  ? 103.325 152.535 140.794 1.00 25.94  ? 44  ASP D OD1 1 
ATOM   8447  O OD2 . ASP D  2  44  ? 101.701 153.155 139.457 1.00 25.94  ? 44  ASP D OD2 1 
ATOM   8448  N N   . ILE D  2  45  ? 105.915 153.101 141.044 1.00 43.48  ? 45  ILE D N   1 
ATOM   8449  C CA  . ILE D  2  45  ? 107.046 152.319 140.564 1.00 43.48  ? 45  ILE D CA  1 
ATOM   8450  C C   . ILE D  2  45  ? 106.522 151.040 139.935 1.00 43.48  ? 45  ILE D C   1 
ATOM   8451  O O   . ILE D  2  45  ? 105.558 150.448 140.426 1.00 43.48  ? 45  ILE D O   1 
ATOM   8452  C CB  . ILE D  2  45  ? 108.037 152.001 141.702 1.00 43.48  ? 45  ILE D CB  1 
ATOM   8453  C CG1 . ILE D  2  45  ? 108.670 153.280 142.228 1.00 43.48  ? 45  ILE D CG1 1 
ATOM   8454  C CG2 . ILE D  2  45  ? 109.119 151.069 141.234 1.00 43.48  ? 45  ILE D CG2 1 
ATOM   8455  C CD1 . ILE D  2  45  ? 109.499 153.068 143.457 1.00 43.48  ? 45  ILE D CD1 1 
ATOM   8456  N N   . PHE D  2  46  ? 107.146 150.626 138.835 1.00 29.20  ? 46  PHE D N   1 
ATOM   8457  C CA  . PHE D  2  46  ? 106.874 149.339 138.197 1.00 29.20  ? 46  PHE D CA  1 
ATOM   8458  C C   . PHE D  2  46  ? 108.217 148.643 138.015 1.00 29.20  ? 46  PHE D C   1 
ATOM   8459  O O   . PHE D  2  46  ? 108.850 148.777 136.968 1.00 29.20  ? 46  PHE D O   1 
ATOM   8460  C CB  . PHE D  2  46  ? 106.148 149.509 136.869 1.00 29.20  ? 46  PHE D CB  1 
ATOM   8461  C CG  . PHE D  2  46  ? 105.846 148.211 136.176 1.00 29.20  ? 46  PHE D CG  1 
ATOM   8462  C CD1 . PHE D  2  46  ? 104.780 147.432 136.576 1.00 29.20  ? 46  PHE D CD1 1 
ATOM   8463  C CD2 . PHE D  2  46  ? 106.637 147.762 135.140 1.00 29.20  ? 46  PHE D CD2 1 
ATOM   8464  C CE1 . PHE D  2  46  ? 104.504 146.240 135.946 1.00 29.20  ? 46  PHE D CE1 1 
ATOM   8465  C CE2 . PHE D  2  46  ? 106.365 146.570 134.512 1.00 29.20  ? 46  PHE D CE2 1 
ATOM   8466  C CZ  . PHE D  2  46  ? 105.298 145.809 134.914 1.00 29.20  ? 46  PHE D CZ  1 
ATOM   8467  N N   . VAL D  2  47  ? 108.647 147.900 139.030 1.00 18.86  ? 47  VAL D N   1 
ATOM   8468  C CA  . VAL D  2  47  ? 109.931 147.211 138.998 1.00 18.86  ? 47  VAL D CA  1 
ATOM   8469  C C   . VAL D  2  47  ? 109.942 146.180 137.881 1.00 18.86  ? 47  VAL D C   1 
ATOM   8470  O O   . VAL D  2  47  ? 109.218 145.183 137.939 1.00 18.86  ? 47  VAL D O   1 
ATOM   8471  C CB  . VAL D  2  47  ? 110.226 146.546 140.350 1.00 18.86  ? 47  VAL D CB  1 
ATOM   8472  C CG1 . VAL D  2  47  ? 111.469 145.705 140.253 1.00 18.86  ? 47  VAL D CG1 1 
ATOM   8473  C CG2 . VAL D  2  47  ? 110.380 147.595 141.420 1.00 18.86  ? 47  VAL D CG2 1 
ATOM   8474  N N   . THR D  2  48  ? 110.766 146.405 136.858 1.00 21.57  ? 48  THR D N   1 
ATOM   8475  C CA  . THR D  2  48  ? 110.819 145.465 135.744 1.00 21.57  ? 48  THR D CA  1 
ATOM   8476  C C   . THR D  2  48  ? 111.553 144.190 136.129 1.00 21.57  ? 48  THR D C   1 
ATOM   8477  O O   . THR D  2  48  ? 111.072 143.084 135.866 1.00 21.57  ? 48  THR D O   1 
ATOM   8478  C CB  . THR D  2  48  ? 111.481 146.110 134.529 1.00 21.57  ? 48  THR D CB  1 
ATOM   8479  O OG1 . THR D  2  48  ? 110.684 147.208 134.073 1.00 21.57  ? 48  THR D OG1 1 
ATOM   8480  C CG2 . THR D  2  48  ? 111.625 145.099 133.412 1.00 21.57  ? 48  THR D CG2 1 
ATOM   8481  N N   . SER D  2  49  ? 112.720 144.319 136.754 1.00 22.11  ? 49  SER D N   1 
ATOM   8482  C CA  . SER D  2  49  ? 113.507 143.151 137.111 1.00 22.11  ? 49  SER D CA  1 
ATOM   8483  C C   . SER D  2  49  ? 114.350 143.470 138.329 1.00 22.11  ? 49  SER D C   1 
ATOM   8484  O O   . SER D  2  49  ? 114.994 144.520 138.383 1.00 22.11  ? 49  SER D O   1 
ATOM   8485  C CB  . SER D  2  49  ? 114.419 142.716 135.967 1.00 22.11  ? 49  SER D CB  1 
ATOM   8486  O OG  . SER D  2  49  ? 115.482 143.636 135.804 1.00 22.11  ? 49  SER D OG  1 
ATOM   8487  N N   . PHE D  2  50  ? 114.366 142.552 139.289 1.00 29.85  ? 50  PHE D N   1 
ATOM   8488  C CA  . PHE D  2  50  ? 115.051 142.758 140.558 1.00 29.85  ? 50  PHE D CA  1 
ATOM   8489  C C   . PHE D  2  50  ? 116.428 142.114 140.452 1.00 29.85  ? 50  PHE D C   1 
ATOM   8490  O O   . PHE D  2  50  ? 116.541 140.890 140.354 1.00 29.85  ? 50  PHE D O   1 
ATOM   8491  C CB  . PHE D  2  50  ? 114.242 142.165 141.705 1.00 29.85  ? 50  PHE D CB  1 
ATOM   8492  C CG  . PHE D  2  50  ? 114.692 142.614 143.054 1.00 29.85  ? 50  PHE D CG  1 
ATOM   8493  C CD1 . PHE D  2  50  ? 114.332 143.854 143.528 1.00 29.85  ? 50  PHE D CD1 1 
ATOM   8494  C CD2 . PHE D  2  50  ? 115.480 141.811 143.844 1.00 29.85  ? 50  PHE D CD2 1 
ATOM   8495  C CE1 . PHE D  2  50  ? 114.740 144.279 144.768 1.00 29.85  ? 50  PHE D CE1 1 
ATOM   8496  C CE2 . PHE D  2  50  ? 115.890 142.233 145.086 1.00 29.85  ? 50  PHE D CE2 1 
ATOM   8497  C CZ  . PHE D  2  50  ? 115.522 143.468 145.546 1.00 29.85  ? 50  PHE D CZ  1 
ATOM   8498  N N   . GLY D  2  51  ? 117.471 142.934 140.473 1.00 19.10  ? 51  GLY D N   1 
ATOM   8499  C CA  . GLY D  2  51  ? 118.798 142.486 140.123 1.00 19.10  ? 51  GLY D CA  1 
ATOM   8500  C C   . GLY D  2  51  ? 119.474 141.637 141.175 1.00 19.10  ? 51  GLY D C   1 
ATOM   8501  O O   . GLY D  2  51  ? 118.869 141.222 142.165 1.00 19.10  ? 51  GLY D O   1 
ATOM   8502  N N   . PRO D  2  52  ? 120.764 141.364 140.969 1.00 16.83  ? 52  PRO D N   1 
ATOM   8503  C CA  . PRO D  2  52  ? 121.503 140.451 141.852 1.00 16.83  ? 52  PRO D CA  1 
ATOM   8504  C C   . PRO D  2  52  ? 121.893 141.140 143.149 1.00 16.83  ? 52  PRO D C   1 
ATOM   8505  O O   . PRO D  2  52  ? 122.681 142.087 143.149 1.00 16.83  ? 52  PRO D O   1 
ATOM   8506  C CB  . PRO D  2  52  ? 122.737 140.084 141.020 1.00 16.83  ? 52  PRO D CB  1 
ATOM   8507  C CG  . PRO D  2  52  ? 122.942 141.261 140.142 1.00 16.83  ? 52  PRO D CG  1 
ATOM   8508  C CD  . PRO D  2  52  ? 121.576 141.794 139.820 1.00 16.83  ? 52  PRO D CD  1 
ATOM   8509  N N   . VAL D  2  53  ? 121.342 140.655 144.261 1.00 22.28  ? 53  VAL D N   1 
ATOM   8510  C CA  . VAL D  2  53  ? 121.739 141.155 145.570 1.00 22.28  ? 53  VAL D CA  1 
ATOM   8511  C C   . VAL D  2  53  ? 123.136 140.654 145.900 1.00 22.28  ? 53  VAL D C   1 
ATOM   8512  O O   . VAL D  2  53  ? 123.465 139.483 145.673 1.00 22.28  ? 53  VAL D O   1 
ATOM   8513  C CB  . VAL D  2  53  ? 120.727 140.718 146.639 1.00 22.28  ? 53  VAL D CB  1 
ATOM   8514  C CG1 . VAL D  2  53  ? 121.178 141.174 148.001 1.00 22.28  ? 53  VAL D CG1 1 
ATOM   8515  C CG2 . VAL D  2  53  ? 119.360 141.273 146.322 1.00 22.28  ? 53  VAL D CG2 1 
ATOM   8516  N N   . SER D  2  54  ? 123.967 141.537 146.440 1.00 36.64  ? 54  SER D N   1 
ATOM   8517  C CA  . SER D  2  54  ? 125.360 141.232 146.730 1.00 36.64  ? 54  SER D CA  1 
ATOM   8518  C C   . SER D  2  54  ? 125.591 141.272 148.232 1.00 36.64  ? 54  SER D C   1 
ATOM   8519  O O   . SER D  2  54  ? 125.177 142.223 148.901 1.00 36.64  ? 54  SER D O   1 
ATOM   8520  C CB  . SER D  2  54  ? 126.289 142.220 146.027 1.00 36.64  ? 54  SER D CB  1 
ATOM   8521  O OG  . SER D  2  54  ? 127.643 141.957 146.344 1.00 36.64  ? 54  SER D OG  1 
ATOM   8522  N N   . ASP D  2  55  ? 126.252 140.240 148.760 1.00 49.52  ? 55  ASP D N   1 
ATOM   8523  C CA  . ASP D  2  55  ? 126.540 140.195 150.189 1.00 49.52  ? 55  ASP D CA  1 
ATOM   8524  C C   . ASP D  2  55  ? 127.814 140.952 150.536 1.00 49.52  ? 55  ASP D C   1 
ATOM   8525  O O   . ASP D  2  55  ? 127.885 141.599 151.586 1.00 49.52  ? 55  ASP D O   1 
ATOM   8526  C CB  . ASP D  2  55  ? 126.647 138.747 150.664 1.00 49.52  ? 55  ASP D CB  1 
ATOM   8527  C CG  . ASP D  2  55  ? 125.310 138.048 150.701 1.00 49.52  ? 55  ASP D CG  1 
ATOM   8528  O OD1 . ASP D  2  55  ? 124.292 138.734 150.921 1.00 49.52  ? 55  ASP D OD1 1 
ATOM   8529  O OD2 . ASP D  2  55  ? 125.273 136.814 150.511 1.00 49.52  ? 55  ASP D OD2 1 
ATOM   8530  N N   . HIS D  2  56  ? 128.833 140.871 149.679 1.00 74.51  ? 56  HIS D N   1 
ATOM   8531  C CA  . HIS D  2  56  ? 130.106 141.521 149.970 1.00 74.51  ? 56  HIS D CA  1 
ATOM   8532  C C   . HIS D  2  56  ? 129.941 143.033 150.064 1.00 74.51  ? 56  HIS D C   1 
ATOM   8533  O O   . HIS D  2  56  ? 130.206 143.638 151.108 1.00 74.51  ? 56  HIS D O   1 
ATOM   8534  C CB  . HIS D  2  56  ? 131.135 141.152 148.901 1.00 74.51  ? 56  HIS D CB  1 
ATOM   8535  C CG  . HIS D  2  56  ? 131.469 139.695 148.866 1.00 74.51  ? 56  HIS D CG  1 
ATOM   8536  N ND1 . HIS D  2  56  ? 132.281 139.095 149.803 1.00 74.51  ? 56  HIS D ND1 1 
ATOM   8537  C CD2 . HIS D  2  56  ? 131.097 138.716 148.009 1.00 74.51  ? 56  HIS D CD2 1 
ATOM   8538  C CE1 . HIS D  2  56  ? 132.398 137.809 149.523 1.00 74.51  ? 56  HIS D CE1 1 
ATOM   8539  N NE2 . HIS D  2  56  ? 131.688 137.553 148.439 1.00 74.51  ? 56  HIS D NE2 1 
ATOM   8540  N N   . ASP D  2  57  ? 129.499 143.664 148.976 1.00 65.89  ? 57  ASP D N   1 
ATOM   8541  C CA  . ASP D  2  57  ? 129.317 145.109 148.968 1.00 65.89  ? 57  ASP D CA  1 
ATOM   8542  C C   . ASP D  2  57  ? 128.055 145.550 149.696 1.00 65.89  ? 57  ASP D C   1 
ATOM   8543  O O   . ASP D  2  57  ? 127.948 146.725 150.060 1.00 65.89  ? 57  ASP D O   1 
ATOM   8544  C CB  . ASP D  2  57  ? 129.276 145.623 147.529 1.00 65.89  ? 57  ASP D CB  1 
ATOM   8545  C CG  . ASP D  2  57  ? 130.602 145.476 146.819 1.00 65.89  ? 57  ASP D CG  1 
ATOM   8546  O OD1 . ASP D  2  57  ? 131.649 145.523 147.496 1.00 65.89  ? 57  ASP D OD1 1 
ATOM   8547  O OD2 . ASP D  2  57  ? 130.598 145.312 145.582 1.00 65.89  ? 57  ASP D OD2 1 
ATOM   8548  N N   . MET D  2  58  ? 127.105 144.638 149.910 1.00 47.58  ? 58  MET D N   1 
ATOM   8549  C CA  . MET D  2  58  ? 125.811 144.957 150.515 1.00 47.58  ? 58  MET D CA  1 
ATOM   8550  C C   . MET D  2  58  ? 125.055 146.014 149.717 1.00 47.58  ? 58  MET D C   1 
ATOM   8551  O O   . MET D  2  58  ? 124.466 146.938 150.276 1.00 47.58  ? 58  MET D O   1 
ATOM   8552  C CB  . MET D  2  58  ? 125.960 145.376 151.978 1.00 47.58  ? 58  MET D CB  1 
ATOM   8553  C CG  . MET D  2  58  ? 126.197 144.198 152.897 1.00 47.58  ? 58  MET D CG  1 
ATOM   8554  S SD  . MET D  2  58  ? 126.276 144.618 154.642 1.00 47.58  ? 58  MET D SD  1 
ATOM   8555  C CE  . MET D  2  58  ? 126.475 142.984 155.343 1.00 47.58  ? 58  MET D CE  1 
ATOM   8556  N N   . GLU D  2  59  ? 125.061 145.868 148.397 1.00 38.45  ? 59  GLU D N   1 
ATOM   8557  C CA  . GLU D  2  59  ? 124.224 146.660 147.512 1.00 38.45  ? 59  GLU D CA  1 
ATOM   8558  C C   . GLU D  2  59  ? 123.334 145.719 146.716 1.00 38.45  ? 59  GLU D C   1 
ATOM   8559  O O   . GLU D  2  59  ? 123.670 144.549 146.519 1.00 38.45  ? 59  GLU D O   1 
ATOM   8560  C CB  . GLU D  2  59  ? 125.057 147.514 146.553 1.00 38.45  ? 59  GLU D CB  1 
ATOM   8561  C CG  . GLU D  2  59  ? 125.795 146.713 145.491 1.00 38.45  ? 59  GLU D CG  1 
ATOM   8562  C CD  . GLU D  2  59  ? 126.644 147.582 144.583 1.00 38.45  ? 59  GLU D CD  1 
ATOM   8563  O OE1 . GLU D  2  59  ? 126.704 148.805 144.817 1.00 38.45  ? 59  GLU D OE1 1 
ATOM   8564  O OE2 . GLU D  2  59  ? 127.244 147.044 143.629 1.00 38.45  ? 59  GLU D OE2 1 
ATOM   8565  N N   . TYR D  2  60  ? 122.192 146.224 146.267 1.00 23.84  ? 60  TYR D N   1 
ATOM   8566  C CA  . TYR D  2  60  ? 121.288 145.432 145.447 1.00 23.84  ? 60  TYR D CA  1 
ATOM   8567  C C   . TYR D  2  60  ? 120.832 146.268 144.265 1.00 23.84  ? 60  TYR D C   1 
ATOM   8568  O O   . TYR D  2  60  ? 120.398 147.408 144.438 1.00 23.84  ? 60  TYR D O   1 
ATOM   8569  C CB  . TYR D  2  60  ? 120.089 144.938 146.256 1.00 23.84  ? 60  TYR D CB  1 
ATOM   8570  C CG  . TYR D  2  60  ? 119.113 146.012 146.647 1.00 23.84  ? 60  TYR D CG  1 
ATOM   8571  C CD1 . TYR D  2  60  ? 119.330 146.794 147.761 1.00 23.84  ? 60  TYR D CD1 1 
ATOM   8572  C CD2 . TYR D  2  60  ? 117.957 146.218 145.922 1.00 23.84  ? 60  TYR D CD2 1 
ATOM   8573  C CE1 . TYR D  2  60  ? 118.440 147.768 148.123 1.00 23.84  ? 60  TYR D CE1 1 
ATOM   8574  C CE2 . TYR D  2  60  ? 117.061 147.187 146.281 1.00 23.84  ? 60  TYR D CE2 1 
ATOM   8575  C CZ  . TYR D  2  60  ? 117.308 147.959 147.383 1.00 23.84  ? 60  TYR D CZ  1 
ATOM   8576  O OH  . TYR D  2  60  ? 116.414 148.933 147.748 1.00 23.84  ? 60  TYR D OH  1 
ATOM   8577  N N   . THR D  2  61  ? 120.942 145.705 143.070 1.00 18.62  ? 61  THR D N   1 
ATOM   8578  C CA  . THR D  2  61  ? 120.529 146.404 141.867 1.00 18.62  ? 61  THR D CA  1 
ATOM   8579  C C   . THR D  2  61  ? 119.042 146.194 141.630 1.00 18.62  ? 61  THR D C   1 
ATOM   8580  O O   . THR D  2  61  ? 118.529 145.085 141.780 1.00 18.62  ? 61  THR D O   1 
ATOM   8581  C CB  . THR D  2  61  ? 121.328 145.897 140.670 1.00 18.62  ? 61  THR D CB  1 
ATOM   8582  O OG1 . THR D  2  61  ? 122.720 146.147 140.890 1.00 18.62  ? 61  THR D OG1 1 
ATOM   8583  C CG2 . THR D  2  61  ? 120.893 146.591 139.402 1.00 18.62  ? 61  THR D CG2 1 
ATOM   8584  N N   . ILE D  2  62  ? 118.347 147.263 141.269 1.00 13.53  ? 62  ILE D N   1 
ATOM   8585  C CA  . ILE D  2  62  ? 116.920 147.202 140.981 1.00 13.53  ? 62  ILE D CA  1 
ATOM   8586  C C   . ILE D  2  62  ? 116.647 148.037 139.742 1.00 13.53  ? 62  ILE D C   1 
ATOM   8587  O O   . ILE D  2  62  ? 117.278 149.077 139.530 1.00 13.53  ? 62  ILE D O   1 
ATOM   8588  C CB  . ILE D  2  62  ? 116.079 147.686 142.180 1.00 13.53  ? 62  ILE D CB  1 
ATOM   8589  C CG1 . ILE D  2  62  ? 114.591 147.518 141.904 1.00 13.53  ? 62  ILE D CG1 1 
ATOM   8590  C CG2 . ILE D  2  62  ? 116.376 149.115 142.501 1.00 13.53  ? 62  ILE D CG2 1 
ATOM   8591  C CD1 . ILE D  2  62  ? 113.739 147.742 143.114 1.00 13.53  ? 62  ILE D CD1 1 
ATOM   8592  N N   . ASP D  2  63  ? 115.723 147.572 138.910 1.00 21.05  ? 63  ASP D N   1 
ATOM   8593  C CA  . ASP D  2  63  ? 115.275 148.310 137.741 1.00 21.05  ? 63  ASP D CA  1 
ATOM   8594  C C   . ASP D  2  63  ? 113.850 148.794 137.964 1.00 21.05  ? 63  ASP D C   1 
ATOM   8595  O O   . ASP D  2  63  ? 113.015 148.062 138.499 1.00 21.05  ? 63  ASP D O   1 
ATOM   8596  C CB  . ASP D  2  63  ? 115.347 147.444 136.487 1.00 21.05  ? 63  ASP D CB  1 
ATOM   8597  C CG  . ASP D  2  63  ? 114.996 148.209 135.233 1.00 21.05  ? 63  ASP D CG  1 
ATOM   8598  O OD1 . ASP D  2  63  ? 114.640 149.400 135.340 1.00 21.05  ? 63  ASP D OD1 1 
ATOM   8599  O OD2 . ASP D  2  63  ? 115.076 147.621 134.134 1.00 21.05  ? 63  ASP D OD2 1 
ATOM   8600  N N   . VAL D  2  64  ? 113.571 150.027 137.552 1.00 32.17  ? 64  VAL D N   1 
ATOM   8601  C CA  . VAL D  2  64  ? 112.289 150.659 137.828 1.00 32.17  ? 64  VAL D CA  1 
ATOM   8602  C C   . VAL D  2  64  ? 111.835 151.440 136.607 1.00 32.17  ? 64  VAL D C   1 
ATOM   8603  O O   . VAL D  2  64  ? 112.649 151.893 135.800 1.00 32.17  ? 64  VAL D O   1 
ATOM   8604  C CB  . VAL D  2  64  ? 112.362 151.595 139.053 1.00 32.17  ? 64  VAL D CB  1 
ATOM   8605  C CG1 . VAL D  2  64  ? 112.665 150.814 140.313 1.00 32.17  ? 64  VAL D CG1 1 
ATOM   8606  C CG2 . VAL D  2  64  ? 113.412 152.654 138.840 1.00 32.17  ? 64  VAL D CG2 1 
ATOM   8607  N N   . PHE D  2  65  ? 110.542 151.739 136.562 1.00 43.48  ? 65  PHE D N   1 
ATOM   8608  C CA  . PHE D  2  65  ? 109.935 152.593 135.548 1.00 43.48  ? 65  PHE D CA  1 
ATOM   8609  C C   . PHE D  2  65  ? 109.335 153.631 136.472 1.00 43.48  ? 65  PHE D C   1 
ATOM   8610  O O   . PHE D  2  65  ? 108.148 153.612 136.745 1.00 43.48  ? 65  PHE D O   1 
ATOM   8611  C CB  . PHE D  2  65  ? 108.815 151.873 134.824 1.00 43.48  ? 65  PHE D CB  1 
ATOM   8612  C CG  . PHE D  2  65  ? 109.263 151.081 133.640 1.00 43.48  ? 65  PHE D CG  1 
ATOM   8613  C CD1 . PHE D  2  65  ? 110.112 150.008 133.789 1.00 43.48  ? 65  PHE D CD1 1 
ATOM   8614  C CD2 . PHE D  2  65  ? 108.811 151.398 132.380 1.00 43.48  ? 65  PHE D CD2 1 
ATOM   8615  C CE1 . PHE D  2  65  ? 110.514 149.269 132.699 1.00 43.48  ? 65  PHE D CE1 1 
ATOM   8616  C CE2 . PHE D  2  65  ? 109.208 150.666 131.285 1.00 43.48  ? 65  PHE D CE2 1 
ATOM   8617  C CZ  . PHE D  2  65  ? 110.063 149.599 131.444 1.00 43.48  ? 65  PHE D CZ  1 
ATOM   8618  N N   . PHE D  2  66  ? 110.153 154.562 136.926 1.00 43.48  ? 66  PHE D N   1 
ATOM   8619  C CA  . PHE D  2  66  ? 109.748 155.498 137.963 1.00 43.48  ? 66  PHE D CA  1 
ATOM   8620  C C   . PHE D  2  66  ? 108.749 156.495 137.388 1.00 43.48  ? 66  PHE D C   1 
ATOM   8621  O O   . PHE D  2  66  ? 109.137 157.417 136.668 1.00 43.48  ? 66  PHE D O   1 
ATOM   8622  C CB  . PHE D  2  66  ? 110.983 156.198 138.509 1.00 43.48  ? 66  PHE D CB  1 
ATOM   8623  C CG  . PHE D  2  66  ? 110.727 156.997 139.729 1.00 43.48  ? 66  PHE D CG  1 
ATOM   8624  C CD1 . PHE D  2  66  ? 110.536 156.373 140.936 1.00 43.48  ? 66  PHE D CD1 1 
ATOM   8625  C CD2 . PHE D  2  66  ? 110.692 158.365 139.680 1.00 43.48  ? 66  PHE D CD2 1 
ATOM   8626  C CE1 . PHE D  2  66  ? 110.305 157.099 142.073 1.00 43.48  ? 66  PHE D CE1 1 
ATOM   8627  C CE2 . PHE D  2  66  ? 110.462 159.091 140.817 1.00 43.48  ? 66  PHE D CE2 1 
ATOM   8628  C CZ  . PHE D  2  66  ? 110.269 158.457 142.014 1.00 43.48  ? 66  PHE D CZ  1 
ATOM   8629  N N   . ARG D  2  67  ? 107.465 156.300 137.667 1.00 36.55  ? 67  ARG D N   1 
ATOM   8630  C CA  . ARG D  2  67  ? 106.430 157.184 137.137 1.00 36.55  ? 67  ARG D CA  1 
ATOM   8631  C C   . ARG D  2  67  ? 106.104 158.361 138.041 1.00 36.55  ? 67  ARG D C   1 
ATOM   8632  O O   . ARG D  2  67  ? 106.161 158.255 139.255 1.00 36.55  ? 67  ARG D O   1 
ATOM   8633  C CB  . ARG D  2  67  ? 105.149 156.403 136.876 1.00 36.55  ? 67  ARG D CB  1 
ATOM   8634  C CG  . ARG D  2  67  ? 105.328 155.206 135.969 1.00 36.55  ? 67  ARG D CG  1 
ATOM   8635  C CD  . ARG D  2  67  ? 103.990 154.709 135.460 1.00 36.55  ? 67  ARG D CD  1 
ATOM   8636  N NE  . ARG D  2  67  ? 104.132 153.446 134.754 1.00 36.55  ? 67  ARG D NE  1 
ATOM   8637  C CZ  . ARG D  2  67  ? 103.758 152.277 135.252 1.00 36.55  ? 67  ARG D CZ  1 
ATOM   8638  N NH1 . ARG D  2  67  ? 103.925 151.170 134.550 1.00 36.55  ? 67  ARG D NH1 1 
ATOM   8639  N NH2 . ARG D  2  67  ? 103.208 152.217 136.451 1.00 36.55  ? 67  ARG D NH2 1 
ATOM   8640  N N   . GLN D  2  68  ? 105.745 159.481 137.435 1.00 43.48  ? 68  GLN D N   1 
ATOM   8641  C CA  . GLN D  2  68  ? 105.382 160.683 138.173 1.00 43.48  ? 68  GLN D CA  1 
ATOM   8642  C C   . GLN D  2  68  ? 104.232 161.396 137.481 1.00 43.48  ? 68  GLN D C   1 
ATOM   8643  O O   . GLN D  2  68  ? 104.017 161.234 136.281 1.00 43.48  ? 68  GLN D O   1 
ATOM   8644  C CB  . GLN D  2  68  ? 106.560 161.644 138.321 1.00 43.48  ? 68  GLN D CB  1 
ATOM   8645  C CG  . GLN D  2  68  ? 107.614 161.174 139.286 1.00 43.48  ? 68  GLN D CG  1 
ATOM   8646  C CD  . GLN D  2  68  ? 108.720 162.177 139.453 1.00 43.48  ? 68  GLN D CD  1 
ATOM   8647  O OE1 . GLN D  2  68  ? 108.766 163.184 138.754 1.00 43.48  ? 68  GLN D OE1 1 
ATOM   8648  N NE2 . GLN D  2  68  ? 109.606 161.929 140.401 1.00 43.48  ? 68  GLN D NE2 1 
ATOM   8649  N N   . SER D  2  69  ? 103.496 162.196 138.250 1.00 43.48  ? 69  SER D N   1 
ATOM   8650  C CA  . SER D  2  69  ? 102.339 162.905 137.719 1.00 43.48  ? 69  SER D CA  1 
ATOM   8651  C C   . SER D  2  69  ? 101.980 164.054 138.644 1.00 43.48  ? 69  SER D C   1 
ATOM   8652  O O   . SER D  2  69  ? 101.791 163.840 139.843 1.00 43.48  ? 69  SER D O   1 
ATOM   8653  C CB  . SER D  2  69  ? 101.146 161.964 137.570 1.00 43.48  ? 69  SER D CB  1 
ATOM   8654  O OG  . SER D  2  69  ? 100.006 162.670 137.124 1.00 43.48  ? 69  SER D OG  1 
ATOM   8655  N N   . TRP D  2  70  ? 101.869 165.259 138.092 1.00 43.48  ? 70  TRP D N   1 
ATOM   8656  C CA  . TRP D  2  70  ? 101.533 166.427 138.892 1.00 43.48  ? 70  TRP D CA  1 
ATOM   8657  C C   . TRP D  2  70  ? 100.699 167.376 138.052 1.00 43.48  ? 70  TRP D C   1 
ATOM   8658  O O   . TRP D  2  70  ? 100.811 167.407 136.826 1.00 43.48  ? 70  TRP D O   1 
ATOM   8659  C CB  . TRP D  2  70  ? 102.785 167.133 139.405 1.00 43.48  ? 70  TRP D CB  1 
ATOM   8660  C CG  . TRP D  2  70  ? 103.642 167.700 138.333 1.00 43.48  ? 70  TRP D CG  1 
ATOM   8661  C CD1 . TRP D  2  70  ? 103.601 168.962 137.840 1.00 43.48  ? 70  TRP D CD1 1 
ATOM   8662  C CD2 . TRP D  2  70  ? 104.671 167.020 137.616 1.00 43.48  ? 70  TRP D CD2 1 
ATOM   8663  N NE1 . TRP D  2  70  ? 104.546 169.118 136.859 1.00 43.48  ? 70  TRP D NE1 1 
ATOM   8664  C CE2 . TRP D  2  70  ? 105.214 167.935 136.702 1.00 43.48  ? 70  TRP D CE2 1 
ATOM   8665  C CE3 . TRP D  2  70  ? 105.185 165.725 137.657 1.00 43.48  ? 70  TRP D CE3 1 
ATOM   8666  C CZ2 . TRP D  2  70  ? 106.242 167.598 135.837 1.00 43.48  ? 70  TRP D CZ2 1 
ATOM   8667  C CZ3 . TRP D  2  70  ? 106.206 165.394 136.800 1.00 43.48  ? 70  TRP D CZ3 1 
ATOM   8668  C CH2 . TRP D  2  70  ? 106.726 166.325 135.901 1.00 43.48  ? 70  TRP D CH2 1 
ATOM   8669  N N   . LYS D  2  71  ? 99.868  168.164 138.724 1.00 32.75  ? 71  LYS D N   1 
ATOM   8670  C CA  . LYS D  2  71  ? 98.927  169.052 138.051 1.00 32.75  ? 71  LYS D CA  1 
ATOM   8671  C C   . LYS D  2  71  ? 99.548  170.435 137.921 1.00 32.75  ? 71  LYS D C   1 
ATOM   8672  O O   . LYS D  2  71  ? 99.683  171.158 138.912 1.00 32.75  ? 71  LYS D O   1 
ATOM   8673  C CB  . LYS D  2  71  ? 97.602  169.124 138.804 1.00 32.75  ? 71  LYS D CB  1 
ATOM   8674  C CG  . LYS D  2  71  ? 96.556  169.953 138.087 1.00 32.75  ? 71  LYS D CG  1 
ATOM   8675  C CD  . LYS D  2  71  ? 95.223  169.915 138.805 1.00 32.75  ? 71  LYS D CD  1 
ATOM   8676  C CE  . LYS D  2  71  ? 94.183  170.731 138.059 1.00 32.75  ? 71  LYS D CE  1 
ATOM   8677  N NZ  . LYS D  2  71  ? 92.859  170.703 138.737 1.00 32.75  ? 71  LYS D NZ  1 
ATOM   8678  N N   . ASP D  2  72  ? 99.904  170.805 136.697 1.00 33.28  ? 72  ASP D N   1 
ATOM   8679  C CA  . ASP D  2  72  ? 100.472 172.108 136.386 1.00 33.28  ? 72  ASP D CA  1 
ATOM   8680  C C   . ASP D  2  72  ? 99.420  172.937 135.666 1.00 33.28  ? 72  ASP D C   1 
ATOM   8681  O O   . ASP D  2  72  ? 98.854  172.492 134.665 1.00 33.28  ? 72  ASP D O   1 
ATOM   8682  C CB  . ASP D  2  72  ? 101.728 171.962 135.527 1.00 33.28  ? 72  ASP D CB  1 
ATOM   8683  C CG  . ASP D  2  72  ? 102.462 173.267 135.337 1.00 33.28  ? 72  ASP D CG  1 
ATOM   8684  O OD1 . ASP D  2  72  ? 101.954 174.313 135.787 1.00 33.28  ? 72  ASP D OD1 1 
ATOM   8685  O OD2 . ASP D  2  72  ? 103.559 173.246 134.745 1.00 33.28  ? 72  ASP D OD2 1 
ATOM   8686  N N   . GLU D  2  73  ? 99.169  174.141 136.175 1.00 38.22  ? 73  GLU D N   1 
ATOM   8687  C CA  . GLU D  2  73  ? 98.018  174.915 135.727 1.00 38.22  ? 73  GLU D CA  1 
ATOM   8688  C C   . GLU D  2  73  ? 98.289  175.675 134.436 1.00 38.22  ? 73  GLU D C   1 
ATOM   8689  O O   . GLU D  2  73  ? 97.360  175.908 133.656 1.00 38.22  ? 73  GLU D O   1 
ATOM   8690  C CB  . GLU D  2  73  ? 97.591  175.884 136.829 1.00 38.22  ? 73  GLU D CB  1 
ATOM   8691  C CG  . GLU D  2  73  ? 96.322  176.663 136.536 1.00 38.22  ? 73  GLU D CG  1 
ATOM   8692  C CD  . GLU D  2  73  ? 95.927  177.576 137.680 1.00 38.22  ? 73  GLU D CD  1 
ATOM   8693  O OE1 . GLU D  2  73  ? 96.662  177.614 138.689 1.00 38.22  ? 73  GLU D OE1 1 
ATOM   8694  O OE2 . GLU D  2  73  ? 94.885  178.256 137.572 1.00 38.22  ? 73  GLU D OE2 1 
ATOM   8695  N N   . ARG D  2  74  ? 99.540  176.058 134.185 1.00 29.72  ? 74  ARG D N   1 
ATOM   8696  C CA  . ARG D  2  74  ? 99.845  176.928 133.057 1.00 29.72  ? 74  ARG D CA  1 
ATOM   8697  C C   . ARG D  2  74  ? 99.838  176.206 131.718 1.00 29.72  ? 74  ARG D C   1 
ATOM   8698  O O   . ARG D  2  74  ? 99.697  176.862 130.683 1.00 29.72  ? 74  ARG D O   1 
ATOM   8699  C CB  . ARG D  2  74  ? 101.205 177.593 133.267 1.00 29.72  ? 74  ARG D CB  1 
ATOM   8700  C CG  . ARG D  2  74  ? 101.240 178.575 134.422 1.00 29.72  ? 74  ARG D CG  1 
