data_6DBT
# 
_entry.id   6DBT 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.320 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   6DBT         
WWPDB D_1000234339 
EMDB  EMD-7849     
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.details 
_pdbx_database_related.db_id 
_pdbx_database_related.content_type 
EMDB . EMD-7843 'other EM volume'      
EMDB . EMD-7844 'other EM volume'      
EMDB . EMD-7845 'other EM volume'      
EMDB . EMD-7846 'other EM volume'      
EMDB . EMD-7847 'other EM volume'      
EMDB . EMD-7848 'other EM volume'      
EMDB . EMD-7849 'associated EM volume' 
EMDB . EMD-7850 'other EM volume'      
EMDB . EMD-7851 'other EM volume'      
EMDB . EMD-7852 'other EM volume'      
EMDB . EMD-7853 'other EM volume'      
PDB  . 6DBI     unspecified            
PDB  . 6DBJ     unspecified            
PDB  . 6DBL     unspecified            
PDB  . 6DBO     unspecified            
PDB  . 6DBQ     unspecified            
PDB  . 6DBR     unspecified            
PDB  . 6DBU     unspecified            
PDB  . 6DBV     unspecified            
PDB  . 6DBW     unspecified            
PDB  . 6DBX     unspecified            
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.entry_id                        6DBT 
_pdbx_database_status.recvd_initial_deposition_date   2018-05-03 
_pdbx_database_status.SG_entry                        N 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
_audit_author.identifier_ORCID 
'Wu, H.'   1 ? 
'Liao, M.' 2 ? 
'Ru, H.'   3 ? 
'Mi, W.'   4 ? 
# 
_citation.abstract                  ? 
_citation.abstract_id_CAS           ? 
_citation.book_id_ISBN              ? 
_citation.book_publisher            ? 
_citation.book_publisher_city       ? 
_citation.book_title                ? 
_citation.coordinate_linkage        ? 
_citation.country                   US 
_citation.database_id_Medline       ? 
_citation.details                   ? 
_citation.id                        primary 
_citation.journal_abbrev            'Nat. Struct. Mol. Biol.' 
_citation.journal_id_ASTM           ? 
_citation.journal_id_CSD            ? 
_citation.journal_id_ISSN           1545-9985 
_citation.journal_full              ? 
_citation.journal_issue             ? 
_citation.journal_volume            25 
_citation.language                  ? 
_citation.page_first                732 
_citation.page_last                 742 
_citation.title                     'DNA melting initiates the RAG catalytic pathway.' 
_citation.year                      2018 
_citation.database_id_CSD           ? 
_citation.pdbx_database_id_DOI      10.1038/s41594-018-0098-5 
_citation.pdbx_database_id_PubMed   30061602 
_citation.unpublished_flag          ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Ru, H.'       1 ?                   
primary 'Mi, W.'       2 ?                   
primary 'Zhang, P.'    3 ?                   
primary 'Alt, F.W.'    4 ?                   
primary 'Schatz, D.G.' 5 0000-0002-5669-1176 
primary 'Liao, M.'     6 ?                   
primary 'Wu, H.'       7 0000-0002-7281-8579 
# 
_cell.angle_alpha                  90.00 
_cell.angle_alpha_esd              ? 
_cell.angle_beta                   90.00 
_cell.angle_beta_esd               ? 
_cell.angle_gamma                  90.00 
_cell.angle_gamma_esd              ? 
_cell.entry_id                     6DBT 
_cell.details                      ? 
_cell.formula_units_Z              ? 
_cell.length_a                     1 
_cell.length_a_esd                 ? 
_cell.length_b                     1 
_cell.length_b_esd                 ? 
_cell.length_c                     1 
_cell.length_c_esd                 ? 
_cell.volume                       ? 
_cell.volume_esd                   ? 
_cell.Z_PDB                        1 
_cell.reciprocal_angle_alpha       ? 
_cell.reciprocal_angle_beta        ? 
_cell.reciprocal_angle_gamma       ? 
_cell.reciprocal_angle_alpha_esd   ? 
_cell.reciprocal_angle_beta_esd    ? 
_cell.reciprocal_angle_gamma_esd   ? 
_cell.reciprocal_length_a          ? 
_cell.reciprocal_length_b          ? 
_cell.reciprocal_length_c          ? 
_cell.reciprocal_length_a_esd      ? 
_cell.reciprocal_length_b_esd      ? 
_cell.reciprocal_length_c_esd      ? 
_cell.pdbx_unique_axis             ? 
# 
_symmetry.entry_id                         6DBT 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                1 
_symmetry.space_group_name_Hall            ? 
_symmetry.space_group_name_H-M             'P 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'Recombination activating gene 1 - MBP chimera' 131160.047 2 2.3.2.27 ? ? ? 
2 polymer     man 'Recombination activating gene 2'               59435.930  2 ?        ? ? ? 
3 polymer     syn 'Forward strand of 12-RSS substrate DNA'        15364.879  1 ?        ? ? ? 
4 polymer     syn 'Reverse strand of 12-RSS substrate DNA'        15439.880  1 ?        ? ? ? 
5 polymer     syn 'Forward strand of 23-RSS substrate DNA'        18731.996  1 ?        ? ? ? 
6 polymer     syn 'Reverse strand of 23-RSS substrate DNA'        18870.094  1 ?        ? ? ? 
7 non-polymer syn 'ZINC ION'                                      65.409     2 ?        ? ? ? 
8 non-polymer syn 'CALCIUM ION'                                   40.078     4 ?        ? ? ? 
# 
loop_
_entity_name_com.entity_id 
_entity_name_com.name 
1 'MBP,MMBP,Maltodextrin-binding protein,RAG-1' 
2 'V(D)J recombination-activating protein 2'    
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)'        no no 
;MGSSHHHHHHGTKTEEGKLVIWINGDKGYNGLAEVGKKFEKDTGIKVTVEHPDKLEEKFPQVAATGDGPDIIFWAHDRFG
GYAQSGLLAEITPDKAFQDKLYPFTWDAVRYNGKLIAYPIAVEALSLIYNKDLLPNPPKTWEEIPALDKELKAKGKSALM
FNLQEPYFTWPLIAADGGYAFKYENGKYDIKDVGVDNAGAKAGLTFLVDLIKNKHMNADTDYSIAEAAFNKGETAMTING
PWAWSNIDTSKVNYGVTVLPTFKGQPSKPFVGVLSAGINAASPNKELAKEFLENYLLTDEGLEAVNKDKPLGAVALKSYE
EELAKDPRIAATMENAQKGEIMPNIPQMSAFWYAVRTAVINAASGRQTVDEALKDAQTGTDYDIPTTLEVLFQGPLGSRC
QRDHLSTKLIPTEVPADLIRAVTCQVCDHLLSDPVQSPCRHLFCRLCIIRYTHALGPNCPTCNQHLNPSHLIKPAKFFLA
TLSSLPLLCPSEECSDWVRLDSFREHCLNHYREKESQEEQTPSEQNLDGYLPVNKGGRPRQHLLSLTRRAQKHRLRDLKN
QVKTFAEKEEGGDVKSVCLTLFLLALRAGNEHKQADELEAMMQGRGFGLHPAVCLAIRVNTFLSCSQYHKMYRTVKATSG
RQIFQPLHTLRNAEKELLPGFHQFEWQPALKNVSTSWDVGIIDGLSGWTVSVDDVPADTISRRFRYDVALVSALKDLEED
IMEGLRERALDDSMCTSGFTVVVKESCDGMGDVSEKHGSGPAVPEKAVRFSFTIMSISIRLEGEDDGITIFQEQKPNSEL
SCRPLCLMFVDESDHETLTAILGPVVAERKAMMESRLIISVGGLLRSFRFFFRGTGYDEKMVREMEGLEASGSTYICTLC
DSTRAEASQNMVLHSITRSHDENLERYEIWRKNPFSESADELRDRVKGVSAKPFMETQPTLDALHCDIGNATEFYKIFQD
EIGEVYQKPNPSREERRRWRSTLDKQLRKKMKLKPVMRMNGNYARRLMTREAVEAVCELVPSEERREALLKLMDLYLQMK
PVWRSTCPSRDCPDQLCQYSYNSQQFADLLSSMFKYRYDGKITNYLHKTLAHVPEIVERDGSIGAWASEGNESGNKLFRR
FRKMNARQSKTFELEDILKHHWLYTSKYLQKFMEAHKNS
;
;MGSSHHHHHHGTKTEEGKLVIWINGDKGYNGLAEVGKKFEKDTGIKVTVEHPDKLEEKFPQVAATGDGPDIIFWAHDRFG
GYAQSGLLAEITPDKAFQDKLYPFTWDAVRYNGKLIAYPIAVEALSLIYNKDLLPNPPKTWEEIPALDKELKAKGKSALM
FNLQEPYFTWPLIAADGGYAFKYENGKYDIKDVGVDNAGAKAGLTFLVDLIKNKHMNADTDYSIAEAAFNKGETAMTING
PWAWSNIDTSKVNYGVTVLPTFKGQPSKPFVGVLSAGINAASPNKELAKEFLENYLLTDEGLEAVNKDKPLGAVALKSYE
EELAKDPRIAATMENAQKGEIMPNIPQMSAFWYAVRTAVINAASGRQTVDEALKDAQTGTDYDIPTTLEVLFQGPLGSRC
QRDHLSTKLIPTEVPADLIRAVTCQVCDHLLSDPVQSPCRHLFCRLCIIRYTHALGPNCPTCNQHLNPSHLIKPAKFFLA
TLSSLPLLCPSEECSDWVRLDSFREHCLNHYREKESQEEQTPSEQNLDGYLPVNKGGRPRQHLLSLTRRAQKHRLRDLKN
QVKTFAEKEEGGDVKSVCLTLFLLALRAGNEHKQADELEAMMQGRGFGLHPAVCLAIRVNTFLSCSQYHKMYRTVKATSG
RQIFQPLHTLRNAEKELLPGFHQFEWQPALKNVSTSWDVGIIDGLSGWTVSVDDVPADTISRRFRYDVALVSALKDLEED
IMEGLRERALDDSMCTSGFTVVVKESCDGMGDVSEKHGSGPAVPEKAVRFSFTIMSISIRLEGEDDGITIFQEQKPNSEL
SCRPLCLMFVDESDHETLTAILGPVVAERKAMMESRLIISVGGLLRSFRFFFRGTGYDEKMVREMEGLEASGSTYICTLC
DSTRAEASQNMVLHSITRSHDENLERYEIWRKNPFSESADELRDRVKGVSAKPFMETQPTLDALHCDIGNATEFYKIFQD
EIGEVYQKPNPSREERRRWRSTLDKQLRKKMKLKPVMRMNGNYARRLMTREAVEAVCELVPSEERREALLKLMDLYLQMK
PVWRSTCPSRDCPDQLCQYSYNSQQFADLLSSMFKYRYDGKITNYLHKTLAHVPEIVERDGSIGAWASEGNESGNKLFRR
FRKMNARQSKTFELEDILKHHWLYTSKYLQKFMEAHKNS
;
A,C ? 
2 'polypeptide(L)'        no no 
;GGSMSLQPLTAVNCGSLVQPGFSLLDLEGDVYLFGQKGWPKRSCPTGIFGVRIKKGELKLRAISFSNNSSYLPPLRCPAI
AHFEAQDGKPECYLIHGGRTPNNELSSSLYMLSVDSRGCNRKVTLRCEEKELVGDVPSARYGHTLSVINSRGKTACVLFG
GRSYMPPTERTTQNWNSVVDCPPQVYLIDLEFGCCTAHTLPELTDGQSFHVALARQDCVYFLGGHILSSDCRPSRLIRLH
VELLLGSPVLTCTILHEGLTITSAIASPIGYHEYIIFGGYQSETQKRMECTYVGLDDVGVHMESREPPQWTSEISHSRTW
FGGSLGKGTALVAIPSEGNPTPPEAYHFYQVSFQKEQDGEATAQGGSQESTDFEDSAPLEDSEELYFGREPHELEYSSDV
EGDTYNEEDEEDESQTGYWIKCCLSCQVDPNIWEPYYSTELTRPAMIFCSRGEGGHWVHAQCMELPESLLLQLSQDNSKY
FCLDHGGLPKQEMTPPKQMLPVKRVPMKMTHRKAPVSLKMTPAKKTFLRRLFD
;
;GGSMSLQPLTAVNCGSLVQPGFSLLDLEGDVYLFGQKGWPKRSCPTGIFGVRIKKGELKLRAISFSNNSSYLPPLRCPAI
AHFEAQDGKPECYLIHGGRTPNNELSSSLYMLSVDSRGCNRKVTLRCEEKELVGDVPSARYGHTLSVINSRGKTACVLFG
GRSYMPPTERTTQNWNSVVDCPPQVYLIDLEFGCCTAHTLPELTDGQSFHVALARQDCVYFLGGHILSSDCRPSRLIRLH
VELLLGSPVLTCTILHEGLTITSAIASPIGYHEYIIFGGYQSETQKRMECTYVGLDDVGVHMESREPPQWTSEISHSRTW
FGGSLGKGTALVAIPSEGNPTPPEAYHFYQVSFQKEQDGEATAQGGSQESTDFEDSAPLEDSEELYFGREPHELEYSSDV
EGDTYNEEDEEDESQTGYWIKCCLSCQVDPNIWEPYYSTELTRPAMIFCSRGEGGHWVHAQCMELPESLLLQLSQDNSKY
FCLDHGGLPKQEMTPPKQMLPVKRVPMKMTHRKAPVSLKMTPAKKTFLRRLFD
;
B,D ? 
3 polydeoxyribonucleotide no no 
;(DG)(DA)(DT)(DC)(DT)(DG)(DG)(DC)(DC)(DT)(DG)(DT)(DC)(DT)(DT)(DA)(DC)(DA)(DC)(DA)
(DG)(DT)(DG)(DC)(DT)(DA)(DC)(DA)(DG)(DA)(DC)(DT)(DG)(DG)(DA)(DA)(DC)(DA)(DA)(DA)
(DA)(DA)(DC)(DC)(DC)(DT)(DG)(DC)(DA)(DG)
;
GATCTGGCCTGTCTTACACAGTGCTACAGACTGGAACAAAAACCCTGCAG E   ? 
4 polydeoxyribonucleotide no no 
;(DC)(DT)(DG)(DC)(DA)(DG)(DG)(DG)(DT)(DT)(DT)(DT)(DT)(DG)(DT)(DT)(DC)(DC)(DA)(DG)
(DT)(DC)(DT)(DG)(DT)(DA)(DG)(DC)(DA)(DC)(DT)(DG)(DT)(DG)(DT)(DA)(DA)(DG)(DA)(DC)
(DA)(DG)(DG)(DC)(DC)(DA)(DG)(DA)(DT)(DC)
;
CTGCAGGGTTTTTGTTCCAGTCTGTAGCACTGTGTAAGACAGGCCAGATC F   ? 
5 polydeoxyribonucleotide no no 
;(DG)(DA)(DT)(DC)(DT)(DG)(DG)(DC)(DC)(DT)(DG)(DT)(DC)(DT)(DT)(DA)(DC)(DA)(DC)(DA)
(DG)(DT)(DG)(DG)(DT)(DA)(DG)(DT)(DA)(DC)(DT)(DC)(DC)(DA)(DC)(DT)(DG)(DT)(DC)(DT)
(DG)(DG)(DC)(DT)(DG)(DT)(DA)(DC)(DA)(DA)(DA)(DA)(DA)(DC)(DC)(DC)(DT)(DG)(DC)(DA)
(DG)
;
GATCTGGCCTGTCTTACACAGTGGTAGTACTCCACTGTCTGGCTGTACAAAAACCCTGCAG G   ? 
6 polydeoxyribonucleotide no no 
;(DC)(DT)(DG)(DC)(DA)(DG)(DG)(DG)(DT)(DT)(DT)(DT)(DT)(DG)(DT)(DA)(DC)(DA)(DG)(DC)
(DC)(DA)(DG)(DA)(DC)(DA)(DG)(DT)(DG)(DG)(DA)(DG)(DT)(DA)(DC)(DT)(DA)(DC)(DC)(DA)
(DC)(DT)(DG)(DT)(DG)(DT)(DA)(DA)(DG)(DA)(DC)(DA)(DG)(DG)(DC)(DC)(DA)(DG)(DA)(DT)
(DC)
;
CTGCAGGGTTTTTGTACAGCCAGACAGTGGAGTACTACCACTGTGTAAGACAGGCCAGATC H   ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1    MET n 
1 2    GLY n 
1 3    SER n 
1 4    SER n 
1 5    HIS n 
1 6    HIS n 
1 7    HIS n 
1 8    HIS n 
1 9    HIS n 
1 10   HIS n 
1 11   GLY n 
1 12   THR n 
1 13   LYS n 
1 14   THR n 
1 15   GLU n 
1 16   GLU n 
1 17   GLY n 
1 18   LYS n 
1 19   LEU n 
1 20   VAL n 
1 21   ILE n 
1 22   TRP n 
1 23   ILE n 
1 24   ASN n 
1 25   GLY n 
1 26   ASP n 
1 27   LYS n 
1 28   GLY n 
1 29   TYR n 
1 30   ASN n 
1 31   GLY n 
1 32   LEU n 
1 33   ALA n 
1 34   GLU n 
1 35   VAL n 
1 36   GLY n 
1 37   LYS n 
1 38   LYS n 
1 39   PHE n 
1 40   GLU n 
1 41   LYS n 
1 42   ASP n 
1 43   THR n 
1 44   GLY n 
1 45   ILE n 
1 46   LYS n 
1 47   VAL n 
1 48   THR n 
1 49   VAL n 
1 50   GLU n 
1 51   HIS n 
1 52   PRO n 
1 53   ASP n 
1 54   LYS n 
1 55   LEU n 
1 56   GLU n 
1 57   GLU n 
1 58   LYS n 
1 59   PHE n 
1 60   PRO n 
1 61   GLN n 
1 62   VAL n 
1 63   ALA n 
1 64   ALA n 
1 65   THR n 
1 66   GLY n 
1 67   ASP n 
1 68   GLY n 
1 69   PRO n 
1 70   ASP n 
1 71   ILE n 
1 72   ILE n 
1 73   PHE n 
1 74   TRP n 
1 75   ALA n 
1 76   HIS n 
1 77   ASP n 
1 78   ARG n 
1 79   PHE n 
1 80   GLY n 
1 81   GLY n 
1 82   TYR n 
1 83   ALA n 
1 84   GLN n 
1 85   SER n 
1 86   GLY n 
1 87   LEU n 
1 88   LEU n 
1 89   ALA n 
1 90   GLU n 
1 91   ILE n 
1 92   THR n 
1 93   PRO n 
1 94   ASP n 
1 95   LYS n 
1 96   ALA n 
1 97   PHE n 
1 98   GLN n 
1 99   ASP n 
1 100  LYS n 
1 101  LEU n 
1 102  TYR n 
1 103  PRO n 
1 104  PHE n 
1 105  THR n 
1 106  TRP n 
1 107  ASP n 
1 108  ALA n 
1 109  VAL n 
1 110  ARG n 
1 111  TYR n 
1 112  ASN n 
1 113  GLY n 
1 114  LYS n 
1 115  LEU n 
1 116  ILE n 
1 117  ALA n 
1 118  TYR n 
1 119  PRO n 
1 120  ILE n 
1 121  ALA n 
1 122  VAL n 
1 123  GLU n 
1 124  ALA n 
1 125  LEU n 
1 126  SER n 
1 127  LEU n 
1 128  ILE n 
1 129  TYR n 
1 130  ASN n 
1 131  LYS n 
1 132  ASP n 
1 133  LEU n 
1 134  LEU n 
1 135  PRO n 
1 136  ASN n 
1 137  PRO n 
1 138  PRO n 
1 139  LYS n 
1 140  THR n 
1 141  TRP n 
1 142  GLU n 
1 143  GLU n 
1 144  ILE n 
1 145  PRO n 
1 146  ALA n 
1 147  LEU n 
1 148  ASP n 
1 149  LYS n 
1 150  GLU n 
1 151  LEU n 
1 152  LYS n 
1 153  ALA n 
1 154  LYS n 
1 155  GLY n 
1 156  LYS n 
1 157  SER n 
1 158  ALA n 
1 159  LEU n 
1 160  MET n 
1 161  PHE n 
1 162  ASN n 
1 163  LEU n 
1 164  GLN n 
1 165  GLU n 
1 166  PRO n 
1 167  TYR n 
1 168  PHE n 
1 169  THR n 
1 170  TRP n 
1 171  PRO n 
1 172  LEU n 
1 173  ILE n 
1 174  ALA n 
1 175  ALA n 
1 176  ASP n 
1 177  GLY n 
1 178  GLY n 
1 179  TYR n 
1 180  ALA n 
1 181  PHE n 
1 182  LYS n 
1 183  TYR n 
1 184  GLU n 
1 185  ASN n 
1 186  GLY n 
1 187  LYS n 
1 188  TYR n 
1 189  ASP n 
1 190  ILE n 
1 191  LYS n 
1 192  ASP n 
1 193  VAL n 
1 194  GLY n 
1 195  VAL n 
1 196  ASP n 
1 197  ASN n 
1 198  ALA n 
1 199  GLY n 
1 200  ALA n 
1 201  LYS n 
1 202  ALA n 
1 203  GLY n 
1 204  LEU n 
1 205  THR n 
1 206  PHE n 
1 207  LEU n 
1 208  VAL n 
1 209  ASP n 
1 210  LEU n 
1 211  ILE n 
1 212  LYS n 
1 213  ASN n 
1 214  LYS n 
1 215  HIS n 
1 216  MET n 
1 217  ASN n 
1 218  ALA n 
1 219  ASP n 
1 220  THR n 
1 221  ASP n 
1 222  TYR n 
1 223  SER n 
1 224  ILE n 
1 225  ALA n 
1 226  GLU n 
1 227  ALA n 
1 228  ALA n 
1 229  PHE n 
1 230  ASN n 
1 231  LYS n 
1 232  GLY n 
1 233  GLU n 
1 234  THR n 
1 235  ALA n 
1 236  MET n 
1 237  THR n 
1 238  ILE n 
1 239  ASN n 
1 240  GLY n 
1 241  PRO n 
1 242  TRP n 
1 243  ALA n 
1 244  TRP n 
1 245  SER n 
1 246  ASN n 
1 247  ILE n 
1 248  ASP n 
1 249  THR n 
1 250  SER n 
1 251  LYS n 
1 252  VAL n 
1 253  ASN n 
1 254  TYR n 
1 255  GLY n 
1 256  VAL n 
1 257  THR n 
1 258  VAL n 
1 259  LEU n 
1 260  PRO n 
1 261  THR n 
1 262  PHE n 
1 263  LYS n 
1 264  GLY n 
1 265  GLN n 
1 266  PRO n 
1 267  SER n 
1 268  LYS n 
1 269  PRO n 
1 270  PHE n 
1 271  VAL n 
1 272  GLY n 
1 273  VAL n 
1 274  LEU n 
1 275  SER n 
1 276  ALA n 
1 277  GLY n 
1 278  ILE n 
1 279  ASN n 
1 280  ALA n 
1 281  ALA n 
1 282  SER n 
1 283  PRO n 
1 284  ASN n 
1 285  LYS n 
1 286  GLU n 
1 287  LEU n 
1 288  ALA n 
1 289  LYS n 
1 290  GLU n 
1 291  PHE n 
1 292  LEU n 
1 293  GLU n 
1 294  ASN n 
1 295  TYR n 
1 296  LEU n 
1 297  LEU n 
1 298  THR n 
1 299  ASP n 
1 300  GLU n 
1 301  GLY n 
1 302  LEU n 
1 303  GLU n 
1 304  ALA n 
1 305  VAL n 
1 306  ASN n 
1 307  LYS n 
1 308  ASP n 
1 309  LYS n 
1 310  PRO n 
1 311  LEU n 
1 312  GLY n 
1 313  ALA n 
1 314  VAL n 
1 315  ALA n 
1 316  LEU n 
1 317  LYS n 
1 318  SER n 
1 319  TYR n 
1 320  GLU n 
1 321  GLU n 
1 322  GLU n 
1 323  LEU n 
1 324  ALA n 
1 325  LYS n 
1 326  ASP n 
1 327  PRO n 
1 328  ARG n 
1 329  ILE n 
1 330  ALA n 
1 331  ALA n 
1 332  THR n 
1 333  MET n 
1 334  GLU n 
1 335  ASN n 
1 336  ALA n 
1 337  GLN n 
1 338  LYS n 
1 339  GLY n 
1 340  GLU n 
1 341  ILE n 
1 342  MET n 
1 343  PRO n 
1 344  ASN n 
1 345  ILE n 
1 346  PRO n 
1 347  GLN n 
1 348  MET n 
1 349  SER n 
1 350  ALA n 
1 351  PHE n 
1 352  TRP n 
1 353  TYR n 
1 354  ALA n 
1 355  VAL n 
1 356  ARG n 
1 357  THR n 
1 358  ALA n 
1 359  VAL n 
1 360  ILE n 
1 361  ASN n 
1 362  ALA n 
1 363  ALA n 
1 364  SER n 
1 365  GLY n 
1 366  ARG n 
1 367  GLN n 
1 368  THR n 
1 369  VAL n 
1 370  ASP n 
1 371  GLU n 
1 372  ALA n 
1 373  LEU n 
1 374  LYS n 
1 375  ASP n 
1 376  ALA n 
1 377  GLN n 
1 378  THR n 
1 379  GLY n 
1 380  THR n 
1 381  ASP n 
1 382  TYR n 
1 383  ASP n 
1 384  ILE n 
1 385  PRO n 
1 386  THR n 
1 387  THR n 
1 388  LEU n 
1 389  GLU n 
1 390  VAL n 
1 391  LEU n 
1 392  PHE n 
1 393  GLN n 
1 394  GLY n 
1 395  PRO n 
1 396  LEU n 
1 397  GLY n 
1 398  SER n 
1 399  ARG n 
1 400  CYS n 
1 401  GLN n 
1 402  ARG n 
1 403  ASP n 
1 404  HIS n 
1 405  LEU n 
1 406  SER n 
1 407  THR n 
1 408  LYS n 
1 409  LEU n 
1 410  ILE n 
1 411  PRO n 
1 412  THR n 
1 413  GLU n 
1 414  VAL n 
1 415  PRO n 
1 416  ALA n 
1 417  ASP n 
1 418  LEU n 
1 419  ILE n 
1 420  ARG n 
1 421  ALA n 
1 422  VAL n 
1 423  THR n 
1 424  CYS n 
1 425  GLN n 
1 426  VAL n 
1 427  CYS n 
1 428  ASP n 
1 429  HIS n 
1 430  LEU n 
1 431  LEU n 
1 432  SER n 
1 433  ASP n 
1 434  PRO n 
1 435  VAL n 
1 436  GLN n 
1 437  SER n 
1 438  PRO n 
1 439  CYS n 
1 440  ARG n 
1 441  HIS n 
1 442  LEU n 
1 443  PHE n 
1 444  CYS n 
1 445  ARG n 
1 446  LEU n 
1 447  CYS n 
1 448  ILE n 
1 449  ILE n 
1 450  ARG n 
1 451  TYR n 
1 452  THR n 
1 453  HIS n 
1 454  ALA n 
1 455  LEU n 
1 456  GLY n 
1 457  PRO n 
1 458  ASN n 
1 459  CYS n 
1 460  PRO n 
1 461  THR n 
1 462  CYS n 
1 463  ASN n 
1 464  GLN n 
1 465  HIS n 
1 466  LEU n 
1 467  ASN n 
1 468  PRO n 
1 469  SER n 
1 470  HIS n 
1 471  LEU n 
1 472  ILE n 
1 473  LYS n 
1 474  PRO n 
1 475  ALA n 
1 476  LYS n 
1 477  PHE n 
1 478  PHE n 
1 479  LEU n 
1 480  ALA n 
1 481  THR n 
1 482  LEU n 
1 483  SER n 
1 484  SER n 
1 485  LEU n 
1 486  PRO n 
1 487  LEU n 
1 488  LEU n 
1 489  CYS n 
1 490  PRO n 
1 491  SER n 
1 492  GLU n 
1 493  GLU n 
1 494  CYS n 
1 495  SER n 
1 496  ASP n 
1 497  TRP n 
1 498  VAL n 
1 499  ARG n 
1 500  LEU n 
1 501  ASP n 
1 502  SER n 
1 503  PHE n 
1 504  ARG n 
1 505  GLU n 
1 506  HIS n 
1 507  CYS n 
1 508  LEU n 
1 509  ASN n 
1 510  HIS n 
1 511  TYR n 
1 512  ARG n 
1 513  GLU n 
1 514  LYS n 
1 515  GLU n 
1 516  SER n 
1 517  GLN n 
1 518  GLU n 
1 519  GLU n 
1 520  GLN n 
1 521  THR n 
1 522  PRO n 
1 523  SER n 
1 524  GLU n 
1 525  GLN n 
1 526  ASN n 
1 527  LEU n 
1 528  ASP n 
1 529  GLY n 
1 530  TYR n 
1 531  LEU n 
1 532  PRO n 
1 533  VAL n 
1 534  ASN n 
1 535  LYS n 
1 536  GLY n 
1 537  GLY n 
1 538  ARG n 
1 539  PRO n 
1 540  ARG n 
1 541  GLN n 
1 542  HIS n 
1 543  LEU n 
1 544  LEU n 
1 545  SER n 
1 546  LEU n 
1 547  THR n 
1 548  ARG n 
1 549  ARG n 
1 550  ALA n 
1 551  GLN n 
1 552  LYS n 
1 553  HIS n 
1 554  ARG n 
1 555  LEU n 
1 556  ARG n 
1 557  ASP n 
1 558  LEU n 
1 559  LYS n 
1 560  ASN n 
1 561  GLN n 
1 562  VAL n 
1 563  LYS n 
1 564  THR n 
1 565  PHE n 
1 566  ALA n 
1 567  GLU n 
1 568  LYS n 
1 569  GLU n 
1 570  GLU n 
1 571  GLY n 
1 572  GLY n 
1 573  ASP n 
1 574  VAL n 
1 575  LYS n 
1 576  SER n 
1 577  VAL n 
1 578  CYS n 
1 579  LEU n 
1 580  THR n 
1 581  LEU n 
1 582  PHE n 
1 583  LEU n 
1 584  LEU n 
1 585  ALA n 
1 586  LEU n 
1 587  ARG n 
1 588  ALA n 
1 589  GLY n 
1 590  ASN n 
1 591  GLU n 
1 592  HIS n 
1 593  LYS n 
1 594  GLN n 
1 595  ALA n 
1 596  ASP n 
1 597  GLU n 
1 598  LEU n 
1 599  GLU n 
1 600  ALA n 
1 601  MET n 
1 602  MET n 
1 603  GLN n 
1 604  GLY n 
1 605  ARG n 
1 606  GLY n 
1 607  PHE n 
1 608  GLY n 
1 609  LEU n 
1 610  HIS n 
1 611  PRO n 
1 612  ALA n 
1 613  VAL n 
1 614  CYS n 
1 615  LEU n 
1 616  ALA n 
1 617  ILE n 
1 618  ARG n 
1 619  VAL n 
1 620  ASN n 
1 621  THR n 
1 622  PHE n 
1 623  LEU n 
1 624  SER n 
1 625  CYS n 
1 626  SER n 
1 627  GLN n 
1 628  TYR n 
1 629  HIS n 
1 630  LYS n 
1 631  MET n 
1 632  TYR n 
1 633  ARG n 
1 634  THR n 
1 635  VAL n 
1 636  LYS n 
1 637  ALA n 
1 638  THR n 
1 639  SER n 
1 640  GLY n 
1 641  ARG n 
1 642  GLN n 
1 643  ILE n 
1 644  PHE n 
1 645  GLN n 
1 646  PRO n 
1 647  LEU n 
1 648  HIS n 
1 649  THR n 
1 650  LEU n 
1 651  ARG n 
1 652  ASN n 
1 653  ALA n 
1 654  GLU n 
1 655  LYS n 
1 656  GLU n 
1 657  LEU n 
1 658  LEU n 
1 659  PRO n 
1 660  GLY n 
1 661  PHE n 
1 662  HIS n 
1 663  GLN n 
1 664  PHE n 
1 665  GLU n 
1 666  TRP n 
1 667  GLN n 
1 668  PRO n 
1 669  ALA n 
1 670  LEU n 
1 671  LYS n 
1 672  ASN n 
1 673  VAL n 
1 674  SER n 
1 675  THR n 
1 676  SER n 
1 677  TRP n 
1 678  ASP n 
1 679  VAL n 
1 680  GLY n 
1 681  ILE n 
1 682  ILE n 
1 683  ASP n 
1 684  GLY n 
1 685  LEU n 
1 686  SER n 
1 687  GLY n 
1 688  TRP n 
1 689  THR n 
1 690  VAL n 
1 691  SER n 
1 692  VAL n 
1 693  ASP n 
1 694  ASP n 
1 695  VAL n 
1 696  PRO n 
1 697  ALA n 
1 698  ASP n 
1 699  THR n 
1 700  ILE n 
1 701  SER n 
1 702  ARG n 
1 703  ARG n 
1 704  PHE n 
1 705  ARG n 
1 706  TYR n 
1 707  ASP n 
1 708  VAL n 
1 709  ALA n 
1 710  LEU n 
1 711  VAL n 
1 712  SER n 
1 713  ALA n 
1 714  LEU n 
1 715  LYS n 
1 716  ASP n 
1 717  LEU n 
1 718  GLU n 
1 719  GLU n 
1 720  ASP n 
1 721  ILE n 
1 722  MET n 
1 723  GLU n 
1 724  GLY n 
1 725  LEU n 
1 726  ARG n 
1 727  GLU n 
1 728  ARG n 
1 729  ALA n 
1 730  LEU n 
1 731  ASP n 
1 732  ASP n 
1 733  SER n 
1 734  MET n 
1 735  CYS n 
1 736  THR n 
1 737  SER n 
1 738  GLY n 
1 739  PHE n 
1 740  THR n 
1 741  VAL n 
1 742  VAL n 
1 743  VAL n 
1 744  LYS n 
1 745  GLU n 
1 746  SER n 
1 747  CYS n 
1 748  ASP n 
1 749  GLY n 
1 750  MET n 
1 751  GLY n 
1 752  ASP n 
1 753  VAL n 
1 754  SER n 
1 755  GLU n 
1 756  LYS n 
1 757  HIS n 
1 758  GLY n 
1 759  SER n 
1 760  GLY n 
1 761  PRO n 
1 762  ALA n 
1 763  VAL n 
1 764  PRO n 
1 765  GLU n 
1 766  LYS n 
1 767  ALA n 
1 768  VAL n 
1 769  ARG n 
1 770  PHE n 
1 771  SER n 
1 772  PHE n 
1 773  THR n 
1 774  ILE n 
1 775  MET n 
1 776  SER n 
1 777  ILE n 
1 778  SER n 
1 779  ILE n 
1 780  ARG n 
1 781  LEU n 
1 782  GLU n 
1 783  GLY n 
1 784  GLU n 
1 785  ASP n 
1 786  ASP n 
1 787  GLY n 
1 788  ILE n 
1 789  THR n 
1 790  ILE n 
1 791  PHE n 
1 792  GLN n 
1 793  GLU n 
1 794  GLN n 
1 795  LYS n 
1 796  PRO n 
1 797  ASN n 
1 798  SER n 
1 799  GLU n 
1 800  LEU n 
1 801  SER n 
1 802  CYS n 
1 803  ARG n 
1 804  PRO n 
1 805  LEU n 
1 806  CYS n 
1 807  LEU n 
1 808  MET n 
1 809  PHE n 
1 810  VAL n 
1 811  ASP n 
1 812  GLU n 
1 813  SER n 
1 814  ASP n 
1 815  HIS n 
1 816  GLU n 
1 817  THR n 
1 818  LEU n 
1 819  THR n 
1 820  ALA n 
1 821  ILE n 
1 822  LEU n 
1 823  GLY n 
1 824  PRO n 
1 825  VAL n 
1 826  VAL n 
1 827  ALA n 
1 828  GLU n 
1 829  ARG n 
1 830  LYS n 
1 831  ALA n 
1 832  MET n 
1 833  MET n 
1 834  GLU n 
1 835  SER n 
1 836  ARG n 
1 837  LEU n 
1 838  ILE n 
1 839  ILE n 
1 840  SER n 
1 841  VAL n 
1 842  GLY n 
1 843  GLY n 
1 844  LEU n 
1 845  LEU n 
1 846  ARG n 
1 847  SER n 
1 848  PHE n 
1 849  ARG n 
1 850  PHE n 
1 851  PHE n 
1 852  PHE n 
1 853  ARG n 
1 854  GLY n 
1 855  THR n 
1 856  GLY n 
1 857  TYR n 
1 858  ASP n 
1 859  GLU n 
1 860  LYS n 
1 861  MET n 
1 862  VAL n 
1 863  ARG n 
1 864  GLU n 
1 865  MET n 
1 866  GLU n 
1 867  GLY n 
1 868  LEU n 
1 869  GLU n 
1 870  ALA n 
1 871  SER n 
1 872  GLY n 
1 873  SER n 
1 874  THR n 
1 875  TYR n 
1 876  ILE n 
1 877  CYS n 
1 878  THR n 
1 879  LEU n 
1 880  CYS n 
1 881  ASP n 
1 882  SER n 
1 883  THR n 
1 884  ARG n 
1 885  ALA n 
1 886  GLU n 
1 887  ALA n 
1 888  SER n 
1 889  GLN n 
1 890  ASN n 
1 891  MET n 
1 892  VAL n 
1 893  LEU n 
1 894  HIS n 
1 895  SER n 
1 896  ILE n 
1 897  THR n 
1 898  ARG n 
1 899  SER n 
1 900  HIS n 
1 901  ASP n 
1 902  GLU n 
1 903  ASN n 
1 904  LEU n 
1 905  GLU n 
1 906  ARG n 
1 907  TYR n 
1 908  GLU n 
1 909  ILE n 
1 910  TRP n 
1 911  ARG n 
1 912  LYS n 
1 913  ASN n 
1 914  PRO n 
1 915  PHE n 
1 916  SER n 
1 917  GLU n 
1 918  SER n 
1 919  ALA n 
1 920  ASP n 
1 921  GLU n 
1 922  LEU n 
1 923  ARG n 
1 924  ASP n 
1 925  ARG n 
1 926  VAL n 
1 927  LYS n 
1 928  GLY n 
1 929  VAL n 
1 930  SER n 
1 931  ALA n 
1 932  LYS n 
1 933  PRO n 
1 934  PHE n 
1 935  MET n 
1 936  GLU n 
1 937  THR n 
1 938  GLN n 
1 939  PRO n 
1 940  THR n 
1 941  LEU n 
1 942  ASP n 
1 943  ALA n 
1 944  LEU n 
1 945  HIS n 
1 946  CYS n 
1 947  ASP n 
1 948  ILE n 
1 949  GLY n 
1 950  ASN n 
1 951  ALA n 
1 952  THR n 
1 953  GLU n 
1 954  PHE n 
1 955  TYR n 
1 956  LYS n 
1 957  ILE n 
1 958  PHE n 
1 959  GLN n 
1 960  ASP n 
1 961  GLU n 
1 962  ILE n 
1 963  GLY n 
1 964  GLU n 
1 965  VAL n 
1 966  TYR n 
1 967  GLN n 
1 968  LYS n 
1 969  PRO n 
1 970  ASN n 
1 971  PRO n 
1 972  SER n 
1 973  ARG n 
1 974  GLU n 
1 975  GLU n 
1 976  ARG n 
1 977  ARG n 
1 978  ARG n 
1 979  TRP n 
1 980  ARG n 
1 981  SER n 
1 982  THR n 
1 983  LEU n 
1 984  ASP n 
1 985  LYS n 
1 986  GLN n 
1 987  LEU n 
1 988  ARG n 
1 989  LYS n 
1 990  LYS n 
1 991  MET n 
1 992  LYS n 
1 993  LEU n 
1 994  LYS n 
1 995  PRO n 
1 996  VAL n 
1 997  MET n 
1 998  ARG n 
1 999  MET n 
1 1000 ASN n 
1 1001 GLY n 
1 1002 ASN n 
1 1003 TYR n 
1 1004 ALA n 
1 1005 ARG n 
1 1006 ARG n 
1 1007 LEU n 
1 1008 MET n 
1 1009 THR n 
1 1010 ARG n 
1 1011 GLU n 
1 1012 ALA n 
1 1013 VAL n 
1 1014 GLU n 
1 1015 ALA n 
1 1016 VAL n 
1 1017 CYS n 
1 1018 GLU n 
1 1019 LEU n 
1 1020 VAL n 
1 1021 PRO n 
1 1022 SER n 
1 1023 GLU n 
1 1024 GLU n 
1 1025 ARG n 
1 1026 ARG n 
1 1027 GLU n 
1 1028 ALA n 
1 1029 LEU n 
1 1030 LEU n 
1 1031 LYS n 
1 1032 LEU n 
1 1033 MET n 
1 1034 ASP n 
1 1035 LEU n 
1 1036 TYR n 
1 1037 LEU n 
1 1038 GLN n 
1 1039 MET n 
1 1040 LYS n 
1 1041 PRO n 
1 1042 VAL n 
1 1043 TRP n 
1 1044 ARG n 
1 1045 SER n 
1 1046 THR n 
1 1047 CYS n 
1 1048 PRO n 
1 1049 SER n 
1 1050 ARG n 
1 1051 ASP n 
1 1052 CYS n 
1 1053 PRO n 
1 1054 ASP n 
1 1055 GLN n 
1 1056 LEU n 
1 1057 CYS n 
1 1058 GLN n 
1 1059 TYR n 
1 1060 SER n 
1 1061 TYR n 
1 1062 ASN n 
1 1063 SER n 
1 1064 GLN n 
1 1065 GLN n 
1 1066 PHE n 
1 1067 ALA n 
1 1068 ASP n 
1 1069 LEU n 
1 1070 LEU n 
1 1071 SER n 
1 1072 SER n 
1 1073 MET n 
1 1074 PHE n 
1 1075 LYS n 
1 1076 TYR n 
1 1077 ARG n 
1 1078 TYR n 
1 1079 ASP n 
1 1080 GLY n 
1 1081 LYS n 
1 1082 ILE n 
1 1083 THR n 
1 1084 ASN n 
1 1085 TYR n 
1 1086 LEU n 
1 1087 HIS n 
1 1088 LYS n 
1 1089 THR n 
1 1090 LEU n 
1 1091 ALA n 
1 1092 HIS n 
1 1093 VAL n 
1 1094 PRO n 
1 1095 GLU n 
1 1096 ILE n 
1 1097 VAL n 
1 1098 GLU n 
1 1099 ARG n 
1 1100 ASP n 
1 1101 GLY n 
1 1102 SER n 
1 1103 ILE n 
1 1104 GLY n 
1 1105 ALA n 
1 1106 TRP n 
1 1107 ALA n 
1 1108 SER n 
1 1109 GLU n 
1 1110 GLY n 
1 1111 ASN n 
1 1112 GLU n 
1 1113 SER n 
1 1114 GLY n 
1 1115 ASN n 
1 1116 LYS n 
1 1117 LEU n 
1 1118 PHE n 
1 1119 ARG n 
1 1120 ARG n 
1 1121 PHE n 
1 1122 ARG n 
1 1123 LYS n 
1 1124 MET n 
1 1125 ASN n 
1 1126 ALA n 
1 1127 ARG n 
1 1128 GLN n 
1 1129 SER n 
1 1130 LYS n 
1 1131 THR n 
1 1132 PHE n 
1 1133 GLU n 
1 1134 LEU n 
1 1135 GLU n 
1 1136 ASP n 
1 1137 ILE n 
1 1138 LEU n 
1 1139 LYS n 
1 1140 HIS n 
1 1141 HIS n 
1 1142 TRP n 
1 1143 LEU n 
1 1144 TYR n 
1 1145 THR n 
1 1146 SER n 
1 1147 LYS n 
1 1148 TYR n 
1 1149 LEU n 
1 1150 GLN n 
1 1151 LYS n 
1 1152 PHE n 
1 1153 MET n 
1 1154 GLU n 
1 1155 ALA n 
1 1156 HIS n 
1 1157 LYS n 
1 1158 ASN n 
1 1159 SER n 
2 1    GLY n 
2 2    GLY n 
2 3    SER n 
2 4    MET n 
2 5    SER n 
2 6    LEU n 
2 7    GLN n 
2 8    PRO n 
2 9    LEU n 
2 10   THR n 
2 11   ALA n 
2 12   VAL n 
2 13   ASN n 
2 14   CYS n 
2 15   GLY n 
2 16   SER n 
2 17   LEU n 
2 18   VAL n 
2 19   GLN n 
2 20   PRO n 
2 21   GLY n 
2 22   PHE n 
2 23   SER n 
2 24   LEU n 
2 25   LEU n 
2 26   ASP n 
2 27   LEU n 
2 28   GLU n 
2 29   GLY n 
2 30   ASP n 
2 31   VAL n 
2 32   TYR n 
2 33   LEU n 
2 34   PHE n 
2 35   GLY n 
2 36   GLN n 
2 37   LYS n 
2 38   GLY n 
2 39   TRP n 
2 40   PRO n 
2 41   LYS n 
2 42   ARG n 
2 43   SER n 
2 44   CYS n 
2 45   PRO n 
2 46   THR n 
2 47   GLY n 
2 48   ILE n 
2 49   PHE n 
2 50   GLY n 
2 51   VAL n 
2 52   ARG n 
2 53   ILE n 
2 54   LYS n 
2 55   LYS n 
2 56   GLY n 
2 57   GLU n 
2 58   LEU n 
2 59   LYS n 
2 60   LEU n 
2 61   ARG n 
2 62   ALA n 
2 63   ILE n 
2 64   SER n 
2 65   PHE n 
2 66   SER n 
2 67   ASN n 
2 68   ASN n 
2 69   SER n 
2 70   SER n 
2 71   TYR n 
2 72   LEU n 
2 73   PRO n 
2 74   PRO n 
2 75   LEU n 
2 76   ARG n 
2 77   CYS n 
2 78   PRO n 
2 79   ALA n 
2 80   ILE n 
2 81   ALA n 
2 82   HIS n 
2 83   PHE n 
2 84   GLU n 
2 85   ALA n 
2 86   GLN n 
2 87   ASP n 
2 88   GLY n 
2 89   LYS n 
2 90   PRO n 
2 91   GLU n 
2 92   CYS n 
2 93   TYR n 
2 94   LEU n 
2 95   ILE n 
2 96   HIS n 
2 97   GLY n 
2 98   GLY n 
2 99   ARG n 
2 100  THR n 
2 101  PRO n 
2 102  ASN n 
2 103  ASN n 
2 104  GLU n 
2 105  LEU n 
2 106  SER n 
2 107  SER n 
2 108  SER n 
2 109  LEU n 
2 110  TYR n 
2 111  MET n 
2 112  LEU n 
2 113  SER n 
2 114  VAL n 
2 115  ASP n 
2 116  SER n 
2 117  ARG n 
2 118  GLY n 
2 119  CYS n 
2 120  ASN n 
2 121  ARG n 
2 122  LYS n 
2 123  VAL n 
2 124  THR n 
2 125  LEU n 
2 126  ARG n 
2 127  CYS n 
2 128  GLU n 
2 129  GLU n 
2 130  LYS n 
2 131  GLU n 
2 132  LEU n 
2 133  VAL n 
2 134  GLY n 
2 135  ASP n 
2 136  VAL n 
2 137  PRO n 
2 138  SER n 
2 139  ALA n 
2 140  ARG n 
2 141  TYR n 
2 142  GLY n 
2 143  HIS n 
2 144  THR n 
2 145  LEU n 
2 146  SER n 
2 147  VAL n 
2 148  ILE n 
2 149  ASN n 
2 150  SER n 
2 151  ARG n 
2 152  GLY n 
2 153  LYS n 
2 154  THR n 
2 155  ALA n 
2 156  CYS n 
2 157  VAL n 
2 158  LEU n 
2 159  PHE n 
2 160  GLY n 
2 161  GLY n 
2 162  ARG n 
2 163  SER n 
2 164  TYR n 
2 165  MET n 
2 166  PRO n 
2 167  PRO n 
2 168  THR n 
2 169  GLU n 
2 170  ARG n 
2 171  THR n 
2 172  THR n 
2 173  GLN n 
2 174  ASN n 
2 175  TRP n 
2 176  ASN n 
2 177  SER n 
2 178  VAL n 
2 179  VAL n 
2 180  ASP n 
2 181  CYS n 
2 182  PRO n 
2 183  PRO n 
2 184  GLN n 
2 185  VAL n 
2 186  TYR n 
2 187  LEU n 
2 188  ILE n 
2 189  ASP n 
2 190  LEU n 
2 191  GLU n 
2 192  PHE n 
2 193  GLY n 
2 194  CYS n 
2 195  CYS n 
2 196  THR n 
2 197  ALA n 
2 198  HIS n 
2 199  THR n 
2 200  LEU n 
2 201  PRO n 
2 202  GLU n 
2 203  LEU n 
2 204  THR n 
2 205  ASP n 
2 206  GLY n 
2 207  GLN n 
2 208  SER n 
2 209  PHE n 
2 210  HIS n 
2 211  VAL n 
2 212  ALA n 
2 213  LEU n 
2 214  ALA n 
2 215  ARG n 
2 216  GLN n 
2 217  ASP n 
2 218  CYS n 
2 219  VAL n 
2 220  TYR n 
2 221  PHE n 
2 222  LEU n 
2 223  GLY n 
2 224  GLY n 
2 225  HIS n 
2 226  ILE n 
2 227  LEU n 
2 228  SER n 
2 229  SER n 
2 230  ASP n 
2 231  CYS n 
2 232  ARG n 
2 233  PRO n 
2 234  SER n 
2 235  ARG n 
2 236  LEU n 
2 237  ILE n 
2 238  ARG n 
2 239  LEU n 
2 240  HIS n 
2 241  VAL n 
2 242  GLU n 
2 243  LEU n 
2 244  LEU n 
2 245  LEU n 
2 246  GLY n 
2 247  SER n 
2 248  PRO n 
2 249  VAL n 
2 250  LEU n 
2 251  THR n 
2 252  CYS n 
2 253  THR n 
2 254  ILE n 
2 255  LEU n 
2 256  HIS n 
2 257  GLU n 
2 258  GLY n 
2 259  LEU n 
2 260  THR n 
2 261  ILE n 
2 262  THR n 
2 263  SER n 
2 264  ALA n 
2 265  ILE n 
2 266  ALA n 
2 267  SER n 
2 268  PRO n 
2 269  ILE n 
2 270  GLY n 
2 271  TYR n 
2 272  HIS n 
2 273  GLU n 
2 274  TYR n 
2 275  ILE n 
2 276  ILE n 
2 277  PHE n 
2 278  GLY n 
2 279  GLY n 
2 280  TYR n 
2 281  GLN n 
2 282  SER n 
2 283  GLU n 
2 284  THR n 
2 285  GLN n 
2 286  LYS n 
2 287  ARG n 
2 288  MET n 
2 289  GLU n 
2 290  CYS n 
2 291  THR n 
2 292  TYR n 
2 293  VAL n 
2 294  GLY n 
2 295  LEU n 
2 296  ASP n 
2 297  ASP n 
2 298  VAL n 
2 299  GLY n 
2 300  VAL n 
2 301  HIS n 
2 302  MET n 
2 303  GLU n 
2 304  SER n 
2 305  ARG n 
2 306  GLU n 
2 307  PRO n 
2 308  PRO n 
2 309  GLN n 
2 310  TRP n 
2 311  THR n 
2 312  SER n 
2 313  GLU n 
2 314  ILE n 
2 315  SER n 
2 316  HIS n 
2 317  SER n 
2 318  ARG n 
2 319  THR n 
2 320  TRP n 
2 321  PHE n 
2 322  GLY n 
2 323  GLY n 
2 324  SER n 
2 325  LEU n 
2 326  GLY n 
2 327  LYS n 
2 328  GLY n 
2 329  THR n 
2 330  ALA n 
2 331  LEU n 
2 332  VAL n 
2 333  ALA n 
2 334  ILE n 
2 335  PRO n 
2 336  SER n 
2 337  GLU n 
2 338  GLY n 
2 339  ASN n 
2 340  PRO n 
2 341  THR n 
2 342  PRO n 
2 343  PRO n 
2 344  GLU n 
2 345  ALA n 
2 346  TYR n 
2 347  HIS n 
2 348  PHE n 
2 349  TYR n 
2 350  GLN n 
2 351  VAL n 
2 352  SER n 
2 353  PHE n 
2 354  GLN n 
2 355  LYS n 
2 356  GLU n 
2 357  GLN n 
2 358  ASP n 
2 359  GLY n 
2 360  GLU n 
2 361  ALA n 
2 362  THR n 
2 363  ALA n 
2 364  GLN n 
2 365  GLY n 
2 366  GLY n 
2 367  SER n 
2 368  GLN n 
2 369  GLU n 
2 370  SER n 
2 371  THR n 
2 372  ASP n 
2 373  PHE n 
2 374  GLU n 
2 375  ASP n 
2 376  SER n 
2 377  ALA n 
2 378  PRO n 
2 379  LEU n 
2 380  GLU n 
2 381  ASP n 
2 382  SER n 
2 383  GLU n 
2 384  GLU n 
2 385  LEU n 
2 386  TYR n 
2 387  PHE n 
2 388  GLY n 
2 389  ARG n 
2 390  GLU n 
2 391  PRO n 
2 392  HIS n 
2 393  GLU n 
2 394  LEU n 
2 395  GLU n 
2 396  TYR n 
2 397  SER n 
2 398  SER n 
2 399  ASP n 
2 400  VAL n 
2 401  GLU n 
2 402  GLY n 
2 403  ASP n 
2 404  THR n 
2 405  TYR n 
2 406  ASN n 
2 407  GLU n 
2 408  GLU n 
2 409  ASP n 
2 410  GLU n 
2 411  GLU n 
2 412  ASP n 
2 413  GLU n 
2 414  SER n 
2 415  GLN n 
2 416  THR n 
2 417  GLY n 
2 418  TYR n 
2 419  TRP n 
2 420  ILE n 
2 421  LYS n 
2 422  CYS n 
2 423  CYS n 
2 424  LEU n 
2 425  SER n 
2 426  CYS n 
2 427  GLN n 
2 428  VAL n 
2 429  ASP n 
2 430  PRO n 
2 431  ASN n 
2 432  ILE n 
2 433  TRP n 
2 434  GLU n 
2 435  PRO n 
2 436  TYR n 
2 437  TYR n 
2 438  SER n 
2 439  THR n 
2 440  GLU n 
2 441  LEU n 
2 442  THR n 
2 443  ARG n 
2 444  PRO n 
2 445  ALA n 
2 446  MET n 
2 447  ILE n 
2 448  PHE n 
2 449  CYS n 
2 450  SER n 
2 451  ARG n 
2 452  GLY n 
2 453  GLU n 
2 454  GLY n 
2 455  GLY n 
2 456  HIS n 
2 457  TRP n 
2 458  VAL n 
2 459  HIS n 
2 460  ALA n 
2 461  GLN n 
2 462  CYS n 
2 463  MET n 
2 464  GLU n 
2 465  LEU n 
2 466  PRO n 
2 467  GLU n 
2 468  SER n 
2 469  LEU n 
2 470  LEU n 
2 471  LEU n 
2 472  GLN n 
2 473  LEU n 
2 474  SER n 
2 475  GLN n 
2 476  ASP n 
2 477  ASN n 
2 478  SER n 
2 479  LYS n 
2 480  TYR n 
2 481  PHE n 
2 482  CYS n 
2 483  LEU n 
2 484  ASP n 
2 485  HIS n 
2 486  GLY n 
2 487  GLY n 
2 488  LEU n 
2 489  PRO n 
2 490  LYS n 
2 491  GLN n 
2 492  GLU n 
2 493  MET n 
2 494  THR n 
2 495  PRO n 
2 496  PRO n 
2 497  LYS n 
2 498  GLN n 
2 499  MET n 
2 500  LEU n 
2 501  PRO n 
2 502  VAL n 
2 503  LYS n 
2 504  ARG n 
2 505  VAL n 
2 506  PRO n 
2 507  MET n 
2 508  LYS n 
2 509  MET n 
2 510  THR n 
2 511  HIS n 
2 512  ARG n 
2 513  LYS n 
2 514  ALA n 
2 515  PRO n 
2 516  VAL n 
2 517  SER n 
2 518  LEU n 
2 519  LYS n 
2 520  MET n 
2 521  THR n 
2 522  PRO n 
2 523  ALA n 
2 524  LYS n 
2 525  LYS n 
2 526  THR n 
2 527  PHE n 
2 528  LEU n 
2 529  ARG n 
2 530  ARG n 
2 531  LEU n 
2 532  PHE n 
2 533  ASP n 
3 1    DG  n 
3 2    DA  n 
3 3    DT  n 
3 4    DC  n 
3 5    DT  n 
3 6    DG  n 
3 7    DG  n 
3 8    DC  n 
3 9    DC  n 
3 10   DT  n 
3 11   DG  n 
3 12   DT  n 
3 13   DC  n 
3 14   DT  n 
3 15   DT  n 
3 16   DA  n 
3 17   DC  n 
3 18   DA  n 
3 19   DC  n 
3 20   DA  n 
3 21   DG  n 
3 22   DT  n 
3 23   DG  n 
3 24   DC  n 
3 25   DT  n 
3 26   DA  n 
3 27   DC  n 
3 28   DA  n 
3 29   DG  n 
3 30   DA  n 
3 31   DC  n 
3 32   DT  n 
3 33   DG  n 
3 34   DG  n 
3 35   DA  n 
3 36   DA  n 
3 37   DC  n 
3 38   DA  n 
3 39   DA  n 
3 40   DA  n 
3 41   DA  n 
3 42   DA  n 
3 43   DC  n 
3 44   DC  n 
3 45   DC  n 
3 46   DT  n 
3 47   DG  n 
3 48   DC  n 
3 49   DA  n 
3 50   DG  n 
4 1    DC  n 
4 2    DT  n 
4 3    DG  n 
4 4    DC  n 
4 5    DA  n 
4 6    DG  n 
4 7    DG  n 
4 8    DG  n 
4 9    DT  n 
4 10   DT  n 
4 11   DT  n 
4 12   DT  n 
4 13   DT  n 
4 14   DG  n 
4 15   DT  n 
4 16   DT  n 
4 17   DC  n 
4 18   DC  n 
4 19   DA  n 
4 20   DG  n 
4 21   DT  n 
4 22   DC  n 
4 23   DT  n 
4 24   DG  n 
4 25   DT  n 
4 26   DA  n 
4 27   DG  n 
4 28   DC  n 
4 29   DA  n 
4 30   DC  n 
4 31   DT  n 
4 32   DG  n 
4 33   DT  n 
4 34   DG  n 
4 35   DT  n 
4 36   DA  n 
4 37   DA  n 
4 38   DG  n 
4 39   DA  n 
4 40   DC  n 
4 41   DA  n 
4 42   DG  n 
4 43   DG  n 
4 44   DC  n 
4 45   DC  n 
4 46   DA  n 
4 47   DG  n 
4 48   DA  n 
4 49   DT  n 
4 50   DC  n 
5 1    DG  n 
5 2    DA  n 
5 3    DT  n 
5 4    DC  n 
5 5    DT  n 
5 6    DG  n 
5 7    DG  n 
5 8    DC  n 
5 9    DC  n 
5 10   DT  n 
5 11   DG  n 
5 12   DT  n 
5 13   DC  n 
5 14   DT  n 
5 15   DT  n 
5 16   DA  n 
5 17   DC  n 
5 18   DA  n 
5 19   DC  n 
5 20   DA  n 
5 21   DG  n 
5 22   DT  n 
5 23   DG  n 
5 24   DG  n 
5 25   DT  n 
5 26   DA  n 
5 27   DG  n 
5 28   DT  n 
5 29   DA  n 
5 30   DC  n 
5 31   DT  n 
5 32   DC  n 
5 33   DC  n 
5 34   DA  n 
5 35   DC  n 
5 36   DT  n 
5 37   DG  n 
5 38   DT  n 
5 39   DC  n 
5 40   DT  n 
5 41   DG  n 
5 42   DG  n 
5 43   DC  n 
5 44   DT  n 
5 45   DG  n 
5 46   DT  n 
5 47   DA  n 
5 48   DC  n 
5 49   DA  n 
5 50   DA  n 
5 51   DA  n 
5 52   DA  n 
5 53   DA  n 
5 54   DC  n 
5 55   DC  n 
5 56   DC  n 
5 57   DT  n 
5 58   DG  n 
5 59   DC  n 
5 60   DA  n 
5 61   DG  n 
6 1    DC  n 
6 2    DT  n 
6 3    DG  n 
6 4    DC  n 
6 5    DA  n 
6 6    DG  n 
6 7    DG  n 
6 8    DG  n 
6 9    DT  n 
6 10   DT  n 
6 11   DT  n 
6 12   DT  n 
6 13   DT  n 
6 14   DG  n 
6 15   DT  n 
6 16   DA  n 
6 17   DC  n 
6 18   DA  n 
6 19   DG  n 
6 20   DC  n 
6 21   DC  n 
6 22   DA  n 
6 23   DG  n 
6 24   DA  n 
6 25   DC  n 
6 26   DA  n 
6 27   DG  n 
6 28   DT  n 
6 29   DG  n 
6 30   DG  n 
6 31   DA  n 
6 32   DG  n 
6 33   DT  n 
6 34   DA  n 
6 35   DC  n 
6 36   DT  n 
6 37   DA  n 
6 38   DC  n 
6 39   DC  n 
6 40   DA  n 
6 41   DC  n 
6 42   DT  n 
6 43   DG  n 
6 44   DT  n 
6 45   DG  n 
6 46   DT  n 
6 47   DA  n 
6 48   DA  n 
6 49   DG  n 
6 50   DA  n 
6 51   DC  n 
6 52   DA  n 
6 53   DG  n 
6 54   DG  n 
6 55   DC  n 
6 56   DC  n 
6 57   DA  n 
6 58   DG  n 
6 59   DA  n 
6 60   DT  n 
6 61   DC  n 
# 
loop_
_entity_src_gen.entity_id 
_entity_src_gen.pdbx_src_id 
_entity_src_gen.pdbx_alt_source_flag 
_entity_src_gen.pdbx_seq_type 
_entity_src_gen.pdbx_beg_seq_num 
_entity_src_gen.pdbx_end_seq_num 
_entity_src_gen.gene_src_common_name 
_entity_src_gen.gene_src_genus 
_entity_src_gen.pdbx_gene_src_gene 
_entity_src_gen.gene_src_species 
_entity_src_gen.gene_src_strain 
_entity_src_gen.gene_src_tissue 
_entity_src_gen.gene_src_tissue_fraction 
_entity_src_gen.gene_src_details 
_entity_src_gen.pdbx_gene_src_fragment 
_entity_src_gen.pdbx_gene_src_scientific_name 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 
_entity_src_gen.pdbx_gene_src_variant 
_entity_src_gen.pdbx_gene_src_cell_line 
_entity_src_gen.pdbx_gene_src_atcc 
_entity_src_gen.pdbx_gene_src_organ 
_entity_src_gen.pdbx_gene_src_organelle 
_entity_src_gen.pdbx_gene_src_cell 
_entity_src_gen.pdbx_gene_src_cellular_location 
_entity_src_gen.host_org_common_name 
_entity_src_gen.pdbx_host_org_scientific_name 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 
_entity_src_gen.host_org_genus 
_entity_src_gen.pdbx_host_org_gene 
_entity_src_gen.pdbx_host_org_organ 
_entity_src_gen.host_org_species 
_entity_src_gen.pdbx_host_org_tissue 
_entity_src_gen.pdbx_host_org_tissue_fraction 
_entity_src_gen.pdbx_host_org_strain 
_entity_src_gen.pdbx_host_org_variant 
_entity_src_gen.pdbx_host_org_cell_line 
_entity_src_gen.pdbx_host_org_atcc 
_entity_src_gen.pdbx_host_org_culture_collection 
_entity_src_gen.pdbx_host_org_cell 
_entity_src_gen.pdbx_host_org_organelle 
_entity_src_gen.pdbx_host_org_cellular_location 
_entity_src_gen.pdbx_host_org_vector_type 
_entity_src_gen.pdbx_host_org_vector 
_entity_src_gen.host_org_details 
_entity_src_gen.expression_system_id 
_entity_src_gen.plasmid_name 
_entity_src_gen.plasmid_details 
_entity_src_gen.pdbx_description 
1 1 sample 'Biological sequence' 1   398  ?         ? 'malE, b4034, JW3994' ? K12 ? ? ? ? 'Escherichia coli' 83333 ? ? ? ? ? ? ? ? 
'Spodoptera frugiperda' 7108 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
1 2 sample 'Biological sequence' 399 1159 Zebrafish ? rag1                  ? ?   ? ? ? ? 'Danio rerio'      7955  ? ? ? ? ? ? ? ? 
'Spodoptera frugiperda' 7108 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
2 1 sample 'Biological sequence' 1   533  Zebrafish ? rag2                  ? ?   ? ? ? ? 'Danio rerio'      7955  ? ? ? ? ? ? ? ? 
'Spodoptera frugiperda' 7108 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
# 
loop_
_pdbx_entity_src_syn.entity_id 
_pdbx_entity_src_syn.pdbx_src_id 
_pdbx_entity_src_syn.pdbx_alt_source_flag 
_pdbx_entity_src_syn.pdbx_beg_seq_num 
_pdbx_entity_src_syn.pdbx_end_seq_num 
_pdbx_entity_src_syn.organism_scientific 
_pdbx_entity_src_syn.organism_common_name 
_pdbx_entity_src_syn.ncbi_taxonomy_id 
_pdbx_entity_src_syn.details 
3 1 sample 1 50 'Danio rerio' ? 7955 ? 
4 1 sample 1 50 'Danio rerio' ? 7955 ? 
5 1 sample 1 61 'Danio rerio' ? 7955 ? 
6 1 sample 1 61 'Danio rerio' ? 7955 ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_db_isoform 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
1 UNP MALE_ECOLI   P0AEX9 ? 1 
;EEGKLVIWINGDKGYNGLAEVGKKFEKDTGIKVTVEHPDKLEEKFPQVAATGDGPDIIFWAHDRFGGYAQSGLLAEITPD
KAFQDKLYPFTWDAVRYNGKLIAYPIAVEALSLIYNKDLLPNPPKTWEEIPALDKELKAKGKSALMFNLQEPYFTWPLIA
ADGGYAFKYENGKYDIKDVGVDNAGAKAGLTFLVDLIKNKHMNADTDYSIAEAAFNKGETAMTINGPWAWSNIDTSKVNY
GVTVLPTFKGQPSKPFVGVLSAGINAASPNKELAKEFLENYLLTDEGLEAVNKDKPLGAVALKSYEEELAKDPRIAATME
NAQKGEIMPNIPQMSAFWYAVRTAVINAASGRQTVDEALKDAQT
;
29  
2 UNP RAG1_DANRE   O13033 ? 1 
;RCQRDHLSTKLIPTEVPADLIRAVTCQVCDHLLSDPVQSPCRHLFCRLCIIRYTHALGPNCPTCNQHLNPSHLIKPAKFF
LATLSSLPLLCPSEECSDWVRLDSFREHCLNHYREKESQEEQTPSEQNLDGYLPVNKGGRPRQHLLSLTRRAQKHRLRDL
KNQVKTFAEKEEGGDVKSVCLTLFLLALRAGNEHKQADELEAMMQGRGFGLHPAVCLAIRVNTFLSCSQYHKMYRTVKAT
SGRQIFQPLHTLRNAEKELLPGFHQFEWQPALKNVSTSWDVGIIDGLSGWTVSVDDVPADTISRRFRYDVALVSALKDLE
EDIMEGLRERALDDSMCTSGFTVVVKESCDGMGDVSEKHGSGPAVPEKAVRFSFTIMSISIRLEGEDDGITIFQEQKPNS
ELSCRPLCLMFVDESDHETLTAILGPVVAERKAMMESRLIISVGGLLRSFRFFFRGTGYDEKMVREMEGLEASGSTYICT
LCDSTRAEASQNMVLHSITRSHDENLERYEIWRKNPFSESADELRDRVKGVSAKPFMETQPTLDALHCDIGNATEFYKIF
QDEIGEVYQKPNPSREERRRWRSTLDKQLRKKMKLKPVMRMNGNYARRLMTREAVEAVCELVPSEERREALLKLMDLYLQ
MKPVWRSTCPSRDCPDQLCQYSYNSQQFADLLSSMFKYRYDGKITNYLHKTLAHVPEIVERDGSIGAWASEGNESGNKLF
RRFRKMNARQSKTFELEDILKHHWLYTSKYLQKFMEAHKNS
;
271 
3 UNP Q1RLW7_DANRE Q1RLW7 ? 2 
;MSLQPLTAVNCGSLVQPGFSLLDLEGDVYLFGQKGWPKRSCPTGIFGVRIKKGELKLRAISFSNNSSYLPPLRCPAIAHF
EAQDGKPECYLIHGGRTPNNELSSSLYMLSVDSRGCNRKVTLRCEEKELVGDVPSARYGHTLSVINSRGKTACVLFGGRS
YMPPTERTTQNWNSVVDCPPQVYLIDLEFGCCTAHTLPELTDGQSFHVALARQDCVYFLGGHILSSDCRPSRLIRLHVEL
LLGSPVLTCTILHEGLTITSAIASPIGYHEYIIFGGYQSETQKRMECTYVGLDDVGVHMESREPPQWTSEISHSRTWFGG
SLGKGTALVAIPSEGNPTPPEAYHFYQVSFQKEQDGEATAQGGSQESTDFEDSAPLEDSEELYFGREPHELEYSSDVEGD
TYNEEDEEDESQTGYWIKCCLSCQVDPNIWEPYYSTELTRPAMIFCSRGEGGHWVHAQCMELPESLLLQLSQDNSKYFCL
DHGGLPKQEMTPPKQMLPVKRVPMKMTHRKAPVSLKMTPAKKTFLRRLFD
;
1   
4 PDB 6DBT         6DBT   ? 3 ? 1   
5 PDB 6DBT         6DBT   ? 4 ? 1   
6 PDB 6DBT         6DBT   ? 5 ? 1   
7 PDB 6DBT         6DBT   ? 6 ? 1   
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1  1 6DBT A 15  ? 378  ? P0AEX9 29  ? 392  ? -113 250  
2  2 6DBT A 399 ? 1159 ? O13033 271 ? 1031 ? 271  1031 
3  3 6DBT B 4   ? 533  ? Q1RLW7 1   ? 530  ? 1    530  
4  1 6DBT C 15  ? 378  ? P0AEX9 29  ? 392  ? -113 250  
5  2 6DBT C 399 ? 1159 ? O13033 271 ? 1031 ? 271  1031 
6  3 6DBT D 4   ? 533  ? Q1RLW7 1   ? 530  ? 1    530  
7  4 6DBT E 1   ? 50   ? 6DBT   1   ? 50   ? 1    50   
8  5 6DBT F 1   ? 50   ? 6DBT   1   ? 50   ? 1    50   
9  6 6DBT G 1   ? 61   ? 6DBT   1   ? 61   ? 1    61   
10 7 6DBT H 1   ? 61   ? 6DBT   1   ? 61   ? 1    61   
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 6DBT MET A 1   ? UNP P0AEX9 ? ? 'initiating methionine' -127 1  
1 6DBT GLY A 2   ? UNP P0AEX9 ? ? 'expression tag'        -126 2  
1 6DBT SER A 3   ? UNP P0AEX9 ? ? 'expression tag'        -125 3  
1 6DBT SER A 4   ? UNP P0AEX9 ? ? 'expression tag'        -124 4  
1 6DBT HIS A 5   ? UNP P0AEX9 ? ? 'expression tag'        -123 5  
1 6DBT HIS A 6   ? UNP P0AEX9 ? ? 'expression tag'        -122 6  
1 6DBT HIS A 7   ? UNP P0AEX9 ? ? 'expression tag'        -121 7  
1 6DBT HIS A 8   ? UNP P0AEX9 ? ? 'expression tag'        -120 8  
1 6DBT HIS A 9   ? UNP P0AEX9 ? ? 'expression tag'        -119 9  
1 6DBT HIS A 10  ? UNP P0AEX9 ? ? 'expression tag'        -118 10 
1 6DBT GLY A 11  ? UNP P0AEX9 ? ? 'expression tag'        -117 11 
1 6DBT THR A 12  ? UNP P0AEX9 ? ? 'expression tag'        -116 12 
1 6DBT LYS A 13  ? UNP P0AEX9 ? ? 'expression tag'        -115 13 
1 6DBT THR A 14  ? UNP P0AEX9 ? ? 'expression tag'        -114 14 
1 6DBT GLY A 379 ? UNP P0AEX9 ? ? linker                  251  15 
1 6DBT THR A 380 ? UNP P0AEX9 ? ? linker                  252  16 
1 6DBT ASP A 381 ? UNP P0AEX9 ? ? linker                  253  17 
1 6DBT TYR A 382 ? UNP P0AEX9 ? ? linker                  254  18 
1 6DBT ASP A 383 ? UNP P0AEX9 ? ? linker                  255  19 
1 6DBT ILE A 384 ? UNP P0AEX9 ? ? linker                  256  20 
1 6DBT PRO A 385 ? UNP P0AEX9 ? ? linker                  257  21 
1 6DBT THR A 386 ? UNP P0AEX9 ? ? linker                  258  22 
1 6DBT THR A 387 ? UNP P0AEX9 ? ? linker                  259  23 
1 6DBT LEU A 388 ? UNP P0AEX9 ? ? linker                  260  24 
1 6DBT GLU A 389 ? UNP P0AEX9 ? ? linker                  261  25 
1 6DBT VAL A 390 ? UNP P0AEX9 ? ? linker                  262  26 
1 6DBT LEU A 391 ? UNP P0AEX9 ? ? linker                  263  27 
1 6DBT PHE A 392 ? UNP P0AEX9 ? ? linker                  264  28 
1 6DBT GLN A 393 ? UNP P0AEX9 ? ? linker                  265  29 
1 6DBT GLY A 394 ? UNP P0AEX9 ? ? linker                  266  30 
1 6DBT PRO A 395 ? UNP P0AEX9 ? ? linker                  267  31 
1 6DBT LEU A 396 ? UNP P0AEX9 ? ? linker                  268  32 
1 6DBT GLY A 397 ? UNP P0AEX9 ? ? linker                  269  33 
1 6DBT SER A 398 ? UNP P0AEX9 ? ? linker                  270  34 
3 6DBT GLY B 1   ? UNP Q1RLW7 ? ? 'expression tag'        -2   35 
3 6DBT GLY B 2   ? UNP Q1RLW7 ? ? 'expression tag'        -1   36 
3 6DBT SER B 3   ? UNP Q1RLW7 ? ? 'expression tag'        0    37 
4 6DBT MET C 1   ? UNP P0AEX9 ? ? 'initiating methionine' -127 38 
4 6DBT GLY C 2   ? UNP P0AEX9 ? ? 'expression tag'        -126 39 
4 6DBT SER C 3   ? UNP P0AEX9 ? ? 'expression tag'        -125 40 
4 6DBT SER C 4   ? UNP P0AEX9 ? ? 'expression tag'        -124 41 
4 6DBT HIS C 5   ? UNP P0AEX9 ? ? 'expression tag'        -123 42 
4 6DBT HIS C 6   ? UNP P0AEX9 ? ? 'expression tag'        -122 43 
4 6DBT HIS C 7   ? UNP P0AEX9 ? ? 'expression tag'        -121 44 
4 6DBT HIS C 8   ? UNP P0AEX9 ? ? 'expression tag'        -120 45 
4 6DBT HIS C 9   ? UNP P0AEX9 ? ? 'expression tag'        -119 46 
4 6DBT HIS C 10  ? UNP P0AEX9 ? ? 'expression tag'        -118 47 
4 6DBT GLY C 11  ? UNP P0AEX9 ? ? 'expression tag'        -117 48 
4 6DBT THR C 12  ? UNP P0AEX9 ? ? 'expression tag'        -116 49 
4 6DBT LYS C 13  ? UNP P0AEX9 ? ? 'expression tag'        -115 50 
4 6DBT THR C 14  ? UNP P0AEX9 ? ? 'expression tag'        -114 51 
4 6DBT GLY C 379 ? UNP P0AEX9 ? ? linker                  251  52 
4 6DBT THR C 380 ? UNP P0AEX9 ? ? linker                  252  53 
4 6DBT ASP C 381 ? UNP P0AEX9 ? ? linker                  253  54 
4 6DBT TYR C 382 ? UNP P0AEX9 ? ? linker                  254  55 
4 6DBT ASP C 383 ? UNP P0AEX9 ? ? linker                  255  56 
4 6DBT ILE C 384 ? UNP P0AEX9 ? ? linker                  256  57 
4 6DBT PRO C 385 ? UNP P0AEX9 ? ? linker                  257  58 
4 6DBT THR C 386 ? UNP P0AEX9 ? ? linker                  258  59 
4 6DBT THR C 387 ? UNP P0AEX9 ? ? linker                  259  60 
4 6DBT LEU C 388 ? UNP P0AEX9 ? ? linker                  260  61 
4 6DBT GLU C 389 ? UNP P0AEX9 ? ? linker                  261  62 
4 6DBT VAL C 390 ? UNP P0AEX9 ? ? linker                  262  63 
4 6DBT LEU C 391 ? UNP P0AEX9 ? ? linker                  263  64 
4 6DBT PHE C 392 ? UNP P0AEX9 ? ? linker                  264  65 
4 6DBT GLN C 393 ? UNP P0AEX9 ? ? linker                  265  66 
4 6DBT GLY C 394 ? UNP P0AEX9 ? ? linker                  266  67 
4 6DBT PRO C 395 ? UNP P0AEX9 ? ? linker                  267  68 
4 6DBT LEU C 396 ? UNP P0AEX9 ? ? linker                  268  69 
4 6DBT GLY C 397 ? UNP P0AEX9 ? ? linker                  269  70 
4 6DBT SER C 398 ? UNP P0AEX9 ? ? linker                  270  71 
6 6DBT GLY D 1   ? UNP Q1RLW7 ? ? 'expression tag'        -2   72 
6 6DBT GLY D 2   ? UNP Q1RLW7 ? ? 'expression tag'        -1   73 
6 6DBT SER D 3   ? UNP Q1RLW7 ? ? 'expression tag'        0    74 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                              ? 'C3 H7 N O2'      89.093  
ARG 'L-peptide linking' y ARGININE                             ? 'C6 H15 N4 O2 1'  175.209 
ASN 'L-peptide linking' y ASPARAGINE                           ? 'C4 H8 N2 O3'     132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                      ? 'C4 H7 N O4'      133.103 
CA  non-polymer         . 'CALCIUM ION'                        ? 'Ca 2'            40.078  
CYS 'L-peptide linking' y CYSTEINE                             ? 'C3 H7 N O2 S'    121.158 
DA  'DNA linking'       y "2'-DEOXYADENOSINE-5'-MONOPHOSPHATE" ? 'C10 H14 N5 O6 P' 331.222 
DC  'DNA linking'       y "2'-DEOXYCYTIDINE-5'-MONOPHOSPHATE"  ? 'C9 H14 N3 O7 P'  307.197 
DG  'DNA linking'       y "2'-DEOXYGUANOSINE-5'-MONOPHOSPHATE" ? 'C10 H14 N5 O7 P' 347.221 
DT  'DNA linking'       y "THYMIDINE-5'-MONOPHOSPHATE"         ? 'C10 H15 N2 O8 P' 322.208 
GLN 'L-peptide linking' y GLUTAMINE                            ? 'C5 H10 N2 O3'    146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                      ? 'C5 H9 N O4'      147.129 
GLY 'peptide linking'   y GLYCINE                              ? 'C2 H5 N O2'      75.067  
HIS 'L-peptide linking' y HISTIDINE                            ? 'C6 H10 N3 O2 1'  156.162 
ILE 'L-peptide linking' y ISOLEUCINE                           ? 'C6 H13 N O2'     131.173 
LEU 'L-peptide linking' y LEUCINE                              ? 'C6 H13 N O2'     131.173 
LYS 'L-peptide linking' y LYSINE                               ? 'C6 H15 N2 O2 1'  147.195 
MET 'L-peptide linking' y METHIONINE                           ? 'C5 H11 N O2 S'   149.211 
PHE 'L-peptide linking' y PHENYLALANINE                        ? 'C9 H11 N O2'     165.189 
PRO 'L-peptide linking' y PROLINE                              ? 'C5 H9 N O2'      115.130 
SER 'L-peptide linking' y SERINE                               ? 'C3 H7 N O3'      105.093 
THR 'L-peptide linking' y THREONINE                            ? 'C4 H9 N O3'      119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                           ? 'C11 H12 N2 O2'   204.225 
TYR 'L-peptide linking' y TYROSINE                             ? 'C9 H11 N O3'     181.189 
VAL 'L-peptide linking' y VALINE                               ? 'C5 H11 N O2'     117.146 
ZN  non-polymer         . 'ZINC ION'                           ? 'Zn 2'            65.409  
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.entry_id                   6DBT 
_exptl.crystals_number            ? 
_exptl.details                    ? 
_exptl.method                     'ELECTRON MICROSCOPY' 
_exptl.method_details             ? 
# 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.entry_id                                 6DBT 
_refine.pdbx_diffrn_id                           ? 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.ls_number_reflns_obs                     525996 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          0.20 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             271.360 
_refine.ls_d_res_high                            4.300 
_refine.ls_percent_reflns_obs                    99.91 
_refine.ls_R_factor_obs                          0.4190 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.4190 
_refine.ls_R_factor_R_free                       0.4425 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 0.36 
_refine.ls_number_reflns_R_free                  1911 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.B_iso_mean                               ? 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.solvent_model_details                    'FLAT BULK SOLVENT MODEL' 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             1.11 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             0.90 
_refine.pdbx_ls_cross_valid_method               ? 
_refine.details                                  ? 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_method_to_determine_struct          ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       MLHL 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            1.48 
_refine.pdbx_overall_phase_error                 55.61 
_refine.overall_SU_B                             ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
f_bond_d           0.005  ? ? 20772 'X-RAY DIFFRACTION' ? 
f_angle_d          0.806  ? ? 29010 'X-RAY DIFFRACTION' ? 
f_dihedral_angle_d 19.149 ? ? 11720 'X-RAY DIFFRACTION' ? 
f_chiral_restr     0.043  ? ? 3178  'X-RAY DIFFRACTION' ? 
f_plane_restr      0.005  ? ? 2970  'X-RAY DIFFRACTION' ? 
# 
_struct.entry_id                     6DBT 
_struct.title                        'Cryo-EM structure of RAG in complex with 12-RSS and 23-RSS substrate DNAs' 
_struct.pdbx_descriptor              
'Maltose-binding periplasmic protein,V(D)J recombination-activating protein 1, Recombination activating gene 2/DNA Complex' 
_struct.pdbx_model_details           ? 
_struct.pdbx_formula_weight          ? 
_struct.pdbx_formula_weight_method   ? 
_struct.pdbx_model_type_details      ? 
_struct.pdbx_CASP_flag               N 
# 
_struct_keywords.entry_id        6DBT 
_struct_keywords.text            'V(D)J recombination, RAG complex, unmelted RSS, Pre-cleveage complex, recombination-dna complex' 
_struct_keywords.pdbx_keywords   recombination/dna 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 1 ? 
D N N 2 ? 
E N N 3 ? 
F N N 4 ? 
G N N 5 ? 
H N N 6 ? 
I N N 7 ? 
J N N 8 ? 
K N N 8 ? 
L N N 7 ? 
M N N 8 ? 
N N N 8 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  AA1 HIS A 542  ? LEU A 546  ? HIS A 414  LEU A 418  5 ? 5  
HELX_P HELX_P2  AA2 THR A 547  ? GLU A 570  ? THR A 419  GLU A 442  1 ? 24 
HELX_P HELX_P3  AA3 ASP A 573  ? ALA A 588  ? ASP A 445  ALA A 460  1 ? 16 
HELX_P HELX_P4  AA4 GLU A 591  ? MET A 602  ? GLU A 463  MET A 474  1 ? 12 
HELX_P HELX_P5  AA5 HIS A 610  ? ASN A 620  ? HIS A 482  ASN A 492  1 ? 11 
HELX_P HELX_P6  AA6 SER A 624  ? SER A 639  ? SER A 496  SER A 511  1 ? 16 
HELX_P HELX_P7  AA7 PRO A 646  ? GLU A 656  ? PRO A 518  GLU A 528  1 ? 11 
HELX_P HELX_P8  AA8 ARG A 705  ? ARG A 728  ? ARG A 577  ARG A 600  1 ? 24 
HELX_P HELX_P9  AA9 SER A 798  ? CYS A 802  ? SER A 670  CYS A 674  5 ? 5  
HELX_P HELX_P10 AB1 ASP A 814  ? MET A 833  ? ASP A 686  MET A 705  1 ? 20 
HELX_P HELX_P11 AB2 ASP A 858  ? GLY A 867  ? ASP A 730  GLY A 739  1 ? 10 
HELX_P HELX_P12 AB3 ALA A 885  ? ASN A 890  ? ALA A 757  ASN A 762  1 ? 6  
HELX_P HELX_P13 AB4 SER A 899  ? ASN A 913  ? SER A 771  ASN A 785  1 ? 15 
HELX_P HELX_P14 AB5 SER A 918  ? LYS A 927  ? SER A 790  LYS A 799  1 ? 10 
HELX_P HELX_P15 AB6 ASP A 947  ? GLY A 963  ? ASP A 819  GLY A 835  1 ? 17 
HELX_P HELX_P16 AB7 GLU A 974  ? MET A 991  ? GLU A 846  MET A 863  1 ? 18 
HELX_P HELX_P17 AB8 ASN A 1000 ? MET A 1008 ? ASN A 872  MET A 880  1 ? 9  
HELX_P HELX_P18 AB9 THR A 1009 ? GLU A 1018 ? THR A 881  GLU A 890  1 ? 10 
HELX_P HELX_P19 AC1 GLU A 1023 ? LYS A 1040 ? GLU A 895  LYS A 912  1 ? 18 
HELX_P HELX_P20 AC2 LYS A 1040 ? SER A 1045 ? LYS A 912  SER A 917  1 ? 6  
HELX_P HELX_P21 AC3 CYS A 1047 ? CYS A 1052 ? CYS A 919  CYS A 924  1 ? 6  
HELX_P HELX_P22 AC4 CYS A 1052 ? LYS A 1075 ? CYS A 924  LYS A 947  1 ? 24 
HELX_P HELX_P23 AC5 THR A 1083 ? HIS A 1092 ? THR A 955  HIS A 964  1 ? 10 
HELX_P HELX_P24 AC6 HIS A 1092 ? GLY A 1101 ? HIS A 964  GLY A 973  1 ? 10 
HELX_P HELX_P25 AC7 ILE A 1103 ? ALA A 1107 ? ILE A 975  ALA A 979  5 ? 5  
HELX_P HELX_P26 AC8 SER A 1108 ? ASN A 1125 ? SER A 980  ASN A 997  1 ? 18 
HELX_P HELX_P27 AC9 SER A 1129 ? THR A 1145 ? SER A 1001 THR A 1017 1 ? 17 
HELX_P HELX_P28 AD1 SER A 1146 ? MET A 1153 ? SER A 1018 MET A 1025 1 ? 8  
HELX_P HELX_P29 AD2 CYS B 14   ? VAL B 18   ? CYS B 11   VAL B 15   5 ? 5  
HELX_P HELX_P30 AD3 THR B 311  ? SER B 317  ? THR B 308  SER B 314  1 ? 7  
HELX_P HELX_P31 AD4 THR C 547  ? GLU C 569  ? THR C 419  GLU C 441  1 ? 23 
HELX_P HELX_P32 AD5 ASP C 573  ? GLY C 589  ? ASP C 445  GLY C 461  1 ? 17 
HELX_P HELX_P33 AD6 GLU C 591  ? MET C 602  ? GLU C 463  MET C 474  1 ? 12 
HELX_P HELX_P34 AD7 HIS C 610  ? ASN C 620  ? HIS C 482  ASN C 492  1 ? 11 
HELX_P HELX_P35 AD8 SER C 624  ? SER C 639  ? SER C 496  SER C 511  1 ? 16 
HELX_P HELX_P36 AD9 PRO C 646  ? LYS C 655  ? PRO C 518  LYS C 527  1 ? 10 
HELX_P HELX_P37 AE1 ARG C 705  ? LEU C 717  ? ARG C 577  LEU C 589  1 ? 13 
HELX_P HELX_P38 AE2 LEU C 717  ? ALA C 729  ? LEU C 589  ALA C 601  1 ? 13 
HELX_P HELX_P39 AE3 SER C 798  ? CYS C 802  ? SER C 670  CYS C 674  5 ? 5  
HELX_P HELX_P40 AE4 ASP C 814  ? MET C 833  ? ASP C 686  MET C 705  1 ? 20 
HELX_P HELX_P41 AE5 ASP C 858  ? GLU C 866  ? ASP C 730  GLU C 738  1 ? 9  
HELX_P HELX_P42 AE6 THR C 883  ? ASN C 890  ? THR C 755  ASN C 762  1 ? 8  
HELX_P HELX_P43 AE7 SER C 899  ? ASN C 913  ? SER C 771  ASN C 785  1 ? 15 
HELX_P HELX_P44 AE8 SER C 918  ? VAL C 926  ? SER C 790  VAL C 798  1 ? 9  
HELX_P HELX_P45 AE9 ASP C 947  ? GLY C 963  ? ASP C 819  GLY C 835  1 ? 17 
HELX_P HELX_P46 AF1 SER C 972  ? LYS C 990  ? SER C 844  LYS C 862  1 ? 19 
HELX_P HELX_P47 AF2 ASN C 1000 ? MET C 1008 ? ASN C 872  MET C 880  1 ? 9  
HELX_P HELX_P48 AF3 THR C 1009 ? VAL C 1020 ? THR C 881  VAL C 892  1 ? 12 
HELX_P HELX_P49 AF4 GLU C 1023 ? SER C 1045 ? GLU C 895  SER C 917  1 ? 23 
HELX_P HELX_P50 AF5 GLN C 1055 ? MET C 1073 ? GLN C 927  MET C 945  1 ? 19 
HELX_P HELX_P51 AF6 PHE C 1074 ? ARG C 1077 ? PHE C 946  ARG C 949  5 ? 4  
HELX_P HELX_P52 AF7 THR C 1083 ? HIS C 1092 ? THR C 955  HIS C 964  1 ? 10 
HELX_P HELX_P53 AF8 HIS C 1092 ? ASP C 1100 ? HIS C 964  ASP C 972  1 ? 9  
HELX_P HELX_P54 AF9 ILE C 1103 ? ALA C 1107 ? ILE C 975  ALA C 979  5 ? 5  
HELX_P HELX_P55 AG1 SER C 1108 ? ASN C 1125 ? SER C 980  ASN C 997  1 ? 18 
HELX_P HELX_P56 AG2 THR C 1131 ? THR C 1145 ? THR C 1003 THR C 1017 1 ? 15 
HELX_P HELX_P57 AG3 LYS C 1147 ? PHE C 1152 ? LYS C 1019 PHE C 1024 1 ? 6  
HELX_P HELX_P58 AG4 THR D 311  ? SER D 317  ? THR D 308  SER D 314  1 ? 7  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
metalc1   metalc ? ? A CYS 877  SG  ? ? ? 1_555 I ZN .  ZN ? ? A CYS 749 A ZN 1101 1_555 ? ? ? ? ? ? ?               2.465 ? 
metalc2   metalc ? ? A CYS 880  SG  ? ? ? 1_555 I ZN .  ZN ? ? A CYS 752 A ZN 1101 1_555 ? ? ? ? ? ? ?               2.904 ? 
metalc3   metalc ? ? A HIS 1087 NE2 ? ? ? 1_555 I ZN .  ZN ? ? A HIS 959 A ZN 1101 1_555 ? ? ? ? ? ? ?               2.508 ? 
metalc4   metalc ? ? A HIS 1092 NE2 ? ? ? 1_555 I ZN .  ZN ? ? A HIS 964 A ZN 1101 1_555 ? ? ? ? ? ? ?               2.287 ? 
metalc5   metalc ? ? A GLU 1112 OE1 ? ? ? 1_555 J CA .  CA ? ? A GLU 984 A CA 1102 1_555 ? ? ? ? ? ? ?               2.852 ? 
metalc6   metalc ? ? A GLU 1112 OE2 ? ? ? 1_555 J CA .  CA ? ? A GLU 984 A CA 1102 1_555 ? ? ? ? ? ? ?               2.781 ? 
metalc7   metalc ? ? C ASP 858  OD2 ? ? ? 1_555 N CA .  CA ? ? C ASP 730 C CA 1103 1_555 ? ? ? ? ? ? ?               2.703 ? 
metalc8   metalc ? ? C CYS 877  SG  ? ? ? 1_555 L ZN .  ZN ? ? C CYS 749 C ZN 1101 1_555 ? ? ? ? ? ? ?               2.526 ? 
metalc9   metalc ? ? C HIS 1087 NE2 ? ? ? 1_555 L ZN .  ZN ? ? C HIS 959 C ZN 1101 1_555 ? ? ? ? ? ? ?               2.121 ? 
metalc10  metalc ? ? C HIS 1092 NE2 ? ? ? 1_555 L ZN .  ZN ? ? C HIS 964 C ZN 1101 1_555 ? ? ? ? ? ? ?               1.899 ? 
hydrog1   hydrog ? ? E DG  1    N1  ? ? ? 1_555 F DC 50 N3 ? ? E DG  1   F DC 50   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog2   hydrog ? ? E DG  1    N2  ? ? ? 1_555 F DC 50 O2 ? ? E DG  1   F DC 50   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog3   hydrog ? ? E DG  1    O6  ? ? ? 1_555 F DC 50 N4 ? ? E DG  1   F DC 50   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog4   hydrog ? ? E DA  2    N1  ? ? ? 1_555 F DT 49 N3 ? ? E DA  2   F DT 49   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog5   hydrog ? ? E DA  2    N6  ? ? ? 1_555 F DT 49 O4 ? ? E DA  2   F DT 49   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog6   hydrog ? ? E DT  3    N3  ? ? ? 1_555 F DA 48 N1 ? ? E DT  3   F DA 48   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog7   hydrog ? ? E DT  3    O4  ? ? ? 1_555 F DA 48 N6 ? ? E DT  3   F DA 48   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog8   hydrog ? ? E DC  4    N3  ? ? ? 1_555 F DG 47 N1 ? ? E DC  4   F DG 47   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog9   hydrog ? ? E DC  4    N4  ? ? ? 1_555 F DG 47 O6 ? ? E DC  4   F DG 47   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog10  hydrog ? ? E DC  4    O2  ? ? ? 1_555 F DG 47 N2 ? ? E DC  4   F DG 47   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog11  hydrog ? ? E DT  5    N3  ? ? ? 1_555 F DA 46 N1 ? ? E DT  5   F DA 46   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog12  hydrog ? ? E DT  5    O4  ? ? ? 1_555 F DA 46 N6 ? ? E DT  5   F DA 46   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog13  hydrog ? ? E DG  6    N1  ? ? ? 1_555 F DC 45 N3 ? ? E DG  6   F DC 45   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog14  hydrog ? ? E DG  6    N2  ? ? ? 1_555 F DC 45 O2 ? ? E DG  6   F DC 45   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog15  hydrog ? ? E DG  6    O6  ? ? ? 1_555 F DC 45 N4 ? ? E DG  6   F DC 45   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog16  hydrog ? ? E DG  7    N1  ? ? ? 1_555 F DC 44 N3 ? ? E DG  7   F DC 44   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog17  hydrog ? ? E DG  7    N2  ? ? ? 1_555 F DC 44 O2 ? ? E DG  7   F DC 44   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog18  hydrog ? ? E DG  7    O6  ? ? ? 1_555 F DC 44 N4 ? ? E DG  7   F DC 44   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog19  hydrog ? ? E DC  8    N3  ? ? ? 1_555 F DG 43 N1 ? ? E DC  8   F DG 43   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog20  hydrog ? ? E DC  8    N4  ? ? ? 1_555 F DG 43 O6 ? ? E DC  8   F DG 43   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog21  hydrog ? ? E DC  8    O2  ? ? ? 1_555 F DG 43 N2 ? ? E DC  8   F DG 43   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog22  hydrog ? ? E DC  9    N3  ? ? ? 1_555 F DG 42 N1 ? ? E DC  9   F DG 42   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog23  hydrog ? ? E DC  9    N4  ? ? ? 1_555 F DG 42 O6 ? ? E DC  9   F DG 42   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog24  hydrog ? ? E DC  9    O2  ? ? ? 1_555 F DG 42 N2 ? ? E DC  9   F DG 42   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog25  hydrog ? ? E DT  10   N3  ? ? ? 1_555 F DA 41 N1 ? ? E DT  10  F DA 41   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog26  hydrog ? ? E DT  10   O4  ? ? ? 1_555 F DA 41 N6 ? ? E DT  10  F DA 41   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog27  hydrog ? ? E DG  11   N1  ? ? ? 1_555 F DC 40 N3 ? ? E DG  11  F DC 40   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog28  hydrog ? ? E DG  11   N2  ? ? ? 1_555 F DC 40 O2 ? ? E DG  11  F DC 40   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog29  hydrog ? ? E DG  11   O6  ? ? ? 1_555 F DC 40 N4 ? ? E DG  11  F DC 40   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog30  hydrog ? ? E DT  12   N3  ? ? ? 1_555 F DA 39 N1 ? ? E DT  12  F DA 39   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog31  hydrog ? ? E DT  12   O4  ? ? ? 1_555 F DA 39 N6 ? ? E DT  12  F DA 39   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog32  hydrog ? ? E DC  13   N3  ? ? ? 1_555 F DG 38 N1 ? ? E DC  13  F DG 38   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog33  hydrog ? ? E DC  13   N4  ? ? ? 1_555 F DG 38 O6 ? ? E DC  13  F DG 38   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog34  hydrog ? ? E DC  13   O2  ? ? ? 1_555 F DG 38 N2 ? ? E DC  13  F DG 38   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog35  hydrog ? ? E DT  14   N3  ? ? ? 1_555 F DA 37 N1 ? ? E DT  14  F DA 37   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog36  hydrog ? ? E DT  14   O4  ? ? ? 1_555 F DA 37 N6 ? ? E DT  14  F DA 37   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog37  hydrog ? ? E DT  15   N3  ? ? ? 1_555 F DA 36 N1 ? ? E DT  15  F DA 36   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog38  hydrog ? ? E DT  15   O4  ? ? ? 1_555 F DA 36 N6 ? ? E DT  15  F DA 36   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog39  hydrog ? ? E DA  16   N1  ? ? ? 1_555 F DT 35 N3 ? ? E DA  16  F DT 35   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog40  hydrog ? ? E DA  16   N6  ? ? ? 1_555 F DT 35 O4 ? ? E DA  16  F DT 35   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog41  hydrog ? ? E DC  17   N3  ? ? ? 1_555 F DG 34 N1 ? ? E DC  17  F DG 34   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog42  hydrog ? ? E DC  17   N4  ? ? ? 1_555 F DG 34 O6 ? ? E DC  17  F DG 34   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog43  hydrog ? ? E DC  17   O2  ? ? ? 1_555 F DG 34 N2 ? ? E DC  17  F DG 34   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog44  hydrog ? ? E DA  18   N1  ? ? ? 1_555 F DT 33 N3 ? ? E DA  18  F DT 33   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog45  hydrog ? ? E DA  18   N6  ? ? ? 1_555 F DT 33 O4 ? ? E DA  18  F DT 33   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog46  hydrog ? ? E DC  19   N3  ? ? ? 1_555 F DG 32 N1 ? ? E DC  19  F DG 32   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog47  hydrog ? ? E DC  19   N4  ? ? ? 1_555 F DG 32 O6 ? ? E DC  19  F DG 32   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog48  hydrog ? ? E DC  19   O2  ? ? ? 1_555 F DG 32 N2 ? ? E DC  19  F DG 32   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog49  hydrog ? ? E DA  20   N6  ? ? ? 1_555 F DC 30 N3 ? ? E DA  20  F DC 30   1_555 ? ? ? ? ? ? 'DA-DC MISPAIR' ?     ? 
hydrog50  hydrog ? ? E DG  21   N1  ? ? ? 1_555 F DA 29 N1 ? ? E DG  21  F DA 29   1_555 ? ? ? ? ? ? TYPE_8_PAIR     ?     ? 
hydrog51  hydrog ? ? E DG  21   O6  ? ? ? 1_555 F DA 29 N6 ? ? E DG  21  F DA 29   1_555 ? ? ? ? ? ? TYPE_8_PAIR     ?     ? 
hydrog52  hydrog ? ? E DG  21   N1  ? ? ? 1_555 F DC 30 N3 ? ? E DG  21  F DC 30   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog53  hydrog ? ? E DG  21   N2  ? ? ? 1_555 F DC 30 O2 ? ? E DG  21  F DC 30   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog54  hydrog ? ? E DG  21   O6  ? ? ? 1_555 F DC 30 N4 ? ? E DG  21  F DC 30   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog55  hydrog ? ? E DT  22   N3  ? ? ? 1_555 F DA 29 N1 ? ? E DT  22  F DA 29   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog56  hydrog ? ? E DT  22   O4  ? ? ? 1_555 F DA 29 N6 ? ? E DT  22  F DA 29   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog57  hydrog ? ? E DG  23   N1  ? ? ? 1_555 F DC 28 N3 ? ? E DG  23  F DC 28   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog58  hydrog ? ? E DG  23   N2  ? ? ? 1_555 F DC 28 O2 ? ? E DG  23  F DC 28   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog59  hydrog ? ? E DG  23   O6  ? ? ? 1_555 F DC 28 N4 ? ? E DG  23  F DC 28   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog60  hydrog ? ? E DC  24   N3  ? ? ? 1_555 F DG 27 N1 ? ? E DC  24  F DG 27   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog61  hydrog ? ? E DC  24   N4  ? ? ? 1_555 F DG 27 O6 ? ? E DC  24  F DG 27   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog62  hydrog ? ? E DC  24   O2  ? ? ? 1_555 F DG 27 N2 ? ? E DC  24  F DG 27   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog63  hydrog ? ? E DT  25   N3  ? ? ? 1_555 F DA 26 N1 ? ? E DT  25  F DA 26   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog64  hydrog ? ? E DT  25   O4  ? ? ? 1_555 F DA 26 N6 ? ? E DT  25  F DA 26   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog65  hydrog ? ? E DA  26   N1  ? ? ? 1_555 F DT 25 N3 ? ? E DA  26  F DT 25   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog66  hydrog ? ? E DA  26   N6  ? ? ? 1_555 F DT 25 O4 ? ? E DA  26  F DT 25   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog67  hydrog ? ? E DC  27   N3  ? ? ? 1_555 F DG 24 N1 ? ? E DC  27  F DG 24   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog68  hydrog ? ? E DC  27   N4  ? ? ? 1_555 F DG 24 O6 ? ? E DC  27  F DG 24   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog69  hydrog ? ? E DC  27   O2  ? ? ? 1_555 F DG 24 N2 ? ? E DC  27  F DG 24   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog70  hydrog ? ? E DA  28   N1  ? ? ? 1_555 F DT 23 N3 ? ? E DA  28  F DT 23   1_555 ? ? ? ? ? ? 'DA-DT PAIR'    ?     ? 
hydrog71  hydrog ? ? E DG  29   N1  ? ? ? 1_555 F DC 22 N3 ? ? E DG  29  F DC 22   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog72  hydrog ? ? E DG  29   N2  ? ? ? 1_555 F DC 22 O2 ? ? E DG  29  F DC 22   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog73  hydrog ? ? E DG  29   O6  ? ? ? 1_555 F DC 22 N4 ? ? E DG  29  F DC 22   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog74  hydrog ? ? E DA  30   N1  ? ? ? 1_555 F DG 20 N1 ? ? E DA  30  F DG 20   1_555 ? ? ? ? ? ? TYPE_8_PAIR     ?     ? 
hydrog75  hydrog ? ? E DA  30   N6  ? ? ? 1_555 F DG 20 O6 ? ? E DA  30  F DG 20   1_555 ? ? ? ? ? ? TYPE_8_PAIR     ?     ? 
hydrog76  hydrog ? ? E DA  30   N1  ? ? ? 1_555 F DT 21 N3 ? ? E DA  30  F DT 21   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog77  hydrog ? ? E DA  30   N6  ? ? ? 1_555 F DT 21 O4 ? ? E DA  30  F DT 21   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog78  hydrog ? ? E DC  31   N3  ? ? ? 1_555 F DG 20 N1 ? ? E DC  31  F DG 20   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog79  hydrog ? ? E DC  31   N4  ? ? ? 1_555 F DG 20 O6 ? ? E DC  31  F DG 20   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog80  hydrog ? ? E DC  31   O2  ? ? ? 1_555 F DG 20 N2 ? ? E DC  31  F DG 20   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog81  hydrog ? ? E DG  33   N1  ? ? ? 1_555 F DC 18 N3 ? ? E DG  33  F DC 18   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog82  hydrog ? ? E DG  33   N2  ? ? ? 1_555 F DC 18 O2 ? ? E DG  33  F DC 18   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog83  hydrog ? ? E DG  33   O6  ? ? ? 1_555 F DC 18 N4 ? ? E DG  33  F DC 18   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog84  hydrog ? ? E DG  34   N1  ? ? ? 1_555 F DC 17 N3 ? ? E DG  34  F DC 17   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog85  hydrog ? ? E DG  34   N2  ? ? ? 1_555 F DC 17 O2 ? ? E DG  34  F DC 17   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog86  hydrog ? ? E DG  34   O6  ? ? ? 1_555 F DC 17 N4 ? ? E DG  34  F DC 17   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog87  hydrog ? ? E DA  36   N1  ? ? ? 1_555 F DT 15 N3 ? ? E DA  36  F DT 15   1_555 ? ? ? ? ? ? 'DA-DT PAIR'    ?     ? 
hydrog88  hydrog ? ? E DC  37   O2  ? ? ? 1_555 F DG 14 N2 ? ? E DC  37  F DG 14   1_555 ? ? ? ? ? ? 'DC-DG PAIR'    ?     ? 
hydrog89  hydrog ? ? E DA  38   N1  ? ? ? 1_555 F DT 13 N3 ? ? E DA  38  F DT 13   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog90  hydrog ? ? E DA  38   N6  ? ? ? 1_555 F DT 13 O4 ? ? E DA  38  F DT 13   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog91  hydrog ? ? E DA  39   N1  ? ? ? 1_555 F DT 12 N3 ? ? E DA  39  F DT 12   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog92  hydrog ? ? E DA  39   N6  ? ? ? 1_555 F DT 12 O4 ? ? E DA  39  F DT 12   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog93  hydrog ? ? E DA  40   N1  ? ? ? 1_555 F DT 11 N3 ? ? E DA  40  F DT 11   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog94  hydrog ? ? E DA  40   N6  ? ? ? 1_555 F DT 11 O4 ? ? E DA  40  F DT 11   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog95  hydrog ? ? E DA  41   N1  ? ? ? 1_555 F DT 10 N3 ? ? E DA  41  F DT 10   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog96  hydrog ? ? E DA  41   N6  ? ? ? 1_555 F DT 10 O4 ? ? E DA  41  F DT 10   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog97  hydrog ? ? E DA  42   N1  ? ? ? 1_555 F DT 9  N3 ? ? E DA  42  F DT 9    1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog98  hydrog ? ? E DA  42   N6  ? ? ? 1_555 F DT 9  O4 ? ? E DA  42  F DT 9    1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog99  hydrog ? ? E DC  43   N3  ? ? ? 1_555 F DG 8  N1 ? ? E DC  43  F DG 8    1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog100 hydrog ? ? E DC  43   N4  ? ? ? 1_555 F DG 8  O6 ? ? E DC  43  F DG 8    1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog101 hydrog ? ? E DC  43   O2  ? ? ? 1_555 F DG 8  N2 ? ? E DC  43  F DG 8    1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog102 hydrog ? ? E DC  44   N3  ? ? ? 1_555 F DG 7  N1 ? ? E DC  44  F DG 7    1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog103 hydrog ? ? E DC  44   N4  ? ? ? 1_555 F DG 7  O6 ? ? E DC  44  F DG 7    1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog104 hydrog ? ? E DC  44   O2  ? ? ? 1_555 F DG 7  N2 ? ? E DC  44  F DG 7    1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog105 hydrog ? ? E DC  45   N3  ? ? ? 1_555 F DG 6  N2 ? ? E DC  45  F DG 6    1_555 ? ? ? ? ? ? 'DC-DG PAIR'    ?     ? 
hydrog106 hydrog ? ? E DT  46   N3  ? ? ? 1_555 F DA 5  N1 ? ? E DT  46  F DA 5    1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog107 hydrog ? ? E DT  46   O4  ? ? ? 1_555 F DA 5  N6 ? ? E DT  46  F DA 5    1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog108 hydrog ? ? E DG  47   N1  ? ? ? 1_555 F DC 4  N3 ? ? E DG  47  F DC 4    1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog109 hydrog ? ? E DG  47   N2  ? ? ? 1_555 F DC 4  O2 ? ? E DG  47  F DC 4    1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog110 hydrog ? ? E DG  47   O6  ? ? ? 1_555 F DC 4  N4 ? ? E DG  47  F DC 4    1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog111 hydrog ? ? E DC  48   N3  ? ? ? 1_555 F DG 3  N1 ? ? E DC  48  F DG 3    1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog112 hydrog ? ? E DC  48   N4  ? ? ? 1_555 F DG 3  O6 ? ? E DC  48  F DG 3    1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog113 hydrog ? ? E DC  48   O2  ? ? ? 1_555 F DG 3  N2 ? ? E DC  48  F DG 3    1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog114 hydrog ? ? E DG  50   N1  ? ? ? 1_555 F DC 1  N3 ? ? E DG  50  F DC 1    1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog115 hydrog ? ? E DG  50   N2  ? ? ? 1_555 F DC 1  O2 ? ? E DG  50  F DC 1    1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog116 hydrog ? ? E DG  50   O6  ? ? ? 1_555 F DC 1  N4 ? ? E DG  50  F DC 1    1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog117 hydrog ? ? G DG  1    N1  ? ? ? 1_555 H DC 61 N3 ? ? G DG  1   H DC 61   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog118 hydrog ? ? G DG  1    N2  ? ? ? 1_555 H DC 61 O2 ? ? G DG  1   H DC 61   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog119 hydrog ? ? G DG  1    O6  ? ? ? 1_555 H DC 61 N4 ? ? G DG  1   H DC 61   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog120 hydrog ? ? G DA  2    N1  ? ? ? 1_555 H DT 60 N3 ? ? G DA  2   H DT 60   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog121 hydrog ? ? G DA  2    N6  ? ? ? 1_555 H DT 60 O4 ? ? G DA  2   H DT 60   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog122 hydrog ? ? G DT  3    N3  ? ? ? 1_555 H DA 59 N1 ? ? G DT  3   H DA 59   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog123 hydrog ? ? G DT  3    O4  ? ? ? 1_555 H DA 59 N6 ? ? G DT  3   H DA 59   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog124 hydrog ? ? G DT  3    N3  ? ? ? 1_555 H DT 60 O2 ? ? G DT  3   H DT 60   1_555 ? ? ? ? ? ? TYPE_16_PAIR    ?     ? 
hydrog125 hydrog ? ? G DT  3    O4  ? ? ? 1_555 H DT 60 N3 ? ? G DT  3   H DT 60   1_555 ? ? ? ? ? ? TYPE_16_PAIR    ?     ? 
hydrog126 hydrog ? ? G DC  4    N3  ? ? ? 1_555 H DG 58 N1 ? ? G DC  4   H DG 58   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog127 hydrog ? ? G DC  4    N4  ? ? ? 1_555 H DG 58 O6 ? ? G DC  4   H DG 58   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog128 hydrog ? ? G DC  4    O2  ? ? ? 1_555 H DG 58 N2 ? ? G DC  4   H DG 58   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog129 hydrog ? ? G DT  5    N3  ? ? ? 1_555 H DA 57 N1 ? ? G DT  5   H DA 57   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog130 hydrog ? ? G DT  5    O4  ? ? ? 1_555 H DA 57 N6 ? ? G DT  5   H DA 57   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog131 hydrog ? ? G DG  6    N1  ? ? ? 1_555 H DC 56 N3 ? ? G DG  6   H DC 56   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog132 hydrog ? ? G DG  6    N2  ? ? ? 1_555 H DC 56 O2 ? ? G DG  6   H DC 56   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog133 hydrog ? ? G DG  6    O6  ? ? ? 1_555 H DC 56 N4 ? ? G DG  6   H DC 56   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog134 hydrog ? ? G DG  7    N1  ? ? ? 1_555 H DC 55 N3 ? ? G DG  7   H DC 55   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog135 hydrog ? ? G DG  7    N2  ? ? ? 1_555 H DC 55 O2 ? ? G DG  7   H DC 55   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog136 hydrog ? ? G DG  7    O6  ? ? ? 1_555 H DC 55 N4 ? ? G DG  7   H DC 55   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog137 hydrog ? ? G DC  8    N3  ? ? ? 1_555 H DG 54 N1 ? ? G DC  8   H DG 54   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog138 hydrog ? ? G DC  8    N4  ? ? ? 1_555 H DG 54 O6 ? ? G DC  8   H DG 54   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog139 hydrog ? ? G DC  8    O2  ? ? ? 1_555 H DG 54 N2 ? ? G DC  8   H DG 54   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog140 hydrog ? ? G DC  9    N3  ? ? ? 1_555 H DG 53 N1 ? ? G DC  9   H DG 53   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog141 hydrog ? ? G DC  9    N4  ? ? ? 1_555 H DG 53 O6 ? ? G DC  9   H DG 53   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog142 hydrog ? ? G DC  9    O2  ? ? ? 1_555 H DG 53 N2 ? ? G DC  9   H DG 53   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog143 hydrog ? ? G DT  10   N3  ? ? ? 1_555 H DA 52 N1 ? ? G DT  10  H DA 52   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog144 hydrog ? ? G DT  10   O4  ? ? ? 1_555 H DA 52 N6 ? ? G DT  10  H DA 52   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog145 hydrog ? ? G DG  11   N1  ? ? ? 1_555 H DC 51 N3 ? ? G DG  11  H DC 51   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog146 hydrog ? ? G DG  11   N2  ? ? ? 1_555 H DC 51 O2 ? ? G DG  11  H DC 51   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog147 hydrog ? ? G DG  11   O6  ? ? ? 1_555 H DC 51 N4 ? ? G DG  11  H DC 51   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog148 hydrog ? ? G DT  12   N3  ? ? ? 1_555 H DA 50 N1 ? ? G DT  12  H DA 50   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog149 hydrog ? ? G DT  12   O4  ? ? ? 1_555 H DA 50 N6 ? ? G DT  12  H DA 50   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog150 hydrog ? ? G DC  13   N3  ? ? ? 1_555 H DG 49 N1 ? ? G DC  13  H DG 49   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog151 hydrog ? ? G DC  13   N4  ? ? ? 1_555 H DG 49 O6 ? ? G DC  13  H DG 49   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog152 hydrog ? ? G DC  13   O2  ? ? ? 1_555 H DG 49 N2 ? ? G DC  13  H DG 49   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog153 hydrog ? ? G DT  14   N3  ? ? ? 1_555 H DA 48 N1 ? ? G DT  14  H DA 48   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog154 hydrog ? ? G DT  14   O4  ? ? ? 1_555 H DA 48 N6 ? ? G DT  14  H DA 48   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog155 hydrog ? ? G DT  15   N3  ? ? ? 1_555 H DA 47 N1 ? ? G DT  15  H DA 47   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog156 hydrog ? ? G DT  15   O4  ? ? ? 1_555 H DA 47 N6 ? ? G DT  15  H DA 47   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog157 hydrog ? ? G DA  16   N1  ? ? ? 1_555 H DT 46 N3 ? ? G DA  16  H DT 46   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog158 hydrog ? ? G DA  16   N6  ? ? ? 1_555 H DT 46 O4 ? ? G DA  16  H DT 46   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog159 hydrog ? ? G DC  17   N3  ? ? ? 1_555 H DG 45 N1 ? ? G DC  17  H DG 45   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog160 hydrog ? ? G DC  17   N4  ? ? ? 1_555 H DG 45 O6 ? ? G DC  17  H DG 45   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog161 hydrog ? ? G DC  17   O2  ? ? ? 1_555 H DG 45 N2 ? ? G DC  17  H DG 45   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog162 hydrog ? ? G DA  18   N1  ? ? ? 1_555 H DT 44 N3 ? ? G DA  18  H DT 44   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog163 hydrog ? ? G DA  18   N6  ? ? ? 1_555 H DT 44 O4 ? ? G DA  18  H DT 44   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog164 hydrog ? ? G DC  19   N3  ? ? ? 1_555 H DG 43 N1 ? ? G DC  19  H DG 43   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog165 hydrog ? ? G DC  19   N4  ? ? ? 1_555 H DG 43 O6 ? ? G DC  19  H DG 43   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog166 hydrog ? ? G DC  19   O2  ? ? ? 1_555 H DG 43 N2 ? ? G DC  19  H DG 43   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog167 hydrog ? ? G DA  20   N1  ? ? ? 1_555 H DT 42 N3 ? ? G DA  20  H DT 42   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog168 hydrog ? ? G DA  20   N6  ? ? ? 1_555 H DT 42 O4 ? ? G DA  20  H DT 42   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog169 hydrog ? ? G DG  21   N1  ? ? ? 1_555 H DA 40 N1 ? ? G DG  21  H DA 40   1_555 ? ? ? ? ? ? TYPE_8_PAIR     ?     ? 
hydrog170 hydrog ? ? G DG  21   O6  ? ? ? 1_555 H DA 40 N6 ? ? G DG  21  H DA 40   1_555 ? ? ? ? ? ? TYPE_8_PAIR     ?     ? 
hydrog171 hydrog ? ? G DG  21   N1  ? ? ? 1_555 H DC 41 N3 ? ? G DG  21  H DC 41   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog172 hydrog ? ? G DG  21   N2  ? ? ? 1_555 H DC 41 O2 ? ? G DG  21  H DC 41   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog173 hydrog ? ? G DG  21   O6  ? ? ? 1_555 H DC 41 N4 ? ? G DG  21  H DC 41   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog174 hydrog ? ? G DT  22   N3  ? ? ? 1_555 H DA 40 N1 ? ? G DT  22  H DA 40   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog175 hydrog ? ? G DT  22   O4  ? ? ? 1_555 H DA 40 N6 ? ? G DT  22  H DA 40   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog176 hydrog ? ? G DG  23   N1  ? ? ? 1_555 H DC 39 N3 ? ? G DG  23  H DC 39   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog177 hydrog ? ? G DG  23   N2  ? ? ? 1_555 H DC 39 O2 ? ? G DG  23  H DC 39   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog178 hydrog ? ? G DG  23   O6  ? ? ? 1_555 H DC 39 N4 ? ? G DG  23  H DC 39   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog179 hydrog ? ? G DG  24   N1  ? ? ? 1_555 H DC 38 N3 ? ? G DG  24  H DC 38   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog180 hydrog ? ? G DG  24   N2  ? ? ? 1_555 H DC 38 O2 ? ? G DG  24  H DC 38   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog181 hydrog ? ? G DG  24   O6  ? ? ? 1_555 H DC 38 N4 ? ? G DG  24  H DC 38   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog182 hydrog ? ? G DT  25   N3  ? ? ? 1_555 H DA 37 N1 ? ? G DT  25  H DA 37   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog183 hydrog ? ? G DT  25   O4  ? ? ? 1_555 H DA 37 N6 ? ? G DT  25  H DA 37   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog184 hydrog ? ? G DA  26   N1  ? ? ? 1_555 H DT 36 N3 ? ? G DA  26  H DT 36   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog185 hydrog ? ? G DA  26   N6  ? ? ? 1_555 H DT 36 O4 ? ? G DA  26  H DT 36   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog186 hydrog ? ? G DG  27   N1  ? ? ? 1_555 H DC 35 N3 ? ? G DG  27  H DC 35   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog187 hydrog ? ? G DG  27   N2  ? ? ? 1_555 H DC 35 O2 ? ? G DG  27  H DC 35   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog188 hydrog ? ? G DG  27   O6  ? ? ? 1_555 H DC 35 N4 ? ? G DG  27  H DC 35   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog189 hydrog ? ? G DT  28   N3  ? ? ? 1_555 H DA 34 N1 ? ? G DT  28  H DA 34   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog190 hydrog ? ? G DT  28   O4  ? ? ? 1_555 H DA 34 N6 ? ? G DT  28  H DA 34   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog191 hydrog ? ? G DA  29   N1  ? ? ? 1_555 H DT 33 N3 ? ? G DA  29  H DT 33   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog192 hydrog ? ? G DA  29   N6  ? ? ? 1_555 H DT 33 O4 ? ? G DA  29  H DT 33   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog193 hydrog ? ? G DC  30   N3  ? ? ? 1_555 H DG 32 N1 ? ? G DC  30  H DG 32   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog194 hydrog ? ? G DC  30   N4  ? ? ? 1_555 H DG 32 O6 ? ? G DC  30  H DG 32   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog195 hydrog ? ? G DC  30   O2  ? ? ? 1_555 H DG 32 N2 ? ? G DC  30  H DG 32   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog196 hydrog ? ? G DT  31   N3  ? ? ? 1_555 H DA 31 N1 ? ? G DT  31  H DA 31   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog197 hydrog ? ? G DT  31   O4  ? ? ? 1_555 H DA 31 N6 ? ? G DT  31  H DA 31   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog198 hydrog ? ? G DC  32   N3  ? ? ? 1_555 H DG 30 N1 ? ? G DC  32  H DG 30   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog199 hydrog ? ? G DC  32   N4  ? ? ? 1_555 H DG 30 O6 ? ? G DC  32  H DG 30   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog200 hydrog ? ? G DC  32   O2  ? ? ? 1_555 H DG 30 N2 ? ? G DC  32  H DG 30   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog201 hydrog ? ? G DC  33   N3  ? ? ? 1_555 H DG 29 N1 ? ? G DC  33  H DG 29   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog202 hydrog ? ? G DC  33   N4  ? ? ? 1_555 H DG 29 O6 ? ? G DC  33  H DG 29   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog203 hydrog ? ? G DC  33   O2  ? ? ? 1_555 H DG 29 N2 ? ? G DC  33  H DG 29   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog204 hydrog ? ? G DA  34   N1  ? ? ? 1_555 H DT 28 N3 ? ? G DA  34  H DT 28   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog205 hydrog ? ? G DA  34   N6  ? ? ? 1_555 H DT 28 O4 ? ? G DA  34  H DT 28   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog206 hydrog ? ? G DT  36   N3  ? ? ? 1_555 H DA 26 N1 ? ? G DT  36  H DA 26   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog207 hydrog ? ? G DT  36   O4  ? ? ? 1_555 H DA 26 N6 ? ? G DT  36  H DA 26   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog208 hydrog ? ? G DT  36   N3  ? ? ? 1_555 H DG 27 O6 ? ? G DT  36  H DG 27   1_555 ? ? ? ? ? ? TYPE_28_PAIR    ?     ? 
hydrog209 hydrog ? ? G DT  36   O2  ? ? ? 1_555 H DG 27 N1 ? ? G DT  36  H DG 27   1_555 ? ? ? ? ? ? TYPE_28_PAIR    ?     ? 
hydrog210 hydrog ? ? G DG  37   N1  ? ? ? 1_555 H DA 24 N1 ? ? G DG  37  H DA 24   1_555 ? ? ? ? ? ? TYPE_8_PAIR     ?     ? 
hydrog211 hydrog ? ? G DG  37   O6  ? ? ? 1_555 H DA 24 N6 ? ? G DG  37  H DA 24   1_555 ? ? ? ? ? ? TYPE_8_PAIR     ?     ? 
hydrog212 hydrog ? ? G DG  37   N1  ? ? ? 1_555 H DC 25 N3 ? ? G DG  37  H DC 25   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog213 hydrog ? ? G DG  37   N2  ? ? ? 1_555 H DC 25 O2 ? ? G DG  37  H DC 25   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog214 hydrog ? ? G DG  37   O6  ? ? ? 1_555 H DC 25 N4 ? ? G DG  37  H DC 25   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog215 hydrog ? ? G DT  38   N3  ? ? ? 1_555 H DA 24 N1 ? ? G DT  38  H DA 24   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog216 hydrog ? ? G DT  38   O4  ? ? ? 1_555 H DA 24 N6 ? ? G DT  38  H DA 24   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog217 hydrog ? ? G DC  39   N3  ? ? ? 1_555 H DG 23 N1 ? ? G DC  39  H DG 23   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog218 hydrog ? ? G DC  39   N4  ? ? ? 1_555 H DG 23 O6 ? ? G DC  39  H DG 23   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog219 hydrog ? ? G DC  39   O2  ? ? ? 1_555 H DG 23 N2 ? ? G DC  39  H DG 23   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog220 hydrog ? ? G DT  40   N3  ? ? ? 1_555 H DA 22 N1 ? ? G DT  40  H DA 22   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog221 hydrog ? ? G DT  40   O4  ? ? ? 1_555 H DA 22 N6 ? ? G DT  40  H DA 22   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog222 hydrog ? ? G DG  41   N1  ? ? ? 1_555 H DC 21 N3 ? ? G DG  41  H DC 21   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog223 hydrog ? ? G DG  41   N2  ? ? ? 1_555 H DC 21 O2 ? ? G DG  41  H DC 21   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog224 hydrog ? ? G DG  41   O6  ? ? ? 1_555 H DC 21 N4 ? ? G DG  41  H DC 21   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog225 hydrog ? ? G DG  42   N1  ? ? ? 1_555 H DC 20 N3 ? ? G DG  42  H DC 20   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog226 hydrog ? ? G DG  42   N2  ? ? ? 1_555 H DC 20 O2 ? ? G DG  42  H DC 20   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog227 hydrog ? ? G DG  42   O6  ? ? ? 1_555 H DC 20 N4 ? ? G DG  42  H DC 20   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog228 hydrog ? ? G DC  43   N3  ? ? ? 1_555 H DG 19 N1 ? ? G DC  43  H DG 19   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog229 hydrog ? ? G DC  43   N4  ? ? ? 1_555 H DG 19 O6 ? ? G DC  43  H DG 19   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog230 hydrog ? ? G DC  43   O2  ? ? ? 1_555 H DG 19 N2 ? ? G DC  43  H DG 19   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog231 hydrog ? ? G DT  44   O4  ? ? ? 1_555 H DC 17 N4 ? ? G DT  44  H DC 17   1_555 ? ? ? ? ? ? 'DT-DC MISPAIR' ?     ? 
hydrog232 hydrog ? ? G DG  45   N1  ? ? ? 1_555 H DC 17 N3 ? ? G DG  45  H DC 17   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog233 hydrog ? ? G DG  45   N2  ? ? ? 1_555 H DC 17 O2 ? ? G DG  45  H DC 17   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog234 hydrog ? ? G DG  45   O6  ? ? ? 1_555 H DC 17 N4 ? ? G DG  45  H DC 17   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog235 hydrog ? ? G DT  46   N3  ? ? ? 1_555 H DA 16 N1 ? ? G DT  46  H DA 16   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog236 hydrog ? ? G DT  46   O4  ? ? ? 1_555 H DA 16 N6 ? ? G DT  46  H DA 16   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog237 hydrog ? ? G DA  47   N1  ? ? ? 1_555 H DT 15 N3 ? ? G DA  47  H DT 15   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog238 hydrog ? ? G DA  47   N6  ? ? ? 1_555 H DT 15 O4 ? ? G DA  47  H DT 15   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog239 hydrog ? ? G DC  48   N3  ? ? ? 1_555 H DG 14 N1 ? ? G DC  48  H DG 14   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog240 hydrog ? ? G DC  48   N4  ? ? ? 1_555 H DG 14 O6 ? ? G DC  48  H DG 14   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog241 hydrog ? ? G DC  48   O2  ? ? ? 1_555 H DG 14 N2 ? ? G DC  48  H DG 14   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog242 hydrog ? ? G DA  49   N1  ? ? ? 1_555 H DT 13 N3 ? ? G DA  49  H DT 13   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog243 hydrog ? ? G DA  49   N6  ? ? ? 1_555 H DT 13 O4 ? ? G DA  49  H DT 13   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog244 hydrog ? ? G DA  50   N1  ? ? ? 1_555 H DT 12 N3 ? ? G DA  50  H DT 12   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog245 hydrog ? ? G DA  50   N6  ? ? ? 1_555 H DT 12 O4 ? ? G DA  50  H DT 12   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog246 hydrog ? ? G DA  51   N1  ? ? ? 1_555 H DT 11 N3 ? ? G DA  51  H DT 11   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog247 hydrog ? ? G DA  51   N6  ? ? ? 1_555 H DT 11 O4 ? ? G DA  51  H DT 11   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog248 hydrog ? ? G DA  52   N1  ? ? ? 1_555 H DT 10 N3 ? ? G DA  52  H DT 10   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog249 hydrog ? ? G DA  52   N6  ? ? ? 1_555 H DT 10 O4 ? ? G DA  52  H DT 10   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog250 hydrog ? ? G DA  53   N1  ? ? ? 1_555 H DT 9  N3 ? ? G DA  53  H DT 9    1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog251 hydrog ? ? G DA  53   N6  ? ? ? 1_555 H DT 9  O4 ? ? G DA  53  H DT 9    1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog252 hydrog ? ? G DC  54   N3  ? ? ? 1_555 H DG 8  N1 ? ? G DC  54  H DG 8    1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog253 hydrog ? ? G DC  54   N4  ? ? ? 1_555 H DG 8  O6 ? ? G DC  54  H DG 8    1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog254 hydrog ? ? G DC  54   O2  ? ? ? 1_555 H DG 8  N2 ? ? G DC  54  H DG 8    1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog255 hydrog ? ? G DC  55   N3  ? ? ? 1_555 H DG 7  N2 ? ? G DC  55  H DG 7    1_555 ? ? ? ? ? ? 'DC-DG PAIR'    ?     ? 
hydrog256 hydrog ? ? G DC  56   N3  ? ? ? 1_555 H DG 7  N2 ? ? G DC  56  H DG 7    1_555 ? ? ? ? ? ? 'DC-DG PAIR'    ?     ? 
hydrog257 hydrog ? ? G DT  57   N3  ? ? ? 1_555 H DA 5  N1 ? ? G DT  57  H DA 5    1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog258 hydrog ? ? G DT  57   O4  ? ? ? 1_555 H DA 5  N6 ? ? G DT  57  H DA 5    1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog259 hydrog ? ? G DG  58   N1  ? ? ? 1_555 H DC 4  N3 ? ? G DG  58  H DC 4    1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog260 hydrog ? ? G DG  58   N2  ? ? ? 1_555 H DC 4  O2 ? ? G DG  58  H DC 4    1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog261 hydrog ? ? G DG  58   O6  ? ? ? 1_555 H DC 4  N4 ? ? G DG  58  H DC 4    1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog262 hydrog ? ? G DC  59   O2  ? ? ? 1_555 H DG 3  N2 ? ? G DC  59  H DG 3    1_555 ? ? ? ? ? ? 'DC-DG PAIR'    ?     ? 
hydrog263 hydrog ? ? G DA  60   N1  ? ? ? 1_555 H DT 2  N3 ? ? G DA  60  H DT 2    1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog264 hydrog ? ? G DA  60   N6  ? ? ? 1_555 H DT 2  O4 ? ? G DA  60  H DT 2    1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog265 hydrog ? ? G DG  61   N1  ? ? ? 1_555 H DC 1  N3 ? ? G DG  61  H DC 1    1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog266 hydrog ? ? G DG  61   N2  ? ? ? 1_555 H DC 1  O2 ? ? G DG  61  H DC 1    1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog267 hydrog ? ? G DG  61   O6  ? ? ? 1_555 H DC 1  N4 ? ? G DG  61  H DC 1    1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
metalc ? ? 
hydrog ? ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1  GLN 603  A . ? GLN 475 A GLY 604  A ? GLY 476  A 1 8.28   
2  GLN 667  A . ? GLN 539 A PRO 668  A ? PRO 540  A 1 -8.73  
3  LEU 781  A . ? LEU 653 A GLU 782  A ? GLU 654  A 1 -1.38  
4  ALA 870  A . ? ALA 742 A SER 871  A ? SER 743  A 1 3.01   
5  ARG 1127 A . ? ARG 999 A GLN 1128 A ? GLN 1000 A 1 -2.84  
6  ASP 87   B . ? ASP 84  B GLY 88   B ? GLY 85   B 1 4.18   
7  PRO 90   B . ? PRO 87  B GLU 91   B ? GLU 88   B 1 -10.20 
8  HIS 96   B . ? HIS 93  B GLY 97   B ? GLY 94   B 1 -6.48  
9  ARG 117  B . ? ARG 114 B GLY 118  B ? GLY 115  B 1 -10.47 
10 GLY 118  B . ? GLY 115 B CYS 119  B ? CYS 116  B 1 -3.70  
11 GLY 134  B . ? GLY 131 B ASP 135  B ? ASP 132  B 1 -2.13  
12 ARG 151  B . ? ARG 148 B GLY 152  B ? GLY 149  B 1 -5.90  
13 GLU 191  B . ? GLU 188 B PHE 192  B ? PHE 189  B 1 3.96   
14 LEU 245  B . ? LEU 242 B GLY 246  B ? GLY 243  B 1 1.55   
15 ASN 339  B . ? ASN 336 B PRO 340  B ? PRO 337  B 1 -1.43  
16 PRO 342  B . ? PRO 339 B PRO 343  B ? PRO 340  B 1 4.74   
17 GLN 667  C . ? GLN 539 C PRO 668  C ? PRO 540  C 1 -7.57  
18 LEU 781  C . ? LEU 653 C GLU 782  C ? GLU 654  C 1 -5.73  
19 ALA 870  C . ? ALA 742 C SER 871  C ? SER 743  C 1 -4.09  
20 ARG 1127 C . ? ARG 999 C GLN 1128 C ? GLN 1000 C 1 6.16   
21 ASP 87   D . ? ASP 84  D GLY 88   D ? GLY 85   D 1 3.94   
22 PRO 90   D . ? PRO 87  D GLU 91   D ? GLU 88   D 1 -10.33 
23 HIS 96   D . ? HIS 93  D GLY 97   D ? GLY 94   D 1 -5.97  
24 ARG 117  D . ? ARG 114 D GLY 118  D ? GLY 115  D 1 -10.51 
25 GLY 118  D . ? GLY 115 D CYS 119  D ? CYS 116  D 1 -2.34  
26 GLY 134  D . ? GLY 131 D ASP 135  D ? ASP 132  D 1 -1.04  
27 ARG 151  D . ? ARG 148 D GLY 152  D ? GLY 149  D 1 -11.43 
28 GLU 191  D . ? GLU 188 D PHE 192  D ? PHE 189  D 1 -11.14 
29 LEU 245  D . ? LEU 242 D GLY 246  D ? GLY 243  D 1 2.19   
30 ASN 339  D . ? ASN 336 D PRO 340  D ? PRO 337  D 1 -1.27  
31 PRO 342  D . ? PRO 339 D PRO 343  D ? PRO 340  D 1 2.74   
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA1 ? 8 ? 
AA2 ? 6 ? 
AA3 ? 4 ? 
AA4 ? 4 ? 
AA5 ? 5 ? 
AA6 ? 4 ? 
AA7 ? 2 ? 
AA8 ? 4 ? 
AA9 ? 4 ? 
AB1 ? 6 ? 
AB2 ? 6 ? 
AB3 ? 4 ? 
AB4 ? 4 ? 
AB5 ? 4 ? 
AB6 ? 2 ? 
AB7 ? 4 ? 
AB8 ? 2 ? 
AB9 ? 4 ? 
AC1 ? 4 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA1 1 2 ? anti-parallel 
AA1 2 3 ? anti-parallel 
AA1 3 4 ? parallel      
AA1 4 5 ? anti-parallel 
AA1 5 6 ? anti-parallel 
AA1 6 7 ? anti-parallel 
AA1 7 8 ? anti-parallel 
AA2 1 2 ? anti-parallel 
AA2 2 3 ? anti-parallel 
AA2 3 4 ? parallel      
AA2 4 5 ? anti-parallel 
AA2 5 6 ? anti-parallel 
AA3 1 2 ? anti-parallel 
AA3 2 3 ? anti-parallel 
AA3 3 4 ? anti-parallel 
AA4 1 2 ? anti-parallel 
AA4 2 3 ? anti-parallel 
AA4 3 4 ? anti-parallel 
AA5 1 2 ? parallel      
AA5 2 3 ? anti-parallel 
AA5 3 4 ? anti-parallel 
AA5 4 5 ? anti-parallel 
AA6 1 2 ? anti-parallel 
AA6 2 3 ? anti-parallel 
AA6 3 4 ? anti-parallel 
AA7 1 2 ? anti-parallel 
AA8 1 2 ? anti-parallel 
AA8 2 3 ? anti-parallel 
AA8 3 4 ? anti-parallel 
AA9 1 2 ? anti-parallel 
AA9 2 3 ? anti-parallel 
AA9 3 4 ? anti-parallel 
AB1 1 2 ? anti-parallel 
AB1 2 3 ? anti-parallel 
AB1 3 4 ? parallel      
AB1 4 5 ? anti-parallel 
AB1 5 6 ? anti-parallel 
AB2 1 2 ? anti-parallel 
AB2 2 3 ? anti-parallel 
AB2 3 4 ? anti-parallel 
AB2 4 5 ? anti-parallel 
AB2 5 6 ? parallel      
AB3 1 2 ? anti-parallel 
AB3 2 3 ? anti-parallel 
AB3 3 4 ? anti-parallel 
AB4 1 2 ? anti-parallel 
AB4 2 3 ? anti-parallel 
AB4 3 4 ? anti-parallel 
AB5 1 2 ? anti-parallel 
AB5 2 3 ? anti-parallel 
AB5 3 4 ? anti-parallel 
AB6 1 2 ? parallel      
AB7 1 2 ? anti-parallel 
AB7 2 3 ? anti-parallel 
AB7 3 4 ? anti-parallel 
AB8 1 2 ? anti-parallel 
AB9 1 2 ? anti-parallel 
AB9 2 3 ? anti-parallel 
AB9 3 4 ? anti-parallel 
AC1 1 2 ? anti-parallel 
AC1 2 3 ? anti-parallel 
AC1 3 4 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA1 1 PHE A 664 ? GLN A 667 ? PHE A 536 GLN A 539 
AA1 2 ARG A 836 ? VAL A 841 ? ARG A 708 VAL A 713 
AA1 3 LEU A 844 ? GLY A 856 ? LEU A 716 GLY A 728 
AA1 4 PHE A 739 ? MET A 750 ? PHE A 611 MET A 622 
AA1 5 ALA A 767 ? ILE A 779 ? ALA A 639 ILE A 651 
AA1 6 ARG A 803 ? MET A 808 ? ARG A 675 MET A 680 
AA1 7 SER A 701 ? ARG A 703 ? SER A 573 ARG A 575 
AA1 8 ILE A 682 ? ASP A 683 ? ILE A 554 ASP A 555 
AA2 1 PHE A 664 ? GLN A 667 ? PHE A 536 GLN A 539 
AA2 2 ARG A 836 ? VAL A 841 ? ARG A 708 VAL A 713 
AA2 3 LEU A 844 ? GLY A 856 ? LEU A 716 GLY A 728 
AA2 4 PHE A 739 ? MET A 750 ? PHE A 611 MET A 622 
AA2 5 ALA A 767 ? ILE A 779 ? ALA A 639 ILE A 651 
AA2 6 ILE A 788 ? GLN A 792 ? ILE A 660 GLN A 664 
AA3 1 SER B 5   ? PRO B 8   ? SER B 2   PRO B 5   
AA3 2 TYR B 346 ? SER B 352 ? TYR B 343 SER B 349 
AA3 3 THR B 329 ? PRO B 335 ? THR B 326 PRO B 332 
AA3 4 PHE B 321 ? GLY B 326 ? PHE B 318 GLY B 323 
AA4 1 SER B 23  ? LEU B 25  ? SER B 20  LEU B 22  
AA4 2 VAL B 31  ? PHE B 34  ? VAL B 28  PHE B 31  
AA4 3 PHE B 49  ? LYS B 54  ? PHE B 46  LYS B 51  
AA4 4 GLU B 57  ? ALA B 62  ? GLU B 54  ALA B 59  
AA5 1 SER B 64  ? PHE B 65  ? SER B 61  PHE B 62  
AA5 2 VAL B 123 ? LYS B 130 ? VAL B 120 LYS B 127 
AA5 3 LEU B 109 ? ARG B 117 ? LEU B 106 ARG B 114 
AA5 4 CYS B 92  ? HIS B 96  ? CYS B 89  HIS B 93  
AA5 5 ALA B 79  ? PHE B 83  ? ALA B 76  PHE B 80  
AA6 1 THR B 144 ? SER B 150 ? THR B 141 SER B 147 
AA6 2 LYS B 153 ? PHE B 159 ? LYS B 150 PHE B 156 
AA6 3 TYR B 186 ? ILE B 188 ? TYR B 183 ILE B 185 
AA6 4 THR B 196 ? ALA B 197 ? THR B 193 ALA B 194 
AA7 1 ARG B 162 ? TYR B 164 ? ARG B 159 TYR B 161 
AA7 2 VAL B 178 ? ASP B 180 ? VAL B 175 ASP B 177 
AA8 1 ALA B 212 ? ARG B 215 ? ALA B 209 ARG B 212 
AA8 2 CYS B 218 ? PHE B 221 ? CYS B 215 PHE B 218 
AA8 3 ILE B 237 ? LEU B 243 ? ILE B 234 LEU B 240 
AA8 4 PRO B 248 ? ILE B 254 ? PRO B 245 ILE B 251 
AA9 1 ALA B 266 ? PRO B 268 ? ALA B 263 PRO B 265 
AA9 2 GLU B 273 ? ILE B 276 ? GLU B 270 ILE B 273 
AA9 3 TYR B 292 ? GLY B 294 ? TYR B 289 GLY B 291 
AA9 4 HIS B 301 ? GLU B 303 ? HIS B 298 GLU B 300 
AB1 1 GLU C 665 ? GLN C 667 ? GLU C 537 GLN C 539 
AB1 2 ARG C 836 ? VAL C 841 ? ARG C 708 VAL C 713 
AB1 3 LEU C 844 ? PHE C 850 ? LEU C 716 PHE C 722 
AB1 4 PHE C 739 ? MET C 750 ? PHE C 611 MET C 622 
AB1 5 ALA C 767 ? ILE C 779 ? ALA C 639 ILE C 651 
AB1 6 THR C 789 ? GLN C 792 ? THR C 661 GLN C 664 
AB2 1 ILE C 682 ? ASP C 683 ? ILE C 554 ASP C 555 
AB2 2 SER C 701 ? ARG C 703 ? SER C 573 ARG C 575 
AB2 3 ARG C 803 ? MET C 808 ? ARG C 675 MET C 680 
AB2 4 ALA C 767 ? ILE C 779 ? ALA C 639 ILE C 651 
AB2 5 PHE C 739 ? MET C 750 ? PHE C 611 MET C 622 
AB2 6 ARG C 853 ? GLY C 856 ? ARG C 725 GLY C 728 
AB3 1 SER D 5   ? PRO D 8   ? SER D 2   PRO D 5   
AB3 2 TYR D 346 ? SER D 352 ? TYR D 343 SER D 349 
AB3 3 THR D 329 ? PRO D 335 ? THR D 326 PRO D 332 
AB3 4 PHE D 321 ? GLY D 326 ? PHE D 318 GLY D 323 
AB4 1 SER D 23  ? LEU D 25  ? SER D 20  LEU D 22  
AB4 2 VAL D 31  ? PHE D 34  ? VAL D 28  PHE D 31  
AB4 3 PHE D 49  ? LYS D 54  ? PHE D 46  LYS D 51  
AB4 4 GLU D 57  ? ALA D 62  ? GLU D 54  ALA D 59  
AB5 1 PRO D 78  ? PHE D 83  ? PRO D 75  PHE D 80  
AB5 2 CYS D 92  ? GLY D 97  ? CYS D 89  GLY D 94  
AB5 3 TYR D 110 ? VAL D 114 ? TYR D 107 VAL D 111 
AB5 4 LEU D 125 ? GLU D 129 ? LEU D 122 GLU D 126 
AB6 1 LEU D 132 ? VAL D 133 ? LEU D 129 VAL D 130 
AB6 2 GLY D 193 ? CYS D 194 ? GLY D 190 CYS D 191 
AB7 1 THR D 144 ? SER D 150 ? THR D 141 SER D 147 
AB7 2 LYS D 153 ? PHE D 159 ? LYS D 150 PHE D 156 
AB7 3 TYR D 186 ? ILE D 188 ? TYR D 183 ILE D 185 
AB7 4 THR D 196 ? ALA D 197 ? THR D 193 ALA D 194 
AB8 1 ARG D 162 ? TYR D 164 ? ARG D 159 TYR D 161 
AB8 2 VAL D 178 ? ASP D 180 ? VAL D 175 ASP D 177 
AB9 1 ALA D 212 ? ARG D 215 ? ALA D 209 ARG D 212 
AB9 2 CYS D 218 ? PHE D 221 ? CYS D 215 PHE D 218 
AB9 3 ILE D 237 ? LEU D 244 ? ILE D 234 LEU D 241 
AB9 4 SER D 247 ? ILE D 254 ? SER D 244 ILE D 251 
AC1 1 ALA D 266 ? PRO D 268 ? ALA D 263 PRO D 265 
AC1 2 GLU D 273 ? ILE D 276 ? GLU D 270 ILE D 273 
AC1 3 THR D 291 ? LEU D 295 ? THR D 288 LEU D 292 
AC1 4 VAL D 300 ? GLU D 303 ? VAL D 297 GLU D 300 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA1 1 2 N GLN A 667 ? N GLN A 539 O ARG A 836 ? O ARG A 708 
AA1 2 3 N ILE A 839 ? N ILE A 711 O ARG A 846 ? O ARG A 718 
AA1 3 4 O ARG A 849 ? O ARG A 721 N PHE A 739 ? N PHE A 611 
AA1 4 5 N VAL A 742 ? N VAL A 614 O SER A 776 ? O SER A 648 
AA1 5 6 N PHE A 772 ? N PHE A 644 O ARG A 803 ? O ARG A 675 
AA1 6 7 O LEU A 807 ? O LEU A 679 N ARG A 702 ? N ARG A 574 
AA1 7 8 O ARG A 703 ? O ARG A 575 N ILE A 682 ? N ILE A 554 
AA2 1 2 N GLN A 667 ? N GLN A 539 O ARG A 836 ? O ARG A 708 
AA2 2 3 N ILE A 839 ? N ILE A 711 O ARG A 846 ? O ARG A 718 
AA2 3 4 O ARG A 849 ? O ARG A 721 N PHE A 739 ? N PHE A 611 
AA2 4 5 N VAL A 742 ? N VAL A 614 O SER A 776 ? O SER A 648 
AA2 5 6 N ILE A 777 ? N ILE A 649 O PHE A 791 ? O PHE A 663 
AA3 1 2 N GLN B 7   ? N GLN B 4   O GLN B 350 ? O GLN B 347 
AA3 2 3 O TYR B 349 ? O TYR B 346 N VAL B 332 ? N VAL B 329 
AA3 3 4 O ALA B 333 ? O ALA B 330 N PHE B 321 ? N PHE B 318 
AA4 1 2 N LEU B 25  ? N LEU B 22  O TYR B 32  ? O TYR B 29  
AA4 2 3 N VAL B 31  ? N VAL B 28  O VAL B 51  ? O VAL B 48  
AA4 3 4 N GLY B 50  ? N GLY B 47  O ARG B 61  ? O ARG B 58  
AA5 1 2 N SER B 64  ? N SER B 61  O LEU B 125 ? O LEU B 122 
AA5 2 3 O ARG B 126 ? O ARG B 123 N SER B 113 ? N SER B 110 
AA5 3 4 O TYR B 110 ? O TYR B 107 N ILE B 95  ? N ILE B 92  
AA5 4 5 O LEU B 94  ? O LEU B 91  N ALA B 81  ? N ALA B 78  
AA6 1 2 N SER B 150 ? N SER B 147 O LYS B 153 ? O LYS B 150 
AA6 2 3 N CYS B 156 ? N CYS B 153 O ILE B 188 ? O ILE B 185 
AA6 3 4 N LEU B 187 ? N LEU B 184 O THR B 196 ? O THR B 193 
AA7 1 2 N SER B 163 ? N SER B 160 O VAL B 179 ? O VAL B 176 
AA8 1 2 N LEU B 213 ? N LEU B 210 O TYR B 220 ? O TYR B 217 
AA8 2 3 N VAL B 219 ? N VAL B 216 O LEU B 239 ? O LEU B 236 
AA8 3 4 N HIS B 240 ? N HIS B 237 O THR B 251 ? O THR B 248 
AA9 1 2 N SER B 267 ? N SER B 264 O ILE B 275 ? O ILE B 272 
AA9 2 3 N TYR B 274 ? N TYR B 271 O VAL B 293 ? O VAL B 290 
AA9 3 4 N TYR B 292 ? N TYR B 289 O GLU B 303 ? O GLU B 300 
AB1 1 2 N GLU C 665 ? N GLU C 537 O ILE C 838 ? O ILE C 710 
AB1 2 3 N ILE C 839 ? N ILE C 711 O ARG C 846 ? O ARG C 718 
AB1 3 4 O ARG C 849 ? O ARG C 721 N PHE C 739 ? N PHE C 611 
AB1 4 5 N VAL C 742 ? N VAL C 614 O SER C 776 ? O SER C 648 
AB1 5 6 N ILE C 777 ? N ILE C 649 O PHE C 791 ? O PHE C 663 
AB2 1 2 N ILE C 682 ? N ILE C 554 O ARG C 703 ? O ARG C 575 
AB2 2 3 N ARG C 702 ? N ARG C 574 O LEU C 807 ? O LEU C 679 
AB2 3 4 O LEU C 805 ? O LEU C 677 N PHE C 770 ? N PHE C 642 
AB2 4 5 O SER C 776 ? O SER C 648 N VAL C 742 ? N VAL C 614 
AB2 5 6 N CYS C 747 ? N CYS C 619 O GLY C 856 ? O GLY C 728 
AB3 1 2 N GLN D 7   ? N GLN D 4   O GLN D 350 ? O GLN D 347 
AB3 2 3 O VAL D 351 ? O VAL D 348 N ALA D 330 ? N ALA D 327 
AB3 3 4 O LEU D 331 ? O LEU D 328 N GLY D 323 ? N GLY D 320 
AB4 1 2 N LEU D 25  ? N LEU D 22  O TYR D 32  ? O TYR D 29  
AB4 2 3 N VAL D 31  ? N VAL D 28  O VAL D 51  ? O VAL D 48  
AB4 3 4 N GLY D 50  ? N GLY D 47  O ARG D 61  ? O ARG D 58  
AB5 1 2 N ALA D 79  ? N ALA D 76  O HIS D 96  ? O HIS D 93  
AB5 2 3 N ILE D 95  ? N ILE D 92  O TYR D 110 ? O TYR D 107 
AB5 3 4 N SER D 113 ? N SER D 110 O ARG D 126 ? O ARG D 123 
AB6 1 2 N VAL D 133 ? N VAL D 130 O GLY D 193 ? O GLY D 190 
AB7 1 2 N THR D 144 ? N THR D 141 O PHE D 159 ? O PHE D 156 
AB7 2 3 N CYS D 156 ? N CYS D 153 O ILE D 188 ? O ILE D 185 
AB7 3 4 N LEU D 187 ? N LEU D 184 O THR D 196 ? O THR D 193 
AB8 1 2 N SER D 163 ? N SER D 160 O VAL D 179 ? O VAL D 176 
AB9 1 2 N LEU D 213 ? N LEU D 210 O TYR D 220 ? O TYR D 217 
AB9 2 3 N PHE D 221 ? N PHE D 218 O ILE D 237 ? O ILE D 234 
AB9 3 4 N ARG D 238 ? N ARG D 235 O THR D 253 ? O THR D 250 
AC1 1 2 N SER D 267 ? N SER D 264 O ILE D 275 ? O ILE D 272 
AC1 2 3 N TYR D 274 ? N TYR D 271 O VAL D 293 ? O VAL D 290 
AC1 3 4 N GLY D 294 ? N GLY D 291 O HIS D 301 ? O HIS D 298 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software A ZN 1101 ? 5 'binding site for residue ZN A 1101' 
AC2 Software A CA 1102 ? 4 'binding site for residue CA A 1102' 
AC3 Software A CA 1103 ? 4 'binding site for residue CA A 1103' 
AC4 Software C ZN 1101 ? 4 'binding site for residue ZN C 1101' 
AC5 Software C CA 1102 ? 4 'binding site for residue CA C 1102' 
AC6 Software C CA 1103 ? 2 'binding site for residue CA C 1103' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 5 CYS A 877  ? CYS A 749  . ? 1_555 ? 