ATOM   8701  C CD  . ARG D  2  74  ? 102.564 179.308 134.465 1.00 29.72  ? 74  ARG D CD  1 
ATOM   8702  N NE  . ARG D  2  74  ? 103.668 178.383 134.687 1.00 29.72  ? 74  ARG D NE  1 
ATOM   8703  C CZ  . ARG D  2  74  ? 104.121 178.030 135.881 1.00 29.72  ? 74  ARG D CZ  1 
ATOM   8704  N NH1 . ARG D  2  74  ? 103.573 178.538 136.974 1.00 29.72  ? 74  ARG D NH1 1 
ATOM   8705  N NH2 . ARG D  2  74  ? 105.127 177.175 135.981 1.00 29.72  ? 74  ARG D NH2 1 
ATOM   8706  N N   . LEU D  2  75  ? 99.992  174.886 131.707 1.00 28.69  ? 75  LEU D N   1 
ATOM   8707  C CA  . LEU D  2  75  ? 100.106 174.132 130.468 1.00 28.69  ? 75  LEU D CA  1 
ATOM   8708  C C   . LEU D  2  75  ? 98.762  173.733 129.879 1.00 28.69  ? 75  LEU D C   1 
ATOM   8709  O O   . LEU D  2  75  ? 98.730  172.938 128.937 1.00 28.69  ? 75  LEU D O   1 
ATOM   8710  C CB  . LEU D  2  75  ? 100.952 172.880 130.690 1.00 28.69  ? 75  LEU D CB  1 
ATOM   8711  C CG  . LEU D  2  75  ? 102.402 173.129 131.090 1.00 28.69  ? 75  LEU D CG  1 
ATOM   8712  C CD1 . LEU D  2  75  ? 103.095 171.820 131.393 1.00 28.69  ? 75  LEU D CD1 1 
ATOM   8713  C CD2 . LEU D  2  75  ? 103.126 173.878 130.005 1.00 28.69  ? 75  LEU D CD2 1 
ATOM   8714  N N   . LYS D  2  76  ? 97.658  174.247 130.410 1.00 30.33  ? 76  LYS D N   1 
ATOM   8715  C CA  . LYS D  2  76  ? 96.349  173.892 129.880 1.00 30.33  ? 76  LYS D CA  1 
ATOM   8716  C C   . LYS D  2  76  ? 96.161  174.472 128.485 1.00 30.33  ? 76  LYS D C   1 
ATOM   8717  O O   . LYS D  2  76  ? 96.651  175.560 128.173 1.00 30.33  ? 76  LYS D O   1 
ATOM   8718  C CB  . LYS D  2  76  ? 95.248  174.384 130.816 1.00 30.33  ? 76  LYS D CB  1 
ATOM   8719  C CG  . LYS D  2  76  ? 95.143  175.888 130.922 1.00 30.33  ? 76  LYS D CG  1 
ATOM   8720  C CD  . LYS D  2  76  ? 94.161  176.289 132.006 1.00 30.33  ? 76  LYS D CD  1 
ATOM   8721  C CE  . LYS D  2  76  ? 92.734  175.973 131.606 1.00 30.33  ? 76  LYS D CE  1 
ATOM   8722  N NZ  . LYS D  2  76  ? 91.763  176.453 132.627 1.00 30.33  ? 76  LYS D NZ  1 
ATOM   8723  N N   . PHE D  2  77  ? 95.452  173.731 127.636 1.00 32.41  ? 77  PHE D N   1 
ATOM   8724  C CA  . PHE D  2  77  ? 95.234  174.152 126.261 1.00 32.41  ? 77  PHE D CA  1 
ATOM   8725  C C   . PHE D  2  77  ? 93.904  173.604 125.773 1.00 32.41  ? 77  PHE D C   1 
ATOM   8726  O O   . PHE D  2  77  ? 93.382  172.622 126.303 1.00 32.41  ? 77  PHE D O   1 
ATOM   8727  C CB  . PHE D  2  77  ? 96.370  173.684 125.348 1.00 32.41  ? 77  PHE D CB  1 
ATOM   8728  C CG  . PHE D  2  77  ? 96.461  172.194 125.210 1.00 32.41  ? 77  PHE D CG  1 
ATOM   8729  C CD1 . PHE D  2  77  ? 97.182  171.447 126.118 1.00 32.41  ? 77  PHE D CD1 1 
ATOM   8730  C CD2 . PHE D  2  77  ? 95.840  171.542 124.162 1.00 32.41  ? 77  PHE D CD2 1 
ATOM   8731  C CE1 . PHE D  2  77  ? 97.270  170.082 125.992 1.00 32.41  ? 77  PHE D CE1 1 
ATOM   8732  C CE2 . PHE D  2  77  ? 95.928  170.177 124.033 1.00 32.41  ? 77  PHE D CE2 1 
ATOM   8733  C CZ  . PHE D  2  77  ? 96.642  169.447 124.949 1.00 32.41  ? 77  PHE D CZ  1 
ATOM   8734  N N   . LYS D  2  78  ? 93.364  174.250 124.743 1.00 40.21  ? 78  LYS D N   1 
ATOM   8735  C CA  . LYS D  2  78  ? 92.120  173.833 124.104 1.00 40.21  ? 78  LYS D CA  1 
ATOM   8736  C C   . LYS D  2  78  ? 92.447  173.412 122.679 1.00 40.21  ? 78  LYS D C   1 
ATOM   8737  O O   . LYS D  2  78  ? 92.812  174.251 121.849 1.00 40.21  ? 78  LYS D O   1 
ATOM   8738  C CB  . LYS D  2  78  ? 91.090  174.960 124.122 1.00 40.21  ? 78  LYS D CB  1 
ATOM   8739  C CG  . LYS D  2  78  ? 89.722  174.561 123.603 1.00 40.21  ? 78  LYS D CG  1 
ATOM   8740  C CD  . LYS D  2  78  ? 88.757  175.736 123.640 1.00 40.21  ? 78  LYS D CD  1 
ATOM   8741  C CE  . LYS D  2  78  ? 88.362  176.086 125.064 1.00 40.21  ? 78  LYS D CE  1 
ATOM   8742  N NZ  . LYS D  2  78  ? 87.550  175.006 125.688 1.00 40.21  ? 78  LYS D NZ  1 
ATOM   8743  N N   . GLY D  2  79  ? 92.319  172.119 122.394 1.00 46.01  ? 79  GLY D N   1 
ATOM   8744  C CA  . GLY D  2  79  ? 92.706  171.588 121.110 1.00 46.01  ? 79  GLY D CA  1 
ATOM   8745  C C   . GLY D  2  79  ? 91.934  170.346 120.718 1.00 46.01  ? 79  GLY D C   1 
ATOM   8746  O O   . GLY D  2  79  ? 91.084  169.849 121.463 1.00 46.01  ? 79  GLY D O   1 
ATOM   8747  N N   . PRO D  2  80  ? 92.218  169.823 119.525 1.00 54.15  ? 80  PRO D N   1 
ATOM   8748  C CA  . PRO D  2  80  ? 91.471  168.662 119.023 1.00 54.15  ? 80  PRO D CA  1 
ATOM   8749  C C   . PRO D  2  80  ? 91.916  167.326 119.603 1.00 54.15  ? 80  PRO D C   1 
ATOM   8750  O O   . PRO D  2  80  ? 91.094  166.419 119.764 1.00 54.15  ? 80  PRO D O   1 
ATOM   8751  C CB  . PRO D  2  80  ? 91.731  168.717 117.513 1.00 54.15  ? 80  PRO D CB  1 
ATOM   8752  C CG  . PRO D  2  80  ? 93.046  169.391 117.391 1.00 54.15  ? 80  PRO D CG  1 
ATOM   8753  C CD  . PRO D  2  80  ? 93.109  170.396 118.503 1.00 54.15  ? 80  PRO D CD  1 
ATOM   8754  N N   . MET D  2  81  ? 93.205  167.182 119.913 1.00 56.57  ? 81  MET D N   1 
ATOM   8755  C CA  . MET D  2  81  ? 93.727  165.870 120.281 1.00 56.57  ? 81  MET D CA  1 
ATOM   8756  C C   . MET D  2  81  ? 93.445  165.528 121.742 1.00 56.57  ? 81  MET D C   1 
ATOM   8757  O O   . MET D  2  81  ? 93.138  164.374 122.059 1.00 56.57  ? 81  MET D O   1 
ATOM   8758  C CB  . MET D  2  81  ? 95.226  165.809 119.988 1.00 56.57  ? 81  MET D CB  1 
ATOM   8759  C CG  . MET D  2  81  ? 95.841  164.431 120.156 1.00 56.57  ? 81  MET D CG  1 
ATOM   8760  S SD  . MET D  2  81  ? 95.115  163.210 119.047 1.00 56.57  ? 81  MET D SD  1 
ATOM   8761  C CE  . MET D  2  81  ? 95.760  163.752 117.468 1.00 56.57  ? 81  MET D CE  1 
ATOM   8762  N N   . THR D  2  82  ? 93.579  166.508 122.639 1.00 47.60  ? 82  THR D N   1 
ATOM   8763  C CA  . THR D  2  82  ? 93.249  166.418 124.064 1.00 47.60  ? 82  THR D CA  1 
ATOM   8764  C C   . THR D  2  82  ? 94.241  165.572 124.856 1.00 47.60  ? 82  THR D C   1 
ATOM   8765  O O   . THR D  2  82  ? 94.167  165.531 126.087 1.00 47.60  ? 82  THR D O   1 
ATOM   8766  C CB  . THR D  2  82  ? 91.834  165.872 124.288 1.00 47.60  ? 82  THR D CB  1 
ATOM   8767  O OG1 . THR D  2  82  ? 91.754  164.518 123.828 1.00 47.60  ? 82  THR D OG1 1 
ATOM   8768  C CG2 . THR D  2  82  ? 90.809  166.721 123.554 1.00 47.60  ? 82  THR D CG2 1 
ATOM   8769  N N   . VAL D  2  83  ? 95.173  164.909 124.175 1.00 35.83  ? 83  VAL D N   1 
ATOM   8770  C CA  . VAL D  2  83  ? 96.290  164.215 124.812 1.00 35.83  ? 83  VAL D CA  1 
ATOM   8771  C C   . VAL D  2  83  ? 97.494  164.379 123.897 1.00 35.83  ? 83  VAL D C   1 
ATOM   8772  O O   . VAL D  2  83  ? 97.543  163.774 122.820 1.00 35.83  ? 83  VAL D O   1 
ATOM   8773  C CB  . VAL D  2  83  ? 96.017  162.726 125.064 1.00 35.83  ? 83  VAL D CB  1 
ATOM   8774  C CG1 . VAL D  2  83  ? 97.291  162.035 125.492 1.00 35.83  ? 83  VAL D CG1 1 
ATOM   8775  C CG2 . VAL D  2  83  ? 94.962  162.542 126.131 1.00 35.83  ? 83  VAL D CG2 1 
ATOM   8776  N N   . LEU D  2  84  ? 98.459  165.187 124.311 1.00 27.02  ? 84  LEU D N   1 
ATOM   8777  C CA  . LEU D  2  84  ? 99.675  165.382 123.539 1.00 27.02  ? 84  LEU D CA  1 
ATOM   8778  C C   . LEU D  2  84  ? 100.713 164.366 123.989 1.00 27.02  ? 84  LEU D C   1 
ATOM   8779  O O   . LEU D  2  84  ? 101.078 164.326 125.168 1.00 27.02  ? 84  LEU D O   1 
ATOM   8780  C CB  . LEU D  2  84  ? 100.207 166.802 123.706 1.00 27.02  ? 84  LEU D CB  1 
ATOM   8781  C CG  . LEU D  2  84  ? 99.356  167.894 123.070 1.00 27.02  ? 84  LEU D CG  1 
ATOM   8782  C CD1 . LEU D  2  84  ? 99.890  169.257 123.432 1.00 27.02  ? 84  LEU D CD1 1 
ATOM   8783  C CD2 . LEU D  2  84  ? 99.340  167.719 121.571 1.00 27.02  ? 84  LEU D CD2 1 
ATOM   8784  N N   . ARG D  2  85  ? 101.175 163.538 123.056 1.00 26.19  ? 85  ARG D N   1 
ATOM   8785  C CA  . ARG D  2  85  ? 102.243 162.583 123.326 1.00 26.19  ? 85  ARG D CA  1 
ATOM   8786  C C   . ARG D  2  85  ? 103.541 163.198 122.820 1.00 26.19  ? 85  ARG D C   1 
ATOM   8787  O O   . ARG D  2  85  ? 104.073 162.834 121.773 1.00 26.19  ? 85  ARG D O   1 
ATOM   8788  C CB  . ARG D  2  85  ? 101.947 161.245 122.668 1.00 26.19  ? 85  ARG D CB  1 
ATOM   8789  C CG  . ARG D  2  85  ? 100.752 160.535 123.257 1.00 26.19  ? 85  ARG D CG  1 
ATOM   8790  C CD  . ARG D  2  85  ? 100.508 159.217 122.565 1.00 26.19  ? 85  ARG D CD  1 
ATOM   8791  N NE  . ARG D  2  85  ? 99.373  158.508 123.141 1.00 26.19  ? 85  ARG D NE  1 
ATOM   8792  C CZ  . ARG D  2  85  ? 98.121  158.651 122.725 1.00 26.19  ? 85  ARG D CZ  1 
ATOM   8793  N NH1 . ARG D  2  85  ? 97.145  157.968 123.305 1.00 26.19  ? 85  ARG D NH1 1 
ATOM   8794  N NH2 . ARG D  2  85  ? 97.844  159.480 121.730 1.00 26.19  ? 85  ARG D NH2 1 
ATOM   8795  N N   . LEU D  2  86  ? 104.049 164.158 123.585 1.00 27.38  ? 86  LEU D N   1 
ATOM   8796  C CA  . LEU D  2  86  ? 105.214 164.908 123.155 1.00 27.38  ? 86  LEU D CA  1 
ATOM   8797  C C   . LEU D  2  86  ? 106.469 164.044 123.229 1.00 27.38  ? 86  LEU D C   1 
ATOM   8798  O O   . LEU D  2  86  ? 106.498 162.978 123.849 1.00 27.38  ? 86  LEU D O   1 
ATOM   8799  C CB  . LEU D  2  86  ? 105.378 166.170 123.994 1.00 27.38  ? 86  LEU D CB  1 
ATOM   8800  C CG  . LEU D  2  86  ? 104.263 167.178 123.740 1.00 27.38  ? 86  LEU D CG  1 
ATOM   8801  C CD1 . LEU D  2  86  ? 104.397 168.379 124.645 1.00 27.38  ? 86  LEU D CD1 1 
ATOM   8802  C CD2 . LEU D  2  86  ? 104.272 167.599 122.286 1.00 27.38  ? 86  LEU D CD2 1 
ATOM   8803  N N   . ASN D  2  87  ? 107.522 164.535 122.587 1.00 33.53  ? 87  ASN D N   1 
ATOM   8804  C CA  . ASN D  2  87  ? 108.749 163.776 122.401 1.00 33.53  ? 87  ASN D CA  1 
ATOM   8805  C C   . ASN D  2  87  ? 109.550 163.792 123.701 1.00 33.53  ? 87  ASN D C   1 
ATOM   8806  O O   . ASN D  2  87  ? 109.057 164.193 124.757 1.00 33.53  ? 87  ASN D O   1 
ATOM   8807  C CB  . ASN D  2  87  ? 109.531 164.348 121.221 1.00 33.53  ? 87  ASN D CB  1 
ATOM   8808  C CG  . ASN D  2  87  ? 110.592 163.401 120.707 1.00 33.53  ? 87  ASN D CG  1 
ATOM   8809  O OD1 . ASN D  2  87  ? 110.757 162.298 121.222 1.00 33.53  ? 87  ASN D OD1 1 
ATOM   8810  N ND2 . ASN D  2  87  ? 111.322 163.831 119.689 1.00 33.53  ? 87  ASN D ND2 1 
ATOM   8811  N N   . ASN D  2  88  ? 110.801 163.342 123.641 1.00 33.42  ? 88  ASN D N   1 
ATOM   8812  C CA  . ASN D  2  88  ? 111.650 163.300 124.821 1.00 33.42  ? 88  ASN D CA  1 
ATOM   8813  C C   . ASN D  2  88  ? 112.339 164.630 125.091 1.00 33.42  ? 88  ASN D C   1 
ATOM   8814  O O   . ASN D  2  88  ? 112.727 164.890 126.234 1.00 33.42  ? 88  ASN D O   1 
ATOM   8815  C CB  . ASN D  2  88  ? 112.707 162.208 124.657 1.00 33.42  ? 88  ASN D CB  1 
ATOM   8816  C CG  . ASN D  2  88  ? 112.108 160.874 124.250 1.00 33.42  ? 88  ASN D CG  1 
ATOM   8817  O OD1 . ASN D  2  88  ? 112.416 160.345 123.184 1.00 33.42  ? 88  ASN D OD1 1 
ATOM   8818  N ND2 . ASN D  2  88  ? 111.228 160.341 125.079 1.00 33.42  ? 88  ASN D ND2 1 
ATOM   8819  N N   . LEU D  2  89  ? 112.504 165.466 124.062 1.00 40.44  ? 89  LEU D N   1 
ATOM   8820  C CA  . LEU D  2  89  ? 113.215 166.732 124.215 1.00 40.44  ? 89  LEU D CA  1 
ATOM   8821  C C   . LEU D  2  89  ? 112.373 167.768 124.940 1.00 40.44  ? 89  LEU D C   1 
ATOM   8822  O O   . LEU D  2  89  ? 112.917 168.683 125.566 1.00 40.44  ? 89  LEU D O   1 
ATOM   8823  C CB  . LEU D  2  89  ? 113.624 167.268 122.846 1.00 40.44  ? 89  LEU D CB  1 
ATOM   8824  C CG  . LEU D  2  89  ? 114.602 166.407 122.050 1.00 40.44  ? 89  LEU D CG  1 
ATOM   8825  C CD1 . LEU D  2  89  ? 114.802 166.982 120.660 1.00 40.44  ? 89  LEU D CD1 1 
ATOM   8826  C CD2 . LEU D  2  89  ? 115.929 166.283 122.780 1.00 40.44  ? 89  LEU D CD2 1 
ATOM   8827  N N   . MET D  2  90  ? 111.051 167.647 124.852 1.00 34.77  ? 90  MET D N   1 
ATOM   8828  C CA  . MET D  2  90  ? 110.152 168.582 125.510 1.00 34.77  ? 90  MET D CA  1 
ATOM   8829  C C   . MET D  2  90  ? 110.280 168.541 127.025 1.00 34.77  ? 90  MET D C   1 
ATOM   8830  O O   . MET D  2  90  ? 109.984 169.540 127.687 1.00 34.77  ? 90  MET D O   1 
ATOM   8831  C CB  . MET D  2  90  ? 108.719 168.267 125.092 1.00 34.77  ? 90  MET D CB  1 
ATOM   8832  C CG  . MET D  2  90  ? 107.672 169.197 125.632 1.00 34.77  ? 90  MET D CG  1 
ATOM   8833  S SD  . MET D  2  90  ? 107.823 170.875 125.021 1.00 34.77  ? 90  MET D SD  1 
ATOM   8834  C CE  . MET D  2  90  ? 106.890 171.732 126.279 1.00 34.77  ? 90  MET D CE  1 
ATOM   8835  N N   . ALA D  2  91  ? 110.734 167.421 127.586 1.00 31.28  ? 91  ALA D N   1 
ATOM   8836  C CA  . ALA D  2  91  ? 110.731 167.251 129.034 1.00 31.28  ? 91  ALA D CA  1 
ATOM   8837  C C   . ALA D  2  91  ? 111.676 168.203 129.751 1.00 31.28  ? 91  ALA D C   1 
ATOM   8838  O O   . ALA D  2  91  ? 111.510 168.422 130.952 1.00 31.28  ? 91  ALA D O   1 
ATOM   8839  C CB  . ALA D  2  91  ? 111.087 165.811 129.395 1.00 31.28  ? 91  ALA D CB  1 
ATOM   8840  N N   . SER D  2  92  ? 112.663 168.767 129.058 1.00 29.63  ? 92  SER D N   1 
ATOM   8841  C CA  . SER D  2  92  ? 113.643 169.605 129.737 1.00 29.63  ? 92  SER D CA  1 
ATOM   8842  C C   . SER D  2  92  ? 113.157 171.033 129.936 1.00 29.63  ? 92  SER D C   1 
ATOM   8843  O O   . SER D  2  92  ? 113.611 171.708 130.865 1.00 29.63  ? 92  SER D O   1 
ATOM   8844  C CB  . SER D  2  92  ? 114.958 169.613 128.962 1.00 29.63  ? 92  SER D CB  1 
ATOM   8845  O OG  . SER D  2  92  ? 114.805 170.264 127.715 1.00 29.63  ? 92  SER D OG  1 
ATOM   8846  N N   . LYS D  2  93  ? 112.249 171.514 129.087 1.00 30.13  ? 93  LYS D N   1 
ATOM   8847  C CA  . LYS D  2  93  ? 111.867 172.921 129.134 1.00 30.13  ? 93  LYS D CA  1 
ATOM   8848  C C   . LYS D  2  93  ? 110.841 173.218 130.219 1.00 30.13  ? 93  LYS D C   1 
ATOM   8849  O O   . LYS D  2  93  ? 110.841 174.320 130.771 1.00 30.13  ? 93  LYS D O   1 
ATOM   8850  C CB  . LYS D  2  93  ? 111.336 173.363 127.773 1.00 30.13  ? 93  LYS D CB  1 
ATOM   8851  C CG  . LYS D  2  93  ? 112.397 173.366 126.691 1.00 30.13  ? 93  LYS D CG  1 
ATOM   8852  C CD  . LYS D  2  93  ? 111.843 173.831 125.363 1.00 30.13  ? 93  LYS D CD  1 
ATOM   8853  C CE  . LYS D  2  93  ? 112.913 173.799 124.289 1.00 30.13  ? 93  LYS D CE  1 
ATOM   8854  N NZ  . LYS D  2  93  ? 112.388 174.245 122.971 1.00 30.13  ? 93  LYS D NZ  1 
ATOM   8855  N N   . ILE D  2  94  ? 109.955 172.273 130.524 1.00 22.86  ? 94  ILE D N   1 
ATOM   8856  C CA  . ILE D  2  94  ? 108.955 172.451 131.571 1.00 22.86  ? 94  ILE D CA  1 
ATOM   8857  C C   . ILE D  2  94  ? 109.566 172.132 132.926 1.00 22.86  ? 94  ILE D C   1 
ATOM   8858  O O   . ILE D  2  94  ? 110.683 171.612 133.004 1.00 22.86  ? 94  ILE D O   1 
ATOM   8859  C CB  . ILE D  2  94  ? 107.727 171.569 131.319 1.00 22.86  ? 94  ILE D CB  1 
ATOM   8860  C CG1 . ILE D  2  94  ? 108.145 170.107 131.330 1.00 22.86  ? 94  ILE D CG1 1 
ATOM   8861  C CG2 . ILE D  2  94  ? 107.082 171.927 130.001 1.00 22.86  ? 94  ILE D CG2 1 
ATOM   8862  C CD1 . ILE D  2  94  ? 106.999 169.163 131.319 1.00 22.86  ? 94  ILE D CD1 1 
ATOM   8863  N N   . TRP D  2  95  ? 108.850 172.443 134.002 1.00 28.42  ? 95  TRP D N   1 
ATOM   8864  C CA  . TRP D  2  95  ? 109.320 172.068 135.326 1.00 28.42  ? 95  TRP D CA  1 
ATOM   8865  C C   . TRP D  2  95  ? 109.298 170.555 135.475 1.00 28.42  ? 95  TRP D C   1 
ATOM   8866  O O   . TRP D  2  95  ? 108.377 169.882 135.010 1.00 28.42  ? 95  TRP D O   1 
ATOM   8867  C CB  . TRP D  2  95  ? 108.459 172.699 136.413 1.00 28.42  ? 95  TRP D CB  1 
ATOM   8868  C CG  . TRP D  2  95  ? 108.994 172.450 137.783 1.00 28.42  ? 95  TRP D CG  1 
ATOM   8869  C CD1 . TRP D  2  95  ? 110.164 172.913 138.289 1.00 28.42  ? 95  TRP D CD1 1 
ATOM   8870  C CD2 . TRP D  2  95  ? 108.385 171.678 138.823 1.00 28.42  ? 95  TRP D CD2 1 
ATOM   8871  N NE1 . TRP D  2  95  ? 110.327 172.482 139.579 1.00 28.42  ? 95  TRP D NE1 1 
ATOM   8872  C CE2 . TRP D  2  95  ? 109.245 171.721 139.930 1.00 28.42  ? 95  TRP D CE2 1 
ATOM   8873  C CE3 . TRP D  2  95  ? 107.197 170.955 138.924 1.00 28.42  ? 95  TRP D CE3 1 
ATOM   8874  C CZ2 . TRP D  2  95  ? 108.959 171.071 141.122 1.00 28.42  ? 95  TRP D CZ2 1 
ATOM   8875  C CZ3 . TRP D  2  95  ? 106.914 170.310 140.111 1.00 28.42  ? 95  TRP D CZ3 1 
ATOM   8876  C CH2 . TRP D  2  95  ? 107.792 170.370 141.192 1.00 28.42  ? 95  TRP D CH2 1 
ATOM   8877  N N   . THR D  2  96  ? 110.329 170.019 136.109 1.00 21.00  ? 96  THR D N   1 
ATOM   8878  C CA  . THR D  2  96  ? 110.393 168.598 136.421 1.00 21.00  ? 96  THR D CA  1 
ATOM   8879  C C   . THR D  2  96  ? 110.904 168.415 137.843 1.00 21.00  ? 96  THR D C   1 
ATOM   8880  O O   . THR D  2  96  ? 112.033 168.814 138.149 1.00 21.00  ? 96  THR D O   1 
ATOM   8881  C CB  . THR D  2  96  ? 111.298 167.858 135.439 1.00 21.00  ? 96  THR D CB  1 
ATOM   8882  O OG1 . THR D  2  96  ? 112.601 168.450 135.452 1.00 21.00  ? 96  THR D OG1 1 
ATOM   8883  C CG2 . THR D  2  96  ? 110.730 167.909 134.040 1.00 21.00  ? 96  THR D CG2 1 
ATOM   8884  N N   . PRO D  2  97  ? 110.116 167.817 138.732 1.00 19.51  ? 97  PRO D N   1 
ATOM   8885  C CA  . PRO D  2  97  ? 110.515 167.759 140.138 1.00 19.51  ? 97  PRO D CA  1 
ATOM   8886  C C   . PRO D  2  97  ? 111.759 166.911 140.320 1.00 19.51  ? 97  PRO D C   1 
ATOM   8887  O O   . PRO D  2  97  ? 111.906 165.853 139.707 1.00 19.51  ? 97  PRO D O   1 
ATOM   8888  C CB  . PRO D  2  97  ? 109.301 167.122 140.819 1.00 19.51  ? 97  PRO D CB  1 
ATOM   8889  C CG  . PRO D  2  97  ? 108.693 166.296 139.764 1.00 19.51  ? 97  PRO D CG  1 
ATOM   8890  C CD  . PRO D  2  97  ? 108.895 167.040 138.479 1.00 19.51  ? 97  PRO D CD  1 
ATOM   8891  N N   . ASP D  2  98  ? 112.658 167.389 141.173 1.00 20.99  ? 98  ASP D N   1 
ATOM   8892  C CA  . ASP D  2  98  ? 113.898 166.684 141.463 1.00 20.99  ? 98  ASP D CA  1 
ATOM   8893  C C   . ASP D  2  98  ? 113.651 165.657 142.560 1.00 20.99  ? 98  ASP D C   1 
ATOM   8894  O O   . ASP D  2  98  ? 113.238 166.007 143.669 1.00 20.99  ? 98  ASP D O   1 
ATOM   8895  C CB  . ASP D  2  98  ? 115.002 167.665 141.853 1.00 20.99  ? 98  ASP D CB  1 
ATOM   8896  C CG  . ASP D  2  98  ? 114.577 168.618 142.941 1.00 20.99  ? 98  ASP D CG  1 
ATOM   8897  O OD1 . ASP D  2  98  ? 113.393 168.597 143.328 1.00 20.99  ? 98  ASP D OD1 1 
ATOM   8898  O OD2 . ASP D  2  98  ? 115.433 169.401 143.405 1.00 20.99  ? 98  ASP D OD2 1 
ATOM   8899  N N   . THR D  2  99  ? 113.894 164.391 142.242 1.00 31.05  ? 99  THR D N   1 
ATOM   8900  C CA  . THR D  2  99  ? 113.580 163.272 143.125 1.00 31.05  ? 99  THR D CA  1 
ATOM   8901  C C   . THR D  2  99  ? 114.807 162.374 143.194 1.00 31.05  ? 99  THR D C   1 
ATOM   8902  O O   . THR D  2  99  ? 115.061 161.608 142.262 1.00 31.05  ? 99  THR D O   1 
ATOM   8903  C CB  . THR D  2  99  ? 112.376 162.503 142.605 1.00 31.05  ? 99  THR D CB  1 
ATOM   8904  O OG1 . THR D  2  99  ? 111.239 163.371 142.543 1.00 31.05  ? 99  THR D OG1 1 
ATOM   8905  C CG2 . THR D  2  99  ? 112.070 161.345 143.514 1.00 31.05  ? 99  THR D CG2 1 
ATOM   8906  N N   . PHE D  2  100 ? 115.591 162.521 144.263 1.00 43.48  ? 100 PHE D N   1 
ATOM   8907  C CA  . PHE D  2  100 ? 116.823 161.706 144.421 1.00 43.48  ? 100 PHE D CA  1 
ATOM   8908  C C   . PHE D  2  100 ? 116.538 160.521 145.342 1.00 43.48  ? 100 PHE D C   1 
ATOM   8909  O O   . PHE D  2  100 ? 115.435 160.453 145.890 1.00 43.48  ? 100 PHE D O   1 
ATOM   8910  C CB  . PHE D  2  100 ? 117.972 162.559 144.953 1.00 43.48  ? 100 PHE D CB  1 
ATOM   8911  C CG  . PHE D  2  100 ? 117.937 162.804 146.437 1.00 43.48  ? 100 PHE D CG  1 
ATOM   8912  C CD1 . PHE D  2  100 ? 116.879 163.472 147.019 1.00 43.48  ? 100 PHE D CD1 1 
ATOM   8913  C CD2 . PHE D  2  100 ? 118.977 162.392 147.247 1.00 43.48  ? 100 PHE D CD2 1 
ATOM   8914  C CE1 . PHE D  2  100 ? 116.852 163.699 148.384 1.00 43.48  ? 100 PHE D CE1 1 
ATOM   8915  C CE2 . PHE D  2  100 ? 118.953 162.625 148.610 1.00 43.48  ? 100 PHE D CE2 1 
ATOM   8916  C CZ  . PHE D  2  100 ? 117.890 163.280 149.176 1.00 43.48  ? 100 PHE D CZ  1 
ATOM   8917  N N   . PHE D  2  101 ? 117.499 159.603 145.459 1.00 43.48  ? 101 PHE D N   1 
ATOM   8918  C CA  . PHE D  2  101 ? 117.397 158.401 146.274 1.00 43.48  ? 101 PHE D CA  1 
ATOM   8919  C C   . PHE D  2  101 ? 118.340 158.528 147.460 1.00 43.48  ? 101 PHE D C   1 
ATOM   8920  O O   . PHE D  2  101 ? 119.561 158.546 147.280 1.00 43.48  ? 101 PHE D O   1 
ATOM   8921  C CB  . PHE D  2  101 ? 117.725 157.167 145.441 1.00 43.48  ? 101 PHE D CB  1 
ATOM   8922  C CG  . PHE D  2  101 ? 116.719 156.886 144.374 1.00 43.48  ? 101 PHE D CG  1 
ATOM   8923  C CD1 . PHE D  2  101 ? 115.467 157.438 144.434 1.00 43.48  ? 101 PHE D CD1 1 
ATOM   8924  C CD2 . PHE D  2  101 ? 117.030 156.096 143.300 1.00 43.48  ? 101 PHE D CD2 1 
ATOM   8925  C CE1 . PHE D  2  101 ? 114.536 157.191 143.455 1.00 43.48  ? 101 PHE D CE1 1 
ATOM   8926  C CE2 . PHE D  2  101 ? 116.102 155.858 142.322 1.00 43.48  ? 101 PHE D CE2 1 
ATOM   8927  C CZ  . PHE D  2  101 ? 114.855 156.400 142.403 1.00 43.48  ? 101 PHE D CZ  1 
ATOM   8928  N N   . HIS D  2  102 ? 117.764 158.641 148.661 1.00 43.48  ? 102 HIS D N   1 
ATOM   8929  C CA  . HIS D  2  102 ? 118.507 158.880 149.931 1.00 43.48  ? 102 HIS D CA  1 
ATOM   8930  C C   . HIS D  2  102 ? 119.623 157.864 150.188 1.00 43.48  ? 102 HIS D C   1 
ATOM   8931  O O   . HIS D  2  102 ? 120.554 158.219 150.918 1.00 43.48  ? 102 HIS D O   1 
ATOM   8932  C CB  . HIS D  2  102 ? 117.546 158.887 151.122 1.00 43.48  ? 102 HIS D CB  1 
ATOM   8933  C CG  . HIS D  2  102 ? 116.797 160.160 151.305 1.00 43.48  ? 102 HIS D CG  1 
ATOM   8934  N ND1 . HIS D  2  102 ? 115.745 160.516 150.499 1.00 43.48  ? 102 HIS D ND1 1 
ATOM   8935  C CD2 . HIS D  2  102 ? 116.921 161.145 152.215 1.00 43.48  ? 102 HIS D CD2 1 
ATOM   8936  C CE1 . HIS D  2  102 ? 115.265 161.677 150.888 1.00 43.48  ? 102 HIS D CE1 1 
ATOM   8937  N NE2 . HIS D  2  102 ? 115.966 162.082 151.941 1.00 43.48  ? 102 HIS D NE2 1 
ATOM   8938  N N   . ASN D  2  103 ? 119.517 156.650 149.651 1.00 30.27  ? 103 ASN D N   1 
ATOM   8939  C CA  . ASN D  2  103 ? 120.510 155.612 149.896 1.00 30.27  ? 103 ASN D CA  1 
ATOM   8940  C C   . ASN D  2  103 ? 120.818 154.839 148.622 1.00 30.27  ? 103 ASN D C   1 
ATOM   8941  O O   . ASN D  2  103 ? 120.801 153.608 148.592 1.00 30.27  ? 103 ASN D O   1 
ATOM   8942  C CB  . ASN D  2  103 ? 120.055 154.683 151.016 1.00 30.27  ? 103 ASN D CB  1 
ATOM   8943  C CG  . ASN D  2  103 ? 118.763 153.975 150.701 1.00 30.27  ? 103 ASN D CG  1 
ATOM   8944  O OD1 . ASN D  2  103 ? 118.226 154.087 149.604 1.00 30.27  ? 103 ASN D OD1 1 
ATOM   8945  N ND2 . ASN D  2  103 ? 118.258 153.227 151.668 1.00 30.27  ? 103 ASN D ND2 1 
ATOM   8946  N N   . GLY D  2  104 ? 121.099 155.557 147.542 1.00 21.63  ? 104 GLY D N   1 
ATOM   8947  C CA  . GLY D  2  104 ? 121.527 154.917 146.314 1.00 21.63  ? 104 GLY D CA  1 
ATOM   8948  C C   . GLY D  2  104 ? 122.940 155.304 145.942 1.00 21.63  ? 104 GLY D C   1 
ATOM   8949  O O   . GLY D  2  104 ? 123.215 156.481 145.708 1.00 21.63  ? 104 GLY D O   1 
ATOM   8950  N N   . LYS D  2  105 ? 123.850 154.333 145.875 1.00 23.17  ? 105 LYS D N   1 
ATOM   8951  C CA  . LYS D  2  105 ? 125.256 154.671 145.688 1.00 23.17  ? 105 LYS D CA  1 
ATOM   8952  C C   . LYS D  2  105 ? 125.526 155.178 144.278 1.00 23.17  ? 105 LYS D C   1 
ATOM   8953  O O   . LYS D  2  105 ? 125.915 156.333 144.090 1.00 23.17  ? 105 LYS D O   1 
ATOM   8954  C CB  . LYS D  2  105 ? 126.136 153.467 146.018 1.00 23.17  ? 105 LYS D CB  1 