2  AC1 5 LEU A 879  ? LEU A 751  . ? 1_555 ? 
3  AC1 5 CYS A 880  ? CYS A 752  . ? 1_555 ? 
4  AC1 5 HIS A 1087 ? HIS A 959  . ? 1_555 ? 
5  AC1 5 HIS A 1092 ? HIS A 964  . ? 1_555 ? 
6  AC2 4 ASP A 748  ? ASP A 620  . ? 1_555 ? 
7  AC2 4 GLU A 1112 ? GLU A 984  . ? 1_555 ? 
8  AC2 4 CA  K .    ? CA  A 1103 . ? 1_555 ? 
9  AC2 4 DA  F 36   ? DA  F 36   . ? 1_555 ? 
10 AC3 4 ASP A 748  ? ASP A 620  . ? 1_555 ? 
11 AC3 4 ASP A 858  ? ASP A 730  . ? 1_555 ? 
12 AC3 4 CA  J .    ? CA  A 1102 . ? 1_555 ? 
13 AC3 4 DA  F 36   ? DA  F 36   . ? 1_555 ? 
14 AC4 4 CYS C 877  ? CYS C 749  . ? 1_555 ? 
15 AC4 4 CYS C 880  ? CYS C 752  . ? 1_555 ? 
16 AC4 4 HIS C 1087 ? HIS C 959  . ? 1_555 ? 
17 AC4 4 HIS C 1092 ? HIS C 964  . ? 1_555 ? 
18 AC5 4 ASP C 748  ? ASP C 620  . ? 1_555 ? 
19 AC5 4 GLU C 1112 ? GLU C 984  . ? 1_555 ? 
20 AC5 4 CA  N .    ? CA  C 1103 . ? 1_555 ? 
21 AC5 4 DA  H 47   ? DA  H 47   . ? 1_555 ? 
22 AC6 2 ASP C 858  ? ASP C 730  . ? 1_555 ? 
23 AC6 2 CA  M .    ? CA  C 1102 . ? 1_555 ? 
# 
_atom_sites.entry_id                    6DBT 
_atom_sites.fract_transf_matrix[1][1]   1.000000 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   1.000000 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   1.000000 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
CA 
N  
O  
P  
S  
ZN 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1     N  N     . GLY A 1 536  ? 98.826  140.942 58.671  1.00 216.76 ?  408  GLY A N     1 
ATOM   2     C  CA    . GLY A 1 536  ? 98.898  140.409 60.020  1.00 235.27 ?  408  GLY A CA    1 
ATOM   3     C  C     . GLY A 1 536  ? 100.291 140.469 60.615  1.00 228.05 ?  408  GLY A C     1 
ATOM   4     O  O     . GLY A 1 536  ? 101.022 141.435 60.400  1.00 231.03 ?  408  GLY A O     1 
ATOM   5     N  N     . GLY A 1 537  ? 100.661 139.428 61.360  1.00 235.65 ?  409  GLY A N     1 
ATOM   6     C  CA    . GLY A 1 537  ? 101.961 139.374 62.002  1.00 238.03 ?  409  GLY A CA    1 
ATOM   7     C  C     . GLY A 1 537  ? 101.995 138.477 63.222  1.00 248.13 ?  409  GLY A C     1 
ATOM   8     O  O     . GLY A 1 537  ? 101.054 138.472 64.021  1.00 258.46 ?  409  GLY A O     1 
ATOM   9     N  N     . ARG A 1 538  ? 103.069 137.709 63.373  1.00 250.00 ?  410  ARG A N     1 
ATOM   10    C  CA    . ARG A 1 538  ? 103.229 136.857 64.548  1.00 255.82 ?  410  ARG A CA    1 
ATOM   11    C  C     . ARG A 1 538  ? 103.759 137.686 65.712  1.00 261.91 ?  410  ARG A C     1 
ATOM   12    O  O     . ARG A 1 538  ? 104.756 138.398 65.552  1.00 253.46 ?  410  ARG A O     1 
ATOM   13    C  CB    . ARG A 1 538  ? 104.179 135.702 64.245  1.00 246.99 ?  410  ARG A CB    1 
ATOM   14    C  CG    . ARG A 1 538  ? 104.321 134.670 65.350  1.00 241.02 ?  410  ARG A CG    1 
ATOM   15    C  CD    . ARG A 1 538  ? 104.886 133.378 64.783  1.00 230.73 ?  410  ARG A CD    1 
ATOM   16    N  NE    . ARG A 1 538  ? 105.872 132.751 65.654  1.00 241.92 ?  410  ARG A NE    1 
ATOM   17    C  CZ    . ARG A 1 538  ? 106.497 131.613 65.368  1.00 241.13 ?  410  ARG A CZ    1 
ATOM   18    N  NH1   . ARG A 1 538  ? 106.227 130.978 64.236  1.00 256.03 ?  410  ARG A NH1   1 
ATOM   19    N  NH2   . ARG A 1 538  ? 107.384 131.105 66.212  1.00 227.62 ?  410  ARG A NH2   1 
ATOM   20    N  N     . PRO A 1 539  ? 103.126 137.628 66.885  1.00 265.90 ?  411  PRO A N     1 
ATOM   21    C  CA    . PRO A 1 539  ? 103.575 138.470 68.002  1.00 257.12 ?  411  PRO A CA    1 
ATOM   22    C  C     . PRO A 1 539  ? 104.932 138.013 68.513  1.00 269.28 ?  411  PRO A C     1 
ATOM   23    O  O     . PRO A 1 539  ? 105.107 136.856 68.903  1.00 270.85 ?  411  PRO A O     1 
ATOM   24    C  CB    . PRO A 1 539  ? 102.482 138.280 69.064  1.00 222.60 ?  411  PRO A CB    1 
ATOM   25    C  CG    . PRO A 1 539  ? 101.373 137.523 68.384  1.00 240.74 ?  411  PRO A CG    1 
ATOM   26    C  CD    . PRO A 1 539  ? 102.004 136.760 67.270  1.00 260.52 ?  411  PRO A CD    1 
ATOM   27    N  N     . ARG A 1 540  ? 105.892 138.934 68.507  1.00 274.82 ?  412  ARG A N     1 
ATOM   28    C  CA    . ARG A 1 540  ? 107.214 138.620 69.025  1.00 277.92 ?  412  ARG A CA    1 
ATOM   29    C  C     . ARG A 1 540  ? 107.138 138.342 70.522  1.00 286.77 ?  412  ARG A C     1 
ATOM   30    O  O     . ARG A 1 540  ? 106.434 139.033 71.264  1.00 281.62 ?  412  ARG A O     1 
ATOM   31    C  CB    . ARG A 1 540  ? 108.189 139.775 68.769  1.00 275.58 ?  412  ARG A CB    1 
ATOM   32    C  CG    . ARG A 1 540  ? 108.239 140.321 67.346  1.00 258.11 ?  412  ARG A CG    1 
ATOM   33    C  CD    . ARG A 1 540  ? 109.393 141.318 67.231  1.00 258.40 ?  412  ARG A CD    1 
ATOM   34    N  NE    . ARG A 1 540  ? 109.286 142.218 66.085  1.00 237.42 ?  412  ARG A NE    1 
ATOM   35    C  CZ    . ARG A 1 540  ? 110.172 143.170 65.803  1.00 225.51 ?  412  ARG A CZ    1 
ATOM   36    N  NH1   . ARG A 1 540  ? 111.231 143.346 66.582  1.00 237.33 ?  412  ARG A NH1   1 
ATOM   37    N  NH2   . ARG A 1 540  ? 110.001 143.947 64.742  1.00 213.58 ?  412  ARG A NH2   1 
ATOM   38    N  N     . GLN A 1 541  ? 107.861 137.318 70.962  1.00 283.56 ?  413  GLN A N     1 
ATOM   39    C  CA    . GLN A 1 541  ? 108.113 137.106 72.381  1.00 285.56 ?  413  GLN A CA    1 
ATOM   40    C  C     . GLN A 1 541  ? 109.123 138.164 72.834  1.00 304.09 ?  413  GLN A C     1 
ATOM   41    O  O     . GLN A 1 541  ? 109.544 139.029 72.060  1.00 312.12 ?  413  GLN A O     1 
ATOM   42    C  CB    . GLN A 1 541  ? 108.614 135.683 72.625  1.00 259.10 ?  413  GLN A CB    1 
ATOM   43    C  CG    . GLN A 1 541  ? 108.069 134.643 71.649  1.00 225.63 ?  413  GLN A CG    1 
ATOM   44    C  CD    . GLN A 1 541  ? 108.886 133.361 71.646  1.00 189.41 ?  413  GLN A CD    1 
ATOM   45    O  OE1   . GLN A 1 541  ? 109.930 133.276 72.292  1.00 204.17 ?  413  GLN A OE1   1 
ATOM   46    N  NE2   . GLN A 1 541  ? 108.422 132.364 70.902  1.00 181.39 ?  413  GLN A NE2   1 
ATOM   47    N  N     . HIS A 1 542  ? 109.531 138.118 74.099  1.00 293.77 ?  414  HIS A N     1 
ATOM   48    C  CA    . HIS A 1 542  ? 110.623 138.980 74.536  1.00 294.36 ?  414  HIS A CA    1 
ATOM   49    C  C     . HIS A 1 542  ? 111.926 138.535 73.875  1.00 317.86 ?  414  HIS A C     1 
ATOM   50    O  O     . HIS A 1 542  ? 112.158 137.340 73.678  1.00 308.74 ?  414  HIS A O     1 
ATOM   51    C  CB    . HIS A 1 542  ? 110.752 138.956 76.060  1.00 256.89 ?  414  HIS A CB    1 
ATOM   52    C  CG    . HIS A 1 542  ? 111.718 139.965 76.599  1.00 260.25 ?  414  HIS A CG    1 
ATOM   53    N  ND1   . HIS A 1 542  ? 113.082 139.768 76.593  1.00 275.67 ?  414  HIS A ND1   1 
ATOM   54    C  CD2   . HIS A 1 542  ? 111.517 141.184 77.152  1.00 252.56 ?  414  HIS A CD2   1 
ATOM   55    C  CE1   . HIS A 1 542  ? 113.680 140.820 77.124  1.00 276.34 ?  414  HIS A CE1   1 
ATOM   56    N  NE2   . HIS A 1 542  ? 112.752 141.693 77.472  1.00 275.42 ?  414  HIS A NE2   1 
ATOM   57    N  N     . LEU A 1 543  ? 112.773 139.508 73.514  1.00 314.41 ?  415  LEU A N     1 
ATOM   58    C  CA    . LEU A 1 543  ? 113.966 139.204 72.719  1.00 301.82 ?  415  LEU A CA    1 
ATOM   59    C  C     . LEU A 1 543  ? 114.906 138.257 73.457  1.00 285.42 ?  415  LEU A C     1 
ATOM   60    O  O     . LEU A 1 543  ? 115.479 137.342 72.852  1.00 275.46 ?  415  LEU A O     1 
ATOM   61    C  CB    . LEU A 1 543  ? 114.701 140.491 72.332  1.00 284.81 ?  415  LEU A CB    1 
ATOM   62    C  CG    . LEU A 1 543  ? 116.071 140.316 71.657  1.00 237.53 ?  415  LEU A CG    1 
ATOM   63    C  CD1   . LEU A 1 543  ? 115.926 139.715 70.270  1.00 221.04 ?  415  LEU A CD1   1 
ATOM   64    C  CD2   . LEU A 1 543  ? 116.844 141.633 71.590  1.00 235.33 ?  415  LEU A CD2   1 
ATOM   65    N  N     . LEU A 1 544  ? 115.088 138.466 74.760  1.00 280.67 ?  416  LEU A N     1 
ATOM   66    C  CA    . LEU A 1 544  ? 115.924 137.578 75.558  1.00 276.77 ?  416  LEU A CA    1 
ATOM   67    C  C     . LEU A 1 544  ? 115.289 136.210 75.782  1.00 280.29 ?  416  LEU A C     1 
ATOM   68    O  O     . LEU A 1 544  ? 115.966 135.314 76.299  1.00 260.31 ?  416  LEU A O     1 
ATOM   69    C  CB    . LEU A 1 544  ? 116.243 138.237 76.903  1.00 260.52 ?  416  LEU A CB    1 
ATOM   70    C  CG    . LEU A 1 544  ? 116.971 139.584 76.836  1.00 224.92 ?  416  LEU A CG    1 
ATOM   71    C  CD1   . LEU A 1 544  ? 117.451 140.010 78.216  1.00 209.55 ?  416  LEU A CD1   1 
ATOM   72    C  CD2   . LEU A 1 544  ? 118.136 139.529 75.855  1.00 192.70 ?  416  LEU A CD2   1 
ATOM   73    N  N     . SER A 1 545  ? 114.021 136.025 75.406  1.00 284.20 ?  417  SER A N     1 
ATOM   74    C  CA    . SER A 1 545  ? 113.364 134.725 75.468  1.00 265.46 ?  417  SER A CA    1 
ATOM   75    C  C     . SER A 1 545  ? 113.430 133.962 74.150  1.00 268.03 ?  417  SER A C     1 
ATOM   76    O  O     . SER A 1 545  ? 113.007 132.802 74.102  1.00 249.37 ?  417  SER A O     1 
ATOM   77    C  CB    . SER A 1 545  ? 111.895 134.884 75.890  1.00 253.40 ?  417  SER A CB    1 
ATOM   78    O  OG    . SER A 1 545  ? 111.154 135.625 74.934  1.00 270.94 ?  417  SER A OG    1 
ATOM   79    N  N     . LEU A 1 546  ? 113.936 134.583 73.086  1.00 276.33 ?  418  LEU A N     1 
ATOM   80    C  CA    . LEU A 1 546  ? 114.042 133.950 71.781  1.00 256.56 ?  418  LEU A CA    1 
ATOM   81    C  C     . LEU A 1 546  ? 115.266 133.037 71.717  1.00 246.45 ?  418  LEU A C     1 
ATOM   82    O  O     . LEU A 1 546  ? 116.000 132.852 72.694  1.00 247.58 ?  418  LEU A O     1 
ATOM   83    C  CB    . LEU A 1 546  ? 114.109 135.010 70.684  1.00 249.44 ?  418  LEU A CB    1 
ATOM   84    C  CG    . LEU A 1 546  ? 113.090 136.147 70.729  1.00 258.00 ?  418  LEU A CG    1 
ATOM   85    C  CD1   . LEU A 1 546  ? 113.284 137.080 69.549  1.00 250.41 ?  418  LEU A CD1   1 
ATOM   86    C  CD2   . LEU A 1 546  ? 111.683 135.580 70.722  1.00 243.49 ?  418  LEU A CD2   1 
ATOM   87    N  N     . THR A 1 547  ? 115.482 132.454 70.543  1.00 229.76 ?  419  THR A N     1 
ATOM   88    C  CA    . THR A 1 547  ? 116.648 131.632 70.267  1.00 227.46 ?  419  THR A CA    1 
ATOM   89    C  C     . THR A 1 547  ? 117.769 132.483 69.674  1.00 236.14 ?  419  THR A C     1 
ATOM   90    O  O     . THR A 1 547  ? 117.589 133.657 69.349  1.00 238.28 ?  419  THR A O     1 
ATOM   91    C  CB    . THR A 1 547  ? 116.287 130.496 69.311  1.00 226.32 ?  419  THR A CB    1 
ATOM   92    O  OG1   . THR A 1 547  ? 116.447 130.940 67.958  1.00 226.89 ?  419  THR A OG1   1 
ATOM   93    C  CG2   . THR A 1 547  ? 114.842 130.072 69.524  1.00 236.79 ?  419  THR A CG2   1 
ATOM   94    N  N     . ARG A 1 548  ? 118.948 131.871 69.540  1.00 236.18 ?  420  ARG A N     1 
ATOM   95    C  CA    . ARG A 1 548  ? 120.055 132.539 68.860  1.00 241.28 ?  420  ARG A CA    1 
ATOM   96    C  C     . ARG A 1 548  ? 119.672 132.908 67.431  1.00 237.54 ?  420  ARG A C     1 
ATOM   97    O  O     . ARG A 1 548  ? 120.038 133.982 66.936  1.00 229.09 ?  420  ARG A O     1 
ATOM   98    C  CB    . ARG A 1 548  ? 121.291 131.639 68.869  1.00 226.32 ?  420  ARG A CB    1 
ATOM   99    C  CG    . ARG A 1 548  ? 122.138 131.729 70.129  1.00 218.29 ?  420  ARG A CG    1 
ATOM   100   C  CD    . ARG A 1 548  ? 123.519 131.148 69.884  1.00 207.15 ?  420  ARG A CD    1 
ATOM   101   N  NE    . ARG A 1 548  ? 123.444 129.746 69.482  1.00 229.11 ?  420  ARG A NE    1 
ATOM   102   C  CZ    . ARG A 1 548  ? 123.616 128.719 70.307  1.00 219.08 ?  420  ARG A CZ    1 
ATOM   103   N  NH1   . ARG A 1 548  ? 123.878 128.930 71.589  1.00 207.71 ?  420  ARG A NH1   1 
ATOM   104   N  NH2   . ARG A 1 548  ? 123.527 127.478 69.849  1.00 218.49 ?  420  ARG A NH2   1 
ATOM   105   N  N     . ARG A 1 549  ? 118.914 132.033 66.763  1.00 231.08 ?  421  ARG A N     1 
ATOM   106   C  CA    . ARG A 1 549  ? 118.470 132.292 65.395  1.00 232.88 ?  421  ARG A CA    1 
ATOM   107   C  C     . ARG A 1 549  ? 117.599 133.542 65.322  1.00 232.70 ?  421  ARG A C     1 
ATOM   108   O  O     . ARG A 1 549  ? 117.805 134.411 64.466  1.00 228.81 ?  421  ARG A O     1 
ATOM   109   C  CB    . ARG A 1 549  ? 117.711 131.073 64.865  1.00 221.61 ?  421  ARG A CB    1 
ATOM   110   C  CG    . ARG A 1 549  ? 117.132 131.232 63.470  1.00 209.79 ?  421  ARG A CG    1 
ATOM   111   C  CD    . ARG A 1 549  ? 118.172 130.932 62.404  1.00 232.02 ?  421  ARG A CD    1 
ATOM   112   N  NE    . ARG A 1 549  ? 117.567 130.590 61.119  1.00 230.86 ?  421  ARG A NE    1 
ATOM   113   C  CZ    . ARG A 1 549  ? 117.446 131.432 60.101  1.00 232.78 ?  421  ARG A CZ    1 
ATOM   114   N  NH1   . ARG A 1 549  ? 117.898 132.673 60.206  1.00 230.52 ?  421  ARG A NH1   1 
ATOM   115   N  NH2   . ARG A 1 549  ? 116.884 131.031 58.971  1.00 212.55 ?  421  ARG A NH2   1 
ATOM   116   N  N     . ALA A 1 550  ? 116.624 133.655 66.225  1.00 234.70 ?  422  ALA A N     1 
ATOM   117   C  CA    . ALA A 1 550  ? 115.704 134.785 66.192  1.00 234.79 ?  422  ALA A CA    1 
ATOM   118   C  C     . ALA A 1 550  ? 116.400 136.089 66.568  1.00 225.09 ?  422  ALA A C     1 
ATOM   119   O  O     . ALA A 1 550  ? 116.143 137.136 65.955  1.00 217.82 ?  422  ALA A O     1 
ATOM   120   C  CB    . ALA A 1 550  ? 114.524 134.517 67.123  1.00 233.17 ?  422  ALA A CB    1 
ATOM   121   N  N     . GLN A 1 551  ? 117.280 136.051 67.572  1.00 228.09 ?  423  GLN A N     1 
ATOM   122   C  CA    . GLN A 1 551  ? 118.023 137.251 67.950  1.00 228.37 ?  423  GLN A CA    1 
ATOM   123   C  C     . GLN A 1 551  ? 118.909 137.723 66.804  1.00 230.57 ?  423  GLN A C     1 
ATOM   124   O  O     . GLN A 1 551  ? 118.974 138.923 66.504  1.00 233.92 ?  423  GLN A O     1 
ATOM   125   C  CB    . GLN A 1 551  ? 118.856 136.991 69.210  1.00 239.93 ?  423  GLN A CB    1 
ATOM   126   C  CG    . GLN A 1 551  ? 118.046 136.644 70.459  1.00 235.71 ?  423  GLN A CG    1 
ATOM   127   C  CD    . GLN A 1 551  ? 118.840 135.831 71.475  1.00 222.72 ?  423  GLN A CD    1 
ATOM   128   O  OE1   . GLN A 1 551  ? 119.477 134.839 71.126  1.00 225.40 ?  423  GLN A OE1   1 
ATOM   129   N  NE2   . GLN A 1 551  ? 118.796 136.247 72.737  1.00 204.41 ?  423  GLN A NE2   1 
ATOM   130   N  N     . LYS A 1 552  ? 119.608 136.786 66.157  1.00 225.62 ?  424  LYS A N     1 
ATOM   131   C  CA    . LYS A 1 552  ? 120.394 137.111 64.971  1.00 220.41 ?  424  LYS A CA    1 
ATOM   132   C  C     . LYS A 1 552  ? 119.527 137.761 63.896  1.00 216.89 ?  424  LYS A C     1 
ATOM   133   O  O     . LYS A 1 552  ? 119.868 138.821 63.352  1.00 204.85 ?  424  LYS A O     1 
ATOM   134   C  CB    . LYS A 1 552  ? 121.042 135.833 64.435  1.00 200.70 ?  424  LYS A CB    1 
ATOM   135   C  CG    . LYS A 1 552  ? 122.555 135.810 64.464  1.00 167.22 ?  424  LYS A CG    1 
ATOM   136   C  CD    . LYS A 1 552  ? 123.065 134.464 63.978  1.00 146.37 ?  424  LYS A CD    1 
ATOM   137   C  CE    . LYS A 1 552  ? 124.552 134.506 63.711  1.00 191.70 ?  424  LYS A CE    1 
ATOM   138   N  NZ    . LYS A 1 552  ? 125.026 133.223 63.129  1.00 234.31 ?  424  LYS A NZ    1 
ATOM   139   N  N     . HIS A 1 553  ? 118.387 137.130 63.591  1.00 222.79 ?  425  HIS A N     1 
ATOM   140   C  CA    . HIS A 1 553  ? 117.498 137.613 62.539  1.00 226.91 ?  425  HIS A CA    1 
ATOM   141   C  C     . HIS A 1 553  ? 117.023 139.035 62.819  1.00 211.15 ?  425  HIS A C     1 
ATOM   142   O  O     . HIS A 1 553  ? 116.934 139.860 61.902  1.00 197.51 ?  425  HIS A O     1 
ATOM   143   C  CB    . HIS A 1 553  ? 116.307 136.660 62.409  1.00 231.30 ?  425  HIS A CB    1 
ATOM   144   C  CG    . HIS A 1 553  ? 115.615 136.715 61.081  1.00 228.24 ?  425  HIS A CG    1 
ATOM   145   N  ND1   . HIS A 1 553  ? 114.926 137.826 60.643  1.00 218.91 ?  425  HIS A ND1   1 
ATOM   146   C  CD2   . HIS A 1 553  ? 115.483 135.783 60.108  1.00 226.94 ?  425  HIS A CD2   1 
ATOM   147   C  CE1   . HIS A 1 553  ? 114.408 137.579 59.452  1.00 213.04 ?  425  HIS A CE1   1 
ATOM   148   N  NE2   . HIS A 1 553  ? 114.733 136.346 59.105  1.00 220.16 ?  425  HIS A NE2   1 
ATOM   149   N  N     . ARG A 1 554  ? 116.710 139.339 64.082  1.00 211.88 ?  426  ARG A N     1 
ATOM   150   C  CA    . ARG A 1 554  ? 116.130 140.635 64.412  1.00 195.89 ?  426  ARG A CA    1 
ATOM   151   C  C     . ARG A 1 554  ? 117.167 141.717 64.686  1.00 187.84 ?  426  ARG A C     1 
ATOM   152   O  O     . ARG A 1 554  ? 116.817 142.902 64.662  1.00 168.57 ?  426  ARG A O     1 
ATOM   153   C  CB    . ARG A 1 554  ? 115.214 140.505 65.629  1.00 191.29 ?  426  ARG A CB    1 
ATOM   154   C  CG    . ARG A 1 554  ? 113.986 139.667 65.353  1.00 212.16 ?  426  ARG A CG    1 
ATOM   155   C  CD    . ARG A 1 554  ? 113.319 139.221 66.631  1.00 224.82 ?  426  ARG A CD    1 
ATOM   156   N  NE    . ARG A 1 554  ? 113.429 140.223 67.683  1.00 229.07 ?  426  ARG A NE    1 
ATOM   157   C  CZ    . ARG A 1 554  ? 112.547 140.356 68.667  1.00 269.67 ?  426  ARG A CZ    1 
ATOM   158   N  NH1   . ARG A 1 554  ? 111.499 139.546 68.730  1.00 277.94 ?  426  ARG A NH1   1 
ATOM   159   N  NH2   . ARG A 1 554  ? 112.714 141.294 69.589  1.00 293.94 ?  426  ARG A NH2   1 
ATOM   160   N  N     . LEU A 1 555  ? 118.420 141.350 64.958  1.00 210.32 ?  427  LEU A N     1 
ATOM   161   C  CA    . LEU A 1 555  ? 119.435 142.334 65.302  1.00 204.99 ?  427  LEU A CA    1 
ATOM   162   C  C     . LEU A 1 555  ? 120.537 142.489 64.262  1.00 210.28 ?  427  LEU A C     1 
ATOM   163   O  O     . LEU A 1 555  ? 121.434 143.316 64.470  1.00 201.77 ?  427  LEU A O     1 
ATOM   164   C  CB    . LEU A 1 555  ? 120.062 141.986 66.660  1.00 208.18 ?  427  LEU A CB    1 
ATOM   165   C  CG    . LEU A 1 555  ? 119.116 142.032 67.862  1.00 204.80 ?  427  LEU A CG    1 
ATOM   166   C  CD1   . LEU A 1 555  ? 119.904 142.127 69.157  1.00 205.10 ?  427  LEU A CD1   1 
ATOM   167   C  CD2   . LEU A 1 555  ? 118.138 143.195 67.745  1.00 181.80 ?  427  LEU A CD2   1 
ATOM   168   N  N     . ARG A 1 556  ? 120.517 141.704 63.176  1.00 215.72 ?  428  ARG A N     1 
ATOM   169   C  CA    . ARG A 1 556  ? 121.496 141.874 62.102  1.00 221.77 ?  428  ARG A CA    1 
ATOM   170   C  C     . ARG A 1 556  ? 121.595 143.322 61.620  1.00 244.45 ?  428  ARG A C     1 
ATOM   171   O  O     . ARG A 1 556  ? 122.676 143.773 61.219  1.00 238.08 ?  428  ARG A O     1 
ATOM   172   C  CB    . ARG A 1 556  ? 121.136 140.945 60.940  1.00 208.87 ?  428  ARG A CB    1 
ATOM   173   C  CG    . ARG A 1 556  ? 122.070 141.022 59.746  1.00 222.45 ?  428  ARG A CG    1 
ATOM   174   C  CD    . ARG A 1 556  ? 121.939 139.802 58.846  1.00 221.42 ?  428  ARG A CD    1 
ATOM   175   N  NE    . ARG A 1 556  ? 122.725 139.946 57.623  1.00 217.87 ?  428  ARG A NE    1 
ATOM   176   C  CZ    . ARG A 1 556  ? 122.194 140.092 56.412  1.00 219.00 ?  428  ARG A CZ    1 
ATOM   177   N  NH1   . ARG A 1 556  ? 120.876 140.113 56.262  1.00 222.42 ?  428  ARG A NH1   1 
ATOM   178   N  NH2   . ARG A 1 556  ? 122.980 140.221 55.352  1.00 217.02 ?  428  ARG A NH2   1 
ATOM   179   N  N     . ASP A 1 557  ? 120.485 144.063 61.657  1.00 247.41 ?  429  ASP A N     1 
ATOM   180   C  CA    . ASP A 1 557  ? 120.475 145.452 61.204  1.00 250.87 ?  429  ASP A CA    1 
ATOM   181   C  C     . ASP A 1 557  ? 121.433 146.309 62.027  1.00 229.57 ?  429  ASP A C     1 
ATOM   182   O  O     . ASP A 1 557  ? 122.381 146.910 61.498  1.00 223.59 ?  429  ASP A O     1 
ATOM   183   C  CB    . ASP A 1 557  ? 119.049 145.998 61.292  1.00 244.87 ?  429  ASP A CB    1 
ATOM   184   C  CG    . ASP A 1 557  ? 118.003 144.942 60.970  1.00 267.39 ?  429  ASP A CG    1 
ATOM   185   O  OD1   . ASP A 1 557  ? 117.888 144.548 59.790  1.00 264.36 ?  429  ASP A OD1   1 
ATOM   186   O  OD2   . ASP A 1 557  ? 117.323 144.472 61.909  1.00 311.83 -1 429  ASP A OD2   1 
ATOM   187   N  N     . LEU A 1 558  ? 121.188 146.390 63.335  1.00 214.82 ?  430  LEU A N     1 
ATOM   188   C  CA    . LEU A 1 558  ? 122.074 147.153 64.202  1.00 202.45 ?  430  LEU A CA    1 
ATOM   189   C  C     . LEU A 1 558  ? 123.466 146.538 64.260  1.00 194.77 ?  430  LEU A C     1 
ATOM   190   O  O     . LEU A 1 558  ? 124.433 147.255 64.527  1.00 190.07 ?  430  LEU A O     1 
ATOM   191   C  CB    . LEU A 1 558  ? 121.467 147.259 65.600  1.00 205.59 ?  430  LEU A CB    1 
ATOM   192   C  CG    . LEU A 1 558  ? 122.074 148.295 66.544  1.00 214.19 ?  430  LEU A CG    1 
ATOM   193   C  CD1   . LEU A 1 558  ? 122.498 149.548 65.790  1.00 200.38 ?  430  LEU A CD1   1 
ATOM   194   C  CD2   . LEU A 1 558  ? 121.087 148.640 67.652  1.00 224.29 ?  430  LEU A CD2   1 
ATOM   195   N  N     . LYS A 1 559  ? 123.587 145.233 63.995  1.00 200.29 ?  431  LYS A N     1 
ATOM   196   C  CA    . LYS A 1 559  ? 124.906 144.624 63.870  1.00 211.61 ?  431  LYS A CA    1 
ATOM   197   C  C     . LYS A 1 559  ? 125.702 145.264 62.738  1.00 201.14 ?  431  LYS A C     1 
ATOM   198   O  O     . LYS A 1 559  ? 126.866 145.634 62.916  1.00 200.51 ?  431  LYS A O     1 
ATOM   199   C  CB    . LYS A 1 559  ? 124.781 143.116 63.640  1.00 211.12 ?  431  LYS A CB    1 
ATOM   200   C  CG    . LYS A 1 559  ? 126.091 142.465 63.205  1.00 198.95 ?  431  LYS A CG    1 
ATOM   201   C  CD    . LYS A 1 559  ? 125.897 141.032 62.736  1.00 161.36 ?  431  LYS A CD    1 
ATOM   202   C  CE    . LYS A 1 559  ? 127.201 140.459 62.202  1.00 130.05 ?  431  LYS A CE    1 
ATOM   203   N  NZ    . LYS A 1 559  ? 127.005 139.109 61.615  1.00 168.18 ?  431  LYS A NZ    1 
ATOM   204   N  N     . ASN A 1 560  ? 125.089 145.391 61.558  1.00 194.46 ?  432  ASN A N     1 
ATOM   205   C  CA    . ASN A 1 560  ? 125.766 146.039 60.436  1.00 171.91 ?  432  ASN A CA    1 
ATOM   206   C  C     . ASN A 1 560  ? 126.016 147.519 60.699  1.00 165.43 ?  432  ASN A C     1 
ATOM   207   O  O     . ASN A 1 560  ? 127.034 148.062 60.251  1.00 165.93 ?  432  ASN A O     1 
ATOM   208   C  CB    . ASN A 1 560  ? 124.958 145.867 59.149  1.00 175.96 ?  432  ASN A CB    1 
ATOM   209   C  CG    . ASN A 1 560  ? 124.534 144.430 58.908  1.00 189.74 ?  432  ASN A CG    1 
ATOM   210   O  OD1   . ASN A 1 560  ? 125.223 143.489 59.306  1.00 185.31 ?  432  ASN A OD1   1 
ATOM   211   N  ND2   . ASN A 1 560  ? 123.385 144.255 58.263  1.00 211.19 ?  432  ASN A ND2   1 
ATOM   212   N  N     . GLN A 1 561  ? 125.098 148.186 61.404  1.00 172.73 ?  433  GLN A N     1 
ATOM   213   C  CA    . GLN A 1 561  ? 125.317 149.586 61.773  1.00 161.18 ?  433  GLN A CA    1 
ATOM   214   C  C     . GLN A 1 561  ? 126.559 149.740 62.650  1.00 177.30 ?  433  GLN A C     1 
ATOM   215   O  O     . GLN A 1 561  ? 127.422 150.592 62.390  1.00 181.46 ?  433  GLN A O     1 
ATOM   216   C  CB    . GLN A 1 561  ? 124.086 150.132 62.495  1.00 160.51 ?  433  GLN A CB    1 
ATOM   217   C  CG    . GLN A 1 561  ? 122.790 150.038 61.705  1.00 174.16 ?  433  GLN A CG    1 
ATOM   218   C  CD    . GLN A 1 561  ? 121.635 150.753 62.384  1.00 163.60 ?  433  GLN A CD    1 
ATOM   219   O  OE1   . GLN A 1 561  ? 121.837 151.638 63.217  1.00 158.66 ?  433  GLN A OE1   1 
ATOM   220   N  NE2   . GLN A 1 561  ? 120.414 150.363 62.037  0.33 168.82 ?  433  GLN A NE2   1 
ATOM   221   N  N     . VAL A 1 562  ? 126.652 148.934 63.712  1.00 192.86 ?  434  VAL A N     1 
ATOM   222   C  CA    . VAL A 1 562  ? 127.833 148.951 64.574  1.00 210.37 ?  434  VAL A CA    1 
ATOM   223   C  C     . VAL A 1 562  ? 129.074 148.561 63.782  1.00 207.01 ?  434  VAL A C     1 
ATOM   224   O  O     . VAL A 1 562  ? 130.166 149.103 63.998  1.00 204.55 ?  434  VAL A O     1 
ATOM   225   C  CB    . VAL A 1 562  ? 127.621 148.027 65.790  1.00 219.79 ?  434  VAL A CB    1 
ATOM   226   C  CG1   . VAL A 1 562  ? 128.918 147.840 66.567  1.00 202.26 ?  434  VAL A CG1   1 
ATOM   227   C  CG2   . VAL A 1 562  ? 126.527 148.577 66.698  1.00 212.52 ?  434  VAL A CG2   1 
ATOM   228   N  N     . LYS A 1 563  ? 128.925 147.614 62.854  1.00 202.18 ?  435  LYS A N     1 
ATOM   229   C  CA    . LYS A 1 563  ? 130.041 147.203 62.012  1.00 208.79 ?  435  LYS A CA    1 
ATOM   230   C  C     . LYS A 1 563  ? 130.610 148.389 61.243  1.00 215.89 ?  435  LYS A C     1 
ATOM   231   O  O     . LYS A 1 563  ? 131.812 148.670 61.318  1.00 226.92 ?  435  LYS A O     1 
ATOM   232   C  CB    . LYS A 1 563  ? 129.589 146.095 61.056  1.00 200.24 ?  435  LYS A CB    1 
ATOM   233   C  CG    . LYS A 1 563  ? 130.727 145.315 60.414  1.00 207.86 ?  435  LYS A CG    1 
ATOM   234   C  CD    . LYS A 1 563  ? 131.577 144.609 61.461  1.00 209.39 ?  435  LYS A CD    1 
ATOM   235   C  CE    . LYS A 1 563  ? 132.771 143.896 60.842  1.00 222.48 ?  435  LYS A CE    1 
ATOM   236   N  NZ    . LYS A 1 563  ? 133.826 144.858 60.417  1.00 239.14 ?  435  LYS A NZ    1 
ATOM   237   N  N     . THR A 1 564  ? 129.755 149.105 60.503  1.00 208.29 ?  436  THR A N     1 
ATOM   238   C  CA    . THR A 1 564  ? 130.250 150.218 59.695  1.00 216.28 ?  436  THR A CA    1 
ATOM   239   C  C     . THR A 1 564  ? 130.797 151.339 60.575  1.00 220.40 ?  436  THR A C     1 
ATOM   240   O  O     . THR A 1 564  ? 131.828 151.941 60.249  1.00 233.27 ?  436  THR A O     1 
ATOM   241   C  CB    . THR A 1 564  ? 129.168 150.746 58.739  1.00 197.21 ?  436  THR A CB    1 
ATOM   242   O  OG1   . THR A 1 564  ? 129.587 152.003 58.190  1.00 205.86 ?  436  THR A OG1   1 
ATOM   243   C  CG2   . THR A 1 564  ? 127.839 150.944 59.430  1.00 155.70 ?  436  THR A CG2   1 
ATOM   244   N  N     . PHE A 1 565  ? 130.143 151.616 61.709  1.00 204.36 ?  437  PHE A N     1 
ATOM   245   C  CA    . PHE A 1 565  ? 130.647 152.655 62.608  1.00 202.20 ?  437  PHE A CA    1 
ATOM   246   C  C     . PHE A 1 565  ? 132.053 152.318 63.103  1.00 209.15 ?  437  PHE A C     1 
ATOM   247   O  O     . PHE A 1 565  ? 132.966 153.154 63.047  1.00 214.59 ?  437  PHE A O     1 
ATOM   248   C  CB    . PHE A 1 565  ? 129.688 152.848 63.786  1.00 200.35 ?  437  PHE A CB    1 
ATOM   249   C  CG    . PHE A 1 565  ? 130.227 153.739 64.878  1.00 195.00 ?  437  PHE A CG    1 
ATOM   250   C  CD1   . PHE A 1 565  ? 130.967 153.219 65.928  1.00 190.01 ?  437  PHE A CD1   1 
ATOM   251   C  CD2   . PHE A 1 565  ? 129.979 155.104 64.856  1.00 181.51 ?  437  PHE A CD2   1 
ATOM   252   C  CE1   . PHE A 1 565  ? 131.456 154.041 66.927  1.00 180.26 ?  437  PHE A CE1   1 
ATOM   253   C  CE2   . PHE A 1 565  ? 130.466 155.930 65.857  1.00 169.42 ?  437  PHE A CE2   1 
ATOM   254   C  CZ    . PHE A 1 565  ? 131.204 155.395 66.891  1.00 166.92 ?  437  PHE A CZ    1 
ATOM   255   N  N     . ALA A 1 566  ? 132.243 151.093 63.599  1.00 214.96 ?  438  ALA A N     1 
ATOM   256   C  CA    . ALA A 1 566  ? 133.537 150.705 64.148  1.00 230.09 ?  438  ALA A CA    1 
ATOM   257   C  C     . ALA A 1 566  ? 134.615 150.684 63.073  1.00 240.95 ?  438  ALA A C     1 
ATOM   258   O  O     . ALA A 1 566  ? 135.743 151.134 63.311  1.00 245.23 ?  438  ALA A O     1 
ATOM   259   C  CB    . ALA A 1 566  ? 133.430 149.341 64.829  1.00 238.83 ?  438  ALA A CB    1 
ATOM   260   N  N     . GLU A 1 567  ? 134.296 150.157 61.884  1.00 241.10 ?  439  GLU A N     1 
ATOM   261   C  CA    . GLU A 1 567  ? 135.268 150.184 60.792  1.00 240.79 ?  439  GLU A CA    1 
ATOM   262   C  C     . GLU A 1 567  ? 135.615 151.611 60.388  1.00 238.79 ?  439  GLU A C     1 
ATOM   263   O  O     . GLU A 1 567  ? 136.726 151.867 59.908  1.00 227.70 ?  439  GLU A O     1 
ATOM   264   C  CB    . GLU A 1 567  ? 134.739 149.395 59.590  1.00 263.61 ?  439  GLU A CB    1 
ATOM   265   C  CG    . GLU A 1 567  ? 134.448 147.927 59.894  1.00 277.76 ?  439  GLU A CG    1 
ATOM   266   C  CD    . GLU A 1 567  ? 133.328 147.355 59.034  1.00 308.31 ?  439  GLU A CD    1 
ATOM   267   O  OE1   . GLU A 1 567  ? 132.512 148.146 58.515  1.00 292.54 ?  439  GLU A OE1   1 
ATOM   268   O  OE2   . GLU A 1 567  ? 133.250 146.115 58.898  1.00 396.89 -1 439  GLU A OE2   1 
ATOM   269   N  N     . LYS A 1 568  ? 134.682 152.549 60.567  1.00 246.75 ?  440  LYS A N     1 
ATOM   270   C  CA    . LYS A 1 568  ? 134.992 153.952 60.304  1.00 249.56 ?  440  LYS A CA    1 
ATOM   271   C  C     . LYS A 1 568  ? 135.941 154.520 61.353  1.00 244.81 ?  440  LYS A C     1 
ATOM   272   O  O     . LYS A 1 568  ? 136.898 155.225 61.011  1.00 240.45 ?  440  LYS A O     1 
ATOM   273   C  CB    . LYS A 1 568  ? 133.704 154.772 60.253  1.00 242.47 ?  440  LYS A CB    1 
ATOM   274   C  CG    . LYS A 1 568  ? 132.909 154.614 58.967  1.00 223.71 ?  440  LYS A CG    1 
ATOM   275   C  CD    . LYS A 1 568  ? 131.508 155.185 59.118  1.00 213.50 ?  440  LYS A CD    1 
ATOM   276   C  CE    . LYS A 1 568  ? 130.738 155.122 57.810  1.00 219.82 ?  440  LYS A CE    1 
ATOM   277   N  NZ    . LYS A 1 568  ? 129.379 155.714 57.950  1.00 233.82 ?  440  LYS A NZ    1 
ATOM   278   N  N     . GLU A 1 569  ? 135.705 154.222 62.631  1.00 241.21 ?  441  GLU A N     1 
ATOM   279   C  CA    . GLU A 1 569  ? 136.407 154.919 63.703  1.00 249.73 ?  441  GLU A CA    1 
ATOM   280   C  C     . GLU A 1 569  ? 137.437 154.054 64.421  1.00 261.33 ?  441  GLU A C     1 
ATOM   281   O  O     . GLU A 1 569  ? 138.616 154.417 64.471  1.00 261.68 ?  441  GLU A O     1 
ATOM   282   C  CB    . GLU A 1 569  ? 135.389 155.478 64.709  1.00 265.07 ?  441  GLU A CB    1 
ATOM   283   C  CG    . GLU A 1 569  ? 134.568 156.655 64.192  1.00 267.03 ?  441  GLU A CG    1 
ATOM   284   C  CD    . GLU A 1 569  ? 135.328 157.972 64.216  1.00 304.43 ?  441  GLU A CD    1 
ATOM   285   O  OE1   . GLU A 1 569  ? 136.474 158.015 63.721  1.00 293.37 ?  441  GLU A OE1   1 
ATOM   286   O  OE2   . GLU A 1 569  ? 134.776 158.970 64.727  1.00 389.07 -1 441  GLU A OE2   1 
ATOM   287   N  N     . GLU A 1 570  ? 137.035 152.916 64.982  1.00 271.70 ?  442  GLU A N     1 
ATOM   288   C  CA    . GLU A 1 570  ? 137.905 152.131 65.859  1.00 286.47 ?  442  GLU A CA    1 
ATOM   289   C  C     . GLU A 1 570  ? 138.433 150.869 65.186  1.00 278.86 ?  442  GLU A C     1 
ATOM   290   O  O     . GLU A 1 570  ? 138.604 149.835 65.839  1.00 277.62 ?  442  GLU A O     1 
ATOM   291   C  CB    . GLU A 1 570  ? 137.172 151.784 67.152  1.00 290.00 ?  442  GLU A CB    1 
ATOM   292   C  CG    . GLU A 1 570  ? 136.582 152.992 67.867  1.00 288.23 ?  442  GLU A CG    1 
ATOM   293   C  CD    . GLU A 1 570  ? 137.642 153.906 68.456  1.00 310.25 ?  442  GLU A CD    1 
ATOM   294   O  OE1   . GLU A 1 570  ? 138.781 153.442 68.672  1.00 294.45 ?  442  GLU A OE1   1 
ATOM   295   O  OE2   . GLU A 1 570  ? 137.340 155.096 68.691  1.00 404.91 -1 442  GLU A OE2   1 
ATOM   296   N  N     . GLY A 1 571  ? 138.706 150.927 63.885  1.00 261.19 ?  443  GLY A N     1 
ATOM   297   C  CA    . GLY A 1 571  ? 139.296 149.794 63.192  1.00 254.35 ?  443  GLY A CA    1 
ATOM   298   C  C     . GLY A 1 571  ? 138.431 148.554 63.149  1.00 251.16 ?  443  GLY A C     1 
ATOM   299   O  O     . GLY A 1 571  ? 138.960 147.442 63.043  1.00 240.18 ?  443  GLY A O     1 
ATOM   300   N  N     . GLY A 1 572  ? 137.112 148.712 63.232  1.00 259.53 ?  444  GLY A N     1 
ATOM   301   C  CA    . GLY A 1 572  ? 136.214 147.576 63.142  1.00 265.45 ?  444  GLY A CA    1 
ATOM   302   C  C     . GLY A 1 572  ? 136.226 146.629 64.321  1.00 279.54 ?  444  GLY A C     1 
ATOM   303   O  O     . GLY A 1 572  ? 135.723 145.508 64.197  1.00 266.61 ?  444  GLY A O     1 
ATOM   304   N  N     . ASP A 1 573  ? 136.775 147.038 65.466  1.00 295.74 ?  445  ASP A N     1 
ATOM   305   C  CA    . ASP A 1 573  ? 136.843 146.176 66.647  1.00 302.02 ?  445  ASP A CA    1 
ATOM   306   C  C     . ASP A 1 573  ? 135.445 146.115 67.264  1.00 292.21 ?  445  ASP A C     1 
ATOM   307   O  O     . ASP A 1 573  ? 135.104 146.852 68.191  1.00 284.16 ?  445  ASP A O     1 
ATOM   308   C  CB    . ASP A 1 573  ? 137.886 146.702 67.634  1.00 294.00 ?  445  ASP A CB    1 
ATOM   309   C  CG    . ASP A 1 573  ? 138.025 145.830 68.882  1.00 273.60 ?  445  ASP A CG    1 
ATOM   310   O  OD1   . ASP A 1 573  ? 137.354 144.781 68.972  1.00 250.17 ?  445  ASP A OD1   1 
ATOM   311   O  OD2   . ASP A 1 573  ? 138.813 146.201 69.780  1.00 298.74 -1 445  ASP A OD2   1 
ATOM   312   N  N     . VAL A 1 574  ? 134.616 145.219 66.714  1.00 270.99 ?  446  VAL A N     1 
ATOM   313   C  CA    . VAL A 1 574  ? 133.254 145.029 67.219  1.00 253.95 ?  446  VAL A CA    1 
ATOM   314   C  C     . VAL A 1 574  ? 133.278 144.662 68.698  1.00 251.02 ?  446  VAL A C     1 
ATOM   315   O  O     . VAL A 1 574  ? 132.411 145.084 69.476  1.00 252.05 ?  446  VAL A O     1 
ATOM   316   C  CB    . VAL A 1 574  ? 132.517 143.965 66.378  1.00 211.27 ?  446  VAL A CB    1 
ATOM   317   C  CG1   . VAL A 1 574  ? 131.241 143.498 67.065  1.00 158.86 ?  446  VAL A CG1   1 
ATOM   318   C  CG2   . VAL A 1 574  ? 132.198 144.509 64.990  1.00 198.30 ?  446  VAL A CG2   1 
ATOM   319   N  N     . LYS A 1 575  ? 134.288 143.893 69.113  1.00 227.83 ?  447  LYS A N     1 
ATOM   320   C  CA    . LYS A 1 575  ? 134.384 143.429 70.495  1.00 208.76 ?  447  LYS A CA    1 
ATOM   321   C  C     . LYS A 1 575  ? 134.442 144.595 71.479  1.00 235.27 ?  447  LYS A C     1 
ATOM   322   O  O     . LYS A 1 575  ? 133.572 144.737 72.348  1.00 235.26 ?  447  LYS A O     1 
ATOM   323   C  CB    . LYS A 1 575  ? 135.611 142.529 70.646  1.00 164.32 ?  447  LYS A CB    1 
ATOM   324   C  CG    . LYS A 1 575  ? 135.773 141.932 72.025  1.00 155.64 ?  447  LYS A CG    1 
ATOM   325   C  CD    . LYS A 1 575  ? 136.447 140.578 71.964  1.00 164.78 ?  447  LYS A CD    1 
ATOM   326   C  CE    . LYS A 1 575  ? 136.163 139.773 73.219  1.00 183.04 ?  447  LYS A CE    1 
ATOM   327   N  NZ    . LYS A 1 575  ? 136.730 138.402 73.125  1.00 238.44 ?  447  LYS A NZ    1 
ATOM   328   N  N     . SER A 1 576  ? 135.477 145.436 71.362  1.00 232.65 ?  448  SER A N     1 
ATOM   329   C  CA    . SER A 1 576  ? 135.634 146.561 72.281  1.00 213.44 ?  448  SER A CA    1 
ATOM   330   C  C     . SER A 1 576  ? 134.489 147.562 72.160  1.00 218.67 ?  448  SER A C     1 
ATOM   331   O  O     . SER A 1 576  ? 134.086 148.163 73.164  1.00 205.14 ?  448  SER A O     1 
ATOM   332   C  CB    . SER A 1 576  ? 136.975 147.259 72.039  1.00 206.48 ?  448  SER A CB    1 
ATOM   333   O  OG    . SER A 1 576  ? 138.064 146.357 72.147  1.00 208.42 ?  448  SER A OG    1 
ATOM   334   N  N     . VAL A 1 577  ? 133.949 147.750 70.951  1.00 238.37 ?  449  VAL A N     1 
ATOM   335   C  CA    . VAL A 1 577  ? 132.844 148.690 70.754  1.00 226.57 ?  449  VAL A CA    1 
ATOM   336   C  C     . VAL A 1 577  ? 131.613 148.241 71.538  1.00 231.00 ?  449  VAL A C     1 
ATOM   337   O  O     . VAL A 1 577  ? 131.079 148.989 72.366  1.00 229.47 ?  449  VAL A O     1 
ATOM   338   C  CB    . VAL A 1 577  ? 132.530 148.856 69.254  1.00 224.61 ?  449  VAL A CB    1 
ATOM   339   C  CG1   . VAL A 1 577  ? 131.183 149.532 69.057  1.00 209.89 ?  449  VAL A CG1   1 
ATOM   340   C  CG2   . VAL A 1 577  ? 133.618 149.674 68.569  1.00 217.13 ?  449  VAL A CG2   1 
ATOM   341   N  N     . CYS A 1 578  ? 131.141 147.012 71.285  1.00 232.09 ?  450  CYS A N     1 
ATOM   342   C  CA    . CYS A 1 578  ? 129.965 146.527 72.006  1.00 222.51 ?  450  CYS A CA    1 
ATOM   343   C  C     . CYS A 1 578  ? 130.239 146.413 73.501  1.00 213.29 ?  450  CYS A C     1 
ATOM   344   O  O     . CYS A 1 578  ? 129.331 146.626 74.315  1.00 205.61 ?  450  CYS A O     1 
ATOM   345   C  CB    . CYS A 1 578  ? 129.486 145.186 71.433  1.00 213.90 ?  450  CYS A CB    1 
ATOM   346   S  SG    . CYS A 1 578  ? 130.611 143.772 71.565  1.00 234.59 ?  450  CYS A SG    1 
ATOM   347   N  N     . LEU A 1 579  ? 131.484 146.113 73.884  1.00 209.37 ?  451  LEU A N     1 
ATOM   348   C  CA    . LEU A 1 579  ? 131.850 146.097 75.296  1.00 193.33 ?  451  LEU A CA    1 
ATOM   349   C  C     . LEU A 1 579  ? 131.605 147.457 75.943  1.00 196.89 ?  451  LEU A C     1 
ATOM   350   O  O     . LEU A 1 579  ? 130.857 147.567 76.923  1.00 199.38 ?  451  LEU A O     1 
ATOM   351   C  CB    . LEU A 1 579  ? 133.316 145.681 75.441  1.00 190.26 ?  451  LEU A CB    1 
ATOM   352   C  CG    . LEU A 1 579  ? 133.888 145.561 76.857  1.00 182.84 ?  451  LEU A CG    1 
ATOM   353   C  CD1   . LEU A 1 579  ? 132.968 144.744 77.746  1.00 196.05 ?  451  LEU A CD1   1 
ATOM   354   C  CD2   . LEU A 1 579  ? 135.295 144.972 76.849  1.00 170.80 ?  451  LEU A CD2   1 
ATOM   355   N  N     . THR A 1 580  ? 132.245 148.505 75.409  1.00 208.12 ?  452  THR A N     1 
ATOM   356   C  CA    . THR A 1 580  ? 132.098 149.846 75.974  1.00 215.31 ?  452  THR A CA    1 
ATOM   357   C  C     . THR A 1 580  ? 130.646 150.310 75.933  1.00 215.49 ?  452  THR A C     1 
ATOM   358   O  O     . THR A 1 580  ? 130.179 150.997 76.852  1.00 201.68 ?  452  THR A O     1 
ATOM   359   C  CB    . THR A 1 580  ? 133.004 150.832 75.227  1.00 206.17 ?  452  THR A CB    1 
ATOM   360   O  OG1   . THR A 1 580  ? 134.342 150.319 75.173  1.00 196.59 ?  452  THR A OG1   1 
ATOM   361   C  CG2   . THR A 1 580  ? 133.028 152.189 75.924  1.00 199.08 ?  452  THR A CG2   1 
ATOM   362   N  N     . LEU A 1 581  ? 129.911 149.939 74.879  1.00 223.45 ?  453  LEU A N     1 
ATOM   363   C  CA    . LEU A 1 581  ? 128.507 150.334 74.779  1.00 207.50 ?  453  LEU A CA    1 
ATOM   364   C  C     . LEU A 1 581  ? 127.675 149.706 75.891  1.00 190.82 ?  453  LEU A C     1 
ATOM   365   O  O     . LEU A 1 581  ? 126.873 150.390 76.537  1.00 188.01 ?  453  LEU A O     1 
ATOM   366   C  CB    . LEU A 1 581  ? 127.944 149.961 73.406  1.00 212.29 ?  453  LEU A CB    1 
ATOM   367   C  CG    . LEU A 1 581  ? 128.465 150.746 72.199  1.00 226.26 ?  453  LEU A CG    1 
ATOM   368   C  CD1   . LEU A 1 581  ? 127.931 150.158 70.899  1.00 238.38 ?  453  LEU A CD1   1 
ATOM   369   C  CD2   . LEU A 1 581  ? 128.102 152.221 72.317  1.00 203.11 ?  453  LEU A CD2   1 
ATOM   370   N  N     . PHE A 1 582  ? 127.841 148.401 76.120  1.00 189.93 ?  454  PHE A N     1 
ATOM   371   C  CA    . PHE A 1 582  ? 127.099 147.749 77.195  1.00 186.78 ?  454  PHE A CA    1 
ATOM   372   C  C     . PHE A 1 582  ? 127.507 148.302 78.558  1.00 180.84 ?  454  PHE A C     1 
ATOM   373   O  O     . PHE A 1 582  ? 126.664 148.462 79.452  1.00 184.27 ?  454  PHE A O     1 
ATOM   374   C  CB    . PHE A 1 582  ? 127.304 146.236 77.131  1.00 184.49 ?  454  PHE A CB    1 
ATOM   375   C  CG    . PHE A 1 582  ? 126.482 145.469 78.124  1.00 200.05 ?  454  PHE A CG    1 
ATOM   376   C  CD1   . PHE A 1 582  ? 125.114 145.342 77.960  1.00 211.63 ?  454  PHE A CD1   1 
ATOM   377   C  CD2   . PHE A 1 582  ? 127.074 144.870 79.218  1.00 210.59 ?  454  PHE A CD2   1 
ATOM   378   C  CE1   . PHE A 1 582  ? 124.354 144.640 78.873  1.00 211.93 ?  454  PHE A CE1   1 
ATOM   379   C  CE2   . PHE A 1 582  ? 126.317 144.162 80.132  1.00 220.07 ?  454  PHE A CE2   1 
ATOM   380   C  CZ    . PHE A 1 582  ? 124.957 144.049 79.958  1.00 206.65 ?  454  PHE A CZ    1 
ATOM   381   N  N     . LEU A 1 583  ? 128.793 148.618 78.729  1.00 176.68 ?  455  LEU A N     1 
ATOM   382   C  CA    . LEU A 1 583  ? 129.255 149.224 79.976  1.00 170.79 ?  455  LEU A CA    1 
ATOM   383   C  C     . LEU A 1 583  ? 128.545 150.547 80.241  1.00 165.79 ?  455  LEU A C     1 
ATOM   384   O  O     . LEU A 1 583  ? 127.995 150.768 81.327  1.00 179.41 ?  455  LEU A O     1 
ATOM   385   C  CB    . LEU A 1 583  ? 130.771 149.427 79.935  1.00 175.95 ?  455  LEU A CB    1 
ATOM   386   C  CG    . LEU A 1 583  ? 131.641 148.178 79.810  1.00 194.30 ?  455  LEU A CG    1 
ATOM   387   C  CD1   . LEU A 1 583  ? 133.084 148.555 79.510  1.00 232.68 ?  455  LEU A CD1   1 
ATOM   388   C  CD2   . LEU A 1 583  ? 131.557 147.346 81.078  1.00 198.68 ?  455  LEU A CD2   1 
ATOM   389   N  N     . LEU A 1 584  ? 128.561 151.447 79.255  1.00 166.92 ?  456  LEU A N     1 
ATOM   390   C  CA    . LEU A 1 584  ? 127.903 152.738 79.426  1.00 179.14 ?  456  LEU A CA    1 
ATOM   391   C  C     . LEU A 1 584  ? 126.396 152.584 79.596  1.00 196.64 ?  456  LEU A C     1 
ATOM   392   O  O     . LEU A 1 584  ? 125.769 153.375 80.311  1.00 211.39 ?  456  LEU A O     1 
ATOM   393   C  CB    . LEU A 1 584  ? 128.230 153.650 78.241  1.00 180.20 ?  456  LEU A CB    1 
ATOM   394   C  CG    . LEU A 1 584  ? 129.680 154.140 78.150  1.00 169.48 ?  456  LEU A CG    1 
ATOM   395   C  CD1   . LEU A 1 584  ? 129.862 155.123 77.000  1.00 166.72 ?  456  LEU A CD1   1 
ATOM   396   C  CD2   . LEU A 1 584  ? 130.126 154.772 79.465  1.00 172.10 ?  456  LEU A CD2   1 
ATOM   397   N  N     . ALA A 1 585  ? 125.796 151.581 78.949  1.00 189.04 ?  457  ALA A N     1 
ATOM   398   C  CA    . ALA A 1 585  ? 124.372 151.327 79.143  1.00 198.39 ?  457  ALA A CA    1 
ATOM   399   C  C     . ALA A 1 585  ? 124.075 150.933 80.584  1.00 184.72 ?  457  ALA A C     1 
ATOM   400   O  O     . ALA A 1 585  ? 123.075 151.374 81.164  1.00 194.99 ?  457  ALA A O     1 
ATOM   401   C  CB    . ALA A 1 585  ? 123.896 150.239 78.180  1.00 204.67 ?  457  ALA A CB    1 
ATOM   402   N  N     . LEU A 1 586  ? 124.929 150.098 81.175  1.00 183.20 ?  458  LEU A N     1 
ATOM   403   C  CA    . LEU A 1 586  ? 124.739 149.721 82.574  1.00 202.84 ?  458  LEU A CA    1 
ATOM   404   C  C     . LEU A 1 586  ? 124.958 150.910 83.504  1.00 200.26 ?  458  LEU A C     1 
ATOM   405   O  O     . LEU A 1 586  ? 124.199 151.110 84.460  1.00 201.88 ?  458  LEU A O     1 
ATOM   406   C  CB    . LEU A 1 586  ? 125.672 148.567 82.942  1.00 225.28 ?  458  LEU A CB    1 
ATOM   407   C  CG    . LEU A 1 586  ? 125.506 147.234 82.207  1.00 242.98 ?  458  LEU A CG    1 
ATOM   408   C  CD1   . LEU A 1 586  ? 126.106 146.099 83.032  1.00 248.78 ?  458  LEU A CD1   1 
ATOM   409   C  CD2   . LEU A 1 586  ? 124.040 146.956 81.890  1.00 256.31 ?  458  LEU A CD2   1 
ATOM   410   N  N     . ARG A 1 587  ? 125.999 151.708 83.244  1.00 200.20 ?  459  ARG A N     1 
ATOM   411   C  CA    . ARG A 1 587  ? 126.332 152.815 84.139  1.00 212.27 ?  459  ARG A CA    1 
ATOM   412   C  C     . ARG A 1 587  ? 125.225 153.863 84.196  1.00 204.85 ?  459  ARG A C     1 
ATOM   413   O  O     . ARG A 1 587  ? 125.063 154.536 85.222  1.00 208.60 ?  459  ARG A O     1 
ATOM   414   C  CB    . ARG A 1 587  ? 127.653 153.456 83.711  1.00 224.44 ?  459  ARG A CB    1 
ATOM   415   C  CG    . ARG A 1 587  ? 128.879 152.600 83.991  1.00 195.24 ?  459  ARG A CG    1 
ATOM   416   C  CD    . ARG A 1 587  ? 129.394 152.825 85.403  1.00 170.53 ?  459  ARG A CD    1 
ATOM   417   N  NE    . ARG A 1 587  ? 130.539 151.974 85.701  1.00 156.25 ?  459  ARG A NE    1 
ATOM   418   C  CZ    . ARG A 1 587  ? 130.450 150.823 86.359  1.00 145.12 ?  459  ARG A CZ    1 
ATOM   419   N  NH1   . ARG A 1 587  ? 129.269 150.395 86.782  1.00 143.14 ?  459  ARG A NH1   1 
ATOM   420   N  NH2   . ARG A 1 587  ? 131.537 150.100 86.593  1.00 152.19 ?  459  ARG A NH2   1 
ATOM   421   N  N     . ALA A 1 588  ? 124.459 154.020 83.115  1.00 192.82 ?  460  ALA A N     1 
ATOM   422   C  CA    . ALA A 1 588  ? 123.316 154.925 83.141  1.00 179.61 ?  460  ALA A CA    1 
ATOM   423   C  C     . ALA A 1 588  ? 122.182 154.395 84.010  1.00 192.07 ?  460  ALA A C     1 
ATOM   424   C  CB    . ALA A 1 588  ? 122.811 155.180 81.720  1.00 187.22 ?  460  ALA A CB    1 
ATOM   425   N  N     . GLY A 1 589  ? 122.115 153.081 84.219  1.00 199.06 ?  461  GLY A N     1 
ATOM   426   C  CA    . GLY A 1 589  ? 121.081 152.488 85.045  1.00 189.20 ?  461  GLY A CA    1 
ATOM   427   C  C     . GLY A 1 589  ? 121.503 152.214 86.474  1.00 182.64 ?  461  GLY A C     1 
ATOM   428   O  O     . GLY A 1 589  ? 120.860 151.422 87.172  1.00 168.63 ?  461  GLY A O     1 
ATOM   429   N  N     . ASN A 1 590  ? 122.588 152.854 86.918  1.00 186.87 ?  462  ASN A N     1 
ATOM   430   C  CA    . ASN A 1 590  ? 123.113 152.728 88.279  1.00 173.76 ?  462  ASN A CA    1 
ATOM   431   C  C     . ASN A 1 590  ? 123.529 151.300 88.620  1.00 162.54 ?  462  ASN A C     1 
ATOM   432   O  O     . ASN A 1 590  ? 123.654 150.951 89.799  1.00 152.62 ?  462  ASN A O     1 
ATOM   433   C  CB    . ASN A 1 590  ? 122.108 153.243 89.316  1.00 153.69 ?  462  ASN A CB    1 
ATOM   434   C  CG    . ASN A 1 590  ? 122.216 154.737 89.539  1.00 171.75 ?  462  ASN A CG    1 
ATOM   435   O  OD1   . ASN A 1 590  ? 122.584 155.190 90.624  1.00 187.69 ?  462  ASN A OD1   1 
ATOM   436   N  ND2   . ASN A 1 590  ? 121.898 155.513 88.510  1.00 190.86 ?  462  ASN A ND2   1 
ATOM   437   N  N     . GLU A 1 591  ? 123.757 150.468 87.608  1.00 171.19 ?  463  GLU A N     1 
ATOM   438   C  CA    . GLU A 1 591  ? 124.115 149.065 87.814  1.00 156.34 ?  463  GLU A CA    1 
ATOM   439   C  C     . GLU A 1 591  ? 125.621 148.894 87.976  1.00 121.26 ?  463  GLU A C     1 
ATOM   440   O  O     . GLU A 1 591  ? 126.266 148.151 87.237  1.00 140.31 ?  463  GLU A O     1 
ATOM   441   C  CB    . GLU A 1 591  ? 123.593 148.229 86.654  1.00 206.27 ?  463  GLU A CB    1 
ATOM   442   C  CG    . GLU A 1 591  ? 122.107 148.412 86.392  1.00 245.11 ?  463  GLU A CG    1 
ATOM   443   C  CD    . GLU A 1 591  ? 121.655 147.759 85.101  1.00 297.93 ?  463  GLU A CD    1 
ATOM   444   O  OE1   . GLU A 1 591  ? 121.888 148.344 84.022  1.00 265.00 ?  463  GLU A OE1   1 
ATOM   445   O  OE2   . GLU A 1 591  ? 121.052 146.667 85.166  1.00 458.03 -1 463  GLU A OE2   1 
ATOM   446   N  N     . HIS A 1 592  ? 126.193 149.608 88.948  1.00 112.32 ?  464  HIS A N     1 
ATOM   447   C  CA    . HIS A 1 592  ? 127.632 149.533 89.178  1.00 112.25 ?  464  HIS A CA    1 
ATOM   448   C  C     . HIS A 1 592  ? 128.087 148.106 89.461  1.00 121.57 ?  464  HIS A C     1 
ATOM   449   O  O     . HIS A 1 592  ? 129.187 147.716 89.056  1.00 139.24 ?  464  HIS A O     1 
ATOM   450   C  CB    . HIS A 1 592  ? 128.040 150.466 90.324  1.00 103.42 ?  464  HIS A CB    1 
ATOM   451   C  CG    . HIS A 1 592  ? 127.673 151.903 90.103  1.00 124.73 ?  464  HIS A CG    1 
ATOM   452   N  ND1   . HIS A 1 592  ? 126.403 152.312 89.753  1.00 151.75 ?  464  HIS A ND1   1 
ATOM   453   C  CD2   . HIS A 1 592  ? 128.422 153.029 90.172  1.00 132.82 ?  464  HIS A CD2   1 
ATOM   454   C  CE1   . HIS A 1 592  ? 126.384 153.627 89.624  1.00 167.38 ?  464  HIS A CE1   1 
ATOM   455   N  NE2   . HIS A 1 592  ? 127.597 154.087 89.872  1.00 155.03 ?  464  HIS A NE2   1 
ATOM   456   N  N     . LYS A 1 593  ? 127.253 147.311 90.136  1.00 102.42 ?  465  LYS A N     1 
ATOM   457   C  CA    . LYS A 1 593  ? 127.637 145.945 90.478  1.00 100.56 ?  465  LYS A CA    1 
ATOM   458   C  C     . LYS A 1 593  ? 127.828 145.089 89.230  1.00 110.04 ?  465  LYS A C     1 
ATOM   459   O  O     . LYS A 1 593  ? 128.861 144.427 89.064  1.00 135.70 ?  465  LYS A O     1 
ATOM   460   C  CB    . LYS A 1 593  ? 126.587 145.325 91.400  1.00 106.98 ?  465  LYS A CB    1 
ATOM   461   C  CG    . LYS A 1 593  ? 126.397 146.071 92.710  1.00 128.40 ?  465  LYS A CG    1 
ATOM   462   C  CD    . LYS A 1 593  ? 125.258 145.483 93.522  1.00 123.18 ?  465  LYS A CD    1 
ATOM   463   C  CE    . LYS A 1 593  ? 124.932 146.357 94.719  1.00 103.51 ?  465  LYS A CE    1 
ATOM   464   N  NZ    . LYS A 1 593  ? 123.631 145.973 95.321  1.00 89.77  ?  465  LYS A NZ    1 
ATOM   465   N  N     . GLN A 1 594  ? 126.827 145.072 88.350  1.00 104.00 ?  466  GLN A N     1 
ATOM   466   C  CA    . GLN A 1 594  ? 126.896 144.218 87.172  1.00 108.69 ?  466  GLN A CA    1 
ATOM   467   C  C     . GLN A 1 594  ? 128.041 144.630 86.257  1.00 127.76 ?  466  GLN A C     1 
ATOM   468   O  O     . GLN A 1 594  ? 128.787 143.779 85.759  1.00 139.59 ?  466  GLN A O     1 
ATOM   469   C  CB    . GLN A 1 594  ? 125.564 144.267 86.430  1.00 125.25 ?  466  GLN A CB    1 
ATOM   470   C  CG    . GLN A 1 594  ? 124.358 144.193 87.349  1.00 145.83 ?  466  GLN A CG    1 
ATOM   471   C  CD    . GLN A 1 594  ? 123.124 144.775 86.703  1.00 215.82 ?  466  GLN A CD    1 
ATOM   472   O  OE1   . GLN A 1 594  ? 123.092 144.988 85.491  1.00 239.94 ?  466  GLN A OE1   1 
ATOM   473   N  NE2   . GLN A 1 594  ? 122.105 145.055 87.508  1.00 232.44 ?  466  GLN A NE2   1 
ATOM   474   N  N     . ALA A 1 595  ? 128.199 145.936 86.029  1.00 142.31 ?  467  ALA A N     1 
ATOM   475   C  CA    . ALA A 1 595  ? 129.280 146.417 85.173  1.00 162.68 ?  467  ALA A CA    1 
ATOM   476   C  C     . ALA A 1 595  ? 130.644 146.128 85.786  1.00 146.46 ?  467  ALA A C     1 
ATOM   477   O  O     . ALA A 1 595  ? 131.603 145.813 85.070  1.00 145.18 ?  467  ALA A O     1 
ATOM   478   C  CB    . ALA A 1 595  ? 129.113 147.915 84.916  1.00 172.23 ?  467  ALA A CB    1 
ATOM   479   N  N     . ASP A 1 596  ? 130.749 146.230 87.112  1.00 138.53 ?  468  ASP A N     1 
ATOM   480   C  CA    . ASP A 1 596  ? 132.015 145.939 87.775  1.00 127.46 ?  468  ASP A CA    1 
ATOM   481   C  C     . ASP A 1 596  ? 132.381 144.469 87.637  1.00 114.77 ?  468  ASP A C     1 
ATOM   482   O  O     . ASP A 1 596  ? 133.537 144.135 87.367  1.00 118.99 ?  468  ASP A O     1 
ATOM   483   C  CB    . ASP A 1 596  ? 131.937 146.339 89.246  1.00 141.05 ?  468  ASP A CB    1 
ATOM   484   C  CG    . ASP A 1 596  ? 132.507 147.719 89.507  1.00 203.51 ?  468  ASP A CG    1 
ATOM   485   O  OD1   . ASP A 1 596  ? 132.564 148.532 88.559  1.00 193.97 ?  468  ASP A OD1   1 
ATOM   486   O  OD2   . ASP A 1 596  ? 132.895 147.995 90.661  1.00 371.02 -1 468  ASP A OD2   1 
ATOM   487   N  N     . GLU A 1 597  ? 131.407 143.572 87.804  1.00 126.37 ?  469  GLU A N     1 
ATOM   488   C  CA    . GLU A 1 597  ? 131.709 142.151 87.639  1.00 132.12 ?  469  GLU A CA    1 
ATOM   489   C  C     . GLU A 1 597  ? 131.998 141.798 86.185  1.00 125.79 ?  469  GLU A C     1 
ATOM   490   O  O     . GLU A 1 597  ? 132.820 140.912 85.916  1.00 129.01 ?  469  GLU A O     1 
ATOM   491   C  CB    . GLU A 1 597  ? 130.568 141.300 88.185  1.00 175.22 ?  469  GLU A CB    1 
ATOM   492   C  CG    . GLU A 1 597  ? 130.208 141.644 89.617  1.00 223.12 ?  469  GLU A CG    1 
ATOM   493   C  CD    . GLU A 1 597  ? 129.557 140.490 90.349  1.00 278.69 ?  469  GLU A CD    1 
ATOM   494   O  OE1   . GLU A 1 597  ? 129.405 139.408 89.743  1.00 278.56 ?  469  GLU A OE1   1 
ATOM   495   O  OE2   . GLU A 1 597  ? 129.219 140.661 91.539  1.00 358.43 -1 469  GLU A OE2   1 
ATOM   496   N  N     . LEU A 1 598  ? 131.347 142.476 85.242  1.00 134.48 ?  470  LEU A N     1 
ATOM   497   C  CA    . LEU A 1 598  ? 131.671 142.269 83.836  1.00 139.01 ?  470  LEU A CA    1 
ATOM   498   C  C     . LEU A 1 598  ? 133.107 142.681 83.541  1.00 133.01 ?  470  LEU A C     1 
ATOM   499   O  O     . LEU A 1 598  ? 133.860 141.940 82.897  1.00 134.53 ?  470  LEU A O     1 
ATOM   500   C  CB    . LEU A 1 598  ? 130.698 143.044 82.950  1.00 161.21 ?  470  LEU A CB    1 
ATOM   501   C  CG    . LEU A 1 598  ? 131.027 142.964 81.458  1.00 168.92 ?  470  LEU A CG    1 
ATOM   502   C  CD1   . LEU A 1 598  ? 131.042 141.522 80.978  1.00 166.81 ?  470  LEU A CD1   1 
ATOM   503   C  CD2   . LEU A 1 598  ? 130.072 143.809 80.629  1.00 187.58 ?  470  LEU A CD2   1 
ATOM   504   N  N     . GLU A 1 599  ? 133.503 143.873 83.993  1.00 128.22 ?  471  GLU A N     1 
ATOM   505   C  CA    . GLU A 1 599  ? 134.887 144.298 83.830  1.00 126.70 ?  471  GLU A CA    1 
ATOM   506   C  C     . GLU A 1 599  ? 135.851 143.405 84.596  1.00 133.35 ?  471  GLU A C     1 
ATOM   507   O  O     . GLU A 1 599  ? 137.025 143.307 84.221  1.00 145.63 ?  471  GLU A O     1 
ATOM   508   C  CB    . GLU A 1 599  ? 135.053 145.749 84.278  1.00 135.32 ?  471  GLU A CB    1 
ATOM   509   C  CG    . GLU A 1 599  ? 136.221 146.444 83.611  1.00 189.11 ?  471  GLU A CG    1 
ATOM   510   C  CD    . GLU A 1 599  ? 135.934 146.798 82.172  1.00 270.79 ?  471  GLU A CD    1 
ATOM   511   O  OE1   . GLU A 1 599  ? 134.789 147.192 81.876  1.00 245.88 ?  471  GLU A OE1   1 
ATOM   512   O  OE2   . GLU A 1 599  ? 136.847 146.653 81.332  1.00 482.76 -1 471  GLU A OE2   1 
ATOM   513   N  N     . ALA A 1 600  ? 135.382 142.759 85.661  1.00 133.90 ?  472  ALA A N     1 
ATOM   514   C  CA    . ALA A 1 600  ? 136.178 141.750 86.349  1.00 152.45 ?  472  ALA A CA    1 
ATOM   515   C  C     . ALA A 1 600  ? 136.261 140.453 85.559  1.00 145.29 ?  472  ALA A C     1 
ATOM   516   O  O     . ALA A 1 600  ? 137.122 139.616 85.849  1.00 148.49 ?  472  ALA A O     1 
ATOM   517   C  CB    . ALA A 1 600  ? 135.590 141.479 87.733  1.00 161.31 ?  472  ALA A CB    1 
ATOM   518   N  N     . MET A 1 601  ? 135.354 140.246 84.603  1.00 123.62 ?  473  MET A N     1 
ATOM   519   C  CA    . MET A 1 601  ? 135.480 139.102 83.709  1.00 105.75 ?  473  MET A CA    1 
ATOM   520   C  C     . MET A 1 601  ? 136.517 139.331 82.615  1.00 123.23 ?  473  MET A C     1 
ATOM   521   O  O     . MET A 1 601  ? 137.044 138.359 82.067  1.00 133.38 ?  473  MET A O     1 
ATOM   522   C  CB    . MET A 1 601  ? 134.125 138.773 83.079  1.00 93.50  ?  473  MET A CB    1 
ATOM   523   C  CG    . MET A 1 601  ? 134.040 137.366 82.503  1.00 118.71 ?  473  MET A CG    1 
ATOM   524   S  SD    . MET A 1 601  ? 132.724 137.137 81.289  1.00 171.43 ?  473  MET A SD    1 
ATOM   525   C  CE    . MET A 1 601  ? 133.176 138.343 80.052  1.00 143.33 ?  473  MET A CE    1 
ATOM   526   N  N     . MET A 1 602  ? 136.821 140.585 82.279  1.00 132.75 ?  474  MET A N     1 
ATOM   527   C  CA    . MET A 1 602  ? 137.716 140.905 81.171  1.00 134.22 ?  474  MET A CA    1 
ATOM   528   C  C     . MET A 1 602  ? 138.802 141.869 81.631  1.00 144.28 ?  474  MET A C     1 
ATOM   529   O  O     . MET A 1 602  ? 138.507 143.021 81.961  1.00 150.64 ?  474  MET A O     1 
ATOM   530   C  CB    . MET A 1 602  ? 136.942 141.506 79.993  1.00 124.99 ?  474  MET A CB    1 
ATOM   531   C  CG    . MET A 1 602  ? 135.857 140.610 79.429  1.00 122.77 ?  474  MET A CG    1 
ATOM   532   S  SD    . MET A 1 602  ? 136.499 139.055 78.779  1.00 142.84 ?  474  MET A SD    1 
ATOM   533   C  CE    . MET A 1 602  ? 137.416 139.630 77.350  1.00 157.45 ?  474  MET A CE    1 
ATOM   534   N  N     . GLN A 1 603  ? 140.055 141.403 81.621  1.00 155.26 ?  475  GLN A N     1 
ATOM   535   C  CA    . GLN A 1 603  ? 141.249 142.246 81.770  1.00 160.64 ?  475  GLN A CA    1 
ATOM   536   C  C     . GLN A 1 603  ? 141.202 143.085 83.053  1.00 135.33 ?  475  GLN A C     1 
ATOM   537   O  O     . GLN A 1 603  ? 141.067 144.308 83.023  1.00 133.74 ?  475  GLN A O     1 
ATOM   538   C  CB    . GLN A 1 603  ? 141.455 143.139 80.537  1.00 193.41 ?  475  GLN A CB    1 
ATOM   539   C  CG    . GLN A 1 603  ? 140.903 142.613 79.204  1.00 224.10 ?  475  GLN A CG    1 
ATOM   540   C  CD    . GLN A 1 603  ? 141.252 141.155 78.933  1.00 223.72 ?  475  GLN A CD    1 
ATOM   541   O  OE1   . GLN A 1 603  ? 140.386 140.281 78.970  1.00 207.87 ?  475  GLN A OE1   1 
ATOM   542   N  NE2   . GLN A 1 603  ? 142.523 140.892 78.644  1.00 208.69 ?  475  GLN A NE2   1 
ATOM   543   N  N     . GLY A 1 604  ? 141.325 142.400 84.190  1.00 134.99 ?  476  GLY A N     1 
ATOM   544   C  CA    . GLY A 1 604  ? 141.665 140.990 84.248  1.00 145.52 ?  476  GLY A CA    1 
ATOM   545   C  C     . GLY A 1 604  ? 140.537 140.128 84.771  1.00 137.54 ?  476  GLY A C     1 
ATOM   546   O  O     . GLY A 1 604  ? 139.465 140.628 85.102  1.00 139.43 ?  476  GLY A O     1 
ATOM   547   N  N     . ARG A 1 605  ? 140.789 138.821 84.843  1.00 134.79 ?  477  ARG A N     1 