ATOM   8955  C CG  . LYS D  2  105 ? 126.169 153.145 147.501 1.00 23.17  ? 105 LYS D CG  1 
ATOM   8956  C CD  . LYS D  2  105 ? 127.211 152.097 147.820 1.00 23.17  ? 105 LYS D CD  1 
ATOM   8957  C CE  . LYS D  2  105 ? 126.753 150.728 147.385 1.00 23.17  ? 105 LYS D CE  1 
ATOM   8958  N NZ  . LYS D  2  105 ? 127.727 149.684 147.786 1.00 23.17  ? 105 LYS D NZ  1 
ATOM   8959  N N   . LYS D  2  106 ? 125.314 154.343 143.265 1.00 21.20  ? 106 LYS D N   1 
ATOM   8960  C CA  . LYS D  2  106 ? 125.663 154.708 141.890 1.00 21.20  ? 106 LYS D CA  1 
ATOM   8961  C C   . LYS D  2  106 ? 124.531 154.305 140.954 1.00 21.20  ? 106 LYS D C   1 
ATOM   8962  O O   . LYS D  2  106 ? 124.522 153.197 140.415 1.00 21.20  ? 106 LYS D O   1 
ATOM   8963  C CB  . LYS D  2  106 ? 126.980 154.064 141.484 1.00 21.20  ? 106 LYS D CB  1 
ATOM   8964  C CG  . LYS D  2  106 ? 127.432 154.408 140.080 1.00 21.20  ? 106 LYS D CG  1 
ATOM   8965  C CD  . LYS D  2  106 ? 128.799 153.820 139.788 1.00 21.20  ? 106 LYS D CD  1 
ATOM   8966  C CE  . LYS D  2  106 ? 129.172 153.985 138.325 1.00 21.20  ? 106 LYS D CE  1 
ATOM   8967  N NZ  . LYS D  2  106 ? 129.348 155.411 137.947 1.00 21.20  ? 106 LYS D NZ  1 
ATOM   8968  N N   . SER D  2  107 ? 123.583 155.210 140.748 1.00 23.25  ? 107 SER D N   1 
ATOM   8969  C CA  . SER D  2  107 ? 122.507 154.936 139.815 1.00 23.25  ? 107 SER D CA  1 
ATOM   8970  C C   . SER D  2  107 ? 122.943 155.262 138.391 1.00 23.25  ? 107 SER D C   1 
ATOM   8971  O O   . SER D  2  107 ? 124.044 155.757 138.146 1.00 23.25  ? 107 SER D O   1 
ATOM   8972  C CB  . SER D  2  107 ? 121.260 155.732 140.178 1.00 23.25  ? 107 SER D CB  1 
ATOM   8973  O OG  . SER D  2  107 ? 120.744 155.318 141.427 1.00 23.25  ? 107 SER D OG  1 
ATOM   8974  N N   . VAL D  2  108 ? 122.060 154.967 137.442 1.00 20.97  ? 108 VAL D N   1 
ATOM   8975  C CA  . VAL D  2  108 ? 122.315 155.256 136.037 1.00 20.97  ? 108 VAL D CA  1 
ATOM   8976  C C   . VAL D  2  108 ? 120.998 155.305 135.279 1.00 20.97  ? 108 VAL D C   1 
ATOM   8977  O O   . VAL D  2  108 ? 120.144 154.428 135.437 1.00 20.97  ? 108 VAL D O   1 
ATOM   8978  C CB  . VAL D  2  108 ? 123.279 154.224 135.426 1.00 20.97  ? 108 VAL D CB  1 
ATOM   8979  C CG1 . VAL D  2  108 ? 122.729 152.826 135.563 1.00 20.97  ? 108 VAL D CG1 1 
ATOM   8980  C CG2 . VAL D  2  108 ? 123.522 154.542 133.968 1.00 20.97  ? 108 VAL D CG2 1 
ATOM   8981  N N   . ALA D  2  109 ? 120.814 156.341 134.469 1.00 18.24  ? 109 ALA D N   1 
ATOM   8982  C CA  . ALA D  2  109 ? 119.641 156.474 133.618 1.00 18.24  ? 109 ALA D CA  1 
ATOM   8983  C C   . ALA D  2  109 ? 120.045 156.177 132.185 1.00 18.24  ? 109 ALA D C   1 
ATOM   8984  O O   . ALA D  2  109 ? 120.977 156.794 131.662 1.00 18.24  ? 109 ALA D O   1 
ATOM   8985  C CB  . ALA D  2  109 ? 119.036 157.874 133.721 1.00 18.24  ? 109 ALA D CB  1 
ATOM   8986  N N   . HIS D  2  110 ? 119.355 155.232 131.559 1.00 34.83  ? 110 HIS D N   1 
ATOM   8987  C CA  . HIS D  2  110 ? 119.791 154.744 130.262 1.00 34.83  ? 110 HIS D CA  1 
ATOM   8988  C C   . HIS D  2  110 ? 119.648 155.815 129.193 1.00 34.83  ? 110 HIS D C   1 
ATOM   8989  O O   . HIS D  2  110 ? 118.801 156.706 129.277 1.00 34.83  ? 110 HIS D O   1 
ATOM   8990  C CB  . HIS D  2  110 ? 119.001 153.505 129.861 1.00 34.83  ? 110 HIS D CB  1 
ATOM   8991  C CG  . HIS D  2  110 ? 119.243 152.334 130.753 1.00 34.83  ? 110 HIS D CG  1 
ATOM   8992  N ND1 . HIS D  2  110 ? 120.427 151.633 130.748 1.00 34.83  ? 110 HIS D ND1 1 
ATOM   8993  C CD2 . HIS D  2  110 ? 118.460 151.744 131.684 1.00 34.83  ? 110 HIS D CD2 1 
ATOM   8994  C CE1 . HIS D  2  110 ? 120.363 150.660 131.637 1.00 34.83  ? 110 HIS D CE1 1 
ATOM   8995  N NE2 . HIS D  2  110 ? 119.179 150.705 132.219 1.00 34.83  ? 110 HIS D NE2 1 
ATOM   8996  N N   . ASN D  2  111 ? 120.502 155.718 128.182 1.00 30.43  ? 111 ASN D N   1 
ATOM   8997  C CA  . ASN D  2  111 ? 120.488 156.621 127.043 1.00 30.43  ? 111 ASN D CA  1 
ATOM   8998  C C   . ASN D  2  111 ? 120.684 155.813 125.771 1.00 30.43  ? 111 ASN D C   1 
ATOM   8999  O O   . ASN D  2  111 ? 121.484 156.161 124.902 1.00 30.43  ? 111 ASN D O   1 
ATOM   9000  C CB  . ASN D  2  111 ? 121.570 157.684 127.171 1.00 30.43  ? 111 ASN D CB  1 
ATOM   9001  C CG  . ASN D  2  111 ? 121.325 158.865 126.268 1.00 30.43  ? 111 ASN D CG  1 
ATOM   9002  O OD1 . ASN D  2  111 ? 120.310 158.927 125.577 1.00 30.43  ? 111 ASN D OD1 1 
ATOM   9003  N ND2 . ASN D  2  111 ? 122.258 159.811 126.263 1.00 30.43  ? 111 ASN D ND2 1 
ATOM   9004  N N   . MET D  2  112 ? 119.953 154.706 125.658 1.00 29.52  ? 112 MET D N   1 
ATOM   9005  C CA  . MET D  2  112 ? 120.273 153.686 124.667 1.00 29.52  ? 112 MET D CA  1 
ATOM   9006  C C   . MET D  2  112 ? 120.237 154.173 123.226 1.00 29.52  ? 112 MET D C   1 
ATOM   9007  O O   . MET D  2  112 ? 121.272 154.191 122.556 1.00 29.52  ? 112 MET D O   1 
ATOM   9008  C CB  . MET D  2  112 ? 119.338 152.492 124.805 1.00 29.52  ? 112 MET D CB  1 
ATOM   9009  C CG  . MET D  2  112 ? 119.630 151.473 123.740 1.00 29.52  ? 112 MET D CG  1 
ATOM   9010  S SD  . MET D  2  112 ? 121.359 151.019 123.822 1.00 29.52  ? 112 MET D SD  1 
ATOM   9011  C CE  . MET D  2  112 ? 121.676 150.597 122.116 1.00 29.52  ? 112 MET D CE  1 
ATOM   9012  N N   . THR D  2  113 ? 119.064 154.554 122.731 1.00 23.20  ? 113 THR D N   1 
ATOM   9013  C CA  . THR D  2  113 ? 118.955 155.089 121.384 1.00 23.20  ? 113 THR D CA  1 
ATOM   9014  C C   . THR D  2  113 ? 118.341 156.474 121.340 1.00 23.20  ? 113 THR D C   1 
ATOM   9015  O O   . THR D  2  113 ? 118.460 157.151 120.314 1.00 23.20  ? 113 THR D O   1 
ATOM   9016  C CB  . THR D  2  113 ? 118.135 154.149 120.492 1.00 23.20  ? 113 THR D CB  1 
ATOM   9017  O OG1 . THR D  2  113 ? 116.838 153.966 121.064 1.00 23.20  ? 113 THR D OG1 1 
ATOM   9018  C CG2 . THR D  2  113 ? 118.820 152.811 120.368 1.00 23.20  ? 113 THR D CG2 1 
ATOM   9019  N N   . MET D  2  114 ? 117.687 156.900 122.405 1.00 29.99  ? 114 MET D N   1 
ATOM   9020  C CA  . MET D  2  114 ? 117.151 158.239 122.575 1.00 29.99  ? 114 MET D CA  1 
ATOM   9021  C C   . MET D  2  114 ? 116.700 158.308 124.028 1.00 29.99  ? 114 MET D C   1 
ATOM   9022  O O   . MET D  2  114 ? 116.153 157.320 124.532 1.00 29.99  ? 114 MET D O   1 
ATOM   9023  C CB  . MET D  2  114 ? 116.013 158.491 121.585 1.00 29.99  ? 114 MET D CB  1 
ATOM   9024  C CG  . MET D  2  114 ? 115.534 159.922 121.498 1.00 29.99  ? 114 MET D CG  1 
ATOM   9025  S SD  . MET D  2  114 ? 114.321 160.148 120.187 1.00 29.99  ? 114 MET D SD  1 
ATOM   9026  C CE  . MET D  2  114 ? 113.901 161.871 120.411 1.00 29.99  ? 114 MET D CE  1 
ATOM   9027  N N   . PRO D  2  115 ? 116.933 159.412 124.735 1.00 26.22  ? 115 PRO D N   1 
ATOM   9028  C CA  . PRO D  2  115 ? 116.654 159.447 126.176 1.00 26.22  ? 115 PRO D CA  1 
ATOM   9029  C C   . PRO D  2  115 ? 115.285 158.879 126.512 1.00 26.22  ? 115 PRO D C   1 
ATOM   9030  O O   . PRO D  2  115 ? 114.275 159.241 125.908 1.00 26.22  ? 115 PRO D O   1 
ATOM   9031  C CB  . PRO D  2  115 ? 116.747 160.936 126.510 1.00 26.22  ? 115 PRO D CB  1 
ATOM   9032  C CG  . PRO D  2  115 ? 117.691 161.465 125.515 1.00 26.22  ? 115 PRO D CG  1 
ATOM   9033  C CD  . PRO D  2  115 ? 117.431 160.708 124.252 1.00 26.22  ? 115 PRO D CD  1 
ATOM   9034  N N   . ASN D  2  116 ? 115.265 157.955 127.471 1.00 30.31  ? 116 ASN D N   1 
ATOM   9035  C CA  . ASN D  2  116 ? 114.071 157.173 127.781 1.00 30.31  ? 116 ASN D CA  1 
ATOM   9036  C C   . ASN D  2  116 ? 113.180 157.965 128.730 1.00 30.31  ? 116 ASN D C   1 
ATOM   9037  O O   . ASN D  2  116 ? 113.221 157.809 129.951 1.00 30.31  ? 116 ASN D O   1 
ATOM   9038  C CB  . ASN D  2  116 ? 114.468 155.837 128.380 1.00 30.31  ? 116 ASN D CB  1 
ATOM   9039  C CG  . ASN D  2  116 ? 115.356 155.044 127.467 1.00 30.31  ? 116 ASN D CG  1 
ATOM   9040  O OD1 . ASN D  2  116 ? 116.501 154.751 127.795 1.00 30.31  ? 116 ASN D OD1 1 
ATOM   9041  N ND2 . ASN D  2  116 ? 114.842 154.709 126.297 1.00 30.31  ? 116 ASN D ND2 1 
ATOM   9042  N N   . LYS D  2  117 ? 112.347 158.826 128.153 1.00 43.48  ? 117 LYS D N   1 
ATOM   9043  C CA  . LYS D  2  117 ? 111.454 159.679 128.931 1.00 43.48  ? 117 LYS D CA  1 
ATOM   9044  C C   . LYS D  2  117 ? 110.248 160.016 128.072 1.00 43.48  ? 117 LYS D C   1 
ATOM   9045  O O   . LYS D  2  117 ? 110.407 160.642 127.023 1.00 43.48  ? 117 LYS D O   1 
ATOM   9046  C CB  . LYS D  2  117 ? 112.157 160.970 129.358 1.00 43.48  ? 117 LYS D CB  1 
ATOM   9047  C CG  . LYS D  2  117 ? 113.300 160.823 130.339 1.00 43.48  ? 117 LYS D CG  1 
ATOM   9048  C CD  . LYS D  2  117 ? 113.911 162.171 130.641 1.00 43.48  ? 117 LYS D CD  1 
ATOM   9049  C CE  . LYS D  2  117 ? 115.082 162.037 131.586 1.00 43.48  ? 117 LYS D CE  1 
ATOM   9050  N NZ  . LYS D  2  117 ? 115.693 163.359 131.877 1.00 43.48  ? 117 LYS D NZ  1 
ATOM   9051  N N   . LEU D  2  118 ? 109.055 159.683 128.546 1.00 18.55  ? 118 LEU D N   1 
ATOM   9052  C CA  . LEU D  2  118 ? 107.835 160.012 127.829 1.00 18.55  ? 118 LEU D CA  1 
ATOM   9053  C C   . LEU D  2  118 ? 107.147 161.122 128.609 1.00 18.55  ? 118 LEU D C   1 
ATOM   9054  O O   . LEU D  2  118 ? 107.126 161.086 129.823 1.00 18.55  ? 118 LEU D O   1 
ATOM   9055  C CB  . LEU D  2  118 ? 106.937 158.792 127.730 1.00 18.55  ? 118 LEU D CB  1 
ATOM   9056  C CG  . LEU D  2  118 ? 105.982 158.582 128.893 1.00 18.55  ? 118 LEU D CG  1 
ATOM   9057  C CD1 . LEU D  2  118 ? 104.795 159.509 128.717 1.00 18.55  ? 118 LEU D CD1 1 
ATOM   9058  C CD2 . LEU D  2  118 ? 105.514 157.139 128.929 1.00 18.55  ? 118 LEU D CD2 1 
ATOM   9059  N N   . LEU D  2  119 ? 106.584 162.102 127.916 1.00 19.75  ? 119 LEU D N   1 
ATOM   9060  C CA  . LEU D  2  119 ? 105.929 163.245 128.544 1.00 19.75  ? 119 LEU D CA  1 
ATOM   9061  C C   . LEU D  2  119 ? 104.548 163.414 127.931 1.00 19.75  ? 119 LEU D C   1 
ATOM   9062  O O   . LEU D  2  119 ? 104.429 163.807 126.768 1.00 19.75  ? 119 LEU D O   1 
ATOM   9063  C CB  . LEU D  2  119 ? 106.760 164.510 128.365 1.00 19.75  ? 119 LEU D CB  1 
ATOM   9064  C CG  . LEU D  2  119 ? 106.165 165.790 128.934 1.00 19.75  ? 119 LEU D CG  1 
ATOM   9065  C CD1 . LEU D  2  119 ? 106.030 165.692 130.429 1.00 19.75  ? 119 LEU D CD1 1 
ATOM   9066  C CD2 . LEU D  2  119 ? 107.043 166.954 128.554 1.00 19.75  ? 119 LEU D CD2 1 
ATOM   9067  N N   . ARG D  2  120 ? 103.509 163.120 128.703 1.00 26.66  ? 120 ARG D N   1 
ATOM   9068  C CA  . ARG D  2  120 ? 102.131 163.218 128.246 1.00 26.66  ? 120 ARG D CA  1 
ATOM   9069  C C   . ARG D  2  120 ? 101.467 164.408 128.916 1.00 26.66  ? 120 ARG D C   1 
ATOM   9070  O O   . ARG D  2  120 ? 101.565 164.566 130.135 1.00 26.66  ? 120 ARG D O   1 
ATOM   9071  C CB  . ARG D  2  120 ? 101.353 161.949 128.576 1.00 26.66  ? 120 ARG D CB  1 
ATOM   9072  C CG  . ARG D  2  120 ? 101.910 160.706 127.952 1.00 26.66  ? 120 ARG D CG  1 
ATOM   9073  C CD  . ARG D  2  120 ? 101.061 159.507 128.297 1.00 26.66  ? 120 ARG D CD  1 
ATOM   9074  N NE  . ARG D  2  120 ? 101.715 158.269 127.899 1.00 26.66  ? 120 ARG D NE  1 
ATOM   9075  C CZ  . ARG D  2  120 ? 101.635 157.740 126.687 1.00 26.66  ? 120 ARG D CZ  1 
ATOM   9076  N NH1 . ARG D  2  120 ? 100.933 158.347 125.746 1.00 26.66  ? 120 ARG D NH1 1 
ATOM   9077  N NH2 . ARG D  2  120 ? 102.266 156.609 126.416 1.00 26.66  ? 120 ARG D NH2 1 
ATOM   9078  N N   . ILE D  2  121 ? 100.785 165.231 128.131 1.00 20.38  ? 121 ILE D N   1 
ATOM   9079  C CA  . ILE D  2  121 ? 100.083 166.400 128.640 1.00 20.38  ? 121 ILE D CA  1 
ATOM   9080  C C   . ILE D  2  121 ? 98.606  166.227 128.327 1.00 20.38  ? 121 ILE D C   1 
ATOM   9081  O O   . ILE D  2  121 ? 98.211  166.227 127.155 1.00 20.38  ? 121 ILE D O   1 
ATOM   9082  C CB  . ILE D  2  121 ? 100.617 167.702 128.038 1.00 20.38  ? 121 ILE D CB  1 
ATOM   9083  C CG1 . ILE D  2  121 ? 102.065 167.925 128.449 1.00 20.38  ? 121 ILE D CG1 1 
ATOM   9084  C CG2 . ILE D  2  121 ? 99.765  168.868 128.466 1.00 20.38  ? 121 ILE D CG2 1 
ATOM   9085  C CD1 . ILE D  2  121 ? 102.714 169.067 127.726 1.00 20.38  ? 121 ILE D CD1 1 
ATOM   9086  N N   . THR D  2  122 ? 97.788  166.084 129.363 1.00 27.83  ? 122 THR D N   1 
ATOM   9087  C CA  . THR D  2  122 ? 96.352  166.037 129.154 1.00 27.83  ? 122 THR D CA  1 
ATOM   9088  C C   . THR D  2  122 ? 95.803  167.450 128.981 1.00 27.83  ? 122 THR D C   1 
ATOM   9089  O O   . THR D  2  122 ? 96.493  168.445 129.207 1.00 27.83  ? 122 THR D O   1 
ATOM   9090  C CB  . THR D  2  122 ? 95.661  165.332 130.316 1.00 27.83  ? 122 THR D CB  1 
ATOM   9091  O OG1 . THR D  2  122 ? 95.910  166.053 131.527 1.00 27.83  ? 122 THR D OG1 1 
ATOM   9092  C CG2 . THR D  2  122 ? 96.190  163.917 130.462 1.00 27.83  ? 122 THR D CG2 1 
ATOM   9093  N N   . GLU D  2  123 ? 94.539  167.533 128.564 1.00 41.05  ? 123 GLU D N   1 
ATOM   9094  C CA  . GLU D  2  123 ? 93.927  168.838 128.331 1.00 41.05  ? 123 GLU D CA  1 
ATOM   9095  C C   . GLU D  2  123 ? 93.718  169.594 129.635 1.00 41.05  ? 123 GLU D C   1 
ATOM   9096  O O   . GLU D  2  123 ? 93.846  170.822 129.676 1.00 41.05  ? 123 GLU D O   1 
ATOM   9097  C CB  . GLU D  2  123 ? 92.600  168.670 127.596 1.00 41.05  ? 123 GLU D CB  1 
ATOM   9098  C CG  . GLU D  2  123 ? 91.905  169.978 127.280 1.00 41.05  ? 123 GLU D CG  1 
ATOM   9099  C CD  . GLU D  2  123 ? 90.625  169.783 126.497 1.00 41.05  ? 123 GLU D CD  1 
ATOM   9100  O OE1 . GLU D  2  123 ? 90.272  168.620 126.216 1.00 41.05  ? 123 GLU D OE1 1 
ATOM   9101  O OE2 . GLU D  2  123 ? 89.971  170.792 126.162 1.00 41.05  ? 123 GLU D OE2 1 
ATOM   9102  N N   . ASP D  2  124 ? 93.390  168.877 130.709 1.00 41.11  ? 124 ASP D N   1 
ATOM   9103  C CA  . ASP D  2  124 ? 93.188  169.519 132.003 1.00 41.11  ? 124 ASP D CA  1 
ATOM   9104  C C   . ASP D  2  124 ? 94.450  170.223 132.480 1.00 41.11  ? 124 ASP D C   1 
ATOM   9105  O O   . ASP D  2  124 ? 94.373  171.288 133.100 1.00 41.11  ? 124 ASP D O   1 
ATOM   9106  C CB  . ASP D  2  124 ? 92.744  168.472 133.024 1.00 41.11  ? 124 ASP D CB  1 
ATOM   9107  C CG  . ASP D  2  124 ? 92.232  169.082 134.310 1.00 41.11  ? 124 ASP D CG  1 
ATOM   9108  O OD1 . ASP D  2  124 ? 92.189  170.324 134.412 1.00 41.11  ? 124 ASP D OD1 1 
ATOM   9109  O OD2 . ASP D  2  124 ? 91.876  168.312 135.225 1.00 41.11  ? 124 ASP D OD2 1 
ATOM   9110  N N   . GLY D  2  125 ? 95.615  169.659 132.180 1.00 31.57  ? 125 GLY D N   1 
ATOM   9111  C CA  . GLY D  2  125 ? 96.879  170.131 132.711 1.00 31.57  ? 125 GLY D CA  1 
ATOM   9112  C C   . GLY D  2  125 ? 97.644  169.084 133.487 1.00 31.57  ? 125 GLY D C   1 
ATOM   9113  O O   . GLY D  2  125 ? 98.741  169.379 133.976 1.00 31.57  ? 125 GLY D O   1 
ATOM   9114  N N   . THR D  2  126 ? 97.115  167.873 133.622 1.00 32.74  ? 126 THR D N   1 
ATOM   9115  C CA  . THR D  2  126 ? 97.805  166.800 134.320 1.00 32.74  ? 126 THR D CA  1 
ATOM   9116  C C   . THR D  2  126 ? 98.910  166.235 133.444 1.00 32.74  ? 126 THR D C   1 
ATOM   9117  O O   . THR D  2  126 ? 98.666  165.848 132.299 1.00 32.74  ? 126 THR D O   1 
ATOM   9118  C CB  . THR D  2  126 ? 96.819  165.697 134.698 1.00 32.74  ? 126 THR D CB  1 
ATOM   9119  O OG1 . THR D  2  126 ? 95.857  166.210 135.627 1.00 32.74  ? 126 THR D OG1 1 
ATOM   9120  C CG2 . THR D  2  126 ? 97.541  164.516 135.313 1.00 32.74  ? 126 THR D CG2 1 
ATOM   9121  N N   . LEU D  2  127 ? 100.120 166.184 133.980 1.00 43.48  ? 127 LEU D N   1 
ATOM   9122  C CA  . LEU D  2  127 ? 101.277 165.663 133.273 1.00 43.48  ? 127 LEU D CA  1 
ATOM   9123  C C   . LEU D  2  127 ? 101.568 164.228 133.680 1.00 43.48  ? 127 LEU D C   1 
ATOM   9124  O O   . LEU D  2  127 ? 101.081 163.727 134.694 1.00 43.48  ? 127 LEU D O   1 
ATOM   9125  C CB  . LEU D  2  127 ? 102.505 166.529 133.536 1.00 43.48  ? 127 LEU D CB  1 
ATOM   9126  C CG  . LEU D  2  127 ? 102.698 167.712 132.602 1.00 43.48  ? 127 LEU D CG  1 
ATOM   9127  C CD1 . LEU D  2  127 ? 101.597 168.720 132.762 1.00 43.48  ? 127 LEU D CD1 1 
ATOM   9128  C CD2 . LEU D  2  127 ? 104.020 168.347 132.916 1.00 43.48  ? 127 LEU D CD2 1 
ATOM   9129  N N   . LEU D  2  128 ? 102.371 163.565 132.858 1.00 43.48  ? 128 LEU D N   1 
ATOM   9130  C CA  . LEU D  2  128 ? 102.893 162.245 133.162 1.00 43.48  ? 128 LEU D CA  1 
ATOM   9131  C C   . LEU D  2  128 ? 104.344 162.218 132.722 1.00 43.48  ? 128 LEU D C   1 
ATOM   9132  O O   . LEU D  2  128 ? 104.685 162.745 131.662 1.00 43.48  ? 128 LEU D O   1 
ATOM   9133  C CB  . LEU D  2  128 ? 102.096 161.144 132.464 1.00 43.48  ? 128 LEU D CB  1 
ATOM   9134  C CG  . LEU D  2  128 ? 102.518 159.705 132.749 1.00 43.48  ? 128 LEU D CG  1 
ATOM   9135  C CD1 . LEU D  2  128 ? 102.304 159.384 134.200 1.00 43.48  ? 128 LEU D CD1 1 
ATOM   9136  C CD2 . LEU D  2  128 ? 101.736 158.745 131.888 1.00 43.48  ? 128 LEU D CD2 1 
ATOM   9137  N N   . TYR D  2  129 ? 105.198 161.619 133.542 1.00 43.48  ? 129 TYR D N   1 
ATOM   9138  C CA  . TYR D  2  129 ? 106.636 161.689 133.320 1.00 43.48  ? 129 TYR D CA  1 
ATOM   9139  C C   . TYR D  2  129 ? 107.261 160.449 133.929 1.00 43.48  ? 129 TYR D C   1 
ATOM   9140  O O   . TYR D  2  129 ? 107.048 160.174 135.112 1.00 43.48  ? 129 TYR D O   1 
ATOM   9141  C CB  . TYR D  2  129 ? 107.201 162.954 133.951 1.00 43.48  ? 129 TYR D CB  1 
ATOM   9142  C CG  . TYR D  2  129 ? 108.681 163.157 133.789 1.00 43.48  ? 129 TYR D CG  1 
ATOM   9143  C CD1 . TYR D  2  129 ? 109.208 163.640 132.609 1.00 43.48  ? 129 TYR D CD1 1 
ATOM   9144  C CD2 . TYR D  2  129 ? 109.550 162.886 134.829 1.00 43.48  ? 129 TYR D CD2 1 
ATOM   9145  C CE1 . TYR D  2  129 ? 110.557 163.839 132.465 1.00 43.48  ? 129 TYR D CE1 1 
ATOM   9146  C CE2 . TYR D  2  129 ? 110.902 163.082 134.695 1.00 43.48  ? 129 TYR D CE2 1 
ATOM   9147  C CZ  . TYR D  2  129 ? 111.399 163.560 133.511 1.00 43.48  ? 129 TYR D CZ  1 
ATOM   9148  O OH  . TYR D  2  129 ? 112.751 163.754 133.368 1.00 43.48  ? 129 TYR D OH  1 
ATOM   9149  N N   . THR D  2  130 ? 107.969 159.686 133.108 1.00 24.86  ? 130 THR D N   1 
ATOM   9150  C CA  . THR D  2  130 ? 108.552 158.427 133.539 1.00 24.86  ? 130 THR D CA  1 
ATOM   9151  C C   . THR D  2  130 ? 109.934 158.172 132.955 1.00 24.86  ? 130 THR D C   1 
ATOM   9152  O O   . THR D  2  130 ? 110.196 158.481 131.806 1.00 24.86  ? 130 THR D O   1 
ATOM   9153  C CB  . THR D  2  130 ? 107.594 157.258 133.194 1.00 24.86  ? 130 THR D CB  1 
ATOM   9154  O OG1 . THR D  2  130 ? 108.326 156.113 132.744 1.00 24.86  ? 130 THR D OG1 1 
ATOM   9155  C CG2 . THR D  2  130 ? 106.634 157.654 132.097 1.00 24.86  ? 130 THR D CG2 1 
ATOM   9156  N N   . MET D  2  131 ? 110.800 157.569 133.754 1.00 29.03  ? 131 MET D N   1 
ATOM   9157  C CA  . MET D  2  131 ? 112.151 157.254 133.328 1.00 29.03  ? 131 MET D CA  1 
ATOM   9158  C C   . MET D  2  131 ? 112.340 155.746 133.375 1.00 29.03  ? 131 MET D C   1 
ATOM   9159  O O   . MET D  2  131 ? 111.493 155.013 133.884 1.00 29.03  ? 131 MET D O   1 
ATOM   9160  C CB  . MET D  2  131 ? 113.179 157.943 134.230 1.00 29.03  ? 131 MET D CB  1 
ATOM   9161  C CG  . MET D  2  131 ? 113.074 159.449 134.241 1.00 29.03  ? 131 MET D CG  1 
ATOM   9162  S SD  . MET D  2  131 ? 114.204 160.220 135.409 1.00 29.03  ? 131 MET D SD  1 
ATOM   9163  C CE  . MET D  2  131 ? 115.768 159.976 134.575 1.00 29.03  ? 131 MET D CE  1 
ATOM   9164  N N   . ARG D  2  132 ? 113.458 155.272 132.839 1.00 43.48  ? 132 ARG D N   1 
ATOM   9165  C CA  . ARG D  2  132 ? 113.850 153.879 133.019 1.00 43.48  ? 132 ARG D CA  1 
ATOM   9166  C C   . ARG D  2  132 ? 115.208 153.896 133.705 1.00 43.48  ? 132 ARG D C   1 
ATOM   9167  O O   . ARG D  2  132 ? 116.249 153.840 133.050 1.00 43.48  ? 132 ARG D O   1 
ATOM   9168  C CB  . ARG D  2  132 ? 113.889 153.108 131.707 1.00 43.48  ? 132 ARG D CB  1 
ATOM   9169  C CG  . ARG D  2  132 ? 114.145 151.620 131.905 1.00 43.48  ? 132 ARG D CG  1 
ATOM   9170  C CD  . ARG D  2  132 ? 114.035 150.820 130.618 1.00 43.48  ? 132 ARG D CD  1 
ATOM   9171  N NE  . ARG D  2  132 ? 115.122 151.084 129.689 1.00 43.48  ? 132 ARG D NE  1 
ATOM   9172  C CZ  . ARG D  2  132 ? 116.286 150.453 129.726 1.00 43.48  ? 132 ARG D CZ  1 
ATOM   9173  N NH1 . ARG D  2  132 ? 116.499 149.525 130.644 1.00 43.48  ? 132 ARG D NH1 1 
ATOM   9174  N NH2 . ARG D  2  132 ? 117.235 150.746 128.851 1.00 43.48  ? 132 ARG D NH2 1 
ATOM   9175  N N   . LEU D  2  133 ? 115.192 153.972 135.029 1.00 43.48  ? 133 LEU D N   1 
ATOM   9176  C CA  . LEU D  2  133 ? 116.415 154.017 135.807 1.00 43.48  ? 133 LEU D CA  1 
ATOM   9177  C C   . LEU D  2  133 ? 116.980 152.617 135.993 1.00 43.48  ? 133 LEU D C   1 
ATOM   9178  O O   . LEU D  2  133 ? 116.351 151.612 135.663 1.00 43.48  ? 133 LEU D O   1 
ATOM   9179  C CB  . LEU D  2  133 ? 116.155 154.641 137.169 1.00 43.48  ? 133 LEU D CB  1 
ATOM   9180  C CG  . LEU D  2  133 ? 115.676 156.082 137.165 1.00 43.48  ? 133 LEU D CG  1 
ATOM   9181  C CD1 . LEU D  2  133 ? 115.368 156.502 138.576 1.00 43.48  ? 133 LEU D CD1 1 
ATOM   9182  C CD2 . LEU D  2  133 ? 116.736 156.961 136.570 1.00 43.48  ? 133 LEU D CD2 1 
ATOM   9183  N N   . THR D  2  134 ? 118.191 152.560 136.537 1.00 23.15  ? 134 THR D N   1 
ATOM   9184  C CA  . THR D  2  134 ? 118.787 151.311 137.013 1.00 23.15  ? 134 THR D CA  1 
ATOM   9185  C C   . THR D  2  134 ? 119.419 151.649 138.358 1.00 23.15  ? 134 THR D C   1 
ATOM   9186  O O   . THR D  2  134 ? 120.580 152.052 138.434 1.00 23.15  ? 134 THR D O   1 
ATOM   9187  C CB  . THR D  2  134 ? 119.799 150.744 136.032 1.00 23.15  ? 134 THR D CB  1 
ATOM   9188  O OG1 . THR D  2  134 ? 119.152 150.475 134.783 1.00 23.15  ? 134 THR D OG1 1 
ATOM   9189  C CG2 . THR D  2  134 ? 120.386 149.455 136.573 1.00 23.15  ? 134 THR D CG2 1 
ATOM   9190  N N   . VAL D  2  135 ? 118.644 151.486 139.410 1.00 17.10  ? 135 VAL D N   1 
ATOM   9191  C CA  . VAL D  2  135 ? 119.029 151.953 140.732 1.00 17.10  ? 135 VAL D CA  1 
ATOM   9192  C C   . VAL D  2  135 ? 119.960 150.944 141.379 1.00 17.10  ? 135 VAL D C   1 
ATOM   9193  O O   . VAL D  2  135 ? 119.822 149.731 141.193 1.00 17.10  ? 135 VAL D O   1 
ATOM   9194  C CB  . VAL D  2  135 ? 117.770 152.176 141.581 1.00 17.10  ? 135 VAL D CB  1 
ATOM   9195  C CG1 . VAL D  2  135 ? 118.126 152.763 142.929 1.00 17.10  ? 135 VAL D CG1 1 
ATOM   9196  C CG2 . VAL D  2  135 ? 116.797 153.030 140.827 1.00 17.10  ? 135 VAL D CG2 1 
ATOM   9197  N N   . ARG D  2  136 ? 120.922 151.444 142.150 1.00 19.09  ? 136 ARG D N   1 
ATOM   9198  C CA  . ARG D  2  136 ? 121.869 150.598 142.869 1.00 19.09  ? 136 ARG D CA  1 
ATOM   9199  C C   . ARG D  2  136 ? 121.910 151.102 144.306 1.00 19.09  ? 136 ARG D C   1 
ATOM   9200  O O   . ARG D  2  136 ? 122.770 151.904 144.671 1.00 19.09  ? 136 ARG D O   1 
ATOM   9201  C CB  . ARG D  2  136 ? 123.228 150.630 142.199 1.00 19.09  ? 136 ARG D CB  1 
ATOM   9202  C CG  . ARG D  2  136 ? 124.219 149.633 142.742 1.00 19.09  ? 136 ARG D CG  1 
ATOM   9203  C CD  . ARG D  2  136 ? 125.463 149.617 141.884 1.00 19.09  ? 136 ARG D CD  1 
ATOM   9204  N NE  . ARG D  2  136 ? 125.156 149.174 140.528 1.00 19.09  ? 136 ARG D NE  1 
ATOM   9205  C CZ  . ARG D  2  136 ? 125.226 149.954 139.456 1.00 19.09  ? 136 ARG D CZ  1 
ATOM   9206  N NH1 . ARG D  2  136 ? 124.926 149.473 138.260 1.00 19.09  ? 136 ARG D NH1 1 
ATOM   9207  N NH2 . ARG D  2  136 ? 125.596 151.219 139.583 1.00 19.09  ? 136 ARG D NH2 1 
ATOM   9208  N N   . ALA D  2  137 ? 120.981 150.623 145.120 1.00 25.00  ? 137 ALA D N   1 