ATOM   548   C  CA    . ARG A 1 605  ? 139.806 137.830 85.273  1.00 137.32 ?  477  ARG A CA    1 
ATOM   549   C  C     . ARG A 1 605  ? 140.459 136.881 86.280  1.00 158.65 ?  477  ARG A C     1 
ATOM   550   O  O     . ARG A 1 605  ? 140.419 135.660 86.138  1.00 181.91 ?  477  ARG A O     1 
ATOM   551   C  CB    . ARG A 1 605  ? 139.223 137.059 84.086  1.00 122.99 ?  477  ARG A CB    1 
ATOM   552   C  CG    . ARG A 1 605  ? 140.166 136.925 82.897  1.00 105.87 ?  477  ARG A CG    1 
ATOM   553   C  CD    . ARG A 1 605  ? 139.518 136.154 81.750  1.00 100.42 ?  477  ARG A CD    1 
ATOM   554   N  NE    . ARG A 1 605  ? 140.469 135.838 80.686  1.00 123.36 ?  477  ARG A NE    1 
ATOM   555   C  CZ    . ARG A 1 605  ? 140.192 135.069 79.636  1.00 126.54 ?  477  ARG A CZ    1 
ATOM   556   N  NH1   . ARG A 1 605  ? 138.986 134.535 79.502  1.00 136.69 ?  477  ARG A NH1   1 
ATOM   557   N  NH2   . ARG A 1 605  ? 141.121 134.832 78.718  1.00 112.09 ?  477  ARG A NH2   1 
ATOM   558   N  N     . GLY A 1 606  ? 141.101 137.463 87.290  1.00 144.94 ?  478  GLY A N     1 
ATOM   559   C  CA    . GLY A 1 606  ? 141.918 136.716 88.230  1.00 158.77 ?  478  GLY A CA    1 
ATOM   560   C  C     . GLY A 1 606  ? 141.274 135.536 88.939  1.00 173.29 ?  478  GLY A C     1 
ATOM   561   O  O     . GLY A 1 606  ? 141.680 134.393 88.703  1.00 176.97 ?  478  GLY A O     1 
ATOM   562   N  N     . PHE A 1 607  ? 140.302 135.802 89.826  1.00 156.89 ?  479  PHE A N     1 
ATOM   563   C  CA    . PHE A 1 607  ? 139.681 134.815 90.717  1.00 135.84 ?  479  PHE A CA    1 
ATOM   564   C  C     . PHE A 1 607  ? 140.656 134.323 91.776  1.00 103.55 ?  479  PHE A C     1 
ATOM   565   O  O     . PHE A 1 607  ? 140.288 133.525 92.646  1.00 67.19  ?  479  PHE A O     1 
ATOM   566   C  CB    . PHE A 1 607  ? 139.120 133.606 89.957  1.00 151.94 ?  479  PHE A CB    1 
ATOM   567   C  CG    . PHE A 1 607  ? 137.967 133.925 89.063  1.00 188.18 ?  479  PHE A CG    1 
ATOM   568   C  CD1   . PHE A 1 607  ? 138.140 134.671 87.914  1.00 223.58 ?  479  PHE A CD1   1 
ATOM   569   C  CD2   . PHE A 1 607  ? 136.703 133.455 89.368  1.00 178.18 ?  479  PHE A CD2   1 
ATOM   570   C  CE1   . PHE A 1 607  ? 137.068 134.956 87.092  1.00 236.15 ?  479  PHE A CE1   1 
ATOM   571   C  CE2   . PHE A 1 607  ? 135.627 133.733 88.552  1.00 194.97 ?  479  PHE A CE2   1 
ATOM   572   C  CZ    . PHE A 1 607  ? 135.809 134.484 87.411  1.00 232.75 ?  479  PHE A CZ    1 
ATOM   573   N  N     . GLY A 1 608  ? 141.898 134.793 91.708  1.00 134.90 ?  480  GLY A N     1 
ATOM   574   C  CA    . GLY A 1 608  ? 142.933 134.358 92.622  1.00 124.24 ?  480  GLY A CA    1 
ATOM   575   C  C     . GLY A 1 608  ? 143.195 135.417 93.676  1.00 100.75 ?  480  GLY A C     1 
ATOM   576   O  O     . GLY A 1 608  ? 143.593 136.541 93.362  1.00 105.91 ?  480  GLY A O     1 
ATOM   577   N  N     . LEU A 1 609  ? 142.966 135.046 94.928  1.00 63.98  ?  481  LEU A N     1 
ATOM   578   C  CA    . LEU A 1 609  ? 143.267 135.906 96.060  1.00 48.81  ?  481  LEU A CA    1 
ATOM   579   C  C     . LEU A 1 609  ? 144.703 135.659 96.504  1.00 47.47  ?  481  LEU A C     1 
ATOM   580   O  O     . LEU A 1 609  ? 145.066 134.525 96.826  1.00 64.72  ?  481  LEU A O     1 
ATOM   581   C  CB    . LEU A 1 609  ? 142.288 135.626 97.198  1.00 36.40  ?  481  LEU A CB    1 
ATOM   582   C  CG    . LEU A 1 609  ? 142.103 136.691 98.268  1.00 31.44  ?  481  LEU A CG    1 
ATOM   583   C  CD1   . LEU A 1 609  ? 143.262 136.699 99.250  1.00 41.09  ?  481  LEU A CD1   1 
ATOM   584   C  CD2   . LEU A 1 609  ? 141.985 138.031 97.591  1.00 45.54  ?  481  LEU A CD2   1 
ATOM   585   N  N     . HIS A 1 610  ? 145.509 136.713 96.534  1.00 35.93  ?  482  HIS A N     1 
ATOM   586   C  CA    . HIS A 1 610  ? 146.925 136.547 96.861  1.00 34.81  ?  482  HIS A CA    1 
ATOM   587   C  C     . HIS A 1 610  ? 147.061 136.072 98.308  1.00 35.14  ?  482  HIS A C     1 
ATOM   588   O  O     . HIS A 1 610  ? 146.501 136.708 99.210  1.00 36.76  ?  482  HIS A O     1 
ATOM   589   C  CB    . HIS A 1 610  ? 147.677 137.860 96.623  1.00 32.06  ?  482  HIS A CB    1 
ATOM   590   C  CG    . HIS A 1 610  ? 149.167 137.732 96.724  1.00 50.36  ?  482  HIS A CG    1 
ATOM   591   N  ND1   . HIS A 1 610  ? 149.787 136.948 97.672  1.00 46.29  ?  482  HIS A ND1   1 
ATOM   592   C  CD2   . HIS A 1 610  ? 150.158 138.259 95.966  1.00 70.31  ?  482  HIS A CD2   1 
ATOM   593   C  CE1   . HIS A 1 610  ? 151.095 137.013 97.509  1.00 58.27  ?  482  HIS A CE1   1 
ATOM   594   N  NE2   . HIS A 1 610  ? 151.347 137.801 96.480  1.00 73.55  ?  482  HIS A NE2   1 
ATOM   595   N  N     . PRO A 1 611  ? 147.786 134.948 98.580  1.00 31.77  ?  483  PRO A N     1 
ATOM   596   C  CA    . PRO A 1 611  ? 147.857 134.403 99.950  1.00 23.37  ?  483  PRO A CA    1 
ATOM   597   C  C     . PRO A 1 611  ? 148.305 135.392 101.013 1.00 25.88  ?  483  PRO A C     1 
ATOM   598   O  O     . PRO A 1 611  ? 148.091 135.178 102.212 1.00 35.13  ?  483  PRO A O     1 
ATOM   599   C  CB    . PRO A 1 611  ? 148.875 133.263 99.820  1.00 15.46  ?  483  PRO A CB    1 
ATOM   600   C  CG    . PRO A 1 611  ? 148.735 132.818 98.430  1.00 25.22  ?  483  PRO A CG    1 
ATOM   601   C  CD    . PRO A 1 611  ? 148.435 134.048 97.606  1.00 37.44  ?  483  PRO A CD    1 
ATOM   602   N  N     . ALA A 1 612  ? 148.936 136.481 100.582 1.00 35.86  ?  484  ALA A N     1 
ATOM   603   C  CA    . ALA A 1 612  ? 149.343 137.527 101.513 1.00 54.95  ?  484  ALA A CA    1 
ATOM   604   C  C     . ALA A 1 612  ? 148.128 138.218 102.132 1.00 43.51  ?  484  ALA A C     1 
ATOM   605   O  O     . ALA A 1 612  ? 147.995 138.303 103.362 1.00 39.56  ?  484  ALA A O     1 
ATOM   606   C  CB    . ALA A 1 612  ? 150.244 138.533 100.791 1.00 65.04  ?  484  ALA A CB    1 
ATOM   607   N  N     . VAL A 1 613  ? 147.247 138.751 101.285 1.00 37.54  ?  485  VAL A N     1 
ATOM   608   C  CA    . VAL A 1 613  ? 145.998 139.329 101.766 1.00 31.07  ?  485  VAL A CA    1 
ATOM   609   C  C     . VAL A 1 613  ? 145.210 138.289 102.547 1.00 22.70  ?  485  VAL A C     1 
ATOM   610   O  O     . VAL A 1 613  ? 144.530 138.605 103.530 1.00 21.75  ?  485  VAL A O     1 
ATOM   611   C  CB    . VAL A 1 613  ? 145.184 139.881 100.583 1.00 37.06  ?  485  VAL A CB    1 
ATOM   612   C  CG1   . VAL A 1 613  ? 143.690 139.849 100.891 1.00 34.73  ?  485  VAL A CG1   1 
ATOM   613   C  CG2   . VAL A 1 613  ? 145.627 141.285 100.241 1.00 47.52  ?  485  VAL A CG2   1 
ATOM   614   N  N     . CYS A 1 614  ? 145.281 137.034 102.110 1.00 29.62  ?  486  CYS A N     1 
ATOM   615   C  CA    . CYS A 1 614  ? 144.587 135.954 102.798 1.00 31.25  ?  486  CYS A CA    1 
ATOM   616   C  C     . CYS A 1 614  ? 145.046 135.860 104.252 1.00 27.20  ?  486  CYS A C     1 
ATOM   617   O  O     . CYS A 1 614  ? 144.228 135.801 105.180 1.00 27.29  ?  486  CYS A O     1 
ATOM   618   C  CB    . CYS A 1 614  ? 144.827 134.646 102.034 1.00 64.29  ?  486  CYS A CB    1 
ATOM   619   S  SG    . CYS A 1 614  ? 143.975 133.167 102.610 1.00 156.51 ?  486  CYS A SG    1 
ATOM   620   N  N     . LEU A 1 615  ? 146.359 135.871 104.477 1.00 23.15  ?  487  LEU A N     1 
ATOM   621   C  CA    . LEU A 1 615  ? 146.854 135.827 105.849 1.00 18.08  ?  487  LEU A CA    1 
ATOM   622   C  C     . LEU A 1 615  ? 146.438 137.078 106.610 1.00 16.82  ?  487  LEU A C     1 
ATOM   623   O  O     . LEU A 1 615  ? 145.981 137.002 107.759 1.00 17.42  ?  487  LEU A O     1 
ATOM   624   C  CB    . LEU A 1 615  ? 148.373 135.681 105.862 1.00 21.57  ?  487  LEU A CB    1 
ATOM   625   C  CG    . LEU A 1 615  ? 149.014 135.812 107.243 1.00 30.96  ?  487  LEU A CG    1 
ATOM   626   C  CD1   . LEU A 1 615  ? 148.846 134.531 108.060 1.00 27.66  ?  487  LEU A CD1   1 
ATOM   627   C  CD2   . LEU A 1 615  ? 150.473 136.238 107.147 1.00 57.97  ?  487  LEU A CD2   1 
ATOM   628   N  N     . ALA A 1 616  ? 146.622 138.249 105.991 1.00 15.89  ?  488  ALA A N     1 
ATOM   629   C  CA    . ALA A 1 616  ? 146.251 139.499 106.649 1.00 15.10  ?  488  ALA A CA    1 
ATOM   630   C  C     . ALA A 1 616  ? 144.824 139.425 107.165 1.00 13.47  ?  488  ALA A C     1 
ATOM   631   O  O     . ALA A 1 616  ? 144.543 139.734 108.328 1.00 12.61  ?  488  ALA A O     1 
ATOM   632   C  CB    . ALA A 1 616  ? 146.413 140.671 105.682 1.00 27.23  ?  488  ALA A CB    1 
ATOM   633   N  N     . ILE A 1 617  ? 143.907 138.985 106.305 1.00 15.11  ?  489  ILE A N     1 
ATOM   634   C  CA    . ILE A 1 617  ? 142.509 138.914 106.689 1.00 32.49  ?  489  ILE A CA    1 
ATOM   635   C  C     . ILE A 1 617  ? 142.260 137.765 107.649 1.00 12.78  ?  489  ILE A C     1 
ATOM   636   O  O     . ILE A 1 617  ? 141.237 137.749 108.335 1.00 15.98  ?  489  ILE A O     1 
ATOM   637   C  CB    . ILE A 1 617  ? 141.614 138.830 105.439 1.00 13.82  ?  489  ILE A CB    1 
ATOM   638   C  CG1   . ILE A 1 617  ? 140.172 139.157 105.811 1.00 24.80  ?  489  ILE A CG1   1 
ATOM   639   C  CG2   . ILE A 1 617  ? 141.708 137.462 104.804 1.00 26.83  ?  489  ILE A CG2   1 
ATOM   640   C  CD1   . ILE A 1 617  ? 139.987 140.589 106.269 1.00 59.13  ?  489  ILE A CD1   1 
ATOM   641   N  N     . ARG A 1 618  ? 143.159 136.790 107.725 1.00 7.34   ?  490  ARG A N     1 
ATOM   642   C  CA    . ARG A 1 618  ? 143.024 135.838 108.818 1.00 12.34  ?  490  ARG A CA    1 
ATOM   643   C  C     . ARG A 1 618  ? 143.304 136.520 110.148 1.00 18.26  ?  490  ARG A C     1 
ATOM   644   O  O     . ARG A 1 618  ? 142.589 136.302 111.133 1.00 12.75  ?  490  ARG A O     1 
ATOM   645   C  CB    . ARG A 1 618  ? 143.966 134.651 108.645 1.00 19.58  ?  490  ARG A CB    1 
ATOM   646   C  CG    . ARG A 1 618  ? 144.113 133.881 109.940 1.00 14.97  ?  490  ARG A CG    1 
ATOM   647   C  CD    . ARG A 1 618  ? 145.219 132.871 109.902 1.00 10.72  ?  490  ARG A CD    1 
ATOM   648   N  NE    . ARG A 1 618  ? 146.047 133.034 111.085 1.00 11.82  ?  490  ARG A NE    1 
ATOM   649   C  CZ    . ARG A 1 618  ? 146.561 132.025 111.771 1.00 14.00  ?  490  ARG A CZ    1 
ATOM   650   N  NH1   . ARG A 1 618  ? 147.304 132.268 112.843 1.00 12.91  ?  490  ARG A NH1   1 
ATOM   651   N  NH2   . ARG A 1 618  ? 146.315 130.775 111.400 1.00 13.04  ?  490  ARG A NH2   1 
ATOM   652   N  N     . VAL A 1 619  ? 144.327 137.365 110.186 1.00 7.72   ?  491  VAL A N     1 
ATOM   653   C  CA    . VAL A 1 619  ? 144.837 137.916 111.433 1.00 10.22  ?  491  VAL A CA    1 
ATOM   654   C  C     . VAL A 1 619  ? 144.285 139.307 111.710 1.00 29.07  ?  491  VAL A C     1 
ATOM   655   O  O     . VAL A 1 619  ? 143.770 139.569 112.796 1.00 18.51  ?  491  VAL A O     1 
ATOM   656   C  CB    . VAL A 1 619  ? 146.381 137.917 111.414 1.00 15.93  ?  491  VAL A CB    1 
ATOM   657   C  CG1   . VAL A 1 619  ? 146.927 139.011 112.315 1.00 26.91  ?  491  VAL A CG1   1 
ATOM   658   C  CG2   . VAL A 1 619  ? 146.911 136.556 111.820 1.00 27.94  ?  491  VAL A CG2   1 
ATOM   659   N  N     . ASN A 1 620  ? 144.373 140.220 110.738 1.00 12.47  ?  492  ASN A N     1 
ATOM   660   C  CA    . ASN A 1 620  ? 144.045 141.617 111.010 1.00 15.09  ?  492  ASN A CA    1 
ATOM   661   C  C     . ASN A 1 620  ? 142.631 141.794 111.552 1.00 25.70  ?  492  ASN A C     1 
ATOM   662   O  O     . ASN A 1 620  ? 142.318 142.852 112.108 1.00 12.53  ?  492  ASN A O     1 
ATOM   663   C  CB    . ASN A 1 620  ? 144.239 142.468 109.751 1.00 19.18  ?  492  ASN A CB    1 
ATOM   664   C  CG    . ASN A 1 620  ? 144.233 143.956 110.050 1.00 31.80  ?  492  ASN A CG    1 
ATOM   665   O  OD1   . ASN A 1 620  ? 144.270 144.368 111.212 1.00 31.14  ?  492  ASN A OD1   1 
ATOM   666   N  ND2   . ASN A 1 620  ? 144.241 144.770 109.004 1.00 46.15  ?  492  ASN A ND2   1 
ATOM   667   N  N     . THR A 1 621  ? 141.782 140.779 111.438 1.00 16.23  ?  493  THR A N     1 
ATOM   668   C  CA    . THR A 1 621  ? 140.433 140.867 111.975 1.00 14.31  ?  493  THR A CA    1 
ATOM   669   C  C     . THR A 1 621  ? 140.142 139.726 112.949 1.00 17.37  ?  493  THR A C     1 
ATOM   670   O  O     . THR A 1 621  ? 138.980 139.372 113.161 1.00 27.31  ?  493  THR A O     1 
ATOM   671   C  CB    . THR A 1 621  ? 139.411 140.905 110.838 1.00 17.39  ?  493  THR A CB    1 
ATOM   672   O  OG1   . THR A 1 621  ? 138.096 140.677 111.349 1.00 26.68  ?  493  THR A OG1   1 
ATOM   673   C  CG2   . THR A 1 621  ? 139.725 139.856 109.829 1.00 15.08  ?  493  THR A CG2   1 
ATOM   674   N  N     . PHE A 1 622  ? 141.183 139.133 113.528 1.00 18.20  ?  494  PHE A N     1 
ATOM   675   C  CA    . PHE A 1 622  ? 141.091 138.296 114.725 1.00 18.56  ?  494  PHE A CA    1 
ATOM   676   C  C     . PHE A 1 622  ? 140.332 137.000 114.479 1.00 11.08  ?  494  PHE A C     1 
ATOM   677   O  O     . PHE A 1 622  ? 139.878 136.352 115.427 1.00 8.46   ?  494  PHE A O     1 
ATOM   678   C  CB    . PHE A 1 622  ? 140.443 139.053 115.895 1.00 29.43  ?  494  PHE A CB    1 
ATOM   679   C  CG    . PHE A 1 622  ? 141.112 140.365 116.249 1.00 40.67  ?  494  PHE A CG    1 
ATOM   680   C  CD1   . PHE A 1 622  ? 142.239 140.810 115.583 1.00 30.22  ?  494  PHE A CD1   1 
ATOM   681   C  CD2   . PHE A 1 622  ? 140.589 141.159 117.253 1.00 52.31  ?  494  PHE A CD2   1 
ATOM   682   C  CE1   . PHE A 1 622  ? 142.824 142.014 115.907 1.00 39.79  ?  494  PHE A CE1   1 
ATOM   683   C  CE2   . PHE A 1 622  ? 141.178 142.364 117.580 1.00 76.00  ?  494  PHE A CE2   1 
ATOM   684   C  CZ    . PHE A 1 622  ? 142.291 142.787 116.910 1.00 80.06  ?  494  PHE A CZ    1 
ATOM   685   N  N     . LEU A 1 623  ? 140.166 136.610 113.222 1.00 15.64  ?  495  LEU A N     1 
ATOM   686   C  CA    . LEU A 1 623  ? 139.604 135.304 112.933 1.00 7.82   ?  495  LEU A CA    1 
ATOM   687   C  C     . LEU A 1 623  ? 140.503 134.212 113.482 1.00 15.23  ?  495  LEU A C     1 
ATOM   688   O  O     . LEU A 1 623  ? 141.716 134.219 113.261 1.00 25.43  ?  495  LEU A O     1 
ATOM   689   C  CB    . LEU A 1 623  ? 139.424 135.120 111.433 1.00 14.46  ?  495  LEU A CB    1 
ATOM   690   C  CG    . LEU A 1 623  ? 137.961 135.117 111.023 1.00 38.47  ?  495  LEU A CG    1 
ATOM   691   C  CD1   . LEU A 1 623  ? 137.812 134.471 109.656 1.00 45.46  ?  495  LEU A CD1   1 
ATOM   692   C  CD2   . LEU A 1 623  ? 137.120 134.406 112.075 1.00 36.43  ?  495  LEU A CD2   1 
ATOM   693   N  N     . SER A 1 624  ? 139.905 133.269 114.201 1.00 25.17  ?  496  SER A N     1 
ATOM   694   C  CA    . SER A 1 624  ? 140.651 132.116 114.670 1.00 43.58  ?  496  SER A CA    1 
ATOM   695   C  C     . SER A 1 624  ? 140.898 131.149 113.514 1.00 43.35  ?  496  SER A C     1 
ATOM   696   O  O     . SER A 1 624  ? 140.418 131.331 112.390 1.00 43.52  ?  496  SER A O     1 
ATOM   697   C  CB    . SER A 1 624  ? 139.912 131.423 115.806 1.00 72.43  ?  496  SER A CB    1 
ATOM   698   O  OG    . SER A 1 624  ? 140.537 130.192 116.126 1.00 63.41  ?  496  SER A OG    1 
ATOM   699   N  N     . CYS A 1 625  ? 141.633 130.082 113.809 1.00 33.05  ?  497  CYS A N     1 
ATOM   700   C  CA    . CYS A 1 625  ? 142.162 129.215 112.764 1.00 36.39  ?  497  CYS A CA    1 
ATOM   701   C  C     . CYS A 1 625  ? 141.142 128.181 112.300 1.00 22.49  ?  497  CYS A C     1 
ATOM   702   O  O     . CYS A 1 625  ? 140.826 128.106 111.108 1.00 26.11  ?  497  CYS A O     1 
ATOM   703   C  CB    . CYS A 1 625  ? 143.443 128.540 113.259 1.00 82.35  ?  497  CYS A CB    1 
ATOM   704   S  SG    . CYS A 1 625  ? 144.724 129.717 113.756 1.00 152.60 ?  497  CYS A SG    1 
ATOM   705   N  N     . SER A 1 626  ? 140.646 127.355 113.218 1.00 19.10  ?  498  SER A N     1 
ATOM   706   C  CA    . SER A 1 626  ? 139.600 126.409 112.851 1.00 26.69  ?  498  SER A CA    1 
ATOM   707   C  C     . SER A 1 626  ? 138.413 127.139 112.231 1.00 22.94  ?  498  SER A C     1 
ATOM   708   O  O     . SER A 1 626  ? 137.763 126.629 111.307 1.00 19.45  ?  498  SER A O     1 
ATOM   709   C  CB    . SER A 1 626  ? 139.165 125.610 114.076 1.00 34.25  ?  498  SER A CB    1 
ATOM   710   O  OG    . SER A 1 626  ? 137.942 124.943 113.831 1.00 40.22  ?  498  SER A OG    1 
ATOM   711   N  N     . GLN A 1 627  ? 138.117 128.336 112.745 1.00 20.70  ?  499  GLN A N     1 
ATOM   712   C  CA    . GLN A 1 627  ? 137.145 129.225 112.128 1.00 19.20  ?  499  GLN A CA    1 
ATOM   713   C  C     . GLN A 1 627  ? 137.469 129.430 110.658 1.00 14.71  ?  499  GLN A C     1 
ATOM   714   O  O     . GLN A 1 627  ? 136.611 129.282 109.775 1.00 13.79  ?  499  GLN A O     1 
ATOM   715   C  CB    . GLN A 1 627  ? 137.164 130.569 112.854 1.00 18.52  ?  499  GLN A CB    1 
ATOM   716   C  CG    . GLN A 1 627  ? 136.758 130.519 114.303 1.00 29.08  ?  499  GLN A CG    1 
ATOM   717   C  CD    . GLN A 1 627  ? 135.342 130.963 114.495 1.00 28.23  ?  499  GLN A CD    1 
ATOM   718   O  OE1   . GLN A 1 627  ? 134.563 130.977 113.549 1.00 23.73  ?  499  GLN A OE1   1 
ATOM   719   N  NE2   . GLN A 1 627  ? 134.986 131.319 115.723 1.00 31.46  ?  499  GLN A NE2   1 
ATOM   720   N  N     . TYR A 1 628  ? 138.727 129.787 110.392 1.00 9.22   ?  500  TYR A N     1 
ATOM   721   C  CA    . TYR A 1 628  ? 139.163 130.068 109.033 1.00 29.09  ?  500  TYR A CA    1 
ATOM   722   C  C     . TYR A 1 628  ? 139.009 128.843 108.140 1.00 16.74  ?  500  TYR A C     1 
ATOM   723   O  O     . TYR A 1 628  ? 138.576 128.960 106.990 1.00 16.29  ?  500  TYR A O     1 
ATOM   724   C  CB    . TYR A 1 628  ? 140.608 130.569 109.040 1.00 12.55  ?  500  TYR A CB    1 
ATOM   725   C  CG    . TYR A 1 628  ? 141.055 130.957 107.667 1.00 15.30  ?  500  TYR A CG    1 
ATOM   726   C  CD1   . TYR A 1 628  ? 140.715 132.179 107.132 1.00 14.23  ?  500  TYR A CD1   1 
ATOM   727   C  CD2   . TYR A 1 628  ? 141.771 130.078 106.885 1.00 10.44  ?  500  TYR A CD2   1 
ATOM   728   C  CE1   . TYR A 1 628  ? 141.094 132.528 105.858 1.00 6.66   ?  500  TYR A CE1   1 
ATOM   729   C  CE2   . TYR A 1 628  ? 142.153 130.416 105.615 1.00 11.11  ?  500  TYR A CE2   1 
ATOM   730   C  CZ    . TYR A 1 628  ? 141.813 131.641 105.103 1.00 10.74  ?  500  TYR A CZ    1 
ATOM   731   O  OH    . TYR A 1 628  ? 142.190 131.989 103.830 1.00 24.82  ?  500  TYR A OH    1 
ATOM   732   N  N     . HIS A 1 629  ? 139.338 127.655 108.657 1.00 18.03  ?  501  HIS A N     1 
ATOM   733   C  CA    . HIS A 1 629  ? 139.253 126.441 107.839 1.00 20.78  ?  501  HIS A CA    1 
ATOM   734   C  C     . HIS A 1 629  ? 137.816 126.086 107.507 1.00 18.00  ?  501  HIS A C     1 
ATOM   735   O  O     . HIS A 1 629  ? 137.511 125.686 106.378 1.00 20.45  ?  501  HIS A O     1 
ATOM   736   C  CB    . HIS A 1 629  ? 139.912 125.254 108.537 1.00 39.29  ?  501  HIS A CB    1 
ATOM   737   C  CG    . HIS A 1 629  ? 139.543 123.927 107.942 1.00 38.54  ?  501  HIS A CG    1 
ATOM   738   N  ND1   . HIS A 1 629  ? 139.694 123.645 106.600 1.00 33.34  ?  501  HIS A ND1   1 
ATOM   739   C  CD2   . HIS A 1 629  ? 139.048 122.801 108.511 1.00 33.42  ?  501  HIS A CD2   1 
ATOM   740   C  CE1   . HIS A 1 629  ? 139.298 122.407 106.366 1.00 38.00  ?  501  HIS A CE1   1 
ATOM   741   N  NE2   . HIS A 1 629  ? 138.908 121.871 107.509 1.00 48.20  ?  501  HIS A NE2   1 
ATOM   742   N  N     . LYS A 1 630  ? 136.931 126.175 108.494 1.00 11.44  ?  502  LYS A N     1 
ATOM   743   C  CA    . LYS A 1 630  ? 135.522 125.915 108.237 1.00 10.83  ?  502  LYS A CA    1 
ATOM   744   C  C     . LYS A 1 630  ? 134.974 126.878 107.192 1.00 7.29   ?  502  LYS A C     1 
ATOM   745   O  O     . LYS A 1 630  ? 134.327 126.465 106.216 1.00 8.04   ?  502  LYS A O     1 
ATOM   746   C  CB    . LYS A 1 630  ? 134.744 126.032 109.538 1.00 16.25  ?  502  LYS A CB    1 
ATOM   747   C  CG    . LYS A 1 630  ? 133.269 125.889 109.349 1.00 10.93  ?  502  LYS A CG    1 
ATOM   748   C  CD    . LYS A 1 630  ? 132.658 125.143 110.502 1.00 9.03   ?  502  LYS A CD    1 
ATOM   749   C  CE    . LYS A 1 630  ? 132.883 125.903 111.793 1.00 12.04  ?  502  LYS A CE    1 
ATOM   750   N  NZ    . LYS A 1 630  ? 132.543 125.088 112.983 1.00 11.05  ?  502  LYS A NZ    1 
ATOM   751   N  N     . MET A 1 631  ? 135.243 128.175 107.374 1.00 11.56  ?  503  MET A N     1 
ATOM   752   C  CA    . MET A 1 631  ? 134.734 129.164 106.430 1.00 14.00  ?  503  MET A CA    1 
ATOM   753   C  C     . MET A 1 631  ? 135.321 128.947 105.041 1.00 11.17  ?  503  MET A C     1 
ATOM   754   O  O     . MET A 1 631  ? 134.637 129.173 104.033 1.00 14.05  ?  503  MET A O     1 
ATOM   755   C  CB    . MET A 1 631  ? 135.016 130.588 106.930 1.00 10.85  ?  503  MET A CB    1 
ATOM   756   C  CG    . MET A 1 631  ? 136.315 131.209 106.454 1.00 15.38  ?  503  MET A CG    1 
ATOM   757   S  SD    . MET A 1 631  ? 136.069 132.244 104.988 1.00 15.30  ?  503  MET A SD    1 
ATOM   758   C  CE    . MET A 1 631  ? 135.106 133.595 105.673 1.00 13.35  ?  503  MET A CE    1 
ATOM   759   N  N     . TYR A 1 632  ? 136.578 128.493 104.963 1.00 14.50  ?  504  TYR A N     1 
ATOM   760   C  CA    . TYR A 1 632  ? 137.164 128.186 103.665 1.00 17.69  ?  504  TYR A CA    1 
ATOM   761   C  C     . TYR A 1 632  ? 136.453 127.016 103.008 1.00 19.20  ?  504  TYR A C     1 
ATOM   762   O  O     . TYR A 1 632  ? 136.111 127.078 101.821 1.00 23.51  ?  504  TYR A O     1 
ATOM   763   C  CB    . TYR A 1 632  ? 138.666 127.885 103.780 1.00 20.13  ?  504  TYR A CB    1 
ATOM   764   C  CG    . TYR A 1 632  ? 139.177 127.108 102.570 1.00 19.04  ?  504  TYR A CG    1 
ATOM   765   C  CD1   . TYR A 1 632  ? 139.141 127.654 101.298 1.00 21.70  ?  504  TYR A CD1   1 
ATOM   766   C  CD2   . TYR A 1 632  ? 139.631 125.802 102.699 1.00 43.38  ?  504  TYR A CD2   1 
ATOM   767   C  CE1   . TYR A 1 632  ? 139.574 126.931 100.185 1.00 33.36  ?  504  TYR A CE1   1 
ATOM   768   C  CE2   . TYR A 1 632  ? 140.070 125.076 101.588 1.00 63.19  ?  504  TYR A CE2   1 
ATOM   769   C  CZ    . TYR A 1 632  ? 140.041 125.649 100.335 1.00 47.85  ?  504  TYR A CZ    1 
ATOM   770   O  OH    . TYR A 1 632  ? 140.470 124.945 99.226  1.00 55.76  ?  504  TYR A OH    1 
ATOM   771   N  N     . ARG A 1 633  ? 136.276 125.914 103.743 1.00 16.45  ?  505  ARG A N     1 
ATOM   772   C  CA    . ARG A 1 633  ? 135.549 124.785 103.168 1.00 15.84  ?  505  ARG A CA    1 
ATOM   773   C  C     . ARG A 1 633  ? 134.217 125.252 102.609 1.00 15.57  ?  505  ARG A C     1 
ATOM   774   O  O     . ARG A 1 633  ? 133.799 124.828 101.526 1.00 20.82  ?  505  ARG A O     1 
ATOM   775   C  CB    . ARG A 1 633  ? 135.342 123.670 104.194 1.00 16.24  ?  505  ARG A CB    1 
ATOM   776   C  CG    . ARG A 1 633  ? 134.356 122.605 103.692 1.00 21.03  ?  505  ARG A CG    1 
ATOM   777   C  CD    . ARG A 1 633  ? 134.589 121.245 104.300 1.00 34.86  ?  505  ARG A CD    1 
ATOM   778   N  NE    . ARG A 1 633  ? 134.302 121.240 105.725 1.00 34.35  ?  505  ARG A NE    1 
ATOM   779   C  CZ    . ARG A 1 633  ? 135.248 121.141 106.653 1.00 37.84  ?  505  ARG A CZ    1 
ATOM   780   N  NH1   . ARG A 1 633  ? 134.928 121.143 107.938 1.00 34.86  ?  505  ARG A NH1   1 
ATOM   781   N  NH2   . ARG A 1 633  ? 136.516 121.034 106.279 1.00 52.25  ?  505  ARG A NH2   1 
ATOM   782   N  N     . THR A 1 634  ? 133.559 126.169 103.320 1.00 15.46  ?  506  THR A N     1 
ATOM   783   C  CA    . THR A 1 634  ? 132.258 126.641 102.859 1.00 18.57  ?  506  THR A CA    1 
ATOM   784   C  C     . THR A 1 634  ? 132.379 127.442 101.565 1.00 15.30  ?  506  THR A C     1 
ATOM   785   O  O     . THR A 1 634  ? 131.681 127.156 100.583 1.00 20.49  ?  506  THR A O     1 
ATOM   786   C  CB    . THR A 1 634  ? 131.581 127.473 103.939 1.00 10.73  ?  506  THR A CB    1 
ATOM   787   O  OG1   . THR A 1 634  ? 131.340 126.661 105.095 1.00 13.17  ?  506  THR A OG1   1 
ATOM   788   C  CG2   . THR A 1 634  ? 130.254 127.992 103.433 1.00 9.13   ?  506  THR A CG2   1 
ATOM   789   N  N     . VAL A 1 635  ? 133.246 128.460 101.548 1.00 10.99  ?  507  VAL A N     1 
ATOM   790   C  CA    . VAL A 1 635  ? 133.325 129.341 100.380 1.00 11.80  ?  507  VAL A CA    1 
ATOM   791   C  C     . VAL A 1 635  ? 133.770 128.563 99.148  1.00 11.84  ?  507  VAL A C     1 
ATOM   792   O  O     . VAL A 1 635  ? 133.377 128.881 98.016  1.00 12.11  ?  507  VAL A O     1 
ATOM   793   C  CB    . VAL A 1 635  ? 134.243 130.555 100.650 1.00 11.17  ?  507  VAL A CB    1 
ATOM   794   C  CG1   . VAL A 1 635  ? 135.568 130.134 101.225 1.00 13.99  ?  507  VAL A CG1   1 
ATOM   795   C  CG2   . VAL A 1 635  ? 134.457 131.375 99.375  1.00 9.28   ?  507  VAL A CG2   1 
ATOM   796   N  N     . LYS A 1 636  ? 134.572 127.514 99.337  1.00 17.26  ?  508  LYS A N     1 
ATOM   797   C  CA    . LYS A 1 636  ? 134.905 126.637 98.216  1.00 27.18  ?  508  LYS A CA    1 
ATOM   798   C  C     . LYS A 1 636  ? 133.680 125.864 97.754  1.00 28.53  ?  508  LYS A C     1 
ATOM   799   O  O     . LYS A 1 636  ? 133.256 125.976 96.597  1.00 23.92  ?  508  LYS A O     1 
ATOM   800   C  CB    . LYS A 1 636  ? 136.011 125.661 98.616  1.00 46.38  ?  508  LYS A CB    1 
ATOM   801   C  CG    . LYS A 1 636  ? 136.156 124.491 97.649  1.00 63.71  ?  508  LYS A CG    1 
ATOM   802   C  CD    . LYS A 1 636  ? 136.866 124.872 96.359  1.00 45.77  ?  508  LYS A CD    1 
ATOM   803   C  CE    . LYS A 1 636  ? 138.277 125.362 96.639  1.00 58.37  ?  508  LYS A CE    1 
ATOM   804   N  NZ    . LYS A 1 636  ? 138.936 124.598 97.737  1.00 49.82  ?  508  LYS A NZ    1 
ATOM   805   N  N     . ALA A 1 637  ? 133.096 125.063 98.656  1.00 47.26  ?  509  ALA A N     1 
ATOM   806   C  CA    . ALA A 1 637  ? 131.972 124.203 98.293  1.00 69.49  ?  509  ALA A CA    1 
ATOM   807   C  C     . ALA A 1 637  ? 130.800 124.983 97.717  1.00 52.41  ?  509  ALA A C     1 
ATOM   808   O  O     . ALA A 1 637  ? 129.944 124.393 97.053  1.00 50.85  ?  509  ALA A O     1 
ATOM   809   C  CB    . ALA A 1 637  ? 131.509 123.405 99.515  1.00 51.40  ?  509  ALA A CB    1 
ATOM   810   N  N     . THR A 1 638  ? 130.730 126.290 97.970  1.00 33.32  ?  510  THR A N     1 
ATOM   811   C  CA    . THR A 1 638  ? 129.652 127.089 97.403  1.00 26.28  ?  510  THR A CA    1 
ATOM   812   C  C     . THR A 1 638  ? 129.893 127.360 95.926  1.00 29.46  ?  510  THR A C     1 
ATOM   813   O  O     . THR A 1 638  ? 129.115 126.930 95.069  1.00 38.12  ?  510  THR A O     1 
ATOM   814   C  CB    . THR A 1 638  ? 129.513 128.402 98.165  1.00 35.87  ?  510  THR A CB    1 
ATOM   815   O  OG1   . THR A 1 638  ? 129.191 128.126 99.534  1.00 32.93  ?  510  THR A OG1   1 
ATOM   816   C  CG2   . THR A 1 638  ? 128.403 129.225 97.558  1.00 31.74  ?  510  THR A CG2   1 
ATOM   817   N  N     . SER A 1 639  ? 130.976 128.077 95.601  1.00 29.97  ?  511  SER A N     1 
ATOM   818   C  CA    . SER A 1 639  ? 131.216 128.511 94.226  1.00 51.01  ?  511  SER A CA    1 
ATOM   819   C  C     . SER A 1 639  ? 132.641 128.173 93.778  1.00 39.95  ?  511  SER A C     1 
ATOM   820   O  O     . SER A 1 639  ? 133.544 129.008 93.838  1.00 43.99  ?  511  SER A O     1 
ATOM   821   C  CB    . SER A 1 639  ? 130.920 130.005 94.092  1.00 51.52  ?  511  SER A CB    1 
ATOM   822   O  OG    . SER A 1 639  ? 131.293 130.704 95.263  1.00 59.77  ?  511  SER A OG    1 
ATOM   823   N  N     . GLY A 1 640  ? 132.829 126.921 93.363  1.00 43.57  ?  512  GLY A N     1 
ATOM   824   C  CA    . GLY A 1 640  ? 133.697 126.532 92.264  1.00 77.28  ?  512  GLY A CA    1 
ATOM   825   C  C     . GLY A 1 640  ? 135.079 127.134 92.115  1.00 61.87  ?  512  GLY A C     1 
ATOM   826   O  O     . GLY A 1 640  ? 135.706 126.966 91.065  1.00 69.64  ?  512  GLY A O     1 
ATOM   827   N  N     . ARG A 1 641  ? 135.571 127.836 93.127  1.00 54.12  ?  513  ARG A N     1 
ATOM   828   C  CA    . ARG A 1 641  ? 136.873 128.474 93.030  1.00 63.06  ?  513  ARG A CA    1 
ATOM   829   C  C     . ARG A 1 641  ? 137.590 128.395 94.369  1.00 69.50  ?  513  ARG A C     1 
ATOM   830   O  O     . ARG A 1 641  ? 136.961 128.465 95.429  1.00 53.00  ?  513  ARG A O     1 
ATOM   831   C  CB    . ARG A 1 641  ? 136.761 129.940 92.567  1.00 69.98  ?  513  ARG A CB    1 
ATOM   832   C  CG    . ARG A 1 641  ? 136.073 130.150 91.211  1.00 62.59  ?  513  ARG A CG    1 
ATOM   833   C  CD    . ARG A 1 641  ? 134.688 130.768 91.374  1.00 82.25  ?  513  ARG A CD    1 
ATOM   834   N  NE    . ARG A 1 641  ? 134.724 132.228 91.376  1.00 119.39 ?  513  ARG A NE    1 
ATOM   835   C  CZ    . ARG A 1 641  ? 133.647 133.007 91.325  1.00 124.00 ?  513  ARG A CZ    1 
ATOM   836   N  NH1   . ARG A 1 641  ? 132.437 132.466 91.269  1.00 97.81  ?  513  ARG A NH1   1 
ATOM   837   N  NH2   . ARG A 1 641  ? 133.777 134.328 91.335  1.00 111.52 ?  513  ARG A NH2   1 
ATOM   838   N  N     . GLN A 1 642  ? 138.915 128.226 94.299  1.00 75.15  ?  514  GLN A N     1 
ATOM   839   C  CA    . GLN A 1 642  ? 139.804 128.243 95.464  1.00 62.72  ?  514  GLN A CA    1 
ATOM   840   C  C     . GLN A 1 642  ? 140.114 129.696 95.824  1.00 48.46  ?  514  GLN A C     1 
ATOM   841   O  O     . GLN A 1 642  ? 141.216 130.211 95.624  1.00 44.53  ?  514  GLN A O     1 
ATOM   842   C  CB    . GLN A 1 642  ? 141.083 127.464 95.186  1.00 73.62  ?  514  GLN A CB    1 
ATOM   843   C  CG    . GLN A 1 642  ? 141.839 127.033 96.438  1.00 58.20  ?  514  GLN A CG    1 
ATOM   844   C  CD    . GLN A 1 642  ? 142.905 125.981 96.163  1.00 60.17  ?  514  GLN A CD    1 
ATOM   845   O  OE1   . GLN A 1 642  ? 143.762 126.147 95.289  1.00 79.38  ?  514  GLN A OE1   1 
ATOM   846   N  NE2   . GLN A 1 642  ? 142.847 124.882 96.904  1.00 61.62  ?  514  GLN A NE2   1 
ATOM   847   N  N     . ILE A 1 643  ? 139.098 130.362 96.364  1.00 36.47  ?  515  ILE A N     1 
ATOM   848   C  CA    . ILE A 1 643  ? 139.192 131.794 96.606  1.00 32.31  ?  515  ILE A CA    1 
ATOM   849   C  C     . ILE A 1 643  ? 140.074 132.079 97.816  1.00 22.35  ?  515  ILE A C     1 
ATOM   850   O  O     . ILE A 1 643  ? 140.847 133.042 97.822  1.00 25.28  ?  515  ILE A O     1 
ATOM   851   C  CB    . ILE A 1 643  ? 137.778 132.380 96.754  1.00 35.77  ?  515  ILE A CB    1 
ATOM   852   C  CG1   . ILE A 1 643  ? 137.196 132.705 95.371  1.00 42.06  ?  515  ILE A CG1   1 
ATOM   853   C  CG2   . ILE A 1 643  ? 137.778 133.587 97.672  1.00 28.86  ?  515  ILE A CG2   1 
ATOM   854   C  CD1   . ILE A 1 643  ? 137.852 133.860 94.649  1.00 19.07  ?  515  ILE A CD1   1 
ATOM   855   N  N     . PHE A 1 644  ? 139.990 131.253 98.852  1.00 20.96  ?  516  PHE A N     1 
ATOM   856   C  CA    . PHE A 1 644  ? 140.830 131.389 100.038 1.00 16.38  ?  516  PHE A CA    1 
ATOM   857   C  C     . PHE A 1 644  ? 141.833 130.248 100.065 1.00 17.49  ?  516  PHE A C     1 
ATOM   858   O  O     . PHE A 1 644  ? 141.455 129.091 100.256 1.00 19.57  ?  516  PHE A O     1 
ATOM   859   C  CB    . PHE A 1 644  ? 139.985 131.404 101.307 1.00 12.27  ?  516  PHE A CB    1 
ATOM   860   C  CG    . PHE A 1 644  ? 139.243 132.677 101.501 1.00 12.34  ?  516  PHE A CG    1 
ATOM   861   C  CD1   . PHE A 1 644  ? 139.535 133.771 100.710 1.00 12.10  ?  516  PHE A CD1   1 
ATOM   862   C  CD2   . PHE A 1 644  ? 138.261 132.793 102.457 1.00 10.29  ?  516  PHE A CD2   1 
ATOM   863   C  CE1   . PHE A 1 644  ? 138.869 134.946 100.874 1.00 10.97  ?  516  PHE A CE1   1 
ATOM   864   C  CE2   . PHE A 1 644  ? 137.588 133.981 102.623 1.00 11.58  ?  516  PHE A CE2   1 
ATOM   865   C  CZ    . PHE A 1 644  ? 137.896 135.054 101.830 1.00 14.02  ?  516  PHE A CZ    1 
ATOM   866   N  N     . GLN A 1 645  ? 143.104 130.571 99.885  1.00 16.81  ?  517  GLN A N     1 
ATOM   867   C  CA    . GLN A 1 645  ? 144.120 129.535 99.888  1.00 16.46  ?  517  GLN A CA    1 
ATOM   868   C  C     . GLN A 1 645  ? 144.070 128.766 101.207 1.00 21.06  ?  517  GLN A C     1 
ATOM   869   O  O     . GLN A 1 645  ? 143.860 129.363 102.264 1.00 21.51  ?  517  GLN A O     1 
ATOM   870   C  CB    . GLN A 1 645  ? 145.491 130.158 99.650  1.00 15.31  ?  517  GLN A CB    1 
ATOM   871   C  CG    . GLN A 1 645  ? 145.429 131.371 98.728  1.00 21.69  ?  517  GLN A CG    1 
ATOM   872   C  CD    . GLN A 1 645  ? 145.299 130.991 97.268  1.00 28.67  ?  517  GLN A CD    1 
ATOM   873   O  OE1   . GLN A 1 645  ? 145.005 129.844 96.930  1.00 21.95  ?  517  GLN A OE1   1 
ATOM   874   N  NE2   . GLN A 1 645  ? 145.536 131.957 96.387  1.00 51.92  ?  517  GLN A NE2   1 
ATOM   875   N  N     . PRO A 1 646  ? 144.212 127.441 101.176 1.00 18.47  ?  518  PRO A N     1 
ATOM   876   C  CA    . PRO A 1 646  ? 144.035 126.647 102.399 1.00 12.93  ?  518  PRO A CA    1 
ATOM   877   C  C     . PRO A 1 646  ? 145.028 126.964 103.507 1.00 10.91  ?  518  PRO A C     1 
ATOM   878   O  O     . PRO A 1 646  ? 145.913 127.810 103.361 1.00 14.30  ?  518  PRO A O     1 
ATOM   879   C  CB    . PRO A 1 646  ? 144.185 125.201 101.902 1.00 24.56  ?  518  PRO A CB    1 
ATOM   880   C  CG    . PRO A 1 646  ? 144.891 125.310 100.597 1.00 43.64  ?  518  PRO A CG    1 
ATOM   881   C  CD    . PRO A 1 646  ? 144.393 126.586 99.993  1.00 41.09  ?  518  PRO A CD    1 
ATOM   882   N  N     . LEU A 1 647  ? 144.852 126.281 104.636 1.00 13.86  ?  519  LEU A N     1 
ATOM   883   C  CA    . LEU A 1 647  ? 145.555 126.639 105.860 1.00 14.80  ?  519  LEU A CA    1 
ATOM   884   C  C     . LEU A 1 647  ? 147.063 126.522 105.693 1.00 10.44  ?  519  LEU A C     1 
ATOM   885   O  O     . LEU A 1 647  ? 147.800 127.493 105.898 1.00 18.54  ?  519  LEU A O     1 
ATOM   886   C  CB    . LEU A 1 647  ? 145.082 125.752 107.006 1.00 11.71  ?  519  LEU A CB    1 
ATOM   887   C  CG    . LEU A 1 647  ? 144.428 126.507 108.146 1.00 7.28   ?  519  LEU A CG    1 
ATOM   888   C  CD1   . LEU A 1 647  ? 144.306 125.575 109.334 1.00 15.72  ?  519  LEU A CD1   1 
ATOM   889   C  CD2   . LEU A 1 647  ? 145.238 127.732 108.487 1.00 7.37   ?  519  LEU A CD2   1 
ATOM   890   N  N     . HIS A 1 648  ? 147.544 125.324 105.350 1.00 20.43  ?  520  HIS A N     1 
ATOM   891   C  CA    . HIS A 1 648  ? 148.975 125.058 105.448 1.00 29.03  ?  520  HIS A CA    1 
ATOM   892   C  C     . HIS A 1 648  ? 149.778 125.993 104.549 1.00 38.13  ?  520  HIS A C     1 
ATOM   893   O  O     . HIS A 1 648  ? 150.858 126.460 104.933 1.00 47.13  ?  520  HIS A O     1 
ATOM   894   C  CB    . HIS A 1 648  ? 149.260 123.588 105.133 1.00 51.26  ?  520  HIS A CB    1 
ATOM   895   C  CG    . HIS A 1 648  ? 149.414 123.285 103.672 1.00 68.80  ?  520  HIS A CG    1 
ATOM   896   N  ND1   . HIS A 1 648  ? 150.602 122.842 103.128 1.00 86.82  ?  520  HIS A ND1   1 
ATOM   897   C  CD2   . HIS A 1 648  ? 148.526 123.329 102.651 1.00 69.62  ?  520  HIS A CD2   1 
ATOM   898   C  CE1   . HIS A 1 648  ? 150.442 122.640 101.833 1.00 97.62  ?  520  HIS A CE1   1 
ATOM   899   N  NE2   . HIS A 1 648  ? 149.192 122.929 101.518 1.00 88.27  ?  520  HIS A NE2   1 
ATOM   900   N  N     . THR A 1 649  ? 149.254 126.305 103.360 1.00 40.84  ?  521  THR A N     1 
ATOM   901   C  CA    . THR A 1 649  ? 149.959 127.212 102.459 1.00 55.50  ?  521  THR A CA    1 
ATOM   902   C  C     . THR A 1 649  ? 149.904 128.649 102.955 1.00 35.63  ?  521  THR A C     1 
ATOM   903   O  O     . THR A 1 649  ? 150.843 129.420 102.735 1.00 41.82  ?  521  THR A O     1 
ATOM   904   C  CB    . THR A 1 649  ? 149.386 127.126 101.043 1.00 65.91  ?  521  THR A CB    1 
ATOM   905   O  OG1   . THR A 1 649  ? 149.928 128.188 100.247 1.00 52.32  ?  521  THR A OG1   1 
ATOM   906   C  CG2   . THR A 1 649  ? 147.879 127.237 101.059 1.00 50.79  ?  521  THR A CG2   1 
ATOM   907   N  N     . LEU A 1 650  ? 148.815 129.022 103.621 1.00 20.69  ?  522  LEU A N     1 
ATOM   908   C  CA    . LEU A 1 650  ? 148.763 130.306 104.304 1.00 19.98  ?  522  LEU A CA    1 
ATOM   909   C  C     . LEU A 1 650  ? 149.877 130.414 105.337 1.00 21.40  ?  522  LEU A C     1 
ATOM   910   O  O     . LEU A 1 650  ? 150.588 131.422 105.403 1.00 20.15  ?  522  LEU A O     1 
ATOM   911   C  CB    . LEU A 1 650  ? 147.396 130.475 104.955 1.00 12.77  ?  522  LEU A CB    1 
ATOM   912   C  CG    . LEU A 1 650  ? 147.273 131.660 105.895 1.00 11.98  ?  522  LEU A CG    1 
ATOM   913   C  CD1   . LEU A 1 650  ? 145.946 132.317 105.657 1.00 33.84  ?  522  LEU A CD1   1 
ATOM   914   C  CD2   . LEU A 1 650  ? 147.381 131.212 107.338 1.00 13.97  ?  522  LEU A CD2   1 
ATOM   915   N  N     . ARG A 1 651  ? 150.035 129.377 106.161 1.00 18.30  ?  523  ARG A N     1 
ATOM   916   C  CA    . ARG A 1 651  ? 151.098 129.375 107.165 1.00 14.79  ?  523  ARG A CA    1 
ATOM   917   C  C     . ARG A 1 651  ? 152.472 129.471 106.515 1.00 30.37  ?  523  ARG A C     1 
ATOM   918   O  O     . ARG A 1 651  ? 153.346 130.209 106.987 1.00 43.62  ?  523  ARG A O     1 
ATOM   919   C  CB    . ARG A 1 651  ? 151.027 128.118 108.019 1.00 15.88  ?  523  ARG A CB    1 
ATOM   920   C  CG    . ARG A 1 651  ? 150.448 128.328 109.390 1.00 22.95  ?  523  ARG A CG    1 
ATOM   921   C  CD    . ARG A 1 651  ? 150.509 127.050 110.216 1.00 31.47  ?  523  ARG A CD    1 
ATOM   922   N  NE    . ARG A 1 651  ? 149.443 126.105 109.900 1.00 48.30  ?  523  ARG A NE    1 
ATOM   923   C  CZ    . ARG A 1 651  ? 149.449 125.281 108.853 1.00 53.93  ?  523  ARG A CZ    1 
ATOM   924   N  NH1   . ARG A 1 651  ? 150.483 125.269 108.022 1.00 53.40  ?  523  ARG A NH1   1 
ATOM   925   N  NH2   . ARG A 1 651  ? 148.431 124.454 108.652 1.00 49.73  ?  523  ARG A NH2   1 
ATOM   926   N  N     . ASN A 1 652  ? 152.702 128.677 105.469 1.00 35.67  ?  524  ASN A N     1 
ATOM   927   C  CA    . ASN A 1 652  ? 153.991 128.719 104.787 1.00 37.83  ?  524  ASN A CA    1 
ATOM   928   C  C     . ASN A 1 652  ? 154.267 130.105 104.225 1.00 44.37  ?  524  ASN A C     1 
ATOM   929   O  O     . ASN A 1 652  ? 155.381 130.624 104.349 1.00 53.50  ?  524  ASN A O     1 
ATOM   930   C  CB    . ASN A 1 652  ? 154.032 127.667 103.676 1.00 46.64  ?  524  ASN A CB    1 
ATOM   931   C  CG    . ASN A 1 652  ? 154.990 128.033 102.555 1.00 58.00  ?  524  ASN A CG    1 
ATOM   932   O  OD1   . ASN A 1 652  ? 156.210 127.903 102.687 1.00 63.47  ?  524  ASN A OD1   1 
ATOM   933   N  ND2   . ASN A 1 652  ? 154.437 128.517 101.447 1.00 54.58  ?  524  ASN A ND2   1 
ATOM   934   N  N     . ALA A 1 653  ? 153.258 130.725 103.614 1.00 38.11  ?  525  ALA A N     1 
ATOM   935   C  CA    . ALA A 1 653  ? 153.415 132.078 103.089 1.00 40.21  ?  525  ALA A CA    1 
ATOM   936   C  C     . ALA A 1 653  ? 153.717 133.064 104.208 1.00 37.35  ?  525  ALA A C     1 
ATOM   937   O  O     . ALA A 1 653  ? 154.466 134.029 104.017 1.00 45.90  ?  525  ALA A O     1 
ATOM   938   C  CB    . ALA A 1 653  ? 152.153 132.490 102.327 1.00 41.00  ?  525  ALA A CB    1 
ATOM   939   N  N     . GLU A 1 654  ? 153.119 132.849 105.377 1.00 32.14  ?  526  GLU A N     1 
ATOM   940   C  CA    . GLU A 1 654  ? 153.364 133.714 106.524 1.00 33.09  ?  526  GLU A CA    1 
ATOM   941   C  C     . GLU A 1 654  ? 154.799 133.594 107.031 1.00 33.25  ?  526  GLU A C     1 
ATOM   942   O  O     . GLU A 1 654  ? 155.422 134.596 107.405 1.00 23.80  ?  526  GLU A O     1 
ATOM   943   C  CB    . GLU A 1 654  ? 152.358 133.365 107.625 1.00 39.39  ?  526  GLU A CB    1 
ATOM   944   C  CG    . GLU A 1 654  ? 152.774 133.835 108.994 1.00 72.27  ?  526  GLU A CG    1 
ATOM   945   C  CD    . GLU A 1 654  ? 153.493 132.761 109.776 1.00 106.57 ?  526  GLU A CD    1 
ATOM   946   O  OE1   . GLU A 1 654  ? 153.657 131.640 109.251 1.00 92.54  ?  526  GLU A OE1   1 
ATOM   947   O  OE2   . GLU A 1 654  ? 153.958 133.058 110.892 1.00 295.89 -1 526  GLU A OE2   1 
ATOM   948   N  N     . LYS A 1 655  ? 155.327 132.364 107.066 1.00 47.65  ?  527  LYS A N     1 
ATOM   949   C  CA    . LYS A 1 655  ? 156.615 132.070 107.706 1.00 25.86  ?  527  LYS A CA    1 
ATOM   950   C  C     . LYS A 1 655  ? 157.739 132.967 107.216 1.00 11.64  ?  527  LYS A C     1 
ATOM   951   O  O     . LYS A 1 655  ? 158.722 133.183 107.928 1.00 11.15  ?  527  LYS A O     1 
ATOM   952   C  CB    . LYS A 1 655  ? 156.982 130.609 107.446 1.00 33.02  ?  527  LYS A CB    1 
ATOM   953   C  CG    . LYS A 1 655  ? 158.206 130.099 108.176 1.00 32.87  ?  527  LYS A CG    1 
ATOM   954   C  CD    . LYS A 1 655  ? 158.151 128.576 108.257 1.00 60.73  ?  527  LYS A CD    1 
ATOM   955   C  CE    . LYS A 1 655  ? 156.908 128.127 109.011 1.00 42.48  ?  527  LYS A CE    1 
ATOM   956   N  NZ    . LYS A 1 655  ? 156.784 126.651 109.175 1.00 42.59  ?  527  LYS A NZ    1 
ATOM   957   N  N     . GLU A 1 656  ? 157.628 133.463 105.994 1.00 16.45  ?  528  GLU A N     1 
ATOM   958   C  CA    . GLU A 1 656  ? 158.651 134.321 105.431 1.00 17.75  ?  528  GLU A CA    1 
ATOM   959   C  C     . GLU A 1 656  ? 158.651 135.718 106.036 1.00 26.49  ?  528  GLU A C     1 
ATOM   960   O  O     . GLU A 1 656  ? 159.568 136.495 105.754 1.00 37.92  ?  528  GLU A O     1 
ATOM   961   C  CB    . GLU A 1 656  ? 158.442 134.403 103.923 1.00 34.02  ?  528  GLU A CB    1 
ATOM   962   C  CG    . GLU A 1 656  ? 159.653 134.835 103.148 1.00 80.19  ?  528  GLU A CG    1 
ATOM   963   C  CD    . GLU A 1 656  ? 159.337 135.087 101.692 1.00 191.27 ?  528  GLU A CD    1 
ATOM   964   O  OE1   . GLU A 1 656  ? 158.174 134.876 101.279 1.00 160.87 ?  528  GLU A OE1   1 
ATOM   965   O  OE2   . GLU A 1 656  ? 160.257 135.497 100.959 1.00 451.38 -1 528  GLU A OE2   1 
ATOM   966   N  N     . LEU A 1 657  ? 157.666 136.055 106.865 1.00 33.47  ?  529  LEU A N     1 
ATOM   967   C  CA    . LEU A 1 657  ? 157.518 137.422 107.350 1.00 25.42  ?  529  LEU A CA    1 
ATOM   968   C  C     . LEU A 1 657  ? 158.014 137.634 108.773 1.00 37.84  ?  529  LEU A C     1 
ATOM   969   O  O     . LEU A 1 657  ? 158.507 138.720 109.086 1.00 35.73  ?  529  LEU A O     1 
ATOM   970   C  CB    . LEU A 1 657  ? 156.061 137.858 107.259 1.00 14.81  ?  529  LEU A CB    1 
ATOM   971   C  CG    . LEU A 1 657  ? 155.783 138.388 105.861 1.00 23.63  ?  529  LEU A CG    1 
ATOM   972   C  CD1   . LEU A 1 657  ? 154.389 138.928 105.789 1.00 19.05  ?  529  LEU A CD1   1 
ATOM   973   C  CD2   . LEU A 1 657  ? 156.799 139.447 105.497 1.00 26.30  ?  529  LEU A CD2   1 
ATOM   974   N  N     . LEU A 1 658  ? 157.900 136.635 109.632 1.00 14.95  ?  530  LEU A N     1 
ATOM   975   C  CA    . LEU A 1 658  ? 158.431 136.690 110.985 1.00 12.05  ?  530  LEU A CA    1 
ATOM   976   C  C     . LEU A 1 658  ? 159.944 136.874 110.994 1.00 16.16  ?  530  LEU A C     1 
ATOM   977   O  O     . LEU A 1 658  ? 160.593 136.741 109.952 1.00 37.65  ?  530  LEU A O     1 
ATOM   978   C  CB    . LEU A 1 658  ? 158.055 135.415 111.730 1.00 20.56  ?  530  LEU A CB    1 
ATOM   979   C  CG    . LEU A 1 658  ? 156.723 135.482 112.446 1.00 26.05  ?  530  LEU A CG    1 
ATOM   980   C  CD1   . LEU A 1 658  ? 156.731 134.460 113.558 1.00 48.17  ?  530  LEU A CD1   1 
ATOM   981   C  CD2   . LEU A 1 658  ? 156.528 136.881 112.984 1.00 29.94  ?  530  LEU A CD2   1 
ATOM   982   N  N     . PRO A 1 659  ? 160.543 137.173 112.148 1.00 8.73   ?  531  PRO A N     1 
ATOM   983   C  CA    . PRO A 1 659  ? 162.004 137.230 112.218 1.00 14.58  ?  531  PRO A CA    1 
ATOM   984   C  C     . PRO A 1 659  ? 162.670 135.892 111.926 1.00 27.20  ?  531  PRO A C     1 
ATOM   985   O  O     . PRO A 1 659  ? 162.110 134.815 112.125 1.00 15.26  ?  531  PRO A O     1 
ATOM   986   C  CB    . PRO A 1 659  ? 162.263 137.678 113.655 1.00 23.14  ?  531  PRO A CB    1 
ATOM   987   C  CG    . PRO A 1 659  ? 161.093 137.133 114.397 1.00 24.27  ?  531  PRO A CG    1 
ATOM   988   C  CD    . PRO A 1 659  ? 159.946 137.416 113.472 1.00 26.20  ?  531  PRO A CD    1 
ATOM   989   N  N     . GLY A 1 660  ? 163.906 135.987 111.454 1.00 27.26  ?  532  GLY A N     1 
ATOM   990   C  CA    . GLY A 1 660  ? 164.731 134.830 111.189 1.00 32.63  ?  532  GLY A CA    1 
ATOM   991   C  C     . GLY A 1 660  ? 164.519 134.250 109.810 1.00 25.75  ?  532  GLY A C     1 
ATOM   992   O  O     . GLY A 1 660  ? 164.376 133.033 109.657 1.00 42.20  ?  532  GLY A O     1 
ATOM   993   N  N     . PHE A 1 661  ? 164.446 135.111 108.796 1.00 16.22  ?  533  PHE A N     1 
ATOM   994   C  CA    . PHE A 1 661  ? 164.480 134.614 107.428 1.00 16.94  ?  533  PHE A CA    1 
ATOM   995   C  C     . PHE A 1 661  ? 165.358 135.430 106.483 1.00 63.26  ?  533  PHE A C     1 
ATOM   996   O  O     . PHE A 1 661  ? 165.779 134.892 105.455 1.00 43.74  ?  533  PHE A O     1 
ATOM   997   C  CB    . PHE A 1 661  ? 163.067 134.539 106.846 1.00 22.57  ?  533  PHE A CB    1 
ATOM   998   C  CG    . PHE A 1 661  ? 162.988 133.725 105.598 1.00 43.85  ?  533  PHE A CG    1 
ATOM   999   C  CD1   . PHE A 1 661  ? 163.007 132.342 105.667 1.00 50.19  ?  533  PHE A CD1   1 
ATOM   1000  C  CD2   . PHE A 1 661  ? 162.974 134.327 104.356 1.00 52.18  ?  533  PHE A CD2   1 
ATOM   1001  C  CE1   . PHE A 1 661  ? 162.957 131.576 104.522 1.00 82.24  ?  533  PHE A CE1   1 
ATOM   1002  C  CE2   . PHE A 1 661  ? 162.932 133.561 103.206 1.00 92.30  ?  533  PHE A CE2   1 
ATOM   1003  C  CZ    . PHE A 1 661  ? 162.923 132.185 103.294 1.00 112.21 ?  533  PHE A CZ    1 
ATOM   1004  N  N     . HIS A 1 662  ? 165.662 136.693 106.780 1.00 26.73  ?  534  HIS A N     1 
ATOM   1005  C  CA    . HIS A 1 662  ? 166.338 137.587 105.842 1.00 31.66  ?  534  HIS A CA    1 
ATOM   1006  C  C     . HIS A 1 662  ? 167.804 137.716 106.239 1.00 41.16  ?  534  HIS A C     1 
ATOM   1007  O  O     . HIS A 1 662  ? 168.146 138.447 107.171 1.00 40.55  ?  534  HIS A O     1 
ATOM   1008  C  CB    . HIS A 1 662  ? 165.628 138.930 105.822 1.00 17.29  ?  534  HIS A CB    1 
ATOM   1009  C  CG    . HIS A 1 662  ? 164.194 138.812 105.430 1.00 58.30  ?  534  HIS A CG    1 
ATOM   1010  N  ND1   . HIS A 1 662  ? 163.718 137.740 104.707 1.00 37.47  ?  534  HIS A ND1   1 
ATOM   1011  C  CD2   . HIS A 1 662  ? 163.119 139.578 105.724 1.00 44.70  ?  534  HIS A CD2   1 
ATOM   1012  C  CE1   . HIS A 1 662  ? 162.418 137.877 104.533 1.00 35.61  ?  534  HIS A CE1   1 
ATOM   1013  N  NE2   . HIS A 1 662  ? 162.030 138.984 105.139 1.00 30.12  ?  534  HIS A NE2   1 
ATOM   1014  N  N     . GLN A 1 663  ? 168.668 137.007 105.512 1.00 48.92  ?  535  GLN A N     1 
ATOM   1015  C  CA    . GLN A 1 663  ? 170.088 136.942 105.831 1.00 41.22  ?  535  GLN A CA    1 
ATOM   1016  C  C     . GLN A 1 663  ? 170.734 138.322 105.788 1.00 44.07  ?  535  GLN A C     1 
ATOM   1017  O  O     . GLN A 1 663  ? 170.270 139.233 105.099 1.00 46.94  ?  535  GLN A O     1 
ATOM   1018  C  CB    . GLN A 1 663  ? 170.802 135.999 104.858 1.00 45.45  ?  535  GLN A CB    1 
ATOM   1019  C  CG    . GLN A 1 663  ? 172.156 135.517 105.349 1.00 59.72  ?  535  GLN A CG    1 
ATOM   1020  C  CD    . GLN A 1 663  ? 172.648 134.299 104.589 1.00 84.94  ?  535  GLN A CD    1 
ATOM   1021  O  OE1   . GLN A 1 663  ? 171.879 133.623 103.900 1.00 65.22  ?  535  GLN A OE1   1 
ATOM   1022  N  NE2   . GLN A 1 663  ? 173.938 134.011 104.713 1.00 151.77 ?  535  GLN A NE2   1 
ATOM   1023  N  N     . PHE A 1 664  ? 171.833 138.462 106.521 1.00 50.19  ?  536  PHE A N     1 
ATOM   1024  C  CA    . PHE A 1 664  ? 172.525 139.734 106.643 1.00 53.24  ?  536  PHE A CA    1 
ATOM   1025  C  C     . PHE A 1 664  ? 173.910 139.467 107.213 1.00 40.21  ?  536  PHE A C     1 
ATOM   1026  O  O     . PHE A 1 664  ? 174.214 138.365 107.671 1.00 45.02  ?  536  PHE A O     1 
ATOM   1027  C  CB    . PHE A 1 664  ? 171.775 140.699 107.551 1.00 40.19  ?  536  PHE A CB    1 
ATOM   1028  C  CG    . PHE A 1 664  ? 171.416 140.110 108.877 1.00 36.69  ?  536  PHE A CG    1 
ATOM   1029  C  CD1   . PHE A 1 664  ? 170.314 139.292 109.015 1.00 34.83  ?  536  PHE A CD1   1 
ATOM   1030  C  CD2   . PHE A 1 664  ? 172.210 140.338 109.982 1.00 56.27  ?  536  PHE A CD2   1 
ATOM   1031  C  CE1   . PHE A 1 664  ? 169.989 138.750 110.235 1.00 36.75  ?  536  PHE A CE1   1 
ATOM   1032  C  CE2   . PHE A 1 664  ? 171.884 139.788 111.205 1.00 72.53  ?  536  PHE A CE2   1 
ATOM   1033  C  CZ    . PHE A 1 664  ? 170.776 138.998 111.325 1.00 55.13  ?  536  PHE A CZ    1 
ATOM   1034  N  N     . GLU A 1 665  ? 174.740 140.501 107.199 1.00 33.81  ?  537  GLU A N     1 
ATOM   1035  C  CA    . GLU A 1 665  ? 176.068 140.391 107.762 1.00 41.71  ?  537  GLU A CA    1 
ATOM   1036  C  C     . GLU A 1 665  ? 176.315 141.593 108.660 1.00 36.49  ?  537  GLU A C     1 
ATOM   1037  O  O     . GLU A 1 665  ? 175.546 142.565 108.653 1.00 45.00  ?  537  GLU A O     1 
ATOM   1038  C  CB    . GLU A 1 665  ? 177.122 140.278 106.646 1.00 110.38 ?  537  GLU A CB    1 
ATOM   1039  C  CG    . GLU A 1 665  ? 178.506 139.831 107.091 1.00 170.91 ?  537  GLU A CG    1 
ATOM   1040  C  CD    . GLU A 1 665  ? 179.452 139.597 105.921 1.00 239.82 ?  537  GLU A CD    1 
ATOM   1041  O  OE1   . GLU A 1 665  ? 179.045 138.946 104.937 1.00 236.80 ?  537  GLU A OE1   1 
ATOM   1042  O  OE2   . GLU A 1 665  ? 180.609 140.068 105.989 1.00 330.40 -1 537  GLU A OE2   1 
ATOM   1043  N  N     . TRP A 1 666  ? 177.404 141.552 109.429 1.00 43.72  ?  538  TRP A N     1 
ATOM   1044  C  CA    . TRP A 1 666  ? 177.685 142.658 110.338 1.00 52.12  ?  538  TRP A CA    1 
ATOM   1045  C  C     . TRP A 1 666  ? 179.173 142.977 110.312 1.00 65.53  ?  538  TRP A C     1 
ATOM   1046  O  O     . TRP A 1 666  ? 180.002 142.063 110.410 1.00 74.37  ?  538  TRP A O     1 
ATOM   1047  C  CB    . TRP A 1 666  ? 177.236 142.298 111.758 1.00 44.95  ?  538  TRP A CB    1 
ATOM   1048  C  CG    . TRP A 1 666  ? 176.771 143.490 112.474 1.00 79.92  ?  538  TRP A CG    1 
ATOM   1049  C  CD1   . TRP A 1 666  ? 177.355 144.705 112.513 1.00 88.93  ?  538  TRP A CD1   1 
ATOM   1050  C  CD2   . TRP A 1 666  ? 175.553 143.604 113.212 1.00 73.32  ?  538  TRP A CD2   1 
ATOM   1051  N  NE1   . TRP A 1 666  ? 176.603 145.577 113.260 1.00 101.30 ?  538  TRP A NE1   1 
ATOM   1052  C  CE2   . TRP A 1 666  ? 175.483 144.922 113.700 1.00 111.34 ?  538  TRP A CE2   1 
ATOM   1053  C  CE3   . TRP A 1 666  ? 174.526 142.712 113.521 1.00 41.33  ?  538  TRP A CE3   1 
ATOM   1054  C  CZ2   . TRP A 1 666  ? 174.428 145.370 114.478 1.00 93.86  ?  538  TRP A CZ2   1 
ATOM   1055  C  CZ3   . TRP A 1 666  ? 173.482 143.159 114.289 1.00 25.37  ?  538  TRP A CZ3   1 
ATOM   1056  C  CH2   . TRP A 1 666  ? 173.434 144.479 114.760 1.00 25.34  ?  538  TRP A CH2   1 
ATOM   1057  N  N     . GLN A 1 667  ? 179.520 144.257 110.175 1.00 69.61  ?  539  GLN A N     1 
ATOM   1058  C  CA    . GLN A 1 667  ? 180.914 144.718 110.180 1.00 57.37  ?  539  GLN A CA    1 
ATOM   1059  C  C     . GLN A 1 667  ? 181.167 145.647 111.359 1.00 54.91  ?  539  GLN A C     1 
ATOM   1060  O  O     . GLN A 1 667  ? 180.654 146.785 111.372 1.00 60.12  ?  539  GLN A O     1 
ATOM   1061  C  CB    . GLN A 1 667  ? 181.271 145.435 108.875 1.00 48.52  ?  539  GLN A CB    1 
ATOM   1062  C  CG    . GLN A 1 667  ? 181.114 144.588 107.625 1.00 60.92  ?  539  GLN A CG    1 
ATOM   1063  C  CD    . GLN A 1 667  ? 180.766 145.411 106.399 1.00 63.61  ?  539  GLN A CD    1 
ATOM   1064  O  OE1   . GLN A 1 667  ? 180.437 146.595 106.500 1.00 55.21  ?  539  GLN A OE1   1 
ATOM   1065  N  NE2   . GLN A 1 667  ? 180.817 144.780 105.231 1.00 78.97  ?  539  GLN A NE2   1 
ATOM   1066  N  N     . PRO A 1 668  ? 181.924 145.215 112.380 1.00 62.70  ?  540  PRO A N     1 
ATOM   1067  C  CA    . PRO A 1 668  ? 182.367 143.822 112.500 1.00 71.92  ?  540  PRO A CA    1 
ATOM   1068  C  C     . PRO A 1 668  ? 181.305 142.908 113.107 1.00 73.97  ?  540  PRO A C     1 
ATOM   1069  O  O     . PRO A 1 668  ? 180.169 143.350 113.271 1.00 83.89  ?  540  PRO A O     1 
ATOM   1070  C  CB    . PRO A 1 668  ? 183.583 143.933 113.417 1.00 72.17  ?  540  PRO A CB    1 
ATOM   1071  C  CG    . PRO A 1 668  ? 183.233 145.070 114.310 1.00 61.06  ?  540  PRO A CG    1 
ATOM   1072  C  CD    . PRO A 1 668  ? 182.567 146.072 113.393 1.00 62.49  ?  540  PRO A CD    1 
ATOM   1073  N  N     . ALA A 1 669  ? 181.655 141.661 113.418 1.00 81.92  ?  541  ALA A N     1 
ATOM   1074  C  CA    . ALA A 1 669  ? 180.733 140.803 114.151 1.00 81.27  ?  541  ALA A CA    1 
ATOM   1075  C  C     . ALA A 1 669  ? 180.410 141.429 115.503 1.00 73.36  ?  541  ALA A C     1 
ATOM   1076  O  O     . ALA A 1 669  ? 181.246 142.106 116.106 1.00 69.02  ?  541  ALA A O     1 
ATOM   1077  C  CB    . ALA A 1 669  ? 181.327 139.405 114.335 1.00 63.57  ?  541  ALA A CB    1 
ATOM   1078  N  N     . LEU A 1 670  ? 179.186 141.204 115.978 1.00 72.37  ?  542  LEU A N     1 
ATOM   1079  C  CA    . LEU A 1 670  ? 178.726 141.826 117.210 1.00 47.46  ?  542  LEU A CA    1 
ATOM   1080  C  C     . LEU A 1 670  ? 179.541 141.348 118.404 1.00 40.11  ?  542  LEU A C     1 
ATOM   1081  O  O     . LEU A 1 670  ? 180.262 140.344 118.358 1.00 45.62  ?  542  LEU A O     1 
ATOM   1082  C  CB    . LEU A 1 670  ? 177.250 141.517 117.448 1.00 46.83  ?  542  LEU A CB    1 
ATOM   1083  C  CG    . LEU A 1 670  ? 176.355 141.932 116.287 1.00 90.37  ?  542  LEU A CG    1 
ATOM   1084  C  CD1   . LEU A 1 670  ? 175.143 141.040 116.226 1.00 96.74  ?  542  LEU A CD1   1 
ATOM   1085  C  CD2   . LEU A 1 670  ? 175.941 143.387 116.460 1.00 105.86 ?  542  LEU A CD2   1 
ATOM   1086  N  N     . LYS A 1 671  ? 179.395 142.080 119.498 1.00 40.74  ?  543  LYS A N     1 
ATOM   1087  C  CA    . LYS A 1 671  ? 180.021 141.699 120.751 1.00 37.64  ?  543  LYS A CA    1 
ATOM   1088  C  C     . LYS A 1 671  ? 179.161 140.653 121.443 1.00 41.48  ?  543  LYS A C     1 
ATOM   1089  O  O     . LYS A 1 671  ? 177.965 140.861 121.648 1.00 32.98  ?  543  LYS A O     1 
ATOM   1090  C  CB    . LYS A 1 671  ? 180.222 142.918 121.649 1.00 41.86  ?  543  LYS A CB    1 
ATOM   1091  C  CG    . LYS A 1 671  ? 181.520 143.667 121.374 1.00 66.96  ?  543  LYS A CG    1 
ATOM   1092  C  CD    . LYS A 1 671  ? 182.589 142.745 120.817 1.00 62.48  ?  543  LYS A CD    1 
ATOM   1093  C  CE    . LYS A 1 671  ? 183.978 143.314 121.016 1.00 71.13  ?  543  LYS A CE    1 
ATOM   1094  N  NZ    . LYS A 1 671  ? 184.594 142.827 122.281 1.00 76.30  ?  543  LYS A NZ    1 
ATOM   1095  N  N     . ASN A 1 672  ? 179.780 139.518 121.771 1.00 57.94  ?  544  ASN A N     1 
ATOM   1096  C  CA    . ASN A 1 672  ? 179.186 138.442 122.574 1.00 62.98  ?  544  ASN A CA    1 
ATOM   1097  C  C     . ASN A 1 672  ? 177.792 138.035 122.086 1.00 38.88  ?  544  ASN A C     1 
ATOM   1098  O  O     . ASN A 1 672  ? 176.877 137.803 122.877 1.00 23.66  ?  544  ASN A O     1 
ATOM   1099  C  CB    . ASN A 1 672  ? 179.171 138.815 124.063 1.00 45.79  ?  544  ASN A CB    1 
ATOM   1100  C  CG    . ASN A 1 672  ? 178.327 140.034 124.364 1.00 41.47  ?  544  ASN A CG    1 
ATOM   1101  O  OD1   . ASN A 1 672  ? 178.842 141.146 124.483 1.00 36.90  ?  544  ASN A OD1   1 
ATOM   1102  N  ND2   . ASN A 1 672  ? 177.022 139.832 124.495 1.00 35.56  ?  544  ASN A ND2   1 
ATOM   1103  N  N     . VAL A 1 673  ? 177.648 137.892 120.768 1.00 51.79  ?  545  VAL A N     1 
ATOM   1104  C  CA    . VAL A 1 673  ? 176.400 137.467 120.138 1.00 39.24  ?  545  VAL A CA    1 
ATOM   1105  C  C     . VAL A 1 673  ? 176.715 136.456 119.045 1.00 48.87  ?  545  VAL A C     1 
ATOM   1106  O  O     . VAL A 1 673  ? 177.616 136.673 118.228 1.00 62.09  ?  545  VAL A O     1 
ATOM   1107  C  CB    . VAL A 1 673  ? 175.622 138.654 119.542 1.00 56.54  ?  545  VAL A CB    1 
ATOM   1108  C  CG1   . VAL A 1 673  ? 174.400 138.159 118.785 1.00 53.19  ?  545  VAL A CG1   1 
ATOM   1109  C  CG2   . VAL A 1 673  ? 175.233 139.636 120.626 1.00 77.65  ?  545  VAL A CG2   1 
ATOM   1110  N  N     . SER A 1 674  ? 175.963 135.359 119.020 1.00 51.42  ?  546  SER A N     1 
ATOM   1111  C  CA    . SER A 1 674  ? 176.146 134.353 117.985 1.00 81.54  ?  546  SER A CA    1 
ATOM   1112  C  C     . SER A 1 674  ? 175.877 134.951 116.607 1.00 63.07  ?  546  SER A C     1 
ATOM   1113  O  O     . SER A 1 674  ? 175.003 135.804 116.430 1.00 52.49  ?  546  SER A O     1 
ATOM   1114  C  CB    . SER A 1 674  ? 175.224 133.152 118.235 1.00 65.19  ?  546  SER A CB    1 
ATOM   1115  O  OG    . SER A 1 674  ? 174.967 132.424 117.046 1.00 50.03  ?  546  SER A OG    1 
ATOM   1116  N  N     . THR A 1 675  ? 176.653 134.493 115.625 1.00 83.88  ?  547  THR A N     1 
ATOM   1117  C  CA    . THR A 1 675  ? 176.459 134.899 114.240 1.00 82.74  ?  547  THR A CA    1 
ATOM   1118  C  C     . THR A 1 675  ? 175.218 134.274 113.620 1.00 66.73  ?  547  THR A C     1 
ATOM   1119  O  O     . THR A 1 675  ? 174.833 134.666 112.511 1.00 61.17  ?  547  THR A O     1 
ATOM   1120  C  CB    . THR A 1 675  ? 177.696 134.540 113.408 1.00 98.79  ?  547  THR A CB    1 
ATOM   1121  O  OG1   . THR A 1 675  ? 177.764 133.120 113.236 1.00 102.22 ?  547  THR A OG1   1 
ATOM   1122  C  CG2   . THR A 1 675  ? 178.976 135.029 114.085 1.00 79.05  ?  547  THR A CG2   1 
ATOM   1123  N  N     . SER A 1 676  ? 174.597 133.314 114.302 1.00 54.63  ?  548  SER A N     1 
ATOM   1124  C  CA    . SER A 1 676  ? 173.374 132.699 113.809 1.00 44.84  ?  548  SER A CA    1 
ATOM   1125  C  C     . SER A 1 676  ? 172.298 133.755 113.586 1.00 34.38  ?  548  SER A C     1 
ATOM   1126  O  O     . SER A 1 676  ? 172.113 134.661 114.402 1.00 29.89  ?  548  SER A O     1 
ATOM   1127  C  CB    . SER A 1 676  ? 172.885 131.640 114.799 1.00 32.58  ?  548  SER A CB    1 
ATOM   1128  O  OG    . SER A 1 676  ? 171.478 131.522 114.770 1.00 39.03  ?  548  SER A OG    1 
ATOM   1129  N  N     . TRP A 1 677  ? 171.584 133.627 112.466 1.00 38.17  ?  549  TRP A N     1 
ATOM   1130  C  CA    . TRP A 1 677  ? 170.609 134.619 112.040 1.00 28.87  ?  549  TRP A CA    1 
ATOM   1131  C  C     . TRP A 1 677  ? 169.242 134.031 111.728 1.00 26.45  ?  549  TRP A C     1 
ATOM   1132  O  O     . TRP A 1 677  ? 168.309 134.793 111.455 1.00 27.87  ?  549  TRP A O     1 
ATOM   1133  C  CB    . TRP A 1 677  ? 171.115 135.372 110.797 1.00 39.42  ?  549  TRP A CB    1 
ATOM   1134  C  CG    . TRP A 1 677  ? 171.291 134.501 109.582 1.00 42.89  ?  549  TRP A CG    1 
ATOM   1135  C  CD1   . TRP A 1 677  ? 172.400 133.776 109.242 1.00 57.14  ?  549  TRP A CD1   1 
ATOM   1136  C  CD2   . TRP A 1 677  ? 170.316 134.236 108.568 1.00 50.76  ?  549  TRP A CD2   1 
ATOM   1137  N  NE1   . TRP A 1 677  ? 172.180 133.095 108.067 1.00 50.58  ?  549  TRP A NE1   1 
ATOM   1138  C  CE2   . TRP A 1 677  ? 170.907 133.357 107.636 1.00 49.95  ?  549  TRP A CE2   1 
ATOM   1139  C  CE3   . TRP A 1 677  ? 169.003 134.662 108.355 1.00 36.06  ?  549  TRP A CE3   1 
ATOM   1140  C  CZ2   . TRP A 1 677  ? 170.230 132.899 106.513 1.00 57.94  ?  549  TRP A CZ2   1 
ATOM   1141  C  CZ3   . TRP A 1 677  ? 168.335 134.208 107.243 1.00 47.37  ?  549  TRP A CZ3   1 
ATOM   1142  C  CH2   . TRP A 1 677  ? 168.948 133.337 106.331 1.00 55.85  ?  549  TRP A CH2   1 
ATOM   1143  N  N     . ASP A 1 678  ? 169.095 132.711 111.754 1.00 34.86  ?  550  ASP A N     1 
ATOM   1144  C  CA    . ASP A 1 678  ? 167.833 132.067 111.425 1.00 51.32  ?  550  ASP A CA    1 
ATOM   1145  C  C     . ASP A 1 678  ? 167.073 131.582 112.653 1.00 51.27  ?  550  ASP A C     1 
ATOM   1146  O  O     . ASP A 1 678  ? 165.980 131.027 112.509 1.00 60.40  ?  550  ASP A O     1 
ATOM   1147  C  CB    . ASP A 1 678  ? 168.070 130.901 110.457 1.00 72.11  ?  550  ASP A CB    1 
ATOM   1148  C  CG    . ASP A 1 678  ? 168.486 129.623 111.157 1.00 118.01 ?  550  ASP A CG    1 
ATOM   1149  O  OD1   . ASP A 1 678  ? 169.556 129.601 111.802 1.00 98.86  ?  550  ASP A OD1   1 
ATOM   1150  O  OD2   . ASP A 1 678  ? 167.735 128.631 111.055 1.00 265.23 -1 550  ASP A OD2   1 
ATOM   1151  N  N     . VAL A 1 679  ? 167.618 131.794 113.852 1.00 43.77  ?  551  VAL A N     1 
ATOM   1152  C  CA    . VAL A 1 679  ? 166.895 131.446 115.069 1.00 37.65  ?  551  VAL A CA    1 
ATOM   1153  C  C     . VAL A 1 679  ? 165.669 132.341 115.193 1.00 21.81  ?  551  VAL A C     1 
ATOM   1154  O  O     . VAL A 1 679  ? 165.758 133.566 115.067 1.00 20.94  ?  551  VAL A O     1 
ATOM   1155  C  CB    . VAL A 1 679  ? 167.820 131.551 116.295 1.00 34.82  ?  551  VAL A CB    1 
ATOM   1156  C  CG1   . VAL A 1 679  ? 168.669 130.285 116.437 1.00 51.45  ?  551  VAL A CG1   1 
ATOM   1157  C  CG2   . VAL A 1 679  ? 168.708 132.791 116.224 1.00 30.45  ?  551  VAL A CG2   1 
ATOM   1158  N  N     . GLY A 1 680  ? 164.511 131.726 115.435 1.00 10.25  ?  552  GLY A N     1 
ATOM   1159  C  CA    . GLY A 1 680  ? 163.250 132.443 115.538 1.00 11.30  ?  552  GLY A CA    1 
ATOM   1160  C  C     . GLY A 1 680  ? 162.911 132.867 116.955 1.00 12.25  ?  552  GLY A C     1 
ATOM   1161  O  O     . GLY A 1 680  ? 163.637 133.670 117.540 1.00 7.70   ?  552  GLY A O     1 
ATOM   1162  N  N     . ILE A 1 681  ? 161.841 132.328 117.535 1.00 7.46   ?  553  ILE A N     1 
ATOM   1163  C  CA    . ILE A 1 681  ? 161.340 132.768 118.836 1.00 20.18  ?  553  ILE A CA    1 
ATOM   1164  C  C     . ILE A 1 681  ? 162.189 132.120 119.924 1.00 22.21  ?  553  ILE A C     1 
ATOM   1165  O  O     . ILE A 1 681  ? 162.080 130.917 120.164 1.00 25.69  ?  553  ILE A O     1 
ATOM   1166  C  CB    . ILE A 1 681  ? 159.864 132.400 119.020 1.00 18.77  ?  553  ILE A CB    1 
ATOM   1167  C  CG1   . ILE A 1 681  ? 158.989 133.140 118.015 1.00 18.27  ?  553  ILE A CG1   1 
ATOM   1168  C  CG2   . ILE A 1 681  ? 159.424 132.722 120.438 1.00 15.78  ?  553  ILE A CG2   1 
ATOM   1169  C  CD1   . ILE A 1 681  ? 157.587 132.607 117.888 1.00 14.05  ?  553  ILE A CD1   1 
ATOM   1170  N  N     . ILE A 1 682  ? 163.017 132.910 120.602 1.00 18.60  ?  554  ILE A N     1 
ATOM   1171  C  CA    . ILE A 1 682  ? 163.853 132.408 121.689 1.00 25.64  ?  554  ILE A CA    1 
ATOM   1172  C  C     . ILE A 1 682  ? 163.034 132.420 122.975 1.00 19.46  ?  554  ILE A C     1 
ATOM   1173  O  O     . ILE A 1 682  ? 162.317 133.385 123.256 1.00 20.07  ?  554  ILE A O     1 
ATOM   1174  C  CB    . ILE A 1 682  ? 165.152 133.236 121.820 1.00 23.07  ?  554  ILE A CB    1 
ATOM   1175  C  CG1   . ILE A 1 682  ? 166.193 132.789 120.775 1.00 39.83  ?  554  ILE A CG1   1 
ATOM   1176  C  CG2   . ILE A 1 682  ? 165.754 133.142 123.209 1.00 23.44  ?  554  ILE A CG2   1 
ATOM   1177  C  CD1   . ILE A 1 682  ? 167.643 133.248 121.059 1.00 23.67  ?  554  ILE A CD1   1 
ATOM   1178  N  N     . ASP A 1 683  ? 163.092 131.317 123.723 1.00 34.97  ?  555  ASP A N     1 
ATOM   1179  C  CA    . ASP A 1 683  ? 162.531 131.280 125.067 1.00 33.52  ?  555  ASP A CA    1 
ATOM   1180  C  C     . ASP A 1 683  ? 163.181 132.359 125.929 1.00 38.76  ?  555  ASP A C     1 
ATOM   1181  O  O     . ASP A 1 683  ? 164.406 132.455 126.002 1.00 42.72  ?  555  ASP A O     1 
ATOM   1182  C  CB    . ASP A 1 683  ? 162.738 129.891 125.686 1.00 68.81  ?  555  ASP A CB    1 
ATOM   1183  C  CG    . ASP A 1 683  ? 164.141 129.317 125.413 1.00 164.09 ?  555  ASP A CG    1 
ATOM   1184  O  OD1   . ASP A 1 683  ? 164.883 129.867 124.563 1.00 126.68 ?  555  ASP A OD1   1 
ATOM   1185  O  OD2   . ASP A 1 683  ? 164.507 128.301 126.046 1.00 413.34 -1 555  ASP A OD2   1 
ATOM   1186  N  N     . GLY A 1 684  ? 162.357 133.179 126.581 1.00 26.31  ?  556  GLY A N     1 
ATOM   1187  C  CA    . GLY A 1 684  ? 162.872 134.341 127.290 1.00 18.49  ?  556  GLY A CA    1 
ATOM   1188  C  C     . GLY A 1 684  ? 163.660 134.028 128.550 1.00 13.12  ?  556  GLY A C     1 
ATOM   1189  O  O     . GLY A 1 684  ? 164.403 134.890 129.034 1.00 11.16  ?  556  GLY A O     1 
ATOM   1190  N  N     . LEU A 1 685  ? 163.504 132.819 129.099 1.00 16.41  ?  557  LEU A N     1 
ATOM   1191  C  CA    . LEU A 1 685  ? 164.223 132.440 130.312 1.00 14.69  ?  557  LEU A CA    1 
ATOM   1192  C  C     . LEU A 1 685  ? 165.729 132.624 130.153 1.00 23.74  ?  557  LEU A C     1 
ATOM   1193  O  O     . LEU A 1 685  ? 166.427 132.915 131.130 1.00 22.56  ?  557  LEU A O     1 
ATOM   1194  C  CB    . LEU A 1 685  ? 163.923 130.978 130.675 1.00 31.55  ?  557  LEU A CB    1 
ATOM   1195  C  CG    . LEU A 1 685  ? 162.487 130.425 130.717 1.00 52.07  ?  557  LEU A CG    1 
ATOM   1196  C  CD1   . LEU A 1 685  ? 161.954 129.996 129.351 1.00 54.46  ?  557  LEU A CD1   1 
ATOM   1197  C  CD2   . LEU A 1 685  ? 162.350 129.285 131.744 1.00 56.68  ?  557  LEU A CD2   1 
ATOM   1198  N  N     . SER A 1 686  ? 166.245 132.428 128.935 1.00 34.98  ?  558  SER A N     1 
ATOM   1199  C  CA    . SER A 1 686  ? 167.628 132.695 128.553 1.00 30.82  ?  558  SER A CA    1 
ATOM   1200  C  C     . SER A 1 686  ? 168.641 131.876 129.349 1.00 29.10  ?  558  SER A C     1 
ATOM   1201  O  O     . SER A 1 686  ? 169.565 132.430 129.953 1.00 30.84  ?  558  SER A O     1 
ATOM   1202  C  CB    . SER A 1 686  ? 167.915 134.197 128.660 1.00 16.37  ?  558  SER A CB    1 
ATOM   1203  O  OG    . SER A 1 686  ? 167.878 134.655 129.999 1.00 21.43  ?  558  SER A OG    1 
ATOM   1204  N  N     . GLY A 1 687  ? 168.494 130.552 129.321 1.00 30.98  ?  559  GLY A N     1 
ATOM   1205  C  CA    . GLY A 1 687  ? 169.440 129.655 129.955 1.00 31.82  ?  559  GLY A CA    1 
ATOM   1206  C  C     . GLY A 1 687  ? 169.554 129.829 131.456 1.00 24.20  ?  559  GLY A C     1 
ATOM   1207  O  O     . GLY A 1 687  ? 170.562 130.343 131.945 1.00 23.62  ?  559  GLY A O     1 
ATOM   1208  N  N     . TRP A 1 688  ? 168.534 129.421 132.201 1.00 17.04  ?  560  TRP A N     1 
ATOM   1209  C  CA    . TRP A 1 688  ? 168.514 129.575 133.651 1.00 19.43  ?  560  TRP A CA    1 
ATOM   1210  C  C     . TRP A 1 688  ? 168.549 128.203 134.305 1.00 21.39  ?  560  TRP A C     1 
ATOM   1211  O  O     . TRP A 1 688  ? 167.640 127.393 134.098 1.00 21.73  ?  560  TRP A O     1 
ATOM   1212  C  CB    . TRP A 1 688  ? 167.277 130.344 134.104 1.00 38.06  ?  560  TRP A CB    1 
ATOM   1213  C  CG    . TRP A 1 688  ? 167.569 131.322 135.175 1.00 46.99  ?  560  TRP A CG    1 
ATOM   1214  C  CD1   . TRP A 1 688  ? 168.786 131.594 135.715 1.00 34.53  ?  560  TRP A CD1   1 
ATOM   1215  C  CD2   . TRP A 1 688  ? 166.628 132.152 135.860 1.00 36.26  ?  560  TRP A CD2   1 
ATOM   1216  N  NE1   . TRP A 1 688  ? 168.670 132.552 136.689 1.00 60.62  ?  560  TRP A NE1   1 
ATOM   1217  C  CE2   . TRP A 1 688  ? 167.353 132.910 136.797 1.00 39.69  ?  560  TRP A CE2   1 
ATOM   1218  C  CE3   . TRP A 1 688  ? 165.248 132.334 135.768 1.00 32.26  ?  560  TRP A CE3   1 
ATOM   1219  C  CZ2   . TRP A 1 688  ? 166.748 133.830 137.636 1.00 46.03  ?  560  TRP A CZ2   1 
ATOM   1220  C  CZ3   . TRP A 1 688  ? 164.649 133.245 136.600 1.00 39.47  ?  560  TRP A CZ3   1 
ATOM   1221  C  CH2   . TRP A 1 688  ? 165.397 133.983 137.524 1.00 53.13  ?  560  TRP A CH2   1 
ATOM   1222  N  N     . THR A 1 689  ? 169.583 127.956 135.106 1.00 20.92  ?  561  THR A N     1 
ATOM   1223  C  CA    . THR A 1 689  ? 169.740 126.660 135.746 1.00 23.66  ?  561  THR A CA    1 
ATOM   1224  C  C     . THR A 1 689  ? 168.557 126.383 136.662 1.00 24.35  ?  561  THR A C     1 
ATOM   1225  O  O     . THR A 1 689  ? 168.294 127.134 137.604 1.00 21.66  ?  561  THR A O     1 
ATOM   1226  C  CB    . THR A 1 689  ? 171.061 126.601 136.514 1.00 17.81  ?  561  THR A CB    1 
ATOM   1227  O  OG1   . THR A 1 689  ? 170.919 127.253 137.779 1.00 29.03  ?  561  THR A OG1   1 
ATOM   1228  C  CG2   . THR A 1 689  ? 172.153 127.290 135.718 1.00 17.15  ?  561  THR A CG2   1 
ATOM   1229  N  N     . VAL A 1 690  ? 167.831 125.305 136.363 1.00 35.78  ?  562  VAL A N     1 
ATOM   1230  C  CA    . VAL A 1 690  ? 166.587 124.979 137.047 1.00 56.24  ?  562  VAL A CA    1 
ATOM   1231  C  C     . VAL A 1 690  ? 166.790 124.650 138.523 1.00 75.37  ?  562  VAL A C     1 
ATOM   1232  O  O     . VAL A 1 690  ? 165.815 124.601 139.280 1.00 86.68  ?  562  VAL A O     1 
ATOM   1233  C  CB    . VAL A 1 690  ? 165.890 123.813 136.299 1.00 75.33  ?  562  VAL A CB    1 
ATOM   1234  C  CG1   . VAL A 1 690  ? 166.666 122.509 136.479 1.00 75.31  ?  562  VAL A CG1   1 
ATOM   1235  C  CG2   . VAL A 1 690  ? 164.421 123.667 136.715 1.00 67.66  ?  562  VAL A CG2   1 
ATOM   1236  N  N     . SER A 1 691  ? 168.036 124.442 138.957 1.00 67.97  ?  563  SER A N     1 
ATOM   1237  C  CA    . SER A 1 691  ? 168.331 124.060 140.335 1.00 77.42  ?  563  SER A CA    1 
ATOM   1238  C  C     . SER A 1 691  ? 167.639 124.966 141.350 1.00 61.62  ?  563  SER A C     1 
ATOM   1239  O  O     . SER A 1 691  ? 167.933 126.162 141.420 1.00 64.56  ?  563  SER A O     1 
ATOM   1240  C  CB    . SER A 1 691  ? 169.850 124.052 140.557 1.00 91.30  ?  563  SER A CB    1 
ATOM   1241  O  OG    . SER A 1 691  ? 170.382 125.364 140.631 1.00 71.28  ?  563  SER A OG    1 
ATOM   1242  N  N     . VAL A 1 692  ? 166.721 124.403 142.146 1.00 59.99  ?  564  VAL A N     1 
ATOM   1243  C  CA    . VAL A 1 692  ? 165.872 125.180 143.049 1.00 56.99  ?  564  VAL A CA    1 
ATOM   1244  C  C     . VAL A 1 692  ? 166.674 125.640 144.256 1.00 51.15  ?  564  VAL A C     1 
ATOM   1245  O  O     . VAL A 1 692  ? 166.160 126.365 145.115 1.00 59.15  ?  564  VAL A O     1 
ATOM   1246  C  CB    . VAL A 1 692  ? 164.622 124.397 143.497 1.00 56.71  ?  564  VAL A CB    1 
ATOM   1247  C  CG1   . VAL A 1 692  ? 163.523 124.479 142.443 1.00 64.00  ?  564  VAL A CG1   1 
ATOM   1248  C  CG2   . VAL A 1 692  ? 164.971 122.952 143.798 1.00 76.87  ?  564  VAL A CG2   1 
ATOM   1249  N  N     . ASP A 1 693  ? 167.930 125.209 144.339 1.00 50.81  ?  565  ASP A N     1 
ATOM   1250  C  CA    . ASP A 1 693  ? 168.838 125.760 145.338 1.00 75.25  ?  565  ASP A CA    1 
ATOM   1251  C  C     . ASP A 1 693  ? 168.960 127.279 145.213 1.00 102.07 ?  565  ASP A C     1 
ATOM   1252  O  O     . ASP A 1 693  ? 169.021 127.991 146.224 1.00 94.64  ?  565  ASP A O     1 
ATOM   1253  C  CB    . ASP A 1 693  ? 170.208 125.082 145.220 1.00 100.70 ?  565  ASP A CB    1 
ATOM   1254  C  CG    . ASP A 1 693  ? 171.008 125.558 144.011 1.00 134.58 ?  565  ASP A CG    1 
ATOM   1255  O  OD1   . ASP A 1 693  ? 170.394 125.919 142.984 1.00 106.23 ?  565  ASP A OD1   1 
ATOM   1256  O  OD2   . ASP A 1 693  ? 172.255 125.571 144.088 1.00 272.83 -1 565  ASP A OD2   1 
ATOM   1257  N  N     . ASP A 1 694  ? 168.985 127.793 143.979 1.00 108.37 ?  566  ASP A N     1 
ATOM   1258  C  CA    . ASP A 1 694  ? 169.221 129.204 143.687 1.00 107.21 ?  566  ASP A CA    1 
ATOM   1259  C  C     . ASP A 1 694  ? 167.878 129.942 143.637 1.00 76.95  ?  566  ASP A C     1 
ATOM   1260  O  O     . ASP A 1 694  ? 166.843 129.417 144.058 1.00 92.98  ?  566  ASP A O     1 
ATOM   1261  C  CB    . ASP A 1 694  ? 170.009 129.326 142.375 1.00 135.46 ?  566  ASP A CB    1 
ATOM   1262  C  CG    . ASP A 1 694  ? 170.651 130.702 142.176 1.00 140.22 ?  566  ASP A CG    1 
ATOM   1263  O  OD1   . ASP A 1 694  ? 170.133 131.712 142.697 1.00 100.52 ?  566  ASP A OD1   1 
ATOM   1264  O  OD2   . ASP A 1 694  ? 171.680 130.772 141.468 1.00 304.24 -1 566  ASP A OD2   1 
ATOM   1265  N  N     . VAL A 1 695  ? 167.885 131.175 143.131 1.00 47.06  ?  567  VAL A N     1 
ATOM   1266  C  CA    . VAL A 1 695  ? 166.629 131.896 142.892 1.00 29.95  ?  567  VAL A CA    1 
ATOM   1267  C  C     . VAL A 1 695  ? 165.785 131.103 141.906 1.00 26.52  ?  567  VAL A C     1 
ATOM   1268  O  O     . VAL A 1 695  ? 166.329 130.563 140.922 1.00 32.98  ?  567  VAL A O     1 
ATOM   1269  C  CB    . VAL A 1 695  ? 166.896 133.322 142.373 1.00 27.25  ?  567  VAL A CB    1 
ATOM   1270  C  CG1   . VAL A 1 695  ? 167.822 133.297 141.162 1.00 38.43  ?  567  VAL A CG1   1 
ATOM   1271  C  CG2   . VAL A 1 695  ? 165.593 134.034 142.032 1.00 26.88  ?  567  VAL A CG2   1 
ATOM   1272  N  N     . PRO A 1 696  ? 164.478 130.971 142.124 1.00 22.29  ?  568  PRO A N     1 
ATOM   1273  C  CA    . PRO A 1 696  ? 163.665 130.129 141.242 1.00 30.07  ?  568  PRO A CA    1 
ATOM   1274  C  C     . PRO A 1 696  ? 163.790 130.536 139.778 1.00 36.60  ?  568  PRO A C     1 
ATOM   1275  O  O     . PRO A 1 696  ? 163.925 131.715 139.444 1.00 38.45  ?  568  PRO A O     1 
ATOM   1276  C  CB    . PRO A 1 696  ? 162.247 130.351 141.766 1.00 24.38  ?  568  PRO A CB    1 
ATOM   1277  C  CG    . PRO A 1 696  ? 162.458 130.607 143.225 1.00 17.76  ?  568  PRO A CG    1 
ATOM   1278  C  CD    . PRO A 1 696  ? 163.727 131.404 143.316 1.00 15.77  ?  568  PRO A CD    1 
ATOM   1279  N  N     . ALA A 1 697  ? 163.752 129.527 138.903 1.00 40.01  ?  569  ALA A N     1 
ATOM   1280  C  CA    . ALA A 1 697  ? 163.705 129.712 137.457 1.00 35.25  ?  569  ALA A CA    1 
ATOM   1281  C  C     . ALA A 1 697  ? 162.277 129.696 136.924 1.00 49.04  ?  569  ALA A C     1 
ATOM   1282  O  O     . ALA A 1 697  ? 162.044 129.267 135.786 1.00 40.06  ?  569  ALA A O     1 
ATOM   1283  C  CB    . ALA A 1 697  ? 164.549 128.643 136.758 1.00 22.94  ?  569  ALA A CB    1 
ATOM   1284  N  N     . ASP A 1 698  ? 161.314 130.161 137.726 1.00 60.11  ?  570  ASP A N     1 
ATOM   1285  C  CA    . ASP A 1 698  ? 159.894 130.013 137.411 1.00 72.45  ?  570  ASP A CA    1 
ATOM   1286  C  C     . ASP A 1 698  ? 159.417 131.000 136.351 1.00 63.31  ?  570  ASP A C     1 
ATOM   1287  O  O     . ASP A 1 698  ? 158.576 130.653 135.516 1.00 77.31  ?  570  ASP A O     1 
ATOM   1288  C  CB    . ASP A 1 698  ? 159.053 130.187 138.679 1.00 130.91 ?  570  ASP A CB    1 
ATOM   1289  C  CG    . ASP A 1 698  ? 157.627 129.668 138.515 1.00 210.75 ?  570  ASP A CG    1 
ATOM   1290  O  OD1   . ASP A 1 698  ? 157.404 128.757 137.687 1.00 194.93 ?  570  ASP A OD1   1 
ATOM   1291  O  OD2   . ASP A 1 698  ? 156.719 130.184 139.201 1.00 376.77 -1 570  ASP A OD2   1 
ATOM   1292  N  N     . THR A 1 699  ? 159.905 132.236 136.403 1.00 43.61  ?  571  THR A N     1 
ATOM   1293  C  CA    . THR A 1 699  ? 159.398 133.323 135.569 1.00 23.08  ?  571  THR A CA    1 
ATOM   1294  C  C     . THR A 1 699  ? 159.265 132.910 134.104 1.00 29.70  ?  571  THR A C     1 
ATOM   1295  O  O     . THR A 1 699  ? 160.205 132.371 133.519 1.00 38.70  ?  571  THR A O     1 
ATOM   1296  C  CB    . THR A 1 699  ? 160.344 134.515 135.710 1.00 22.16  ?  571  THR A CB    1 
ATOM   1297  O  OG1   . THR A 1 699  ? 160.103 135.167 136.963 1.00 23.47  ?  571  THR A OG1   1 
ATOM   1298  C  CG2   . THR A 1 699  ? 160.143 135.496 134.588 1.00 27.69  ?  571  THR A CG2   1 
ATOM   1299  N  N     . ILE A 1 700  ? 158.076 133.158 133.512 1.00 15.29  ?  572  ILE A N     1 
ATOM   1300  C  CA    . ILE A 1 700  ? 157.787 132.827 132.116 1.00 13.07  ?  572  ILE A CA    1 
ATOM   1301  C  C     . ILE A 1 700  ? 157.931 134.081 131.271 1.00 23.28  ?  572  ILE A C     1 
ATOM   1302  O  O     . ILE A 1 700  ? 157.547 135.178 131.696 1.00 11.08  ?  572  ILE A O     1 
ATOM   1303  C  CB    . ILE A 1 700  ? 156.377 132.233 131.942 1.00 7.51   ?  572  ILE A CB    1 
ATOM   1304  C  CG1   . ILE A 1 700  ? 156.060 131.247 133.060 1.00 22.17  ?  572  ILE A CG1   1 
ATOM   1305  C  CG2   . ILE A 1 700  ? 156.252 131.526 130.602 1.00 6.83   ?  572  ILE A CG2   1 
ATOM   1306  C  CD1   . ILE A 1 700  ? 154.677 130.627 132.951 1.00 35.06  ?  572  ILE A CD1   1 
ATOM   1307  N  N     . SER A 1 701  ? 158.443 133.914 130.054 1.00 13.20  ?  573  SER A N     1 
ATOM   1308  C  CA    . SER A 1 701  ? 158.760 135.028 129.175 1.00 12.94  ?  573  SER A CA    1 
ATOM   1309  C  C     . SER A 1 701  ? 159.165 134.486 127.809 1.00 15.56  ?  573  SER A C     1 
ATOM   1310  O  O     . SER A 1 701  ? 159.706 133.383 127.695 1.00 18.09  ?  573  SER A O     1 
ATOM   1311  C  CB    . SER A 1 701  ? 159.884 135.894 129.762 1.00 20.48  ?  573  SER A CB    1 
ATOM   1312  O  OG    . SER A 1 701  ? 161.113 135.192 129.790 1.00 26.40  ?  573  SER A OG    1 
ATOM   1313  N  N     . ARG A 1 702  ? 158.890 135.278 126.778 1.00 17.91  ?  574  ARG A N     1 
ATOM   1314  C  CA    . ARG A 1 702  ? 159.317 134.951 125.427 1.00 18.04  ?  574  ARG A CA    1 
ATOM   1315  C  C     . ARG A 1 702  ? 159.669 136.233 124.695 1.00 18.60  ?  574  ARG A C     1 
ATOM   1316  O  O     . ARG A 1 702  ? 159.139 137.308 124.989 1.00 27.99  ?  574  ARG A O     1 
ATOM   1317  C  CB    . ARG A 1 702  ? 158.253 134.199 124.634 1.00 20.03  ?  574  ARG A CB    1 
ATOM   1318  C  CG    . ARG A 1 702  ? 157.910 132.849 125.197 1.00 18.85  ?  574  ARG A CG    1 
ATOM   1319  C  CD    . ARG A 1 702  ? 158.975 131.823 124.894 1.00 18.76  ?  574  ARG A CD    1 
ATOM   1320  N  NE    . ARG A 1 702  ? 158.408 130.487 124.986 1.00 19.02  ?  574  ARG A NE    1 
ATOM   1321  C  CZ    . ARG A 1 702  ? 158.420 129.758 126.095 1.00 19.92  ?  574  ARG A CZ    1 
ATOM   1322  N  NH1   . ARG A 1 702  ? 158.967 130.242 127.203 1.00 19.33  ?  574  ARG A NH1   1 
ATOM   1323  N  NH2   . ARG A 1 702  ? 157.875 128.550 126.102 1.00 27.12  ?  574  ARG A NH2   1 
ATOM   1324  N  N     . ARG A 1 703  ? 160.552 136.101 123.716 1.00 7.86   ?  575  ARG A N     1 
ATOM   1325  C  CA    . ARG A 1 703  ? 161.079 137.262 123.029 1.00 11.47  ?  575  ARG A CA    1 
ATOM   1326  C  C     . ARG A 1 703  ? 161.861 136.801 121.815 1.00 18.67  ?  575  ARG A C     1 
ATOM   1327  O  O     . ARG A 1 703  ? 162.190 135.622 121.667 1.00 17.23  ?  575  ARG A O     1 
ATOM   1328  C  CB    . ARG A 1 703  ? 161.969 138.095 123.950 1.00 9.77   ?  575  ARG A CB    1 
ATOM   1329  C  CG    . ARG A 1 703  ? 163.361 137.525 124.152 1.00 7.52   ?  575  ARG A CG    1 
ATOM   1330  C  CD    . ARG A 1 703  ? 164.256 138.493 124.907 1.00 10.41  ?  575  ARG A CD    1 
ATOM   1331  N  NE    . ARG A 1 703  ? 165.595 137.956 125.107 1.00 7.25   ?  575  ARG A NE    1 
ATOM   1332  C  CZ    . ARG A 1 703  ? 166.447 137.691 124.124 1.00 19.09  ?  575  ARG A CZ    1 
ATOM   1333  N  NH1   . ARG A 1 703  ? 166.114 137.938 122.865 1.00 19.44  ?  575  ARG A NH1   1 
ATOM   1334  N  NH2   . ARG A 1 703  ? 167.646 137.194 124.402 1.00 17.95  ?  575  ARG A NH2   1 
ATOM   1335  N  N     . PHE A 1 704  ? 162.137 137.754 120.944 1.00 15.64  ?  576  PHE A N     1 
ATOM   1336  C  CA    . PHE A 1 704  ? 163.017 137.539 119.816 1.00 9.64   ?  576  PHE A CA    1 
ATOM   1337  C  C     . PHE A 1 704  ? 164.444 137.906 120.210 1.00 9.68   ?  576  PHE A C     1 
ATOM   1338  O  O     . PHE A 1 704  ? 164.763 138.117 121.384 1.00 13.09  ?  576  PHE A O     1 
ATOM   1339  C  CB    . PHE A 1 704  ? 162.560 138.360 118.620 1.00 17.19  ?  576  PHE A CB    1 
ATOM   1340  C  CG    . PHE A 1 704  ? 161.220 137.970 118.081 1.00 14.49  ?  576  PHE A CG    1 
ATOM   1341  C  CD1   . PHE A 1 704  ? 160.734 136.692 118.252 1.00 23.72  ?  576  PHE A CD1   1 
ATOM   1342  C  CD2   . PHE A 1 704  ? 160.450 138.874 117.381 1.00 40.66  ?  576  PHE A CD2   1 
ATOM   1343  C  CE1   . PHE A 1 704  ? 159.511 136.343 117.737 1.00 28.26  ?  576  PHE A CE1   1 
ATOM   1344  C  CE2   . PHE A 1 704  ? 159.217 138.516 116.872 1.00 49.76  ?  576  PHE A CE2   1 
ATOM   1345  C  CZ    . PHE A 1 704  ? 158.758 137.254 117.053 1.00 40.24  ?  576  PHE A CZ    1 
ATOM   1346  N  N     . ARG A 1 705  ? 165.318 137.968 119.219 1.00 11.01  ?  577  ARG A N     1 
ATOM   1347  C  CA    . ARG A 1 705  ? 166.562 138.697 119.356 1.00 10.48  ?  577  ARG A CA    1 
ATOM   1348  C  C     . ARG A 1 705  ? 166.390 140.059 118.702 1.00 10.57  ?  577  ARG A C     1 
ATOM   1349  O  O     . ARG A 1 705  ? 165.720 140.186 117.672 1.00 14.32  ?  577  ARG A O     1 
ATOM   1350  C  CB    . ARG A 1 705  ? 167.736 137.940 118.728 1.00 21.61  ?  577  ARG A CB    1 
ATOM   1351  C  CG    . ARG A 1 705  ? 167.806 136.447 119.078 1.00 16.76  ?  577  ARG A CG    1 
ATOM   1352  C  CD    . ARG A 1 705  ? 169.143 135.835 118.654 1.00 13.15  ?  577  ARG A CD    1 
ATOM   1353  N  NE    . ARG A 1 705  ? 169.828 136.640 117.653 1.00 14.28  ?  577  ARG A NE    1 
ATOM   1354  C  CZ    . ARG A 1 705  ? 171.149 136.708 117.520 1.00 20.89  ?  577  ARG A CZ    1 
ATOM   1355  N  NH1   . ARG A 1 705  ? 171.949 136.027 118.331 1.00 26.04  ?  577  ARG A NH1   1 
ATOM   1356  N  NH2   . ARG A 1 705  ? 171.674 137.476 116.576 1.00 42.83  ?  577  ARG A NH2   1 
ATOM   1357  N  N     . TYR A 1 706  ? 166.979 141.077 119.324 1.00 8.44   ?  578  TYR A N     1 
ATOM   1358  C  CA    . TYR A 1 706  ? 166.891 142.450 118.856 1.00 10.21  ?  578  TYR A CA    1 
ATOM   1359  C  C     . TYR A 1 706  ? 167.219 142.570 117.374 1.00 13.02  ?  578  TYR A C     1 
ATOM   1360  O  O     . TYR A 1 706  ? 166.393 143.027 116.578 1.00 16.79  ?  578  TYR A O     1 
ATOM   1361  C  CB    . TYR A 1 706  ? 167.843 143.330 119.661 1.00 27.26  ?  578  TYR A CB    1 
ATOM   1362  C  CG    . TYR A 1 706  ? 167.234 144.652 120.030 1.00 48.33  ?  578  TYR A CG    1 
ATOM   1363  C  CD1   . TYR A 1 706  ? 166.074 144.707 120.779 1.00 46.61  ?  578  TYR A CD1   1 
ATOM   1364  C  CD2   . TYR A 1 706  ? 167.806 145.842 119.623 1.00 55.40  ?  578  TYR A CD2   1 
ATOM   1365  C  CE1   . TYR A 1 706  ? 165.497 145.908 121.113 1.00 44.02  ?  578  TYR A CE1   1 
ATOM   1366  C  CE2   . TYR A 1 706  ? 167.238 147.053 119.956 1.00 69.38  ?  578  TYR A CE2   1 
ATOM   1367  C  CZ    . TYR A 1 706  ? 166.083 147.080 120.701 1.00 59.99  ?  578  TYR A CZ    1 
ATOM   1368  O  OH    . TYR A 1 706  ? 165.515 148.287 121.032 1.00 70.54  ?  578  TYR A OH    1 
ATOM   1369  N  N     . ASP A 1 707  ? 168.434 142.149 117.014 1.00 16.15  ?  579  ASP A N     1 
ATOM   1370  C  CA    . ASP A 1 707  ? 168.935 142.328 115.658 1.00 29.05  ?  579  ASP A CA    1 
ATOM   1371  C  C     . ASP A 1 707  ? 168.058 141.628 114.624 1.00 38.59  ?  579  ASP A C     1 
ATOM   1372  O  O     . ASP A 1 707  ? 167.844 142.156 113.524 1.00 47.04  ?  579  ASP A O     1 
ATOM   1373  C  CB    . ASP A 1 707  ? 170.384 141.835 115.568 1.00 51.57  ?  579  ASP A CB    1 
ATOM   1374  C  CG    . ASP A 1 707  ? 170.526 140.346 115.862 1.00 67.80  ?  579  ASP A CG    1 
ATOM   1375  O  OD1   . ASP A 1 707  ? 169.637 139.772 116.521 1.00 45.21  ?  579  ASP A OD1   1 
ATOM   1376  O  OD2   . ASP A 1 707  ? 171.528 139.742 115.419 1.00 253.56 -1 579  ASP A OD2   1 
ATOM   1377  N  N     . VAL A 1 708  ? 167.554 140.437 114.943 1.00 27.62  ?  580  VAL A N     1 
ATOM   1378  C  CA    . VAL A 1 708  ? 166.760 139.707 113.962 1.00 29.90  ?  580  VAL A CA    1 
ATOM   1379  C  C     . VAL A 1 708  ? 165.446 140.437 113.705 1.00 19.98  ?  580  VAL A C     1 
ATOM   1380  O  O     . VAL A 1 708  ? 165.008 140.586 112.557 1.00 19.17  ?  580  VAL A O     1 
ATOM   1381  C  CB    . VAL A 1 708  ? 166.539 138.257 114.433 1.00 32.32  ?  580  VAL A CB    1 
ATOM   1382  C  CG1   . VAL A 1 708  ? 166.074 137.397 113.287 1.00 34.21  ?  580  VAL A CG1   1 
ATOM   1383  C  CG2   . VAL A 1 708  ? 167.817 137.674 115.031 1.00 33.05  ?  580  VAL A CG2   1 
ATOM   1384  N  N     . ALA A 1 709  ? 164.815 140.932 114.771 1.00 12.67  ?  581  ALA A N     1 
ATOM   1385  C  CA    . ALA A 1 709  ? 163.611 141.744 114.622 1.00 16.19  ?  581  ALA A CA    1 
ATOM   1386  C  C     . ALA A 1 709  ? 163.899 143.006 113.823 1.00 22.67  ?  581  ALA A C     1 
ATOM   1387  O  O     . ALA A 1 709  ? 163.061 143.471 113.041 1.00 17.99  ?  581  ALA A O     1 
ATOM   1388  C  CB    . ALA A 1 709  ? 163.052 142.099 115.999 1.00 36.63  ?  581  ALA A CB    1 
ATOM   1389  N  N     . LEU A 1 710  ? 165.083 143.579 114.020 1.00 15.76  ?  582  LEU A N     1 
ATOM   1390  C  CA    . LEU A 1 710  ? 165.443 144.795 113.308 1.00 14.44  ?  582  LEU A CA    1 
ATOM   1391  C  C     . LEU A 1 710  ? 165.561 144.530 111.812 1.00 16.97  ?  582  LEU A C     1 
ATOM   1392  O  O     . LEU A 1 710  ? 165.023 145.284 110.993 1.00 18.03  ?  582  LEU A O     1 
ATOM   1393  C  CB    . LEU A 1 710  ? 166.747 145.343 113.876 1.00 19.80  ?  582  LEU A CB    1 
ATOM   1394  C  CG    . LEU A 1 710  ? 166.554 146.299 115.046 1.00 16.99  ?  582  LEU A CG    1 
ATOM   1395  C  CD1   . LEU A 1 710  ? 167.867 146.971 115.414 1.00 33.44  ?  582  LEU A CD1   1 
ATOM   1396  C  CD2   . LEU A 1 710  ? 165.506 147.315 114.674 1.00 14.76  ?  582  LEU A CD2   1 
ATOM   1397  N  N     . VAL A 1 711  ? 166.279 143.465 111.435 1.00 17.84  ?  583  VAL A N     1 
ATOM   1398  C  CA    . VAL A 1 711  ? 166.428 143.150 110.016 1.00 23.44  ?  583  VAL A CA    1 
ATOM   1399  C  C     . VAL A 1 711  ? 165.074 142.808 109.414 1.00 32.63  ?  583  VAL A C     1 
ATOM   1400  O  O     . VAL A 1 711  ? 164.793 143.138 108.256 1.00 39.82  ?  583  VAL A O     1 
ATOM   1401  C  CB    . VAL A 1 711  ? 167.461 142.025 109.779 1.00 31.43  ?  583  VAL A CB    1 
ATOM   1402  C  CG1   . VAL A 1 711  ? 168.814 142.383 110.380 1.00 71.07  ?  583  VAL A CG1   1 
ATOM   1403  C  CG2   . VAL A 1 711  ? 166.975 140.663 110.262 1.00 25.30  ?  583  VAL A CG2   1 
ATOM   1404  N  N     . SER A 1 712  ? 164.200 142.175 110.200 1.00 21.79  ?  584  SER A N     1 
ATOM   1405  C  CA    . SER A 1 712  ? 162.851 141.896 109.720 1.00 20.80  ?  584  SER A CA    1 
ATOM   1406  C  C     . SER A 1 712  ? 162.103 143.195 109.415 1.00 23.43  ?  584  SER A C     1 
ATOM   1407  O  O     . SER A 1 712  ? 161.549 143.369 108.325 1.00 25.14  ?  584  SER A O     1 
ATOM   1408  C  CB    . SER A 1 712  ? 162.111 141.053 110.758 1.00 16.76  ?  584  SER A CB    1 
ATOM   1409  O  OG    . SER A 1 712  ? 161.153 140.196 110.161 1.00 23.10  ?  584  SER A OG    1 
ATOM   1410  N  N     . ALA A 1 713  ? 162.092 144.128 110.372 1.00 24.24  ?  585  ALA A N     1 
ATOM   1411  C  CA    . ALA A 1 713  ? 161.371 145.389 110.197 1.00 19.08  ?  585  ALA A CA    1 
ATOM   1412  C  C     . ALA A 1 713  ? 161.932 146.197 109.037 1.00 19.18  ?  585  ALA A C     1 
ATOM   1413  O  O     . ALA A 1 713  ? 161.189 146.856 108.293 1.00 29.58  ?  585  ALA A O     1 
ATOM   1414  C  CB    . ALA A 1 713  ? 161.441 146.208 111.483 1.00 18.26  ?  585  ALA A CB    1 
ATOM   1415  N  N     . LEU A 1 714  ? 163.247 146.175 108.871 1.00 17.03  ?  586  LEU A N     1 
ATOM   1416  C  CA    . LEU A 1 714  ? 163.836 146.970 107.810 1.00 20.57  ?  586  LEU A CA    1 
ATOM   1417  C  C     . LEU A 1 714  ? 163.545 146.348 106.441 1.00 43.56  ?  586  LEU A C     1 
ATOM   1418  O  O     . LEU A 1 714  ? 163.205 147.065 105.489 1.00 63.06  ?  586  LEU A O     1 
ATOM   1419  C  CB    . LEU A 1 714  ? 165.334 147.136 108.065 1.00 36.94  ?  586  LEU A CB    1 
ATOM   1420  C  CG    . LEU A 1 714  ? 165.932 148.482 107.648 1.00 54.95  ?  586  LEU A CG    1 
ATOM   1421  C  CD1   . LEU A 1 714  ? 165.053 149.634 108.132 1.00 26.52  ?  586  LEU A CD1   1 
ATOM   1422  C  CD2   . LEU A 1 714  ? 167.382 148.651 108.107 1.00 55.62  ?  586  LEU A CD2   1 
ATOM   1423  N  N     . LYS A 1 715  ? 163.657 145.017 106.314 1.00 38.83  ?  587  LYS A N     1 
ATOM   1424  C  CA    . LYS A 1 715  ? 163.260 144.383 105.059 1.00 41.64  ?  587  LYS A CA    1 
ATOM   1425  C  C     . LYS A 1 715  ? 161.763 144.513 104.827 1.00 42.74  ?  587  LYS A C     1 
ATOM   1426  O  O     . LYS A 1 715  ? 161.296 144.369 103.693 1.00 59.61  ?  587  LYS A O     1 
ATOM   1427  C  CB    . LYS A 1 715  ? 163.718 142.909 105.015 1.00 32.58  ?  587  LYS A CB    1 
ATOM   1428  C  CG    . LYS A 1 715  ? 163.427 142.191 103.677 1.00 37.75  ?  587  LYS A CG    1 
ATOM   1429  C  CD    . LYS A 1 715  ? 164.542 141.232 103.245 1.00 37.58  ?  587  LYS A CD    1 
ATOM   1430  C  CE    . LYS A 1 715  ? 165.907 141.890 103.309 1.00 54.28  ?  587  LYS A CE    1 
ATOM   1431  N  NZ    . LYS A 1 715  ? 165.932 143.244 102.672 1.00 55.43  ?  587  LYS A NZ    1 
ATOM   1432  N  N     . ASP A 1 716  ? 161.002 144.786 105.880 1.00 31.32  ?  588  ASP A N     1 
ATOM   1433  C  CA    . ASP A 1 716  ? 159.599 145.144 105.712 1.00 39.06  ?  588  ASP A CA    1 
ATOM   1434  C  C     . ASP A 1 716  ? 159.457 146.503 105.031 1.00 32.67  ?  588  ASP A C     1 
ATOM   1435  O  O     . ASP A 1 716  ? 158.709 146.654 104.059 1.00 38.86  ?  588  ASP A O     1 
ATOM   1436  C  CB    . ASP A 1 716  ? 158.918 145.142 107.074 1.00 39.86  ?  588  ASP A CB    1 
ATOM   1437  C  CG    . ASP A 1 716  ? 157.463 144.804 106.983 1.00 79.42  ?  588  ASP A CG    1 
ATOM   1438  O  OD1   . ASP A 1 716  ? 156.860 145.065 105.919 1.00 81.31  ?  588  ASP A OD1   1 
ATOM   1439  O  OD2   . ASP A 1 716  ? 156.922 144.272 107.970 1.00 307.99 -1 588  ASP A OD2   1 
ATOM   1440  N  N     . LEU A 1 717  ? 160.170 147.506 105.534 1.00 32.95  ?  589  LEU A N     1 
ATOM   1441  C  CA    . LEU A 1 717  ? 160.019 148.875 105.044 1.00 36.59  ?  589  LEU A CA    1 
ATOM   1442  C  C     . LEU A 1 717  ? 160.862 149.190 103.807 1.00 69.02  ?  589  LEU A C     1 
ATOM   1443  O  O     . LEU A 1 717  ? 160.889 150.355 103.374 1.00 91.38  ?  589  LEU A O     1 
ATOM   1444  C  CB    . LEU A 1 717  ? 160.363 149.866 106.160 1.00 34.84  ?  589  LEU A CB    1 
ATOM   1445  C  CG    . LEU A 1 717  ? 159.163 150.439 106.913 1.00 37.79  ?  589  LEU A CG    1 
ATOM   1446  C  CD1   . LEU A 1 717  ? 158.291 149.337 107.484 1.00 29.92  ?  589  LEU A CD1   1 
ATOM   1447  C  CD2   . LEU A 1 717  ? 159.636 151.382 108.003 1.00 39.68  ?  589  LEU A CD2   1 
ATOM   1448  N  N     . GLU A 1 718  ? 161.569 148.196 103.256 1.00 82.14  ?  590  GLU A N     1 
ATOM   1449  C  CA    . GLU A 1 718  ? 162.384 148.434 102.064 1.00 104.15 ?  590  GLU A CA    1 
ATOM   1450  C  C     . GLU A 1 718  ? 161.575 149.062 100.933 1.00 108.85 ?  590  GLU A C     1 
ATOM   1451  O  O     . GLU A 1 718  ? 162.105 149.848 100.138 1.00 101.47 ?  590  GLU A O     1 
ATOM   1452  C  CB    . GLU A 1 718  ? 163.037 147.133 101.590 1.00 105.95 ?  590  GLU A CB    1 
ATOM   1453  C  CG    . GLU A 1 718  ? 162.131 145.985 101.159 1.00 117.60 ?  590  GLU A CG    1 
ATOM   1454  C  CD    . GLU A 1 718  ? 161.518 146.188 99.780  1.00 166.68 ?  590  GLU A CD    1 
ATOM   1455  O  OE1   . GLU A 1 718  ? 160.275 146.221 99.673  1.00 146.21 ?  590  GLU A OE1   1 
ATOM   1456  O  OE2   . GLU A 1 718  ? 162.291 146.348 98.815  1.00 332.02 -1 590  GLU A OE2   1 
ATOM   1457  N  N     . GLU A 1 719  ? 160.288 148.722 100.836 1.00 110.99 ?  591  GLU A N     1 
ATOM   1458  C  CA    . GLU A 1 719  ? 159.454 149.294 99.785  1.00 130.88 ?  591  GLU A CA    1 
ATOM   1459  C  C     . GLU A 1 719  ? 159.379 150.806 99.929  1.00 114.31 ?  591  GLU A C     1 
ATOM   1460  O  O     . GLU A 1 719  ? 159.589 151.551 98.963  1.00 113.79 ?  591  GLU A O     1 
ATOM   1461  C  CB    . GLU A 1 719  ? 158.057 148.666 99.831  1.00 146.38 ?  591  GLU A CB    1 
ATOM   1462  C  CG    . GLU A 1 719  ? 157.246 148.845 98.552  1.00 185.16 ?  591  GLU A CG    1 
ATOM   1463  C  CD    . GLU A 1 719  ? 156.509 150.172 98.475  1.00 203.77 ?  591  GLU A CD    1 
ATOM   1464  O  OE1   . GLU A 1 719  ? 156.571 150.963 99.435  1.00 167.34 ?  591  GLU A OE1   1 
ATOM   1465  O  OE2   . GLU A 1 719  ? 155.886 150.438 97.426  1.00 361.32 -1 591  GLU A OE2   1 
ATOM   1466  N  N     . ASP A 1 720  ? 159.080 151.274 101.141 1.00 94.82  ?  592  ASP A N     1 
ATOM   1467  C  CA    . ASP A 1 720  ? 158.974 152.704 101.379 1.00 88.69  ?  592  ASP A CA    1 
ATOM   1468  C  C     . ASP A 1 720  ? 160.320 153.401 101.224 1.00 81.27  ?  592  ASP A C     1 
ATOM   1469  O  O     . ASP A 1 720  ? 160.372 154.539 100.742 1.00 89.08  ?  592  ASP A O     1 
ATOM   1470  C  CB    . ASP A 1 720  ? 158.389 152.953 102.772 1.00 110.54 ?  592  ASP A CB    1 
ATOM   1471  C  CG    . ASP A 1 720  ? 156.953 152.459 102.906 1.00 162.28 ?  592  ASP A CG    1 
ATOM   1472  O  OD1   . ASP A 1 720  ? 156.491 151.696 102.031 1.00 154.02 ?  592  ASP A OD1   1 
ATOM   1473  O  OD2   . ASP A 1 720  ? 156.284 152.821 103.896 1.00 302.38 -1 592  ASP A OD2   1 
ATOM   1474  N  N     . ILE A 1 721  ? 161.422 152.748 101.603 1.00 88.53  ?  593  ILE A N     1 
ATOM   1475  C  CA    . ILE A 1 721  ? 162.708 153.431 101.443 1.00 91.88  ?  593  ILE A CA    1 
ATOM   1476  C  C     . ILE A 1 721  ? 163.061 153.545 99.963  1.00 98.80  ?  593  ILE A C     1 
ATOM   1477  O  O     . ILE A 1 721  ? 163.638 154.548 99.517  1.00 109.08 ?  593  ILE A O     1 
ATOM   1478  C  CB    . ILE A 1 721  ? 163.836 152.751 102.246 1.00 95.18  ?  593  ILE A CB    1 
ATOM   1479  C  CG1   . ILE A 1 721  ? 164.306 151.459 101.574 1.00 104.04 ?  593  ILE A CG1   1 
ATOM   1480  C  CG2   . ILE A 1 721  ? 163.400 152.505 103.689 1.00 98.18  ?  593  ILE A CG2   1 
ATOM   1481  C  CD1   . ILE A 1 721  ? 165.268 150.622 102.398 1.00 124.00 ?  593  ILE A CD1   1 
ATOM   1482  N  N     . MET A 1 722  ? 162.685 152.540 99.164  1.00 87.95  ?  594  MET A N     1 
ATOM   1483  C  CA    . MET A 1 722  ? 162.969 152.605 97.734  1.00 94.66  ?  594  MET A CA    1 
ATOM   1484  C  C     . MET A 1 722  ? 162.073 153.645 97.063  1.00 117.50 ?  594  MET A C     1 
ATOM   1485  O  O     . MET A 1 722  ? 162.504 154.360 96.148  1.00 144.62 ?  594  MET A O     1 
ATOM   1486  C  CB    . MET A 1 722  ? 162.775 151.223 97.108  1.00 64.21  ?  594  MET A CB    1 
ATOM   1487  C  CG    . MET A 1 722  ? 163.477 151.014 95.773  1.00 83.12  ?  594  MET A CG    1 
ATOM   1488  S  SD    . MET A 1 722  ? 165.249 151.404 95.800  1.00 98.79  ?  594  MET A SD    1 
ATOM   1489  C  CE    . MET A 1 722  ? 165.850 150.330 97.103  1.00 43.10  ?  594  MET A CE    1 
ATOM   1490  N  N     . GLU A 1 723  ? 160.828 153.767 97.530  1.00 107.57 ?  595  GLU A N     1 
ATOM   1491  C  CA    . GLU A 1 723  ? 159.947 154.812 97.015  1.00 115.33 ?  595  GLU A CA    1 
ATOM   1492  C  C     . GLU A 1 723  ? 160.466 156.199 97.378  1.00 116.72 ?  595  GLU A C     1 
ATOM   1493  O  O     . GLU A 1 723  ? 160.332 157.145 96.593  1.00 128.68 ?  595  GLU A O     1 
ATOM   1494  C  CB    . GLU A 1 723  ? 158.523 154.612 97.541  1.00 141.53 ?  595  GLU A CB    1 
ATOM   1495  C  CG    . GLU A 1 723  ? 157.817 155.917 97.877  1.00 142.04 ?  595  GLU A CG    1 
ATOM   1496  C  CD    . GLU A 1 723  ? 157.316 156.654 96.650  1.00 169.39 ?  595  GLU A CD    1 
ATOM   1497  O  OE1   . GLU A 1 723  ? 157.628 156.231 95.515  1.00 153.57 ?  595  GLU A OE1   1 
ATOM   1498  O  OE2   . GLU A 1 723  ? 156.666 157.704 96.828  1.00 269.91 -1 595  GLU A OE2   1 
ATOM   1499  N  N     . GLY A 1 724  ? 161.051 156.344 98.570  1.00 107.01 ?  596  GLY A N     1 
ATOM   1500  C  CA    . GLY A 1 724  ? 161.635 157.621 98.940  1.00 102.60 ?  596  GLY A CA    1 
ATOM   1501  C  C     . GLY A 1 724  ? 162.850 157.971 98.103  1.00 107.48 ?  596  GLY A C     1 
ATOM   1502  O  O     . GLY A 1 724  ? 163.056 159.134 97.748  1.00 113.95 ?  596  GLY A O     1 
ATOM   1503  N  N     . LEU A 1 725  ? 163.679 156.969 97.788  1.00 105.21 ?  597  LEU A N     1 
ATOM   1504  C  CA    . LEU A 1 725  ? 164.774 157.191 96.845  1.00 104.29 ?  597  LEU A CA    1 
ATOM   1505  C  C     . LEU A 1 725  ? 164.251 157.540 95.453  1.00 114.87 ?  597  LEU A C     1 
ATOM   1506  O  O     . LEU A 1 725  ? 164.939 158.229 94.687  1.00 107.98 ?  597  LEU A O     1 
ATOM   1507  C  CB    . LEU A 1 725  ? 165.681 155.961 96.780  1.00 114.46 ?  597  LEU A CB    1 
ATOM   1508  C  CG    . LEU A 1 725  ? 166.394 155.531 98.067  1.00 110.34 ?  597  LEU A CG    1 
ATOM   1509  C  CD1   . LEU A 1 725  ? 167.465 154.470 97.805  1.00 129.41 ?  597  LEU A CD1   1 
ATOM   1510  C  CD2   . LEU A 1 725  ? 167.009 156.740 98.750  1.00 94.44  ?  597  LEU A CD2   1 
ATOM   1511  N  N     . ARG A 1 726  ? 163.058 157.055 95.100  1.00 134.53 ?  598  ARG A N     1 
ATOM   1512  C  CA    . ARG A 1 726  ? 162.420 157.481 93.854  1.00 134.56 ?  598  ARG A CA    1 
ATOM   1513  C  C     . ARG A 1 726  ? 162.020 158.952 93.915  1.00 127.88 ?  598  ARG A C     1 
ATOM   1514  O  O     . ARG A 1 726  ? 162.358 159.738 93.022  1.00 136.57 ?  598  ARG A O     1 
ATOM   1515  C  CB    . ARG A 1 726  ? 161.197 156.609 93.550  1.00 113.06 ?  598  ARG A CB    1 
ATOM   1516  C  CG    . ARG A 1 726  ? 161.534 155.231 93.017  1.00 126.50 ?  598  ARG A CG    1 
ATOM   1517  C  CD    . ARG A 1 726  ? 162.852 155.275 92.268  1.00 168.56 ?  598  ARG A CD    1 
ATOM   1518  N  NE    . ARG A 1 726  ? 163.887 154.562 93.008  1.00 202.19 ?  598  ARG A NE    1 
ATOM   1519  C  CZ    . ARG A 1 726  ? 165.145 154.980 93.134  1.00 206.34 ?  598  ARG A CZ    1 
ATOM   1520  N  NH1   . ARG A 1 726  ? 165.538 156.121 92.584  1.00 164.01 ?  598  ARG A NH1   1 
ATOM   1521  N  NH2   . ARG A 1 726  ? 166.007 154.255 93.835  1.00 231.51 ?  598  ARG A NH2   1 
ATOM   1522  N  N     . GLU A 1 727  ? 161.286 159.335 94.961  1.00 124.91 ?  599  GLU A N     1 
ATOM   1523  C  CA    . GLU A 1 727  ? 160.844 160.718 95.106  1.00 115.52 ?  599  GLU A CA    1 
ATOM   1524  C  C     . GLU A 1 727  ? 162.037 161.661 95.200  1.00 115.14 ?  599  GLU A C     1 
ATOM   1525  O  O     . GLU A 1 727  ? 162.168 162.600 94.408  1.00 117.59 ?  599  GLU A O     1 
ATOM   1526  C  CB    . GLU A 1 727  ? 159.929 160.849 96.332  1.00 119.88 ?  599  GLU A CB    1 
ATOM   1527  C  CG    . GLU A 1 727  ? 159.240 162.207 96.470  1.00 143.35 ?  599  GLU A CG    1 
ATOM   1528  C  CD    . GLU A 1 727  ? 160.174 163.314 96.929  1.00 174.63 ?  599  GLU A CD    1 
ATOM   1529  O  OE1   . GLU A 1 727  ? 161.112 163.028 97.700  1.00 150.12 ?  599  GLU A OE1   1 
ATOM   1530  O  OE2   . GLU A 1 727  ? 159.991 164.464 96.478  1.00 304.09 -1 599  GLU A OE2   1 
ATOM   1531  N  N     . ARG A 1 728  ? 162.916 161.432 96.179  1.00 117.46 ?  600  ARG A N     1 
ATOM   1532  C  CA    . ARG A 1 728  ? 164.106 162.259 96.341  1.00 108.70 ?  600  ARG A CA    1 
ATOM   1533  C  C     . ARG A 1 728  ? 164.999 162.244 95.107  1.00 109.03 ?  600  ARG A C     1 
ATOM   1534  O  O     . ARG A 1 728  ? 165.880 163.104 94.988  1.00 105.45 ?  600  ARG A O     1 
ATOM   1535  C  CB    . ARG A 1 728  ? 164.898 161.791 97.572  1.00 105.91 ?  600  ARG A CB    1 
ATOM   1536  C  CG    . ARG A 1 728  ? 166.023 162.725 98.004  1.00 106.11 ?  600  ARG A CG    1 
ATOM   1537  C  CD    . ARG A 1 728  ? 165.519 164.146 98.213  1.00 115.49 ?  600  ARG A CD    1 
ATOM   1538  N  NE    . ARG A 1 728  ? 164.428 164.218 99.181  1.00 123.80 ?  600  ARG A NE    1 
ATOM   1539  C  CZ    . ARG A 1 728  ? 164.144 165.293 99.912  1.00 119.18 ?  600  ARG A CZ    1 
ATOM   1540  N  NH1   . ARG A 1 728  ? 164.859 166.402 99.775  1.00 131.34 ?  600  ARG A NH1   1 
ATOM   1541  N  NH2   . ARG A 1 728  ? 163.132 165.267 100.770 1.00 94.64  ?  600  ARG A NH2   1 
ATOM   1542  N  N     . ALA A 1 729  ? 164.782 161.303 94.187  1.00 118.70 ?  601  ALA A N     1 
ATOM   1543  C  CA    . ALA A 1 729  ? 165.509 161.207 92.924  1.00 130.23 ?  601  ALA A CA    1 
ATOM   1544  C  C     . ALA A 1 729  ? 167.007 161.061 93.131  1.00 112.97 ?  601  ALA A C     1 
ATOM   1545  O  O     . ALA A 1 729  ? 167.796 161.391 92.241  1.00 121.58 ?  601  ALA A O     1 
ATOM   1546  C  CB    . ALA A 1 729  ? 165.215 162.408 92.018  1.00 144.04 ?  601  ALA A CB    1 
ATOM   1547  N  N     . LEU A 1 730  ? 167.412 160.577 94.298  1.00 108.50 ?  602  LEU A N     1 
ATOM   1548  C  CA    . LEU A 1 730  ? 168.824 160.396 94.561  1.00 124.07 ?  602  LEU A CA    1 
ATOM   1549  C  C     . LEU A 1 730  ? 169.364 159.254 93.705  1.00 128.33 ?  602  LEU A C     1 
ATOM   1550  O  O     . LEU A 1 730  ? 168.614 158.435 93.163  1.00 108.23 ?  602  LEU A O     1 
ATOM   1551  C  CB    . LEU A 1 730  ? 169.057 160.116 96.046  1.00 122.15 ?  602  LEU A CB    1 
ATOM   1552  C  CG    . LEU A 1 730  ? 170.450 160.442 96.589  1.00 157.00 ?  602  LEU A CG    1 
ATOM   1553  C  CD1   . LEU A 1 730  ? 170.782 161.918 96.392  1.00 150.59 ?  602  LEU A CD1   1 
ATOM   1554  C  CD2   . LEU A 1 730  ? 170.601 160.036 98.052  1.00 161.31 ?  602  LEU A CD2   1 
ATOM   1555  N  N     . ASP A 1 731  ? 170.689 159.219 93.575  1.00 173.90 ?  603  ASP A N     1 
ATOM   1556  C  CA    . ASP A 1 731  ? 171.366 158.143 92.863  1.00 183.47 ?  603  ASP A CA    1 
ATOM   1557  C  C     . ASP A 1 731  ? 171.006 156.801 93.484  1.00 147.00 ?  603  ASP A C     1 
ATOM   1558  O  O     . ASP A 1 731  ? 170.466 156.751 94.594  1.00 136.96 ?  603  ASP A O     1 
ATOM   1559  C  CB    . ASP A 1 731  ? 172.884 158.336 92.887  1.00 226.31 ?  603  ASP A CB    1 
ATOM   1560  C  CG    . ASP A 1 731  ? 173.301 159.759 92.564  1.00 281.03 ?  603  ASP A CG    1 
ATOM   1561  O  OD1   . ASP A 1 731  ? 172.564 160.456 91.835  1.00 261.29 ?  603  ASP A OD1   1 
ATOM   1562  O  OD2   . ASP A 1 731  ? 174.371 160.181 93.051  1.00 450.25 -1 603  ASP A OD2   1 
ATOM   1563  N  N     . ASP A 1 732  ? 171.285 155.713 92.771  1.00 141.55 ?  604  ASP A N     1 
ATOM   1564  C  CA    . ASP A 1 732  ? 171.038 154.372 93.282  1.00 138.17 ?  604  ASP A CA    1 
ATOM   1565  C  C     . ASP A 1 732  ? 172.319 153.579 93.477  1.00 157.21 ?  604  ASP A C     1 
ATOM   1566  O  O     . ASP A 1 732  ? 172.508 152.963 94.534  1.00 154.20 ?  604  ASP A O     1 
ATOM   1567  C  CB    . ASP A 1 732  ? 170.090 153.616 92.346  1.00 157.57 ?  604  ASP A CB    1 
ATOM   1568  C  CG    . ASP A 1 732  ? 168.684 154.160 92.389  1.00 184.97 ?  604  ASP A CG    1 
ATOM   1569  O  OD1   . ASP A 1 732  ? 168.485 155.299 92.866  1.00 141.07 ?  604  ASP A OD1   1 
ATOM   1570  O  OD2   . ASP A 1 732  ? 167.765 153.432 91.966  1.00 367.08 -1 604  ASP A OD2   1 
ATOM   1571  N  N     . SER A 1 733  ? 173.202 153.564 92.481  1.00 163.16 ?  605  SER A N     1 
ATOM   1572  C  CA    . SER A 1 733  ? 174.528 152.989 92.662  1.00 168.37 ?  605  SER A CA    1 
ATOM   1573  C  C     . SER A 1 733  ? 175.415 153.829 93.580  1.00 206.81 ?  605  SER A C     1 
ATOM   1574  O  O     . SER A 1 733  ? 176.554 153.423 93.834  1.00 208.62 ?  605  SER A O     1 
ATOM   1575  C  CB    . SER A 1 733  ? 175.209 152.801 91.301  1.00 149.85 ?  605  SER A CB    1 
ATOM   1576  O  OG    . SER A 1 733  ? 176.289 151.884 91.380  1.00 139.69 ?  605  SER A OG    1 
ATOM   1577  N  N     . MET A 1 734  ? 174.929 154.975 94.083  1.00 209.06 ?  606  MET A N     1 
ATOM   1578  C  CA    . MET A 1 734  ? 175.700 155.856 94.961  1.00 213.14 ?  606  MET A CA    1 
ATOM   1579  C  C     . MET A 1 734  ? 174.910 156.257 96.205  1.00 196.21 ?  606  MET A C     1 
ATOM   1580  O  O     . MET A 1 734  ? 175.063 157.377 96.707  1.00 180.28 ?  606  MET A O     1 
ATOM   1581  C  CB    . MET A 1 734  ? 176.171 157.100 94.209  1.00 209.16 ?  606  MET A CB    1 
ATOM   1582  C  CG    . MET A 1 734  ? 177.380 156.862 93.325  1.00 206.15 ?  606  MET A CG    1 
ATOM   1583  S  SD    . MET A 1 734  ? 178.676 155.945 94.177  1.00 213.17 ?  606  MET A SD    1 
ATOM   1584  C  CE    . MET A 1 734  ? 179.809 155.625 92.826  1.00 194.16 ?  606  MET A CE    1 
ATOM   1585  N  N     . CYS A 1 735  ? 174.059 155.361 96.712  1.00 190.35 ?  607  CYS A N     1 
ATOM   1586  C  CA    . CYS A 1 735  ? 173.312 155.570 97.951  1.00 172.30 ?  607  CYS A CA    1 
ATOM   1587  C  C     . CYS A 1 735  ? 173.317 154.302 98.799  1.00 158.30 ?  607  CYS A C     1 
ATOM   1588  O  O     . CYS A 1 735  ? 172.303 153.936 99.401  1.00 136.10 ?  607  CYS A O     1 
ATOM   1589  C  CB    . CYS A 1 735  ? 171.872 156.000 97.670  1.00 151.69 ?  607  CYS A CB    1 
ATOM   1590  S  SG    . CYS A 1 735  ? 170.875 154.775 96.779  1.00 204.48 ?  607  CYS A SG    1 
ATOM   1591  N  N     . THR A 1 736  ? 174.459 153.613 98.873  1.00 155.33 ?  608  THR A N     1 
ATOM   1592  C  CA    . THR A 1 736  ? 174.537 152.294 99.487  1.00 114.50 ?  608  THR A CA    1 
ATOM   1593  C  C     . THR A 1 736  ? 175.269 152.271 100.829 1.00 104.94 ?  608  THR A C     1 
ATOM   1594  O  O     . THR A 1 736  ? 175.387 151.195 101.425 1.00 90.12  ?  608  THR A O     1 
ATOM   1595  C  CB    . THR A 1 736  ? 175.208 151.289 98.530  1.00 86.37  ?  608  THR A CB    1 
ATOM   1596  O  OG1   . THR A 1 736  ? 176.633 151.434 98.589  1.00 97.20  ?  608  THR A OG1   1 
ATOM   1597  C  CG2   . THR A 1 736  ? 174.739 151.479 97.093  1.00 94.28  ?  608  THR A CG2   1 
ATOM   1598  N  N     . SER A 1 737  ? 175.765 153.408 101.324 1.00 108.06 ?  609  SER A N     1 
ATOM   1599  C  CA    . SER A 1 737  ? 176.623 153.421 102.507 1.00 97.23  ?  609  SER A CA    1 
ATOM   1600  C  C     . SER A 1 737  ? 175.984 154.078 103.725 1.00 78.39  ?  609  SER A C     1 
ATOM   1601  O  O     . SER A 1 737  ? 175.882 153.453 104.784 1.00 74.17  ?  609  SER A O     1 
ATOM   1602  C  CB    . SER A 1 737  ? 177.947 154.124 102.172 1.00 125.50 ?  609  SER A CB    1 
ATOM   1603  O  OG    . SER A 1 737  ? 178.661 154.468 103.349 1.00 127.10 ?  609  SER A OG    1 
ATOM   1604  N  N     . GLY A 1 738  ? 175.562 155.331 103.613 1.00 77.84  ?  610  GLY A N     1 
ATOM   1605  C  CA    . GLY A 1 738  ? 175.192 156.105 104.783 1.00 85.60  ?  610  GLY A CA    1 
ATOM   1606  C  C     . GLY A 1 738  ? 173.732 156.116 105.192 1.00 88.24  ?  610  GLY A C     1 
ATOM   1607  O  O     . GLY A 1 738  ? 173.069 157.138 105.009 1.00 96.08  ?  610  GLY A O     1 
ATOM   1608  N  N     . PHE A 1 739  ? 173.205 155.027 105.745 1.00 69.06  ?  611  PHE A N     1 
ATOM   1609  C  CA    . PHE A 1 739  ? 171.842 155.020 106.270 1.00 51.75  ?  611  PHE A CA    1 
ATOM   1610  C  C     . PHE A 1 739  ? 171.854 155.174 107.788 1.00 52.70  ?  611  PHE A C     1 
ATOM   1611  O  O     . PHE A 1 739  ? 172.604 154.482 108.485 1.00 50.41  ?  611  PHE A O     1 
ATOM   1612  C  CB    . PHE A 1 739  ? 171.089 153.743 105.888 1.00 43.23  ?  611  PHE A CB    1 
ATOM   1613  C  CG    . PHE A 1 739  ? 170.670 153.681 104.439 1.00 51.19  ?  611  PHE A CG    1 
ATOM   1614  C  CD1   . PHE A 1 739  ? 171.606 153.648 103.425 1.00 70.87  ?  611  PHE A CD1   1 
ATOM   1615  C  CD2   . PHE A 1 739  ? 169.327 153.680 104.094 1.00 55.57  ?  611  PHE A CD2   1 
ATOM   1616  C  CE1   . PHE A 1 739  ? 171.209 153.584 102.104 1.00 83.29  ?  611  PHE A CE1   1 
ATOM   1617  C  CE2   . PHE A 1 739  ? 168.931 153.627 102.769 1.00 63.79  ?  611  PHE A CE2   1 
ATOM   1618  C  CZ    . PHE A 1 739  ? 169.875 153.581 101.779 1.00 76.44  ?  611  PHE A CZ    1 
ATOM   1619  N  N     . THR A 1 740  ? 171.010 156.077 108.293 1.00 59.94  ?  612  THR A N     1 
ATOM   1620  C  CA    . THR A 1 740  ? 170.872 156.352 109.723 1.00 62.00  ?  612  THR A CA    1 
ATOM   1621  C  C     . THR A 1 740  ? 169.430 156.061 110.124 1.00 59.83  ?  612  THR A C     1 
ATOM   1622  O  O     . THR A 1 740  ? 168.506 156.740 109.663 1.00 64.75  ?  612  THR A O     1 
ATOM   1623  C  CB    . THR A 1 740  ? 171.259 157.800 110.041 1.00 59.37  ?  612  THR A CB    1 
ATOM   1624  O  OG1   . THR A 1 740  ? 172.685 157.919 110.102 1.00 78.77  ?  612  THR A OG1   1 
ATOM   1625  C  CG2   . THR A 1 740  ? 170.663 158.263 111.365 1.00 45.33  ?  612  THR A CG2   1 
ATOM   1626  N  N     . VAL A 1 741  ? 169.245 155.039 110.958 1.00 45.45  ?  613  VAL A N     1 
ATOM   1627  C  CA    . VAL A 1 741  ? 167.932 154.627 111.442 1.00 22.22  ?  613  VAL A CA    1 
ATOM   1628  C  C     . VAL A 1 741  ? 167.797 155.063 112.896 1.00 17.00  ?  613  VAL A C     1 
ATOM   1629  O  O     . VAL A 1 741  ? 168.622 154.700 113.740 1.00 25.52  ?  613  VAL A O     1 
ATOM   1630  C  CB    . VAL A 1 741  ? 167.734 153.109 111.302 1.00 24.96  ?  613  VAL A CB    1 
ATOM   1631  C  CG1   . VAL A 1 741  ? 166.717 152.612 112.306 1.00 15.86  ?  613  VAL A CG1   1 
ATOM   1632  C  CG2   . VAL A 1 741  ? 167.297 152.757 109.891 1.00 28.99  ?  613  VAL A CG2   1 
ATOM   1633  N  N     . VAL A 1 742  ? 166.763 155.844 113.191 1.00 29.80  ?  614  VAL A N     1 
ATOM   1634  C  CA    . VAL A 1 742  ? 166.444 156.255 114.551 1.00 12.49  ?  614  VAL A CA    1 
ATOM   1635  C  C     . VAL A 1 742  ? 165.330 155.347 115.052 1.00 12.38  ?  614  VAL A C     1 
ATOM   1636  O  O     . VAL A 1 742  ? 164.294 155.205 114.394 1.00 18.20  ?  614  VAL A O     1 
ATOM   1637  C  CB    . VAL A 1 742  ? 166.035 157.735 114.607 1.00 21.04  ?  614  VAL A CB    1 
ATOM   1638  C  CG1   . VAL A 1 742  ? 165.773 158.168 116.036 1.00 18.76  ?  614  VAL A CG1   1 
ATOM   1639  C  CG2   . VAL A 1 742  ? 167.113 158.605 113.973 1.00 37.30  ?  614  VAL A CG2   1 
ATOM   1640  N  N     . VAL A 1 743  ? 165.537 154.723 116.210 1.00 15.22  ?  615  VAL A N     1 
ATOM   1641  C  CA    . VAL A 1 743  ? 164.581 153.781 116.780 1.00 12.78  ?  615  VAL A CA    1 
ATOM   1642  C  C     . VAL A 1 743  ? 164.214 154.241 118.182 1.00 11.24  ?  615  VAL A C     1 
ATOM   1643  O  O     . VAL A 1 743  ? 165.094 154.548 118.994 1.00 10.36  ?  615  VAL A O     1 
ATOM   1644  C  CB    . VAL A 1 743  ? 165.134 152.348 116.807 1.00 10.53  ?  615  VAL A CB    1 
ATOM   1645  C  CG1   . VAL A 1 743  ? 164.292 151.480 117.715 1.00 11.43  ?  615  VAL A CG1   1 
ATOM   1646  C  CG2   . VAL A 1 743  ? 165.159 151.787 115.407 1.00 11.10  ?  615  VAL A CG2   1 
ATOM   1647  N  N     . LYS A 1 744  ? 162.914 154.280 118.459 1.00 12.37  ?  616  LYS A N     1 
ATOM   1648  C  CA    . LYS A 1 744  ? 162.377 154.651 119.760 1.00 11.08  ?  616  LYS A CA    1 
ATOM   1649  C  C     . LYS A 1 744  ? 161.947 153.402 120.512 1.00 11.65  ?  616  LYS A C     1 
ATOM   1650  O  O     . LYS A 1 744  ? 161.169 152.597 119.994 1.00 9.63   ?  616  LYS A O     1 
ATOM   1651  C  CB    . LYS A 1 744  ? 161.184 155.593 119.610 1.00 12.55  ?  616  LYS A CB    1 
ATOM   1652  C  CG    . LYS A 1 744  ? 160.312 155.651 120.843 1.00 17.60  ?  616  LYS A CG    1 
ATOM   1653  C  CD    . LYS A 1 744  ? 158.864 155.982 120.501 1.00 38.60  ?  616  LYS A CD    1 
ATOM   1654  C  CE    . LYS A 1 744  ? 158.201 154.888 119.684 1.00 35.66  ?  616  LYS A CE    1 
ATOM   1655  N  NZ    . LYS A 1 744  ? 156.711 155.028 119.618 1.00 32.46  ?  616  LYS A NZ    1 
ATOM   1656  N  N     . GLU A 1 745  ? 162.448 153.248 121.728 1.00 30.29  ?  617  GLU A N     1 
ATOM   1657  C  CA    . GLU A 1 745  ? 162.076 152.132 122.576 1.00 13.04  ?  617  GLU A CA    1 
ATOM   1658  C  C     . GLU A 1 745  ? 160.878 152.505 123.431 1.00 8.24   ?  617  GLU A C     1 
ATOM   1659  O  O     . GLU A 1 745  ? 160.448 153.657 123.483 1.00 14.84  ?  617  GLU A O     1 
ATOM   1660  C  CB    . GLU A 1 745  ? 163.249 151.723 123.464 1.00 21.37  ?  617  GLU A CB    1 
ATOM   1661  C  CG    . GLU A 1 745  ? 164.582 151.719 122.740 1.00 49.52  ?  617  GLU A CG    1 
ATOM   1662  C  CD    . GLU A 1 745  ? 165.520 150.657 123.269 1.00 90.14  ?  617  GLU A CD    1 
ATOM   1663  O  OE1   . GLU A 1 745  ? 165.036 149.706 123.918 1.00 68.32  ?  617  GLU A OE1   1 
ATOM   1664  O  OE2   . GLU A 1 745  ? 166.743 150.773 123.037 1.00 261.99 -1 617  GLU A OE2   1 
ATOM   1665  N  N     . SER A 1 746  ? 160.339 151.502 124.111 1.00 8.49   ?  618  SER A N     1 
ATOM   1666  C  CA    . SER A 1 746  ? 159.295 151.730 125.094 1.00 10.82  ?  618  SER A CA    1 
ATOM   1667  C  C     . SER A 1 746  ? 159.102 150.465 125.907 1.00 12.22  ?  618  SER A C     1 
ATOM   1668  O  O     . SER A 1 746  ? 159.032 149.361 125.359 1.00 23.28  ?  618  SER A O     1 
ATOM   1669  C  CB    . SER A 1 746  ? 157.974 152.130 124.436 1.00 11.97  ?  618  SER A CB    1 
ATOM   1670  O  OG    . SER A 1 746  ? 156.885 151.633 125.188 1.00 20.67  ?  618  SER A OG    1 