ATOM   9209  C CA  . ALA D  2  137 ? 120.793 151.144 146.465 1.00 25.00  ? 137 ALA D CA  1 
ATOM   9210  C C   . ALA D  2  137 ? 121.756 150.468 147.437 1.00 25.00  ? 137 ALA D C   1 
ATOM   9211  O O   . ALA D  2  137 ? 122.650 149.713 147.049 1.00 25.00  ? 137 ALA D O   1 
ATOM   9212  C CB  . ALA D  2  137 ? 119.342 150.967 146.895 1.00 25.00  ? 137 ALA D CB  1 
ATOM   9213  N N   . GLU D  2  138 ? 121.577 150.744 148.724 1.00 38.07  ? 138 GLU D N   1 
ATOM   9214  C CA  . GLU D  2  138 ? 122.370 150.149 149.789 1.00 38.07  ? 138 GLU D CA  1 
ATOM   9215  C C   . GLU D  2  138 ? 121.438 149.709 150.901 1.00 38.07  ? 138 GLU D C   1 
ATOM   9216  O O   . GLU D  2  138 ? 120.609 150.498 151.361 1.00 38.07  ? 138 GLU D O   1 
ATOM   9217  C CB  . GLU D  2  138 ? 123.393 151.140 150.340 1.00 38.07  ? 138 GLU D CB  1 
ATOM   9218  C CG  . GLU D  2  138 ? 124.257 150.573 151.444 1.00 38.07  ? 138 GLU D CG  1 
ATOM   9219  C CD  . GLU D  2  138 ? 125.235 151.586 151.998 1.00 38.07  ? 138 GLU D CD  1 
ATOM   9220  O OE1 . GLU D  2  138 ? 125.203 152.750 151.549 1.00 38.07  ? 138 GLU D OE1 1 
ATOM   9221  O OE2 . GLU D  2  138 ? 126.035 151.218 152.884 1.00 38.07  ? 138 GLU D OE2 1 
ATOM   9222  N N   . CYS D  2  139 ? 121.573 148.460 151.340 1.00 46.10  ? 139 CYS D N   1 
ATOM   9223  C CA  . CYS D  2  139 ? 120.740 147.935 152.416 1.00 46.10  ? 139 CYS D CA  1 
ATOM   9224  C C   . CYS D  2  139 ? 121.621 147.245 153.447 1.00 46.10  ? 139 CYS D C   1 
ATOM   9225  O O   . CYS D  2  139 ? 122.312 146.263 153.111 1.00 46.10  ? 139 CYS D O   1 
ATOM   9226  C CB  . CYS D  2  139 ? 119.666 146.985 151.880 1.00 46.10  ? 139 CYS D CB  1 
ATOM   9227  S SG  . CYS D  2  139 ? 120.199 145.447 151.090 1.00 46.10  ? 139 CYS D SG  1 
ATOM   9228  N N   . PRO D  2  140 ? 121.638 147.710 154.693 1.00 52.38  ? 140 PRO D N   1 
ATOM   9229  C CA  . PRO D  2  140 ? 122.414 147.014 155.722 1.00 52.38  ? 140 PRO D CA  1 
ATOM   9230  C C   . PRO D  2  140 ? 121.793 145.667 156.043 1.00 52.38  ? 140 PRO D C   1 
ATOM   9231  O O   . PRO D  2  140 ? 120.572 145.533 156.138 1.00 52.38  ? 140 PRO D O   1 
ATOM   9232  C CB  . PRO D  2  140 ? 122.345 147.966 156.920 1.00 52.38  ? 140 PRO D CB  1 
ATOM   9233  C CG  . PRO D  2  140 ? 121.078 148.715 156.716 1.00 52.38  ? 140 PRO D CG  1 
ATOM   9234  C CD  . PRO D  2  140 ? 120.926 148.878 155.231 1.00 52.38  ? 140 PRO D CD  1 
ATOM   9235  N N   . MET D  2  141 ? 122.646 144.664 156.201 1.00 49.54  ? 141 MET D N   1 
ATOM   9236  C CA  . MET D  2  141 ? 122.206 143.307 156.470 1.00 49.54  ? 141 MET D CA  1 
ATOM   9237  C C   . MET D  2  141 ? 122.607 142.894 157.878 1.00 49.54  ? 141 MET D C   1 
ATOM   9238  O O   . MET D  2  141 ? 123.555 143.431 158.457 1.00 49.54  ? 141 MET D O   1 
ATOM   9239  C CB  . MET D  2  141 ? 122.795 142.326 155.456 1.00 49.54  ? 141 MET D CB  1 
ATOM   9240  C CG  . MET D  2  141 ? 122.257 142.507 154.056 1.00 49.54  ? 141 MET D CG  1 
ATOM   9241  S SD  . MET D  2  141 ? 122.967 141.354 152.873 1.00 49.54  ? 141 MET D SD  1 
ATOM   9242  C CE  . MET D  2  141 ? 122.197 141.939 151.371 1.00 49.54  ? 141 MET D CE  1 
ATOM   9243  N N   . HIS D  2  142 ? 121.867 141.937 158.425 1.00 51.35  ? 142 HIS D N   1 
ATOM   9244  C CA  . HIS D  2  142 ? 122.171 141.331 159.717 1.00 51.35  ? 142 HIS D CA  1 
ATOM   9245  C C   . HIS D  2  142 ? 122.352 139.838 159.485 1.00 51.35  ? 142 HIS D C   1 
ATOM   9246  O O   . HIS D  2  142 ? 121.373 139.100 159.347 1.00 51.35  ? 142 HIS D O   1 
ATOM   9247  C CB  . HIS D  2  142 ? 121.074 141.613 160.734 1.00 51.35  ? 142 HIS D CB  1 
ATOM   9248  C CG  . HIS D  2  142 ? 120.995 143.047 161.149 1.00 51.35  ? 142 HIS D CG  1 
ATOM   9249  N ND1 . HIS D  2  142 ? 121.911 143.623 162.002 1.00 51.35  ? 142 HIS D ND1 1 
ATOM   9250  C CD2 . HIS D  2  142 ? 120.112 144.022 160.831 1.00 51.35  ? 142 HIS D CD2 1 
ATOM   9251  C CE1 . HIS D  2  142 ? 121.596 144.891 162.191 1.00 51.35  ? 142 HIS D CE1 1 
ATOM   9252  N NE2 . HIS D  2  142 ? 120.508 145.159 161.493 1.00 51.35  ? 142 HIS D NE2 1 
ATOM   9253  N N   . LEU D  2  143 ? 123.607 139.396 159.450 1.00 48.97  ? 143 LEU D N   1 
ATOM   9254  C CA  . LEU D  2  143 ? 123.943 138.011 159.166 1.00 48.97  ? 143 LEU D CA  1 
ATOM   9255  C C   . LEU D  2  143 ? 123.997 137.152 160.421 1.00 48.97  ? 143 LEU D C   1 
ATOM   9256  O O   . LEU D  2  143 ? 124.678 136.122 160.431 1.00 48.97  ? 143 LEU D O   1 
ATOM   9257  C CB  . LEU D  2  143 ? 125.273 137.945 158.419 1.00 48.97  ? 143 LEU D CB  1 
ATOM   9258  C CG  . LEU D  2  143 ? 125.224 138.631 157.055 1.00 48.97  ? 143 LEU D CG  1 
ATOM   9259  C CD1 . LEU D  2  143 ? 126.589 138.625 156.399 1.00 48.97  ? 143 LEU D CD1 1 
ATOM   9260  C CD2 . LEU D  2  143 ? 124.191 137.966 156.166 1.00 48.97  ? 143 LEU D CD2 1 
ATOM   9261  N N   . GLU D  2  144 ? 123.287 137.549 161.476 1.00 51.49  ? 144 GLU D N   1 
ATOM   9262  C CA  . GLU D  2  144 ? 123.310 136.796 162.721 1.00 51.49  ? 144 GLU D CA  1 
ATOM   9263  C C   . GLU D  2  144 ? 122.614 135.449 162.598 1.00 51.49  ? 144 GLU D C   1 
ATOM   9264  O O   . GLU D  2  144 ? 122.868 134.559 163.413 1.00 51.49  ? 144 GLU D O   1 
ATOM   9265  C CB  . GLU D  2  144 ? 122.667 137.622 163.832 1.00 51.49  ? 144 GLU D CB  1 
ATOM   9266  C CG  . GLU D  2  144 ? 123.432 138.890 164.159 1.00 51.49  ? 144 GLU D CG  1 
ATOM   9267  C CD  . GLU D  2  144 ? 122.738 139.742 165.197 1.00 51.49  ? 144 GLU D CD  1 
ATOM   9268  O OE1 . GLU D  2  144 ? 121.601 139.402 165.580 1.00 51.49  ? 144 GLU D OE1 1 
ATOM   9269  O OE2 . GLU D  2  144 ? 123.325 140.757 165.624 1.00 51.49  ? 144 GLU D OE2 1 
ATOM   9270  N N   . ASP D  2  145 ? 121.746 135.278 161.604 1.00 49.77  ? 145 ASP D N   1 
ATOM   9271  C CA  . ASP D  2  145 ? 121.036 134.026 161.385 1.00 49.77  ? 145 ASP D CA  1 
ATOM   9272  C C   . ASP D  2  145 ? 121.480 133.341 160.098 1.00 49.77  ? 145 ASP D C   1 
ATOM   9273  O O   . ASP D  2  145 ? 120.718 132.582 159.497 1.00 49.77  ? 145 ASP D O   1 
ATOM   9274  C CB  . ASP D  2  145 ? 119.529 134.261 161.361 1.00 49.77  ? 145 ASP D CB  1 
ATOM   9275  C CG  . ASP D  2  145 ? 118.980 134.651 162.711 1.00 49.77  ? 145 ASP D CG  1 
ATOM   9276  O OD1 . ASP D  2  145 ? 119.574 134.245 163.731 1.00 49.77  ? 145 ASP D OD1 1 
ATOM   9277  O OD2 . ASP D  2  145 ? 117.951 135.356 162.753 1.00 49.77  ? 145 ASP D OD2 1 
ATOM   9278  N N   . PHE D  2  146 ? 122.704 133.611 159.662 1.00 45.43  ? 146 PHE D N   1 
ATOM   9279  C CA  . PHE D  2  146 ? 123.215 132.990 158.452 1.00 45.43  ? 146 PHE D CA  1 
ATOM   9280  C C   . PHE D  2  146 ? 123.222 131.473 158.613 1.00 45.43  ? 146 PHE D C   1 
ATOM   9281  O O   . PHE D  2  146 ? 123.545 130.967 159.693 1.00 45.43  ? 146 PHE D O   1 
ATOM   9282  C CB  . PHE D  2  146 ? 124.633 133.486 158.172 1.00 45.43  ? 146 PHE D CB  1 
ATOM   9283  C CG  . PHE D  2  146 ? 125.204 132.992 156.883 1.00 45.43  ? 146 PHE D CG  1 
ATOM   9284  C CD1 . PHE D  2  146 ? 124.916 133.632 155.697 1.00 45.43  ? 146 PHE D CD1 1 
ATOM   9285  C CD2 . PHE D  2  146 ? 126.014 131.877 156.855 1.00 45.43  ? 146 PHE D CD2 1 
ATOM   9286  C CE1 . PHE D  2  146 ? 125.439 133.181 154.509 1.00 45.43  ? 146 PHE D CE1 1 
ATOM   9287  C CE2 . PHE D  2  146 ? 126.537 131.419 155.668 1.00 45.43  ? 146 PHE D CE2 1 
ATOM   9288  C CZ  . PHE D  2  146 ? 126.250 132.072 154.494 1.00 45.43  ? 146 PHE D CZ  1 
ATOM   9289  N N   . PRO D  2  147 ? 122.866 130.713 157.573 1.00 45.07  ? 147 PRO D N   1 
ATOM   9290  C CA  . PRO D  2  147 ? 122.338 131.176 156.293 1.00 45.07  ? 147 PRO D CA  1 
ATOM   9291  C C   . PRO D  2  147 ? 120.820 131.127 156.246 1.00 45.07  ? 147 PRO D C   1 
ATOM   9292  O O   . PRO D  2  147 ? 120.250 130.930 155.177 1.00 45.07  ? 147 PRO D O   1 
ATOM   9293  C CB  . PRO D  2  147 ? 122.924 130.181 155.306 1.00 45.07  ? 147 PRO D CB  1 
ATOM   9294  C CG  . PRO D  2  147 ? 122.982 128.923 156.080 1.00 45.07  ? 147 PRO D CG  1 
ATOM   9295  C CD  . PRO D  2  147 ? 123.308 129.310 157.492 1.00 45.07  ? 147 PRO D CD  1 
ATOM   9296  N N   . MET D  2  148 ? 120.172 131.288 157.395 1.00 46.84  ? 148 MET D N   1 
ATOM   9297  C CA  . MET D  2  148 ? 118.721 131.226 157.480 1.00 46.84  ? 148 MET D CA  1 
ATOM   9298  C C   . MET D  2  148 ? 118.101 132.602 157.661 1.00 46.84  ? 148 MET D C   1 
ATOM   9299  O O   . MET D  2  148 ? 116.927 132.701 158.032 1.00 46.84  ? 148 MET D O   1 
ATOM   9300  C CB  . MET D  2  148 ? 118.313 130.308 158.628 1.00 46.84  ? 148 MET D CB  1 
ATOM   9301  C CG  . MET D  2  148 ? 118.806 128.887 158.463 1.00 46.84  ? 148 MET D CG  1 
ATOM   9302  S SD  . MET D  2  148 ? 118.410 127.872 159.892 1.00 46.84  ? 148 MET D SD  1 
ATOM   9303  C CE  . MET D  2  148 ? 119.271 126.359 159.493 1.00 46.84  ? 148 MET D CE  1 
ATOM   9304  N N   . ASP D  2  149 ? 118.864 133.661 157.413 1.00 45.93  ? 149 ASP D N   1 
ATOM   9305  C CA  . ASP D  2  149 ? 118.399 135.016 157.662 1.00 45.93  ? 149 ASP D CA  1 
ATOM   9306  C C   . ASP D  2  149 ? 117.247 135.389 156.740 1.00 45.93  ? 149 ASP D C   1 
ATOM   9307  O O   . ASP D  2  149 ? 117.110 134.869 155.631 1.00 45.93  ? 149 ASP D O   1 
ATOM   9308  C CB  . ASP D  2  149 ? 119.549 136.005 157.490 1.00 45.93  ? 149 ASP D CB  1 
ATOM   9309  C CG  . ASP D  2  149 ? 120.232 135.877 156.145 1.00 45.93  ? 149 ASP D CG  1 
ATOM   9310  O OD1 . ASP D  2  149 ? 119.875 134.960 155.379 1.00 45.93  ? 149 ASP D OD1 1 
ATOM   9311  O OD2 . ASP D  2  149 ? 121.132 136.691 155.854 1.00 45.93  ? 149 ASP D OD2 1 
ATOM   9312  N N   . ALA D  2  150 ? 116.395 136.289 157.227 1.00 39.44  ? 150 ALA D N   1 
ATOM   9313  C CA  . ALA D  2  150 ? 115.307 136.871 156.443 1.00 39.44  ? 150 ALA D CA  1 
ATOM   9314  C C   . ALA D  2  150 ? 115.353 138.378 156.666 1.00 39.44  ? 150 ALA D C   1 
ATOM   9315  O O   . ALA D  2  150 ? 114.649 138.909 157.528 1.00 39.44  ? 150 ALA D O   1 
ATOM   9316  C CB  . ALA D  2  150 ? 113.962 136.280 156.839 1.00 39.44  ? 150 ALA D CB  1 
ATOM   9317  N N   . HIS D  2  151 ? 116.169 139.064 155.880 1.00 32.88  ? 151 HIS D N   1 
ATOM   9318  C CA  . HIS D  2  151 ? 116.376 140.495 156.028 1.00 32.88  ? 151 HIS D CA  1 
ATOM   9319  C C   . HIS D  2  151 ? 115.667 141.264 154.920 1.00 32.88  ? 151 HIS D C   1 
ATOM   9320  O O   . HIS D  2  151 ? 115.319 140.714 153.874 1.00 32.88  ? 151 HIS D O   1 
ATOM   9321  C CB  . HIS D  2  151 ? 117.869 140.812 156.038 1.00 32.88  ? 151 HIS D CB  1 
ATOM   9322  C CG  . HIS D  2  151 ? 118.601 140.285 154.848 1.00 32.88  ? 151 HIS D CG  1 
ATOM   9323  N ND1 . HIS D  2  151 ? 118.741 141.004 153.683 1.00 32.88  ? 151 HIS D ND1 1 
ATOM   9324  C CD2 . HIS D  2  151 ? 119.220 139.101 154.637 1.00 32.88  ? 151 HIS D CD2 1 
ATOM   9325  C CE1 . HIS D  2  151 ? 119.426 140.289 152.808 1.00 32.88  ? 151 HIS D CE1 1 
ATOM   9326  N NE2 . HIS D  2  151 ? 119.728 139.130 153.362 1.00 32.88  ? 151 HIS D NE2 1 
ATOM   9327  N N   . ALA D  2  152 ? 115.453 142.555 155.168 1.00 29.36  ? 152 ALA D N   1 
ATOM   9328  C CA  . ALA D  2  152 ? 114.654 143.410 154.299 1.00 29.36  ? 152 ALA D CA  1 
ATOM   9329  C C   . ALA D  2  152 ? 115.487 144.602 153.854 1.00 29.36  ? 152 ALA D C   1 
ATOM   9330  O O   . ALA D  2  152 ? 115.997 145.351 154.692 1.00 29.36  ? 152 ALA D O   1 
ATOM   9331  C CB  . ALA D  2  152 ? 113.390 143.880 155.020 1.00 29.36  ? 152 ALA D CB  1 
ATOM   9332  N N   . CYS D  2  153 ? 115.610 144.787 152.528 1.00 30.85  ? 153 CYS D N   1 
ATOM   9333  C CA  . CYS D  2  153 ? 116.389 145.899 151.992 1.00 30.85  ? 153 CYS D CA  1 
ATOM   9334  C C   . CYS D  2  153 ? 115.484 147.073 151.656 1.00 30.85  ? 153 CYS D C   1 
ATOM   9335  O O   . CYS D  2  153 ? 114.493 146.894 150.937 1.00 30.85  ? 153 CYS D O   1 
ATOM   9336  C CB  . CYS D  2  153 ? 117.161 145.471 150.746 1.00 30.85  ? 153 CYS D CB  1 
ATOM   9337  S SG  . CYS D  2  153 ? 118.515 144.302 151.038 1.00 30.85  ? 153 CYS D SG  1 
ATOM   9338  N N   . PRO D  2  154 ? 115.785 148.275 152.147 1.00 25.34  ? 154 PRO D N   1 
ATOM   9339  C CA  . PRO D  2  154 ? 114.900 149.420 151.908 1.00 25.34  ? 154 PRO D CA  1 
ATOM   9340  C C   . PRO D  2  154 ? 115.210 150.178 150.630 1.00 25.34  ? 154 PRO D C   1 
ATOM   9341  O O   . PRO D  2  154 ? 116.149 149.845 149.905 1.00 25.34  ? 154 PRO D O   1 
ATOM   9342  C CB  . PRO D  2  154 ? 115.149 150.301 153.134 1.00 25.34  ? 154 PRO D CB  1 
ATOM   9343  C CG  . PRO D  2  154 ? 116.547 150.011 153.498 1.00 25.34  ? 154 PRO D CG  1 
ATOM   9344  C CD  . PRO D  2  154 ? 116.773 148.560 153.198 1.00 25.34  ? 154 PRO D CD  1 
ATOM   9345  N N   . LEU D  2  155 ? 114.401 151.199 150.353 1.00 24.85  ? 155 LEU D N   1 
ATOM   9346  C CA  . LEU D  2  155 ? 114.614 152.103 149.225 1.00 24.85  ? 155 LEU D CA  1 
ATOM   9347  C C   . LEU D  2  155 ? 113.852 153.385 149.526 1.00 24.85  ? 155 LEU D C   1 
ATOM   9348  O O   . LEU D  2  155 ? 112.620 153.381 149.504 1.00 24.85  ? 155 LEU D O   1 
ATOM   9349  C CB  . LEU D  2  155 ? 114.134 151.480 147.924 1.00 24.85  ? 155 LEU D CB  1 
ATOM   9350  C CG  . LEU D  2  155 ? 114.286 152.370 146.694 1.00 24.85  ? 155 LEU D CG  1 
ATOM   9351  C CD1 . LEU D  2  155 ? 115.747 152.621 146.395 1.00 24.85  ? 155 LEU D CD1 1 
ATOM   9352  C CD2 . LEU D  2  155 ? 113.582 151.766 145.498 1.00 24.85  ? 155 LEU D CD2 1 
ATOM   9353  N N   . LYS D  2  156 ? 114.568 154.470 149.800 1.00 43.48  ? 156 LYS D N   1 
ATOM   9354  C CA  . LYS D  2  156 ? 113.951 155.723 150.214 1.00 43.48  ? 156 LYS D CA  1 
ATOM   9355  C C   . LYS D  2  156 ? 114.209 156.792 149.166 1.00 43.48  ? 156 LYS D C   1 
ATOM   9356  O O   . LYS D  2  156 ? 115.364 157.080 148.841 1.00 43.48  ? 156 LYS D O   1 
ATOM   9357  C CB  . LYS D  2  156 ? 114.481 156.170 151.575 1.00 43.48  ? 156 LYS D CB  1 
ATOM   9358  C CG  . LYS D  2  156 ? 114.027 155.291 152.718 1.00 43.48  ? 156 LYS D CG  1 
ATOM   9359  C CD  . LYS D  2  156 ? 114.443 155.856 154.061 1.00 43.48  ? 156 LYS D CD  1 
ATOM   9360  C CE  . LYS D  2  156 ? 115.679 155.167 154.594 1.00 43.48  ? 156 LYS D CE  1 
ATOM   9361  N NZ  . LYS D  2  156 ? 116.906 155.582 153.875 1.00 43.48  ? 156 LYS D NZ  1 
ATOM   9362  N N   . PHE D  2  157 ? 113.138 157.387 148.650 1.00 43.48  ? 157 PHE D N   1 
ATOM   9363  C CA  . PHE D  2  157 ? 113.241 158.480 147.695 1.00 43.48  ? 157 PHE D CA  1 
ATOM   9364  C C   . PHE D  2  157 ? 112.366 159.631 148.151 1.00 43.48  ? 157 PHE D C   1 
ATOM   9365  O O   . PHE D  2  157 ? 111.189 159.436 148.460 1.00 43.48  ? 157 PHE D O   1 
ATOM   9366  C CB  . PHE D  2  157 ? 112.839 158.038 146.291 1.00 43.48  ? 157 PHE D CB  1 
ATOM   9367  C CG  . PHE D  2  157 ? 111.406 157.653 146.151 1.00 43.48  ? 157 PHE D CG  1 
ATOM   9368  C CD1 . PHE D  2  157 ? 110.990 156.377 146.451 1.00 43.48  ? 157 PHE D CD1 1 
ATOM   9369  C CD2 . PHE D  2  157 ? 110.485 158.552 145.659 1.00 43.48  ? 157 PHE D CD2 1 
ATOM   9370  C CE1 . PHE D  2  157 ? 109.676 156.019 146.306 1.00 43.48  ? 157 PHE D CE1 1 
ATOM   9371  C CE2 . PHE D  2  157 ? 109.175 158.202 145.514 1.00 43.48  ? 157 PHE D CE2 1 
ATOM   9372  C CZ  . PHE D  2  157 ? 108.768 156.933 145.834 1.00 43.48  ? 157 PHE D CZ  1 
ATOM   9373  N N   . GLY D  2  158 ? 112.945 160.826 148.199 1.00 21.35  ? 158 GLY D N   1 
ATOM   9374  C CA  . GLY D  2  158 ? 112.218 161.995 148.634 1.00 21.35  ? 158 GLY D CA  1 
ATOM   9375  C C   . GLY D  2  158 ? 112.585 163.192 147.784 1.00 21.35  ? 158 GLY D C   1 
ATOM   9376  O O   . GLY D  2  158 ? 113.487 163.132 146.950 1.00 21.35  ? 158 GLY D O   1 
ATOM   9377  N N   . SER D  2  159 ? 111.842 164.275 147.979 1.00 20.44  ? 159 SER D N   1 
ATOM   9378  C CA  . SER D  2  159 ? 112.110 165.488 147.179 1.00 20.44  ? 159 SER D CA  1 
ATOM   9379  C C   . SER D  2  159 ? 113.355 166.179 147.714 1.00 20.44  ? 159 SER D C   1 
ATOM   9380  O O   . SER D  2  159 ? 113.681 165.996 148.887 1.00 20.44  ? 159 SER D O   1 
ATOM   9381  C CB  . SER D  2  159 ? 110.946 166.418 147.172 1.00 20.44  ? 159 SER D CB  1 
ATOM   9382  O OG  . SER D  2  159 ? 111.294 167.611 146.494 1.00 20.44  ? 159 SER D OG  1 
ATOM   9383  N N   . TYR D  2  160 ? 114.022 166.928 146.849 1.00 22.09  ? 160 TYR D N   1 
ATOM   9384  C CA  . TYR D  2  160 ? 115.240 167.672 147.238 1.00 22.09  ? 160 TYR D CA  1 
ATOM   9385  C C   . TYR D  2  160 ? 114.969 169.159 147.016 1.00 22.09  ? 160 TYR D C   1 
ATOM   9386  O O   . TYR D  2  160 ? 114.020 169.497 146.287 1.00 22.09  ? 160 TYR D O   1 
ATOM   9387  C CB  . TYR D  2  160 ? 116.388 167.243 146.325 1.00 22.09  ? 160 TYR D CB  1 
ATOM   9388  C CG  . TYR D  2  160 ? 117.787 167.503 146.816 1.00 22.09  ? 160 TYR D CG  1 
ATOM   9389  C CD1 . TYR D  2  160 ? 118.499 166.519 147.469 1.00 22.09  ? 160 TYR D CD1 1 
ATOM   9390  C CD2 . TYR D  2  160 ? 118.428 168.702 146.573 1.00 22.09  ? 160 TYR D CD2 1 
ATOM   9391  C CE1 . TYR D  2  160 ? 119.795 166.724 147.903 1.00 22.09  ? 160 TYR D CE1 1 
ATOM   9392  C CE2 . TYR D  2  160 ? 119.725 168.928 147.002 1.00 22.09  ? 160 TYR D CE2 1 
ATOM   9393  C CZ  . TYR D  2  160 ? 120.410 167.934 147.671 1.00 22.09  ? 160 TYR D CZ  1 
ATOM   9394  O OH  . TYR D  2  160 ? 121.683 168.128 148.108 1.00 22.09  ? 160 TYR D OH  1 
ATOM   9395  N N   . ALA D  2  161 ? 115.693 170.002 147.743 1.00 26.42  ? 161 ALA D N   1 
ATOM   9396  C CA  . ALA D  2  161 ? 115.668 171.449 147.553 1.00 26.42  ? 161 ALA D CA  1 
ATOM   9397  C C   . ALA D  2  161 ? 114.282 172.061 147.729 1.00 26.42  ? 161 ALA D C   1 
ATOM   9398  O O   . ALA D  2  161 ? 114.126 173.277 147.590 1.00 26.42  ? 161 ALA D O   1 
ATOM   9399  C CB  . ALA D  2  161 ? 116.218 171.817 146.174 1.00 26.42  ? 161 ALA D CB  1 
ATOM   9400  N N   . TYR D  2  162 ? 113.273 171.249 148.035 1.00 43.48  ? 162 TYR D N   1 
ATOM   9401  C CA  . TYR D  2  162 ? 111.940 171.751 148.346 1.00 43.48  ? 162 TYR D CA  1 
ATOM   9402  C C   . TYR D  2  162 ? 111.490 171.147 149.666 1.00 43.48  ? 162 TYR D C   1 
ATOM   9403  O O   . TYR D  2  162 ? 111.413 169.923 149.794 1.00 43.48  ? 162 TYR D O   1 
ATOM   9404  C CB  . TYR D  2  162 ? 110.932 171.413 147.246 1.00 43.48  ? 162 TYR D CB  1 
ATOM   9405  C CG  . TYR D  2  162 ? 111.192 172.062 145.909 1.00 43.48  ? 162 TYR D CG  1 
ATOM   9406  C CD1 . TYR D  2  162 ? 111.015 173.421 145.728 1.00 43.48  ? 162 TYR D CD1 1 
ATOM   9407  C CD2 . TYR D  2  162 ? 111.542 171.300 144.811 1.00 43.48  ? 162 TYR D CD2 1 
ATOM   9408  C CE1 . TYR D  2  162 ? 111.232 174.009 144.503 1.00 43.48  ? 162 TYR D CE1 1 
ATOM   9409  C CE2 . TYR D  2  162 ? 111.757 171.879 143.584 1.00 43.48  ? 162 TYR D CE2 1 
ATOM   9410  C CZ  . TYR D  2  162 ? 111.599 173.232 143.435 1.00 43.48  ? 162 TYR D CZ  1 
ATOM   9411  O OH  . TYR D  2  162 ? 111.817 173.807 142.209 1.00 43.48  ? 162 TYR D OH  1 
ATOM   9412  N N   . THR D  2  163 ? 111.176 171.999 150.636 1.00 30.37  ? 163 THR D N   1 
ATOM   9413  C CA  . THR D  2  163 ? 110.742 171.522 151.938 1.00 30.37  ? 163 THR D CA  1 
ATOM   9414  C C   . THR D  2  163 ? 109.337 170.928 151.842 1.00 30.37  ? 163 THR D C   1 
ATOM   9415  O O   . THR D  2  163 ? 108.743 170.830 150.767 1.00 30.37  ? 163 THR D O   1 
ATOM   9416  C CB  . THR D  2  163 ? 110.780 172.654 152.958 1.00 30.37  ? 163 THR D CB  1 
ATOM   9417  O OG1 . THR D  2  163 ? 109.844 173.667 152.577 1.00 30.37  ? 163 THR D OG1 1 
ATOM   9418  C CG2 . THR D  2  163 ? 112.161 173.266 153.012 1.00 30.37  ? 163 THR D CG2 1 
ATOM   9419  N N   . ARG D  2  164 ? 108.796 170.519 152.991 1.00 21.23  ? 164 ARG D N   1 
ATOM   9420  C CA  . ARG D  2  164 ? 107.468 169.922 153.007 1.00 21.23  ? 164 ARG D CA  1 
ATOM   9421  C C   . ARG D  2  164 ? 106.380 170.945 152.727 1.00 21.23  ? 164 ARG D C   1 
ATOM   9422  O O   . ARG D  2  164 ? 105.284 170.566 152.308 1.00 21.23  ? 164 ARG D O   1 
ATOM   9423  C CB  . ARG D  2  164 ? 107.226 169.232 154.351 1.00 21.23  ? 164 ARG D CB  1 
ATOM   9424  C CG  . ARG D  2  164 ? 105.972 168.375 154.442 1.00 21.23  ? 164 ARG D CG  1 
ATOM   9425  C CD  . ARG D  2  164 ? 104.787 169.143 154.996 1.00 21.23  ? 164 ARG D CD  1 
ATOM   9426  N NE  . ARG D  2  164 ? 105.099 169.760 156.281 1.00 21.23  ? 164 ARG D NE  1 
ATOM   9427  C CZ  . ARG D  2  164 ? 105.047 169.127 157.446 1.00 21.23  ? 164 ARG D CZ  1 
ATOM   9428  N NH1 . ARG D  2  164 ? 105.348 169.772 158.563 1.00 21.23  ? 164 ARG D NH1 1 
ATOM   9429  N NH2 . ARG D  2  164 ? 104.691 167.854 157.495 1.00 21.23  ? 164 ARG D NH2 1 
ATOM   9430  N N   . ALA D  2  165 ? 106.660 172.226 152.920 1.00 19.83  ? 165 ALA D N   1 
ATOM   9431  C CA  . ALA D  2  165 ? 105.677 173.258 152.633 1.00 19.83  ? 165 ALA D CA  1 
ATOM   9432  C C   . ALA D  2  165 ? 105.567 173.579 151.151 1.00 19.83  ? 165 ALA D C   1 
ATOM   9433  O O   . ALA D  2  165 ? 104.856 174.522 150.796 1.00 19.83  ? 165 ALA D O   1 
ATOM   9434  C CB  . ALA D  2  165 ? 106.012 174.535 153.404 1.00 19.83  ? 165 ALA D CB  1 
ATOM   9435  N N   . GLU D  2  166 ? 106.259 172.856 150.289 1.00 21.47  ? 166 GLU D N   1 
ATOM   9436  C CA  . GLU D  2  166 ? 106.206 173.173 148.866 1.00 21.47  ? 166 GLU D CA  1 
ATOM   9437  C C   . GLU D  2  166 ? 105.916 171.976 147.972 1.00 21.47  ? 166 GLU D C   1 
ATOM   9438  O O   . GLU D  2  166 ? 105.259 172.138 146.943 1.00 21.47  ? 166 GLU D O   1 
ATOM   9439  C CB  . GLU D  2  166 ? 107.515 173.838 148.447 1.00 21.47  ? 166 GLU D CB  1 
ATOM   9440  C CG  . GLU D  2  166 ? 107.688 175.221 149.032 1.00 21.47  ? 166 GLU D CG  1 
ATOM   9441  C CD  . GLU D  2  166 ? 109.001 175.857 148.647 1.00 21.47  ? 166 GLU D CD  1 
ATOM   9442  O OE1 . GLU D  2  166 ? 109.860 175.155 148.077 1.00 21.47  ? 166 GLU D OE1 1 
ATOM   9443  O OE2 . GLU D  2  166 ? 109.168 177.066 148.906 1.00 21.47  ? 166 GLU D OE2 1 
ATOM   9444  N N   . VAL D  2  167 ? 106.401 170.788 148.318 1.00 17.97  ? 167 VAL D N   1 
ATOM   9445  C CA  . VAL D  2  167 ? 106.173 169.591 147.515 1.00 17.97  ? 167 VAL D CA  1 
ATOM   9446  C C   . VAL D  2  167 ? 105.860 168.430 148.442 1.00 17.97  ? 167 VAL D C   1 
ATOM   9447  O O   . VAL D  2  167 ? 106.609 168.166 149.386 1.00 17.97  ? 167 VAL D O   1 
ATOM   9448  C CB  . VAL D  2  167 ? 107.383 169.251 146.629 1.00 17.97  ? 167 VAL D CB  1 
ATOM   9449  C CG1 . VAL D  2  167 ? 107.202 167.896 145.999 1.00 17.97  ? 167 VAL D CG1 1 
ATOM   9450  C CG2 . VAL D  2  167 ? 107.552 170.293 145.552 1.00 17.97  ? 167 VAL D CG2 1 
ATOM   9451  N N   . VAL D  2  168 ? 104.764 167.731 148.167 1.00 16.57  ? 168 VAL D N   1 
ATOM   9452  C CA  . VAL D  2  168 ? 104.326 166.597 148.967 1.00 16.57  ? 168 VAL D CA  1 
ATOM   9453  C C   . VAL D  2  168 ? 104.111 165.409 148.044 1.00 16.57  ? 168 VAL D C   1 
ATOM   9454  O O   . VAL D  2  168 ? 103.391 165.519 147.047 1.00 16.57  ? 168 VAL D O   1 
ATOM   9455  C CB  . VAL D  2  168 ? 103.035 166.915 149.740 1.00 16.57  ? 168 VAL D CB  1 
ATOM   9456  C CG1 . VAL D  2  168 ? 102.549 165.688 150.470 1.00 16.57  ? 168 VAL D CG1 1 
ATOM   9457  C CG2 . VAL D  2  168 ? 103.268 168.053 150.707 1.00 16.57  ? 168 VAL D CG2 1 
ATOM   9458  N N   . TYR D  2  169 ? 104.725 164.277 148.377 1.00 18.83  ? 169 TYR D N   1 
ATOM   9459  C CA  . TYR D  2  169 ? 104.574 163.059 147.592 1.00 18.83  ? 169 TYR D CA  1 
ATOM   9460  C C   . TYR D  2  169 ? 103.430 162.208 148.121 1.00 18.83  ? 169 TYR D C   1 
ATOM   9461  O O   . TYR D  2  169 ? 103.268 162.045 149.331 1.00 18.83  ? 169 TYR D O   1 
ATOM   9462  C CB  . TYR D  2  169 ? 105.858 162.233 147.609 1.00 18.83  ? 169 TYR D CB  1 