ATOM   1671  N  N     . CYS A 1 747  ? 159.017 150.607 127.215 1.00 10.92  ?  619  CYS A N     1 
ATOM   1672  C  CA    . CYS A 1 747  ? 158.765 149.472 128.081 1.00 12.42  ?  619  CYS A CA    1 
ATOM   1673  C  C     . CYS A 1 747  ? 157.808 149.963 129.149 1.00 14.56  ?  619  CYS A C     1 
ATOM   1674  O  O     . CYS A 1 747  ? 158.171 150.824 129.956 1.00 31.97  ?  619  CYS A O     1 
ATOM   1675  C  CB    . CYS A 1 747  ? 160.067 148.956 128.672 1.00 13.82  ?  619  CYS A CB    1 
ATOM   1676  S  SG    . CYS A 1 747  ? 159.878 148.102 130.211 1.00 34.53  ?  619  CYS A SG    1 
ATOM   1677  N  N     . ASP A 1 748  ? 156.582 149.463 129.133 1.00 14.85  ?  620  ASP A N     1 
ATOM   1678  C  CA    . ASP A 1 748  ? 155.593 149.911 130.097 1.00 39.39  ?  620  ASP A CA    1 
ATOM   1679  C  C     . ASP A 1 748  ? 154.960 148.700 130.761 1.00 40.83  ?  620  ASP A C     1 
ATOM   1680  O  O     . ASP A 1 748  ? 154.876 147.619 130.173 1.00 35.29  ?  620  ASP A O     1 
ATOM   1681  C  CB    . ASP A 1 748  ? 154.506 150.789 129.444 1.00 72.71  ?  620  ASP A CB    1 
ATOM   1682  C  CG    . ASP A 1 748  ? 153.481 151.316 130.454 1.00 159.10 ?  620  ASP A CG    1 
ATOM   1683  O  OD1   . ASP A 1 748  ? 153.632 151.083 131.677 1.00 129.62 ?  620  ASP A OD1   1 
ATOM   1684  O  OD2   . ASP A 1 748  ? 152.509 151.969 130.021 1.00 347.90 -1 620  ASP A OD2   1 
ATOM   1685  N  N     . GLY A 1 749  ? 154.521 148.898 132.000 1.00 65.09  ?  621  GLY A N     1 
ATOM   1686  C  CA    . GLY A 1 749  ? 153.808 147.862 132.705 1.00 46.44  ?  621  GLY A CA    1 
ATOM   1687  C  C     . GLY A 1 749  ? 152.405 147.681 132.176 1.00 30.15  ?  621  GLY A C     1 
ATOM   1688  O  O     . GLY A 1 749  ? 151.846 148.541 131.495 1.00 59.70  ?  621  GLY A O     1 
ATOM   1689  N  N     . MET A 1 750  ? 151.829 146.533 132.497 1.00 16.06  ?  622  MET A N     1 
ATOM   1690  C  CA    . MET A 1 750  ? 150.506 146.196 131.988 1.00 20.41  ?  622  MET A CA    1 
ATOM   1691  C  C     . MET A 1 750  ? 149.906 145.201 132.960 1.00 24.06  ?  622  MET A C     1 
ATOM   1692  O  O     . MET A 1 750  ? 150.432 144.095 133.109 1.00 24.96  ?  622  MET A O     1 
ATOM   1693  C  CB    . MET A 1 750  ? 150.610 145.596 130.607 1.00 23.06  ?  622  MET A CB    1 
ATOM   1694  C  CG    . MET A 1 750  ? 149.299 145.244 129.971 1.00 46.89  ?  622  MET A CG    1 
ATOM   1695  S  SD    . MET A 1 750  ? 149.587 144.895 128.229 1.00 169.53 ?  622  MET A SD    1 
ATOM   1696  C  CE    . MET A 1 750  ? 151.055 145.881 127.923 1.00 45.61  ?  622  MET A CE    1 
ATOM   1697  N  N     . GLY A 1 751  ? 148.810 145.578 133.605 1.00 34.87  ?  623  GLY A N     1 
ATOM   1698  C  CA    . GLY A 1 751  ? 148.313 144.863 134.762 1.00 54.88  ?  623  GLY A CA    1 
ATOM   1699  C  C     . GLY A 1 751  ? 147.171 143.921 134.431 1.00 80.37  ?  623  GLY A C     1 
ATOM   1700  O  O     . GLY A 1 751  ? 146.368 144.189 133.535 1.00 68.41  ?  623  GLY A O     1 
ATOM   1701  N  N     . ASP A 1 752  ? 147.141 142.798 135.154 1.00 138.23 ?  624  ASP A N     1 
ATOM   1702  C  CA    . ASP A 1 752  ? 145.936 141.991 135.333 1.00 174.94 ?  624  ASP A CA    1 
ATOM   1703  C  C     . ASP A 1 752  ? 145.193 141.627 134.059 1.00 143.03 ?  624  ASP A C     1 
ATOM   1704  O  O     . ASP A 1 752  ? 144.115 142.155 133.797 1.00 154.77 ?  624  ASP A O     1 
ATOM   1705  C  CB    . ASP A 1 752  ? 144.986 142.680 136.310 1.00 267.27 ?  624  ASP A CB    1 
ATOM   1706  C  CG    . ASP A 1 752  ? 145.111 142.129 137.722 1.00 287.24 ?  624  ASP A CG    1 
ATOM   1707  O  OD1   . ASP A 1 752  ? 145.582 140.976 137.862 1.00 378.58 -1 624  ASP A OD1   1 
ATOM   1708  O  OD2   . ASP A 1 752  ? 144.707 142.816 138.680 1.00 293.78 ?  624  ASP A OD2   1 
ATOM   1709  N  N     . VAL A 1 753  ? 145.783 140.762 133.241 1.00 119.19 ?  625  VAL A N     1 
ATOM   1710  C  CA    . VAL A 1 753  ? 144.980 140.091 132.229 1.00 115.48 ?  625  VAL A CA    1 
ATOM   1711  C  C     . VAL A 1 753  ? 143.843 139.390 132.963 1.00 110.39 ?  625  VAL A C     1 
ATOM   1712  O  O     . VAL A 1 753  ? 144.066 138.474 133.760 1.00 110.09 ?  625  VAL A O     1 
ATOM   1713  C  CB    . VAL A 1 753  ? 145.826 139.109 131.399 1.00 115.75 ?  625  VAL A CB    1 
ATOM   1714  C  CG1   . VAL A 1 753  ? 146.564 139.855 130.306 1.00 104.95 ?  625  VAL A CG1   1 
ATOM   1715  C  CG2   . VAL A 1 753  ? 146.817 138.369 132.290 1.00 101.59 ?  625  VAL A CG2   1 
ATOM   1716  N  N     . SER A 1 754  ? 142.615 139.829 132.706 1.00 95.96  ?  626  SER A N     1 
ATOM   1717  C  CA    . SER A 1 754  ? 141.452 139.363 133.448 1.00 91.88  ?  626  SER A CA    1 
ATOM   1718  C  C     . SER A 1 754  ? 140.848 138.159 132.747 1.00 126.19 ?  626  SER A C     1 
ATOM   1719  O  O     . SER A 1 754  ? 140.588 138.205 131.542 1.00 132.16 ?  626  SER A O     1 
ATOM   1720  C  CB    . SER A 1 754  ? 140.408 140.473 133.581 1.00 98.00  ?  626  SER A CB    1 
ATOM   1721  O  OG    . SER A 1 754  ? 140.359 141.282 132.420 1.00 85.10  ?  626  SER A OG    1 
ATOM   1722  N  N     . GLU A 1 755  ? 140.616 137.096 133.507 1.00 165.82 ?  627  GLU A N     1 
ATOM   1723  C  CA    . GLU A 1 755  ? 140.125 135.849 132.938 1.00 215.83 ?  627  GLU A CA    1 
ATOM   1724  C  C     . GLU A 1 755  ? 139.259 135.159 133.989 1.00 235.75 ?  627  GLU A C     1 
ATOM   1725  O  O     . GLU A 1 755  ? 138.839 135.782 134.970 1.00 221.12 ?  627  GLU A O     1 
ATOM   1726  C  CB    . GLU A 1 755  ? 141.307 134.988 132.463 1.00 220.45 ?  627  GLU A CB    1 
ATOM   1727  C  CG    . GLU A 1 755  ? 141.108 134.353 131.096 1.00 259.30 ?  627  GLU A CG    1 
ATOM   1728  C  CD    . GLU A 1 755  ? 140.403 133.015 131.163 1.00 266.72 ?  627  GLU A CD    1 
ATOM   1729  O  OE1   . GLU A 1 755  ? 139.976 132.515 130.101 1.00 256.17 ?  627  GLU A OE1   1 
ATOM   1730  O  OE2   . GLU A 1 755  ? 140.277 132.460 132.276 1.00 295.24 -1 627  GLU A OE2   1 
ATOM   1731  N  N     . LYS A 1 756  ? 138.979 133.876 133.776 1.00 242.31 ?  628  LYS A N     1 
ATOM   1732  C  CA    . LYS A 1 756  ? 138.165 133.078 134.690 1.00 214.40 ?  628  LYS A CA    1 
ATOM   1733  C  C     . LYS A 1 756  ? 138.782 132.997 136.084 1.00 172.77 ?  628  LYS A C     1 
ATOM   1734  O  O     . LYS A 1 756  ? 138.395 133.738 136.988 1.00 170.47 ?  628  LYS A O     1 
ATOM   1735  C  CB    . LYS A 1 756  ? 137.971 131.666 134.132 1.00 215.55 ?  628  LYS A CB    1 
ATOM   1736  C  CG    . LYS A 1 756  ? 136.834 131.503 133.126 1.00 243.47 ?  628  LYS A CG    1 
ATOM   1737  C  CD    . LYS A 1 756  ? 137.167 132.087 131.763 1.00 239.55 ?  628  LYS A CD    1 
ATOM   1738  C  CE    . LYS A 1 756  ? 135.931 132.158 130.876 1.00 211.58 ?  628  LYS A CE    1 
ATOM   1739  N  NZ    . LYS A 1 756  ? 134.859 133.016 131.454 1.00 184.85 ?  628  LYS A NZ    1 
ATOM   1740  N  N     . PRO A 1 764  ? 149.433 134.246 136.655 1.00 86.29  ?  636  PRO A N     1 
ATOM   1741  C  CA    . PRO A 1 764  ? 149.346 135.073 135.446 1.00 75.21  ?  636  PRO A CA    1 
ATOM   1742  C  C     . PRO A 1 764  ? 148.553 136.372 135.640 1.00 78.00  ?  636  PRO A C     1 
ATOM   1743  O  O     . PRO A 1 764  ? 147.438 136.488 135.133 1.00 76.43  ?  636  PRO A O     1 
ATOM   1744  C  CB    . PRO A 1 764  ? 148.657 134.137 134.453 1.00 55.27  ?  636  PRO A CB    1 
ATOM   1745  C  CG    . PRO A 1 764  ? 147.769 133.301 135.309 1.00 57.31  ?  636  PRO A CG    1 
ATOM   1746  C  CD    . PRO A 1 764  ? 148.580 133.045 136.557 1.00 69.86  ?  636  PRO A CD    1 
ATOM   1747  N  N     . GLU A 1 765  ? 149.133 137.336 136.364 1.00 81.80  ?  637  GLU A N     1 
ATOM   1748  C  CA    . GLU A 1 765  ? 148.452 138.598 136.643 1.00 76.90  ?  637  GLU A CA    1 
ATOM   1749  C  C     . GLU A 1 765  ? 149.140 139.775 135.962 1.00 62.54  ?  637  GLU A C     1 
ATOM   1750  O  O     . GLU A 1 765  ? 148.524 140.428 135.118 1.00 76.89  ?  637  GLU A O     1 
ATOM   1751  C  CB    . GLU A 1 765  ? 148.373 138.807 138.156 1.00 127.08 ?  637  GLU A CB    1 
ATOM   1752  C  CG    . GLU A 1 765  ? 147.710 140.107 138.590 1.00 155.33 ?  637  GLU A CG    1 
ATOM   1753  C  CD    . GLU A 1 765  ? 146.690 139.904 139.698 1.00 189.52 ?  637  GLU A CD    1 
ATOM   1754  O  OE1   . GLU A 1 765  ? 146.164 138.781 139.825 1.00 176.52 ?  637  GLU A OE1   1 
ATOM   1755  O  OE2   . GLU A 1 765  ? 146.417 140.871 140.439 1.00 251.54 -1 637  GLU A OE2   1 
ATOM   1756  N  N     . LYS A 1 766  ? 150.406 140.044 136.261 1.00 27.59  ?  638  LYS A N     1 
ATOM   1757  C  CA    . LYS A 1 766  ? 151.075 141.207 135.701 1.00 32.02  ?  638  LYS A CA    1 
ATOM   1758  C  C     . LYS A 1 766  ? 151.868 140.822 134.452 1.00 21.15  ?  638  LYS A C     1 
ATOM   1759  O  O     . LYS A 1 766  ? 152.086 139.646 134.158 1.00 30.17  ?  638  LYS A O     1 
ATOM   1760  C  CB    . LYS A 1 766  ? 151.989 141.859 136.741 1.00 16.68  ?  638  LYS A CB    1 
ATOM   1761  C  CG    . LYS A 1 766  ? 151.352 142.020 138.103 1.00 26.60  ?  638  LYS A CG    1 
ATOM   1762  C  CD    . LYS A 1 766  ? 150.207 143.033 138.052 1.00 33.25  ?  638  LYS A CD    1 
ATOM   1763  C  CE    . LYS A 1 766  ? 150.677 144.473 137.822 1.00 15.83  ?  638  LYS A CE    1 
ATOM   1764  N  NZ    . LYS A 1 766  ? 150.779 145.231 139.102 1.00 13.13  ?  638  LYS A NZ    1 
ATOM   1765  N  N     . ALA A 1 767  ? 152.313 141.838 133.716 1.00 22.28  ?  639  ALA A N     1 
ATOM   1766  C  CA    . ALA A 1 767  ? 153.054 141.603 132.486 1.00 19.91  ?  639  ALA A CA    1 
ATOM   1767  C  C     . ALA A 1 767  ? 153.767 142.880 132.081 1.00 16.99  ?  639  ALA A C     1 
ATOM   1768  O  O     . ALA A 1 767  ? 153.299 143.984 132.368 1.00 23.40  ?  639  ALA A O     1 
ATOM   1769  C  CB    . ALA A 1 767  ? 152.130 141.146 131.352 1.00 21.83  ?  639  ALA A CB    1 
ATOM   1770  N  N     . VAL A 1 768  ? 154.887 142.720 131.388 1.00 21.17  ?  640  VAL A N     1 
ATOM   1771  C  CA    . VAL A 1 768  ? 155.582 143.851 130.792 1.00 20.49  ?  640  VAL A CA    1 
ATOM   1772  C  C     . VAL A 1 768  ? 155.660 143.606 129.295 1.00 27.60  ?  640  VAL A C     1 
ATOM   1773  O  O     . VAL A 1 768  ? 155.745 142.457 128.855 1.00 35.02  ?  640  VAL A O     1 
ATOM   1774  C  CB    . VAL A 1 768  ? 156.980 144.054 131.394 1.00 26.17  ?  640  VAL A CB    1 
ATOM   1775  C  CG1   . VAL A 1 768  ? 157.568 145.356 130.899 1.00 29.94  ?  640  VAL A CG1   1 
ATOM   1776  C  CG2   . VAL A 1 768  ? 156.907 144.027 132.903 1.00 40.39  ?  640  VAL A CG2   1 
ATOM   1777  N  N     . ARG A 1 769  ? 155.610 144.677 128.509 1.00 7.10   ?  641  ARG A N     1 
ATOM   1778  C  CA    . ARG A 1 769  ? 155.633 144.558 127.054 1.00 10.34  ?  641  ARG A CA    1 
ATOM   1779  C  C     . ARG A 1 769  ? 156.697 145.512 126.518 1.00 11.39  ?  641  ARG A C     1 
ATOM   1780  O  O     . ARG A 1 769  ? 156.428 146.696 126.301 1.00 23.01  ?  641  ARG A O     1 
ATOM   1781  C  CB    . ARG A 1 769  ? 154.253 144.828 126.468 1.00 12.85  ?  641  ARG A CB    1 
ATOM   1782  C  CG    . ARG A 1 769  ? 154.152 144.498 124.991 1.00 28.77  ?  641  ARG A CG    1 
ATOM   1783  C  CD    . ARG A 1 769  ? 152.720 144.213 124.586 1.00 98.25  ?  641  ARG A CD    1 
ATOM   1784  N  NE    . ARG A 1 769  ? 151.881 145.348 124.916 1.00 19.23  ?  641  ARG A NE    1 
ATOM   1785  C  CZ    . ARG A 1 769  ? 151.838 146.468 124.208 1.00 23.95  ?  641  ARG A CZ    1 
ATOM   1786  N  NH1   . ARG A 1 769  ? 151.056 147.463 124.595 1.00 53.29  ?  641  ARG A NH1   1 
ATOM   1787  N  NH2   . ARG A 1 769  ? 152.576 146.589 123.115 1.00 24.00  ?  641  ARG A NH2   1 
ATOM   1788  N  N     . PHE A 1 770  ? 157.911 144.986 126.327 1.00 16.36  ?  642  PHE A N     1 
ATOM   1789  C  CA    . PHE A 1 770  ? 159.041 145.759 125.819 1.00 9.35   ?  642  PHE A CA    1 
ATOM   1790  C  C     . PHE A 1 770  ? 158.974 145.770 124.299 1.00 12.88  ?  642  PHE A C     1 
ATOM   1791  O  O     . PHE A 1 770  ? 159.263 144.756 123.651 1.00 21.63  ?  642  PHE A O     1 
ATOM   1792  C  CB    . PHE A 1 770  ? 160.366 145.168 126.284 1.00 14.97  ?  642  PHE A CB    1 
ATOM   1793  C  CG    . PHE A 1 770  ? 161.520 146.112 126.164 1.00 11.94  ?  642  PHE A CG    1 
ATOM   1794  C  CD1   . PHE A 1 770  ? 162.057 146.434 124.932 1.00 11.75  ?  642  PHE A CD1   1 
ATOM   1795  C  CD2   . PHE A 1 770  ? 162.062 146.692 127.285 1.00 19.01  ?  642  PHE A CD2   1 
ATOM   1796  C  CE1   . PHE A 1 770  ? 163.114 147.307 124.833 1.00 24.44  ?  642  PHE A CE1   1 
ATOM   1797  C  CE2   . PHE A 1 770  ? 163.112 147.572 127.183 1.00 33.35  ?  642  PHE A CE2   1 
ATOM   1798  C  CZ    . PHE A 1 770  ? 163.634 147.874 125.958 1.00 36.95  ?  642  PHE A CZ    1 
ATOM   1799  N  N     . SER A 1 771  ? 158.628 146.927 123.736 1.00 12.81  ?  643  SER A N     1 
ATOM   1800  C  CA    . SER A 1 771  ? 158.386 147.084 122.311 1.00 11.85  ?  643  SER A CA    1 
ATOM   1801  C  C     . SER A 1 771  ? 159.125 148.315 121.794 1.00 13.09  ?  643  SER A C     1 
ATOM   1802  O  O     . SER A 1 771  ? 159.434 149.236 122.551 1.00 16.05  ?  643  SER A O     1 
ATOM   1803  C  CB    . SER A 1 771  ? 156.875 147.188 122.010 1.00 25.31  ?  643  SER A CB    1 
ATOM   1804  O  OG    . SER A 1 771  ? 156.345 148.445 122.393 1.00 34.03  ?  643  SER A OG    1 
ATOM   1805  N  N     . PHE A 1 772  ? 159.416 148.310 120.493 1.00 14.33  ?  644  PHE A N     1 
ATOM   1806  C  CA    . PHE A 1 772  ? 160.114 149.388 119.805 1.00 15.38  ?  644  PHE A CA    1 
ATOM   1807  C  C     . PHE A 1 772  ? 159.412 149.663 118.485 1.00 14.80  ?  644  PHE A C     1 
ATOM   1808  O  O     . PHE A 1 772  ? 158.547 148.901 118.052 1.00 17.06  ?  644  PHE A O     1 
ATOM   1809  C  CB    . PHE A 1 772  ? 161.578 149.036 119.536 1.00 26.25  ?  644  PHE A CB    1 
ATOM   1810  C  CG    . PHE A 1 772  ? 161.766 148.091 118.385 1.00 29.76  ?  644  PHE A CG    1 
ATOM   1811  C  CD1   . PHE A 1 772  ? 161.282 146.807 118.448 1.00 16.83  ?  644  PHE A CD1   1 
ATOM   1812  C  CD2   . PHE A 1 772  ? 162.409 148.491 117.235 1.00 30.06  ?  644  PHE A CD2   1 
ATOM   1813  C  CE1   . PHE A 1 772  ? 161.455 145.932 117.396 1.00 15.90  ?  644  PHE A CE1   1 
ATOM   1814  C  CE2   . PHE A 1 772  ? 162.571 147.611 116.182 1.00 18.26  ?  644  PHE A CE2   1 
ATOM   1815  C  CZ    . PHE A 1 772  ? 162.101 146.343 116.267 1.00 19.97  ?  644  PHE A CZ    1 
ATOM   1816  N  N     . THR A 1 773  ? 159.791 150.759 117.834 1.00 14.67  ?  645  THR A N     1 
ATOM   1817  C  CA    . THR A 1 773  ? 159.237 151.093 116.531 1.00 13.82  ?  645  THR A CA    1 
ATOM   1818  C  C     . THR A 1 773  ? 160.248 151.876 115.711 1.00 12.43  ?  645  THR A C     1 
ATOM   1819  O  O     . THR A 1 773  ? 160.969 152.724 116.241 1.00 12.14  ?  645  THR A O     1 
ATOM   1820  C  CB    . THR A 1 773  ? 157.936 151.894 116.658 1.00 15.74  ?  645  THR A CB    1 
ATOM   1821  O  OG1   . THR A 1 773  ? 157.099 151.306 117.659 1.00 18.90  ?  645  THR A OG1   1 
ATOM   1822  C  CG2   . THR A 1 773  ? 157.202 151.923 115.343 1.00 13.39  ?  645  THR A CG2   1 
ATOM   1823  N  N     . ILE A 1 774  ? 160.311 151.549 114.418 1.00 6.81   ?  646  ILE A N     1 
ATOM   1824  C  CA    . ILE A 1 774  ? 161.062 152.359 113.472 1.00 16.02  ?  646  ILE A CA    1 
ATOM   1825  C  C     . ILE A 1 774  ? 160.477 153.755 113.479 1.00 14.85  ?  646  ILE A C     1 
ATOM   1826  O  O     . ILE A 1 774  ? 159.253 153.936 113.460 1.00 13.83  ?  646  ILE A O     1 
ATOM   1827  C  CB    . ILE A 1 774  ? 161.011 151.737 112.070 1.00 8.76   ?  646  ILE A CB    1 
ATOM   1828  C  CG1   . ILE A 1 774  ? 161.895 150.497 111.999 1.00 21.49  ?  646  ILE A CG1   1 
ATOM   1829  C  CG2   . ILE A 1 774  ? 161.425 152.741 111.019 1.00 28.56  ?  646  ILE A CG2   1 
ATOM   1830  C  CD1   . ILE A 1 774  ? 163.355 150.780 112.249 1.00 46.97  ?  646  ILE A CD1   1 
ATOM   1831  N  N     . MET A 1 775  ? 161.345 154.751 113.525 1.00 11.37  ?  647  MET A N     1 
ATOM   1832  C  CA    . MET A 1 775  ? 160.902 156.130 113.600 1.00 13.97  ?  647  MET A CA    1 
ATOM   1833  C  C     . MET A 1 775  ? 161.314 156.955 112.390 1.00 22.09  ?  647  MET A C     1 
ATOM   1834  O  O     . MET A 1 775  ? 160.477 157.653 111.812 1.00 36.72  ?  647  MET A O     1 
ATOM   1835  C  CB    . MET A 1 775  ? 161.432 156.759 114.887 1.00 23.76  ?  647  MET A CB    1 
ATOM   1836  C  CG    . MET A 1 775  ? 160.360 157.430 115.702 1.00 35.14  ?  647  MET A CG    1 
ATOM   1837  S  SD    . MET A 1 775  ? 159.672 158.828 114.797 1.00 121.37 ?  647  MET A SD    1 
ATOM   1838  C  CE    . MET A 1 775  ? 161.120 159.880 114.623 1.00 72.95  ?  647  MET A CE    1 
ATOM   1839  N  N     . SER A 1 776  ? 162.574 156.886 111.971 1.00 28.29  ?  648  SER A N     1 
ATOM   1840  C  CA    . SER A 1 776  ? 163.004 157.687 110.831 1.00 31.06  ?  648  SER A CA    1 
ATOM   1841  C  C     . SER A 1 776  ? 164.254 157.075 110.217 1.00 30.50  ?  648  SER A C     1 
ATOM   1842  O  O     . SER A 1 776  ? 165.092 156.509 110.921 1.00 33.72  ?  648  SER A O     1 
ATOM   1843  C  CB    . SER A 1 776  ? 163.270 159.143 111.240 1.00 46.81  ?  648  SER A CB    1 
ATOM   1844  O  OG    . SER A 1 776  ? 164.649 159.389 111.441 1.00 57.75  ?  648  SER A OG    1 
ATOM   1845  N  N     . ILE A 1 777  ? 164.366 157.185 108.900 1.00 34.08  ?  649  ILE A N     1 
ATOM   1846  C  CA    . ILE A 1 777  ? 165.558 156.767 108.178 1.00 37.66  ?  649  ILE A CA    1 
ATOM   1847  C  C     . ILE A 1 777  ? 166.039 157.954 107.347 1.00 51.64  ?  649  ILE A C     1 
ATOM   1848  O  O     . ILE A 1 777  ? 165.231 158.632 106.701 1.00 53.13  ?  649  ILE A O     1 
ATOM   1849  C  CB    . ILE A 1 777  ? 165.289 155.512 107.320 1.00 28.86  ?  649  ILE A CB    1 
ATOM   1850  C  CG1   . ILE A 1 777  ? 166.427 155.233 106.335 1.00 69.06  ?  649  ILE A CG1   1 
ATOM   1851  C  CG2   . ILE A 1 777  ? 163.959 155.603 106.616 1.00 40.62  ?  649  ILE A CG2   1 
ATOM   1852  C  CD1   . ILE A 1 777  ? 167.737 154.898 107.004 1.00 83.60  ?  649  ILE A CD1   1 
ATOM   1853  N  N     . SER A 1 778  ? 167.348 158.229 107.401 1.00 63.05  ?  650  SER A N     1 
ATOM   1854  C  CA    . SER A 1 778  ? 167.971 159.338 106.682 1.00 63.28  ?  650  SER A CA    1 
ATOM   1855  C  C     . SER A 1 778  ? 169.243 158.850 105.994 1.00 61.89  ?  650  SER A C     1 
ATOM   1856  O  O     . SER A 1 778  ? 169.726 157.742 106.251 1.00 64.72  ?  650  SER A O     1 
ATOM   1857  C  CB    . SER A 1 778  ? 168.294 160.514 107.623 1.00 53.98  ?  650  SER A CB    1 
ATOM   1858  O  OG    . SER A 1 778  ? 168.989 160.080 108.782 1.00 58.34  ?  650  SER A OG    1 
ATOM   1859  N  N     . ILE A 1 779  ? 169.808 159.689 105.124 1.00 52.90  ?  651  ILE A N     1 
ATOM   1860  C  CA    . ILE A 1 779  ? 171.033 159.332 104.418 1.00 55.01  ?  651  ILE A CA    1 
ATOM   1861  C  C     . ILE A 1 779  ? 172.182 160.168 104.971 1.00 77.03  ?  651  ILE A C     1 
ATOM   1862  O  O     . ILE A 1 779  ? 171.989 161.216 105.598 1.00 79.06  ?  651  ILE A O     1 
ATOM   1863  C  CB    . ILE A 1 779  ? 170.921 159.495 102.885 1.00 63.87  ?  651  ILE A CB    1 
ATOM   1864  C  CG1   . ILE A 1 779  ? 171.708 158.396 102.169 1.00 76.90  ?  651  ILE A CG1   1 
ATOM   1865  C  CG2   . ILE A 1 779  ? 171.435 160.845 102.435 1.00 89.41  ?  651  ILE A CG2   1 
ATOM   1866  C  CD1   . ILE A 1 779  ? 171.177 157.005 102.427 1.00 55.80  ?  651  ILE A CD1   1 
ATOM   1867  N  N     . ARG A 1 780  ? 173.400 159.676 104.741 1.00 130.97 ?  652  ARG A N     1 
ATOM   1868  C  CA    . ARG A 1 780  ? 174.623 160.334 105.182 1.00 175.09 ?  652  ARG A CA    1 
ATOM   1869  C  C     . ARG A 1 780  ? 175.557 160.701 104.032 1.00 212.22 ?  652  ARG A C     1 
ATOM   1870  O  O     . ARG A 1 780  ? 176.649 161.219 104.284 1.00 230.77 ?  652  ARG A O     1 
ATOM   1871  C  CB    . ARG A 1 780  ? 175.372 159.447 106.195 1.00 172.40 ?  652  ARG A CB    1 
ATOM   1872  C  CG    . ARG A 1 780  ? 176.309 160.193 107.144 1.00 184.53 ?  652  ARG A CG    1 
ATOM   1873  C  CD    . ARG A 1 780  ? 175.675 161.484 107.628 1.00 212.09 ?  652  ARG A CD    1 
ATOM   1874  N  NE    . ARG A 1 780  ? 176.648 162.456 108.124 1.00 227.45 ?  652  ARG A NE    1 
ATOM   1875  C  CZ    . ARG A 1 780  ? 177.503 163.115 107.347 1.00 229.70 ?  652  ARG A CZ    1 
ATOM   1876  N  NH1   . ARG A 1 780  ? 177.512 162.893 106.039 1.00 247.82 ?  652  ARG A NH1   1 
ATOM   1877  N  NH2   . ARG A 1 780  ? 178.347 163.995 107.872 1.00 198.81 ?  652  ARG A NH2   1 
ATOM   1878  N  N     . LEU A 1 781  ? 175.166 160.449 102.784 1.00 202.81 ?  653  LEU A N     1 
ATOM   1879  C  CA    . LEU A 1 781  ? 176.000 160.771 101.629 1.00 217.66 ?  653  LEU A CA    1 
ATOM   1880  C  C     . LEU A 1 781  ? 175.681 162.168 101.104 1.00 219.23 ?  653  LEU A C     1 
ATOM   1881  O  O     . LEU A 1 781  ? 174.512 162.548 100.999 1.00 194.17 ?  653  LEU A O     1 
ATOM   1882  C  CB    . LEU A 1 781  ? 175.821 159.735 100.516 1.00 178.65 ?  653  LEU A CB    1 
ATOM   1883  C  CG    . LEU A 1 781  ? 176.130 158.259 100.788 1.00 160.60 ?  653  LEU A CG    1 
ATOM   1884  C  CD1   . LEU A 1 781  ? 176.670 157.610 99.525  1.00 151.78 ?  653  LEU A CD1   1 
ATOM   1885  C  CD2   . LEU A 1 781  ? 177.131 158.096 101.921 1.00 167.95 ?  653  LEU A CD2   1 
ATOM   1886  N  N     . GLU A 1 782  ? 176.725 162.926 100.767 1.00 233.37 ?  654  GLU A N     1 
ATOM   1887  C  CA    . GLU A 1 782  ? 178.113 162.488 100.908 1.00 234.93 ?  654  GLU A CA    1 
ATOM   1888  C  C     . GLU A 1 782  ? 178.987 163.562 101.567 1.00 220.80 ?  654  GLU A C     1 
ATOM   1889  O  O     . GLU A 1 782  ? 180.068 163.265 102.082 1.00 201.51 ?  654  GLU A O     1 
ATOM   1890  C  CB    . GLU A 1 782  ? 178.693 162.104 99.542  1.00 240.32 ?  654  GLU A CB    1 
ATOM   1891  C  CG    . GLU A 1 782  ? 179.174 163.279 98.699  1.00 282.78 ?  654  GLU A CG    1 
ATOM   1892  C  CD    . GLU A 1 782  ? 178.109 164.341 98.492  1.00 293.93 ?  654  GLU A CD    1 
ATOM   1893  O  OE1   . GLU A 1 782  ? 176.979 163.990 98.089  1.00 268.29 ?  654  GLU A OE1   1 
ATOM   1894  O  OE2   . GLU A 1 782  ? 178.397 165.527 98.752  1.00 387.80 -1 654  GLU A OE2   1 
ATOM   1895  N  N     . GLY A 1 783  ? 178.505 164.805 101.553 1.00 223.94 ?  655  GLY A N     1 
ATOM   1896  C  CA    . GLY A 1 783  ? 179.217 165.917 102.154 1.00 213.77 ?  655  GLY A CA    1 
ATOM   1897  C  C     . GLY A 1 783  ? 178.964 166.020 103.644 1.00 222.32 ?  655  GLY A C     1 
ATOM   1898  O  O     . GLY A 1 783  ? 179.140 165.040 104.371 1.00 222.52 ?  655  GLY A O     1 
ATOM   1899  N  N     . GLU A 1 784  ? 178.571 167.202 104.121 1.00 243.22 ?  656  GLU A N     1 
ATOM   1900  C  CA    . GLU A 1 784  ? 178.158 167.318 105.517 1.00 246.73 ?  656  GLU A CA    1 
ATOM   1901  C  C     . GLU A 1 784  ? 176.768 166.723 105.732 1.00 263.29 ?  656  GLU A C     1 
ATOM   1902  O  O     . GLU A 1 784  ? 176.535 166.035 106.734 1.00 247.29 ?  656  GLU A O     1 
ATOM   1903  C  CB    . GLU A 1 784  ? 178.229 168.782 105.979 1.00 249.82 ?  656  GLU A CB    1 
ATOM   1904  C  CG    . GLU A 1 784  ? 177.056 169.692 105.598 1.00 275.48 ?  656  GLU A CG    1 
ATOM   1905  C  CD    . GLU A 1 784  ? 176.803 169.761 104.099 1.00 291.09 ?  656  GLU A CD    1 
ATOM   1906  O  OE1   . GLU A 1 784  ? 177.757 169.572 103.316 1.00 279.92 ?  656  GLU A OE1   1 
ATOM   1907  O  OE2   . GLU A 1 784  ? 175.638 169.986 103.705 1.00 351.44 -1 656  GLU A OE2   1 
ATOM   1908  N  N     . ASP A 1 785  ? 175.845 166.968 104.795 1.00 283.36 ?  657  ASP A N     1 
ATOM   1909  C  CA    . ASP A 1 785  ? 174.471 166.458 104.780 1.00 282.99 ?  657  ASP A CA    1 
ATOM   1910  C  C     . ASP A 1 785  ? 173.860 166.379 106.174 1.00 246.83 ?  657  ASP A C     1 
ATOM   1911  O  O     . ASP A 1 785  ? 173.490 165.293 106.635 1.00 225.47 ?  657  ASP A O     1 
ATOM   1912  C  CB    . ASP A 1 785  ? 174.384 165.090 104.096 1.00 278.80 ?  657  ASP A CB    1 
ATOM   1913  C  CG    . ASP A 1 785  ? 175.289 164.056 104.726 1.00 270.97 ?  657  ASP A CG    1 
ATOM   1914  O  OD1   . ASP A 1 785  ? 176.501 164.049 104.427 1.00 269.24 ?  657  ASP A OD1   1 
ATOM   1915  O  OD2   . ASP A 1 785  ? 174.776 163.258 105.538 1.00 314.40 -1 657  ASP A OD2   1 
ATOM   1916  N  N     . ASP A 1 786  ? 173.769 167.527 106.848 1.00 245.45 ?  658  ASP A N     1 
ATOM   1917  C  CA    . ASP A 1 786  ? 173.258 167.635 108.211 1.00 230.63 ?  658  ASP A CA    1 
ATOM   1918  C  C     . ASP A 1 786  ? 172.024 166.772 108.444 1.00 203.78 ?  658  ASP A C     1 
ATOM   1919  O  O     . ASP A 1 786  ? 171.894 166.135 109.494 1.00 196.94 ?  658  ASP A O     1 
ATOM   1920  C  CB    . ASP A 1 786  ? 172.942 169.098 108.539 1.00 250.60 ?  658  ASP A CB    1 
ATOM   1921  C  CG    . ASP A 1 786  ? 172.098 169.767 107.468 1.00 255.30 ?  658  ASP A CG    1 
ATOM   1922  O  OD1   . ASP A 1 786  ? 171.731 169.092 106.481 1.00 234.28 ?  658  ASP A OD1   1 
ATOM   1923  O  OD2   . ASP A 1 786  ? 171.787 170.967 107.622 1.00 338.61 -1 658  ASP A OD2   1 
ATOM   1924  N  N     . GLY A 1 787  ? 171.119 166.741 107.471 1.00 187.47 ?  659  GLY A N     1 
ATOM   1925  C  CA    . GLY A 1 787  ? 169.992 165.834 107.519 1.00 163.68 ?  659  GLY A CA    1 
ATOM   1926  C  C     . GLY A 1 787  ? 169.338 165.629 106.168 1.00 122.51 ?  659  GLY A C     1 
ATOM   1927  O  O     . GLY A 1 787  ? 168.929 166.592 105.510 1.00 120.95 ?  659  GLY A O     1 
ATOM   1928  N  N     . ILE A 1 788  ? 169.227 164.374 105.746 1.00 85.48  ?  660  ILE A N     1 
ATOM   1929  C  CA    . ILE A 1 788  ? 168.555 164.015 104.498 1.00 69.88  ?  660  ILE A CA    1 
ATOM   1930  C  C     . ILE A 1 788  ? 167.536 162.939 104.861 1.00 48.42  ?  660  ILE A C     1 
ATOM   1931  O  O     . ILE A 1 788  ? 167.822 161.741 104.787 1.00 46.44  ?  660  ILE A O     1 
ATOM   1932  C  CB    . ILE A 1 788  ? 169.525 163.520 103.422 1.00 69.08  ?  660  ILE A CB    1 
ATOM   1933  C  CG1   . ILE A 1 788  ? 170.837 164.307 103.456 1.00 106.49 ?  660  ILE A CG1   1 
ATOM   1934  C  CG2   . ILE A 1 788  ? 168.891 163.594 102.048 1.00 74.07  ?  660  ILE A CG2   1 
ATOM   1935  C  CD1   . ILE A 1 788  ? 170.725 165.727 102.931 1.00 141.79 ?  660  ILE A CD1   1 
ATOM   1936  N  N     . THR A 1 789  ? 166.330 163.362 105.234 1.00 51.04  ?  661  THR A N     1 
ATOM   1937  C  CA    . THR A 1 789  ? 165.299 162.439 105.695 1.00 42.65  ?  661  THR A CA    1 
ATOM   1938  C  C     . THR A 1 789  ? 164.813 161.601 104.519 1.00 46.86  ?  661  THR A C     1 
ATOM   1939  O  O     . THR A 1 789  ? 164.129 162.099 103.618 1.00 51.01  ?  661  THR A O     1 
ATOM   1940  C  CB    . THR A 1 789  ? 164.150 163.206 106.348 1.00 40.71  ?  661  THR A CB    1 
ATOM   1941  O  OG1   . THR A 1 789  ? 163.012 162.349 106.506 1.00 38.87  ?  661  THR A OG1   1 
ATOM   1942  C  CG2   . THR A 1 789  ? 163.751 164.436 105.535 1.00 41.80  ?  661  THR A CG2   1 
ATOM   1943  N  N     . ILE A 1 790  ? 165.197 160.323 104.505 1.00 52.77  ?  662  ILE A N     1 
ATOM   1944  C  CA    . ILE A 1 790  ? 164.664 159.401 103.503 1.00 55.05  ?  662  ILE A CA    1 
ATOM   1945  C  C     . ILE A 1 790  ? 163.189 159.142 103.768 1.00 49.24  ?  662  ILE A C     1 
ATOM   1946  O  O     . ILE A 1 790  ? 162.357 159.185 102.856 1.00 53.42  ?  662  ILE A O     1 
ATOM   1947  C  CB    . ILE A 1 790  ? 165.482 158.093 103.481 1.00 56.21  ?  662  ILE A CB    1 
ATOM   1948  C  CG1   . ILE A 1 790  ? 166.613 158.164 102.448 1.00 75.10  ?  662  ILE A CG1   1 
ATOM   1949  C  CG2   . ILE A 1 790  ? 164.598 156.889 103.181 1.00 65.96  ?  662  ILE A CG2   1 
ATOM   1950  C  CD1   . ILE A 1 790  ? 167.515 159.350 102.610 1.00 84.44  ?  662  ILE A CD1   1 
ATOM   1951  N  N     . PHE A 1 791  ? 162.843 158.895 105.028 1.00 54.30  ?  663  PHE A N     1 
ATOM   1952  C  CA    . PHE A 1 791  ? 161.459 158.620 105.397 1.00 51.11  ?  663  PHE A CA    1 
ATOM   1953  C  C     . PHE A 1 791  ? 161.287 158.921 106.876 1.00 42.09  ?  663  PHE A C     1 
ATOM   1954  O  O     . PHE A 1 791  ? 161.973 158.325 107.712 1.00 41.96  ?  663  PHE A O     1 
ATOM   1955  C  CB    . PHE A 1 791  ? 161.094 157.165 105.094 1.00 44.38  ?  663  PHE A CB    1 
ATOM   1956  C  CG    . PHE A 1 791  ? 160.164 156.541 106.106 1.00 38.46  ?  663  PHE A CG    1 
ATOM   1957  C  CD1   . PHE A 1 791  ? 158.841 156.927 106.191 1.00 59.26  ?  663  PHE A CD1   1 
ATOM   1958  C  CD2   . PHE A 1 791  ? 160.618 155.562 106.970 1.00 35.56  ?  663  PHE A CD2   1 
ATOM   1959  C  CE1   . PHE A 1 791  ? 157.996 156.341 107.115 1.00 54.34  ?  663  PHE A CE1   1 
ATOM   1960  C  CE2   . PHE A 1 791  ? 159.774 154.984 107.892 1.00 39.71  ?  663  PHE A CE2   1 
ATOM   1961  C  CZ    . PHE A 1 791  ? 158.469 155.371 107.962 1.00 37.26  ?  663  PHE A CZ    1 
ATOM   1962  N  N     . GLN A 1 792  ? 160.379 159.834 107.193 1.00 41.95  ?  664  GLN A N     1 
ATOM   1963  C  CA    . GLN A 1 792  ? 159.941 160.067 108.559 1.00 41.37  ?  664  GLN A CA    1 
ATOM   1964  C  C     . GLN A 1 792  ? 158.616 159.349 108.768 1.00 40.03  ?  664  GLN A C     1 
ATOM   1965  O  O     . GLN A 1 792  ? 157.696 159.494 107.957 1.00 46.16  ?  664  GLN A O     1 
ATOM   1966  C  CB    . GLN A 1 792  ? 159.785 161.562 108.839 1.00 55.83  ?  664  GLN A CB    1 
ATOM   1967  C  CG    . GLN A 1 792  ? 159.084 161.875 110.150 1.00 65.60  ?  664  GLN A CG    1 
ATOM   1968  C  CD    . GLN A 1 792  ? 159.029 163.359 110.450 1.00 61.61  ?  664  GLN A CD    1 
ATOM   1969  O  OE1   . GLN A 1 792  ? 159.135 164.197 109.550 1.00 72.89  ?  664  GLN A OE1   1 
ATOM   1970  N  NE2   . GLN A 1 792  ? 158.850 163.694 111.723 1.00 39.58  ?  664  GLN A NE2   1 
ATOM   1971  N  N     . GLU A 1 793  ? 158.533 158.555 109.832 1.00 45.52  ?  665  GLU A N     1 
ATOM   1972  C  CA    . GLU A 1 793  ? 157.304 157.834 110.135 1.00 54.77  ?  665  GLU A CA    1 
ATOM   1973  C  C     . GLU A 1 793  ? 156.175 158.835 110.376 1.00 63.50  ?  665  GLU A C     1 
ATOM   1974  O  O     . GLU A 1 793  ? 156.394 159.932 110.895 1.00 60.86  ?  665  GLU A O     1 
ATOM   1975  C  CB    . GLU A 1 793  ? 157.514 156.931 111.361 1.00 63.21  ?  665  GLU A CB    1 
ATOM   1976  C  CG    . GLU A 1 793  ? 156.302 156.729 112.251 1.00 80.05  ?  665  GLU A CG    1 
ATOM   1977  C  CD    . GLU A 1 793  ? 155.231 155.906 111.581 1.00 104.02 ?  665  GLU A CD    1 
ATOM   1978  O  OE1   . GLU A 1 793  ? 155.583 154.931 110.883 1.00 70.23  ?  665  GLU A OE1   1 
ATOM   1979  O  OE2   . GLU A 1 793  ? 154.045 156.272 111.699 1.00 229.37 -1 665  GLU A OE2   1 
ATOM   1980  N  N     . GLN A 1 794  ? 154.954 158.455 109.995 1.00 64.17  ?  666  GLN A N     1 
ATOM   1981  C  CA    . GLN A 1 794  ? 153.829 159.383 109.978 1.00 52.93  ?  666  GLN A CA    1 
ATOM   1982  C  C     . GLN A 1 794  ? 152.910 159.272 111.191 1.00 50.94  ?  666  GLN A C     1 
ATOM   1983  O  O     . GLN A 1 794  ? 152.394 160.291 111.663 1.00 52.11  ?  666  GLN A O     1 
ATOM   1984  C  CB    . GLN A 1 794  ? 153.006 159.201 108.697 1.00 44.97  ?  666  GLN A CB    1 
ATOM   1985  C  CG    . GLN A 1 794  ? 152.404 160.501 108.226 1.00 61.41  ?  666  GLN A CG    1 
ATOM   1986  C  CD    . GLN A 1 794  ? 153.453 161.575 108.081 1.00 56.64  ?  666  GLN A CD    1 
ATOM   1987  O  OE1   . GLN A 1 794  ? 153.384 162.619 108.733 1.00 51.63  ?  666  GLN A OE1   1 
ATOM   1988  N  NE2   . GLN A 1 794  ? 154.444 161.321 107.235 1.00 59.86  ?  666  GLN A NE2   1 
ATOM   1989  N  N     . LYS A 1 795  ? 152.696 158.067 111.715 1.00 55.94  ?  667  LYS A N     1 
ATOM   1990  C  CA    . LYS A 1 795  ? 151.827 157.853 112.869 1.00 41.64  ?  667  LYS A CA    1 
ATOM   1991  C  C     . LYS A 1 795  ? 152.589 157.215 114.027 1.00 51.96  ?  667  LYS A C     1 
ATOM   1992  O  O     . LYS A 1 795  ? 152.206 156.135 114.493 1.00 49.91  ?  667  LYS A O     1 
ATOM   1993  C  CB    . LYS A 1 795  ? 150.643 156.969 112.476 1.00 41.80  ?  667  LYS A CB    1 
ATOM   1994  C  CG    . LYS A 1 795  ? 150.090 157.214 111.079 1.00 47.30  ?  667  LYS A CG    1 
ATOM   1995  C  CD    . LYS A 1 795  ? 148.928 156.275 110.798 1.00 50.47  ?  667  LYS A CD    1 
ATOM   1996  C  CE    . LYS A 1 795  ? 147.788 156.499 111.769 1.00 38.83  ?  667  LYS A CE    1 
ATOM   1997  N  NZ    . LYS A 1 795  ? 146.527 155.891 111.277 1.00 25.93  ?  667  LYS A NZ    1 
ATOM   1998  N  N     . PRO A 1 796  ? 153.656 157.847 114.527 1.00 58.98  ?  668  PRO A N     1 
ATOM   1999  C  CA    . PRO A 1 796  ? 154.539 157.158 115.486 1.00 64.20  ?  668  PRO A CA    1 
ATOM   2000  C  C     . PRO A 1 796  ? 153.879 156.846 116.813 1.00 48.81  ?  668  PRO A C     1 
ATOM   2001  O  O     . PRO A 1 796  ? 154.478 156.135 117.632 1.00 52.52  ?  668  PRO A O     1 
ATOM   2002  C  CB    . PRO A 1 796  ? 155.698 158.142 115.659 1.00 73.01  ?  668  PRO A CB    1 
ATOM   2003  C  CG    . PRO A 1 796  ? 155.043 159.469 115.500 1.00 76.52  ?  668  PRO A CG    1 
ATOM   2004  C  CD    . PRO A 1 796  ? 153.962 159.287 114.449 1.00 73.64  ?  668  PRO A CD    1 
ATOM   2005  N  N     . ASN A 1 797  ? 152.677 157.360 117.054 1.00 35.75  ?  669  ASN A N     1 
ATOM   2006  C  CA    . ASN A 1 797  ? 151.916 157.028 118.247 1.00 31.95  ?  669  ASN A CA    1 
ATOM   2007  C  C     . ASN A 1 797  ? 150.818 156.019 117.977 1.00 27.41  ?  669  ASN A C     1 
ATOM   2008  O  O     . ASN A 1 797  ? 150.423 155.294 118.889 1.00 39.80  ?  669  ASN A O     1 
ATOM   2009  C  CB    . ASN A 1 797  ? 151.310 158.295 118.838 1.00 41.89  ?  669  ASN A CB    1 
ATOM   2010  C  CG    . ASN A 1 797  ? 152.226 159.485 118.681 1.00 68.83  ?  669  ASN A CG    1 
ATOM   2011  O  OD1   . ASN A 1 797  ? 152.619 159.826 117.565 1.00 74.75  ?  669  ASN A OD1   1 
ATOM   2012  N  ND2   . ASN A 1 797  ? 152.601 160.105 119.793 1.00 73.00  ?  669  ASN A ND2   1 
ATOM   2013  N  N     . SER A 1 798  ? 150.312 155.958 116.754 1.00 30.60  ?  670  SER A N     1 
ATOM   2014  C  CA    . SER A 1 798  ? 149.326 154.947 116.415 1.00 33.80  ?  670  SER A CA    1 
ATOM   2015  C  C     . SER A 1 798  ? 149.909 153.558 116.666 1.00 28.07  ?  670  SER A C     1 
ATOM   2016  O  O     . SER A 1 798  ? 150.958 153.205 116.120 1.00 30.38  ?  670  SER A O     1 
ATOM   2017  C  CB    . SER A 1 798  ? 148.897 155.115 114.958 1.00 45.45  ?  670  SER A CB    1 
ATOM   2018  O  OG    . SER A 1 798  ? 147.944 154.146 114.564 1.00 66.10  ?  670  SER A OG    1 
ATOM   2019  N  N     . GLU A 1 799  ? 149.226 152.782 117.513 1.00 32.88  ?  671  GLU A N     1 
ATOM   2020  C  CA    . GLU A 1 799  ? 149.690 151.454 117.905 1.00 28.64  ?  671  GLU A CA    1 
ATOM   2021  C  C     . GLU A 1 799  ? 149.887 150.526 116.717 1.00 18.59  ?  671  GLU A C     1 
ATOM   2022  O  O     . GLU A 1 799  ? 150.648 149.555 116.806 1.00 20.98  ?  671  GLU A O     1 
ATOM   2023  C  CB    . GLU A 1 799  ? 148.697 150.814 118.886 1.00 46.97  ?  671  GLU A CB    1 
ATOM   2024  C  CG    . GLU A 1 799  ? 147.359 150.335 118.276 1.00 78.83  ?  671  GLU A CG    1 
ATOM   2025  C  CD    . GLU A 1 799  ? 146.433 151.450 117.796 1.00 126.88 ?  671  GLU A CD    1 
ATOM   2026  O  OE1   . GLU A 1 799  ? 146.907 152.436 117.195 1.00 97.93  ?  671  GLU A OE1   1 
ATOM   2027  O  OE2   . GLU A 1 799  ? 145.205 151.317 117.998 1.00 314.33 -1 671  GLU A OE2   1 
ATOM   2028  N  N     . LEU A 1 800  ? 149.186 150.786 115.614 1.00 17.27  ?  672  LEU A N     1 
ATOM   2029  C  CA    . LEU A 1 800  ? 149.337 149.991 114.402 1.00 12.96  ?  672  LEU A CA    1 
ATOM   2030  C  C     . LEU A 1 800  ? 150.791 149.837 113.993 1.00 10.86  ?  672  LEU A C     1 
ATOM   2031  O  O     . LEU A 1 800  ? 151.136 148.861 113.315 1.00 12.01  ?  672  LEU A O     1 
ATOM   2032  C  CB    . LEU A 1 800  ? 148.550 150.633 113.257 1.00 22.33  ?  672  LEU A CB    1 
ATOM   2033  C  CG    . LEU A 1 800  ? 147.029 150.659 113.410 1.00 44.10  ?  672  LEU A CG    1 
ATOM   2034  C  CD1   . LEU A 1 800  ? 146.336 151.385 112.248 1.00 41.43  ?  672  LEU A CD1   1 
ATOM   2035  C  CD2   . LEU A 1 800  ? 146.516 149.245 113.554 1.00 39.53  ?  672  LEU A CD2   1 
ATOM   2036  N  N     . SER A 1 801  ? 151.645 150.781 114.379 1.00 9.34   ?  673  SER A N     1 
ATOM   2037  C  CA    . SER A 1 801  ? 153.093 150.672 114.217 1.00 9.78   ?  673  SER A CA    1 
ATOM   2038  C  C     . SER A 1 801  ? 153.715 150.813 115.603 1.00 9.70   ?  673  SER A C     1 
ATOM   2039  O  O     . SER A 1 801  ? 154.122 151.899 116.018 1.00 7.87   ?  673  SER A O     1 
ATOM   2040  C  CB    . SER A 1 801  ? 153.632 151.729 113.233 1.00 12.09  ?  673  SER A CB    1 
ATOM   2041  O  OG    . SER A 1 801  ? 155.043 151.688 113.128 1.00 8.76   ?  673  SER A OG    1 
ATOM   2042  N  N     . CYS A 1 802  ? 153.746 149.696 116.333 1.00 11.27  ?  674  CYS A N     1 
ATOM   2043  C  CA    . CYS A 1 802  ? 154.533 149.579 117.559 1.00 9.78   ?  674  CYS A CA    1 
ATOM   2044  C  C     . CYS A 1 802  ? 154.762 148.084 117.793 1.00 20.38  ?  674  CYS A C     1 
ATOM   2045  O  O     . CYS A 1 802  ? 153.891 147.413 118.354 1.00 26.70  ?  674  CYS A O     1 
ATOM   2046  C  CB    . CYS A 1 802  ? 153.816 150.226 118.725 1.00 10.49  ?  674  CYS A CB    1 
ATOM   2047  S  SG    . CYS A 1 802  ? 154.668 150.056 120.283 1.00 35.40  ?  674  CYS A SG    1 
ATOM   2048  N  N     . ARG A 1 803  ? 155.949 147.584 117.400 1.00 12.09  ?  675  ARG A N     1 
ATOM   2049  C  CA    . ARG A 1 803  ? 156.021 146.124 117.402 1.00 11.23  ?  675  ARG A CA    1 
ATOM   2050  C  C     . ARG A 1 803  ? 156.717 145.598 118.655 1.00 12.83  ?  675  ARG A C     1 
ATOM   2051  O  O     . ARG A 1 803  ? 157.765 146.113 119.054 1.00 8.31   ?  675  ARG A O     1 
ATOM   2052  C  CB    . ARG A 1 803  ? 156.735 145.580 116.160 1.00 14.19  ?  675  ARG A CB    1 
ATOM   2053  C  CG    . ARG A 1 803  ? 157.939 146.351 115.688 1.00 17.77  ?  675  ARG A CG    1 
ATOM   2054  C  CD    . ARG A 1 803  ? 157.601 147.148 114.438 1.00 19.32  ?  675  ARG A CD    1 
ATOM   2055  N  NE    . ARG A 1 803  ? 157.064 146.320 113.367 1.00 19.69  ?  675  ARG A NE    1 
ATOM   2056  C  CZ    . ARG A 1 803  ? 157.809 145.572 112.558 1.00 41.14  ?  675  ARG A CZ    1 
ATOM   2057  N  NH1   . ARG A 1 803  ? 159.125 145.550 112.698 1.00 67.92  ?  675  ARG A NH1   1 
ATOM   2058  N  NH2   . ARG A 1 803  ? 157.239 144.861 111.594 1.00 46.28  ?  675  ARG A NH2   1 
ATOM   2059  N  N     . PRO A 1 804  ? 156.136 144.553 119.229 1.00 23.27  ?  676  PRO A N     1 
ATOM   2060  C  CA    . PRO A 1 804  ? 156.680 143.992 120.456 1.00 26.52  ?  676  PRO A CA    1 
ATOM   2061  C  C     . PRO A 1 804  ? 157.933 143.198 120.177 1.00 12.64  ?  676  PRO A C     1 
ATOM   2062  O  O     . PRO A 1 804  ? 158.135 142.651 119.092 1.00 12.61  ?  676  PRO A O     1 
ATOM   2063  C  CB    . PRO A 1 804  ? 155.553 143.091 120.954 1.00 30.16  ?  676  PRO A CB    1 
ATOM   2064  C  CG    . PRO A 1 804  ? 154.963 142.604 119.698 1.00 15.74  ?  676  PRO A CG    1 
ATOM   2065  C  CD    . PRO A 1 804  ? 154.986 143.773 118.752 1.00 33.00  ?  676  PRO A CD    1 
ATOM   2066  N  N     . LEU A 1 805  ? 158.785 143.151 121.178 1.00 29.85  ?  677  LEU A N     1 
ATOM   2067  C  CA    . LEU A 1 805  ? 160.007 142.391 121.077 1.00 23.12  ?  677  LEU A CA    1 
ATOM   2068  C  C     . LEU A 1 805  ? 160.275 141.525 122.286 1.00 36.81  ?  677  LEU A C     1 
ATOM   2069  O  O     . LEU A 1 805  ? 160.983 140.517 122.154 1.00 43.10  ?  677  LEU A O     1 
ATOM   2070  C  CB    . LEU A 1 805  ? 161.186 143.332 120.827 1.00 21.27  ?  677  LEU A CB    1 
ATOM   2071  C  CG    . LEU A 1 805  ? 162.557 142.719 120.893 1.00 24.46  ?  677  LEU A CG    1 
ATOM   2072  C  CD1   . LEU A 1 805  ? 163.341 143.158 119.701 1.00 43.98  ?  677  LEU A CD1   1 
ATOM   2073  C  CD2   . LEU A 1 805  ? 163.195 143.211 122.164 1.00 26.63  ?  677  LEU A CD2   1 
ATOM   2074  N  N     . CYS A 1 806  ? 159.697 141.835 123.439 1.00 24.86  ?  678  CYS A N     1 
ATOM   2075  C  CA    . CYS A 1 806  ? 159.885 140.965 124.585 1.00 17.14  ?  678  CYS A CA    1 
ATOM   2076  C  C     . CYS A 1 806  ? 158.678 141.061 125.511 1.00 15.89  ?  678  CYS A C     1 
ATOM   2077  O  O     . CYS A 1 806  ? 158.070 142.128 125.651 1.00 23.45  ?  678  CYS A O     1 
ATOM   2078  C  CB    . CYS A 1 806  ? 161.183 141.340 125.290 1.00 14.01  ?  678  CYS A CB    1 
ATOM   2079  S  SG    . CYS A 1 806  ? 161.233 140.916 127.011 1.00 75.76  ?  678  CYS A SG    1 
ATOM   2080  N  N     . LEU A 1 807  ? 158.334 139.931 126.143 1.00 29.56  ?  679  LEU A N     1 
ATOM   2081  C  CA    . LEU A 1 807  ? 157.195 139.877 127.060 1.00 26.04  ?  679  LEU A CA    1 
ATOM   2082  C  C     . LEU A 1 807  ? 157.484 138.932 128.218 1.00 51.55  ?  679  LEU A C     1 
ATOM   2083  O  O     . LEU A 1 807  ? 158.010 137.833 128.006 1.00 36.07  ?  679  LEU A O     1 
ATOM   2084  C  CB    . LEU A 1 807  ? 155.921 139.422 126.355 1.00 37.54  ?  679  LEU A CB    1 
ATOM   2085  C  CG    . LEU A 1 807  ? 155.351 140.396 125.345 1.00 42.04  ?  679  LEU A CG    1 
ATOM   2086  C  CD1   . LEU A 1 807  ? 155.931 140.127 123.992 1.00 24.48  ?  679  LEU A CD1   1 
ATOM   2087  C  CD2   . LEU A 1 807  ? 153.867 140.248 125.317 1.00 28.40  ?  679  LEU A CD2   1 
ATOM   2088  N  N     . MET A 1 808  ? 157.126 139.358 129.435 1.00 24.78  ?  680  MET A N     1 
ATOM   2089  C  CA    . MET A 1 808  ? 157.348 138.577 130.643 1.00 16.56  ?  680  MET A CA    1 
ATOM   2090  C  C     . MET A 1 808  ? 156.194 138.760 131.618 1.00 13.31  ?  680  MET A C     1 
ATOM   2091  O  O     . MET A 1 808  ? 155.592 139.837 131.703 1.00 15.59  ?  680  MET A O     1 
ATOM   2092  C  CB    . MET A 1 808  ? 158.614 138.980 131.395 1.00 12.70  ?  680  MET A CB    1 
ATOM   2093  C  CG    . MET A 1 808  ? 159.781 139.347 130.548 1.00 18.50  ?  680  MET A CG    1 
ATOM   2094  S  SD    . MET A 1 808  ? 159.680 141.086 130.096 1.00 94.91  ?  680  MET A SD    1 
ATOM   2095  C  CE    . MET A 1 808  ? 159.931 141.863 131.687 1.00 39.92  ?  680  MET A CE    1 
ATOM   2096  N  N     . PHE A 1 809  ? 155.931 137.703 132.394 1.00 15.09  ?  681  PHE A N     1 
ATOM   2097  C  CA    . PHE A 1 809  ? 154.945 137.727 133.475 1.00 7.75   ?  681  PHE A CA    1 
ATOM   2098  C  C     . PHE A 1 809  ? 155.631 138.084 134.786 1.00 9.05   ?  681  PHE A C     1 
ATOM   2099  O  O     . PHE A 1 809  ? 155.811 137.258 135.682 1.00 16.69  ?  681  PHE A O     1 
ATOM   2100  C  CB    . PHE A 1 809  ? 154.227 136.394 133.585 1.00 8.32   ?  681  PHE A CB    1 
ATOM   2101  C  CG    . PHE A 1 809  ? 153.279 136.126 132.471 1.00 16.84  ?  681  PHE A CG    1 
ATOM   2102  C  CD1   . PHE A 1 809  ? 153.185 136.998 131.406 1.00 18.80  ?  681  PHE A CD1   1 
ATOM   2103  C  CD2   . PHE A 1 809  ? 152.462 135.021 132.496 1.00 17.98  ?  681  PHE A CD2   1 
ATOM   2104  C  CE1   . PHE A 1 809  ? 152.308 136.751 130.388 1.00 45.69  ?  681  PHE A CE1   1 
ATOM   2105  C  CE2   . PHE A 1 809  ? 151.583 134.780 131.479 1.00 35.25  ?  681  PHE A CE2   1 
ATOM   2106  C  CZ    . PHE A 1 809  ? 151.509 135.646 130.429 1.00 68.99  ?  681  PHE A CZ    1 
ATOM   2107  N  N     . VAL A 1 810  ? 156.016 139.352 134.898 1.00 12.87  ?  682  VAL A N     1 
ATOM   2108  C  CA    . VAL A 1 810  ? 156.692 139.857 136.068 1.00 12.35  ?  682  VAL A CA    1 
ATOM   2109  C  C     . VAL A 1 810  ? 155.945 141.102 136.539 1.00 20.55  ?  682  VAL A C     1 
ATOM   2110  O  O     . VAL A 1 810  ? 155.078 141.630 135.845 1.00 30.50  ?  682  VAL A O     1 
ATOM   2111  C  CB    . VAL A 1 810  ? 158.174 140.164 135.797 1.00 36.49  ?  682  VAL A CB    1 
ATOM   2112  C  CG1   . VAL A 1 810  ? 158.960 140.204 137.092 1.00 72.24  ?  682  VAL A CG1   1 
ATOM   2113  C  CG2   . VAL A 1 810  ? 158.760 139.146 134.843 1.00 43.67  ?  682  VAL A CG2   1 
ATOM   2114  N  N     . ASP A 1 811  ? 156.291 141.570 137.731 1.00 30.00  ?  683  ASP A N     1 
ATOM   2115  C  CA    . ASP A 1 811  ? 155.739 142.790 138.280 1.00 34.88  ?  683  ASP A CA    1 
ATOM   2116  C  C     . ASP A 1 811  ? 156.620 143.958 137.868 1.00 42.47  ?  683  ASP A C     1 
ATOM   2117  O  O     . ASP A 1 811  ? 157.837 143.832 137.723 1.00 34.84  ?  683  ASP A O     1 
ATOM   2118  C  CB    . ASP A 1 811  ? 155.623 142.660 139.810 1.00 64.99  ?  683  ASP A CB    1 
ATOM   2119  C  CG    . ASP A 1 811  ? 155.102 143.926 140.505 1.00 89.25  ?  683  ASP A CG    1 
ATOM   2120  O  OD1   . ASP A 1 811  ? 155.411 145.059 140.082 1.00 76.08  ?  683  ASP A OD1   1 
ATOM   2121  O  OD2   . ASP A 1 811  ? 154.352 143.773 141.497 1.00 243.63 -1 683  ASP A OD2   1 
ATOM   2122  N  N     . GLU A 1 812  ? 155.972 145.095 137.628 1.00 30.72  ?  684  GLU A N     1 
ATOM   2123  C  CA    . GLU A 1 812  ? 156.684 146.310 137.243 1.00 27.50  ?  684  GLU A CA    1 
ATOM   2124  C  C     . GLU A 1 812  ? 157.635 146.762 138.335 1.00 27.88  ?  684  GLU A C     1 
ATOM   2125  O  O     . GLU A 1 812  ? 158.670 147.376 138.048 1.00 37.30  ?  684  GLU A O     1 
ATOM   2126  C  CB    . GLU A 1 812  ? 155.660 147.399 136.926 1.00 76.07  ?  684  GLU A CB    1 
ATOM   2127  C  CG    . GLU A 1 812  ? 156.240 148.719 136.481 1.00 122.09 ?  684  GLU A CG    1 
ATOM   2128  C  CD    . GLU A 1 812  ? 155.163 149.749 136.171 1.00 160.63 ?  684  GLU A CD    1 
ATOM   2129  O  OE1   . GLU A 1 812  ? 154.023 149.619 136.678 1.00 121.03 ?  684  GLU A OE1   1 
ATOM   2130  O  OE2   . GLU A 1 812  ? 155.462 150.694 135.415 1.00 284.78 -1 684  GLU A OE2   1 
ATOM   2131  N  N     . SER A 1 813  ? 157.305 146.461 139.593 1.00 32.05  ?  685  SER A N     1 
ATOM   2132  C  CA    . SER A 1 813  ? 158.038 147.027 140.721 1.00 37.98  ?  685  SER A CA    1 
ATOM   2133  C  C     . SER A 1 813  ? 159.362 146.306 140.931 1.00 43.26  ?  685  SER A C     1 
ATOM   2134  O  O     . SER A 1 813  ? 160.426 146.907 140.799 1.00 43.23  ?  685  SER A O     1 
ATOM   2135  C  CB    . SER A 1 813  ? 157.183 146.946 141.990 1.00 46.56  ?  685  SER A CB    1 
ATOM   2136  O  OG    . SER A 1 813  ? 155.840 147.306 141.729 1.00 60.70  ?  685  SER A OG    1 
ATOM   2137  N  N     . ASP A 1 814  ? 159.320 145.005 141.262 1.00 35.25  ?  686  ASP A N     1 
ATOM   2138  C  CA    . ASP A 1 814  ? 160.523 144.313 141.730 1.00 29.91  ?  686  ASP A CA    1 
ATOM   2139  C  C     . ASP A 1 814  ? 161.682 144.425 140.736 1.00 21.20  ?  686  ASP A C     1 
ATOM   2140  O  O     . ASP A 1 814  ? 161.608 143.922 139.610 1.00 21.68  ?  686  ASP A O     1 
ATOM   2141  C  CB    . ASP A 1 814  ? 160.261 142.833 142.037 1.00 28.15  ?  686  ASP A CB    1 
ATOM   2142  C  CG    . ASP A 1 814  ? 159.773 142.062 140.846 1.00 55.37  ?  686  ASP A CG    1 
ATOM   2143  O  OD1   . ASP A 1 814  ? 159.124 142.653 139.955 1.00 60.95  ?  686  ASP A OD1   1 
ATOM   2144  O  OD2   . ASP A 1 814  ? 160.136 140.874 140.755 1.00 163.30 -1 686  ASP A OD2   1 
ATOM   2145  N  N     . HIS A 1 815  ? 162.758 145.077 141.174 1.00 24.70  ?  687  HIS A N     1 
ATOM   2146  C  CA    . HIS A 1 815  ? 163.906 145.282 140.307 1.00 15.18  ?  687  HIS A CA    1 
ATOM   2147  C  C     . HIS A 1 815  ? 164.532 143.953 139.907 1.00 16.53  ?  687  HIS A C     1 
ATOM   2148  O  O     . HIS A 1 815  ? 165.014 143.792 138.773 1.00 22.94  ?  687  HIS A O     1 
ATOM   2149  C  CB    . HIS A 1 815  ? 164.933 146.166 140.998 1.00 10.46  ?  687  HIS A CB    1 
ATOM   2150  C  CG    . HIS A 1 815  ? 165.521 147.212 140.099 1.00 11.41  ?  687  HIS A CG    1 
ATOM   2151  N  ND1   . HIS A 1 815  ? 166.562 146.963 139.234 1.00 19.29  ?  687  HIS A ND1   1 
ATOM   2152  C  CD2   . HIS A 1 815  ? 165.115 148.478 139.854 1.00 13.90  ?  687  HIS A CD2   1 
ATOM   2153  C  CE1   . HIS A 1 815  ? 166.819 148.053 138.543 1.00 18.57  ?  687  HIS A CE1   1 
ATOM   2154  N  NE2   . HIS A 1 815  ? 165.950 148.983 138.894 1.00 17.98  ?  687  HIS A NE2   1 
ATOM   2155  N  N     . GLU A 1 816  ? 164.526 142.989 140.825 1.00 17.27  ?  688  GLU A N     1 
ATOM   2156  C  CA    . GLU A 1 816  ? 165.301 141.767 140.668 1.00 24.21  ?  688  GLU A CA    1 
ATOM   2157  C  C     . GLU A 1 816  ? 164.939 141.047 139.381 1.00 28.51  ?  688  GLU A C     1 
ATOM   2158  O  O     . GLU A 1 816  ? 165.767 140.959 138.468 1.00 41.11  ?  688  GLU A O     1 
ATOM   2159  C  CB    . GLU A 1 816  ? 165.108 140.848 141.881 1.00 41.44  ?  688  GLU A CB    1 
ATOM   2160  C  CG    . GLU A 1 816  ? 166.368 140.018 142.215 1.00 127.91 ?  688  GLU A CG    1 
ATOM   2161  C  CD    . GLU A 1 816  ? 166.776 139.026 141.121 1.00 164.76 ?  688  GLU A CD    1 
ATOM   2162  O  OE1   . GLU A 1 816  ? 165.893 138.506 140.405 1.00 124.46 ?  688  GLU A OE1   1 
ATOM   2163  O  OE2   . GLU A 1 816  ? 167.991 138.811 140.931 1.00 337.67 -1 688  GLU A OE2   1 
ATOM   2164  N  N     . THR A 1 817  ? 163.703 140.556 139.278 1.00 20.85  ?  689  THR A N     1 
ATOM   2165  C  CA    . THR A 1 817  ? 163.388 139.689 138.153 1.00 19.74  ?  689  THR A CA    1 
ATOM   2166  C  C     . THR A 1 817  ? 163.349 140.471 136.848 1.00 14.85  ?  689  THR A C     1 
ATOM   2167  O  O     . THR A 1 817  ? 163.733 139.946 135.790 1.00 21.96  ?  689  THR A O     1 
ATOM   2168  C  CB    . THR A 1 817  ? 162.063 138.957 138.380 1.00 29.38  ?  689  THR A CB    1 
ATOM   2169  O  OG1   . THR A 1 817  ? 161.904 138.661 139.774 1.00 44.63  ?  689  THR A OG1   1 
ATOM   2170  C  CG2   . THR A 1 817  ? 162.070 137.646 137.614 1.00 31.17  ?  689  THR A CG2   1 
ATOM   2171  N  N     . LEU A 1 818  ? 162.912 141.728 136.908 1.00 14.05  ?  690  LEU A N     1 
ATOM   2172  C  CA    . LEU A 1 818  ? 162.897 142.570 135.718 1.00 11.41  ?  690  LEU A CA    1 
ATOM   2173  C  C     . LEU A 1 818  ? 164.301 142.675 135.118 1.00 15.65  ?  690  LEU A C     1 
ATOM   2174  O  O     . LEU A 1 818  ? 164.482 142.474 133.910 1.00 14.65  ?  690  LEU A O     1 
ATOM   2175  C  CB    . LEU A 1 818  ? 162.295 143.940 136.055 1.00 11.71  ?  690  LEU A CB    1 
ATOM   2176  C  CG    . LEU A 1 818  ? 162.028 144.917 134.903 1.00 12.70  ?  690  LEU A CG    1 
ATOM   2177  C  CD1   . LEU A 1 818  ? 161.115 144.319 133.883 1.00 8.49   ?  690  LEU A CD1   1 
ATOM   2178  C  CD2   . LEU A 1 818  ? 161.425 146.235 135.419 1.00 12.93  ?  690  LEU A CD2   1 
ATOM   2179  N  N     . THR A 1 819  ? 165.311 142.967 135.951 1.00 13.29  ?  691  THR A N     1 
ATOM   2180  C  CA    . THR A 1 819  ? 166.692 142.972 135.469 1.00 17.48  ?  691  THR A CA    1 
ATOM   2181  C  C     . THR A 1 819  ? 167.074 141.604 134.923 1.00 11.18  ?  691  THR A C     1 
ATOM   2182  O  O     . THR A 1 819  ? 167.554 141.478 133.789 1.00 11.77  ?  691  THR A O     1 
ATOM   2183  C  CB    . THR A 1 819  ? 167.692 143.366 136.576 1.00 11.86  ?  691  THR A CB    1 
ATOM   2184  O  OG1   . THR A 1 819  ? 167.286 142.819 137.841 1.00 18.43  ?  691  THR A OG1   1 
ATOM   2185  C  CG2   . THR A 1 819  ? 167.895 144.879 136.696 1.00 20.96  ?  691  THR A CG2   1 
ATOM   2186  N  N     . ALA A 1 820  ? 166.889 140.566 135.744 1.00 25.37  ?  692  ALA A N     1 
ATOM   2187  C  CA    . ALA A 1 820  ? 167.322 139.211 135.402 1.00 32.69  ?  692  ALA A CA    1 
ATOM   2188  C  C     . ALA A 1 820  ? 166.828 138.751 134.038 1.00 25.94  ?  692  ALA A C     1 
ATOM   2189  O  O     . ALA A 1 820  ? 167.453 137.890 133.406 1.00 23.98  ?  692  ALA A O     1 
ATOM   2190  C  CB    . ALA A 1 820  ? 166.833 138.225 136.464 1.00 50.51  ?  692  ALA A CB    1 
ATOM   2191  N  N     . ILE A 1 821  ? 165.688 139.262 133.590 1.00 17.32  ?  693  ILE A N     1 
ATOM   2192  C  CA    . ILE A 1 821  ? 165.221 138.904 132.256 1.00 10.55  ?  693  ILE A CA    1 
ATOM   2193  C  C     . ILE A 1 821  ? 165.698 139.908 131.213 1.00 26.26  ?  693  ILE A C     1 
ATOM   2194  O  O     . ILE A 1 821  ? 166.171 139.524 130.141 1.00 11.09  ?  693  ILE A O     1 
ATOM   2195  C  CB    . ILE A 1 821  ? 163.689 138.753 132.235 1.00 6.92   ?  693  ILE A CB    1 
ATOM   2196  C  CG1   . ILE A 1 821  ? 163.291 137.364 132.745 1.00 13.97  ?  693  ILE A CG1   1 
ATOM   2197  C  CG2   . ILE A 1 821  ? 163.170 138.976 130.840 1.00 7.43   ?  693  ILE A CG2   1 
ATOM   2198  C  CD1   . ILE A 1 821  ? 163.302 136.287 131.690 1.00 15.25  ?  693  ILE A CD1   1 
ATOM   2199  N  N     . LEU A 1 822  ? 165.578 141.208 131.494 1.00 11.40  ?  694  LEU A N     1 
ATOM   2200  C  CA    . LEU A 1 822  ? 165.833 142.215 130.470 1.00 10.98  ?  694  LEU A CA    1 
ATOM   2201  C  C     . LEU A 1 822  ? 167.309 142.352 130.121 1.00 19.39  ?  694  LEU A C     1 
ATOM   2202  O  O     . LEU A 1 822  ? 167.633 142.928 129.075 1.00 11.69  ?  694  LEU A O     1 
ATOM   2203  C  CB    . LEU A 1 822  ? 165.295 143.571 130.924 1.00 9.95   ?  694  LEU A CB    1 
ATOM   2204  C  CG    . LEU A 1 822  ? 164.081 144.033 130.128 1.00 8.18   ?  694  LEU A CG    1 
ATOM   2205  C  CD1   . LEU A 1 822  ? 162.905 143.130 130.412 1.00 11.25  ?  694  LEU A CD1   1 
ATOM   2206  C  CD2   . LEU A 1 822  ? 163.734 145.482 130.400 1.00 7.60   ?  694  LEU A CD2   1 
ATOM   2207  N  N     . GLY A 1 823  ? 168.199 141.856 130.977 1.00 22.34  ?  695  GLY A N     1 
ATOM   2208  C  CA    . GLY A 1 823  ? 169.630 141.924 130.774 1.00 10.11  ?  695  GLY A CA    1 
ATOM   2209  C  C     . GLY A 1 823  ? 170.117 141.666 129.361 1.00 7.78   ?  695  GLY A C     1 
ATOM   2210  O  O     . GLY A 1 823  ? 170.844 142.482 128.782 1.00 11.96  ?  695  GLY A O     1 
ATOM   2211  N  N     . PRO A 1 824  ? 169.773 140.498 128.796 1.00 10.72  ?  696  PRO A N     1 
ATOM   2212  C  CA    . PRO A 1 824  ? 170.127 140.216 127.396 1.00 16.35  ?  696  PRO A CA    1 
ATOM   2213  C  C     . PRO A 1 824  ? 169.900 141.379 126.438 1.00 17.13  ?  696  PRO A C     1 
ATOM   2214  O  O     . PRO A 1 824  ? 170.821 141.777 125.718 1.00 28.26  ?  696  PRO A O     1 
ATOM   2215  C  CB    . PRO A 1 824  ? 169.223 139.027 127.050 1.00 13.46  ?  696  PRO A CB    1 
ATOM   2216  C  CG    . PRO A 1 824  ? 169.045 138.319 128.344 1.00 14.83  ?  696  PRO A CG    1 
ATOM   2217  C  CD    . PRO A 1 824  ? 169.172 139.325 129.457 1.00 16.80  ?  696  PRO A CD    1 
ATOM   2218  N  N     . VAL A 1 825  ? 168.685 141.930 126.432 1.00 10.64  ?  697  VAL A N     1 
ATOM   2219  C  CA    . VAL A 1 825  ? 168.341 143.003 125.500 1.00 11.65  ?  697  VAL A CA    1 
ATOM   2220  C  C     . VAL A 1 825  ? 169.194 144.239 125.764 1.00 10.82  ?  697  VAL A C     1 
ATOM   2221  O  O     . VAL A 1 825  ? 169.582 144.965 124.838 1.00 15.98  ?  697  VAL A O     1 
ATOM   2222  C  CB    . VAL A 1 825  ? 166.837 143.319 125.604 1.00 8.76   ?  697  VAL A CB    1 
ATOM   2223  C  CG1   . VAL A 1 825  ? 166.495 144.559 124.802 1.00 11.12  ?  697  VAL A CG1   1 
ATOM   2224  C  CG2   . VAL A 1 825  ? 166.021 142.132 125.147 1.00 7.69   ?  697  VAL A CG2   1 
ATOM   2225  N  N     . VAL A 1 826  ? 169.477 144.507 127.034 1.00 8.05   ?  698  VAL A N     1 
ATOM   2226  C  CA    . VAL A 1 826  ? 170.339 145.624 127.399 1.00 12.96  ?  698  VAL A CA    1 
ATOM   2227  C  C     . VAL A 1 826  ? 171.713 145.450 126.767 1.00 10.81  ?  698  VAL A C     1 
ATOM   2228  O  O     . VAL A 1 826  ? 172.240 146.351 126.101 1.00 15.82  ?  698  VAL A O     1 
ATOM   2229  C  CB    . VAL A 1 826  ? 170.444 145.720 128.929 1.00 10.38  ?  698  VAL A CB    1 
ATOM   2230  C  CG1   . VAL A 1 826  ? 171.609 146.611 129.333 1.00 12.30  ?  698  VAL A CG1   1 
ATOM   2231  C  CG2   . VAL A 1 826  ? 169.122 146.172 129.539 1.00 8.70   ?  698  VAL A CG2   1 
ATOM   2232  N  N     . ALA A 1 827  ? 172.321 144.286 126.990 1.00 16.57  ?  699  ALA A N     1 
ATOM   2233  C  CA    . ALA A 1 827  ? 173.646 144.029 126.436 1.00 21.07  ?  699  ALA A CA    1 
ATOM   2234  C  C     . ALA A 1 827  ? 173.639 144.150 124.918 1.00 17.95  ?  699  ALA A C     1 
ATOM   2235  O  O     . ALA A 1 827  ? 174.580 144.689 124.323 1.00 19.72  ?  699  ALA A O     1 
ATOM   2236  C  CB    . ALA A 1 827  ? 174.131 142.645 126.870 1.00 27.77  ?  699  ALA A CB    1 
ATOM   2237  N  N     . GLU A 1 828  ? 172.590 143.634 124.275 1.00 23.30  ?  700  GLU A N     1 
ATOM   2238  C  CA    . GLU A 1 828  ? 172.466 143.752 122.824 1.00 26.73  ?  700  GLU A CA    1 
ATOM   2239  C  C     . GLU A 1 828  ? 172.454 145.210 122.389 1.00 18.67  ?  700  GLU A C     1 
ATOM   2240  O  O     . GLU A 1 828  ? 173.255 145.635 121.550 1.00 19.55  ?  700  GLU A O     1 
ATOM   2241  C  CB    . GLU A 1 828  ? 171.204 143.038 122.339 1.00 45.82  ?  700  GLU A CB    1 
ATOM   2242  C  CG    . GLU A 1 828  ? 171.118 141.546 122.656 1.00 99.28  ?  700  GLU A CG    1 
ATOM   2243  C  CD    . GLU A 1 828  ? 171.897 140.692 121.662 1.00 216.55 ?  700  GLU A CD    1 
ATOM   2244  O  OE1   . GLU A 1 828  ? 172.432 141.257 120.685 1.00 196.60 ?  700  GLU A OE1   1 
ATOM   2245  O  OE2   . GLU A 1 828  ? 171.988 139.460 121.857 1.00 376.78 -1 700  GLU A OE2   1 
ATOM   2246  N  N     . ARG A 1 829  ? 171.516 145.983 122.920 1.00 14.18  ?  701  ARG A N     1 
ATOM   2247  C  CA    . ARG A 1 829  ? 171.390 147.371 122.505 1.00 14.09  ?  701  ARG A CA    1 
ATOM   2248  C  C     . ARG A 1 829  ? 172.680 148.146 122.747 1.00 13.03  ?  701  ARG A C     1 
ATOM   2249  O  O     . ARG A 1 829  ? 173.065 148.997 121.937 1.00 12.84  ?  701  ARG A O     1 
ATOM   2250  C  CB    . ARG A 1 829  ? 170.215 148.010 123.226 1.00 16.94  ?  701  ARG A CB    1 
ATOM   2251  C  CG    . ARG A 1 829  ? 169.679 149.213 122.530 1.00 17.01  ?  701  ARG A CG    1 
ATOM   2252  C  CD    . ARG A 1 829  ? 170.420 150.422 123.011 1.00 16.12  ?  701  ARG A CD    1 
ATOM   2253  N  NE    . ARG A 1 829  ? 170.416 150.453 124.462 1.00 20.64  ?  701  ARG A NE    1 
ATOM   2254  C  CZ    . ARG A 1 829  ? 169.314 150.564 125.190 1.00 26.92  ?  701  ARG A CZ    1 
ATOM   2255  N  NH1   . ARG A 1 829  ? 168.128 150.627 124.595 1.00 48.40  ?  701  ARG A NH1   1 
ATOM   2256  N  NH2   . ARG A 1 829  ? 169.394 150.604 126.517 1.00 37.93  ?  701  ARG A NH2   1 
ATOM   2257  N  N     . LYS A 1 830  ? 173.356 147.876 123.862 1.00 15.44  ?  702  LYS A N     1 
ATOM   2258  C  CA    . LYS A 1 830  ? 174.613 148.567 124.129 1.00 16.90  ?  702  LYS A CA    1 
ATOM   2259  C  C     . LYS A 1 830  ? 175.668 148.199 123.091 1.00 19.23  ?  702  LYS A C     1 
ATOM   2260  O  O     . LYS A 1 830  ? 176.268 149.079 122.463 1.00 27.14  ?  702  LYS A O     1 
ATOM   2261  C  CB    . LYS A 1 830  ? 175.093 148.272 125.554 1.00 22.49  ?  702  LYS A CB    1 
ATOM   2262  C  CG    . LYS A 1 830  ? 176.007 149.364 126.128 1.00 32.02  ?  702  LYS A CG    1 
ATOM   2263  C  CD    . LYS A 1 830  ? 176.117 149.311 127.647 1.00 40.17  ?  702  LYS A CD    1 
ATOM   2264  C  CE    . LYS A 1 830  ? 174.748 149.361 128.302 1.00 31.61  ?  702  LYS A CE    1 
ATOM   2265  N  NZ    . LYS A 1 830  ? 173.957 150.555 127.882 1.00 20.38  ?  702  LYS A NZ    1 
ATOM   2266  N  N     . ALA A 1 831  ? 175.896 146.900 122.875 1.00 18.77  ?  703  ALA A N     1 
ATOM   2267  C  CA    . ALA A 1 831  ? 176.893 146.470 121.890 1.00 29.31  ?  703  ALA A CA    1 
ATOM   2268  C  C     . ALA A 1 831  ? 176.446 146.692 120.455 1.00 18.32  ?  703  ALA A C     1 
ATOM   2269  O  O     . ALA A 1 831  ? 177.168 146.304 119.527 1.00 19.36  ?  703  ALA A O     1 
ATOM   2270  C  CB    . ALA A 1 831  ? 177.233 144.989 122.083 1.00 26.32  ?  703  ALA A CB    1 
ATOM   2271  N  N     . MET A 1 832  ? 175.279 147.288 120.250 1.00 12.80  ?  704  MET A N     1 
ATOM   2272  C  CA    . MET A 1 832  ? 174.741 147.455 118.915 1.00 15.12  ?  704  MET A CA    1 
ATOM   2273  C  C     . MET A 1 832  ? 175.055 148.806 118.299 1.00 15.81  ?  704  MET A C     1 
ATOM   2274  O  O     . MET A 1 832  ? 175.286 148.895 117.090 1.00 22.92  ?  704  MET A O     1 
ATOM   2275  C  CB    . MET A 1 832  ? 173.230 147.278 118.943 1.00 13.04  ?  704  MET A CB    1 
ATOM   2276  C  CG    . MET A 1 832  ? 172.654 147.410 117.576 1.00 29.98  ?  704  MET A CG    1 
ATOM   2277  S  SD    . MET A 1 832  ? 171.474 146.099 117.336 1.00 37.81  ?  704  MET A SD    1 
ATOM   2278  C  CE    . MET A 1 832  ? 172.555 144.691 117.497 1.00 48.34  ?  704  MET A CE    1 
ATOM   2279  N  N     . MET A 1 833  ? 175.053 149.865 119.102 1.00 13.97  ?  705  MET A N     1 
ATOM   2280  C  CA    . MET A 1 833  ? 175.123 151.219 118.567 1.00 14.68  ?  705  MET A CA    1 
ATOM   2281  C  C     . MET A 1 833  ? 176.404 151.496 117.789 1.00 43.74  ?  705  MET A C     1 
ATOM   2282  O  O     . MET A 1 833  ? 176.466 152.498 117.072 1.00 55.99  ?  705  MET A O     1 
ATOM   2283  C  CB    . MET A 1 833  ? 174.991 152.217 119.706 1.00 23.79  ?  705  MET A CB    1 
ATOM   2284  C  CG    . MET A 1 833  ? 173.911 151.853 120.699 1.00 18.08  ?  705  MET A CG    1 
ATOM   2285  S  SD    . MET A 1 833  ? 173.624 153.183 121.869 1.00 99.39  ?  705  MET A SD    1 
ATOM   2286  C  CE    . MET A 1 833  ? 175.310 153.663 122.268 1.00 57.70  ?  705  MET A CE    1 
ATOM   2287  N  N     . GLU A 1 834  ? 177.419 150.644 117.918 1.00 60.88  ?  706  GLU A N     1 
ATOM   2288  C  CA    . GLU A 1 834  ? 178.729 150.925 117.341 1.00 77.14  ?  706  GLU A CA    1 
ATOM   2289  C  C     . GLU A 1 834  ? 178.905 150.326 115.945 1.00 77.35  ?  706  GLU A C     1 
ATOM   2290  O  O     . GLU A 1 834  ? 179.092 151.060 114.968 1.00 84.16  ?  706  GLU A O     1 
ATOM   2291  C  CB    . GLU A 1 834  ? 179.832 150.420 118.282 1.00 90.75  ?  706  GLU A CB    1 
ATOM   2292  C  CG    . GLU A 1 834  ? 180.417 151.499 119.181 1.00 130.38 ?  706  GLU A CG    1 
ATOM   2293  C  CD    . GLU A 1 834  ? 179.454 151.997 120.248 1.00 168.27 ?  706  GLU A CD    1 
ATOM   2294  O  OE1   . GLU A 1 834  ? 178.289 151.547 120.289 1.00 114.01 ?  706  GLU A OE1   1 
ATOM   2295  O  OE2   . GLU A 1 834  ? 179.859 152.882 121.031 1.00 391.03 -1 706  GLU A OE2   1 
ATOM   2296  N  N     . SER A 1 835  ? 178.838 149.004 115.832 1.00 66.03  ?  707  SER A N     1 
ATOM   2297  C  CA    . SER A 1 835  ? 179.129 148.342 114.567 1.00 70.06  ?  707  SER A CA    1 
ATOM   2298  C  C     . SER A 1 835  ? 178.054 148.686 113.534 1.00 49.34  ?  707  SER A C     1 
ATOM   2299  O  O     . SER A 1 835  ? 177.059 149.358 113.827 1.00 45.58  ?  707  SER A O     1 
ATOM   2300  C  CB    . SER A 1 835  ? 179.245 146.837 114.781 1.00 79.01  ?  707  SER A CB    1 
ATOM   2301  O  OG    . SER A 1 835  ? 179.364 146.164 113.542 1.00 80.35  ?  707  SER A OG    1 
ATOM   2302  N  N     . ARG A 1 836  ? 178.242 148.221 112.304 1.00 47.95  ?  708  ARG A N     1 
ATOM   2303  C  CA    . ARG A 1 836  ? 177.322 148.583 111.235 1.00 40.93  ?  708  ARG A CA    1 
ATOM   2304  C  C     . ARG A 1 836  ? 176.792 147.346 110.518 1.00 46.45  ?  708  ARG A C     1 
ATOM   2305  O  O     . ARG A 1 836  ? 177.507 146.362 110.308 1.00 53.70  ?  708  ARG A O     1 
ATOM   2306  C  CB    . ARG A 1 836  ? 177.989 149.527 110.228 1.00 44.52  ?  708  ARG A CB    1 
ATOM   2307  C  CG    . ARG A 1 836  ? 178.426 150.855 110.829 1.00 34.51  ?  708  ARG A CG    1 
ATOM   2308  C  CD    . ARG A 1 836  ? 179.109 151.730 109.793 1.00 46.48  ?  708  ARG A CD    1 
ATOM   2309  N  NE    . ARG A 1 836  ? 180.097 150.984 109.016 1.00 89.11  ?  708  ARG A NE    1 
ATOM   2310  C  CZ    . ARG A 1 836  ? 179.951 150.654 107.735 1.00 90.82  ?  708  ARG A CZ    1 
ATOM   2311  N  NH1   . ARG A 1 836  ? 178.851 151.002 107.079 1.00 72.00  ?  708  ARG A NH1   1 
ATOM   2312  N  NH2   . ARG A 1 836  ? 180.904 149.974 107.110 1.00 77.62  ?  708  ARG A NH2   1 
ATOM   2313  N  N     . LEU A 1 837  ? 175.540 147.446 110.082 1.00 53.76  ?  709  LEU A N     1 
ATOM   2314  C  CA    . LEU A 1 837  ? 174.775 146.347 109.511 1.00 50.61  ?  709  LEU A CA    1 
ATOM   2315  C  C     . LEU A 1 837  ? 174.844 146.355 107.992 1.00 35.43  ?  709  LEU A C     1 
ATOM   2316  O  O     . LEU A 1 837  ? 174.876 147.419 107.376 1.00 41.06  ?  709  LEU A O     1 
ATOM   2317  C  CB    . LEU A 1 837  ? 173.314 146.442 109.953 1.00 40.99  ?  709  LEU A CB    1 
ATOM   2318  C  CG    . LEU A 1 837  ? 172.444 145.230 109.654 1.00 24.26  ?  709  LEU A CG    1 
ATOM   2319  C  CD1   . LEU A 1 837  ? 172.949 144.023 110.402 1.00 42.99  ?  709  LEU A CD1   1 
ATOM   2320  C  CD2   . LEU A 1 837  ? 171.026 145.539 110.036 1.00 16.61  ?  709  LEU A CD2   1 
ATOM   2321  N  N     . ILE A 1 838  ? 174.865 145.170 107.383 1.00 50.30  ?  710  ILE A N     1 
ATOM   2322  C  CA    . ILE A 1 838  ? 174.830 145.036 105.932 1.00 49.83  ?  710  ILE A CA    1 
ATOM   2323  C  C     . ILE A 1 838  ? 173.630 144.168 105.590 1.00 39.55  ?  710  ILE A C     1 
ATOM   2324  O  O     . ILE A 1 838  ? 173.549 143.013 106.029 1.00 44.72  ?  710  ILE A O     1 
ATOM   2325  C  CB    . ILE A 1 838  ? 176.130 144.428 105.376 1.00 70.42  ?  710  ILE A CB    1 
ATOM   2326  C  CG1   . ILE A 1 838  ? 177.352 145.290 105.723 1.00 69.42  ?  710  ILE A CG1   1 
ATOM   2327  C  CG2   . ILE A 1 838  ? 176.033 144.219 103.872 1.00 70.04  ?  710  ILE A CG2   1 
ATOM   2328  C  CD1   . ILE A 1 838  ? 177.493 146.570 104.913 1.00 67.24  ?  710  ILE A CD1   1 
ATOM   2329  N  N     . ILE A 1 839  ? 172.709 144.722 104.804 1.00 45.01  ?  711  ILE A N     1 
ATOM   2330  C  CA    . ILE A 1 839  ? 171.483 144.038 104.413 1.00 50.39  ?  711  ILE A CA    1 
ATOM   2331  C  C     . ILE A 1 839  ? 171.336 144.102 102.899 1.00 66.12  ?  711  ILE A C     1 
ATOM   2332  O  O     . ILE A 1 839  ? 171.749 145.077 102.265 1.00 64.78  ?  711  ILE A O     1 
ATOM   2333  C  CB    . ILE A 1 839  ? 170.247 144.630 105.123 1.00 35.16  ?  711  ILE A CB    1 
ATOM   2334  C  CG1   . ILE A 1 839  ? 169.062 143.669 105.062 1.00 51.34  ?  711  ILE A CG1   1 
ATOM   2335  C  CG2   . ILE A 1 839  ? 169.861 145.948 104.515 1.00 39.50  ?  711  ILE A CG2   1 
ATOM   2336  C  CD1   . ILE A 1 839  ? 169.425 142.244 105.359 1.00 74.27  ?  711  ILE A CD1   1 
ATOM   2337  N  N     . SER A 1 840  ? 170.745 143.054 102.319 1.00 68.74  ?  712  SER A N     1 
ATOM   2338  C  CA    . SER A 1 840  ? 170.486 142.980 100.878 1.00 81.95  ?  712  SER A CA    1 
ATOM   2339  C  C     . SER A 1 840  ? 169.065 143.479 100.617 1.00 74.92  ?  712  SER A C     1 
ATOM   2340  O  O     . SER A 1 840  ? 168.093 142.744 100.800 1.00 70.12  ?  712  SER A O     1 
ATOM   2341  C  CB    . SER A 1 840  ? 170.692 141.558 100.363 1.00 87.75  ?  712  SER A CB    1 
ATOM   2342  O  OG    . SER A 1 840  ? 169.515 140.776 100.479 1.00 93.21  ?  712  SER A OG    1 
ATOM   2343  N  N     . VAL A 1 841  ? 168.956 144.736 100.178 1.00 59.33  ?  713  VAL A N     1 
ATOM   2344  C  CA    . VAL A 1 841  ? 167.690 145.400 99.892  1.00 38.14  ?  713  VAL A CA    1 
ATOM   2345  C  C     . VAL A 1 841  ? 167.689 145.875 98.445  1.00 38.50  ?  713  VAL A C     1 
ATOM   2346  O  O     . VAL A 1 841  ? 168.675 146.451 97.970  1.00 48.84  ?  713  VAL A O     1 
ATOM   2347  C  CB    . VAL A 1 841  ? 167.445 146.588 100.845 1.00 30.85  ?  713  VAL A CB    1 
ATOM   2348  C  CG1   . VAL A 1 841  ? 168.686 147.450 100.946 1.00 33.93  ?  713  VAL A CG1   1 
ATOM   2349  C  CG2   . VAL A 1 841  ? 166.306 147.438 100.326 1.00 37.41  ?  713  VAL A CG2   1 
ATOM   2350  N  N     . GLY A 1 842  ? 166.575 145.645 97.757  1.00 32.10  ?  714  GLY A N     1 
ATOM   2351  C  CA    . GLY A 1 842  ? 166.472 146.061 96.365  1.00 39.14  ?  714  GLY A CA    1 
ATOM   2352  C  C     . GLY A 1 842  ? 167.610 145.552 95.513  1.00 71.93  ?  714  GLY A C     1 
ATOM   2353  O  O     . GLY A 1 842  ? 168.117 146.278 94.651  1.00 70.56  ?  714  GLY A O     1 
ATOM   2354  N  N     . GLY A 1 843  ? 168.048 144.319 95.760  1.00 82.51  ?  715  GLY A N     1 
ATOM   2355  C  CA    . GLY A 1 843  ? 169.133 143.704 95.017  1.00 83.31  ?  715  GLY A CA    1 
ATOM   2356  C  C     . GLY A 1 843  ? 170.524 144.156 95.419  1.00 62.22  ?  715  GLY A C     1 
ATOM   2357  O  O     . GLY A 1 843  ? 171.511 143.466 95.143  1.00 60.30  ?  715  GLY A O     1 
ATOM   2358  N  N     . LEU A 1 844  ? 170.620 145.306 96.077  1.00 64.25  ?  716  LEU A N     1 
ATOM   2359  C  CA    . LEU A 1 844  ? 171.898 145.886 96.462  1.00 68.97  ?  716  LEU A CA    1 
ATOM   2360  C  C     . LEU A 1 844  ? 172.155 145.637 97.944  1.00 66.30  ?  716  LEU A C     1 
ATOM   2361  O  O     . LEU A 1 844  ? 171.257 145.795 98.775  1.00 76.48  ?  716  LEU A O     1 
ATOM   2362  C  CB    . LEU A 1 844  ? 171.927 147.395 96.171  1.00 69.39  ?  716  LEU A CB    1 
ATOM   2363  C  CG    . LEU A 1 844  ? 171.386 147.953 94.846  1.00 55.83  ?  716  LEU A CG    1 
ATOM   2364  C  CD1   . LEU A 1 844  ? 171.787 149.416 94.648  1.00 42.93  ?  716  LEU A CD1   1 
ATOM   2365  C  CD2   . LEU A 1 844  ? 171.884 147.126 93.678  1.00 79.33  ?  716  LEU A CD2   1 
ATOM   2366  N  N     . LEU A 1 845  ? 173.379 145.238 98.276  1.00 49.61  ?  717  LEU A N     1 
ATOM   2367  C  CA    . LEU A 1 845  ? 173.774 145.184 99.672  1.00 50.58  ?  717  LEU A CA    1 
ATOM   2368  C  C     . LEU A 1 845  ? 174.172 146.585 100.118 1.00 58.87  ?  717  LEU A C     1 
ATOM   2369  O  O     . LEU A 1 845  ? 174.961 147.260 99.450  1.00 61.55  ?  717  LEU A O     1 
ATOM   2370  C  CB    . LEU A 1 845  ? 174.918 144.190 99.887  1.00 51.62  ?  717  LEU A CB    1 
ATOM   2371  C  CG    . LEU A 1 845  ? 176.189 144.254 99.040  1.00 90.87  ?  717  LEU A CG    1 
ATOM   2372  C  CD1   . LEU A 1 845  ? 177.279 145.090 99.711  1.00 78.79  ?  717  LEU A CD1   1 
ATOM   2373  C  CD2   . LEU A 1 845  ? 176.690 142.846 98.743  1.00 114.88 ?  717  LEU A CD2   1 
ATOM   2374  N  N     . ARG A 1 846  ? 173.605 147.026 101.238 1.00 55.98  ?  718  ARG A N     1 
ATOM   2375  C  CA    . ARG A 1 846  ? 173.810 148.375 101.735 1.00 54.76  ?  718  ARG A CA    1 
ATOM   2376  C  C     . ARG A 1 846  ? 174.049 148.337 103.240 1.00 56.54  ?  718  ARG A C     1 
ATOM   2377  O  O     . ARG A 1 846  ? 173.606 147.422 103.946 1.00 52.93  ?  718  ARG A O     1 
ATOM   2378  C  CB    . ARG A 1 846  ? 172.619 149.289 101.393 1.00 48.49  ?  718  ARG A CB    1 
ATOM   2379  C  CG    . ARG A 1 846  ? 172.331 149.422 99.902  1.00 46.84  ?  718  ARG A CG    1 
ATOM   2380  C  CD    . ARG A 1 846  ? 171.054 150.206 99.660  1.00 38.50  ?  718  ARG A CD    1 
ATOM   2381  N  NE    . ARG A 1 846  ? 170.672 150.235 98.252  1.00 40.42  ?  718  ARG A NE    1 
ATOM   2382  C  CZ    . ARG A 1 846  ? 169.418 150.306 97.823  1.00 22.35  ?  718  ARG A CZ    1 
ATOM   2383  N  NH1   . ARG A 1 846  ? 168.422 150.357 98.695  1.00 26.22  ?  718  ARG A NH1   1 
ATOM   2384  N  NH2   . ARG A 1 846  ? 169.158 150.336 96.521  1.00 26.09  ?  718  ARG A NH2   1 
ATOM   2385  N  N     . SER A 1 847  ? 174.753 149.367 103.719 1.00 62.02  ?  719  SER A N     1 
ATOM   2386  C  CA    . SER A 1 847  ? 175.199 149.487 105.100 1.00 62.91  ?  719  SER A CA    1 
ATOM   2387  C  C     . SER A 1 847  ? 174.300 150.437 105.889 1.00 69.74  ?  719  SER A C     1 
ATOM   2388  O  O     . SER A 1 847  ? 173.797 151.435 105.364 1.00 72.69  ?  719  SER A O     1 
ATOM   2389  C  CB    . SER A 1 847  ? 176.654 149.974 105.156 1.00 57.89  ?  719  SER A CB    1 
ATOM   2390  O  OG    . SER A 1 847  ? 176.744 151.386 105.100 1.00 64.09  ?  719  SER A OG    1 
ATOM   2391  N  N     . PHE A 1 848  ? 174.121 150.115 107.172 1.00 67.06  ?  720  PHE A N     1 
ATOM   2392  C  CA    . PHE A 1 848  ? 173.238 150.829 108.087 1.00 64.02  ?  720  PHE A CA    1 
ATOM   2393  C  C     . PHE A 1 848  ? 173.936 151.073 109.418 1.00 57.99  ?  720  PHE A C     1 
ATOM   2394  O  O     . PHE A 1 848  ? 174.620 150.189 109.946 1.00 62.86  ?  720  PHE A O     1 
ATOM   2395  C  CB    . PHE A 1 848  ? 171.926 150.057 108.333 1.00 49.87  ?  720  PHE A CB    1 
ATOM   2396  C  CG    . PHE A 1 848  ? 171.048 149.969 107.129 1.00 39.90  ?  720  PHE A CG    1 
ATOM   2397  C  CD1   . PHE A 1 848  ? 171.344 149.109 106.094 1.00 43.81  ?  720  PHE A CD1   1 
ATOM   2398  C  CD2   . PHE A 1 848  ? 169.946 150.789 107.011 1.00 35.71  ?  720  PHE A CD2   1 
ATOM   2399  C  CE1   . PHE A 1 848  ? 170.543 149.064 104.981 1.00 54.39  ?  720  PHE A CE1   1 
ATOM   2400  C  CE2   . PHE A 1 848  ? 169.148 150.736 105.896 1.00 48.26  ?  720  PHE A CE2   1 
ATOM   2401  C  CZ    . PHE A 1 848  ? 169.445 149.871 104.889 1.00 62.11  ?  720  PHE A CZ    1 
ATOM   2402  N  N     . ARG A 1 849  ? 173.753 152.275 109.958 1.00 51.29  ?  721  ARG A N     1 
ATOM   2403  C  CA    . ARG A 1 849  ? 174.097 152.587 111.337 1.00 45.69  ?  721  ARG A CA    1 
ATOM   2404  C  C     . ARG A 1 849  ? 172.814 152.685 112.147 1.00 32.70  ?  721  ARG A C     1 
ATOM   2405  O  O     . ARG A 1 849  ? 171.708 152.531 111.623 1.00 33.46  ?  721  ARG A O     1 
ATOM   2406  C  CB    . ARG A 1 849  ? 174.911 153.876 111.427 1.00 54.98  ?  721  ARG A CB    1 
ATOM   2407  C  CG    . ARG A 1 849  ? 176.270 153.789 110.771 1.00 70.59  ?  721  ARG A CG    1 
ATOM   2408  C  CD    . ARG A 1 849  ? 177.074 155.053 110.995 1.00 73.49  ?  721  ARG A CD    1 
ATOM   2409  N  NE    . ARG A 1 849  ? 177.406 155.215 112.405 1.00 64.36  ?  721  ARG A NE    1 
ATOM   2410  C  CZ    . ARG A 1 849  ? 178.306 154.473 113.044 1.00 59.12  ?  721  ARG A CZ    1 
ATOM   2411  N  NH1   . ARG A 1 849  ? 178.950 153.509 112.399 1.00 52.93  ?  721  ARG A NH1   1 
ATOM   2412  N  NH2   . ARG A 1 849  ? 178.554 154.686 114.331 1.00 62.21  ?  721  ARG A NH2   1 
ATOM   2413  N  N     . PHE A 1 850  ? 172.967 152.952 113.441 1.00 37.23  ?  722  PHE A N     1 
ATOM   2414  C  CA    . PHE A 1 850  ? 171.812 153.041 114.321 1.00 36.39  ?  722  PHE A CA    1 
ATOM   2415  C  C     . PHE A 1 850  ? 172.085 154.014 115.460 1.00 44.32  ?  722  PHE A C     1 
ATOM   2416  O  O     . PHE A 1 850  ? 173.158 153.989 116.066 1.00 49.40  ?  722  PHE A O     1 
ATOM   2417  C  CB    . PHE A 1 850  ? 171.435 151.673 114.895 1.00 29.97  ?  722  PHE A CB    1 
ATOM   2418  C  CG    . PHE A 1 850  ? 170.881 150.724 113.881 1.00 28.15  ?  722  PHE A CG    1 
ATOM   2419  C  CD1   . PHE A 1 850  ? 169.561 150.808 113.485 1.00 24.84  ?  722  PHE A CD1   1 
ATOM   2420  C  CD2   . PHE A 1 850  ? 171.675 149.737 113.332 1.00 47.25  ?  722  PHE A CD2   1 
ATOM   2421  C  CE1   . PHE A 1 850  ? 169.047 149.930 112.554 1.00 27.65  ?  722  PHE A CE1   1 
ATOM   2422  C  CE2   . PHE A 1 850  ? 171.163 148.860 112.405 1.00 43.34  ?  722  PHE A CE2   1 
ATOM   2423  C  CZ    . PHE A 1 850  ? 169.849 148.961 112.019 1.00 40.33  ?  722  PHE A CZ    1 
ATOM   2424  N  N     . PHE A 1 851  ? 171.105 154.873 115.731 1.00 40.21  ?  723  PHE A N     1 
ATOM   2425  C  CA    . PHE A 1 851  ? 171.067 155.696 116.927 1.00 25.30  ?  723  PHE A CA    1 
ATOM   2426  C  C     . PHE A 1 851  ? 169.794 155.338 117.676 1.00 15.68  ?  723  PHE A C     1 
ATOM   2427  O  O     . PHE A 1 851  ? 168.791 154.954 117.066 1.00 23.61  ?  723  PHE A O     1 
ATOM   2428  C  CB    . PHE A 1 851  ? 171.096 157.190 116.589 1.00 29.89  ?  723  PHE A CB    1 
ATOM   2429  C  CG    . PHE A 1 851  ? 172.260 157.585 115.720 1.00 64.75  ?  723  PHE A CG    1 
ATOM   2430  C  CD1   . PHE A 1 851  ? 173.504 157.000 115.895 1.00 67.95  ?  723  PHE A CD1   1 
ATOM   2431  C  CD2   . PHE A 1 851  ? 172.105 158.519 114.709 1.00 86.80  ?  723  PHE A CD2   1 
ATOM   2432  C  CE1   . PHE A 1 851  ? 174.575 157.356 115.094 1.00 68.12  ?  723  PHE A CE1   1 
ATOM   2433  C  CE2   . PHE A 1 851  ? 173.178 158.879 113.902 1.00 110.90 ?  723  PHE A CE2   1 
ATOM   2434  C  CZ    . PHE A 1 851  ? 174.410 158.295 114.097 1.00 98.97  ?  723  PHE A CZ    1 
ATOM   2435  N  N     . PHE A 1 852  ? 169.832 155.442 119.000 1.00 7.43   ?  724  PHE A N     1 
ATOM   2436  C  CA    . PHE A 1 852  ? 168.796 154.842 119.823 1.00 9.58   ?  724  PHE A CA    1 
ATOM   2437  C  C     . PHE A 1 852  ? 168.239 155.855 120.805 1.00 9.28   ?  724  PHE A C     1 
ATOM   2438  O  O     . PHE A 1 852  ? 168.994 156.497 121.540 1.00 13.00  ?  724  PHE A O     1 
ATOM   2439  C  CB    . PHE A 1 852  ? 169.337 153.628 120.558 1.00 8.52   ?  724  PHE A CB    1 
ATOM   2440  C  CG    . PHE A 1 852  ? 169.156 152.369 119.798 1.00 13.38  ?  724  PHE A CG    1 
ATOM   2441  C  CD1   . PHE A 1 852  ? 169.795 152.186 118.587 1.00 14.69  ?  724  PHE A CD1   1 
ATOM   2442  C  CD2   . PHE A 1 852  ? 168.327 151.381 120.265 1.00 27.52  ?  724  PHE A CD2   1 
ATOM   2443  C  CE1   . PHE A 1 852  ? 169.615 151.036 117.877 1.00 19.02  ?  724  PHE A CE1   1 
ATOM   2444  C  CE2   . PHE A 1 852  ? 168.150 150.227 119.554 1.00 39.43  ?  724  PHE A CE2   1 
ATOM   2445  C  CZ    . PHE A 1 852  ? 168.794 150.057 118.363 1.00 31.97  ?  724  PHE A CZ    1 
ATOM   2446  N  N     . ARG A 1 853  ? 166.919 155.989 120.813 1.00 8.48   ?  725  ARG A N     1 
ATOM   2447  C  CA    . ARG A 1 853  ? 166.217 156.960 121.643 1.00 9.71   ?  725  ARG A CA    1 
ATOM   2448  C  C     . ARG A 1 853  ? 165.315 156.188 122.604 1.00 29.18  ?  725  ARG A C     1 
ATOM   2449  O  O     . ARG A 1 853  ? 164.283 155.648 122.200 1.00 8.91   ?  725  ARG A O     1 
ATOM   2450  C  CB    . ARG A 1 853  ? 165.422 157.942 120.779 1.00 14.77  ?  725  ARG A CB    1 
ATOM   2451  C  CG    . ARG A 1 853  ? 166.194 158.511 119.576 1.00 23.23  ?  725  ARG A CG    1 
ATOM   2452  C  CD    . ARG A 1 853  ? 167.311 159.479 119.976 1.00 57.16  ?  725  ARG A CD    1 
ATOM   2453  N  NE    . ARG A 1 853  ? 167.710 160.368 118.880 1.00 74.47  ?  725  ARG A NE    1 
ATOM   2454  C  CZ    . ARG A 1 853  ? 167.650 161.697 118.918 1.00 81.50  ?  725  ARG A CZ    1 
ATOM   2455  N  NH1   . ARG A 1 853  ? 167.210 162.317 120.005 1.00 71.46  ?  725  ARG A NH1   1 
ATOM   2456  N  NH2   . ARG A 1 853  ? 168.049 162.414 117.870 1.00 90.85  ?  725  ARG A NH2   1 
ATOM   2457  N  N     . GLY A 1 854  ? 165.719 156.114 123.870 1.00 11.84  ?  726  GLY A N     1 
ATOM   2458  C  CA    . GLY A 1 854  ? 164.881 155.541 124.907 1.00 10.36  ?  726  GLY A CA    1 
ATOM   2459  C  C     . GLY A 1 854  ? 163.965 156.577 125.533 1.00 16.76  ?  726  GLY A C     1 
ATOM   2460  O  O     . GLY A 1 854  ? 164.414 157.430 126.306 1.00 24.75  ?  726  GLY A O     1 
ATOM   2461  N  N     . THR A 1 855  ? 162.671 156.526 125.190 1.00 11.00  ?  727  THR A N     1 
ATOM   2462  C  CA    . THR A 1 855  ? 161.701 157.534 125.617 1.00 12.48  ?  727  THR A CA    1 
ATOM   2463  C  C     . THR A 1 855  ? 160.463 156.948 126.284 1.00 24.35  ?  727  THR A C     1 
ATOM   2464  O  O     . THR A 1 855  ? 159.941 157.534 127.235 1.00 7.42   ?  727  THR A O     1 
ATOM   2465  C  CB    . THR A 1 855  ? 161.237 158.397 124.422 1.00 13.50  ?  727  THR A CB    1 
ATOM   2466  O  OG1   . THR A 1 855  ? 160.110 157.776 123.798 1.00 16.00  ?  727  THR A OG1   1 
ATOM   2467  C  CG2   . THR A 1 855  ? 162.348 158.565 123.395 1.00 19.29  ?  727  THR A CG2   1 
ATOM   2468  N  N     . GLY A 1 856  ? 159.977 155.805 125.809 1.00 11.43  ?  728  GLY A N     1 
ATOM   2469  C  CA    . GLY A 1 856  ? 158.684 155.287 126.202 1.00 19.74  ?  728  GLY A CA    1 
ATOM   2470  C  C     . GLY A 1 856  ? 158.648 154.712 127.598 1.00 10.19  ?  728  GLY A C     1 
ATOM   2471  O  O     . GLY A 1 856  ? 158.538 153.496 127.780 1.00 11.79  ?  728  GLY A O     1 
ATOM   2472  N  N     . TYR A 1 857  ? 158.767 155.586 128.593 1.00 11.15  ?  729  TYR A N     1 
ATOM   2473  C  CA    . TYR A 1 857  ? 158.666 155.205 129.991 1.00 15.54  ?  729  TYR A CA    1 
ATOM   2474  C  C     . TYR A 1 857  ? 157.968 156.319 130.755 1.00 18.97  ?  729  TYR A C     1 
ATOM   2475  O  O     . TYR A 1 857  ? 158.162 157.501 130.458 1.00 19.77  ?  729  TYR A O     1 
ATOM   2476  C  CB    . TYR A 1 857  ? 160.044 154.927 130.628 1.00 39.34  ?  729  TYR A CB    1 
ATOM   2477  C  CG    . TYR A 1 857  ? 161.036 154.117 129.799 1.00 22.37  ?  729  TYR A CG    1 
ATOM   2478  C  CD1   . TYR A 1 857  ? 161.746 154.693 128.757 1.00 17.33  ?  729  TYR A CD1   1 
ATOM   2479  C  CD2   . TYR A 1 857  ? 161.276 152.776 130.078 1.00 17.13  ?  729  TYR A CD2   1 
ATOM   2480  C  CE1   . TYR A 1 857  ? 162.659 153.960 128.015 1.00 14.87  ?  729  TYR A CE1   1 
ATOM   2481  C  CE2   . TYR A 1 857  ? 162.188 152.034 129.333 1.00 12.46  ?  729  TYR A CE2   1 
ATOM   2482  C  CZ    . TYR A 1 857  ? 162.874 152.634 128.304 1.00 11.22  ?  729  TYR A CZ    1 
ATOM   2483  O  OH    . TYR A 1 857  ? 163.782 151.921 127.553 1.00 10.78  ?  729  TYR A OH    1 
ATOM   2484  N  N     . ASP A 1 858  ? 157.150 155.939 131.734 1.00 20.19  ?  730  ASP A N     1 
ATOM   2485  C  CA    . ASP A 1 858  ? 156.573 156.920 132.637 1.00 33.16  ?  730  ASP A CA    1 
ATOM   2486  C  C     . ASP A 1 858  ? 157.604 157.366 133.669 1.00 28.06  ?  730  ASP A C     1 
ATOM   2487  O  O     . ASP A 1 858  ? 158.714 156.841 133.751 1.00 23.76  ?  730  ASP A O     1 
ATOM   2488  C  CB    . ASP A 1 858  ? 155.341 156.361 133.346 1.00 57.58  ?  730  ASP A CB    1 
ATOM   2489  C  CG    . ASP A 1 858  ? 155.486 154.897 133.701 1.00 84.60  ?  730  ASP A CG    1 
ATOM   2490  O  OD1   . ASP A 1 858  ? 156.489 154.273 133.296 1.00 52.39  ?  730  ASP A OD1   1 
ATOM   2491  O  OD2   . ASP A 1 858  ? 154.596 154.369 134.401 1.00 263.24 -1 730  ASP A OD2   1 
ATOM   2492  N  N     . GLU A 1 859  ? 157.206 158.352 134.474 1.00 35.71  ?  731  GLU A N     1 
ATOM   2493  C  CA    . GLU A 1 859  ? 158.116 158.948 135.449 1.00 31.95  ?  731  GLU A CA    1 
ATOM   2494  C  C     . GLU A 1 859  ? 158.690 157.899 136.399 1.00 24.00  ?  731  GLU A C     1 
ATOM   2495  O  O     . GLU A 1 859  ? 159.898 157.865 136.643 1.00 26.15  ?  731  GLU A O     1 
ATOM   2496  C  CB    . GLU A 1 859  ? 157.397 160.050 136.234 1.00 65.37  ?  731  GLU A CB    1 
ATOM   2497  C  CG    . GLU A 1 859  ? 156.722 161.130 135.381 1.00 135.51 ?  731  GLU A CG    1 
ATOM   2498  C  CD    . GLU A 1 859  ? 155.221 160.910 135.203 1.00 180.53 ?  731  GLU A CD    1 
ATOM   2499  O  OE1   . GLU A 1 859  ? 154.683 159.945 135.787 1.00 135.41 ?  731  GLU A OE1   1 
ATOM   2500  O  OE2   . GLU A 1 859  ? 154.575 161.718 134.498 1.00 329.79 -1 731  GLU A OE2   1 
ATOM   2501  N  N     . LYS A 1 860  ? 157.827 157.052 136.963 1.00 26.28  ?  732  LYS A N     1 
ATOM   2502  C  CA    . LYS A 1 860  ? 158.268 156.075 137.953 1.00 22.52  ?  732  LYS A CA    1 
ATOM   2503  C  C     . LYS A 1 860  ? 159.300 155.117 137.368 1.00 15.60  ?  732  LYS A C     1 
ATOM   2504  O  O     . LYS A 1 860  ? 160.359 154.880 137.962 1.00 18.89  ?  732  LYS A O     1 
ATOM   2505  C  CB    . LYS A 1 860  ? 157.068 155.302 138.505 1.00 22.94  ?  732  LYS A CB    1 
ATOM   2506  C  CG    . LYS A 1 860  ? 157.415 153.972 139.171 1.00 26.09  ?  732  LYS A CG    1 
ATOM   2507  C  CD    . LYS A 1 860  ? 156.251 153.451 140.019 1.00 25.98  ?  732  LYS A CD    1 
ATOM   2508  C  CE    . LYS A 1 860  ? 155.953 151.983 139.723 1.00 37.27  ?  732  LYS A CE    1 
ATOM   2509  N  NZ    . LYS A 1 860  ? 154.589 151.561 140.167 1.00 28.05  ?  732  LYS A NZ    1 
ATOM   2510  N  N     . MET A 1 861  ? 158.997 154.534 136.214 1.00 19.23  ?  733  MET A N     1 
ATOM   2511  C  CA    . MET A 1 861  ? 159.952 153.629 135.588 1.00 14.71  ?  733  MET A CA    1 
ATOM   2512  C  C     . MET A 1 861  ? 161.215 154.363 135.179 1.00 9.29   ?  733  MET A C     1 
ATOM   2513  O  O     . MET A 1 861  ? 162.308 153.792 135.201 1.00 14.65  ?  733  MET A O     1 
ATOM   2514  C  CB    . MET A 1 861  ? 159.323 152.953 134.381 1.00 22.69  ?  733  MET A CB    1 
ATOM   2515  C  CG    . MET A 1 861  ? 160.332 152.174 133.577 1.00 32.08  ?  733  MET A CG    1 
ATOM   2516  S  SD    . MET A 1 861  ? 159.602 150.699 132.881 1.00 95.73  ?  733  MET A SD    1 
ATOM   2517  C  CE    . MET A 1 861  ? 158.893 149.998 134.367 1.00 100.76 ?  733  MET A CE    1 
ATOM   2518  N  N     . VAL A 1 862  ? 161.078 155.611 134.746 1.00 8.28   ?  734  VAL A N     1 
ATOM   2519  C  CA    . VAL A 1 862  ? 162.256 156.424 134.477 1.00 16.55  ?  734  VAL A CA    1 
ATOM   2520  C  C     . VAL A 1 862  ? 163.134 156.492 135.716 1.00 21.88  ?  734  VAL A C     1 
ATOM   2521  O  O     . VAL A 1 862  ? 164.345 156.253 135.656 1.00 20.37  ?  734  VAL A O     1 
ATOM   2522  C  CB    . VAL A 1 862  ? 161.834 157.821 133.993 1.00 18.68  ?  734  VAL A CB    1 
ATOM   2523  C  CG1   . VAL A 1 862  ? 162.877 158.849 134.357 1.00 34.61  ?  734  VAL A CG1   1 
ATOM   2524  C  CG2   . VAL A 1 862  ? 161.612 157.801 132.494 1.00 31.01  ?  734  VAL A CG2   1 
ATOM   2525  N  N     . ARG A 1 863  ? 162.527 156.777 136.867 1.00 15.37  ?  735  ARG A N     1 
ATOM   2526  C  CA    . ARG A 1 863  ? 163.288 156.790 138.111 1.00 24.06  ?  735  ARG A CA    1 
ATOM   2527  C  C     . ARG A 1 863  ? 163.924 155.430 138.375 1.00 40.36  ?  735  ARG A C     1 
ATOM   2528  O  O     . ARG A 1 863  ? 165.078 155.353 138.805 1.00 42.69  ?  735  ARG A O     1 
ATOM   2529  C  CB    . ARG A 1 863  ? 162.391 157.207 139.279 1.00 27.70  ?  735  ARG A CB    1 
ATOM   2530  C  CG    . ARG A 1 863  ? 161.966 158.665 139.237 1.00 39.62  ?  735  ARG A CG    1 
ATOM   2531  C  CD    . ARG A 1 863  ? 163.166 159.587 139.095 1.00 32.54  ?  735  ARG A CD    1 
ATOM   2532  N  NE    . ARG A 1 863  ? 162.746 160.973 138.918 1.00 27.17  ?  735  ARG A NE    1 
ATOM   2533  C  CZ    . ARG A 1 863  ? 162.181 161.714 139.866 1.00 31.92  ?  735  ARG A CZ    1 
ATOM   2534  N  NH1   . ARG A 1 863  ? 161.960 161.202 141.074 1.00 28.15  ?  735  ARG A NH1   1 
ATOM   2535  N  NH2   . ARG A 1 863  ? 161.836 162.969 139.602 1.00 44.48  ?  735  ARG A NH2   1 
ATOM   2536  N  N     . GLU A 1 864  ? 163.188 154.346 138.117 1.00 27.28  ?  736  GLU A N     1 
ATOM   2537  C  CA    . GLU A 1 864  ? 163.693 153.016 138.456 1.00 23.02  ?  736  GLU A CA    1 
ATOM   2538  C  C     . GLU A 1 864  ? 164.870 152.621 137.574 1.00 15.57  ?  736  GLU A C     1 
ATOM   2539  O  O     . GLU A 1 864  ? 165.937 152.250 138.073 1.00 16.93  ?  736  GLU A O     1 
ATOM   2540  C  CB    . GLU A 1 864  ? 162.583 151.975 138.358 1.00 19.75  ?  736  GLU A CB    1 
ATOM   2541  C  CG    . GLU A 1 864  ? 161.696 151.947 139.580 1.00 47.85  ?  736  GLU A CG    1 
ATOM   2542  C  CD    . GLU A 1 864  ? 161.031 150.603 139.785 1.00 116.52 ?  736  GLU A CD    1 
ATOM   2543  O  OE1   . GLU A 1 864  ? 161.329 149.659 139.020 1.00 87.42  ?  736  GLU A OE1   1 
ATOM   2544  O  OE2   . GLU A 1 864  ? 160.223 150.483 140.727 1.00 271.44 -1 736  GLU A OE2   1 
ATOM   2545  N  N     . MET A 1 865  ? 164.688 152.673 136.260 1.00 14.45  ?  737  MET A N     1 
ATOM   2546  C  CA    . MET A 1 865  ? 165.787 152.405 135.347 1.00 12.78  ?  737  MET A CA    1 
ATOM   2547  C  C     . MET A 1 865  ? 166.942 153.358 135.568 1.00 12.73  ?  737  MET A C     1 
ATOM   2548  O  O     . MET A 1 865  ? 168.091 152.991 135.306 1.00 12.61  ?  737  MET A O     1 
ATOM   2549  C  CB    . MET A 1 865  ? 165.304 152.508 133.903 1.00 16.60  ?  737  MET A CB    1 
ATOM   2550  C  CG    . MET A 1 865  ? 164.174 151.564 133.600 1.00 50.92  ?  737  MET A CG    1 
ATOM   2551  S  SD    . MET A 1 865  ? 164.799 149.876 133.517 1.00 112.42 ?  737  MET A SD    1 
ATOM   2552  C  CE    . MET A 1 865  ? 163.280 148.953 133.760 1.00 50.05  ?  737  MET A CE    1 
ATOM   2553  N  N     . GLU A 1 866  ? 166.664 154.557 136.065 1.00 21.69  ?  738  GLU A N     1 
ATOM   2554  C  CA    . GLU A 1 866  ? 167.708 155.523 136.363 1.00 26.06  ?  738  GLU A CA    1 
ATOM   2555  C  C     . GLU A 1 866  ? 168.268 155.378 137.768 1.00 28.60  ?  738  GLU A C     1 
ATOM   2556  O  O     . GLU A 1 866  ? 169.347 155.910 138.048 1.00 39.55  ?  738  GLU A O     1 
ATOM   2557  C  CB    . GLU A 1 866  ? 167.186 156.950 136.192 1.00 32.94  ?  738  GLU A CB    1 
ATOM   2558  C  CG    . GLU A 1 866  ? 168.280 157.967 135.931 1.00 71.55  ?  738  GLU A CG    1 
ATOM   2559  C  CD    . GLU A 1 866  ? 169.426 157.383 135.122 1.00 110.54 ?  738  GLU A CD    1 
ATOM   2560  O  OE1   . GLU A 1 866  ? 169.249 157.199 133.899 1.00 69.89  ?  738  GLU A OE1   1 
ATOM   2561  O  OE2   . GLU A 1 866  ? 170.495 157.094 135.702 1.00 277.38 -1 738  GLU A OE2   1 
ATOM   2562  N  N     . GLY A 1 867  ? 167.557 154.698 138.661 1.00 32.31  ?  739  GLY A N     1 
ATOM   2563  C  CA    . GLY A 1 867  ? 168.054 154.418 139.987 1.00 40.82  ?  739  GLY A CA    1 
ATOM   2564  C  C     . GLY A 1 867  ? 167.697 155.442 141.042 1.00 33.72  ?  739  GLY A C     1 
ATOM   2565  O  O     . GLY A 1 867  ? 167.792 155.141 142.237 1.00 27.57  ?  739  GLY A O     1 
ATOM   2566  N  N     . LEU A 1 868  ? 167.282 156.636 140.636 1.00 26.02  ?  740  LEU A N     1 
ATOM   2567  C  CA    . LEU A 1 868  ? 166.896 157.655 141.590 1.00 21.75  ?  740  LEU A CA    1 
ATOM   2568  C  C     . LEU A 1 868  ? 165.709 157.183 142.426 1.00 43.27  ?  740  LEU A C     1 
ATOM   2569  O  O     . LEU A 1 868  ? 165.009 156.220 142.095 1.00 51.44  ?  740  LEU A O     1 
ATOM   2570  C  CB    . LEU A 1 868  ? 166.547 158.947 140.867 1.00 15.29  ?  740  LEU A CB    1 
ATOM   2571  C  CG    . LEU A 1 868  ? 167.660 159.436 139.956 1.00 14.98  ?  740  LEU A CG    1 
ATOM   2572  C  CD1   . LEU A 1 868  ? 167.332 160.825 139.465 1.00 20.38  ?  740  LEU A CD1   1 
ATOM   2573  C  CD2   . LEU A 1 868  ? 168.978 159.422 140.710 1.00 22.74  ?  740  LEU A CD2   1 
ATOM   2574  N  N     . GLU A 1 869  ? 165.490 157.888 143.529 1.00 57.78  ?  741  GLU A N     1 
ATOM   2575  C  CA    . GLU A 1 869  ? 164.378 157.579 144.409 1.00 59.16  ?  741  GLU A CA    1 
ATOM   2576  C  C     . GLU A 1 869  ? 163.052 157.825 143.687 1.00 38.23  ?  741  GLU A C     1 
ATOM   2577  O  O     . GLU A 1 869  ? 162.971 158.556 142.696 1.00 38.40  ?  741  GLU A O     1 
ATOM   2578  C  CB    . GLU A 1 869  ? 164.454 158.415 145.694 1.00 79.11  ?  741  GLU A CB    1 
ATOM   2579  C  CG    . GLU A 1 869  ? 164.858 159.887 145.508 1.00 104.82 ?  741  GLU A CG    1 
ATOM   2580  C  CD    . GLU A 1 869  ? 166.337 160.109 145.211 1.00 118.31 ?  741  GLU A CD    1 
ATOM   2581  O  OE1   . GLU A 1 869  ? 166.777 159.740 144.101 1.00 69.16  ?  741  GLU A OE1   1 
ATOM   2582  O  OE2   . GLU A 1 869  ? 167.042 160.703 146.059 1.00 271.63 -1 741  GLU A OE2   1 
ATOM   2583  N  N     . ALA A 1 870  ? 162.000 157.202 144.204 1.00 30.03  ?  742  ALA A N     1 
ATOM   2584  C  CA    . ALA A 1 870  ? 160.688 157.300 143.582 1.00 32.30  ?  742  ALA A CA    1 
ATOM   2585  C  C     . ALA A 1 870  ? 159.644 157.152 144.675 1.00 67.78  ?  742  ALA A C     1 
ATOM   2586  O  O     . ALA A 1 870  ? 159.753 156.252 145.514 1.00 62.76  ?  742  ALA A O     1 
ATOM   2587  C  CB    . ALA A 1 870  ? 160.507 156.229 142.502 1.00 29.30  ?  742  ALA A CB    1 
ATOM   2588  N  N     . SER A 1 871  ? 158.649 158.037 144.675 1.00 93.95  ?  743  SER A N     1 
ATOM   2589  C  CA    . SER A 1 871  ? 158.519 159.064 143.640 1.00 103.38 ?  743  SER A CA    1 
ATOM   2590  C  C     . SER A 1 871  ? 158.595 160.504 144.174 1.00 91.62  ?  743  SER A C     1 
ATOM   2591  O  O     . SER A 1 871  ? 159.227 161.365 143.552 1.00 60.90  ?  743  SER A O     1 
ATOM   2592  C  CB    . SER A 1 871  ? 157.205 158.860 142.877 1.00 136.32 ?  743  SER A CB    1 
ATOM   2593  O  OG    . SER A 1 871  ? 156.650 160.092 142.455 1.00 149.88 ?  743  SER A OG    1 
ATOM   2594  N  N     . GLY A 1 872  ? 157.955 160.754 145.321 1.00 97.20  ?  744  GLY A N     1 
ATOM   2595  C  CA    . GLY A 1 872  ? 157.886 162.081 145.910 1.00 65.66  ?  744  GLY A CA    1 
ATOM   2596  C  C     . GLY A 1 872  ? 159.194 162.524 146.523 1.00 42.75  ?  744  GLY A C     1 
ATOM   2597  O  O     . GLY A 1 872  ? 159.279 162.862 147.708 1.00 40.32  ?  744  GLY A O     1 
ATOM   2598  N  N     . SER A 1 873  ? 160.230 162.512 145.698 1.00 41.23  ?  745  SER A N     1 
ATOM   2599  C  CA    . SER A 1 873  ? 161.557 162.890 146.140 1.00 37.10  ?  745  SER A CA    1 
ATOM   2600  C  C     . SER A 1 873  ? 161.645 164.392 146.367 1.00 29.38  ?  745  SER A C     1 
ATOM   2601  O  O     . SER A 1 873  ? 160.866 165.175 145.820 1.00 35.11  ?  745  SER A O     1 
ATOM   2602  C  CB    . SER A 1 873  ? 162.593 162.455 145.107 1.00 48.62  ?  745  SER A CB    1 
ATOM   2603  O  OG    . SER A 1 873  ? 162.072 162.583 143.796 1.00 45.38  ?  745  SER A OG    1 
ATOM   2604  N  N     . THR A 1 874  ? 162.610 164.786 147.196 1.00 33.68  ?  746  THR A N     1 
ATOM   2605  C  CA    . THR A 1 874  ? 162.962 166.195 147.295 1.00 25.25  ?  746  THR A CA    1 
ATOM   2606  C  C     . THR A 1 874  ? 163.602 166.687 146.010 1.00 33.94  ?  746  THR A C     1 
ATOM   2607  O  O     . THR A 1 874  ? 163.503 167.875 145.683 1.00 47.17  ?  746  THR A O     1 
ATOM   2608  C  CB    . THR A 1 874  ? 163.903 166.420 148.479 1.00 36.64  ?  746  THR A CB    1 
ATOM   2609  O  OG1   . THR A 1 874  ? 163.350 165.810 149.652 1.00 53.38  ?  746  THR A OG1   1 
ATOM   2610  C  CG2   . THR A 1 874  ? 164.116 167.901 148.735 1.00 29.96  ?  746  THR A CG2   1 
ATOM   2611  N  N     . TYR A 1 875  ? 164.237 165.789 145.268 1.00 26.80  ?  747  TYR A N     1 
ATOM   2612  C  CA    . TYR A 1 875  ? 164.942 166.138 144.037 1.00 37.00  ?  747  TYR A CA    1 
ATOM   2613  C  C     . TYR A 1 875  ? 164.020 165.913 142.844 1.00 55.25  ?  747  TYR A C     1 
ATOM   2614  O  O     . TYR A 1 875  ? 164.243 165.055 141.988 1.00 71.36  ?  747  TYR A O     1 
ATOM   2615  C  CB    . TYR A 1 875  ? 166.231 165.333 143.907 1.00 24.53  ?  747  TYR A CB    1 
ATOM   2616  C  CG    . TYR A 1 875  ? 167.232 165.681 144.967 1.00 25.32  ?  747  TYR A CG    1 
ATOM   2617  C  CD1   . TYR A 1 875  ? 166.931 165.479 146.301 1.00 36.96  ?  747  TYR A CD1   1 
ATOM   2618  C  CD2   . TYR A 1 875  ? 168.452 166.249 144.647 1.00 22.55  ?  747  TYR A CD2   1 
ATOM   2619  C  CE1   . TYR A 1 875  ? 167.806 165.800 147.283 1.00 35.33  ?  747  TYR A CE1   1 
ATOM   2620  C  CE2   . TYR A 1 875  ? 169.347 166.583 145.639 1.00 43.26  ?  747  TYR A CE2   1 
ATOM   2621  C  CZ    . TYR A 1 875  ? 169.014 166.350 146.954 1.00 55.05  ?  747  TYR A CZ    1 
ATOM   2622  O  OH    . TYR A 1 875  ? 169.881 166.670 147.963 1.00 77.13  ?  747  TYR A OH    1 
ATOM   2623  N  N     . ILE A 1 876  ? 162.955 166.718 142.833 1.00 61.91  ?  748  ILE A N     1 
ATOM   2624  C  CA    . ILE A 1 876  ? 161.843 166.523 141.906 1.00 66.73  ?  748  ILE A CA    1 
ATOM   2625  C  C     . ILE A 1 876  ? 162.326 166.495 140.457 1.00 55.19  ?  748  ILE A C     1 
ATOM   2626  O  O     . ILE A 1 876  ? 161.955 165.610 139.674 1.00 51.40  ?  748  ILE A O     1 
ATOM   2627  C  CB    . ILE A 1 876  ? 160.776 167.610 142.132 1.00 79.83  ?  748  ILE A CB    1 
ATOM   2628  C  CG1   . ILE A 1 876  ? 161.456 168.947 142.458 1.00 74.22  ?  748  ILE A CG1   1 
ATOM   2629  C  CG2   . ILE A 1 876  ? 159.792 167.178 143.214 1.00 64.54  ?  748  ILE A CG2   1 
ATOM   2630  C  CD1   . ILE A 1 876  ? 160.561 170.175 142.337 1.00 77.81  ?  748  ILE A CD1   1 
ATOM   2631  N  N     . CYS A 1 877  ? 163.158 167.453 140.084 1.00 57.28  ?  749  CYS A N     1 
ATOM   2632  C  CA    . CYS A 1 877  ? 163.525 167.626 138.686 1.00 62.00  ?  749  CYS A CA    1 
ATOM   2633  C  C     . CYS A 1 877  ? 164.336 166.451 138.167 1.00 41.41  ?  749  CYS A C     1 
ATOM   2634  O  O     . CYS A 1 877  ? 165.384 166.109 138.723 1.00 49.60  ?  749  CYS A O     1 
ATOM   2635  C  CB    . CYS A 1 877  ? 164.321 168.911 138.494 1.00 107.88 ?  749  CYS A CB    1 
ATOM   2636  S  SG    . CYS A 1 877  ? 164.965 169.036 136.817 1.00 123.70 ?  749  CYS A SG    1 
ATOM   2637  N  N     . THR A 1 878  ? 163.870 165.865 137.075 1.00 27.62  ?  750  THR A N     1 
ATOM   2638  C  CA    . THR A 1 878  ? 164.591 164.791 136.421 1.00 24.53  ?  750  THR A CA    1 
ATOM   2639  C  C     . THR A 1 878  ? 165.670 165.308 135.474 1.00 28.86  ?  750  THR A C     1 
ATOM   2640  O  O     . THR A 1 878  ? 166.430 164.505 134.920 1.00 25.84  ?  750  THR A O     1 
ATOM   2641  C  CB    . THR A 1 878  ? 163.593 163.898 135.673 1.00 25.88  ?  750  THR A CB    1 
ATOM   2642  O  OG1   . THR A 1 878  ? 162.437 163.705 136.492 1.00 20.45  ?  750  THR A OG1   1 
ATOM   2643  C  CG2   . THR A 1 878  ? 164.187 162.535 135.410 1.00 28.72  ?  750  THR A CG2   1 
ATOM   2644  N  N     . LEU A 1 879  ? 165.779 166.627 135.300 1.00 43.20  ?  751  LEU A N     1 
ATOM   2645  C  CA    . LEU A 1 879  ? 166.682 167.219 134.317 1.00 69.40  ?  751  LEU A CA    1 
ATOM   2646  C  C     . LEU A 1 879  ? 167.776 168.078 134.930 1.00 93.88  ?  751  LEU A C     1 
ATOM   2647  O  O     . LEU A 1 879  ? 168.953 167.898 134.595 1.00 89.45  ?  751  LEU A O     1 
ATOM   2648  C  CB    . LEU A 1 879  ? 165.874 168.051 133.311 1.00 84.68  ?  751  LEU A CB    1 
ATOM   2649  C  CG    . LEU A 1 879  ? 164.912 167.175 132.520 1.00 73.68  ?  751  LEU A CG    1 
ATOM   2650  C  CD1   . LEU A 1 879  ? 164.288 167.952 131.369 1.00 139.33 ?  751  LEU A CD1   1 
ATOM   2651  C  CD2   . LEU A 1 879  ? 165.638 165.937 132.030 1.00 50.84  ?  751  LEU A CD2   1 
ATOM   2652  N  N     . CYS A 1 880  ? 167.430 169.044 135.775 1.00 98.15  ?  752  CYS A N     1 
ATOM   2653  C  CA    . CYS A 1 880  ? 168.442 169.773 136.522 1.00 89.58  ?  752  CYS A CA    1 
ATOM   2654  C  C     . CYS A 1 880  ? 168.529 169.166 137.923 1.00 86.04  ?  752  CYS A C     1 
ATOM   2655  O  O     . CYS A 1 880  ? 167.934 168.124 138.213 1.00 84.19  ?  752  CYS A O     1 
ATOM   2656  C  CB    . CYS A 1 880  ? 168.145 171.275 136.523 1.00 98.68  ?  752  CYS A CB    1 
ATOM   2657  S  SG    . CYS A 1 880  ? 166.856 171.839 137.652 1.00 227.41 ?  752  CYS A SG    1 
ATOM   2658  N  N     . ASP A 1 881  ? 169.278 169.810 138.815 1.00 86.60  ?  753  ASP A N     1 
ATOM   2659  C  CA    . ASP A 1 881  ? 169.523 169.266 140.143 1.00 95.10  ?  753  ASP A CA    1 
ATOM   2660  C  C     . ASP A 1 881  ? 168.688 169.963 141.213 1.00 79.36  ?  753  ASP A C     1 
ATOM   2661  O  O     . ASP A 1 881  ? 169.014 169.886 142.402 1.00 78.03  ?  753  ASP A O     1 
ATOM   2662  C  CB    . ASP A 1 881  ? 171.013 169.351 140.480 1.00 145.36 ?  753  ASP A CB    1 
ATOM   2663  C  CG    . ASP A 1 881  ? 171.891 168.650 139.447 1.00 140.82 ?  753  ASP A CG    1 
ATOM   2664  O  OD1   . ASP A 1 881  ? 171.385 168.321 138.351 1.00 103.75 ?  753  ASP A OD1   1 
ATOM   2665  O  OD2   . ASP A 1 881  ? 173.081 168.402 139.738 1.00 253.81 -1 753  ASP A OD2   1 
ATOM   2666  N  N     . SER A 1 882  ? 167.608 170.629 140.814 1.00 85.24  ?  754  SER A N     1 
ATOM   2667  C  CA    . SER A 1 882  ? 166.824 171.420 141.753 1.00 91.48  ?  754  SER A CA    1 
ATOM   2668  C  C     . SER A 1 882  ? 166.088 170.532 142.749 1.00 57.73  ?  754  SER A C     1 
ATOM   2669  O  O     . SER A 1 882  ? 165.728 169.389 142.456 1.00 52.29  ?  754  SER A O     1 
ATOM   2670  C  CB    . SER A 1 882  ? 165.813 172.297 141.006 1.00 112.50 ?  754  SER A CB    1 
ATOM   2671  O  OG    . SER A 1 882  ? 166.331 173.592 140.744 1.00 118.07 ?  754  SER A OG    1 
ATOM   2672  N  N     . THR A 1 883  ? 165.893 171.073 143.947 1.00 63.56  ?  755  THR A N     1 
ATOM   2673  C  CA    . THR A 1 883  ? 164.917 170.573 144.901 1.00 53.88  ?  755  THR A CA    1 
ATOM   2674  C  C     . THR A 1 883  ? 163.591 171.276 144.630 1.00 48.07  ?  755  THR A C     1 
ATOM   2675  O  O     . THR A 1 883  ? 163.393 171.895 143.583 1.00 54.62  ?  755  THR A O     1 
ATOM   2676  C  CB    . THR A 1 883  ? 165.371 170.798 146.343 1.00 52.82  ?  755  THR A CB    1 
ATOM   2677  O  OG1   . THR A 1 883  ? 164.929 172.088 146.785 1.00 58.29  ?  755  THR A OG1   1 
ATOM   2678  C  CG2   . THR A 1 883  ? 166.880 170.712 146.462 1.00 75.85  ?  755  THR A CG2   1 
ATOM   2679  N  N     . ARG A 1 884  ? 162.664 171.178 145.576 1.00 35.49  ?  756  ARG A N     1 
ATOM   2680  C  CA    . ARG A 1 884  ? 161.470 172.007 145.516 1.00 42.55  ?  756  ARG A CA    1 
ATOM   2681  C  C     . ARG A 1 884  ? 161.824 173.491 145.570 1.00 67.72  ?  756  ARG A C     1 
ATOM   2682  O  O     . ARG A 1 884  ? 161.297 174.297 144.792 1.00 76.33  ?  756  ARG A O     1 
ATOM   2683  C  CB    . ARG A 1 884  ? 160.530 171.635 146.658 1.00 40.43  ?  756  ARG A CB    1 
ATOM   2684  C  CG    . ARG A 1 884  ? 159.217 171.116 146.179 1.00 42.43  ?  756  ARG A CG    1 
ATOM   2685  C  CD    . ARG A 1 884  ? 159.377 169.735 145.610 1.00 28.36  ?  756  ARG A CD    1 
ATOM   2686  N  NE    . ARG A 1 884  ? 158.079 169.090 145.500 1.00 26.01  ?  756  ARG A NE    1 
ATOM   2687  C  CZ    . ARG A 1 884  ? 157.471 168.478 146.505 1.00 28.09  ?  756  ARG A CZ    1 
ATOM   2688  N  NH1   . ARG A 1 884  ? 156.280 167.924 146.312 1.00 39.10  ?  756  ARG A NH1   1 
ATOM   2689  N  NH2   . ARG A 1 884  ? 158.042 168.429 147.700 1.00 15.36  ?  756  ARG A NH2   1 
ATOM   2690  N  N     . ALA A 1 885  ? 162.752 173.862 146.451 1.00 83.73  ?  757  ALA A N     1 
ATOM   2691  C  CA    . ALA A 1 885  ? 162.971 175.263 146.804 1.00 105.16 ?  757  ALA A CA    1 
ATOM   2692  C  C     . ALA A 1 885  ? 163.755 176.025 145.733 1.00 108.87 ?  757  ALA A C     1 
ATOM   2693  O  O     . ALA A 1 885  ? 163.275 177.030 145.201 1.00 123.47 ?  757  ALA A O     1 
ATOM   2694  C  CB    . ALA A 1 885  ? 163.683 175.346 148.157 1.00 111.60 ?  757  ALA A CB    1 
ATOM   2695  N  N     . GLU A 1 886  ? 164.977 175.574 145.417 1.00 93.80  ?  758  GLU A N     1 
ATOM   2696  C  CA    . GLU A 1 886  ? 165.832 176.328 144.499 1.00 87.07  ?  758  GLU A CA    1 
ATOM   2697  C  C     . GLU A 1 886  ? 165.165 176.545 143.146 1.00 77.26  ?  758  GLU A C     1 
ATOM   2698  O  O     . GLU A 1 886  ? 165.491 177.504 142.434 1.00 89.93  ?  758  GLU A O     1 
ATOM   2699  C  CB    . GLU A 1 886  ? 167.175 175.620 144.307 1.00 100.18 ?  758  GLU A CB    1 
ATOM   2700  C  CG    . GLU A 1 886  ? 167.054 174.130 144.055 1.00 124.48 ?  758  GLU A CG    1 
ATOM   2701  C  CD    . GLU A 1 886  ? 168.372 173.378 144.212 1.00 153.19 ?  758  GLU A CD    1 
ATOM   2702  O  OE1   . GLU A 1 886  ? 169.443 174.027 144.235 1.00 137.91 ?  758  GLU A OE1   1 
ATOM   2703  O  OE2   . GLU A 1 886  ? 168.334 172.130 144.296 1.00 207.20 -1 758  GLU A OE2   1 
ATOM   2704  N  N     . ALA A 1 887  ? 164.243 175.660 142.767 1.00 75.30  ?  759  ALA A N     1 
ATOM   2705  C  CA    . ALA A 1 887  ? 163.368 175.868 141.625 1.00 82.61  ?  759  ALA A CA    1 
ATOM   2706  C  C     . ALA A 1 887  ? 162.094 176.617 141.986 1.00 102.66 ?  759  ALA A C     1 
ATOM   2707  O  O     . ALA A 1 887  ? 161.379 177.060 141.080 1.00 100.40 ?  759  ALA A O     1 
ATOM   2708  C  CB    . ALA A 1 887  ? 162.991 174.525 140.989 1.00 83.20  ?  759  ALA A CB    1 
ATOM   2709  N  N     . SER A 1 888  ? 161.779 176.755 143.277 1.00 116.77 ?  760  SER A N     1 
ATOM   2710  C  CA    . SER A 1 888  ? 160.583 177.501 143.657 1.00 119.91 ?  760  SER A CA    1 
ATOM   2711  C  C     . SER A 1 888  ? 160.838 179.007 143.697 1.00 131.53 ?  760  SER A C     1 
ATOM   2712  O  O     . SER A 1 888  ? 160.022 179.785 143.191 1.00 120.33 ?  760  SER A O     1 
ATOM   2713  C  CB    . SER A 1 888  ? 160.059 177.002 145.004 1.00 105.61 ?  760  SER A CB    1 
ATOM   2714  O  OG    . SER A 1 888  ? 158.750 177.485 145.257 1.00 99.92  ?  760  SER A OG    1 
ATOM   2715  N  N     . GLN A 1 889  ? 161.946 179.441 144.304 1.00 148.36 ?  761  GLN A N     1 
ATOM   2716  C  CA    . GLN A 1 889  ? 162.312 180.858 144.312 1.00 131.29 ?  761  GLN A CA    1 
ATOM   2717  C  C     . GLN A 1 889  ? 162.569 181.369 142.900 1.00 112.93 ?  761  GLN A C     1 
ATOM   2718  O  O     . GLN A 1 889  ? 161.880 182.272 142.419 1.00 120.39 ?  761  GLN A O     1 
ATOM   2719  C  CB    . GLN A 1 889  ? 163.553 181.108 145.181 1.00 115.08 ?  761  GLN A CB    1 
ATOM   2720  C  CG    . GLN A 1 889  ? 163.405 180.694 146.630 1.00 125.97 ?  761  GLN A CG    1 
ATOM   2721  C  CD    . GLN A 1 889  ? 162.083 181.117 147.227 1.00 134.89 ?  761  GLN A CD    1 
ATOM   2722  O  OE1   . GLN A 1 889  ? 161.701 182.286 147.159 1.00 133.31 ?  761  GLN A OE1   1 
ATOM   2723  N  NE2   . GLN A 1 889  ? 161.369 180.163 147.810 1.00 135.48 ?  761  GLN A NE2   1 
ATOM   2724  N  N     . ASN A 1 890  ? 163.581 180.814 142.243 1.00 105.28 ?  762  ASN A N     1 
ATOM   2725  C  CA    . ASN A 1 890  ? 163.848 181.078 140.836 1.00 103.21 ?  762  ASN A CA    1 
ATOM   2726  C  C     . ASN A 1 890  ? 163.369 179.860 140.052 1.00 111.59 ?  762  ASN A C     1 
ATOM   2727  O  O     . ASN A 1 890  ? 163.903 178.762 140.230 1.00 117.26 ?  762  ASN A O     1 
ATOM   2728  C  CB    . ASN A 1 890  ? 165.341 181.339 140.627 1.00 90.97  ?  762  ASN A CB    1 
ATOM   2729  C  CG    . ASN A 1 890  ? 165.751 181.358 139.161 1.00 92.83  ?  762  ASN A CG    1 
ATOM   2730  O  OD1   . ASN A 1 890  ? 164.917 181.285 138.258 1.00 92.03  ?  762  ASN A OD1   1 
ATOM   2731  N  ND2   . ASN A 1 890  ? 167.057 181.437 138.923 1.00 83.68  ?  762  ASN A ND2   1 
ATOM   2732  N  N     . MET A 1 891  ? 162.361 180.047 139.197 1.00 101.62 ?  763  MET A N     1 
ATOM   2733  C  CA    . MET A 1 891  ? 161.647 178.928 138.582 1.00 95.10  ?  763  MET A CA    1 
ATOM   2734  C  C     . MET A 1 891  ? 162.186 178.545 137.204 1.00 81.54  ?  763  MET A C     1 
ATOM   2735  O  O     . MET A 1 891  ? 162.596 177.399 136.994 1.00 82.93  ?  763  MET A O     1 
ATOM   2736  C  CB    . MET A 1 891  ? 160.144 179.245 138.495 1.00 103.53 ?  763  MET A CB    1 
ATOM   2737  C  CG    . MET A 1 891  ? 159.453 179.369 139.855 1.00 115.10 ?  763  MET A CG    1 
ATOM   2738  S  SD    . MET A 1 891  ? 157.681 179.711 139.777 1.00 139.22 ?  763  MET A SD    1 
ATOM   2739  C  CE    . MET A 1 891  ? 157.086 178.223 138.989 1.00 76.06  ?  763  MET A CE    1 
ATOM   2740  N  N     . VAL A 1 892  ? 162.193 179.479 136.255 1.00 65.53  ?  764  VAL A N     1 
ATOM   2741  C  CA    . VAL A 1 892  ? 162.395 179.139 134.849 1.00 72.62  ?  764  VAL A CA    1 
ATOM   2742  C  C     . VAL A 1 892  ? 163.843 179.319 134.411 1.00 69.91  ?  764  VAL A C     1 
ATOM   2743  O  O     . VAL A 1 892  ? 164.142 179.311 133.211 1.00 67.54  ?  764  VAL A O     1 
ATOM   2744  C  CB    . VAL A 1 892  ? 161.461 179.968 133.948 1.00 84.27  ?  764  VAL A CB    1 
ATOM   2745  C  CG1   . VAL A 1 892  ? 160.014 179.622 134.230 1.00 73.35  ?  764  VAL A CG1   1 
ATOM   2746  C  CG2   . VAL A 1 892  ? 161.710 181.456 134.144 1.00 95.85  ?  764  VAL A CG2   1 
ATOM   2747  N  N     . LEU A 1 893  ? 164.758 179.455 135.364 1.00 80.65  ?  765  LEU A N     1 
ATOM   2748  C  CA    . LEU A 1 893  ? 166.164 179.688 135.046 1.00 92.71  ?  765  LEU A CA    1 
ATOM   2749  C  C     . LEU A 1 893  ? 166.960 178.454 135.462 1.00 91.68  ?  765  LEU A C     1 
ATOM   2750  O  O     . LEU A 1 893  ? 167.425 178.348 136.599 1.00 95.17  ?  765  LEU A O     1 
ATOM   2751  C  CB    . LEU A 1 893  ? 166.682 180.957 135.724 1.00 97.15  ?  765  LEU A CB    1 
ATOM   2752  C  CG    . LEU A 1 893  ? 167.765 181.738 134.977 1.00 86.94  ?  765  LEU A CG    1 
ATOM   2753  C  CD1   . LEU A 1 893  ? 167.532 181.676 133.476 1.00 62.12  ?  765  LEU A CD1   1 
ATOM   2754  C  CD2   . LEU A 1 893  ? 167.806 183.184 135.451 1.00 73.42  ?  765  LEU A CD2   1 
ATOM   2755  N  N     . HIS A 1 894  ? 167.113 177.523 134.525 1.00 70.44  ?  766  HIS A N     1 
ATOM   2756  C  CA    . HIS A 1 894  ? 167.943 176.351 134.736 1.00 54.54  ?  766  HIS A CA    1 
ATOM   2757  C  C     . HIS A 1 894  ? 168.552 175.936 133.408 1.00 48.41  ?  766  HIS A C     1 
ATOM   2758  O  O     . HIS A 1 894  ? 168.022 176.233 132.336 1.00 41.91  ?  766  HIS A O     1 
ATOM   2759  C  CB    . HIS A 1 894  ? 167.157 175.186 135.341 1.00 58.02  ?  766  HIS A CB    1 
ATOM   2760  C  CG    . HIS A 1 894  ? 166.653 175.448 136.725 1.00 68.83  ?  766  HIS A CG    1 
ATOM   2761  N  ND1   . HIS A 1 894  ? 165.438 176.051 136.976 1.00 76.37  ?  766  HIS A ND1   1 
ATOM   2762  C  CD2   . HIS A 1 894  ? 167.213 175.212 137.935 1.00 77.28  ?  766  HIS A CD2   1 
ATOM   2763  C  CE1   . HIS A 1 894  ? 165.265 176.157 138.281 1.00 84.16  ?  766  HIS A CE1   1 
ATOM   2764  N  NE2   . HIS A 1 894  ? 166.328 175.656 138.885 1.00 83.21  ?  766  HIS A NE2   1 
ATOM   2765  N  N     . SER A 1 895  ? 169.683 175.246 133.502 1.00 53.19  ?  767  SER A N     1 
ATOM   2766  C  CA    . SER A 1 895  ? 170.359 174.657 132.357 1.00 60.51  ?  767  SER A CA    1 
ATOM   2767  C  C     . SER A 1 895  ? 170.278 173.143 132.486 1.00 75.84  ?  767  SER A C     1 
ATOM   2768  O  O     . SER A 1 895  ? 170.489 172.599 133.575 1.00 82.19  ?  767  SER A O     1 
ATOM   2769  C  CB    . SER A 1 895  ? 171.818 175.131 132.272 1.00 77.67  ?  767  SER A CB    1 
ATOM   2770  O  OG    . SER A 1 895  ? 172.382 175.312 133.561 1.00 74.29  ?  767  SER A OG    1 
ATOM   2771  N  N     . ILE A 1 896  ? 169.952 172.466 131.380 1.00 72.12  ?  768  ILE A N     1 
ATOM   2772  C  CA    . ILE A 1 896  ? 169.803 171.015 131.418 1.00 72.09  ?  768  ILE A CA    1 
ATOM   2773  C  C     . ILE A 1 896  ? 171.129 170.370 131.768 1.00 79.81  ?  768  ILE A C     1 
ATOM   2774  O  O     . ILE A 1 896  ? 172.149 170.596 131.107 1.00 75.66  ?  768  ILE A O     1 
ATOM   2775  C  CB    . ILE A 1 896  ? 169.262 170.476 130.087 1.00 67.63  ?  768  ILE A CB    1 
ATOM   2776  C  CG1   . ILE A 1 896  ? 167.744 170.625 130.041 1.00 79.44  ?  768  ILE A CG1   1 
ATOM   2777  C  CG2   . ILE A 1 896  ? 169.660 169.018 129.889 1.00 53.76  ?  768  ILE A CG2   1 
ATOM   2778  C  CD1   . ILE A 1 896  ? 167.102 169.935 128.864 1.00 116.66 ?  768  ILE A CD1   1 
ATOM   2779  N  N     . THR A 1 897  ? 171.117 169.557 132.819 1.00 90.42  ?  769  THR A N     1 
ATOM   2780  C  CA    . THR A 1 897  ? 172.308 168.861 133.282 1.00 107.87 ?  769  THR A CA    1 
ATOM   2781  C  C     . THR A 1 897  ? 172.178 167.349 133.170 1.00 114.07 ?  769  THR A C     1 
ATOM   2782  O  O     . THR A 1 897  ? 173.052 166.711 132.578 1.00 118.71 ?  769  THR A O     1 
ATOM   2783  C  CB    . THR A 1 897  ? 172.622 169.277 134.734 1.00 110.59 ?  769  THR A CB    1 
ATOM   2784  O  OG1   . THR A 1 897  ? 171.400 169.437 135.462 1.00 98.63  ?  769  THR A OG1   1 
ATOM   2785  C  CG2   . THR A 1 897  ? 173.373 170.606 134.759 1.00 108.23 ?  769  THR A CG2   1 
ATOM   2786  N  N     . ARG A 1 898  ? 171.085 166.762 133.674 1.00 96.76  ?  770  ARG A N     1 
ATOM   2787  C  CA    . ARG A 1 898  ? 170.973 165.317 133.881 1.00 67.92  ?  770  ARG A CA    1 
ATOM   2788  C  C     . ARG A 1 898  ? 171.242 164.511 132.613 1.00 67.21  ?  770  ARG A C     1 
ATOM   2789  O  O     . ARG A 1 898  ? 170.503 164.622 131.629 1.00 69.50  ?  770  ARG A O     1 
ATOM   2790  C  CB    . ARG A 1 898  ? 169.583 164.956 134.420 1.00 39.32  ?  770  ARG A CB    1 
ATOM   2791  C  CG    . ARG A 1 898  ? 169.453 165.107 135.927 1.00 33.87  ?  770  ARG A CG    1 
ATOM   2792  C  CD    . ARG A 1 898  ? 170.442 164.240 136.675 1.00 37.78  ?  770  ARG A CD    1 
ATOM   2793  N  NE    . ARG A 1 898  ? 170.474 164.567 138.100 1.00 45.70  ?  770  ARG A NE    1 