ATOM   9463  C CG  . TYR D  2  169 ? 106.984 162.794 146.783 1.00 18.83  ? 169 TYR D CG  1 
ATOM   9464  C CD1 . TYR D  2  169 ? 106.769 163.804 145.872 1.00 18.83  ? 169 TYR D CD1 1 
ATOM   9465  C CD2 . TYR D  2  169 ? 108.262 162.292 146.904 1.00 18.83  ? 169 TYR D CD2 1 
ATOM   9466  C CE1 . TYR D  2  169 ? 107.799 164.304 145.117 1.00 18.83  ? 169 TYR D CE1 1 
ATOM   9467  C CE2 . TYR D  2  169 ? 109.293 162.785 146.156 1.00 18.83  ? 169 TYR D CE2 1 
ATOM   9468  C CZ  . TYR D  2  169 ? 109.057 163.790 145.264 1.00 18.83  ? 169 TYR D CZ  1 
ATOM   9469  O OH  . TYR D  2  169 ? 110.088 164.285 144.510 1.00 18.83  ? 169 TYR D OH  1 
ATOM   9470  N N   . GLU D  2  170 ? 102.645 161.657 147.202 1.00 42.20  ? 170 GLU D N   1 
ATOM   9471  C CA  . GLU D  2  170 ? 101.592 160.713 147.536 1.00 42.20  ? 170 GLU D CA  1 
ATOM   9472  C C   . GLU D  2  170 ? 101.584 159.609 146.494 1.00 42.20  ? 170 GLU D C   1 
ATOM   9473  O O   . GLU D  2  170 ? 101.774 159.873 145.306 1.00 42.20  ? 170 GLU D O   1 
ATOM   9474  C CB  . GLU D  2  170 ? 100.219 161.386 147.590 1.00 42.20  ? 170 GLU D CB  1 
ATOM   9475  C CG  . GLU D  2  170 ? 100.063 162.364 148.728 1.00 42.20  ? 170 GLU D CG  1 
ATOM   9476  C CD  . GLU D  2  170 ? 100.123 161.683 150.076 1.00 42.20  ? 170 GLU D CD  1 
ATOM   9477  O OE1 . GLU D  2  170 ? 99.696  160.514 150.168 1.00 42.20  ? 170 GLU D OE1 1 
ATOM   9478  O OE2 . GLU D  2  170 ? 100.593 162.313 151.046 1.00 42.20  ? 170 GLU D OE2 1 
ATOM   9479  N N   . TRP D  2  171 ? 101.368 158.378 146.939 1.00 43.48  ? 171 TRP D N   1 
ATOM   9480  C CA  . TRP D  2  171 ? 101.369 157.255 146.016 1.00 43.48  ? 171 TRP D CA  1 
ATOM   9481  C C   . TRP D  2  171 ? 100.193 157.358 145.057 1.00 43.48  ? 171 TRP D C   1 
ATOM   9482  O O   . TRP D  2  171 ? 99.091  157.754 145.442 1.00 43.48  ? 171 TRP D O   1 
ATOM   9483  C CB  . TRP D  2  171 ? 101.321 155.942 146.781 1.00 43.48  ? 171 TRP D CB  1 
ATOM   9484  C CG  . TRP D  2  171 ? 102.564 155.675 147.541 1.00 43.48  ? 171 TRP D CG  1 
ATOM   9485  C CD1 . TRP D  2  171 ? 102.783 155.919 148.856 1.00 43.48  ? 171 TRP D CD1 1 
ATOM   9486  C CD2 . TRP D  2  171 ? 103.774 155.117 147.027 1.00 43.48  ? 171 TRP D CD2 1 
ATOM   9487  N NE1 . TRP D  2  171 ? 104.054 155.541 149.200 1.00 43.48  ? 171 TRP D NE1 1 
ATOM   9488  C CE2 . TRP D  2  171 ? 104.683 155.047 148.090 1.00 43.48  ? 171 TRP D CE2 1 
ATOM   9489  C CE3 . TRP D  2  171 ? 104.174 154.668 145.770 1.00 43.48  ? 171 TRP D CE3 1 
ATOM   9490  C CZ2 . TRP D  2  171 ? 105.967 154.546 147.936 1.00 43.48  ? 171 TRP D CZ2 1 
ATOM   9491  C CZ3 . TRP D  2  171 ? 105.450 154.172 145.621 1.00 43.48  ? 171 TRP D CZ3 1 
ATOM   9492  C CH2 . TRP D  2  171 ? 106.330 154.115 146.695 1.00 43.48  ? 171 TRP D CH2 1 
ATOM   9493  N N   . THR D  2  172 ? 100.438 157.000 143.794 1.00 31.48  ? 172 THR D N   1 
ATOM   9494  C CA  . THR D  2  172 ? 99.452  157.241 142.746 1.00 31.48  ? 172 THR D CA  1 
ATOM   9495  C C   . THR D  2  172 ? 98.170  156.464 142.999 1.00 31.48  ? 172 THR D C   1 
ATOM   9496  O O   . THR D  2  172 ? 97.072  157.024 142.927 1.00 31.48  ? 172 THR D O   1 
ATOM   9497  C CB  . THR D  2  172 ? 100.032 156.871 141.382 1.00 31.48  ? 172 THR D CB  1 
ATOM   9498  O OG1 . THR D  2  172 ? 101.225 157.627 141.147 1.00 31.48  ? 172 THR D OG1 1 
ATOM   9499  C CG2 . THR D  2  172 ? 99.032  157.178 140.287 1.00 31.48  ? 172 THR D CG2 1 
ATOM   9500  N N   . ARG D  2  173 ? 98.287  155.182 143.298 1.00 32.42  ? 173 ARG D N   1 
ATOM   9501  C CA  . ARG D  2  173 ? 97.156  154.335 143.632 1.00 32.42  ? 173 ARG D CA  1 
ATOM   9502  C C   . ARG D  2  173 ? 97.189  154.040 145.126 1.00 32.42  ? 173 ARG D C   1 
ATOM   9503  O O   . ARG D  2  173 ? 98.028  154.567 145.858 1.00 32.42  ? 173 ARG D O   1 
ATOM   9504  C CB  . ARG D  2  173 ? 97.190  153.060 142.792 1.00 32.42  ? 173 ARG D CB  1 
ATOM   9505  C CG  . ARG D  2  173 ? 96.895  153.308 141.327 1.00 32.42  ? 173 ARG D CG  1 
ATOM   9506  C CD  . ARG D  2  173 ? 97.113  152.063 140.500 1.00 32.42  ? 173 ARG D CD  1 
ATOM   9507  N NE  . ARG D  2  173 ? 98.533  151.766 140.358 1.00 32.42  ? 173 ARG D NE  1 
ATOM   9508  C CZ  . ARG D  2  173 ? 99.010  150.646 139.832 1.00 32.42  ? 173 ARG D CZ  1 
ATOM   9509  N NH1 . ARG D  2  173 ? 98.178  149.706 139.405 1.00 32.42  ? 173 ARG D NH1 1 
ATOM   9510  N NH2 . ARG D  2  173 ? 100.318 150.462 139.737 1.00 32.42  ? 173 ARG D NH2 1 
ATOM   9511  N N   . GLU D  2  174 ? 96.260  153.212 145.587 1.00 37.70  ? 174 GLU D N   1 
ATOM   9512  C CA  . GLU D  2  174 ? 96.281  152.836 146.992 1.00 37.70  ? 174 GLU D CA  1 
ATOM   9513  C C   . GLU D  2  174 ? 97.588  152.112 147.310 1.00 37.70  ? 174 GLU D C   1 
ATOM   9514  O O   . GLU D  2  174 ? 98.059  151.298 146.508 1.00 37.70  ? 174 GLU D O   1 
ATOM   9515  C CB  . GLU D  2  174 ? 95.075  151.967 147.350 1.00 37.70  ? 174 GLU D CB  1 
ATOM   9516  C CG  . GLU D  2  174 ? 94.981  150.664 146.600 1.00 37.70  ? 174 GLU D CG  1 
ATOM   9517  C CD  . GLU D  2  174 ? 94.165  150.796 145.338 1.00 37.70  ? 174 GLU D CD  1 
ATOM   9518  O OE1 . GLU D  2  174 ? 93.900  151.943 144.927 1.00 37.70  ? 174 GLU D OE1 1 
ATOM   9519  O OE2 . GLU D  2  174 ? 93.790  149.757 144.758 1.00 37.70  ? 174 GLU D OE2 1 
ATOM   9520  N N   . PRO D  2  175 ? 98.206  152.397 148.456 1.00 43.48  ? 175 PRO D N   1 
ATOM   9521  C CA  . PRO D  2  175 ? 99.617  152.031 148.645 1.00 43.48  ? 175 PRO D CA  1 
ATOM   9522  C C   . PRO D  2  175 ? 99.918  150.554 148.502 1.00 43.48  ? 175 PRO D C   1 
ATOM   9523  O O   . PRO D  2  175 ? 101.059 150.202 148.182 1.00 43.48  ? 175 PRO D O   1 
ATOM   9524  C CB  . PRO D  2  175 ? 99.907  152.529 150.064 1.00 43.48  ? 175 PRO D CB  1 
ATOM   9525  C CG  . PRO D  2  175 ? 98.935  153.616 150.278 1.00 43.48  ? 175 PRO D CG  1 
ATOM   9526  C CD  . PRO D  2  175 ? 97.690  153.186 149.582 1.00 43.48  ? 175 PRO D CD  1 
ATOM   9527  N N   . ALA D  2  176 ? 98.948  149.672 148.729 1.00 26.34  ? 176 ALA D N   1 
ATOM   9528  C CA  . ALA D  2  176 ? 99.226  148.247 148.596 1.00 26.34  ? 176 ALA D CA  1 
ATOM   9529  C C   . ALA D  2  176 ? 99.579  147.886 147.161 1.00 26.34  ? 176 ALA D C   1 
ATOM   9530  O O   . ALA D  2  176 ? 100.444 147.038 146.921 1.00 26.34  ? 176 ALA D O   1 
ATOM   9531  C CB  . ALA D  2  176 ? 98.026  147.430 149.069 1.00 26.34  ? 176 ALA D CB  1 
ATOM   9532  N N   . ARG D  2  177 ? 98.931  148.533 146.195 1.00 30.56  ? 177 ARG D N   1 
ATOM   9533  C CA  . ARG D  2  177 ? 99.042  148.178 144.786 1.00 30.56  ? 177 ARG D CA  1 
ATOM   9534  C C   . ARG D  2  177 ? 99.853  149.195 143.989 1.00 30.56  ? 177 ARG D C   1 
ATOM   9535  O O   . ARG D  2  177 ? 99.614  149.381 142.795 1.00 30.56  ? 177 ARG D O   1 
ATOM   9536  C CB  . ARG D  2  177 ? 97.653  148.025 144.174 1.00 30.56  ? 177 ARG D CB  1 
ATOM   9537  C CG  . ARG D  2  177 ? 96.840  146.880 144.734 1.00 30.56  ? 177 ARG D CG  1 
ATOM   9538  C CD  . ARG D  2  177 ? 95.443  146.873 144.142 1.00 30.56  ? 177 ARG D CD  1 
ATOM   9539  N NE  . ARG D  2  177 ? 95.460  146.630 142.703 1.00 30.56  ? 177 ARG D NE  1 
ATOM   9540  C CZ  . ARG D  2  177 ? 95.170  147.549 141.788 1.00 30.56  ? 177 ARG D CZ  1 
ATOM   9541  N NH1 . ARG D  2  177 ? 94.840  148.776 142.162 1.00 30.56  ? 177 ARG D NH1 1 
ATOM   9542  N NH2 . ARG D  2  177 ? 95.210  147.242 140.499 1.00 30.56  ? 177 ARG D NH2 1 
ATOM   9543  N N   . SER D  2  178 ? 100.802 149.875 144.630 1.00 22.03  ? 178 SER D N   1 
ATOM   9544  C CA  . SER D  2  178 ? 101.621 150.845 143.913 1.00 22.03  ? 178 SER D CA  1 
ATOM   9545  C C   . SER D  2  178 ? 102.929 150.235 143.421 1.00 22.03  ? 178 SER D C   1 
ATOM   9546  O O   . SER D  2  178 ? 103.177 150.179 142.215 1.00 22.03  ? 178 SER D O   1 
ATOM   9547  C CB  . SER D  2  178 ? 101.896 152.057 144.801 1.00 22.03  ? 178 SER D CB  1 
ATOM   9548  O OG  . SER D  2  178 ? 100.691 152.736 145.090 1.00 22.03  ? 178 SER D OG  1 
ATOM   9549  N N   . VAL D  2  179 ? 103.768 149.761 144.336 1.00 13.32  ? 179 VAL D N   1 
ATOM   9550  C CA  . VAL D  2  179 ? 105.053 149.187 143.953 1.00 13.32  ? 179 VAL D CA  1 
ATOM   9551  C C   . VAL D  2  179 ? 104.806 147.775 143.440 1.00 13.32  ? 179 VAL D C   1 
ATOM   9552  O O   . VAL D  2  179 ? 104.608 146.847 144.224 1.00 13.32  ? 179 VAL D O   1 
ATOM   9553  C CB  . VAL D  2  179 ? 106.040 149.186 145.121 1.00 13.32  ? 179 VAL D CB  1 
ATOM   9554  C CG1 . VAL D  2  179 ? 107.338 148.537 144.698 1.00 13.32  ? 179 VAL D CG1 1 
ATOM   9555  C CG2 . VAL D  2  179 ? 106.287 150.595 145.593 1.00 13.32  ? 179 VAL D CG2 1 
ATOM   9556  N N   . VAL D  2  180 ? 104.833 147.606 142.124 1.00 12.65  ? 180 VAL D N   1 
ATOM   9557  C CA  . VAL D  2  180 ? 104.509 146.340 141.480 1.00 12.65  ? 180 VAL D CA  1 
ATOM   9558  C C   . VAL D  2  180 ? 105.786 145.716 140.946 1.00 12.65  ? 180 VAL D C   1 
ATOM   9559  O O   . VAL D  2  180 ? 106.609 146.399 140.330 1.00 12.65  ? 180 VAL D O   1 
ATOM   9560  C CB  . VAL D  2  180 ? 103.488 146.536 140.346 1.00 12.65  ? 180 VAL D CB  1 
ATOM   9561  C CG1 . VAL D  2  180 ? 103.262 145.236 139.612 1.00 12.65  ? 180 VAL D CG1 1 
ATOM   9562  C CG2 . VAL D  2  180 ? 102.184 147.054 140.900 1.00 12.65  ? 180 VAL D CG2 1 
ATOM   9563  N N   . VAL D  2  181 ? 105.949 144.417 141.174 1.00 16.29  ? 181 VAL D N   1 
ATOM   9564  C CA  . VAL D  2  181 ? 107.073 143.658 140.642 1.00 16.29  ? 181 VAL D CA  1 
ATOM   9565  C C   . VAL D  2  181 ? 106.564 142.784 139.506 1.00 16.29  ? 181 VAL D C   1 
ATOM   9566  O O   . VAL D  2  181 ? 105.437 142.280 139.554 1.00 16.29  ? 181 VAL D O   1 
ATOM   9567  C CB  . VAL D  2  181 ? 107.760 142.821 141.739 1.00 16.29  ? 181 VAL D CB  1 
ATOM   9568  C CG1 . VAL D  2  181 ? 106.816 141.770 142.286 1.00 16.29  ? 181 VAL D CG1 1 
ATOM   9569  C CG2 . VAL D  2  181 ? 109.024 142.181 141.209 1.00 16.29  ? 181 VAL D CG2 1 
ATOM   9570  N N   . ALA D  2  182 ? 107.381 142.630 138.470 1.00 33.57  ? 182 ALA D N   1 
ATOM   9571  C CA  . ALA D  2  182 ? 106.971 141.864 137.307 1.00 33.57  ? 182 ALA D CA  1 
ATOM   9572  C C   . ALA D  2  182 ? 106.903 140.378 137.643 1.00 33.57  ? 182 ALA D C   1 
ATOM   9573  O O   . ALA D  2  182 ? 107.481 139.907 138.625 1.00 33.57  ? 182 ALA D O   1 
ATOM   9574  C CB  . ALA D  2  182 ? 107.931 142.098 136.144 1.00 33.57  ? 182 ALA D CB  1 
ATOM   9575  N N   . GLU D  2  183 ? 106.183 139.634 136.803 1.00 60.40  ? 183 GLU D N   1 
ATOM   9576  C CA  . GLU D  2  183 ? 105.970 138.214 137.064 1.00 60.40  ? 183 GLU D CA  1 
ATOM   9577  C C   . GLU D  2  183 ? 107.275 137.433 136.965 1.00 60.40  ? 183 GLU D C   1 
ATOM   9578  O O   . GLU D  2  183 ? 107.733 136.837 137.945 1.00 60.40  ? 183 GLU D O   1 
ATOM   9579  C CB  . GLU D  2  183 ? 104.934 137.654 136.089 1.00 60.40  ? 183 GLU D CB  1 
ATOM   9580  C CG  . GLU D  2  183 ? 103.537 138.217 136.275 1.00 60.40  ? 183 GLU D CG  1 
ATOM   9581  C CD  . GLU D  2  183 ? 102.542 137.647 135.282 1.00 60.40  ? 183 GLU D CD  1 
ATOM   9582  O OE1 . GLU D  2  183 ? 102.965 136.900 134.376 1.00 60.40  ? 183 GLU D OE1 1 
ATOM   9583  O OE2 . GLU D  2  183 ? 101.337 137.947 135.408 1.00 60.40  ? 183 GLU D OE2 1 
ATOM   9584  N N   . ASP D  2  184 ? 107.892 137.431 135.785 1.00 71.70  ? 184 ASP D N   1 
ATOM   9585  C CA  . ASP D  2  184 ? 109.114 136.679 135.540 1.00 71.70  ? 184 ASP D CA  1 
ATOM   9586  C C   . ASP D  2  184 ? 110.354 137.563 135.522 1.00 71.70  ? 184 ASP D C   1 
ATOM   9587  O O   . ASP D  2  184 ? 111.353 137.205 134.889 1.00 71.70  ? 184 ASP D O   1 
ATOM   9588  C CB  . ASP D  2  184 ? 109.001 135.904 134.228 1.00 71.70  ? 184 ASP D CB  1 
ATOM   9589  C CG  . ASP D  2  184 ? 108.778 136.811 133.031 1.00 71.70  ? 184 ASP D CG  1 
ATOM   9590  O OD1 . ASP D  2  184 ? 108.617 138.034 133.221 1.00 71.70  ? 184 ASP D OD1 1 
ATOM   9591  O OD2 . ASP D  2  184 ? 108.770 136.297 131.893 1.00 71.70  ? 184 ASP D OD2 1 
ATOM   9592  N N   . GLY D  2  185 ? 110.313 138.709 136.191 1.00 52.00  ? 185 GLY D N   1 
ATOM   9593  C CA  . GLY D  2  185 ? 111.449 139.604 136.175 1.00 52.00  ? 185 GLY D CA  1 
ATOM   9594  C C   . GLY D  2  185 ? 112.512 139.335 137.209 1.00 52.00  ? 185 GLY D C   1 
ATOM   9595  O O   . GLY D  2  185 ? 113.585 139.938 137.149 1.00 52.00  ? 185 GLY D O   1 
ATOM   9596  N N   . SER D  2  186 ? 112.263 138.431 138.153 1.00 42.63  ? 186 SER D N   1 
ATOM   9597  C CA  . SER D  2  186 ? 113.193 138.195 139.254 1.00 42.63  ? 186 SER D CA  1 
ATOM   9598  C C   . SER D  2  186 ? 114.397 137.411 138.742 1.00 42.63  ? 186 SER D C   1 
ATOM   9599  O O   . SER D  2  186 ? 114.487 136.189 138.873 1.00 42.63  ? 186 SER D O   1 
ATOM   9600  C CB  . SER D  2  186 ? 112.495 137.462 140.391 1.00 42.63  ? 186 SER D CB  1 
ATOM   9601  O OG  . SER D  2  186 ? 113.407 137.152 141.428 1.00 42.63  ? 186 SER D OG  1 
ATOM   9602  N N   . ARG D  2  187 ? 115.351 138.135 138.152 1.00 36.63  ? 187 ARG D N   1 
ATOM   9603  C CA  . ARG D  2  187 ? 116.625 137.529 137.764 1.00 36.63  ? 187 ARG D CA  1 
ATOM   9604  C C   . ARG D  2  187 ? 117.542 137.439 138.986 1.00 36.63  ? 187 ARG D C   1 
ATOM   9605  O O   . ARG D  2  187 ? 118.620 138.025 139.064 1.00 36.63  ? 187 ARG D O   1 
ATOM   9606  C CB  . ARG D  2  187 ? 117.277 138.281 136.608 1.00 36.63  ? 187 ARG D CB  1 
ATOM   9607  C CG  . ARG D  2  187 ? 117.707 139.723 136.848 1.00 36.63  ? 187 ARG D CG  1 
ATOM   9608  C CD  . ARG D  2  187 ? 118.466 140.245 135.627 1.00 36.63  ? 187 ARG D CD  1 
ATOM   9609  N NE  . ARG D  2  187 ? 119.057 141.567 135.841 1.00 36.63  ? 187 ARG D NE  1 
ATOM   9610  C CZ  . ARG D  2  187 ? 118.496 142.715 135.479 1.00 36.63  ? 187 ARG D CZ  1 
ATOM   9611  N NH1 . ARG D  2  187 ? 119.113 143.864 135.725 1.00 36.63  ? 187 ARG D NH1 1 
ATOM   9612  N NH2 . ARG D  2  187 ? 117.336 142.715 134.847 1.00 36.63  ? 187 ARG D NH2 1 
ATOM   9613  N N   . LEU D  2  188 ? 117.080 136.657 139.956 1.00 35.87  ? 188 LEU D N   1 
ATOM   9614  C CA  . LEU D  2  188 ? 117.734 136.524 141.247 1.00 35.87  ? 188 LEU D CA  1 
ATOM   9615  C C   . LEU D  2  188 ? 117.885 135.043 141.563 1.00 35.87  ? 188 LEU D C   1 
ATOM   9616  O O   . LEU D  2  188 ? 116.940 134.270 141.382 1.00 35.87  ? 188 LEU D O   1 
ATOM   9617  C CB  . LEU D  2  188 ? 116.921 137.240 142.324 1.00 35.87  ? 188 LEU D CB  1 
ATOM   9618  C CG  . LEU D  2  188 ? 117.612 137.515 143.648 1.00 35.87  ? 188 LEU D CG  1 
ATOM   9619  C CD1 . LEU D  2  188 ? 117.009 138.734 144.299 1.00 35.87  ? 188 LEU D CD1 1 
ATOM   9620  C CD2 . LEU D  2  188 ? 117.444 136.336 144.538 1.00 35.87  ? 188 LEU D CD2 1 
ATOM   9621  N N   . ASN D  2  189 ? 119.071 134.651 142.028 1.00 34.06  ? 189 ASN D N   1 
ATOM   9622  C CA  . ASN D  2  189 ? 119.424 133.243 142.187 1.00 34.06  ? 189 ASN D CA  1 
ATOM   9623  C C   . ASN D  2  189 ? 119.486 132.779 143.639 1.00 34.06  ? 189 ASN D C   1 
ATOM   9624  O O   . ASN D  2  189 ? 118.920 131.735 143.974 1.00 34.06  ? 189 ASN D O   1 
ATOM   9625  C CB  . ASN D  2  189 ? 120.758 132.975 141.484 1.00 34.06  ? 189 ASN D CB  1 
ATOM   9626  C CG  . ASN D  2  189 ? 121.849 133.917 141.936 1.00 34.06  ? 189 ASN D CG  1 
ATOM   9627  O OD1 . ASN D  2  189 ? 121.658 134.700 142.866 1.00 34.06  ? 189 ASN D OD1 1 
ATOM   9628  N ND2 . ASN D  2  189 ? 122.993 133.866 141.266 1.00 34.06  ? 189 ASN D ND2 1 
ATOM   9629  N N   . GLN D  2  190 ? 120.158 133.528 144.513 1.00 34.36  ? 190 GLN D N   1 
ATOM   9630  C CA  . GLN D  2  190 ? 120.322 133.081 145.893 1.00 34.36  ? 190 GLN D CA  1 
ATOM   9631  C C   . GLN D  2  190 ? 119.013 133.174 146.664 1.00 34.36  ? 190 GLN D C   1 
ATOM   9632  O O   . GLN D  2  190 ? 118.490 132.168 147.155 1.00 34.36  ? 190 GLN D O   1 
ATOM   9633  C CB  . GLN D  2  190 ? 121.389 133.918 146.595 1.00 34.36  ? 190 GLN D CB  1 
ATOM   9634  C CG  . GLN D  2  190 ? 122.785 133.774 146.051 1.00 34.36  ? 190 GLN D CG  1 
ATOM   9635  C CD  . GLN D  2  190 ? 123.779 134.635 146.804 1.00 34.36  ? 190 GLN D CD  1 
ATOM   9636  O OE1 . GLN D  2  190 ? 123.408 135.377 147.712 1.00 34.36  ? 190 GLN D OE1 1 
ATOM   9637  N NE2 . GLN D  2  190 ? 125.049 134.543 146.429 1.00 34.36  ? 190 GLN D NE2 1 
ATOM   9638  N N   . TYR D  2  191 ? 118.474 134.381 146.783 1.00 30.76  ? 191 TYR D N   1 
ATOM   9639  C CA  . TYR D  2  191 ? 117.355 134.673 147.658 1.00 30.76  ? 191 TYR D CA  1 
ATOM   9640  C C   . TYR D  2  191 ? 116.032 134.332 146.979 1.00 30.76  ? 191 TYR D C   1 
ATOM   9641  O O   . TYR D  2  191 ? 115.985 133.806 145.866 1.00 30.76  ? 191 TYR D O   1 
ATOM   9642  C CB  . TYR D  2  191 ? 117.378 136.144 148.057 1.00 30.76  ? 191 TYR D CB  1 
ATOM   9643  C CG  . TYR D  2  191 ? 118.566 136.540 148.887 1.00 30.76  ? 191 TYR D CG  1 
ATOM   9644  C CD1 . TYR D  2  191 ? 119.334 135.589 149.522 1.00 30.76  ? 191 TYR D CD1 1 
ATOM   9645  C CD2 . TYR D  2  191 ? 118.921 137.867 149.029 1.00 30.76  ? 191 TYR D CD2 1 
ATOM   9646  C CE1 . TYR D  2  191 ? 120.418 135.946 150.282 1.00 30.76  ? 191 TYR D CE1 1 
ATOM   9647  C CE2 . TYR D  2  191 ? 120.005 138.234 149.788 1.00 30.76  ? 191 TYR D CE2 1 
ATOM   9648  C CZ  . TYR D  2  191 ? 120.751 137.269 150.411 1.00 30.76  ? 191 TYR D CZ  1 
ATOM   9649  O OH  . TYR D  2  191 ? 121.837 137.629 151.171 1.00 30.76  ? 191 TYR D OH  1 
ATOM   9650  N N   . ASP D  2  192 ? 114.937 134.625 147.671 1.00 30.93  ? 192 ASP D N   1 
ATOM   9651  C CA  . ASP D  2  192 ? 113.596 134.496 147.123 1.00 30.93  ? 192 ASP D CA  1 
ATOM   9652  C C   . ASP D  2  192 ? 112.805 135.731 147.515 1.00 30.93  ? 192 ASP D C   1 
ATOM   9653  O O   . ASP D  2  192 ? 112.864 136.165 148.668 1.00 30.93  ? 192 ASP D O   1 
ATOM   9654  C CB  . ASP D  2  192 ? 112.903 133.231 147.632 1.00 30.93  ? 192 ASP D CB  1 
ATOM   9655  C CG  . ASP D  2  192 ? 111.601 132.947 146.906 1.00 30.93  ? 192 ASP D CG  1 
ATOM   9656  O OD1 . ASP D  2  192 ? 111.230 133.738 146.014 1.00 30.93  ? 192 ASP D OD1 1 
ATOM   9657  O OD2 . ASP D  2  192 ? 110.946 131.932 147.228 1.00 30.93  ? 192 ASP D OD2 1 
ATOM   9658  N N   . LEU D  2  193 ? 112.074 136.296 146.561 1.00 24.61  ? 193 LEU D N   1 
ATOM   9659  C CA  . LEU D  2  193 ? 111.309 137.505 146.821 1.00 24.61  ? 193 LEU D CA  1 
ATOM   9660  C C   . LEU D  2  193 ? 109.963 137.157 147.446 1.00 24.61  ? 193 LEU D C   1 
ATOM   9661  O O   . LEU D  2  193 ? 109.360 136.127 147.138 1.00 24.61  ? 193 LEU D O   1 
ATOM   9662  C CB  . LEU D  2  193 ? 111.108 138.294 145.529 1.00 24.61  ? 193 LEU D CB  1 
ATOM   9663  C CG  . LEU D  2  193 ? 110.432 139.653 145.668 1.00 24.61  ? 193 LEU D CG  1 
ATOM   9664  C CD1 . LEU D  2  193 ? 111.278 140.553 146.536 1.00 24.61  ? 193 LEU D CD1 1 
ATOM   9665  C CD2 . LEU D  2  193 ? 110.215 140.279 144.308 1.00 24.61  ? 193 LEU D CD2 1 
ATOM   9666  N N   . LEU D  2  194 ? 109.498 138.028 148.345 1.00 26.20  ? 194 LEU D N   1 
ATOM   9667  C CA  . LEU D  2  194 ? 108.259 137.792 149.081 1.00 26.20  ? 194 LEU D CA  1 
ATOM   9668  C C   . LEU D  2  194 ? 107.180 138.816 148.758 1.00 26.20  ? 194 LEU D C   1 
ATOM   9669  O O   . LEU D  2  194 ? 106.075 138.432 148.364 1.00 26.20  ? 194 LEU D O   1 
ATOM   9670  C CB  . LEU D  2  194 ? 108.537 137.775 150.588 1.00 26.20  ? 194 LEU D CB  1 
ATOM   9671  C CG  . LEU D  2  194 ? 108.919 136.442 151.227 1.00 26.20  ? 194 LEU D CG  1 
ATOM   9672  C CD1 . LEU D  2  194 ? 107.763 135.474 151.100 1.00 26.20  ? 194 LEU D CD1 1 
ATOM   9673  C CD2 . LEU D  2  194 ? 110.171 135.856 150.614 1.00 26.20  ? 194 LEU D CD2 1 
ATOM   9674  N N   . GLY D  2  195 ? 107.454 140.101 148.921 1.00 21.53  ? 195 GLY D N   1 
ATOM   9675  C CA  . GLY D  2  195 ? 106.427 141.095 148.717 1.00 21.53  ? 195 GLY D CA  1 
ATOM   9676  C C   . GLY D  2  195 ? 106.985 142.494 148.799 1.00 21.53  ? 195 GLY D C   1 
ATOM   9677  O O   . GLY D  2  195 ? 108.184 142.714 148.630 1.00 21.53  ? 195 GLY D O   1 
ATOM   9678  N N   . GLN D  2  196 ? 106.094 143.447 149.052 1.00 16.61  ? 196 GLN D N   1 
ATOM   9679  C CA  . GLN D  2  196 ? 106.479 144.843 149.155 1.00 16.61  ? 196 GLN D CA  1 
ATOM   9680  C C   . GLN D  2  196 ? 105.787 145.478 150.347 1.00 16.61  ? 196 GLN D C   1 
ATOM   9681  O O   . GLN D  2  196 ? 104.735 145.019 150.797 1.00 16.61  ? 196 GLN D O   1 
ATOM   9682  C CB  . GLN D  2  196 ? 106.138 145.619 147.884 1.00 16.61  ? 196 GLN D CB  1 
ATOM   9683  C CG  . GLN D  2  196 ? 106.989 145.242 146.697 1.00 16.61  ? 196 GLN D CG  1 
ATOM   9684  C CD  . GLN D  2  196 ? 106.505 143.985 146.020 1.00 16.61  ? 196 GLN D CD  1 
ATOM   9685  O OE1 . GLN D  2  196 ? 105.379 143.544 146.244 1.00 16.61  ? 196 GLN D OE1 1 
ATOM   9686  N NE2 . GLN D  2  196 ? 107.351 143.399 145.184 1.00 16.61  ? 196 GLN D NE2 1 
ATOM   9687  N N   . THR D  2  197 ? 106.394 146.543 150.853 1.00 18.48  ? 197 THR D N   1 
ATOM   9688  C CA  . THR D  2  197 ? 105.858 147.288 151.980 1.00 18.48  ? 197 THR D CA  1 
ATOM   9689  C C   . THR D  2  197 ? 106.202 148.754 151.795 1.00 18.48  ? 197 THR D C   1 
ATOM   9690  O O   . THR D  2  197 ? 107.373 149.097 151.611 1.00 18.48  ? 197 THR D O   1 
ATOM   9691  C CB  . THR D  2  197 ? 106.427 146.768 153.298 1.00 18.48  ? 197 THR D CB  1 
ATOM   9692  O OG1 . THR D  2  197 ? 105.995 145.418 153.502 1.00 18.48  ? 197 THR D OG1 1 
ATOM   9693  C CG2 . THR D  2  197 ? 105.976 147.633 154.450 1.00 18.48  ? 197 THR D CG2 1 
ATOM   9694  N N   . VAL D  2  198 ? 105.191 149.613 151.840 1.00 20.33  ? 198 VAL D N   1 
ATOM   9695  C CA  . VAL D  2  198 ? 105.376 151.033 151.587 1.00 20.33  ? 198 VAL D CA  1 
ATOM   9696  C C   . VAL D  2  198 ? 104.889 151.817 152.793 1.00 20.33  ? 198 VAL D C   1 
ATOM   9697  O O   . VAL D  2  198 ? 103.963 151.402 153.495 1.00 20.33  ? 198 VAL D O   1 
ATOM   9698  C CB  . VAL D  2  198 ? 104.644 151.475 150.310 1.00 20.33  ? 198 VAL D CB  1 
ATOM   9699  C CG1 . VAL D  2  198 ? 105.235 150.778 149.116 1.00 20.33  ? 198 VAL D CG1 1 
ATOM   9700  C CG2 . VAL D  2  198 ? 103.190 151.131 150.420 1.00 20.33  ? 198 VAL D CG2 1 
ATOM   9701  N N   . ASP D  2  199 ? 105.524 152.960 153.035 1.00 21.94  ? 199 ASP D N   1 
ATOM   9702  C CA  . ASP D  2  199 ? 105.260 153.726 154.248 1.00 21.94  ? 199 ASP D CA  1 
ATOM   9703  C C   . ASP D  2  199 ? 105.715 155.160 154.047 1.00 21.94  ? 199 ASP D C   1 
ATOM   9704  O O   . ASP D  2  199 ? 106.912 155.408 153.885 1.00 21.94  ? 199 ASP D O   1 
ATOM   9705  C CB  . ASP D  2  199 ? 105.979 153.099 155.437 1.00 21.94  ? 199 ASP D CB  1 
ATOM   9706  C CG  . ASP D  2  199 ? 105.745 153.855 156.724 1.00 21.94  ? 199 ASP D CG  1 
ATOM   9707  O OD1 . ASP D  2  199 ? 104.628 153.770 157.274 1.00 21.94  ? 199 ASP D OD1 1 
ATOM   9708  O OD2 . ASP D  2  199 ? 106.685 154.531 157.190 1.00 21.94  ? 199 ASP D OD2 1 
ATOM   9709  N N   . SER D  2  200 ? 104.776 156.099 154.073 1.00 20.96  ? 200 SER D N   1 
ATOM   9710  C CA  . SER D  2  200 ? 105.137 157.504 154.010 1.00 20.96  ? 200 SER D CA  1 
ATOM   9711  C C   . SER D  2  200 ? 105.891 157.907 155.271 1.00 20.96  ? 200 SER D C   1 
ATOM   9712  O O   . SER D  2  200 ? 106.043 157.127 156.214 1.00 20.96  ? 200 SER D O   1 
ATOM   9713  C CB  . SER D  2  200 ? 103.894 158.373 153.838 1.00 20.96  ? 200 SER D CB  1 
ATOM   9714  O OG  . SER D  2  200 ? 103.253 158.102 152.605 1.00 20.96  ? 200 SER D OG  1 
ATOM   9715  N N   . GLY D  2  201 ? 106.370 159.144 155.288 1.00 19.87  ? 201 GLY D N   1 
ATOM   9716  C CA  . GLY D  2  201 ? 107.102 159.599 156.455 1.00 19.87  ? 201 GLY D CA  1 
ATOM   9717  C C   . GLY D  2  201 ? 107.493 161.052 156.327 1.00 19.87  ? 201 GLY D C   1 
ATOM   9718  O O   . GLY D  2  201 ? 107.166 161.725 155.347 1.00 19.87  ? 201 GLY D O   1 
ATOM   9719  N N   . ILE D  2  202 ? 108.195 161.530 157.351 1.00 18.74  ? 202 ILE D N   1 
ATOM   9720  C CA  . ILE D  2  202 ? 108.736 162.884 157.393 1.00 18.74  ? 202 ILE D CA  1 
ATOM   9721  C C   . ILE D  2  202 ? 110.095 162.835 158.071 1.00 18.74  ? 202 ILE D C   1 
ATOM   9722  O O   . ILE D  2  202 ? 110.229 162.272 159.161 1.00 18.74  ? 202 ILE D O   1 
ATOM   9723  C CB  . ILE D  2  202 ? 107.808 163.859 158.141 1.00 18.74  ? 202 ILE D CB  1 
ATOM   9724  C CG1 . ILE D  2  202 ? 106.523 164.088 157.353 1.00 18.74  ? 202 ILE D CG1 1 
ATOM   9725  C CG2 . ILE D  2  202 ? 108.509 165.170 158.395 1.00 18.74  ? 202 ILE D CG2 1 
ATOM   9726  C CD1 . ILE D  2  202 ? 105.471 164.813 158.134 1.00 18.74  ? 202 ILE D CD1 1 
ATOM   9727  N N   . VAL D  2  203 ? 111.105 163.420 157.421 1.00 25.91  ? 203 VAL D N   1 
ATOM   9728  C CA  . VAL D  2  203 ? 112.497 163.398 157.961 1.00 25.91  ? 203 VAL D CA  1 
ATOM   9729  C C   . VAL D  2  203 ? 112.994 164.829 158.165 1.00 25.91  ? 203 VAL D C   1 
ATOM   9730  O O   . VAL D  2  203 ? 113.251 165.497 157.160 1.00 25.91  ? 203 VAL D O   1 
ATOM   9731  C CB  . VAL D  2  203 ? 113.445 162.638 157.020 1.00 25.91  ? 203 VAL D CB  1 
ATOM   9732  C CG1 . VAL D  2  203 ? 114.810 163.298 156.962 1.00 25.91  ? 203 VAL D CG1 1 
ATOM   9733  C CG2 . VAL D  2  203 ? 113.565 161.173 157.400 1.00 25.91  ? 203 VAL D CG2 1 
ATOM   9734  N N   . GLN D  2  204 ? 113.148 165.246 159.423 1.00 41.08  ? 204 GLN D N   1 
ATOM   9735  C CA  . GLN D  2  204 ? 113.604 166.581 159.775 1.00 41.08  ? 204 GLN D CA  1 
ATOM   9736  C C   . GLN D  2  204 ? 115.124 166.626 159.749 1.00 41.08  ? 204 GLN D C   1 
ATOM   9737  O O   . GLN D  2  204 ? 115.789 165.681 160.178 1.00 41.08  ? 204 GLN D O   1 
ATOM   9738  C CB  . GLN D  2  204 ? 113.089 166.975 161.158 1.00 41.08  ? 204 GLN D CB  1 
ATOM   9739  C CG  . GLN D  2  204 ? 113.477 168.373 161.586 1.00 41.08  ? 204 GLN D CG  1 
ATOM   9740  C CD  . GLN D  2  204 ? 112.901 168.747 162.934 1.00 41.08  ? 204 GLN D CD  1 
ATOM   9741  O OE1 . GLN D  2  204 ? 112.216 167.947 163.571 1.00 41.08  ? 204 GLN D OE1 1 
ATOM   9742  N NE2 . GLN D  2  204 ? 113.179 169.966 163.380 1.00 41.08  ? 204 GLN D NE2 1 
ATOM   9743  N N   . SER D  2  205 ? 115.655 167.728 159.218 1.00 41.35  ? 205 SER D N   1 
ATOM   9744  C CA  . SER D  2  205 ? 117.124 167.891 159.102 1.00 41.35  ? 205 SER D CA  1 
ATOM   9745  C C   . SER D  2  205 ? 117.522 169.334 159.419 1.00 41.35  ? 205 SER D C   1 
ATOM   9746  O O   . SER D  2  205 ? 116.646 170.111 159.833 1.00 41.35  ? 205 SER D O   1 
ATOM   9747  C CB  . SER D  2  205 ? 117.586 167.492 157.739 1.00 41.35  ? 205 SER D CB  1 
ATOM   9748  O OG  . SER D  2  205 ? 118.967 167.191 157.770 1.00 41.35  ? 205 SER D OG  1 
ATOM   9749  N N   . SER D  2  206 ? 118.796 169.669 159.199 1.00 47.64  ? 206 SER D N   1 
ATOM   9750  C CA  . SER D  2  206 ? 119.324 171.026 159.489 1.00 47.64  ? 206 SER D CA  1 
ATOM   9751  C C   . SER D  2  206 ? 118.610 172.067 158.624 1.00 47.64  ? 206 SER D C   1 
ATOM   9752  O O   . SER D  2  206 ? 118.282 173.139 159.158 1.00 47.64  ? 206 SER D O   1 
ATOM   9753  C CB  . SER D  2  206 ? 120.805 171.068 159.275 1.00 47.64  ? 206 SER D CB  1 
ATOM   9754  O OG  . SER D  2  206 ? 121.147 170.369 158.093 1.00 47.64  ? 206 SER D OG  1 
ATOM   9755  N N   . THR D  2  207 ? 118.354 171.749 157.352 1.00 36.09  ? 207 THR D N   1 
ATOM   9756  C CA  . THR D  2  207 ? 117.672 172.713 156.445 1.00 36.09  ? 207 THR D CA  1 
ATOM   9757  C C   . THR D  2  207 ? 116.187 172.839 156.806 1.00 36.09  ? 207 THR D C   1 
ATOM   9758  O O   . THR D  2  207 ? 115.746 173.974 157.058 1.00 36.09  ? 207 THR D O   1 
ATOM   9759  C CB  . THR D  2  207 ? 117.874 172.339 154.975 1.00 36.09  ? 207 THR D CB  1 
ATOM   9760  O OG1 . THR D  2  207 ? 119.280 172.189 154.792 1.00 36.09  ? 207 THR D OG1 1 
ATOM   9761  C CG2 . THR D  2  207 ? 117.350 173.403 154.039 1.00 36.09  ? 207 THR D CG2 1 
ATOM   9762  N N   . GLY D  2  208 ? 115.445 171.729 156.829 1.00 37.91  ? 208 GLY D N   1 
ATOM   9763  C CA  . GLY D  2  208 ? 114.036 171.805 157.164 1.00 37.91  ? 208 GLY D CA  1 
ATOM   9764  C C   . GLY D  2  208 ? 113.432 170.418 157.223 1.00 37.91  ? 208 GLY D C   1 
ATOM   9765  O O   . GLY D  2  208 ? 114.144 169.423 157.358 1.00 37.91  ? 208 GLY D O   1 
ATOM   9766  N N   . GLU D  2  209 ? 112.109 170.371 157.122 1.00 38.47  ? 209 GLU D N   1 
ATOM   9767  C CA  . GLU D  2  209 ? 111.366 169.119 157.132 1.00 38.47  ? 209 GLU D CA  1 
ATOM   9768  C C   . GLU D  2  209 ? 111.058 168.714 155.698 1.00 38.47  ? 209 GLU D C   1 
ATOM   9769  O O   . GLU D  2  209 ? 110.362 169.440 154.983 1.00 38.47  ? 209 GLU D O   1 
ATOM   9770  C CB  . GLU D  2  209 ? 110.079 169.263 157.938 1.00 38.47  ? 209 GLU D CB  1 
ATOM   9771  C CG  . GLU D  2  209 ? 110.305 169.471 159.422 1.00 38.47  ? 209 GLU D CG  1 
ATOM   9772  C CD  . GLU D  2  209 ? 109.013 169.648 160.189 1.00 38.47  ? 209 GLU D CD  1 
ATOM   9773  O OE1 . GLU D  2  209 ? 107.948 169.752 159.545 1.00 38.47  ? 209 GLU D OE1 1 
ATOM   9774  O OE2 . GLU D  2  209 ? 109.062 169.677 161.437 1.00 38.47  ? 209 GLU D OE2 1 
ATOM   9775  N N   . TYR D  2  210 ? 111.566 167.548 155.297 1.00 27.15  ? 210 TYR D N   1 
ATOM   9776  C CA  . TYR D  2  210 ? 111.371 167.034 153.918 1.00 27.15  ? 210 TYR D CA  1 
ATOM   9777  C C   . TYR D  2  210 ? 110.531 165.760 153.952 1.00 27.15  ? 210 TYR D C   1 
ATOM   9778  O O   . TYR D  2  210 ? 110.726 164.946 154.861 1.00 27.15  ? 210 TYR D O   1 
ATOM   9779  C CB  . TYR D  2  210 ? 112.721 166.678 153.303 1.00 27.15  ? 210 TYR D CB  1 
ATOM   9780  C CG  . TYR D  2  210 ? 113.588 167.869 153.012 1.00 27.15  ? 210 TYR D CG  1 
ATOM   9781  C CD1 . TYR D  2  210 ? 113.553 168.484 151.777 1.00 27.15  ? 210 TYR D CD1 1 
ATOM   9782  C CD2 . TYR D  2  210 ? 114.437 168.386 153.969 1.00 27.15  ? 210 TYR D CD2 1 
ATOM   9783  C CE1 . TYR D  2  210 ? 114.346 169.580 151.496 1.00 27.15  ? 210 TYR D CE1 1 
ATOM   9784  C CE2 . TYR D  2  210 ? 115.236 169.483 153.706 1.00 27.15  ? 210 TYR D CE2 1 
ATOM   9785  C CZ  . TYR D  2  210 ? 115.191 170.081 152.464 1.00 27.15  ? 210 TYR D CZ  1 
ATOM   9786  O OH  . TYR D  2  210 ? 115.971 171.162 152.191 1.00 27.15  ? 210 TYR D OH  1 
ATOM   9787  N N   . VAL D  2  211 ? 109.666 165.590 152.954 1.00 25.52  ? 211 VAL D N   1 
ATOM   9788  C CA  . VAL D  2  211 ? 108.817 164.412 152.847 1.00 25.52  ? 211 VAL D CA  1 
ATOM   9789  C C   . VAL D  2  211 ? 109.636 163.287 152.236 1.00 25.52  ? 211 VAL D C   1 
ATOM   9790  O O   . VAL D  2  211 ? 110.506 163.518 151.395 1.00 25.52  ? 211 VAL D O   1 
ATOM   9791  C CB  . VAL D  2  211 ? 107.555 164.715 152.017 1.00 25.52  ? 211 VAL D CB  1 
ATOM   9792  C CG1 . VAL D  2  211 ? 107.926 164.988 150.583 1.00 25.52  ? 211 VAL D CG1 1 
ATOM   9793  C CG2 . VAL D  2  211 ? 106.573 163.573 152.106 1.00 25.52  ? 211 VAL D CG2 1 
ATOM   9794  N N   . VAL D  2  212 ? 109.386 162.057 152.686 1.00 43.48  ? 212 VAL D N   1 
ATOM   9795  C CA  . VAL D  2  212 ? 110.234 160.925 152.219 1.00 43.48  ? 212 VAL D CA  1 
ATOM   9796  C C   . VAL D  2  212 ? 109.432 159.634 152.097 1.00 43.48  ? 212 VAL D C   1 
ATOM   9797  O O   . VAL D  2  212 ? 109.096 159.067 153.136 1.00 43.48  ? 212 VAL D O   1 
ATOM   9798  C CB  . VAL D  2  212 ? 111.378 160.696 153.219 1.00 43.48  ? 212 VAL D CB  1 
ATOM   9799  C CG1 . VAL D  2  212 ? 111.789 159.239 153.272 1.00 43.48  ? 212 VAL D CG1 1 
ATOM   9800  C CG2 . VAL D  2  212 ? 112.568 161.594 152.950 1.00 43.48  ? 212 VAL D CG2 1 
ATOM   9801  N N   . MET D  2  213 ? 109.173 159.182 150.870 1.00 34.28  ? 213 MET D N   1 
ATOM   9802  C CA  . MET D  2  213 ? 108.521 157.904 150.642 1.00 34.28  ? 213 MET D CA  1 
ATOM   9803  C C   . MET D  2  213 ? 109.491 156.773 150.957 1.00 34.28  ? 213 MET D C   1 
ATOM   9804  O O   . MET D  2  213 ? 110.709 156.944 150.899 1.00 34.28  ? 213 MET D O   1 
ATOM   9805  C CB  . MET D  2  213 ? 108.046 157.798 149.196 1.00 34.28  ? 213 MET D CB  1 
ATOM   9806  C CG  . MET D  2  213 ? 106.964 158.786 148.812 1.00 34.28  ? 213 MET D CG  1 
ATOM   9807  S SD  . MET D  2  213 ? 105.440 158.525 149.727 1.00 34.28  ? 213 MET D SD  1 
ATOM   9808  C CE  . MET D  2  213 ? 105.512 159.868 150.904 1.00 34.28  ? 213 MET D CE  1 
ATOM   9809  N N   . THR D  2  214 ? 108.947 155.615 151.305 1.00 21.09  ? 214 THR D N   1 
ATOM   9810  C CA  . THR D  2  214 ? 109.763 154.473 151.685 1.00 21.09  ? 214 THR D CA  1 
ATOM   9811  C C   . THR D  2  214 ? 109.190 153.208 151.070 1.00 21.09  ? 214 THR D C   1 
ATOM   9812  O O   . THR D  2  214 ? 107.974 153.058 150.946 1.00 21.09  ? 214 THR D O   1 
ATOM   9813  C CB  . THR D  2  214 ? 109.837 154.325 153.207 1.00 21.09  ? 214 THR D CB  1 
ATOM   9814  O OG1 . THR D  2  214 ? 110.353 155.532 153.773 1.00 21.09  ? 214 THR D OG1 1 
ATOM   9815  C CG2 . THR D  2  214 ? 110.748 153.183 153.600 1.00 21.09  ? 214 THR D CG2 1 
ATOM   9816  N N   . THR D  2  215 ? 110.079 152.298 150.685 1.00 19.63  ? 215 THR D N   1 
ATOM   9817  C CA  . THR D  2  215 ? 109.681 150.998 150.166 1.00 19.63  ? 215 THR D CA  1 
ATOM   9818  C C   . THR D  2  215 ? 110.590 149.939 150.761 1.00 19.63  ? 215 THR D C   1 
ATOM   9819  O O   . THR D  2  215 ? 111.810 150.115 150.784 1.00 19.63  ? 215 THR D O   1 
ATOM   9820  C CB  . THR D  2  215 ? 109.762 150.963 148.641 1.00 19.63  ? 215 THR D CB  1 
ATOM   9821  O OG1 . THR D  2  215 ? 108.942 152.002 148.102 1.00 19.63  ? 215 THR D OG1 1 
ATOM   9822  C CG2 . THR D  2  215 ? 109.267 149.637 148.121 1.00 19.63  ? 215 THR D CG2 1 
ATOM   9823  N N   . HIS D  2  216 ? 110.004 148.849 151.245 1.00 20.95  ? 216 HIS D N   1 
ATOM   9824  C CA  . HIS D  2  216 ? 110.755 147.733 151.803 1.00 20.95  ? 216 HIS D CA  1 
ATOM   9825  C C   . HIS D  2  216 ? 110.508 146.499 150.953 1.00 20.95  ? 216 HIS D C   1 
ATOM   9826  O O   . HIS D  2  216 ? 109.358 146.088 150.773 1.00 20.95  ? 216 HIS D O   1 
ATOM   9827  C CB  . HIS D  2  216 ? 110.357 147.461 153.253 1.00 20.95  ? 216 HIS D CB  1 
ATOM   9828  C CG  . HIS D  2  216 ? 110.834 148.495 154.222 1.00 20.95  ? 216 HIS D CG  1 
ATOM   9829  N ND1 . HIS D  2  216 ? 110.101 149.618 154.533 1.00 20.95  ? 216 HIS D ND1 1 
ATOM   9830  C CD2 . HIS D  2  216 ? 111.961 148.563 154.966 1.00 20.95  ? 216 HIS D CD2 1 
ATOM   9831  C CE1 . HIS D  2  216 ? 110.762 150.340 155.420 1.00 20.95  ? 216 HIS D CE1 1 
ATOM   9832  N NE2 . HIS D  2  216 ? 111.895 149.723 155.698 1.00 20.95  ? 216 HIS D NE2 1 
ATOM   9833  N N   . PHE D  2  217 ? 111.580 145.912 150.435 1.00 21.25  ? 217 PHE D N   1 
ATOM   9834  C CA  . PHE D  2  217 ? 111.521 144.628 149.751 1.00 21.25  ? 217 PHE D CA  1 
ATOM   9835  C C   . PHE D  2  217 ? 112.017 143.560 150.711 1.00 21.25  ? 217 PHE D C   1 
ATOM   9836  O O   . PHE D  2  217 ? 113.075 143.723 151.325 1.00 21.25  ? 217 PHE D O   1 
ATOM   9837  C CB  . PHE D  2  217 ? 112.381 144.633 148.489 1.00 21.25  ? 217 PHE D CB  1 
ATOM   9838  C CG  . PHE D  2  217 ? 111.932 145.614 147.452 1.00 21.25  ? 217 PHE D CG  1 
ATOM   9839  C CD1 . PHE D  2  217 ? 110.891 145.318 146.597 1.00 21.25  ? 217 PHE D CD1 1 
ATOM   9840  C CD2 . PHE D  2  217 ? 112.556 146.834 147.331 1.00 21.25  ? 217 PHE D CD2 1 
ATOM   9841  C CE1 . PHE D  2  217 ? 110.483 146.225 145.644 1.00 21.25  ? 217 PHE D CE1 1 
ATOM   9842  C CE2 . PHE D  2  217 ? 112.153 147.741 146.383 1.00 21.25  ? 217 PHE D CE2 1 
ATOM   9843  C CZ  . PHE D  2  217 ? 111.116 147.438 145.539 1.00 21.25  ? 217 PHE D CZ  1 
ATOM   9844  N N   . HIS D  2  218 ? 111.259 142.478 150.845 1.00 22.67  ? 218 HIS D N   1 
ATOM   9845  C CA  . HIS D  2  218 ? 111.604 141.407 151.769 1.00 22.67  ? 218 HIS D CA  1 
ATOM   9846  C C   . HIS D  2  218 ? 112.344 140.298 151.035 1.00 22.67  ? 218 HIS D C   1 
ATOM   9847  O O   . HIS D  2  218 ? 112.067 140.021 149.865 1.00 22.67  ? 218 HIS D O   1 
ATOM   9848  C CB  . HIS D  2  218 ? 110.356 140.850 152.447 1.00 22.67  ? 218 HIS D CB  1 
ATOM   9849  C CG  . HIS D  2  218 ? 109.640 141.849 153.296 1.00 22.67  ? 218 HIS D CG  1 
ATOM   9850  N ND1 . HIS D  2  218 ? 110.134 142.288 154.504 1.00 22.67  ? 218 HIS D ND1 1 
ATOM   9851  C CD2 . HIS D  2  218 ? 108.461 142.486 153.118 1.00 22.67  ? 218 HIS D CD2 1 
ATOM   9852  C CE1 . HIS D  2  218 ? 109.293 143.159 155.031 1.00 22.67  ? 218 HIS D CE1 1 
ATOM   9853  N NE2 . HIS D  2  218 ? 108.269 143.297 154.210 1.00 22.67  ? 218 HIS D NE2 1 
ATOM   9854  N N   . LEU D  2  219 ? 113.292 139.672 151.727 1.00 27.70  ? 219 LEU D N   1 
ATOM   9855  C CA  . LEU D  2  219 ? 114.130 138.640 151.138 1.00 27.70  ? 219 LEU D CA  1 
ATOM   9856  C C   . LEU D  2  219 ? 114.350 137.528 152.151 1.00 27.70  ? 219 LEU D C   1 
ATOM   9857  O O   . LEU D  2  219 ? 114.445 137.775 153.355 1.00 27.70  ? 219 LEU D O   1 
ATOM   9858  C CB  . LEU D  2  219 ? 115.479 139.206 150.688 1.00 27.70  ? 219 LEU D CB  1 
ATOM   9859  C CG  . LEU D  2  219 ? 115.431 140.237 149.565 1.00 27.70  ? 219 LEU D CG  1 
ATOM   9860  C CD1 . LEU D  2  219 ? 116.799 140.833 149.319 1.00 27.70  ? 219 LEU D CD1 1 
ATOM   9861  C CD2 . LEU D  2  219 ? 114.899 139.599 148.308 1.00 27.70  ? 219 LEU D CD2 1 
ATOM   9862  N N   . LYS D  2  220 ? 114.434 136.297 151.652 1.00 28.30  ? 220 LYS D N   1 
ATOM   9863  C CA  . LYS D  2  220 ? 114.692 135.132 152.490 1.00 28.30  ? 220 LYS D CA  1 
ATOM   9864  C C   . LYS D  2  220 ? 115.655 134.214 151.758 1.00 28.30  ? 220 LYS D C   1 
ATOM   9865  O O   . LYS D  2  220 ? 115.370 133.785 150.637 1.00 28.30  ? 220 LYS D O   1 
ATOM   9866  C CB  . LYS D  2  220 ? 113.397 134.393 152.828 1.00 28.30  ? 220 LYS D CB  1 
ATOM   9867  C CG  . LYS D  2  220 ? 113.601 133.203 153.741 1.00 28.30  ? 220 LYS D CG  1 
ATOM   9868  C CD  . LYS D  2  220 ? 112.280 132.587 154.155 1.00 28.30  ? 220 LYS D CD  1 
ATOM   9869  C CE  . LYS D  2  220 ? 112.508 131.322 154.957 1.00 28.30  ? 220 LYS D CE  1 
ATOM   9870  N NZ  . LYS D  2  220 ? 113.187 131.614 156.248 1.00 28.30  ? 220 LYS D NZ  1 
ATOM   9871  N N   . ARG D  2  221 ? 116.784 133.911 152.391 1.00 31.20  ? 221 ARG D N   1 
ATOM   9872  C CA  . ARG D  2  221 ? 117.820 133.118 151.744 1.00 31.20  ? 221 ARG D CA  1 
ATOM   9873  C C   . ARG D  2  221 ? 117.375 131.672 151.579 1.00 31.20  ? 221 ARG D C   1 
ATOM   9874  O O   . ARG D  2  221 ? 116.676 131.121 152.432 1.00 31.20  ? 221 ARG D O   1 
ATOM   9875  C CB  . ARG D  2  221 ? 119.109 133.179 152.560 1.00 31.20  ? 221 ARG D CB  1 
ATOM   9876  C CG  . ARG D  2  221 ? 120.295 132.502 151.907 1.00 31.20  ? 221 ARG D CG  1 
ATOM   9877  C CD  . ARG D  2  221 ? 121.521 132.588 152.788 1.00 31.20  ? 221 ARG D CD  1 
ATOM   9878  N NE  . ARG D  2  221 ? 121.987 133.958 152.941 1.00 31.20  ? 221 ARG D NE  1 
ATOM   9879  C CZ  . ARG D  2  221 ? 122.808 134.557 152.089 1.00 31.20  ? 221 ARG D CZ  1 
ATOM   9880  N NH1 . ARG D  2  221 ? 123.248 133.901 151.025 1.00 31.20  ? 221 ARG D NH1 1 
ATOM   9881  N NH2 . ARG D  2  221 ? 123.187 135.808 152.297 1.00 31.20  ? 221 ARG D NH2 1 
ATOM   9882  N N   . LYS D  2  222 ? 117.777 131.057 150.470 1.00 37.27  ? 222 LYS D N   1 
ATOM   9883  C CA  . LYS D  2  222 ? 117.507 129.645 150.240 1.00 37.27  ? 222 LYS D CA  1 
ATOM   9884  C C   . LYS D  2  222 ? 118.622 128.793 150.825 1.00 37.27  ? 222 LYS D C   1 
ATOM   9885  O O   . LYS D  2  222 ? 119.805 129.114 150.689 1.00 37.27  ? 222 LYS D O   1 
ATOM   9886  C CB  . LYS D  2  222 ? 117.350 129.336 148.751 1.00 37.27  ? 222 LYS D CB  1 
ATOM   9887  C CG  . LYS D  2  222 ? 116.072 129.866 148.139 1.00 37.27  ? 222 LYS D CG  1 
ATOM   9888  C CD  . LYS D  2  222 ? 115.823 129.250 146.775 1.00 37.27  ? 222 LYS D CD  1 
ATOM   9889  C CE  . LYS D  2  222 ? 116.781 129.784 145.732 1.00 37.27  ? 222 LYS D CE  1 
ATOM   9890  N NZ  . LYS D  2  222 ? 116.453 129.265 144.378 1.00 37.27  ? 222 LYS D NZ  1 
ATOM   9891  N N   . ILE D  2  223 ? 118.229 127.698 151.475 1.00 46.13  ? 223 ILE D N   1 
ATOM   9892  C CA  . ILE D  2  223 ? 119.165 126.851 152.205 1.00 46.13  ? 223 ILE D CA  1 
ATOM   9893  C C   . ILE D  2  223 ? 119.463 125.546 151.477 1.00 46.13  ? 223 ILE D C   1 
ATOM   9894  O O   . ILE D  2  223 ? 120.374 124.808 151.895 1.00 46.13  ? 223 ILE D O   1 
ATOM   9895  C CB  . ILE D  2  223 ? 118.621 126.563 153.620 1.00 46.13  ? 223 ILE D CB  1 
ATOM   9896  C CG1 . ILE D  2  223 ? 119.723 126.053 154.540 1.00 46.13  ? 223 ILE D CG1 1 
ATOM   9897  C CG2 . ILE D  2  223 ? 117.480 125.570 153.551 1.00 46.13  ? 223 ILE D CG2 1 
ATOM   9898  C CD1 . ILE D  2  223 ? 119.329 126.053 155.981 1.00 46.13  ? 223 ILE D CD1 1 
ATOM   9899  N N   . GLY D  2  224 ? 118.738 125.245 150.398 1.00 48.46  ? 224 GLY D N   1 
ATOM   9900  C CA  . GLY D  2  224 ? 118.893 123.957 149.742 1.00 48.46  ? 224 GLY D CA  1 
ATOM   9901  C C   . GLY D  2  224 ? 120.311 123.685 149.280 1.00 48.46  ? 224 GLY D C   1 
ATOM   9902  O O   . GLY D  2  224 ? 120.780 122.547 149.328 1.00 48.46  ? 224 GLY D O   1 
ATOM   9903  N N   . TYR D  2  225 ? 121.013 124.721 148.825 1.00 57.73  ? 225 TYR D N   1 
ATOM   9904  C CA  . TYR D  2  225 ? 122.388 124.529 148.382 1.00 57.73  ? 225 TYR D CA  1 
ATOM   9905  C C   . TYR D  2  225 ? 123.307 124.227 149.557 1.00 57.73  ? 225 TYR D C   1 
ATOM   9906  O O   . TYR D  2  225 ? 124.134 123.309 149.495 1.00 57.73  ? 225 TYR D O   1 
ATOM   9907  C CB  . TYR D  2  225 ? 122.875 125.761 147.628 1.00 57.73  ? 225 TYR D CB  1 
ATOM   9908  C CG  . TYR D  2  225 ? 124.307 125.661 147.165 1.00 57.73  ? 225 TYR D CG  1 
ATOM   9909  C CD1 . TYR D  2  225 ? 124.659 124.844 146.103 1.00 57.73  ? 225 TYR D CD1 1 
ATOM   9910  C CD2 . TYR D  2  225 ? 125.305 126.394 147.783 1.00 57.73  ? 225 TYR D CD2 1 
ATOM   9911  C CE1 . TYR D  2  225 ? 125.968 124.754 145.676 1.00 57.73  ? 225 TYR D CE1 1 
ATOM   9912  C CE2 . TYR D  2  225 ? 126.614 126.313 147.366 1.00 57.73  ? 225 TYR D CE2 1 
ATOM   9913  C CZ  . TYR D  2  225 ? 126.940 125.491 146.312 1.00 57.73  ? 225 TYR D CZ  1 
ATOM   9914  O OH  . TYR D  2  225 ? 128.246 125.407 145.890 1.00 57.73  ? 225 TYR D OH  1 
ATOM   9915  N N   . PHE D  2  226 ? 123.176 124.989 150.641 1.00 51.56  ? 226 PHE D N   1 
ATOM   9916  C CA  . PHE D  2  226 ? 124.068 124.799 151.775 1.00 51.56  ? 226 PHE D CA  1 
ATOM   9917  C C   . PHE D  2  226 ? 123.786 123.500 152.512 1.00 51.56  ? 226 PHE D C   1 
ATOM   9918  O O   . PHE D  2  226 ? 124.651 123.026 153.253 1.00 51.56  ? 226 PHE D O   1 
ATOM   9919  C CB  . PHE D  2  226 ? 123.959 125.987 152.725 1.00 51.56  ? 226 PHE D CB  1 
ATOM   9920  C CG  . PHE D  2  226 ? 124.422 127.279 152.122 1.00 51.56  ? 226 PHE D CG  1 
ATOM   9921  C CD1 . PHE D  2  226 ? 125.214 127.286 150.993 1.00 51.56  ? 226 PHE D CD1 1 
ATOM   9922  C CD2 . PHE D  2  226 ? 124.046 128.484 152.668 1.00 51.56  ? 226 PHE D CD2 1 
ATOM   9923  C CE1 . PHE D  2  226 ? 125.632 128.471 150.430 1.00 51.56  ? 226 PHE D CE1 1 
ATOM   9924  C CE2 . PHE D  2  226 ? 124.462 129.673 152.110 1.00 51.56  ? 226 PHE D CE2 1 
ATOM   9925  C CZ  . PHE D  2  226 ? 125.255 129.666 150.990 1.00 51.56  ? 226 PHE D CZ  1 
ATOM   9926  N N   . VAL D  2  227 ? 122.603 122.912 152.325 1.00 53.81  ? 227 VAL D N   1 
ATOM   9927  C CA  . VAL D  2  227 ? 122.336 121.608 152.925 1.00 53.81  ? 227 VAL D CA  1 
ATOM   9928  C C   . VAL D  2  227 ? 123.237 120.545 152.313 1.00 53.81  ? 227 VAL D C   1 
ATOM   9929  O O   . VAL D  2  227 ? 123.906 119.792 153.029 1.00 53.81  ? 227 VAL D O   1 
ATOM   9930  C CB  . VAL D  2  227 ? 120.852 121.236 152.786 1.00 53.81  ? 227 VAL D CB  1 
ATOM   9931  C CG1 . VAL D  2  227 ? 120.641 119.797 153.203 1.00 53.81  ? 227 VAL D CG1 1 
ATOM   9932  C CG2 . VAL D  2  227 ? 120.010 122.150 153.647 1.00 53.81  ? 227 VAL D CG2 1 
ATOM   9933  N N   . ILE D  2  228 ? 123.269 120.459 150.978 1.00 55.10  ? 228 ILE D N   1 
ATOM   9934  C CA  . ILE D  2  228 ? 124.159 119.506 150.317 1.00 55.10  ? 228 ILE D CA  1 
ATOM   9935  C C   . ILE D  2  228 ? 125.580 120.021 150.195 1.00 55.10  ? 228 ILE D C   1 
ATOM   9936  O O   . ILE D  2  228 ? 126.441 119.307 149.667 1.00 55.10  ? 228 ILE D O   1 
ATOM   9937  C CB  . ILE D  2  228 ? 123.678 119.125 148.903 1.00 55.10  ? 228 ILE D CB  1 
ATOM   9938  C CG1 . ILE D  2  228 ? 123.691 120.343 147.985 1.00 55.10  ? 228 ILE D CG1 1 
ATOM   9939  C CG2 . ILE D  2  228 ? 122.289 118.538 148.954 1.00 55.10  ? 228 ILE D CG2 1 
ATOM   9940  C CD1 . ILE D  2  228 ? 123.420 120.008 146.539 1.00 55.10  ? 228 ILE D CD1 1 
ATOM   9941  N N   . GLN D  2  229 ? 125.855 121.240 150.657 1.00 61.51  ? 229 GLN D N   1 
ATOM   9942  C CA  . GLN D  2  229 ? 127.206 121.783 150.573 1.00 61.51  ? 229 GLN D CA  1 
ATOM   9943  C C   . GLN D  2  229 ? 128.029 121.498 151.828 1.00 61.51  ? 229 GLN D C   1 
ATOM   9944  O O   . GLN D  2  229 ? 129.105 120.899 151.744 1.00 61.51  ? 229 GLN D O   1 
ATOM   9945  C CB  . GLN D  2  229 ? 127.147 123.287 150.300 1.00 61.51  ? 229 GLN D CB  1 
ATOM   9946  C CG  . GLN D  2  229 ? 128.509 123.936 150.187 1.00 61.51  ? 229 GLN D CG  1 
ATOM   9947  C CD  . GLN D  2  229 ? 129.314 123.393 149.029 1.00 61.51  ? 229 GLN D CD  1 
ATOM   9948  O OE1 . GLN D  2  229 ? 128.779 123.137 147.951 1.00 61.51  ? 229 GLN D OE1 1 
ATOM   9949  N NE2 . GLN D  2  229 ? 130.612 123.221 149.244 1.00 61.51  ? 229 GLN D NE2 1 
ATOM   9950  N N   . THR D  2  230 ? 127.545 121.922 152.995 1.00 58.22  ? 230 THR D N   1 
ATOM   9951  C CA  . THR D  2  230 ? 128.343 121.852 154.214 1.00 58.22  ? 230 THR D CA  1 
ATOM   9952  C C   . THR D  2  230 ? 127.715 121.014 155.316 1.00 58.22  ? 230 THR D C   1 
ATOM   9953  O O   . THR D  2  230 ? 128.407 120.188 155.921 1.00 58.22  ? 230 THR D O   1 
ATOM   9954  C CB  . THR D  2  230 ? 128.620 123.265 154.741 1.00 58.22  ? 230 THR D CB  1 
ATOM   9955  O OG1 . THR D  2  230 ? 129.374 123.994 153.766 1.00 58.22  ? 230 THR D OG1 1 
ATOM   9956  C CG2 . THR D  2  230 ? 129.406 123.198 156.036 1.00 58.22  ? 230 THR D CG2 1 
ATOM   9957  N N   . TYR D  2  231 ? 126.429 121.211 155.614 1.00 59.23  ? 231 TYR D N   1 
ATOM   9958  C CA  . TYR D  2  231 ? 125.829 120.563 156.779 1.00 59.23  ? 231 TYR D CA  1 
ATOM   9959  C C   . TYR D  2  231 ? 125.852 119.044 156.661 1.00 59.23  ? 231 TYR D C   1 
ATOM   9960  O O   . TYR D  2  231 ? 126.199 118.342 157.621 1.00 59.23  ? 231 TYR D O   1 
ATOM   9961  C CB  . TYR D  2  231 ? 124.399 121.059 156.975 1.00 59.23  ? 231 TYR D CB  1 
ATOM   9962  C CG  . TYR D  2  231 ? 124.314 122.478 157.476 1.00 59.23  ? 231 TYR D CG  1 
ATOM   9963  C CD1 . TYR D  2  231 ? 124.431 122.761 158.826 1.00 59.23  ? 231 TYR D CD1 1 
ATOM   9964  C CD2 . TYR D  2  231 ? 124.131 123.533 156.603 1.00 59.23  ? 231 TYR D CD2 1 
ATOM   9965  C CE1 . TYR D  2  231 ? 124.358 124.053 159.293 1.00 59.23  ? 231 TYR D CE1 1 
ATOM   9966  C CE2 . TYR D  2  231 ? 124.059 124.829 157.060 1.00 59.23  ? 231 TYR D CE2 1 
ATOM   9967  C CZ  . TYR D  2  231 ? 124.173 125.082 158.405 1.00 59.23  ? 231 TYR D CZ  1 
ATOM   9968  O OH  . TYR D  2  231 ? 124.101 126.374 158.865 1.00 59.23  ? 231 TYR D OH  1 
ATOM   9969  N N   . LEU D  2  232 ? 125.489 118.520 155.503 1.00 55.96  ? 232 LEU D N   1 
ATOM   9970  C CA  . LEU D  2  232 ? 125.387 117.078 155.339 1.00 55.96  ? 232 LEU D CA  1 
ATOM   9971  C C   . LEU D  2  232 ? 126.765 116.414 155.354 1.00 55.96  ? 232 LEU D C   1 
ATOM   9972  O O   . LEU D  2  232 ? 126.902 115.324 155.923 1.00 55.96  ? 232 LEU D O   1 
ATOM   9973  C CB  . LEU D  2  232 ? 124.624 116.746 154.058 1.00 55.96  ? 232 LEU D CB  1 
ATOM   9974  C CG  . LEU D  2  232 ? 124.236 115.286 153.874 1.00 55.96  ? 232 LEU D CG  1 
ATOM   9975  C CD1 . LEU D  2  232 ? 123.322 114.853 154.999 1.00 55.96  ? 232 LEU D CD1 1 
ATOM   9976  C CD2 . LEU D  2  232 ? 123.541 115.122 152.545 1.00 55.96  ? 232 LEU D CD2 1 
ATOM   9977  N N   . PRO D  2  233 ? 127.808 117.007 154.752 1.00 50.71  ? 233 PRO D N   1 
ATOM   9978  C CA  . PRO D  2  233 ? 129.156 116.454 154.971 1.00 50.71  ? 233 PRO D CA  1 
ATOM   9979  C C   . PRO D  2  233 ? 129.584 116.472 156.424 1.00 50.71  ? 233 PRO D C   1 
ATOM   9980  O O   . PRO D  2  233 ? 130.220 115.518 156.879 1.00 50.71  ? 233 PRO D O   1 
ATOM   9981  C CB  . PRO D  2  233 ? 130.045 117.346 154.100 1.00 50.71  ? 233 PRO D CB  1 
ATOM   9982  C CG  . PRO D  2  233 ? 129.152 117.807 153.028 1.00 50.71  ? 233 PRO D CG  1 
ATOM   9983  C CD  . PRO D  2  233 ? 127.816 118.006 153.668 1.00 50.71  ? 233 PRO D CD  1 
ATOM   9984  N N   . CYS D  2  234 ? 129.269 117.532 157.168 1.00 59.88  ? 234 CYS D N   1 
ATOM   9985  C CA  . CYS D  2  234 ? 129.511 117.516 158.607 1.00 59.88  ? 234 CYS D CA  1 
ATOM   9986  C C   . CYS D  2  234 ? 128.841 116.333 159.289 1.00 59.88  ? 234 CYS D C   1 
ATOM   9987  O O   . CYS D  2  234 ? 129.465 115.631 160.093 1.00 59.88  ? 234 CYS D O   1 
ATOM   9988  C CB  . CYS D  2  234 ? 129.023 118.811 159.243 1.00 59.88  ? 234 CYS D CB  1 
ATOM   9989  S SG  . CYS D  2  234 ? 128.723 118.636 161.030 1.00 59.88  ? 234 CYS D SG  1 
ATOM   9990  N N   . ILE D  2  235 ? 127.547 116.135 159.033 1.00 55.66  ? 235 ILE D N   1 
ATOM   9991  C CA  . ILE D  2  235 ? 126.830 115.060 159.712 1.00 55.66  ? 235 ILE D CA  1 
ATOM   9992  C C   . ILE D  2  235 ? 127.420 113.707 159.333 1.00 55.66  ? 235 ILE D C   1 
ATOM   9993  O O   . ILE D  2  235 ? 127.594 112.824 160.185 1.00 55.66  ? 235 ILE D O   1 
ATOM   9994  C CB  . ILE D  2  235 ? 125.326 115.141 159.400 1.00 55.66  ? 235 ILE D CB  1 
ATOM   9995  C CG1 . ILE D  2  235 ? 124.761 116.467 159.900 1.00 55.66  ? 235 ILE D CG1 1 
ATOM   9996  C CG2 . ILE D  2  235 ? 124.592 113.998 160.054 1.00 55.66  ? 235 ILE D CG2 1 
ATOM   9997  C CD1 . ILE D  2  235 ? 123.358 116.743 159.433 1.00 55.66  ? 235 ILE D CD1 1 
ATOM   9998  N N   . MET D  2  236 ? 127.767 113.533 158.055 1.00 54.36  ? 236 MET D N   1 
ATOM   9999  C CA  . MET D  2  236 ? 128.404 112.292 157.627 1.00 54.36  ? 236 MET D CA  1 
ATOM   10000 C C   . MET D  2  236 ? 129.745 112.089 158.321 1.00 54.36  ? 236 MET D C   1 
ATOM   10001 O O   . MET D  2  236 ? 130.066 110.975 158.749 1.00 54.36  ? 236 MET D O   1 
ATOM   10002 C CB  . MET D  2  236 ? 128.583 112.288 156.109 1.00 54.36  ? 236 MET D CB  1 
ATOM   10003 C CG  . MET D  2  236 ? 127.291 112.202 155.314 1.00 54.36  ? 236 MET D CG  1 
ATOM   10004 S SD  . MET D  2  236 ? 126.395 110.661 155.575 1.00 54.36  ? 236 MET D SD  1 
ATOM   10005 C CE  . MET D  2  236 ? 125.080 111.203 156.663 1.00 54.36  ? 236 MET D CE  1 
ATOM   10006 N N   . THR D  2  237 ? 130.540 113.152 158.450 1.00 51.64  ? 237 THR D N   1 
ATOM   10007 C CA  . THR D  2  237 ? 131.849 113.021 159.080 1.00 51.64  ? 237 THR D CA  1 
ATOM   10008 C C   . THR D  2  237 ? 131.721 112.677 160.557 1.00 51.64  ? 237 THR D C   1 
ATOM   10009 O O   . THR D  2  237 ? 132.487 111.859 161.076 1.00 51.64  ? 237 THR D O   1 
ATOM   10010 C CB  . THR D  2  237 ? 132.650 114.307 158.895 1.00 51.64  ? 237 THR D CB  1 
ATOM   10011 O OG1 . THR D  2  237 ? 132.867 114.536 157.498 1.00 51.64  ? 237 THR D OG1 1 
ATOM   10012 C CG2 . THR D  2  237 ? 133.989 114.210 159.596 1.00 51.64  ? 237 THR D CG2 1 
ATOM   10013 N N   . VAL D  2  238 ? 130.757 113.282 161.251 1.00 52.76  ? 238 VAL D N   1 
ATOM   10014 C CA  . VAL D  2  238 ? 130.556 112.961 162.663 1.00 52.76  ? 238 VAL D CA  1 
ATOM   10015 C C   . VAL D  2  238 ? 130.103 111.514 162.823 1.00 52.76  ? 238 VAL D C   1 
ATOM   10016 O O   . VAL D  2  238 ? 130.600 110.780 163.690 1.00 52.76  ? 238 VAL D O   1 
ATOM   10017 C CB  . VAL D  2  238 ? 129.560 113.939 163.307 1.00 52.76  ? 238 VAL D CB  1 
ATOM   10018 C CG1 . VAL D  2  238 ? 129.187 113.463 164.702 1.00 52.76  ? 238 VAL D CG1 1 
ATOM   10019 C CG2 . VAL D  2  238 ? 130.169 115.316 163.382 1.00 52.76  ? 238 VAL D CG2 1 
ATOM   10020 N N   . ILE D  2  239 ? 129.148 111.081 161.996 1.00 55.67  ? 239 ILE D N   1 
ATOM   10021 C CA  . ILE D  2  239 ? 128.702 109.692 162.069 1.00 55.67  ? 239 ILE D CA  1 
ATOM   10022 C C   . ILE D  2  239 ? 129.861 108.748 161.785 1.00 55.67  ? 239 ILE D C   1 
ATOM   10023 O O   . ILE D  2  239 ? 129.990 107.693 162.418 1.00 55.67  ? 239 ILE D O   1 
ATOM   10024 C CB  . ILE D  2  239 ? 127.520 109.451 161.113 1.00 55.67  ? 239 ILE D CB  1 
ATOM   10025 C CG1 . ILE D  2  239 ? 126.294 110.231 161.585 1.00 55.67  ? 239 ILE D CG1 1 
ATOM   10026 C CG2 . ILE D  2  239 ? 127.195 107.973 161.016 1.00 55.67  ? 239 ILE D CG2 1 
ATOM   10027 C CD1 . ILE D  2  239 ? 125.154 110.226 160.595 1.00 55.67  ? 239 ILE D CD1 1 
ATOM   10028 N N   . LEU D  2  240 ? 130.735 109.118 160.850 1.00 60.81  ? 240 LEU D N   1 
ATOM   10029 C CA  . LEU D  2  240 ? 131.886 108.277 160.546 1.00 60.81  ? 240 LEU D CA  1 
ATOM   10030 C C   . LEU D  2  240 ? 132.864 108.236 161.713 1.00 60.81  ? 240 LEU D C   1 
ATOM   10031 O O   . LEU D  2  240 ? 133.434 107.183 162.016 1.00 60.81  ? 240 LEU D O   1 
ATOM   10032 C CB  . LEU D  2  240 ? 132.575 108.784 159.283 1.00 60.81  ? 240 LEU D CB  1 
ATOM   10033 C CG  . LEU D  2  240 ? 133.743 107.925 158.823 1.00 60.81  ? 240 LEU D CG  1 
ATOM   10034 C CD1 . LEU D  2  240 ? 133.238 106.529 158.548 1.00 60.81  ? 240 LEU D CD1 1 
ATOM   10035 C CD2 . LEU D  2  240 ? 134.386 108.514 157.584 1.00 60.81  ? 240 LEU D CD2 1 
ATOM   10036 N N   . SER D  2  241 ? 133.070 109.370 162.380 1.00 60.36  ? 241 SER D N   1 
ATOM   10037 C CA  . SER D  2  241 ? 133.989 109.400 163.511 1.00 60.36  ? 241 SER D CA  1 
ATOM   10038 C C   . SER D  2  241 ? 133.445 108.613 164.693 1.00 60.36  ? 241 SER D C   1 
ATOM   10039 O O   . SER D  2  241 ? 134.221 108.115 165.515 1.00 60.36  ? 241 SER D O   1 
ATOM   10040 C CB  . SER D  2  241 ? 134.282 110.842 163.917 1.00 60.36  ? 241 SER D CB  1 
ATOM   10041 O OG  . SER D  2  241 ? 133.115 111.481 164.402 1.00 60.36  ? 241 SER D OG  1 
ATOM   10042 N N   . GLN D  2  242 ? 132.122 108.499 164.805 1.00 69.03  ? 242 GLN D N   1 
ATOM   10043 C CA  . GLN D  2  242 ? 131.558 107.638 165.839 1.00 69.03  ? 242 GLN D CA  1 
ATOM   10044 C C   . GLN D  2  242 ? 131.657 106.152 165.509 1.00 69.03  ? 242 GLN D C   1 
ATOM   10045 O O   . GLN D  2  242 ? 131.291 105.327 166.352 1.00 69.03  ? 242 GLN D O   1 
ATOM   10046 C CB  . GLN D  2  242 ? 130.094 107.986 166.111 1.00 69.03  ? 242 GLN D CB  1 
ATOM   10047 C CG  . GLN D  2  242 ? 129.887 109.269 166.896 1.00 69.03  ? 242 GLN D CG  1 
ATOM   10048 C CD  . GLN D  2  242 ? 128.426 109.508 167.225 1.00 69.03  ? 242 GLN D CD  1 
ATOM   10049 O OE1 . GLN D  2  242 ? 127.552 108.764 166.781 1.00 69.03  ? 242 GLN D OE1 1 
ATOM   10050 N NE2 . GLN D  2  242 ? 128.155 110.538 168.019 1.00 69.03  ? 242 GLN D NE2 1 
ATOM   10051 N N   . VAL D  2  243 ? 132.127 105.788 164.313 1.00 73.30  ? 243 VAL D N   1 
ATOM   10052 C CA  . VAL D  2  243 ? 132.253 104.376 163.968 1.00 73.30  ? 243 VAL D CA  1 
ATOM   10053 C C   . VAL D  2  243 ? 133.404 103.716 164.716 1.00 73.30  ? 243 VAL D C   1 
ATOM   10054 O O   . VAL D  2  243 ? 133.371 102.502 164.949 1.00 73.30  ? 243 VAL D O   1 
ATOM   10055 C CB  . VAL D  2  243 ? 132.421 104.217 162.445 1.00 73.30  ? 243 VAL D CB  1 
ATOM   10056 C CG1 . VAL D  2  243 ? 132.592 102.755 162.060 1.00 73.30  ? 243 VAL D CG1 1 
ATOM   10057 C CG2 . VAL D  2  243 ? 131.232 104.814 161.727 1.00 73.30  ? 243 VAL D CG2 1 
ATOM   10058 N N   . SER D  2  244 ? 134.405 104.495 165.137 1.00 76.90  ? 244 SER D N   1 
ATOM   10059 C CA  . SER D  2  244 ? 135.617 103.924 165.719 1.00 76.90  ? 244 SER D CA  1 
ATOM   10060 C C   . SER D  2  244 ? 135.319 103.017 166.905 1.00 76.90  ? 244 SER D C   1 
ATOM   10061 O O   . SER D  2  244 ? 136.059 102.058 167.151 1.00 76.90  ? 244 SER D O   1 
ATOM   10062 C CB  . SER D  2  244 ? 136.566 105.043 166.146 1.00 76.90  ? 244 SER D CB  1 
ATOM   10063 O OG  . SER D  2  244 ? 137.728 104.523 166.767 1.00 76.90  ? 244 SER D OG  1 
ATOM   10064 N N   . PHE D  2  245 ? 134.245 103.295 167.644 1.00 79.09  ? 245 PHE D N   1 
ATOM   10065 C CA  . PHE D  2  245 ? 133.966 102.545 168.863 1.00 79.09  ? 245 PHE D CA  1 
ATOM   10066 C C   . PHE D  2  245 ? 133.678 101.081 168.577 1.00 79.09  ? 245 PHE D C   1 
ATOM   10067 O O   . PHE D  2  245 ? 133.892 100.226 169.444 1.00 79.09  ? 245 PHE D O   1 
ATOM   10068 C CB  . PHE D  2  245 ? 132.797 103.190 169.596 1.00 79.09  ? 245 PHE D CB  1 
ATOM   10069 C CG  . PHE D  2  245 ? 133.078 104.586 170.024 1.00 79.09  ? 245 PHE D CG  1 
ATOM   10070 C CD1 . PHE D  2  245 ? 133.797 104.836 171.174 1.00 79.09  ? 245 PHE D CD1 1 
ATOM   10071 C CD2 . PHE D  2  245 ? 132.664 105.652 169.252 1.00 79.09  ? 245 PHE D CD2 1 
ATOM   10072 C CE1 . PHE D  2  245 ? 134.073 106.124 171.560 1.00 79.09  ? 245 PHE D CE1 1 
ATOM   10073 C CE2 . PHE D  2  245 ? 132.939 106.943 169.636 1.00 79.09  ? 245 PHE D CE2 1 
ATOM   10074 C CZ  . PHE D  2  245 ? 133.647 107.177 170.790 1.00 79.09  ? 245 PHE D CZ  1 
ATOM   10075 N N   . TRP D  2  246 ? 133.198 100.771 167.379 1.00 78.84  ? 246 TRP D N   1 
ATOM   10076 C CA  . TRP D  2  246 ? 132.889 99.398  167.017 1.00 78.84  ? 246 TRP D CA  1 
ATOM   10077 C C   . TRP D  2  246 ? 134.090 98.648  166.459 1.00 78.84  ? 246 TRP D C   1 
ATOM   10078 O O   . TRP D  2  246 ? 133.971 97.455  166.162 1.00 78.84  ? 246 TRP D O   1 
ATOM   10079 C CB  . TRP D  2  246 ? 131.739 99.379  166.010 1.00 78.84  ? 246 TRP D CB  1 
ATOM   10080 C CG  . TRP D  2  246 ? 130.459 99.890  166.595 1.00 78.84  ? 246 TRP D CG  1 
ATOM   10081 C CD1 . TRP D  2  246 ? 129.960 101.156 166.496 1.00 78.84  ? 246 TRP D CD1 1 
ATOM   10082 C CD2 . TRP D  2  246 ? 129.518 99.150  167.380 1.00 78.84  ? 246 TRP D CD2 1 
ATOM   10083 N NE1 . TRP D  2  246 ? 128.766 101.249 167.166 1.00 78.84  ? 246 TRP D NE1 1 
ATOM   10084 C CE2 . TRP D  2  246 ? 128.472 100.030 167.718 1.00 78.84  ? 246 TRP D CE2 1 
ATOM   10085 C CE3 . TRP D  2  246 ? 129.457 97.827  167.827 1.00 78.84  ? 246 TRP D CE3 1 
ATOM   10086 C CZ2 . TRP D  2  246 ? 127.378 99.631  168.481 1.00 78.84  ? 246 TRP D CZ2 1 
ATOM   10087 C CZ3 . TRP D  2  246 ? 128.370 97.432  168.584 1.00 78.84  ? 246 TRP D CZ3 1 
ATOM   10088 C CH2 . TRP D  2  246 ? 127.345 98.331  168.904 1.00 78.84  ? 246 TRP D CH2 1 
ATOM   10089 N N   . LEU D  2  247 ? 135.232 99.312  166.307 1.00 75.32  ? 247 LEU D N   1 
ATOM   10090 C CA  . LEU D  2  247 ? 136.449 98.625  165.908 1.00 75.32  ? 247 LEU D CA  1 
ATOM   10091 C C   . LEU D  2  247 ? 137.032 97.856  167.090 1.00 75.32  ? 247 LEU D C   1 
ATOM   10092 O O   . LEU D  2  247 ? 136.650 98.054  168.247 1.00 75.32  ? 247 LEU D O   1 
ATOM   10093 C CB  . LEU D  2  247 ? 137.476 99.619  165.369 1.00 75.32  ? 247 LEU D CB  1 
ATOM   10094 C CG  . LEU D  2  247 ? 137.096 100.337 164.075 1.00 75.32  ? 247 LEU D CG  1 
ATOM   10095 C CD1 . LEU D  2  247 ? 138.135 101.384 163.725 1.00 75.32  ? 247 LEU D CD1 1 
ATOM   10096 C CD2 . LEU D  2  247 ? 136.941 99.340  162.945 1.00 75.32  ? 247 LEU D CD2 1 
ATOM   10097 N N   . ASN D  2  248 ? 137.969 96.963  166.787 1.00 81.22  ? 248 ASN D N   1 
ATOM   10098 C CA  . ASN D  2  248 ? 138.584 96.145  167.821 1.00 81.22  ? 248 ASN D CA  1 
ATOM   10099 C C   . ASN D  2  248 ? 139.626 96.956  168.582 1.00 81.22  ? 248 ASN D C   1 
ATOM   10100 O O   . ASN D  2  248 ? 140.392 97.722  167.991 1.00 81.22  ? 248 ASN D O   1 
ATOM   10101 C CB  . ASN D  2  248 ? 139.221 94.897  167.210 1.00 81.22  ? 248 ASN D CB  1 
ATOM   10102 C CG  . ASN D  2  248 ? 139.579 93.856  168.253 1.00 81.22  ? 248 ASN D CG  1 
ATOM   10103 O OD1 . ASN D  2  248 ? 139.381 94.064  169.449 1.00 81.22  ? 248 ASN D OD1 1 
ATOM   10104 N ND2 . ASN D  2  248 ? 140.102 92.723  167.801 1.00 81.22  ? 248 ASN D ND2 1 
ATOM   10105 N N   . ARG D  2  249 ? 139.648 96.779  169.904 1.00 86.11  ? 249 ARG D N   1 
ATOM   10106 C CA  . ARG D  2  249 ? 140.537 97.560  170.757 1.00 86.11  ? 249 ARG D CA  1 
ATOM   10107 C C   . ARG D  2  249 ? 142.001 97.178  170.588 1.00 86.11  ? 249 ARG D C   1 
ATOM   10108 O O   . ARG D  2  249 ? 142.878 97.951  170.984 1.00 86.11  ? 249 ARG D O   1 
ATOM   10109 C CB  . ARG D  2  249 ? 140.133 97.400  172.222 1.00 86.11  ? 249 ARG D CB  1 
ATOM   10110 C CG  . ARG D  2  249 ? 138.796 98.031  172.572 1.00 86.11  ? 249 ARG D CG  1 
ATOM   10111 C CD  . ARG D  2  249 ? 138.553 97.999  174.071 1.00 86.11  ? 249 ARG D CD  1 
ATOM   10112 N NE  . ARG D  2  249 ? 138.441 96.635  174.577 1.00 86.11  ? 249 ARG D NE  1 
ATOM   10113 C CZ  . ARG D  2  249 ? 137.302 95.955  174.641 1.00 86.11  ? 249 ARG D CZ  1 
ATOM   10114 N NH1 . ARG D  2  249 ? 137.292 94.716  175.115 1.00 86.11  ? 249 ARG D NH1 1 
ATOM   10115 N NH2 . ARG D  2  249 ? 136.172 96.515  174.236 1.00 86.11  ? 249 ARG D NH2 1 
ATOM   10116 N N   . GLU D  2  250 ? 142.286 96.005  170.021 1.00 86.53  ? 250 GLU D N   1 
ATOM   10117 C CA  . GLU D  2  250 ? 143.668 95.561  169.887 1.00 86.53  ? 250 GLU D CA  1 
ATOM   10118 C C   . GLU D  2  250 ? 144.365 96.222  168.702 1.00 86.53  ? 250 GLU D C   1 
ATOM   10119 O O   . GLU D  2  250 ? 145.549 96.567  168.789 1.00 86.53  ? 250 GLU D O   1 
ATOM   10120 C CB  . GLU D  2  250 ? 143.711 94.039  169.761 1.00 86.53  ? 250 GLU D CB  1 
ATOM   10121 C CG  . GLU D  2  250 ? 143.273 93.314  171.023 1.00 86.53  ? 250 GLU D CG  1 
ATOM   10122 C CD  . GLU D  2  250 ? 143.253 91.809  170.858 1.00 86.53  ? 250 GLU D CD  1 
ATOM   10123 O OE1 . GLU D  2  250 ? 143.447 91.330  169.722 1.00 86.53  ? 250 GLU D OE1 1 
ATOM   10124 O OE2 . GLU D  2  250 ? 143.042 91.104  171.866 1.00 86.53  ? 250 GLU D OE2 1 
ATOM   10125 N N   . SER D  2  251 ? 143.651 96.415  167.593 1.00 80.96  ? 251 SER D N   1 
ATOM   10126 C CA  . SER D  2  251 ? 144.221 97.041  166.400 1.00 80.96  ? 251 SER D CA  1 
ATOM   10127 C C   . SER D  2  251 ? 144.360 98.537  166.662 1.00 80.96  ? 251 SER D C   1 
ATOM   10128 O O   . SER D  2  251 ? 143.514 99.355  166.290 1.00 80.96  ? 251 SER D O   1 
ATOM   10129 C CB  . SER D  2  251 ? 143.356 96.758  165.178 1.00 80.96  ? 251 SER D CB  1 
ATOM   10130 O OG  . SER D  2  251 ? 143.326 95.373  164.884 1.00 80.96  ? 251 SER D OG  1 
ATOM   10131 N N   . VAL D  2  252 ? 145.458 98.897  167.317 1.00 72.18  ? 252 VAL D N   1 
ATOM   10132 C CA  . VAL D  2  252 ? 145.702 100.273 167.741 1.00 72.18  ? 252 VAL D CA  1 
ATOM   10133 C C   . VAL D  2  252 ? 145.953 101.192 166.546 1.00 72.18  ? 252 VAL D C   1 
ATOM   10134 O O   . VAL D  2  252 ? 145.266 102.220 166.423 1.00 72.18  ? 252 VAL D O   1 
ATOM   10135 C CB  . VAL D  2  252 ? 146.867 100.342 168.742 1.00 72.18  ? 252 VAL D CB  1 
ATOM   10136 C CG1 . VAL D  2  252 ? 147.168 101.786 169.105 1.00 72.18  ? 252 VAL D CG1 1 
ATOM   10137 C CG2 . VAL D  2  252 ? 146.546 99.524  169.980 1.00 72.18  ? 252 VAL D CG2 1 
ATOM   10138 N N   . PRO D  2  253 ? 146.910 100.892 165.652 1.00 65.62  ? 253 PRO D N   1 
ATOM   10139 C CA  . PRO D  2  253 ? 147.195 101.853 164.571 1.00 65.62  ? 253 PRO D CA  1 
ATOM   10140 C C   . PRO D  2  253 ? 145.994 102.141 163.692 1.00 65.62  ? 253 PRO D C   1 
ATOM   10141 O O   . PRO D  2  253 ? 145.819 103.278 163.232 1.00 65.62  ? 253 PRO D O   1 
ATOM   10142 C CB  . PRO D  2  253 ? 148.320 101.169 163.782 1.00 65.62  ? 253 PRO D CB  1 
ATOM   10143 C CG  . PRO D  2  253 ? 148.928 100.216 164.733 1.00 65.62  ? 253 PRO D CG  1 
ATOM   10144 C CD  . PRO D  2  253 ? 147.794 99.715  165.559 1.00 65.62  ? 253 PRO D CD  1 
ATOM   10145 N N   . ALA D  2  254 ? 145.157 101.133 163.448 1.00 66.47  ? 254 ALA D N   1 
ATOM   10146 C CA  . ALA D  2  254 ? 143.959 101.344 162.646 1.00 66.47  ? 254 ALA D CA  1 
ATOM   10147 C C   . ALA D  2  254 ? 143.055 102.388 163.284 1.00 66.47  ? 254 ALA D C   1 
ATOM   10148 O O   . ALA D  2  254 ? 142.608 103.329 162.619 1.00 66.47  ? 254 ALA D O   1 
ATOM   10149 C CB  . ALA D  2  254 ? 143.215 100.022 162.464 1.00 66.47  ? 254 ALA D CB  1 
ATOM   10150 N N   . ARG D  2  255 ? 142.783 102.243 164.583 1.00 72.61  ? 255 ARG D N   1 
ATOM   10151 C CA  . ARG D  2  255 ? 141.923 103.201 165.267 1.00 72.61  ? 255 ARG D CA  1 
ATOM   10152 C C   . ARG D  2  255 ? 142.558 104.585 165.307 1.00 72.61  ? 255 ARG D C   1 
ATOM   10153 O O   . ARG D  2  255 ? 141.860 105.599 165.183 1.00 72.61  ? 255 ARG D O   1 
ATOM   10154 C CB  . ARG D  2  255 ? 141.611 102.711 166.679 1.00 72.61  ? 255 ARG D CB  1 
ATOM   10155 C CG  . ARG D  2  255 ? 140.755 101.457 166.730 1.00 72.61  ? 255 ARG D CG  1 
ATOM   10156 C CD  . ARG D  2  255 ? 140.544 100.988 168.162 1.00 72.61  ? 255 ARG D CD  1 
ATOM   10157 N NE  . ARG D  2  255 ? 139.761 101.936 168.949 1.00 72.61  ? 255 ARG D NE  1 
ATOM   10158 C CZ  . ARG D  2  255 ? 138.440 101.897 169.073 1.00 72.61  ? 255 ARG D CZ  1 
ATOM   10159 N NH1 . ARG D  2  255 ? 137.743 100.946 168.469 1.00 72.61  ? 255 ARG D NH1 1 
ATOM   10160 N NH2 . ARG D  2  255 ? 137.817 102.804 169.810 1.00 72.61  ? 255 ARG D NH2 1 
ATOM   10161 N N   . THR D  2  256 ? 143.882 104.653 165.469 1.00 63.08  ? 256 THR D N   1 
ATOM   10162 C CA  . THR D  2  256 ? 144.547 105.954 165.488 1.00 63.08  ? 256 THR D CA  1 
ATOM   10163 C C   . THR D  2  256 ? 144.378 106.674 164.156 1.00 63.08  ? 256 THR D C   1 
ATOM   10164 O O   . THR D  2  256 ? 143.995 107.851 164.115 1.00 63.08  ? 256 THR D O   1 
ATOM   10165 C CB  . THR D  2  256 ? 146.029 105.794 165.813 1.00 63.08  ? 256 THR D CB  1 
ATOM   10166 O OG1 . THR D  2  256 ? 146.653 104.999 164.800 1.00 63.08  ? 256 THR D OG1 1 
ATOM   10167 C CG2 . THR D  2  256 ? 146.212 105.128 167.162 1.00 63.08  ? 256 THR D CG2 1 
ATOM   10168 N N   . VAL D  2  257 ? 144.675 105.983 163.053 1.00 62.58  ? 257 VAL D N   1 
ATOM   10169 C CA  . VAL D  2  257 ? 144.510 106.589 161.734 1.00 62.58  ? 257 VAL D CA  1 
ATOM   10170 C C   . VAL D  2  257 ? 143.056 106.974 161.506 1.00 62.58  ? 257 VAL D C   1 
ATOM   10171 O O   . VAL D  2  257 ? 142.755 108.044 160.956 1.00 62.58  ? 257 VAL D O   1 
ATOM   10172 C CB  . VAL D  2  257 ? 145.018 105.634 160.640 1.00 62.58  ? 257 VAL D CB  1 
ATOM   10173 C CG1 . VAL D  2  257 ? 144.724 106.201 159.263 1.00 62.58  ? 257 VAL D CG1 1 
ATOM   10174 C CG2 . VAL D  2  257 ? 146.503 105.388 160.805 1.00 62.58  ? 257 VAL D CG2 1 
ATOM   10175 N N   . PHE D  2  258 ? 142.131 106.109 161.927 1.00 62.96  ? 258 PHE D N   1 
ATOM   10176 C CA  . PHE D  2  258 ? 140.712 106.381 161.744 1.00 62.96  ? 258 PHE D CA  1 
ATOM   10177 C C   . PHE D  2  258 ? 140.307 107.660 162.460 1.00 62.96  ? 258 PHE D C   1 
ATOM   10178 O O   . PHE D  2  258 ? 139.572 108.486 161.908 1.00 62.96  ? 258 PHE D O   1 
ATOM   10179 C CB  . PHE D  2  258 ? 139.904 105.192 162.258 1.00 62.96  ? 258 PHE D CB  1 
ATOM   10180 C CG  . PHE D  2  258 ? 138.447 105.258 161.936 1.00 62.96  ? 258 PHE D CG  1 
ATOM   10181 C CD1 . PHE D  2  258 ? 137.988 104.897 160.685 1.00 62.96  ? 258 PHE D CD1 1 
ATOM   10182 C CD2 . PHE D  2  258 ? 137.535 105.673 162.883 1.00 62.96  ? 258 PHE D CD2 1 
ATOM   10183 C CE1 . PHE D  2  258 ? 136.649 104.946 160.384 1.00 62.96  ? 258 PHE D CE1 1 
ATOM   10184 C CE2 . PHE D  2  258 ? 136.192 105.726 162.588 1.00 62.96  ? 258 PHE D CE2 1 
ATOM   10185 C CZ  . PHE D  2  258 ? 135.749 105.362 161.335 1.00 62.96  ? 258 PHE D CZ  1 
ATOM   10186 N N   . GLY D  2  259 ? 140.793 107.849 163.687 1.00 55.51  ? 259 GLY D N   1 
ATOM   10187 C CA  . GLY D  2  259 ? 140.454 109.053 164.425 1.00 55.51  ? 259 GLY D CA  1 
ATOM   10188 C C   . GLY D  2  259 ? 141.097 110.299 163.847 1.00 55.51  ? 259 GLY D C   1 
ATOM   10189 O O   . GLY D  2  259 ? 140.477 111.365 163.809 1.00 55.51  ? 259 GLY D O   1 
ATOM   10190 N N   . VAL D  2  260 ? 142.344 110.187 163.385 1.00 54.21  ? 260 VAL D N   1 
ATOM   10191 C CA  . VAL D  2  260 ? 143.041 111.364 162.874 1.00 54.21  ? 260 VAL D CA  1 
ATOM   10192 C C   . VAL D  2  260 ? 142.430 111.830 161.558 1.00 54.21  ? 260 VAL D C   1 
ATOM   10193 O O   . VAL D  2  260 ? 142.282 113.038 161.314 1.00 54.21  ? 260 VAL D O   1 
ATOM   10194 C CB  . VAL D  2  260 ? 144.544 111.071 162.729 1.00 54.21  ? 260 VAL D CB  1 
ATOM   10195 C CG1 . VAL D  2  260 ? 145.238 112.208 162.011 1.00 54.21  ? 260 VAL D CG1 1 
ATOM   10196 C CG2 . VAL D  2  260 ? 145.169 110.858 164.093 1.00 54.21  ? 260 VAL D CG2 1 
ATOM   10197 N N   . THR D  2  261 ? 142.064 110.890 160.688 1.00 55.47  ? 261 THR D N   1 
ATOM   10198 C CA  . THR D  2  261 ? 141.586 111.287 159.371 1.00 55.47  ? 261 THR D CA  1 
ATOM   10199 C C   . THR D  2  261 ? 140.237 111.992 159.451 1.00 55.47  ? 261 THR D C   1 
ATOM   10200 O O   . THR D  2  261 ? 139.927 112.828 158.597 1.00 55.47  ? 261 THR D O   1 
ATOM   10201 C CB  . THR D  2  261 ? 141.502 110.071 158.457 1.00 55.47  ? 261 THR D CB  1 
ATOM   10202 O OG1 . THR D  2  261 ? 142.756 109.381 158.471 1.00 55.47  ? 261 THR D OG1 1 
ATOM   10203 C CG2 . THR D  2  261 ? 141.221 110.509 157.034 1.00 55.47  ? 261 THR D CG2 1 
ATOM   10204 N N   . THR D  2  262 ? 139.427 111.686 160.466 1.00 56.22  ? 262 THR D N   1 
ATOM   10205 C CA  . THR D  2  262 ? 138.182 112.424 160.647 1.00 56.22  ? 262 THR D CA  1 
ATOM   10206 C C   . THR D  2  262 ? 138.453 113.892 160.951 1.00 56.22  ? 262 THR D C   1 
ATOM   10207 O O   . THR D  2  262 ? 137.775 114.779 160.419 1.00 56.22  ? 262 THR D O   1 
ATOM   10208 C CB  . THR D  2  262 ? 137.346 111.792 161.758 1.00 56.22  ? 262 THR D CB  1 
ATOM   10209 O OG1 . THR D  2  262 ? 138.103 111.771 162.974 1.00 56.22  ? 262 THR D OG1 1 
ATOM   10210 C CG2 . THR D  2  262 ? 136.946 110.378 161.383 1.00 56.22  ? 262 THR D CG2 1 
ATOM   10211 N N   . VAL D  2  263 ? 139.440 114.170 161.804 1.00 52.44  ? 263 VAL D N   1 
ATOM   10212 C CA  . VAL D  2  263 ? 139.820 115.554 162.073 1.00 52.44  ? 263 VAL D CA  1 
ATOM   10213 C C   . VAL D  2  263 ? 140.352 116.211 160.809 1.00 52.44  ? 263 VAL D C   1 
ATOM   10214 O O   . VAL D  2  263 ? 140.090 117.391 160.544 1.00 52.44  ? 263 VAL D O   1 
ATOM   10215 C CB  . VAL D  2  263 ? 140.849 115.614 163.215 1.00 52.44  ? 263 VAL D CB  1 
ATOM   10216 C CG1 . VAL D  2  263 ? 141.362 117.027 163.388 1.00 52.44  ? 263 VAL D CG1 1 
ATOM   10217 C CG2 . VAL D  2  263 ? 140.228 115.119 164.502 1.00 52.44  ? 263 VAL D CG2 1 
ATOM   10218 N N   . LEU D  2  264 ? 141.114 115.461 160.014 1.00 54.35  ? 264 LEU D N   1 
ATOM   10219 C CA  . LEU D  2  264 ? 141.609 116.001 158.749 1.00 54.35  ? 264 LEU D CA  1 
ATOM   10220 C C   . LEU D  2  264 ? 140.453 116.391 157.831 1.00 54.35  ? 264 LEU D C   1 
ATOM   10221 O O   . LEU D  2  264 ? 140.452 117.475 157.227 1.00 54.35  ? 264 LEU D O   1 
ATOM   10222 C CB  . LEU D  2  264 ? 142.518 114.975 158.078 1.00 54.35  ? 264 LEU D CB  1 
ATOM   10223 C CG  . LEU D  2  264 ? 143.777 114.671 158.889 1.00 54.35  ? 264 LEU D CG  1 
ATOM   10224 C CD1 . LEU D  2  264 ? 144.556 113.517 158.306 1.00 54.35  ? 264 LEU D CD1 1 
ATOM   10225 C CD2 . LEU D  2  264 ? 144.645 115.899 158.952 1.00 54.35  ? 264 LEU D CD2 1 
ATOM   10226 N N   . THR D  2  265 ? 139.455 115.512 157.721 1.00 55.04  ? 265 THR D N   1 
ATOM   10227 C CA  . THR D  2  265 ? 138.271 115.805 156.919 1.00 55.04  ? 265 THR D CA  1 
ATOM   10228 C C   . THR D  2  265 ? 137.538 117.030 157.444 1.00 55.04  ? 265 THR D C   1 
ATOM   10229 O O   . THR D  2  265 ? 137.093 117.878 156.663 1.00 55.04  ? 265 THR D O   1 
ATOM   10230 C CB  . THR D  2  265 ? 137.335 114.596 156.907 1.00 55.04  ? 265 THR D CB  1 
ATOM   10231 O OG1 . THR D  2  265 ? 138.006 113.476 156.321 1.00 55.04  ? 265 THR D OG1 1 
ATOM   10232 C CG2 . THR D  2  265 ? 136.074 114.900 156.114 1.00 55.04  ? 265 THR D CG2 1 
ATOM   10233 N N   . MET D  2  266 ? 137.387 117.130 158.766 1.00 61.49  ? 266 MET D N   1 
ATOM   10234 C CA  . MET D  2  266 ? 136.733 118.297 159.347 1.00 61.49  ? 266 MET D CA  1 
ATOM   10235 C C   . MET D  2  266 ? 137.474 119.578 159.005 1.00 61.49  ? 266 MET D C   1 
ATOM   10236 O O   . MET D  2  266 ? 136.850 120.593 158.681 1.00 61.49  ? 266 MET D O   1 
ATOM   10237 C CB  . MET D  2  266 ? 136.612 118.143 160.860 1.00 61.49  ? 266 MET D CB  1 
ATOM   10238 C CG  . MET D  2  266 ? 135.533 117.184 161.277 1.00 61.49  ? 266 MET D CG  1 
ATOM   10239 S SD  . MET D  2  266 ? 133.972 117.768 160.598 1.00 61.49  ? 266 MET D SD  1 
ATOM   10240 C CE  . MET D  2  266 ? 133.827 119.333 161.453 1.00 61.49  ? 266 MET D CE  1 
ATOM   10241 N N   . THR D  2  267 ? 138.803 119.552 159.073 1.00 58.52  ? 267 THR D N   1 
ATOM   10242 C CA  . THR D  2  267 ? 139.577 120.741 158.735 1.00 58.52  ? 267 THR D CA  1 
ATOM   10243 C C   . THR D  2  267 ? 139.368 121.130 157.278 1.00 58.52  ? 267 THR D C   1 
ATOM   10244 O O   . THR D  2  267 ? 139.114 122.301 156.967 1.00 58.52  ? 267 THR D O   1 
ATOM   10245 C CB  . THR D  2  267 ? 141.057 120.504 159.026 1.00 58.52  ? 267 THR D CB  1 
ATOM   10246 O OG1 . THR D  2  267 ? 141.230 120.233 160.422 1.00 58.52  ? 267 THR D OG1 1 
ATOM   10247 C CG2 . THR D  2  267 ? 141.871 121.724 158.656 1.00 58.52  ? 267 THR D CG2 1 
ATOM   10248 N N   . THR D  2  268 ? 139.462 120.155 156.369 1.00 56.48  ? 268 THR D N   1 
ATOM   10249 C CA  . THR D  2  268 ? 139.254 120.449 154.951 1.00 56.48  ? 268 THR D CA  1 
ATOM   10250 C C   . THR D  2  268 ? 137.867 121.030 154.706 1.00 56.48  ? 268 THR D C   1 
ATOM   10251 O O   . THR D  2  268 ? 137.712 122.039 154.004 1.00 56.48  ? 268 THR D O   1 
ATOM   10252 C CB  . THR D  2  268 ? 139.452 119.188 154.112 1.00 56.48  ? 268 THR D CB  1 
ATOM   10253 O OG1 . THR D  2  268 ? 138.541 118.175 154.554 1.00 56.48  ? 268 THR D OG1 1 
ATOM   10254 C CG2 . THR D  2  268 ? 140.873 118.679 154.236 1.00 56.48  ? 268 THR D CG2 1 
ATOM   10255 N N   . LEU D  2  269 ? 136.845 120.408 155.292 1.00 57.36  ? 269 LEU D N   1 
ATOM   10256 C CA  . LEU D  2  269 ? 135.473 120.844 155.066 1.00 57.36  ? 269 LEU D CA  1 
ATOM   10257 C C   . LEU D  2  269 ? 135.236 122.240 155.624 1.00 57.36  ? 269 LEU D C   1 
ATOM   10258 O O   . LEU D  2  269 ? 134.608 123.078 154.967 1.00 57.36  ? 269 LEU D O   1 
ATOM   10259 C CB  . LEU D  2  269 ? 134.511 119.844 155.697 1.00 57.36  ? 269 LEU D CB  1 
ATOM   10260 C CG  . LEU D  2  269 ? 133.031 120.061 155.420 1.00 57.36  ? 269 LEU D CG  1 
ATOM   10261 C CD1 . LEU D  2  269 ? 132.752 119.855 153.942 1.00 57.36  ? 269 LEU D CD1 1 
ATOM   10262 C CD2 . LEU D  2  269 ? 132.199 119.124 156.276 1.00 57.36  ? 269 LEU D CD2 1 
ATOM   10263 N N   . SER D  2  270 ? 135.734 122.513 156.832 1.00 55.64  ? 270 SER D N   1 
ATOM   10264 C CA  . SER D  2  270 ? 135.541 123.828 157.428 1.00 55.64  ? 270 SER D CA  1 
ATOM   10265 C C   . SER D  2  270 ? 136.255 124.906 156.631 1.00 55.64  ? 270 SER D C   1 
ATOM   10266 O O   . SER D  2  270 ? 135.717 126.004 156.447 1.00 55.64  ? 270 SER D O   1 
ATOM   10267 C CB  . SER D  2  270 ? 136.027 123.828 158.875 1.00 55.64  ? 270 SER D CB  1 
ATOM   10268 O OG  . SER D  2  270 ? 135.887 125.113 159.450 1.00 55.64  ? 270 SER D OG  1 
ATOM   10269 N N   . ILE D  2  271 ? 137.470 124.622 156.155 1.00 59.34  ? 271 ILE D N   1 
ATOM   10270 C CA  . ILE D  2  271 ? 138.180 125.609 155.348 1.00 59.34  ? 271 ILE D CA  1 
ATOM   10271 C C   . ILE D  2  271 ? 137.430 125.873 154.052 1.00 59.34  ? 271 ILE D C   1 
ATOM   10272 O O   . ILE D  2  271 ? 137.302 127.023 153.615 1.00 59.34  ? 271 ILE D O   1 
ATOM   10273 C CB  . ILE D  2  271 ? 139.623 125.150 155.079 1.00 59.34  ? 271 ILE D CB  1 
ATOM   10274 C CG1 . ILE D  2  271 ? 140.405 125.071 156.385 1.00 59.34  ? 271 ILE D CG1 1 
ATOM   10275 C CG2 . ILE D  2  271 ? 140.309 126.098 154.116 1.00 59.34  ? 271 ILE D CG2 1 
ATOM   10276 C CD1 . ILE D  2  271 ? 141.718 124.357 156.241 1.00 59.34  ? 271 ILE D CD1 1 
ATOM   10277 N N   . SER D  2  272 ? 136.913 124.819 153.420 1.00 58.30  ? 272 SER D N   1 
ATOM   10278 C CA  . SER D  2  272 ? 136.186 125.012 152.170 1.00 58.30  ? 272 SER D CA  1 
ATOM   10279 C C   . SER D  2  272 ? 134.895 125.790 152.391 1.00 58.30  ? 272 SER D C   1 
ATOM   10280 O O   . SER D  2  272 ? 134.481 126.573 151.529 1.00 58.30  ? 272 SER D O   1 
ATOM   10281 C CB  . SER D  2  272 ? 135.895 123.663 151.518 1.00 58.30  ? 272 SER D CB  1 
ATOM   10282 O OG  . SER D  2  272 ? 135.169 123.831 150.313 1.00 58.30  ? 272 SER D OG  1 
ATOM   10283 N N   . ALA D  2  273 ? 134.247 125.595 153.541 1.00 62.86  ? 273 ALA D N   1 
ATOM   10284 C CA  . ALA D  2  273 ? 132.953 126.229 153.768 1.00 62.86  ? 273 ALA D CA  1 
ATOM   10285 C C   . ALA D  2  273 ? 133.092 127.678 154.218 1.00 62.86  ? 273 ALA D C   1 
ATOM   10286 O O   . ALA D  2  273 ? 132.340 128.544 153.758 1.00 62.86  ? 273 ALA D O   1 
ATOM   10287 C CB  . ALA D  2  273 ? 132.152 125.430 154.794 1.00 62.86  ? 273 ALA D CB  1 
ATOM   10288 N N   . ARG D  2  274 ? 134.040 127.969 155.110 1.00 76.02  ? 274 ARG D N   1 
ATOM   10289 C CA  . ARG D  2  274 ? 134.128 129.301 155.694 1.00 76.02  ? 274 ARG D CA  1 
ATOM   10290 C C   . ARG D  2  274 ? 134.661 130.341 154.715 1.00 76.02  ? 274 ARG D C   1 
ATOM   10291 O O   . ARG D  2  274 ? 134.619 131.537 155.022 1.00 76.02  ? 274 ARG D O   1 
ATOM   10292 C CB  . ARG D  2  274 ? 134.997 129.246 156.956 1.00 76.02  ? 274 ARG D CB  1 
ATOM   10293 C CG  . ARG D  2  274 ? 134.959 130.497 157.825 1.00 76.02  ? 274 ARG D CG  1 
ATOM   10294 C CD  . ARG D  2  274 ? 135.729 130.309 159.123 1.00 76.02  ? 274 ARG D CD  1 
ATOM   10295 N NE  . ARG D  2  274 ? 137.161 130.124 158.906 1.00 76.02  ? 274 ARG D NE  1 
ATOM   10296 C CZ  . ARG D  2  274 ? 137.817 129.001 159.176 1.00 76.02  ? 274 ARG D CZ  1 
ATOM   10297 N NH1 . ARG D  2  274 ? 137.170 127.957 159.672 1.00 76.02  ? 274 ARG D NH1 1 
ATOM   10298 N NH2 . ARG D  2  274 ? 139.121 128.921 158.948 1.00 76.02  ? 274 ARG D NH2 1 
ATOM   10299 N N   . ASN D  2  275 ? 135.137 129.925 153.542 1.00 79.85  ? 275 ASN D N   1 
ATOM   10300 C CA  . ASN D  2  275 ? 135.686 130.888 152.593 1.00 79.85  ? 275 ASN D CA  1 
ATOM   10301 C C   . ASN D  2  275 ? 134.592 131.755 151.981 1.00 79.85  ? 275 ASN D C   1 
ATOM   10302 O O   . ASN D  2  275 ? 134.781 132.963 151.799 1.00 79.85  ? 275 ASN D O   1 
ATOM   10303 C CB  . ASN D  2  275 ? 136.466 130.159 151.500 1.00 79.85  ? 275 ASN D CB  1 
ATOM   10304 C CG  . ASN D  2  275 ? 137.480 131.051 150.811 1.00 79.85  ? 275 ASN D CG  1 
ATOM   10305 O OD1 . ASN D  2  275 ? 138.364 130.568 150.105 1.00 79.85  ? 275 ASN D OD1 1 
ATOM   10306 N ND2 . ASN D  2  275 ? 137.369 132.357 151.023 1.00 79.85  ? 275 ASN D ND2 1 
ATOM   10307 N N   . SER D  2  276 ? 133.443 131.161 151.652 1.00 82.04  ? 276 SER D N   1 
ATOM   10308 C CA  . SER D  2  276 ? 132.377 131.908 150.994 1.00 82.04  ? 276 SER D CA  1 
ATOM   10309 C C   . SER D  2  276 ? 131.669 132.872 151.936 1.00 82.04  ? 276 SER D C   1 
ATOM   10310 O O   . SER D  2  276 ? 131.004 133.801 151.465 1.00 82.04  ? 276 SER D O   1 
ATOM   10311 C CB  . SER D  2  276 ? 131.363 130.941 150.382 1.00 82.04  ? 276 SER D CB  1 
ATOM   10312 O OG  . SER D  2  276 ? 130.681 130.215 151.388 1.00 82.04  ? 276 SER D OG  1 
ATOM   10313 N N   . LEU D  2  277 ? 131.788 132.670 153.242 1.00 83.36  ? 277 LEU D N   1 
ATOM   10314 C CA  . LEU D  2  277 ? 131.147 133.557 154.201 1.00 83.36  ? 277 LEU D CA  1 
ATOM   10315 C C   . LEU D  2  277 ? 131.736 134.961 154.094 1.00 83.36  ? 277 LEU D C   1 
ATOM   10316 O O   . LEU D  2  277 ? 132.965 135.110 154.059 1.00 83.36  ? 277 LEU D O   1 
ATOM   10317 C CB  . LEU D  2  277 ? 131.333 133.017 155.616 1.00 83.36  ? 277 LEU D CB  1 
ATOM   10318 C CG  . LEU D  2  277 ? 130.675 133.798 156.751 1.00 83.36  ? 277 LEU D CG  1 
ATOM   10319 C CD1 . LEU D  2  277 ? 129.163 133.759 156.626 1.00 83.36  ? 277 LEU D CD1 1 
ATOM   10320 C CD2 . LEU D  2  277 ? 131.122 133.252 158.097 1.00 83.36  ? 277 LEU D CD2 1 
ATOM   10321 N N   . PRO D  2  278 ? 130.912 136.003 154.035 1.00 68.59  ? 278 PRO D N   1 
ATOM   10322 C CA  . PRO D  2  278 ? 131.450 137.367 154.013 1.00 68.59  ? 278 PRO D CA  1 
ATOM   10323 C C   . PRO D  2  278 ? 131.966 137.787 155.380 1.00 68.59  ? 278 PRO D C   1 
ATOM   10324 O O   . PRO D  2  278 ? 131.545 137.280 156.422 1.00 68.59  ? 278 PRO D O   1 
ATOM   10325 C CB  . PRO D  2  278 ? 130.249 138.213 153.589 1.00 68.59  ? 278 PRO D CB  1 
ATOM   10326 C CG  . PRO D  2  278 ? 129.074 137.426 154.038 1.00 68.59  ? 278 PRO D CG  1 
ATOM   10327 C CD  . PRO D  2  278 ? 129.450 135.984 153.878 1.00 68.59  ? 278 PRO D CD  1 
ATOM   10328 N N   . LYS D  2  279 ? 132.892 138.743 155.361 1.00 66.03  ? 279 LYS D N   1 
ATOM   10329 C CA  . LYS D  2  279 ? 133.560 139.160 156.587 1.00 66.03  ? 279 LYS D CA  1 
ATOM   10330 C C   . LYS D  2  279 ? 132.604 139.920 157.496 1.00 66.03  ? 279 LYS D C   1 
ATOM   10331 O O   . LYS D  2  279 ? 131.912 140.844 157.059 1.00 66.03  ? 279 LYS D O   1 
ATOM   10332 C CB  . LYS D  2  279 ? 134.775 140.027 156.263 1.00 66.03  ? 279 LYS D CB  1 
ATOM   10333 C CG  . LYS D  2  279 ? 135.912 139.272 155.603 1.00 66.03  ? 279 LYS D CG  1 
ATOM   10334 C CD  . LYS D  2  279 ? 137.107 140.178 155.359 1.00 66.03  ? 279 LYS D CD  1 
ATOM   10335 C CE  . LYS D  2  279 ? 138.241 139.428 154.679 1.00 66.03  ? 279 LYS D CE  1 
ATOM   10336 N NZ  . LYS D  2  279 ? 139.412 140.310 154.421 1.00 66.03  ? 279 LYS D NZ  1 
ATOM   10337 N N   . VAL D  2  280 ? 132.567 139.520 158.769 1.00 63.42  ? 280 VAL D N   1 
ATOM   10338 C CA  . VAL D  2  280 ? 131.762 140.178 159.789 1.00 63.42  ? 280 VAL D CA  1 
ATOM   10339 C C   . VAL D  2  280 ? 132.564 140.222 161.081 1.00 63.42  ? 280 VAL D C   1 
ATOM   10340 O O   . VAL D  2  280 ? 133.545 139.496 161.258 1.00 63.42  ? 280 VAL D O   1 
ATOM   10341 C CB  . VAL D  2  280 ? 130.412 139.470 160.031 1.00 63.42  ? 280 VAL D CB  1 
ATOM   10342 C CG1 . VAL D  2  280 ? 129.536 139.544 158.796 1.00 63.42  ? 280 VAL D CG1 1 
ATOM   10343 C CG2 . VAL D  2  280 ? 130.644 138.028 160.428 1.00 63.42  ? 280 VAL D CG2 1 
ATOM   10344 N N   . ALA D  2  281 ? 132.135 141.095 161.992 1.00 60.76  ? 281 ALA D N   1 
ATOM   10345 C CA  . ALA D  2  281 ? 132.813 141.218 163.277 1.00 60.76  ? 281 ALA D CA  1 
ATOM   10346 C C   . ALA D  2  281 ? 132.406 140.101 164.230 1.00 60.76  ? 281 ALA D C   1 
ATOM   10347 O O   . ALA D  2  281 ? 133.261 139.477 164.868 1.00 60.76  ? 281 ALA D O   1 
ATOM   10348 C CB  . ALA D  2  281 ? 132.520 142.584 163.899 1.00 60.76  ? 281 ALA D CB  1 
ATOM   10349 N N   . TYR D  2  282 ? 131.109 139.839 164.341 1.00 59.07  ? 282 TYR D N   1 
ATOM   10350 C CA  . TYR D  2  282 ? 130.597 138.817 165.244 1.00 59.07  ? 282 TYR D CA  1 
ATOM   10351 C C   . TYR D  2  282 ? 130.699 137.441 164.590 1.00 59.07  ? 282 TYR D C   1 
ATOM   10352 O O   . TYR D  2  282 ? 131.313 137.268 163.534 1.00 59.07  ? 282 TYR D O   1 
ATOM   10353 C CB  . TYR D  2  282 ? 129.169 139.156 165.654 1.00 59.07  ? 282 TYR D CB  1 
ATOM   10354 C CG  . TYR D  2  282 ? 128.234 139.320 164.482 1.00 59.07  ? 282 TYR D CG  1 
ATOM   10355 C CD1 . TYR D  2  282 ? 127.554 138.236 163.952 1.00 59.07  ? 282 TYR D CD1 1 
ATOM   10356 C CD2 . TYR D  2  282 ? 128.041 140.563 163.899 1.00 59.07  ? 282 TYR D CD2 1 
ATOM   10357 C CE1 . TYR D  2  282 ? 126.704 138.387 162.878 1.00 59.07  ? 282 TYR D CE1 1 
ATOM   10358 C CE2 . TYR D  2  282 ? 127.196 140.724 162.828 1.00 59.07  ? 282 TYR D CE2 1 
ATOM   10359 C CZ  . TYR D  2  282 ? 126.528 139.633 162.321 1.00 59.07  ? 282 TYR D CZ  1 
ATOM   10360 O OH  . TYR D  2  282 ? 125.682 139.787 161.249 1.00 59.07  ? 282 TYR D OH  1 
ATOM   10361 N N   . ALA D  2  283 ? 130.092 136.440 165.219 1.00 59.53  ? 283 ALA D N   1 
ATOM   10362 C CA  . ALA D  2  283 ? 130.144 135.061 164.757 1.00 59.53  ? 283 ALA D CA  1 
ATOM   10363 C C   . ALA D  2  283 ? 128.801 134.668 164.161 1.00 59.53  ? 283 ALA D C   1 
ATOM   10364 O O   . ALA D  2  283 ? 127.760 134.841 164.803 1.00 59.53  ? 283 ALA D O   1 
ATOM   10365 C CB  . ALA D  2  283 ? 130.511 134.115 165.900 1.00 59.53  ? 283 ALA D CB  1 
ATOM   10366 N N   . THR D  2  284 ? 128.830 134.134 162.943 1.00 55.30  ? 284 THR D N   1 
ATOM   10367 C CA  . THR D  2  284 ? 127.609 133.756 162.254 1.00 55.30  ? 284 THR D CA  1 
ATOM   10368 C C   . THR D  2  284 ? 127.011 132.496 162.876 1.00 55.30  ? 284 THR D C   1 
ATOM   10369 O O   . THR D  2  284 ? 127.630 131.818 163.698 1.00 55.30  ? 284 THR D O   1 
ATOM   10370 C CB  . THR D  2  284 ? 127.881 133.534 160.769 1.00 55.30  ? 284 THR D CB  1 
ATOM   10371 O OG1 . THR D  2  284 ? 128.810 132.457 160.613 1.00 55.30  ? 284 THR D OG1 1 
ATOM   10372 C CG2 . THR D  2  284 ? 128.467 134.784 160.151 1.00 55.30  ? 284 THR D CG2 1 
ATOM   10373 N N   . ALA D  2  285 ? 125.781 132.186 162.469 1.00 45.59  ? 285 ALA D N   1 
ATOM   10374 C CA  . ALA D  2  285 ? 125.071 131.051 163.044 1.00 45.59  ? 285 ALA D CA  1 
ATOM   10375 C C   . ALA D  2  285 ? 125.573 129.716 162.518 1.00 45.59  ? 285 ALA D C   1 
ATOM   10376 O O   . ALA D  2  285 ? 125.313 128.685 163.143 1.00 45.59  ? 285 ALA D O   1 
ATOM   10377 C CB  . ALA D  2  285 ? 123.574 131.183 162.784 1.00 45.59  ? 285 ALA D CB  1 
ATOM   10378 N N   . MET D  2  286 ? 126.266 129.703 161.382 1.00 52.66  ? 286 MET D N   1 
ATOM   10379 C CA  . MET D  2  286 ? 126.888 128.469 160.920 1.00 52.66  ? 286 MET D CA  1 
ATOM   10380 C C   . MET D  2  286 ? 128.174 128.174 161.677 1.00 52.66  ? 286 MET D C   1 
ATOM   10381 O O   . MET D  2  286 ? 128.583 127.010 161.774 1.00 52.66  ? 286 MET D O   1 
ATOM   10382 C CB  . MET D  2  286 ? 127.167 128.550 159.419 1.00 52.66  ? 286 MET D CB  1 
ATOM   10383 C CG  . MET D  2  286 ? 127.723 127.275 158.816 1.00 52.66  ? 286 MET D CG  1 
ATOM   10384 S SD  . MET D  2  286 ? 128.057 127.432 157.059 1.00 52.66  ? 286 MET D SD  1 
ATOM   10385 C CE  . MET D  2  286 ? 129.480 128.514 157.100 1.00 52.66  ? 286 MET D CE  1 
ATOM   10386 N N   . ASP D  2  287 ? 128.817 129.211 162.218 1.00 58.07  ? 287 ASP D N   1 
ATOM   10387 C CA  . ASP D  2  287 ? 130.073 129.014 162.930 1.00 58.07  ? 287 ASP D CA  1 
ATOM   10388 C C   . ASP D  2  287 ? 129.882 128.143 164.162 1.00 58.07  ? 287 ASP D C   1 
ATOM   10389 O O   . ASP D  2  287 ? 130.743 127.319 164.480 1.00 58.07  ? 287 ASP D O   1 
ATOM   10390 C CB  . ASP D  2  287 ? 130.675 130.362 163.316 1.00 58.07  ? 287 ASP D CB  1 
ATOM   10391 C CG  . ASP D  2  287 ? 131.195 131.125 162.121 1.00 58.07  ? 287 ASP D CG  1 
ATOM   10392 O OD1 . ASP D  2  287 ? 131.635 130.476 161.148 1.00 58.07  ? 287 ASP D OD1 1 
ATOM   10393 O OD2 . ASP D  2  287 ? 131.155 132.372 162.150 1.00 58.07  ? 287 ASP D OD2 1 
ATOM   10394 N N   . TRP D  2  288 ? 128.761 128.303 164.866 1.00 58.54  ? 288 TRP D N   1 
ATOM   10395 C CA  . TRP D  2  288 ? 128.525 127.475 166.043 1.00 58.54  ? 288 TRP D CA  1 
ATOM   10396 C C   . TRP D  2  288 ? 128.357 126.011 165.661 1.00 58.54  ? 288 TRP D C   1 
ATOM   10397 O O   . TRP D  2  288 ? 128.919 125.121 166.316 1.00 58.54  ? 288 TRP D O   1 
ATOM   10398 C CB  . TRP D  2  288 ? 127.303 127.977 166.807 1.00 58.54  ? 288 TRP D CB  1 
ATOM   10399 C CG  . TRP D  2  288 ? 127.526 129.303 167.435 1.00 58.54  ? 288 TRP D CG  1 
ATOM   10400 C CD1 . TRP D  2  288 ? 127.102 130.509 166.973 1.00 58.54  ? 288 TRP D CD1 1 
ATOM   10401 C CD2 . TRP D  2  288 ? 128.262 129.566 168.632 1.00 58.54  ? 288 TRP D CD2 1 
ATOM   10402 N NE1 . TRP D  2  288 ? 127.512 131.510 167.818 1.00 58.54  ? 288 TRP D NE1 1 
ATOM   10403 C CE2 . TRP D  2  288 ? 128.228 130.955 168.844 1.00 58.54  ? 288 TRP D CE2 1 
ATOM   10404 C CE3 . TRP D  2  288 ? 128.938 128.760 169.549 1.00 58.54  ? 288 TRP D CE3 1 
ATOM   10405 C CZ2 . TRP D  2  288 ? 128.846 131.557 169.935 1.00 58.54  ? 288 TRP D CZ2 1 
ATOM   10406 C CZ3 . TRP D  2  288 ? 129.550 129.358 170.630 1.00 58.54  ? 288 TRP D CZ3 1 
ATOM   10407 C CH2 . TRP D  2  288 ? 129.500 130.742 170.815 1.00 58.54  ? 288 TRP D CH2 1 
ATOM   10408 N N   . PHE D  2  289 ? 127.587 125.741 164.607 1.00 54.05  ? 289 PHE D N   1 
ATOM   10409 C CA  . PHE D  2  289 ? 127.425 124.366 164.157 1.00 54.05  ? 289 PHE D CA  1 
ATOM   10410 C C   . PHE D  2  289 ? 128.757 123.768 163.736 1.00 54.05  ? 289 PHE D C   1 
ATOM   10411 O O   . PHE D  2  289 ? 129.062 122.620 164.078 1.00 54.05  ? 289 PHE D O   1 
ATOM   10412 C CB  . PHE D  2  289 ? 126.432 124.296 163.003 1.00 54.05  ? 289 PHE D CB  1 
ATOM   10413 C CG  . PHE D  2  289 ? 126.168 122.902 162.524 1.00 54.05  ? 289 PHE D CG  1 
ATOM   10414 C CD1 . PHE D  2  289 ? 125.319 122.065 163.221 1.00 54.05  ? 289 PHE D CD1 1 
ATOM   10415 C CD2 . PHE D  2  289 ? 126.781 122.422 161.384 1.00 54.05  ? 289 PHE D CD2 1 
ATOM   10416 C CE1 . PHE D  2  289 ? 125.076 120.782 162.780 1.00 54.05  ? 289 PHE D CE1 1 
ATOM   10417 C CE2 . PHE D  2  289 ? 126.539 121.143 160.941 1.00 54.05  ? 289 PHE D CE2 1 
ATOM   10418 C CZ  . PHE D  2  289 ? 125.689 120.321 161.640 1.00 54.05  ? 289 PHE D CZ  1 
ATOM   10419 N N   . ILE D  2  290 ? 129.567 124.528 162.996 1.00 49.39  ? 290 ILE D N   1 
ATOM   10420 C CA  . ILE D  2  290 ? 130.861 124.007 162.568 1.00 49.39  ? 290 ILE D CA  1 
ATOM   10421 C C   . ILE D  2  290 ? 131.769 123.770 163.768 1.00 49.39  ? 290 ILE D C   1 
ATOM   10422 O O   . ILE D  2  290 ? 132.496 122.774 163.820 1.00 49.39  ? 290 ILE D O   1 
ATOM   10423 C CB  . ILE D  2  290 ? 131.512 124.942 161.535 1.00 49.39  ? 290 ILE D CB  1 
ATOM   10424 C CG1 . ILE D  2  290 ? 130.711 124.924 160.235 1.00 49.39  ? 290 ILE D CG1 1 
ATOM   10425 C CG2 . ILE D  2  290 ? 132.946 124.530 161.268 1.00 49.39  ? 290 ILE D CG2 1 
ATOM   10426 C CD1 . ILE D  2  290 ? 131.157 125.958 159.233 1.00 49.39  ? 290 ILE D CD1 1 
ATOM   10427 N N   . ALA D  2  291 ? 131.719 124.654 164.766 1.00 49.06  ? 291 ALA D N   1 
ATOM   10428 C CA  . ALA D  2  291 ? 132.562 124.484 165.944 1.00 49.06  ? 291 ALA D CA  1 
ATOM   10429 C C   . ALA D  2  291 ? 132.183 123.232 166.721 1.00 49.06  ? 291 ALA D C   1 
ATOM   10430 O O   . ALA D  2  291 ? 133.059 122.478 167.156 1.00 49.06  ? 291 ALA D O   1 
ATOM   10431 C CB  . ALA D  2  291 ? 132.472 125.718 166.840 1.00 49.06  ? 291 ALA D CB  1 
ATOM   10432 N N   . VAL D  2  292 ? 130.886 122.979 166.895 1.00 50.63  ? 292 VAL D N   1 
ATOM   10433 C CA  . VAL D  2  292 ? 130.480 121.788 167.637 1.00 50.63  ? 292 VAL D CA  1 
ATOM   10434 C C   . VAL D  2  292 ? 130.787 120.526 166.836 1.00 50.63  ? 292 VAL D C   1 
ATOM   10435 O O   . VAL D  2  292 ? 131.283 119.523 167.380 1.00 50.63  ? 292 VAL D O   1 
ATOM   10436 C CB  . VAL D  2  292 ? 128.993 121.881 168.011 1.00 50.63  ? 292 VAL D CB  1 
ATOM   10437 C CG1 . VAL D  2  292 ? 128.534 120.597 168.672 1.00 50.63  ? 292 VAL D CG1 1 
ATOM   10438 C CG2 . VAL D  2  292 ? 128.769 123.064 168.936 1.00 50.63  ? 292 VAL D CG2 1 
ATOM   10439 N N   . CYS D  2  293 ? 130.485 120.551 165.537 1.00 56.57  ? 293 CYS D N   1 
ATOM   10440 C CA  . CYS D  2  293 ? 130.831 119.451 164.647 1.00 56.57  ? 293 CYS D CA  1 
ATOM   10441 C C   . CYS D  2  293 ? 132.328 119.184 164.644 1.00 56.57  ? 293 CYS D C   1 
ATOM   10442 O O   . CYS D  2  293 ? 132.758 118.058 164.376 1.00 56.57  ? 293 CYS D O   1 
ATOM   10443 C CB  . CYS D  2  293 ? 130.349 119.793 163.239 1.00 56.57  ? 293 CYS D CB  1 
ATOM   10444 S SG  . CYS D  2  293 ? 130.531 118.553 161.944 1.00 56.57  ? 293 CYS D SG  1 
ATOM   10445 N N   . TYR D  2  294 ? 133.129 120.209 164.920 1.00 56.44  ? 294 TYR D N   1 
ATOM   10446 C CA  . TYR D  2  294 ? 134.579 120.112 164.949 1.00 56.44  ? 294 TYR D CA  1 
ATOM   10447 C C   . TYR D  2  294 ? 135.118 119.701 166.310 1.00 56.44  ? 294 TYR D C   1 
ATOM   10448 O O   . TYR D  2  294 ? 136.240 119.192 166.391 1.00 56.44  ? 294 TYR D O   1 
ATOM   10449 C CB  . TYR D  2  294 ? 135.167 121.466 164.547 1.00 56.44  ? 294 TYR D CB  1 
ATOM   10450 C CG  . TYR D  2  294 ? 136.664 121.525 164.448 1.00 56.44  ? 294 TYR D CG  1 
ATOM   10451 C CD1 . TYR D  2  294 ? 137.325 120.999 163.352 1.00 56.44  ? 294 TYR D CD1 1 
ATOM   10452 C CD2 . TYR D  2  294 ? 137.413 122.133 165.439 1.00 56.44  ? 294 TYR D CD2 1 
ATOM   10453 C CE1 . TYR D  2  294 ? 138.691 121.066 163.253 1.00 56.44  ? 294 TYR D CE1 1 
ATOM   10454 C CE2 . TYR D  2  294 ? 138.778 122.204 165.350 1.00 56.44  ? 294 TYR D CE2 1 
ATOM   10455 C CZ  . TYR D  2  294 ? 139.412 121.670 164.255 1.00 56.44  ? 294 TYR D CZ  1 
ATOM   10456 O OH  . TYR D  2  294 ? 140.777 121.742 164.167 1.00 56.44  ? 294 TYR D OH  1 
ATOM   10457 N N   . ALA D  2  295 ? 134.353 119.928 167.374 1.00 54.67  ? 295 ALA D N   1 
ATOM   10458 C CA  . ALA D  2  295 ? 134.769 119.544 168.715 1.00 54.67  ? 295 ALA D CA  1 
ATOM   10459 C C   . ALA D  2  295 ? 134.403 118.109 169.057 1.00 54.67  ? 295 ALA D C   1 
ATOM   10460 O O   . ALA D  2  295 ? 135.104 117.474 169.857 1.00 54.67  ? 295 ALA D O   1 
ATOM   10461 C CB  . ALA D  2  295 ? 134.155 120.489 169.750 1.00 54.67  ? 295 ALA D CB  1 
ATOM   10462 N N   . PHE D  2  296 ? 133.317 117.582 168.485 1.00 52.36  ? 296 PHE D N   1 
ATOM   10463 C CA  . PHE D  2  296 ? 132.966 116.195 168.784 1.00 52.36  ? 296 PHE D CA  1 
ATOM   10464 C C   . PHE D  2  296 ? 134.039 115.211 168.328 1.00 52.36  ? 296 PHE D C   1 
ATOM   10465 O O   . PHE D  2  296 ? 134.258 114.185 168.986 1.00 52.36  ? 296 PHE D O   1 
ATOM   10466 C CB  . PHE D  2  296 ? 131.617 115.825 168.175 1.00 52.36  ? 296 PHE D CB  1 
ATOM   10467 C CG  . PHE D  2  296 ? 130.449 116.249 169.007 1.00 52.36  ? 296 PHE D CG  1 
ATOM   10468 C CD1 . PHE D  2  296 ? 130.638 116.680 170.306 1.00 52.36  ? 296 PHE D CD1 1 
ATOM   10469 C CD2 . PHE D  2  296 ? 129.162 116.175 168.512 1.00 52.36  ? 296 PHE D CD2 1 
ATOM   10470 C CE1 . PHE D  2  296 ? 129.568 117.060 171.085 1.00 52.36  ? 296 PHE D CE1 1 
ATOM   10471 C CE2 . PHE D  2  296 ? 128.087 116.552 169.287 1.00 52.36  ? 296 PHE D CE2 1 
ATOM   10472 C CZ  . PHE D  2  296 ? 128.291 116.997 170.576 1.00 52.36  ? 296 PHE D CZ  1 
ATOM   10473 N N   . VAL D  2  297 ? 134.731 115.498 167.225 1.00 53.66  ? 297 VAL D N   1 
ATOM   10474 C CA  . VAL D  2  297 ? 135.760 114.570 166.768 1.00 53.66  ? 297 VAL D CA  1 
ATOM   10475 C C   . VAL D  2  297 ? 136.965 114.599 167.704 1.00 53.66  ? 297 VAL D C   1 
ATOM   10476 O O   . VAL D  2  297 ? 137.574 113.559 167.983 1.00 53.66  ? 297 VAL D O   1 
ATOM   10477 C CB  . VAL D  2  297 ? 136.148 114.869 165.310 1.00 53.66  ? 297 VAL D CB  1 
ATOM   10478 C CG1 . VAL D  2  297 ? 134.965 114.612 164.400 1.00 53.66  ? 297 VAL D CG1 1 
ATOM   10479 C CG2 . VAL D  2  297 ? 136.613 116.299 165.167 1.00 53.66  ? 2