ATOM   2794  C  CZ    . ARG A 1 898  ? 169.576 164.151 138.985 1.00 40.27  ?  770  ARG A CZ    1 
ATOM   2795  N  NH1   . ARG A 1 898  ? 168.556 163.410 138.583 1.00 28.55  ?  770  ARG A NH1   1 
ATOM   2796  N  NH2   . ARG A 1 898  ? 169.687 164.493 140.267 1.00 30.50  ?  770  ARG A NH2   1 
ATOM   2797  N  N     . SER A 1 899  ? 172.302 163.706 132.636 1.00 83.48  ?  771  SER A N     1 
ATOM   2798  C  CA    . SER A 1 899  ? 172.603 162.719 131.610 1.00 85.85  ?  771  SER A CA    1 
ATOM   2799  C  C     . SER A 1 899  ? 172.968 161.405 132.288 1.00 79.99  ?  771  SER A C     1 
ATOM   2800  O  O     . SER A 1 899  ? 173.262 161.360 133.485 1.00 85.24  ?  771  SER A O     1 
ATOM   2801  C  CB    . SER A 1 899  ? 173.744 163.172 130.683 1.00 99.57  ?  771  SER A CB    1 
ATOM   2802  O  OG    . SER A 1 899  ? 174.522 162.070 130.242 1.00 87.66  ?  771  SER A OG    1 
ATOM   2803  N  N     . HIS A 1 900  ? 172.960 160.331 131.498 1.00 65.93  ?  772  HIS A N     1 
ATOM   2804  C  CA    . HIS A 1 900  ? 173.088 158.987 132.054 1.00 62.87  ?  772  HIS A CA    1 
ATOM   2805  C  C     . HIS A 1 900  ? 174.485 158.742 132.612 1.00 54.75  ?  772  HIS A C     1 
ATOM   2806  O  O     . HIS A 1 900  ? 174.649 158.299 133.759 1.00 54.83  ?  772  HIS A O     1 
ATOM   2807  C  CB    . HIS A 1 900  ? 172.732 157.961 130.974 1.00 53.68  ?  772  HIS A CB    1 
ATOM   2808  C  CG    . HIS A 1 900  ? 173.065 156.542 131.329 1.00 59.08  ?  772  HIS A CG    1 
ATOM   2809  N  ND1   . HIS A 1 900  ? 172.115 155.546 131.328 1.00 54.09  ?  772  HIS A ND1   1 
ATOM   2810  C  CD2   . HIS A 1 900  ? 174.239 155.944 131.645 1.00 70.70  ?  772  HIS A CD2   1 
ATOM   2811  C  CE1   . HIS A 1 900  ? 172.683 154.402 131.657 1.00 49.74  ?  772  HIS A CE1   1 
ATOM   2812  N  NE2   . HIS A 1 900  ? 173.970 154.616 131.856 1.00 62.86  ?  772  HIS A NE2   1 
ATOM   2813  N  N     . ASP A 1 901  ? 175.503 158.986 131.794 1.00 48.03  ?  773  ASP A N     1 
ATOM   2814  C  CA    . ASP A 1 901  ? 176.860 158.640 132.185 1.00 48.96  ?  773  ASP A CA    1 
ATOM   2815  C  C     . ASP A 1 901  ? 177.291 159.386 133.443 1.00 67.16  ?  773  ASP A C     1 
ATOM   2816  O  O     . ASP A 1 901  ? 177.923 158.808 134.337 1.00 68.13  ?  773  ASP A O     1 
ATOM   2817  C  CB    . ASP A 1 901  ? 177.809 158.921 131.029 1.00 59.13  ?  773  ASP A CB    1 
ATOM   2818  C  CG    . ASP A 1 901  ? 179.122 158.224 131.194 1.00 191.89 ?  773  ASP A CG    1 
ATOM   2819  O  OD1   . ASP A 1 901  ? 179.658 158.275 132.321 1.00 343.08 -1 773  ASP A OD1   1 
ATOM   2820  O  OD2   . ASP A 1 901  ? 179.617 157.620 130.221 1.00 414.22 -1 773  ASP A OD2   1 
ATOM   2821  N  N     . GLU A 1 902  ? 176.945 160.668 133.543 1.00 68.15  ?  774  GLU A N     1 
ATOM   2822  C  CA    . GLU A 1 902  ? 177.275 161.411 134.751 1.00 72.35  ?  774  GLU A CA    1 
ATOM   2823  C  C     . GLU A 1 902  ? 176.466 160.941 135.953 1.00 62.12  ?  774  GLU A C     1 
ATOM   2824  O  O     . GLU A 1 902  ? 176.910 161.120 137.091 1.00 59.14  ?  774  GLU A O     1 
ATOM   2825  C  CB    . GLU A 1 902  ? 177.059 162.909 134.538 1.00 115.92 ?  774  GLU A CB    1 
ATOM   2826  C  CG    . GLU A 1 902  ? 175.598 163.290 134.428 1.00 149.51 ?  774  GLU A CG    1 
ATOM   2827  C  CD    . GLU A 1 902  ? 175.341 164.368 133.395 1.00 194.57 ?  774  GLU A CD    1 
ATOM   2828  O  OE1   . GLU A 1 902  ? 176.311 164.851 132.771 1.00 197.29 ?  774  GLU A OE1   1 
ATOM   2829  O  OE2   . GLU A 1 902  ? 174.159 164.714 133.194 1.00 267.87 -1 774  GLU A OE2   1 
ATOM   2830  N  N     . ASN A 1 903  ? 175.294 160.334 135.733 1.00 57.48  ?  775  ASN A N     1 
ATOM   2831  C  CA    . ASN A 1 903  ? 174.559 159.725 136.839 1.00 51.07  ?  775  ASN A CA    1 
ATOM   2832  C  C     . ASN A 1 903  ? 175.264 158.473 137.339 1.00 52.50  ?  775  ASN A C     1 
ATOM   2833  O  O     . ASN A 1 903  ? 175.322 158.226 138.548 1.00 55.09  ?  775  ASN A O     1 
ATOM   2834  C  CB    . ASN A 1 903  ? 173.125 159.403 136.421 1.00 54.82  ?  775  ASN A CB    1 
ATOM   2835  C  CG    . ASN A 1 903  ? 172.287 160.651 136.167 1.00 79.26  ?  775  ASN A CG    1 
ATOM   2836  O  OD1   . ASN A 1 903  ? 172.227 161.555 137.004 1.00 76.09  ?  775  ASN A OD1   1 
ATOM   2837  N  ND2   . ASN A 1 903  ? 171.618 160.696 135.018 1.00 86.83  ?  775  ASN A ND2   1 
ATOM   2838  N  N     . LEU A 1 904  ? 175.797 157.667 136.420 1.00 49.45  ?  776  LEU A N     1 
ATOM   2839  C  CA    . LEU A 1 904  ? 176.681 156.576 136.820 1.00 46.53  ?  776  LEU A CA    1 
ATOM   2840  C  C     . LEU A 1 904  ? 177.871 157.112 137.623 1.00 50.13  ?  776  LEU A C     1 
ATOM   2841  O  O     . LEU A 1 904  ? 178.290 156.514 138.626 1.00 39.83  ?  776  LEU A O     1 
ATOM   2842  C  CB    . LEU A 1 904  ? 177.141 155.816 135.572 1.00 35.64  ?  776  LEU A CB    1 
ATOM   2843  C  CG    . LEU A 1 904  ? 178.074 154.608 135.689 1.00 26.70  ?  776  LEU A CG    1 
ATOM   2844  C  CD1   . LEU A 1 904  ? 179.545 155.021 135.628 1.00 42.63  ?  776  LEU A CD1   1 
ATOM   2845  C  CD2   . LEU A 1 904  ? 177.771 153.821 136.955 1.00 34.05  ?  776  LEU A CD2   1 
ATOM   2846  N  N     . GLU A 1 905  ? 178.425 158.245 137.187 1.00 70.27  ?  777  GLU A N     1 
ATOM   2847  C  CA    . GLU A 1 905  ? 179.525 158.875 137.916 1.00 67.90  ?  777  GLU A CA    1 
ATOM   2848  C  C     . GLU A 1 905  ? 179.111 159.261 139.333 1.00 63.66  ?  777  GLU A C     1 
ATOM   2849  O  O     . GLU A 1 905  ? 179.850 159.026 140.298 1.00 69.07  ?  777  GLU A O     1 
ATOM   2850  C  CB    . GLU A 1 905  ? 180.024 160.102 137.155 1.00 71.72  ?  777  GLU A CB    1 
ATOM   2851  C  CG    . GLU A 1 905  ? 181.383 160.595 137.608 1.00 87.71  ?  777  GLU A CG    1 
ATOM   2852  C  CD    . GLU A 1 905  ? 182.395 159.475 137.687 1.00 150.30 ?  777  GLU A CD    1 
ATOM   2853  O  OE1   . GLU A 1 905  ? 182.643 158.969 138.802 1.00 125.48 ?  777  GLU A OE1   1 
ATOM   2854  O  OE2   . GLU A 1 905  ? 182.921 159.080 136.626 1.00 320.70 -1 777  GLU A OE2   1 
ATOM   2855  N  N     . ARG A 1 906  ? 177.951 159.907 139.466 1.00 54.61  ?  778  ARG A N     1 
ATOM   2856  C  CA    . ARG A 1 906  ? 177.442 160.287 140.781 1.00 49.76  ?  778  ARG A CA    1 
ATOM   2857  C  C     . ARG A 1 906  ? 177.224 159.060 141.659 1.00 46.61  ?  778  ARG A C     1 
ATOM   2858  O  O     . ARG A 1 906  ? 177.466 159.100 142.872 1.00 39.35  ?  778  ARG A O     1 
ATOM   2859  C  CB    . ARG A 1 906  ? 176.141 161.080 140.631 1.00 46.40  ?  778  ARG A CB    1 
ATOM   2860  C  CG    . ARG A 1 906  ? 176.324 162.576 140.420 1.00 40.14  ?  778  ARG A CG    1 
ATOM   2861  C  CD    . ARG A 1 906  ? 174.996 163.272 140.151 1.00 32.42  ?  778  ARG A CD    1 
ATOM   2862  N  NE    . ARG A 1 906  ? 175.186 164.688 139.862 1.00 29.37  ?  778  ARG A NE    1 
ATOM   2863  C  CZ    . ARG A 1 906  ? 175.682 165.145 138.719 1.00 27.10  ?  778  ARG A CZ    1 
ATOM   2864  N  NH1   . ARG A 1 906  ? 176.041 164.294 137.768 1.00 42.80  ?  778  ARG A NH1   1 
ATOM   2865  N  NH2   . ARG A 1 906  ? 175.829 166.449 138.527 1.00 42.09  ?  778  ARG A NH2   1 
ATOM   2866  N  N     . TYR A 1 907  ? 176.760 157.959 141.064 1.00 40.34  ?  779  TYR A N     1 
ATOM   2867  C  CA    . TYR A 1 907  ? 176.605 156.729 141.834 1.00 37.52  ?  779  TYR A CA    1 
ATOM   2868  C  C     . TYR A 1 907  ? 177.943 156.245 142.366 1.00 40.89  ?  779  TYR A C     1 
ATOM   2869  O  O     . TYR A 1 907  ? 178.043 155.808 143.519 1.00 41.51  ?  779  TYR A O     1 
ATOM   2870  C  CB    . TYR A 1 907  ? 175.934 155.632 141.003 1.00 41.59  ?  779  TYR A CB    1 
ATOM   2871  C  CG    . TYR A 1 907  ? 175.900 154.302 141.740 1.00 28.46  ?  779  TYR A CG    1 
ATOM   2872  C  CD1   . TYR A 1 907  ? 174.874 154.001 142.620 1.00 20.69  ?  779  TYR A CD1   1 
ATOM   2873  C  CD2   . TYR A 1 907  ? 176.883 153.340 141.535 1.00 31.43  ?  779  TYR A CD2   1 
ATOM   2874  C  CE1   . TYR A 1 907  ? 174.839 152.796 143.298 1.00 16.04  ?  779  TYR A CE1   1 
ATOM   2875  C  CE2   . TYR A 1 907  ? 176.852 152.130 142.208 1.00 36.86  ?  779  TYR A CE2   1 
ATOM   2876  C  CZ    . TYR A 1 907  ? 175.824 151.865 143.086 1.00 19.99  ?  779  TYR A CZ    1 
ATOM   2877  O  OH    . TYR A 1 907  ? 175.786 150.664 143.755 1.00 20.50  ?  779  TYR A OH    1 
ATOM   2878  N  N     . GLU A 1 908  ? 178.974 156.271 141.525 1.00 51.66  ?  780  GLU A N     1 
ATOM   2879  C  CA    . GLU A 1 908  ? 180.301 155.899 142.009 1.00 65.61  ?  780  GLU A CA    1 
ATOM   2880  C  C     . GLU A 1 908  ? 180.742 156.809 143.150 1.00 68.01  ?  780  GLU A C     1 
ATOM   2881  O  O     . GLU A 1 908  ? 181.310 156.341 144.151 1.00 69.97  ?  780  GLU A O     1 
ATOM   2882  C  CB    . GLU A 1 908  ? 181.310 155.925 140.865 1.00 71.92  ?  780  GLU A CB    1 
ATOM   2883  C  CG    . GLU A 1 908  ? 182.546 155.088 141.144 1.00 91.78  ?  780  GLU A CG    1 
ATOM   2884  C  CD    . GLU A 1 908  ? 182.268 153.980 142.140 1.00 109.24 ?  780  GLU A CD    1 
ATOM   2885  O  OE1   . GLU A 1 908  ? 182.774 154.052 143.280 1.00 89.81  ?  780  GLU A OE1   1 
ATOM   2886  O  OE2   . GLU A 1 908  ? 181.504 153.055 141.799 1.00 234.30 -1 780  GLU A OE2   1 
ATOM   2887  N  N     . ILE A 1 909  ? 180.487 158.113 143.008 1.00 60.53  ?  781  ILE A N     1 
ATOM   2888  C  CA    . ILE A 1 909  ? 180.832 159.082 144.047 1.00 50.58  ?  781  ILE A CA    1 
ATOM   2889  C  C     . ILE A 1 909  ? 180.158 158.714 145.364 1.00 43.32  ?  781  ILE A C     1 
ATOM   2890  O  O     . ILE A 1 909  ? 180.768 158.791 146.439 1.00 59.53  ?  781  ILE A O     1 
ATOM   2891  C  CB    . ILE A 1 909  ? 180.458 160.504 143.584 1.00 48.50  ?  781  ILE A CB    1 
ATOM   2892  C  CG1   . ILE A 1 909  ? 181.595 161.108 142.748 1.00 51.89  ?  781  ILE A CG1   1 
ATOM   2893  C  CG2   . ILE A 1 909  ? 180.096 161.393 144.771 1.00 50.80  ?  781  ILE A CG2   1 
ATOM   2894  C  CD1   . ILE A 1 909  ? 181.400 162.564 142.378 1.00 50.58  ?  781  ILE A CD1   1 
ATOM   2895  N  N     . TRP A 1 910  ? 178.888 158.308 145.297 1.00 35.64  ?  782  TRP A N     1 
ATOM   2896  C  CA    . TRP A 1 910  ? 178.169 157.853 146.486 1.00 37.14  ?  782  TRP A CA    1 
ATOM   2897  C  C     . TRP A 1 910  ? 178.829 156.622 147.088 1.00 42.64  ?  782  TRP A C     1 
ATOM   2898  O  O     . TRP A 1 910  ? 179.154 156.591 148.279 1.00 48.40  ?  782  TRP A O     1 
ATOM   2899  C  CB    . TRP A 1 910  ? 176.700 157.564 146.138 1.00 26.60  ?  782  TRP A CB    1 
ATOM   2900  C  CG    . TRP A 1 910  ? 175.946 156.618 147.094 1.00 28.05  ?  782  TRP A CG    1 
ATOM   2901  C  CD1   . TRP A 1 910  ? 176.186 155.282 147.294 1.00 32.98  ?  782  TRP A CD1   1 
ATOM   2902  C  CD2   . TRP A 1 910  ? 174.861 156.951 147.970 1.00 26.14  ?  782  TRP A CD2   1 
ATOM   2903  N  NE1   . TRP A 1 910  ? 175.319 154.773 148.227 1.00 34.20  ?  782  TRP A NE1   1 
ATOM   2904  C  CE2   . TRP A 1 910  ? 174.496 155.774 148.657 1.00 20.71  ?  782  TRP A CE2   1 
ATOM   2905  C  CE3   . TRP A 1 910  ? 174.161 158.130 148.240 1.00 43.64  ?  782  TRP A CE3   1 
ATOM   2906  C  CZ2   . TRP A 1 910  ? 173.468 155.741 149.589 1.00 18.85  ?  782  TRP A CZ2   1 
ATOM   2907  C  CZ3   . TRP A 1 910  ? 173.145 158.095 149.161 1.00 40.08  ?  782  TRP A CZ3   1 
ATOM   2908  C  CH2   . TRP A 1 910  ? 172.805 156.908 149.827 1.00 19.89  ?  782  TRP A CH2   1 
ATOM   2909  N  N     . ARG A 1 911  ? 179.022 155.587 146.269 1.00 51.12  ?  783  ARG A N     1 
ATOM   2910  C  CA    . ARG A 1 911  ? 179.379 154.266 146.782 1.00 51.92  ?  783  ARG A CA    1 
ATOM   2911  C  C     . ARG A 1 911  ? 180.762 154.269 147.425 1.00 49.73  ?  783  ARG A C     1 
ATOM   2912  O  O     . ARG A 1 911  ? 180.944 153.735 148.526 1.00 29.11  ?  783  ARG A O     1 
ATOM   2913  C  CB    . ARG A 1 911  ? 179.302 153.237 145.655 1.00 55.55  ?  783  ARG A CB    1 
ATOM   2914  C  CG    . ARG A 1 911  ? 180.175 152.011 145.855 1.00 48.68  ?  783  ARG A CG    1 
ATOM   2915  C  CD    . ARG A 1 911  ? 180.036 151.047 144.682 1.00 49.49  ?  783  ARG A CD    1 
ATOM   2916  N  NE    . ARG A 1 911  ? 181.298 150.371 144.409 1.00 69.22  ?  783  ARG A NE    1 
ATOM   2917  C  CZ    . ARG A 1 911  ? 181.816 149.419 145.179 1.00 92.42  ?  783  ARG A CZ    1 
ATOM   2918  N  NH1   . ARG A 1 911  ? 181.169 149.031 146.270 1.00 94.29  ?  783  ARG A NH1   1 
ATOM   2919  N  NH2   . ARG A 1 911  ? 182.978 148.856 144.864 1.00 105.58 ?  783  ARG A NH2   1 
ATOM   2920  N  N     . LYS A 1 912  ? 181.756 154.843 146.742 1.00 60.54  ?  784  LYS A N     1 
ATOM   2921  C  CA    . LYS A 1 912  ? 183.085 154.924 147.342 1.00 52.07  ?  784  LYS A CA    1 
ATOM   2922  C  C     . LYS A 1 912  ? 183.069 155.778 148.603 1.00 65.41  ?  784  LYS A C     1 
ATOM   2923  O  O     . LYS A 1 912  ? 183.730 155.443 149.594 1.00 64.63  ?  784  LYS A O     1 
ATOM   2924  C  CB    . LYS A 1 912  ? 184.090 155.479 146.333 1.00 58.73  ?  784  LYS A CB    1 
ATOM   2925  C  CG    . LYS A 1 912  ? 185.550 155.251 146.702 1.00 51.10  ?  784  LYS A CG    1 
ATOM   2926  C  CD    . LYS A 1 912  ? 186.007 153.860 146.310 1.00 63.52  ?  784  LYS A CD    1 
ATOM   2927  C  CE    . LYS A 1 912  ? 185.840 153.614 144.817 1.00 64.66  ?  784  LYS A CE    1 
ATOM   2928  N  NZ    . LYS A 1 912  ? 186.648 152.455 144.337 1.00 77.19  ?  784  LYS A NZ    1 
ATOM   2929  N  N     . ASN A 1 913  ? 182.318 156.888 148.579 1.00 70.92  ?  785  ASN A N     1 
ATOM   2930  C  CA    . ASN A 1 913  ? 182.227 157.864 149.662 1.00 69.39  ?  785  ASN A CA    1 
ATOM   2931  C  C     . ASN A 1 913  ? 183.624 158.331 150.053 1.00 67.21  ?  785  ASN A C     1 
ATOM   2932  O  O     . ASN A 1 913  ? 184.113 157.990 151.138 1.00 72.83  ?  785  ASN A O     1 
ATOM   2933  C  CB    . ASN A 1 913  ? 181.509 157.263 150.869 1.00 71.91  ?  785  ASN A CB    1 
ATOM   2934  C  CG    . ASN A 1 913  ? 181.226 158.290 151.960 1.00 85.97  ?  785  ASN A CG    1 
ATOM   2935  O  OD1   . ASN A 1 913  ? 181.801 159.380 151.986 1.00 74.69  ?  785  ASN A OD1   1 
ATOM   2936  N  ND2   . ASN A 1 913  ? 180.349 157.928 152.887 1.00 99.79  ?  785  ASN A ND2   1 
ATOM   2937  N  N     . PRO A 1 914  ? 184.305 159.098 149.202 1.00 65.05  ?  786  PRO A N     1 
ATOM   2938  C  CA    . PRO A 1 914  ? 185.677 159.512 149.505 1.00 76.97  ?  786  PRO A CA    1 
ATOM   2939  C  C     . PRO A 1 914  ? 185.793 160.781 150.335 1.00 85.58  ?  786  PRO A C     1 
ATOM   2940  O  O     . PRO A 1 914  ? 186.877 161.370 150.379 1.00 94.07  ?  786  PRO A O     1 
ATOM   2941  C  CB    . PRO A 1 914  ? 186.278 159.716 148.106 1.00 88.37  ?  786  PRO A CB    1 
ATOM   2942  C  CG    . PRO A 1 914  ? 185.120 160.123 147.268 1.00 81.00  ?  786  PRO A CG    1 
ATOM   2943  C  CD    . PRO A 1 914  ? 183.859 159.589 147.888 1.00 59.54  ?  786  PRO A CD    1 
ATOM   2944  N  N     . PHE A 1 915  ? 184.718 161.218 150.989 1.00 78.77  ?  787  PHE A N     1 
ATOM   2945  C  CA    . PHE A 1 915  ? 184.763 162.425 151.801 1.00 86.88  ?  787  PHE A CA    1 
ATOM   2946  C  C     . PHE A 1 915  ? 184.163 162.228 153.187 1.00 93.99  ?  787  PHE A C     1 
ATOM   2947  O  O     . PHE A 1 915  ? 184.043 163.204 153.937 1.00 100.65 ?  787  PHE A O     1 
ATOM   2948  C  CB    . PHE A 1 915  ? 184.062 163.581 151.083 1.00 113.51 ?  787  PHE A CB    1 
ATOM   2949  C  CG    . PHE A 1 915  ? 184.621 163.865 149.719 1.00 117.92 ?  787  PHE A CG    1 
ATOM   2950  C  CD1   . PHE A 1 915  ? 184.128 163.219 148.599 1.00 113.72 ?  787  PHE A CD1   1 
ATOM   2951  C  CD2   . PHE A 1 915  ? 185.631 164.796 149.553 1.00 134.54 ?  787  PHE A CD2   1 
ATOM   2952  C  CE1   . PHE A 1 915  ? 184.642 163.492 147.344 1.00 118.52 ?  787  PHE A CE1   1 
ATOM   2953  C  CE2   . PHE A 1 915  ? 186.146 165.064 148.301 1.00 141.61 ?  787  PHE A CE2   1 
ATOM   2954  C  CZ    . PHE A 1 915  ? 185.652 164.409 147.200 1.00 129.28 ?  787  PHE A CZ    1 
ATOM   2955  N  N     . SER A 1 916  ? 183.796 160.998 153.551 1.00 94.89  ?  788  SER A N     1 
ATOM   2956  C  CA    . SER A 1 916  ? 183.384 160.643 154.908 1.00 97.77  ?  788  SER A CA    1 
ATOM   2957  C  C     . SER A 1 916  ? 182.235 161.505 155.422 1.00 85.89  ?  788  SER A C     1 
ATOM   2958  O  O     . SER A 1 916  ? 182.063 161.659 156.636 1.00 86.44  ?  788  SER A O     1 
ATOM   2959  C  CB    . SER A 1 916  ? 184.568 160.726 155.879 1.00 118.20 ?  788  SER A CB    1 
ATOM   2960  O  OG    . SER A 1 916  ? 185.130 162.029 155.911 1.00 127.60 ?  788  SER A OG    1 
ATOM   2961  N  N     . GLU A 1 917  ? 181.446 162.071 154.517 1.00 83.77  ?  789  GLU A N     1 
ATOM   2962  C  CA    . GLU A 1 917  ? 180.403 163.002 154.904 1.00 91.63  ?  789  GLU A CA    1 
ATOM   2963  C  C     . GLU A 1 917  ? 179.234 162.262 155.554 1.00 83.09  ?  789  GLU A C     1 
ATOM   2964  O  O     . GLU A 1 917  ? 179.123 161.035 155.486 1.00 74.89  ?  789  GLU A O     1 
ATOM   2965  C  CB    . GLU A 1 917  ? 179.929 163.792 153.684 1.00 124.54 ?  789  GLU A CB    1 
ATOM   2966  C  CG    . GLU A 1 917  ? 181.072 164.410 152.878 1.00 158.53 ?  789  GLU A CG    1 
ATOM   2967  C  CD    . GLU A 1 917  ? 180.652 164.831 151.475 1.00 204.71 ?  789  GLU A CD    1 
ATOM   2968  O  OE1   . GLU A 1 917  ? 179.445 164.758 151.164 1.00 188.94 ?  789  GLU A OE1   1 
ATOM   2969  O  OE2   . GLU A 1 917  ? 181.533 165.215 150.674 1.00 317.89 -1 789  GLU A OE2   1 
ATOM   2970  N  N     . SER A 1 918  ? 178.362 163.029 156.204 1.00 82.75  ?  790  SER A N     1 
ATOM   2971  C  CA    . SER A 1 918  ? 177.148 162.464 156.768 1.00 62.79  ?  790  SER A CA    1 
ATOM   2972  C  C     . SER A 1 918  ? 176.225 161.979 155.653 1.00 55.94  ?  790  SER A C     1 
ATOM   2973  O  O     . SER A 1 918  ? 176.389 162.317 154.477 1.00 64.86  ?  790  SER A O     1 
ATOM   2974  C  CB    . SER A 1 918  ? 176.421 163.488 157.644 1.00 68.28  ?  790  SER A CB    1 
ATOM   2975  O  OG    . SER A 1 918  ? 176.048 164.633 156.899 1.00 70.58  ?  790  SER A OG    1 
ATOM   2976  N  N     . ALA A 1 919  ? 175.244 161.170 156.042 1.00 49.66  ?  791  ALA A N     1 
ATOM   2977  C  CA    . ALA A 1 919  ? 174.350 160.523 155.091 1.00 67.44  ?  791  ALA A CA    1 
ATOM   2978  C  C     . ALA A 1 919  ? 173.579 161.516 154.231 1.00 57.02  ?  791  ALA A C     1 
ATOM   2979  O  O     . ALA A 1 919  ? 173.717 161.521 153.003 1.00 51.79  ?  791  ALA A O     1 
ATOM   2980  C  CB    . ALA A 1 919  ? 173.368 159.610 155.830 1.00 84.33  ?  791  ALA A CB    1 
ATOM   2981  N  N     . ASP A 1 920  ? 172.748 162.342 154.863 1.00 60.41  ?  792  ASP A N     1 
ATOM   2982  C  CA    . ASP A 1 920  ? 171.925 163.274 154.105 1.00 61.25  ?  792  ASP A CA    1 
ATOM   2983  C  C     . ASP A 1 920  ? 172.772 164.289 153.367 1.00 62.40  ?  792  ASP A C     1 
ATOM   2984  O  O     . ASP A 1 920  ? 172.416 164.711 152.262 1.00 66.53  ?  792  ASP A O     1 
ATOM   2985  C  CB    . ASP A 1 920  ? 170.952 163.978 155.040 1.00 66.95  ?  792  ASP A CB    1 
ATOM   2986  C  CG    . ASP A 1 920  ? 170.442 163.061 156.116 1.00 107.20 ?  792  ASP A CG    1 
ATOM   2987  O  OD1   . ASP A 1 920  ? 170.129 161.893 155.804 1.00 77.06  ?  792  ASP A OD1   1 
ATOM   2988  O  OD2   . ASP A 1 920  ? 170.385 163.499 157.283 1.00 319.53 -1 792  ASP A OD2   1 
ATOM   2989  N  N     . GLU A 1 921  ? 173.903 164.687 153.943 1.00 65.47  ?  793  GLU A N     1 
ATOM   2990  C  CA    . GLU A 1 921  ? 174.748 165.648 153.248 1.00 88.23  ?  793  GLU A CA    1 
ATOM   2991  C  C     . GLU A 1 921  ? 175.367 165.018 152.005 1.00 111.82 ?  793  GLU A C     1 
ATOM   2992  O  O     . GLU A 1 921  ? 175.515 165.685 150.975 1.00 136.98 ?  793  GLU A O     1 
ATOM   2993  C  CB    . GLU A 1 921  ? 175.819 166.203 154.194 1.00 99.99  ?  793  GLU A CB    1 
ATOM   2994  C  CG    . GLU A 1 921  ? 176.558 167.422 153.648 1.00 155.62 ?  793  GLU A CG    1 
ATOM   2995  C  CD    . GLU A 1 921  ? 177.725 167.078 152.741 1.00 217.34 ?  793  GLU A CD    1 
ATOM   2996  O  OE1   . GLU A 1 921  ? 178.811 166.751 153.256 1.00 216.65 ?  793  GLU A OE1   1 
ATOM   2997  O  OE2   . GLU A 1 921  ? 177.542 167.127 151.505 1.00 345.82 -1 793  GLU A OE2   1 
ATOM   2998  N  N     . LEU A 1 922  ? 175.723 163.729 152.070 1.00 95.21  ?  794  LEU A N     1 
ATOM   2999  C  CA    . LEU A 1 922  ? 176.240 163.071 150.874 1.00 107.00 ?  794  LEU A CA    1 
ATOM   3000  C  C     . LEU A 1 922  ? 175.140 162.835 149.851 1.00 71.92  ?  794  LEU A C     1 
ATOM   3001  O  O     . LEU A 1 922  ? 175.395 162.893 148.644 1.00 65.82  ?  794  LEU A O     1 
ATOM   3002  C  CB    . LEU A 1 922  ? 176.931 161.750 151.227 1.00 104.62 ?  794  LEU A CB    1 
ATOM   3003  C  CG    . LEU A 1 922  ? 177.676 161.066 150.072 1.00 97.71  ?  794  LEU A CG    1 
ATOM   3004  C  CD1   . LEU A 1 922  ? 178.551 162.044 149.299 1.00 107.06 ?  794  LEU A CD1   1 
ATOM   3005  C  CD2   . LEU A 1 922  ? 178.517 159.901 150.570 1.00 100.75 ?  794  LEU A CD2   1 
ATOM   3006  N  N     . ARG A 1 923  ? 173.923 162.556 150.313 1.00 53.96  ?  795  ARG A N     1 
ATOM   3007  C  CA    . ARG A 1 923  ? 172.769 162.556 149.423 1.00 57.50  ?  795  ARG A CA    1 
ATOM   3008  C  C     . ARG A 1 923  ? 172.629 163.895 148.704 1.00 80.91  ?  795  ARG A C     1 
ATOM   3009  O  O     . ARG A 1 923  ? 172.271 163.945 147.522 1.00 71.99  ?  795  ARG A O     1 
ATOM   3010  C  CB    . ARG A 1 923  ? 171.510 162.241 150.230 1.00 57.99  ?  795  ARG A CB    1 
ATOM   3011  C  CG    . ARG A 1 923  ? 170.224 162.379 149.456 1.00 54.31  ?  795  ARG A CG    1 
ATOM   3012  C  CD    . ARG A 1 923  ? 169.152 161.500 150.045 1.00 55.23  ?  795  ARG A CD    1 
ATOM   3013  N  NE    . ARG A 1 923  ? 167.824 162.008 149.729 1.00 76.97  ?  795  ARG A NE    1 
ATOM   3014  C  CZ    . ARG A 1 923  ? 167.151 162.844 150.513 1.00 107.82 ?  795  ARG A CZ    1 
ATOM   3015  N  NH1   . ARG A 1 923  ? 165.945 163.264 150.161 1.00 122.04 ?  795  ARG A NH1   1 
ATOM   3016  N  NH2   . ARG A 1 923  ? 167.692 163.258 151.653 1.00 81.38  ?  795  ARG A NH2   1 
ATOM   3017  N  N     . ASP A 1 924  ? 172.906 164.989 149.414 1.00 103.05 ?  796  ASP A N     1 
ATOM   3018  C  CA    . ASP A 1 924  ? 172.821 166.320 148.819 1.00 117.40 ?  796  ASP A CA    1 
ATOM   3019  C  C     . ASP A 1 924  ? 173.902 166.506 147.756 1.00 105.38 ?  796  ASP A C     1 
ATOM   3020  O  O     . ASP A 1 924  ? 173.606 166.854 146.606 1.00 101.01 ?  796  ASP A O     1 
ATOM   3021  C  CB    . ASP A 1 924  ? 172.929 167.383 149.920 1.00 165.43 ?  796  ASP A CB    1 
ATOM   3022  C  CG    . ASP A 1 924  ? 173.487 168.723 149.423 1.00 216.28 ?  796  ASP A CG    1 
ATOM   3023  O  OD1   . ASP A 1 924  ? 173.148 169.153 148.298 1.00 215.08 ?  796  ASP A OD1   1 
ATOM   3024  O  OD2   . ASP A 1 924  ? 174.281 169.343 150.159 1.00 304.08 -1 796  ASP A OD2   1 
ATOM   3025  N  N     . ARG A 1 925  ? 175.166 166.278 148.126 1.00 93.83  ?  797  ARG A N     1 
ATOM   3026  C  CA    . ARG A 1 925  ? 176.278 166.509 147.210 1.00 70.14  ?  797  ARG A CA    1 
ATOM   3027  C  C     . ARG A 1 925  ? 176.208 165.613 145.984 1.00 49.17  ?  797  ARG A C     1 
ATOM   3028  O  O     . ARG A 1 925  ? 176.802 165.934 144.950 1.00 40.77  ?  797  ARG A O     1 
ATOM   3029  C  CB    . ARG A 1 925  ? 177.607 166.287 147.932 1.00 67.04  ?  797  ARG A CB    1 
ATOM   3030  C  CG    . ARG A 1 925  ? 178.831 166.515 147.065 1.00 46.94  ?  797  ARG A CG    1 
ATOM   3031  C  CD    . ARG A 1 925  ? 180.104 166.213 147.814 1.00 61.75  ?  797  ARG A CD    1 
ATOM   3032  N  NE    . ARG A 1 925  ? 181.262 166.442 146.964 1.00 74.92  ?  797  ARG A NE    1 
ATOM   3033  C  CZ    . ARG A 1 925  ? 182.517 166.263 147.350 1.00 92.29  ?  797  ARG A CZ    1 
ATOM   3034  N  NH1   . ARG A 1 925  ? 182.782 165.857 148.583 1.00 116.58 ?  797  ARG A NH1   1 
ATOM   3035  N  NH2   . ARG A 1 925  ? 183.508 166.502 146.503 1.00 95.21  ?  797  ARG A NH2   1 
ATOM   3036  N  N     . VAL A 1 926  ? 175.476 164.506 146.072 1.00 50.31  ?  798  VAL A N     1 
ATOM   3037  C  CA    . VAL A 1 926  ? 175.333 163.580 144.960 1.00 47.86  ?  798  VAL A CA    1 
ATOM   3038  C  C     . VAL A 1 926  ? 174.045 163.807 144.172 1.00 47.10  ?  798  VAL A C     1 
ATOM   3039  O  O     . VAL A 1 926  ? 173.879 163.217 143.092 1.00 41.63  ?  798  VAL A O     1 
ATOM   3040  C  CB    . VAL A 1 926  ? 175.409 162.125 145.466 1.00 39.29  ?  798  VAL A CB    1 
ATOM   3041  C  CG1   . VAL A 1 926  ? 174.052 161.678 145.993 1.00 45.74  ?  798  VAL A CG1   1 
ATOM   3042  C  CG2   . VAL A 1 926  ? 175.910 161.216 144.378 1.00 45.19  ?  798  VAL A CG2   1 
ATOM   3043  N  N     . LYS A 1 927  ? 173.142 164.658 144.664 1.00 65.34  ?  799  LYS A N     1 
ATOM   3044  C  CA    . LYS A 1 927  ? 171.859 164.964 144.020 1.00 54.42  ?  799  LYS A CA    1 
ATOM   3045  C  C     . LYS A 1 927  ? 170.973 163.725 143.894 1.00 40.90  ?  799  LYS A C     1 
ATOM   3046  O  O     . LYS A 1 927  ? 170.513 163.354 142.812 1.00 36.95  ?  799  LYS A O     1 
ATOM   3047  C  CB    . LYS A 1 927  ? 172.059 165.634 142.656 1.00 62.75  ?  799  LYS A CB    1 
ATOM   3048  C  CG    . LYS A 1 927  ? 172.449 167.086 142.778 1.00 108.52 ?  799  LYS A CG    1 
ATOM   3049  C  CD    . LYS A 1 927  ? 173.950 167.263 142.812 1.00 120.36 ?  799  LYS A CD    1 
ATOM   3050  C  CE    . LYS A 1 927  ? 174.348 168.706 142.556 1.00 139.94 ?  799  LYS A CE    1 
ATOM   3051  N  NZ    . LYS A 1 927  ? 173.527 169.677 143.333 1.00 150.03 ?  799  LYS A NZ    1 
ATOM   3052  N  N     . GLY A 1 928  ? 170.707 163.110 145.043 1.00 56.55  ?  800  GLY A N     1 
ATOM   3053  C  CA    . GLY A 1 928  ? 169.767 162.013 145.139 1.00 65.74  ?  800  GLY A CA    1 
ATOM   3054  C  C     . GLY A 1 928  ? 170.149 160.724 144.437 1.00 49.83  ?  800  GLY A C     1 
ATOM   3055  O  O     . GLY A 1 928  ? 169.390 159.755 144.518 1.00 43.37  ?  800  GLY A O     1 
ATOM   3056  N  N     . VAL A 1 929  ? 171.291 160.659 143.757 1.00 38.10  ?  801  VAL A N     1 
ATOM   3057  C  CA    . VAL A 1 929  ? 171.673 159.426 143.075 1.00 16.32  ?  801  VAL A CA    1 
ATOM   3058  C  C     . VAL A 1 929  ? 172.081 158.392 144.117 1.00 21.06  ?  801  VAL A C     1 
ATOM   3059  O  O     . VAL A 1 929  ? 173.029 158.605 144.878 1.00 36.18  ?  801  VAL A O     1 
ATOM   3060  C  CB    . VAL A 1 929  ? 172.805 159.679 142.074 1.00 26.42  ?  801  VAL A CB    1 
ATOM   3061  C  CG1   . VAL A 1 929  ? 172.957 158.503 141.135 1.00 23.95  ?  801  VAL A CG1   1 
ATOM   3062  C  CG2   . VAL A 1 929  ? 172.555 160.956 141.300 1.00 41.91  ?  801  VAL A CG2   1 
ATOM   3063  N  N     . SER A 1 930  ? 171.368 157.261 144.160 1.00 17.65  ?  802  SER A N     1 
ATOM   3064  C  CA    . SER A 1 930  ? 171.645 156.214 145.141 1.00 19.85  ?  802  SER A CA    1 
ATOM   3065  C  C     . SER A 1 930  ? 171.653 154.804 144.576 1.00 13.14  ?  802  SER A C     1 
ATOM   3066  O  O     . SER A 1 930  ? 171.921 153.866 145.333 1.00 14.55  ?  802  SER A O     1 
ATOM   3067  C  CB    . SER A 1 930  ? 170.626 156.253 146.287 1.00 20.61  ?  802  SER A CB    1 
ATOM   3068  O  OG    . SER A 1 930  ? 169.613 155.283 146.096 1.00 10.91  ?  802  SER A OG    1 
ATOM   3069  N  N     . ALA A 1 931  ? 171.342 154.611 143.301 1.00 14.93  ?  803  ALA A N     1 
ATOM   3070  C  CA    . ALA A 1 931  ? 171.259 153.274 142.739 1.00 15.84  ?  803  ALA A CA    1 
ATOM   3071  C  C     . ALA A 1 931  ? 171.934 153.245 141.379 1.00 17.26  ?  803  ALA A C     1 
ATOM   3072  O  O     . ALA A 1 931  ? 171.816 154.193 140.597 1.00 18.22  ?  803  ALA A O     1 
ATOM   3073  C  CB    . ALA A 1 931  ? 169.803 152.817 142.619 1.00 30.61  ?  803  ALA A CB    1 
ATOM   3074  N  N     . LYS A 1 932  ? 172.646 152.148 141.107 1.00 15.31  ?  804  LYS A N     1 
ATOM   3075  C  CA    . LYS A 1 932  ? 173.420 152.001 139.886 1.00 17.32  ?  804  LYS A CA    1 
ATOM   3076  C  C     . LYS A 1 932  ? 172.495 151.859 138.689 1.00 12.19  ?  804  LYS A C     1 
ATOM   3077  O  O     . LYS A 1 932  ? 171.887 150.801 138.483 1.00 12.21  ?  804  LYS A O     1 
ATOM   3078  C  CB    . LYS A 1 932  ? 174.358 150.801 139.975 1.00 26.78  ?  804  LYS A CB    1 
ATOM   3079  C  CG    . LYS A 1 932  ? 175.177 150.565 138.720 1.00 31.75  ?  804  LYS A CG    1 
ATOM   3080  C  CD    . LYS A 1 932  ? 176.139 149.406 138.902 1.00 54.84  ?  804  LYS A CD    1 
ATOM   3081  C  CE    . LYS A 1 932  ? 177.034 149.243 137.687 1.00 89.61  ?  804  LYS A CE    1 
ATOM   3082  N  NZ    . LYS A 1 932  ? 177.939 148.069 137.824 1.00 140.66 ?  804  LYS A NZ    1 
ATOM   3083  N  N     . PRO A 1 933  ? 172.388 152.893 137.865 1.00 13.28  ?  805  PRO A N     1 
ATOM   3084  C  CA    . PRO A 1 933  ? 171.490 152.824 136.717 1.00 12.53  ?  805  PRO A CA    1 
ATOM   3085  C  C     . PRO A 1 933  ? 172.046 151.845 135.706 1.00 12.81  ?  805  PRO A C     1 
ATOM   3086  O  O     . PRO A 1 933  ? 173.253 151.602 135.636 1.00 21.01  ?  805  PRO A O     1 
ATOM   3087  C  CB    . PRO A 1 933  ? 171.502 154.254 136.161 1.00 38.83  ?  805  PRO A CB    1 
ATOM   3088  C  CG    . PRO A 1 933  ? 172.371 155.057 137.123 1.00 20.84  ?  805  PRO A CG    1 
ATOM   3089  C  CD    . PRO A 1 933  ? 173.241 154.086 137.812 1.00 18.93  ?  805  PRO A CD    1 
ATOM   3090  N  N     . PHE A 1 934  ? 171.148 151.260 134.922 1.00 11.23  ?  806  PHE A N     1 
ATOM   3091  C  CA    . PHE A 1 934  ? 171.621 150.342 133.898 1.00 27.24  ?  806  PHE A CA    1 
ATOM   3092  C  C     . PHE A 1 934  ? 170.871 150.482 132.574 1.00 35.79  ?  806  PHE A C     1 
ATOM   3093  O  O     . PHE A 1 934  ? 171.119 149.695 131.653 1.00 51.77  ?  806  PHE A O     1 
ATOM   3094  C  CB    . PHE A 1 934  ? 171.529 148.907 134.420 1.00 35.57  ?  806  PHE A CB    1 
ATOM   3095  C  CG    . PHE A 1 934  ? 170.144 148.368 134.440 1.00 27.18  ?  806  PHE A CG    1 
ATOM   3096  C  CD1   . PHE A 1 934  ? 169.282 148.693 135.462 1.00 19.73  ?  806  PHE A CD1   1 
ATOM   3097  C  CD2   . PHE A 1 934  ? 169.710 147.500 133.453 1.00 28.26  ?  806  PHE A CD2   1 
ATOM   3098  C  CE1   . PHE A 1 934  ? 168.000 148.198 135.477 1.00 32.98  ?  806  PHE A CE1   1 
ATOM   3099  C  CE2   . PHE A 1 934  ? 168.437 147.002 133.477 1.00 19.64  ?  806  PHE A CE2   1 
ATOM   3100  C  CZ    . PHE A 1 934  ? 167.583 147.353 134.483 1.00 30.20  ?  806  PHE A CZ    1 
ATOM   3101  N  N     . MET A 1 935  ? 169.993 151.473 132.428 1.00 22.05  ?  807  MET A N     1 
ATOM   3102  C  CA    . MET A 1 935  ? 169.167 151.620 131.234 1.00 26.52  ?  807  MET A CA    1 
ATOM   3103  C  C     . MET A 1 935  ? 169.303 153.043 130.708 1.00 28.57  ?  807  MET A C     1 
ATOM   3104  O  O     . MET A 1 935  ? 168.758 153.982 131.299 1.00 41.34  ?  807  MET A O     1 
ATOM   3105  C  CB    . MET A 1 935  ? 167.709 151.286 131.550 1.00 23.24  ?  807  MET A CB    1 
ATOM   3106  C  CG    . MET A 1 935  ? 166.705 151.603 130.453 1.00 37.45  ?  807  MET A CG    1 
ATOM   3107  S  SD    . MET A 1 935  ? 166.894 150.502 129.044 1.00 44.39  ?  807  MET A SD    1 
ATOM   3108  C  CE    . MET A 1 935  ? 165.354 149.581 129.097 1.00 39.01  ?  807  MET A CE    1 
ATOM   3109  N  N     . GLU A 1 936  ? 170.021 153.207 129.594 1.00 22.54  ?  808  GLU A N     1 
ATOM   3110  C  CA    . GLU A 1 936  ? 170.197 154.539 129.026 1.00 24.39  ?  808  GLU A CA    1 
ATOM   3111  C  C     . GLU A 1 936  ? 168.843 155.084 128.605 1.00 13.36  ?  808  GLU A C     1 
ATOM   3112  O  O     . GLU A 1 936  ? 168.238 154.607 127.640 1.00 20.09  ?  808  GLU A O     1 
ATOM   3113  C  CB    . GLU A 1 936  ? 171.150 154.532 127.825 1.00 42.91  ?  808  GLU A CB    1 
ATOM   3114  C  CG    . GLU A 1 936  ? 171.042 155.788 126.948 1.00 59.60  ?  808  GLU A CG    1 
ATOM   3115  C  CD    . GLU A 1 936  ? 172.085 155.836 125.837 1.00 178.89 ?  808  GLU A CD    1 
ATOM   3116  O  OE1   . GLU A 1 936  ? 173.148 155.192 125.978 1.00 174.44 ?  808  GLU A OE1   1 
ATOM   3117  O  OE2   . GLU A 1 936  ? 171.849 156.540 124.830 1.00 366.02 -1 808  GLU A OE2   1 
ATOM   3118  N  N     . THR A 1 937  ? 168.349 156.062 129.342 1.00 11.27  ?  809  THR A N     1 
ATOM   3119  C  CA    . THR A 1 937  ? 167.079 156.693 129.047 1.00 10.85  ?  809  THR A CA    1 
ATOM   3120  C  C     . THR A 1 937  ? 167.330 158.121 128.588 1.00 33.13  ?  809  THR A C     1 
ATOM   3121  O  O     . THR A 1 937  ? 168.007 158.890 129.278 1.00 44.05  ?  809  THR A O     1 
ATOM   3122  C  CB    . THR A 1 937  ? 166.168 156.663 130.275 1.00 11.25  ?  809  THR A CB    1 
ATOM   3123  O  OG1   . THR A 1 937  ? 165.067 157.561 130.089 1.00 12.64  ?  809  THR A OG1   1 
ATOM   3124  C  CG2   . THR A 1 937  ? 166.932 157.007 131.537 1.00 22.58  ?  809  THR A CG2   1 
ATOM   3125  N  N     . GLN A 1 938  ? 166.833 158.454 127.408 1.00 36.11  ?  810  GLN A N     1 
ATOM   3126  C  CA    . GLN A 1 938  ? 166.822 159.851 127.018 1.00 37.59  ?  810  GLN A CA    1 
ATOM   3127  C  C     . GLN A 1 938  ? 165.811 160.540 127.915 1.00 26.81  ?  810  GLN A C     1 
ATOM   3128  O  O     . GLN A 1 938  ? 164.602 160.347 127.730 1.00 26.15  ?  810  GLN A O     1 
ATOM   3129  C  CB    . GLN A 1 938  ? 166.460 160.020 125.549 1.00 39.04  ?  810  GLN A CB    1 
ATOM   3130  C  CG    . GLN A 1 938  ? 167.095 161.244 124.901 1.00 48.75  ?  810  GLN A CG    1 
ATOM   3131  C  CD    . GLN A 1 938  ? 166.943 161.240 123.393 1.00 56.99  ?  810  GLN A CD    1 
ATOM   3132  O  OE1   . GLN A 1 938  ? 166.203 160.425 122.831 1.00 39.19  ?  810  GLN A OE1   1 
ATOM   3133  N  NE2   . GLN A 1 938  ? 167.657 162.140 122.726 1.00 74.35  ?  810  GLN A NE2   1 
ATOM   3134  N  N     . PRO A 1 939  ? 166.238 161.330 128.878 1.00 53.76  ?  811  PRO A N     1 
ATOM   3135  C  CA    . PRO A 1 939  ? 165.299 161.813 129.894 1.00 73.10  ?  811  PRO A CA    1 
ATOM   3136  C  C     . PRO A 1 939  ? 164.357 162.834 129.292 1.00 79.74  ?  811  PRO A C     1 
ATOM   3137  O  O     . PRO A 1 939  ? 164.546 164.046 129.435 1.00 109.80 ?  811  PRO A O     1 
ATOM   3138  C  CB    . PRO A 1 939  ? 166.217 162.425 130.957 1.00 117.62 ?  811  PRO A CB    1 
ATOM   3139  C  CG    . PRO A 1 939  ? 167.404 162.891 130.182 1.00 123.39 ?  811  PRO A CG    1 
ATOM   3140  C  CD    . PRO A 1 939  ? 167.549 161.995 128.972 1.00 91.88  ?  811  PRO A CD    1 
ATOM   3141  N  N     . THR A 1 940  ? 163.350 162.343 128.587 1.00 42.93  ?  812  THR A N     1 
ATOM   3142  C  CA    . THR A 1 940  ? 162.457 163.206 127.841 1.00 43.36  ?  812  THR A CA    1 
ATOM   3143  C  C     . THR A 1 940  ? 161.158 163.424 128.605 1.00 39.95  ?  812  THR A C     1 
ATOM   3144  O  O     . THR A 1 940  ? 160.724 162.576 129.387 1.00 28.79  ?  812  THR A O     1 
ATOM   3145  C  CB    . THR A 1 940  ? 162.151 162.609 126.474 1.00 42.69  ?  812  THR A CB    1 
ATOM   3146  O  OG1   . THR A 1 940  ? 161.114 163.374 125.851 1.00 54.89  ?  812  THR A OG1   1 
ATOM   3147  C  CG2   . THR A 1 940  ? 161.692 161.178 126.632 1.00 39.56  ?  812  THR A CG2   1 
ATOM   3148  N  N     . LEU A 1 941  ? 160.552 164.588 128.381 1.00 45.04  ?  813  LEU A N     1 
ATOM   3149  C  CA    . LEU A 1 941  ? 159.207 164.845 128.875 1.00 49.70  ?  813  LEU A CA    1 
ATOM   3150  C  C     . LEU A 1 941  ? 158.227 163.863 128.252 1.00 62.33  ?  813  LEU A C     1 
ATOM   3151  O  O     . LEU A 1 941  ? 158.346 163.507 127.076 1.00 67.32  ?  813  LEU A O     1 
ATOM   3152  C  CB    . LEU A 1 941  ? 158.790 166.282 128.542 1.00 41.44  ?  813  LEU A CB    1 
ATOM   3153  C  CG    . LEU A 1 941  ? 157.292 166.587 128.424 1.00 37.25  ?  813  LEU A CG    1 
ATOM   3154  C  CD1   . LEU A 1 941  ? 156.568 166.531 129.761 1.00 40.72  ?  813  LEU A CD1   1 
ATOM   3155  C  CD2   . LEU A 1 941  ? 157.060 167.927 127.735 1.00 45.20  ?  813  LEU A CD2   1 
ATOM   3156  N  N     . ASP A 1 942  ? 157.256 163.417 129.041 1.00 70.69  ?  814  ASP A N     1 
ATOM   3157  C  CA    . ASP A 1 942  ? 156.178 162.585 128.524 1.00 80.78  ?  814  ASP A CA    1 
ATOM   3158  C  C     . ASP A 1 942  ? 155.084 163.522 128.027 1.00 74.37  ?  814  ASP A C     1 
ATOM   3159  O  O     . ASP A 1 942  ? 154.367 164.134 128.825 1.00 68.51  ?  814  ASP A O     1 
ATOM   3160  C  CB    . ASP A 1 942  ? 155.638 161.636 129.587 1.00 113.12 ?  814  ASP A CB    1 
ATOM   3161  C  CG    . ASP A 1 942  ? 154.572 160.700 129.041 1.00 126.86 ?  814  ASP A CG    1 
ATOM   3162  O  OD1   . ASP A 1 942  ? 154.658 160.322 127.852 1.00 93.60  ?  814  ASP A OD1   1 
ATOM   3163  O  OD2   . ASP A 1 942  ? 153.623 160.372 129.782 1.00 211.76 -1 814  ASP A OD2   1 
ATOM   3164  N  N     . ALA A 1 943  ? 154.959 163.634 126.706 1.00 85.75  ?  815  ALA A N     1 
ATOM   3165  C  CA    . ALA A 1 943  ? 154.000 164.552 126.110 1.00 94.05  ?  815  ALA A CA    1 
ATOM   3166  C  C     . ALA A 1 943  ? 152.555 164.172 126.407 1.00 107.33 ?  815  ALA A C     1 
ATOM   3167  O  O     . ALA A 1 943  ? 151.671 165.030 126.300 1.00 103.80 ?  815  ALA A O     1 
ATOM   3168  C  CB    . ALA A 1 943  ? 154.217 164.612 124.595 1.00 99.83  ?  815  ALA A CB    1 
ATOM   3169  N  N     . LEU A 1 944  ? 152.287 162.915 126.769 1.00 118.43 ?  816  LEU A N     1 
ATOM   3170  C  CA    . LEU A 1 944  ? 150.908 162.457 126.926 1.00 118.90 ?  816  LEU A CA    1 
ATOM   3171  C  C     . LEU A 1 944  ? 150.147 163.225 127.998 1.00 117.15 ?  816  LEU A C     1 
ATOM   3172  O  O     . LEU A 1 944  ? 149.198 163.946 127.679 1.00 121.37 ?  816  LEU A O     1 
ATOM   3173  C  CB    . LEU A 1 944  ? 150.853 160.958 127.242 1.00 106.76 ?  816  LEU A CB    1 
ATOM   3174  C  CG    . LEU A 1 944  ? 149.416 160.445 127.400 1.00 82.37  ?  816  LEU A CG    1 
ATOM   3175  C  CD1   . LEU A 1 944  ? 148.633 160.579 126.105 1.00 76.43  ?  816  LEU A CD1   1 
ATOM   3176  C  CD2   . LEU A 1 944  ? 149.373 159.009 127.904 1.00 79.63  ?  816  LEU A CD2   1 
ATOM   3177  N  N     . HIS A 1 945  ? 150.531 163.086 129.268 1.00 104.45 ?  817  HIS A N     1 
ATOM   3178  C  CA    . HIS A 1 945  ? 149.801 163.812 130.306 1.00 94.70  ?  817  HIS A CA    1 
ATOM   3179  C  C     . HIS A 1 945  ? 150.222 165.276 130.304 1.00 78.89  ?  817  HIS A C     1 
ATOM   3180  O  O     . HIS A 1 945  ? 149.444 166.155 129.924 1.00 86.57  ?  817  HIS A O     1 
ATOM   3181  C  CB    . HIS A 1 945  ? 150.054 163.167 131.668 1.00 86.25  ?  817  HIS A CB    1 
ATOM   3182  C  CG    . HIS A 1 945  ? 150.386 161.711 131.588 1.00 105.63 ?  817  HIS A CG    1 
ATOM   3183  N  ND1   . HIS A 1 945  ? 151.659 161.224 131.802 1.00 119.02 ?  817  HIS A ND1   1 
ATOM   3184  C  CD2   . HIS A 1 945  ? 149.617 160.637 131.292 1.00 115.15 ?  817  HIS A CD2   1 
ATOM   3185  C  CE1   . HIS A 1 945  ? 151.655 159.911 131.653 1.00 121.56 ?  817  HIS A CE1   1 
ATOM   3186  N  NE2   . HIS A 1 945  ? 150.429 159.530 131.341 1.00 118.11 ?  817  HIS A NE2   1 
ATOM   3187  N  N     . CYS A 1 946  ? 151.454 165.552 130.736 1.00 73.31  ?  818  CYS A N     1 
ATOM   3188  C  CA    . CYS A 1 946  ? 152.169 166.797 130.472 1.00 73.54  ?  818  CYS A CA    1 
ATOM   3189  C  C     . CYS A 1 946  ? 151.395 168.038 130.901 1.00 81.42  ?  818  CYS A C     1 
ATOM   3190  O  O     . CYS A 1 946  ? 151.904 169.161 130.818 1.00 82.50  ?  818  CYS A O     1 
ATOM   3191  C  CB    . CYS A 1 946  ? 152.523 166.886 128.984 1.00 81.61  ?  818  CYS A CB    1 
ATOM   3192  S  SG    . CYS A 1 946  ? 151.325 167.771 127.970 1.00 111.43 ?  818  CYS A SG    1 
ATOM   3193  N  N     . ASP A 1 947  ? 150.171 167.843 131.372 1.00 80.66  ?  819  ASP A N     1 
ATOM   3194  C  CA    . ASP A 1 947  ? 149.241 168.946 131.574 1.00 89.03  ?  819  ASP A CA    1 
ATOM   3195  C  C     . ASP A 1 947  ? 148.440 168.850 132.863 1.00 64.92  ?  819  ASP A C     1 
ATOM   3196  O  O     . ASP A 1 947  ? 148.029 169.889 133.387 1.00 80.71  ?  819  ASP A O     1 
ATOM   3197  C  CB    . ASP A 1 947  ? 148.276 169.012 130.376 1.00 133.33 ?  819  ASP A CB    1 
ATOM   3198  C  CG    . ASP A 1 947  ? 147.193 170.054 130.533 1.00 210.84 ?  819  ASP A CG    1 
ATOM   3199  O  OD1   . ASP A 1 947  ? 147.457 171.120 131.123 1.00 187.05 ?  819  ASP A OD1   1 
ATOM   3200  O  OD2   . ASP A 1 947  ? 146.059 169.795 130.078 1.00 368.58 -1 819  ASP A OD2   1 
ATOM   3201  N  N     . ILE A 1 948  ? 148.241 167.656 133.423 1.00 45.24  ?  820  ILE A N     1 
ATOM   3202  C  CA    . ILE A 1 948  ? 147.228 167.500 134.455 1.00 46.69  ?  820  ILE A CA    1 
ATOM   3203  C  C     . ILE A 1 948  ? 147.623 168.258 135.719 1.00 70.15  ?  820  ILE A C     1 
ATOM   3204  O  O     . ILE A 1 948  ? 146.762 168.823 136.406 1.00 85.28  ?  820  ILE A O     1 
ATOM   3205  C  CB    . ILE A 1 948  ? 146.974 166.004 134.720 1.00 51.77  ?  820  ILE A CB    1 
ATOM   3206  C  CG1   . ILE A 1 948  ? 146.428 165.333 133.453 1.00 54.19  ?  820  ILE A CG1   1 
ATOM   3207  C  CG2   . ILE A 1 948  ? 145.977 165.824 135.850 1.00 65.55  ?  820  ILE A CG2   1 
ATOM   3208  C  CD1   . ILE A 1 948  ? 146.398 163.805 133.500 1.00 62.73  ?  820  ILE A CD1   1 
ATOM   3209  N  N     . GLY A 1 949  ? 148.918 168.309 136.033 1.00 83.54  ?  821  GLY A N     1 
ATOM   3210  C  CA    . GLY A 1 949  ? 149.358 169.103 137.168 1.00 76.12  ?  821  GLY A CA    1 
ATOM   3211  C  C     . GLY A 1 949  ? 149.068 170.579 136.988 1.00 82.98  ?  821  GLY A C     1 
ATOM   3212  O  O     . GLY A 1 949  ? 148.619 171.252 137.919 1.00 95.63  ?  821  GLY A O     1 
ATOM   3213  N  N     . ASN A 1 950  ? 149.308 171.097 135.781 1.00 74.59  ?  822  ASN A N     1 
ATOM   3214  C  CA    . ASN A 1 950  ? 149.020 172.497 135.485 1.00 78.59  ?  822  ASN A CA    1 
ATOM   3215  C  C     . ASN A 1 950  ? 147.535 172.804 135.672 1.00 88.60  ?  822  ASN A C     1 
ATOM   3216  O  O     . ASN A 1 950  ? 147.167 173.830 136.262 1.00 83.29  ?  822  ASN A O     1 
ATOM   3217  C  CB    . ASN A 1 950  ? 149.476 172.820 134.057 1.00 87.33  ?  822  ASN A CB    1 
ATOM   3218  C  CG    . ASN A 1 950  ? 150.763 172.080 133.658 1.00 62.13  ?  822  ASN A CG    1 
ATOM   3219  O  OD1   . ASN A 1 950  ? 150.831 170.852 133.713 1.00 63.95  ?  822  ASN A OD1   1 
ATOM   3220  N  ND2   . ASN A 1 950  ? 151.767 172.828 133.210 1.00 43.13  ?  822  ASN A ND2   1 
ATOM   3221  N  N     . ALA A 1 951  ? 146.668 171.902 135.205 1.00 92.26  ?  823  ALA A N     1 
ATOM   3222  C  CA    . ALA A 1 951  ? 145.226 172.116 135.290 1.00 108.32 ?  823  ALA A CA    1 
ATOM   3223  C  C     . ALA A 1 951  ? 144.732 172.047 136.731 1.00 102.45 ?  823  ALA A C     1 
ATOM   3224  O  O     . ALA A 1 951  ? 143.926 172.881 137.161 1.00 105.57 ?  823  ALA A O     1 
ATOM   3225  C  CB    . ALA A 1 951  ? 144.495 171.090 134.426 1.00 138.82 ?  823  ALA A CB    1 
ATOM   3226  N  N     . THR A 1 952  ? 145.181 171.042 137.490 1.00 101.36 ?  824  THR A N     1 
ATOM   3227  C  CA    . THR A 1 952  ? 144.752 170.953 138.882 1.00 99.63  ?  824  THR A CA    1 
ATOM   3228  C  C     . THR A 1 952  ? 145.300 172.113 139.706 1.00 120.49 ?  824  THR A C     1 
ATOM   3229  O  O     . THR A 1 952  ? 144.658 172.550 140.671 1.00 134.57 ?  824  THR A O     1 
ATOM   3230  C  CB    . THR A 1 952  ? 145.156 169.606 139.496 1.00 89.57  ?  824  THR A CB    1 
ATOM   3231  O  OG1   . THR A 1 952  ? 144.605 169.494 140.815 1.00 89.22  ?  824  THR A OG1   1 
ATOM   3232  C  CG2   . THR A 1 952  ? 146.659 169.467 139.588 1.00 93.89  ?  824  THR A CG2   1 
ATOM   3233  N  N     . GLU A 1 953  ? 146.453 172.665 139.320 1.00 109.35 ?  825  GLU A N     1 
ATOM   3234  C  CA    . GLU A 1 953  ? 146.943 173.832 140.040 1.00 130.73 ?  825  GLU A CA    1 
ATOM   3235  C  C     . GLU A 1 953  ? 146.188 175.097 139.660 1.00 138.11 ?  825  GLU A C     1 
ATOM   3236  O  O     . GLU A 1 953  ? 146.007 175.973 140.509 1.00 153.08 ?  825  GLU A O     1 
ATOM   3237  C  CB    . GLU A 1 953  ? 148.443 174.021 139.816 1.00 131.92 ?  825  GLU A CB    1 
ATOM   3238  C  CG    . GLU A 1 953  ? 149.163 174.559 141.048 1.00 208.92 ?  825  GLU A CG    1 
ATOM   3239  C  CD    . GLU A 1 953  ? 148.612 173.989 142.354 1.00 220.94 ?  825  GLU A CD    1 
ATOM   3240  O  OE1   . GLU A 1 953  ? 148.569 172.748 142.488 1.00 196.46 ?  825  GLU A OE1   1 
ATOM   3241  O  OE2   . GLU A 1 953  ? 148.198 174.777 143.234 1.00 320.34 -1 825  GLU A OE2   1 
ATOM   3242  N  N     . PHE A 1 954  ? 145.727 175.211 138.411 1.00 111.37 ?  826  PHE A N     1 
ATOM   3243  C  CA    . PHE A 1 954  ? 144.803 176.293 138.071 1.00 104.49 ?  826  PHE A CA    1 
ATOM   3244  C  C     . PHE A 1 954  ? 143.486 176.146 138.829 1.00 114.78 ?  826  PHE A C     1 
ATOM   3245  O  O     . PHE A 1 954  ? 142.867 177.143 139.218 1.00 113.51 ?  826  PHE A O     1 
ATOM   3246  C  CB    . PHE A 1 954  ? 144.552 176.328 136.562 1.00 90.73  ?  826  PHE A CB    1 
ATOM   3247  C  CG    . PHE A 1 954  ? 145.640 177.001 135.773 1.00 82.66  ?  826  PHE A CG    1 
ATOM   3248  C  CD1   . PHE A 1 954  ? 146.885 177.232 136.329 1.00 81.66  ?  826  PHE A CD1   1 
ATOM   3249  C  CD2   . PHE A 1 954  ? 145.410 177.421 134.476 1.00 91.05  ?  826  PHE A CD2   1 
ATOM   3250  C  CE1   . PHE A 1 954  ? 147.876 177.856 135.602 1.00 83.75  ?  826  PHE A CE1   1 
ATOM   3251  C  CE2   . PHE A 1 954  ? 146.402 178.049 133.747 1.00 102.31 ?  826  PHE A CE2   1 
ATOM   3252  C  CZ    . PHE A 1 954  ? 147.632 178.264 134.313 1.00 84.76  ?  826  PHE A CZ    1 
ATOM   3253  N  N     . TYR A 1 955  ? 143.045 174.901 139.041 1.00 119.68 ?  827  TYR A N     1 
ATOM   3254  C  CA    . TYR A 1 955  ? 141.854 174.625 139.846 1.00 119.60 ?  827  TYR A CA    1 
ATOM   3255  C  C     . TYR A 1 955  ? 142.031 175.141 141.273 1.00 125.98 ?  827  TYR A C     1 
ATOM   3256  O  O     . TYR A 1 955  ? 141.179 175.871 141.800 1.00 131.01 ?  827  TYR A O     1 
ATOM   3257  C  CB    . TYR A 1 955  ? 141.580 173.114 139.836 1.00 105.88 ?  827  TYR A CB    1 
ATOM   3258  C  CG    . TYR A 1 955  ? 140.235 172.650 140.389 1.00 96.32  ?  827  TYR A CG    1 
ATOM   3259  C  CD1   . TYR A 1 955  ? 140.077 172.354 141.738 1.00 104.65 ?  827  TYR A CD1   1 
ATOM   3260  C  CD2   . TYR A 1 955  ? 139.142 172.456 139.551 1.00 75.07  ?  827  TYR A CD2   1 
ATOM   3261  C  CE1   . TYR A 1 955  ? 138.856 171.914 142.244 1.00 92.50  ?  827  TYR A CE1   1 
ATOM   3262  C  CE2   . TYR A 1 955  ? 137.919 172.015 140.049 1.00 65.86  ?  827  TYR A CE2   1 
ATOM   3263  C  CZ    . TYR A 1 955  ? 137.783 171.746 141.394 1.00 72.87  ?  827  TYR A CZ    1 
ATOM   3264  O  OH    . TYR A 1 955  ? 136.573 171.309 141.888 1.00 67.15  ?  827  TYR A OH    1 
ATOM   3265  N  N     . LYS A 1 956  ? 143.143 174.768 141.910 1.00 132.09 ?  828  LYS A N     1 
ATOM   3266  C  CA    . LYS A 1 956  ? 143.429 175.240 143.263 1.00 130.05 ?  828  LYS A CA    1 
ATOM   3267  C  C     . LYS A 1 956  ? 143.590 176.758 143.304 1.00 124.30 ?  828  LYS A C     1 
ATOM   3268  O  O     . LYS A 1 956  ? 143.173 177.408 144.269 1.00 132.97 ?  828  LYS A O     1 
ATOM   3269  C  CB    . LYS A 1 956  ? 144.687 174.553 143.796 1.00 140.41 ?  828  LYS A CB    1 
ATOM   3270  C  CG    . LYS A 1 956  ? 144.582 173.036 143.901 1.00 122.48 ?  828  LYS A CG    1 
ATOM   3271  C  CD    . LYS A 1 956  ? 145.898 172.432 144.363 1.00 123.39 ?  828  LYS A CD    1 
ATOM   3272  C  CE    . LYS A 1 956  ? 145.999 170.974 143.957 1.00 123.17 ?  828  LYS A CE    1 
ATOM   3273  N  NZ    . LYS A 1 956  ? 147.355 170.425 144.213 1.00 149.10 ?  828  LYS A NZ    1 
ATOM   3274  N  N     . ILE A 1 957  ? 144.207 177.339 142.269 1.00 113.08 ?  829  ILE A N     1 
ATOM   3275  C  CA    . ILE A 1 957  ? 144.344 178.793 142.183 1.00 102.69 ?  829  ILE A CA    1 
ATOM   3276  C  C     . ILE A 1 957  ? 142.972 179.453 142.184 1.00 121.96 ?  829  ILE A C     1 
ATOM   3277  O  O     . ILE A 1 957  ? 142.703 180.363 142.969 1.00 144.29 ?  829  ILE A O     1 
ATOM   3278  C  CB    . ILE A 1 957  ? 145.158 179.189 140.938 1.00 98.66  ?  829  ILE A CB    1 
ATOM   3279  C  CG1   . ILE A 1 957  ? 146.658 179.038 141.199 1.00 102.07 ?  829  ILE A CG1   1 
ATOM   3280  C  CG2   . ILE A 1 957  ? 144.851 180.615 140.518 1.00 110.61 ?  829  ILE A CG2   1 
ATOM   3281  C  CD1   . ILE A 1 957  ? 147.536 179.569 140.070 1.00 106.30 ?  829  ILE A CD1   1 
ATOM   3282  N  N     . PHE A 1 958  ? 142.090 179.019 141.280 1.00 123.82 ?  830  PHE A N     1 
ATOM   3283  C  CA    . PHE A 1 958  ? 140.757 179.615 141.213 1.00 142.51 ?  830  PHE A CA    1 
ATOM   3284  C  C     . PHE A 1 958  ? 139.997 179.426 142.525 1.00 158.39 ?  830  PHE A C     1 
ATOM   3285  O  O     . PHE A 1 958  ? 139.252 180.318 142.956 1.00 180.69 ?  830  PHE A O     1 
ATOM   3286  C  CB    . PHE A 1 958  ? 139.979 179.026 140.032 1.00 145.91 ?  830  PHE A CB    1 
ATOM   3287  C  CG    . PHE A 1 958  ? 140.392 179.579 138.685 1.00 143.12 ?  830  PHE A CG    1 
ATOM   3288  C  CD1   . PHE A 1 958  ? 141.276 180.642 138.594 1.00 139.67 ?  830  PHE A CD1   1 
ATOM   3289  C  CD2   . PHE A 1 958  ? 139.898 179.026 137.510 1.00 138.76 ?  830  PHE A CD2   1 
ATOM   3290  C  CE1   . PHE A 1 958  ? 141.650 181.148 137.361 1.00 142.87 ?  830  PHE A CE1   1 
ATOM   3291  C  CE2   . PHE A 1 958  ? 140.276 179.528 136.273 1.00 114.77 ?  830  PHE A CE2   1 
ATOM   3292  C  CZ    . PHE A 1 958  ? 141.150 180.589 136.204 1.00 131.28 ?  830  PHE A CZ    1 
ATOM   3293  N  N     . GLN A 1 959  ? 140.191 178.279 143.188 1.00 141.16 ?  831  GLN A N     1 
ATOM   3294  C  CA    . GLN A 1 959  ? 139.535 178.052 144.474 1.00 159.78 ?  831  GLN A CA    1 
ATOM   3295  C  C     . GLN A 1 959  ? 140.086 178.967 145.564 1.00 178.52 ?  831  GLN A C     1 
ATOM   3296  O  O     . GLN A 1 959  ? 139.355 179.332 146.493 1.00 182.57 ?  831  GLN A O     1 
ATOM   3297  C  CB    . GLN A 1 959  ? 139.685 176.593 144.895 1.00 148.42 ?  831  GLN A CB    1 
ATOM   3298  C  CG    . GLN A 1 959  ? 138.741 176.180 146.007 1.00 141.78 ?  831  GLN A CG    1 
ATOM   3299  C  CD    . GLN A 1 959  ? 138.888 174.718 146.359 1.00 156.96 ?  831  GLN A CD    1 
ATOM   3300  O  OE1   . GLN A 1 959  ? 139.233 173.895 145.510 1.00 160.58 ?  831  GLN A OE1   1 
ATOM   3301  N  NE2   . GLN A 1 959  ? 138.634 174.384 147.617 1.00 172.52 ?  831  GLN A NE2   1 
ATOM   3302  N  N     . ASP A 1 960  ? 141.365 179.326 145.479 1.00 177.25 ?  832  ASP A N     1 
ATOM   3303  C  CA    . ASP A 1 960  ? 141.991 180.253 146.412 1.00 200.01 ?  832  ASP A CA    1 
ATOM   3304  C  C     . ASP A 1 960  ? 141.790 181.714 146.021 1.00 191.21 ?  832  ASP A C     1 
ATOM   3305  O  O     . ASP A 1 960  ? 142.169 182.602 146.788 1.00 195.82 ?  832  ASP A O     1 
ATOM   3306  C  CB    . ASP A 1 960  ? 143.490 179.943 146.526 1.00 209.25 ?  832  ASP A CB    1 
ATOM   3307  C  CG    . ASP A 1 960  ? 143.768 178.595 147.181 1.00 235.35 ?  832  ASP A CG    1 
ATOM   3308  O  OD1   . ASP A 1 960  ? 142.800 177.905 147.574 1.00 214.42 ?  832  ASP A OD1   1 
ATOM   3309  O  OD2   . ASP A 1 960  ? 144.953 178.216 147.295 1.00 287.31 -1 832  ASP A OD2   1 
ATOM   3310  N  N     . GLU A 1 961  ? 141.247 181.969 144.832 1.00 174.34 ?  833  GLU A N     1 
ATOM   3311  C  CA    . GLU A 1 961  ? 140.805 183.293 144.396 1.00 152.84 ?  833  GLU A CA    1 
ATOM   3312  C  C     . GLU A 1 961  ? 139.339 183.561 144.728 1.00 151.39 ?  833  GLU A C     1 
ATOM   3313  O  O     . GLU A 1 961  ? 138.961 184.722 144.938 1.00 160.51 ?  833  GLU A O     1 
ATOM   3314  C  CB    . GLU A 1 961  ? 141.076 183.487 142.900 1.00 126.86 ?  833  GLU A CB    1 
ATOM   3315  C  CG    . GLU A 1 961  ? 142.389 184.201 142.556 1.00 137.57 ?  833  GLU A CG    1 
ATOM   3316  C  CD    . GLU A 1 961  ? 143.648 183.518 143.064 1.00 172.97 ?  833  GLU A CD    1 
ATOM   3317  O  OE1   . GLU A 1 961  ? 143.644 182.293 143.270 1.00 156.81 ?  833  GLU A OE1   1 
ATOM   3318  O  OE2   . GLU A 1 961  ? 144.665 184.221 143.258 1.00 306.52 -1 833  GLU A OE2   1 
ATOM   3319  N  N     . ILE A 1 962  ? 138.500 182.525 144.763 1.00 167.45 ?  834  ILE A N     1 
ATOM   3320  C  CA    . ILE A 1 962  ? 137.210 182.654 145.446 1.00 169.86 ?  834  ILE A CA    1 
ATOM   3321  C  C     . ILE A 1 962  ? 137.432 182.908 146.934 1.00 176.57 ?  834  ILE A C     1 
ATOM   3322  O  O     . ILE A 1 962  ? 136.829 183.810 147.529 1.00 191.98 ?  834  ILE A O     1 
ATOM   3323  C  CB    . ILE A 1 962  ? 136.330 181.411 145.199 1.00 160.09 ?  834  ILE A CB    1 
ATOM   3324  C  CG1   . ILE A 1 962  ? 135.649 181.491 143.833 1.00 161.52 ?  834  ILE A CG1   1 
ATOM   3325  C  CG2   . ILE A 1 962  ? 135.280 181.259 146.295 1.00 123.06 ?  834  ILE A CG2   1 
ATOM   3326  C  CD1   . ILE A 1 962  ? 134.476 180.537 143.672 1.00 147.49 ?  834  ILE A CD1   1 
ATOM   3327  N  N     . GLY A 1 963  ? 138.298 182.117 147.552 1.00 167.64 ?  835  GLY A N     1 
ATOM   3328  C  CA    . GLY A 1 963  ? 138.847 182.478 148.842 1.00 164.96 ?  835  GLY A CA    1 
ATOM   3329  C  C     . GLY A 1 963  ? 139.848 183.609 148.705 1.00 184.72 ?  835  GLY A C     1 
ATOM   3330  O  O     . GLY A 1 963  ? 140.135 184.098 147.614 1.00 190.87 ?  835  GLY A O     1 
ATOM   3331  N  N     . GLU A 1 964  ? 140.378 184.053 149.838 1.00 204.32 ?  836  GLU A N     1 
ATOM   3332  C  CA    . GLU A 1 964  ? 141.433 185.067 149.851 1.00 229.71 ?  836  GLU A CA    1 
ATOM   3333  C  C     . GLU A 1 964  ? 142.619 184.535 150.654 1.00 241.40 ?  836  GLU A C     1 
ATOM   3334  O  O     . GLU A 1 964  ? 142.628 184.610 151.885 1.00 240.41 ?  836  GLU A O     1 
ATOM   3335  C  CB    . GLU A 1 964  ? 140.912 186.393 150.407 1.00 219.56 ?  836  GLU A CB    1 
ATOM   3336  C  CG    . GLU A 1 964  ? 140.024 187.177 149.436 1.00 223.47 ?  836  GLU A CG    1 
ATOM   3337  C  CD    . GLU A 1 964  ? 140.544 187.151 148.007 1.00 248.52 ?  836  GLU A CD    1 
ATOM   3338  O  OE1   . GLU A 1 964  ? 141.667 187.648 147.780 1.00 236.43 ?  836  GLU A OE1   1 
ATOM   3339  O  OE2   . GLU A 1 964  ? 139.832 186.647 147.112 1.00 309.40 -1 836  GLU A OE2   1 
ATOM   3340  N  N     . VAL A 1 965  ? 143.626 184.004 149.950 1.00 235.47 ?  837  VAL A N     1 
ATOM   3341  C  CA    . VAL A 1 965  ? 144.816 183.481 150.618 1.00 232.06 ?  837  VAL A CA    1 
ATOM   3342  C  C     . VAL A 1 965  ? 145.735 184.619 151.058 1.00 233.52 ?  837  VAL A C     1 
ATOM   3343  O  O     . VAL A 1 965  ? 146.236 184.620 152.188 1.00 226.39 ?  837  VAL A O     1 
ATOM   3344  C  CB    . VAL A 1 965  ? 145.545 182.475 149.707 1.00 213.50 ?  837  VAL A CB    1 
ATOM   3345  C  CG1   . VAL A 1 965  ? 145.689 183.026 148.297 1.00 194.10 ?  837  VAL A CG1   1 
ATOM   3346  C  CG2   . VAL A 1 965  ? 146.913 182.120 150.287 1.00 213.11 ?  837  VAL A CG2   1 
ATOM   3347  N  N     . TYR A 1 966  ? 145.965 185.598 150.188 1.00 223.83 ?  838  TYR A N     1 
ATOM   3348  C  CA    . TYR A 1 966  ? 146.778 186.762 150.522 1.00 213.74 ?  838  TYR A CA    1 
ATOM   3349  C  C     . TYR A 1 966  ? 146.033 187.779 151.394 1.00 221.98 ?  838  TYR A C     1 
ATOM   3350  O  O     . TYR A 1 966  ? 146.562 188.868 151.638 1.00 204.99 ?  838  TYR A O     1 
ATOM   3351  C  CB    . TYR A 1 966  ? 147.314 187.420 149.240 1.00 166.42 ?  838  TYR A CB    1 
ATOM   3352  C  CG    . TYR A 1 966  ? 146.256 187.836 148.237 1.00 170.18 ?  838  TYR A CG    1 
ATOM   3353  C  CD1   . TYR A 1 966  ? 145.541 186.886 147.519 1.00 182.62 ?  838  TYR A CD1   1 
ATOM   3354  C  CD2   . TYR A 1 966  ? 145.991 189.175 147.990 1.00 168.29 ?  838  TYR A CD2   1 
ATOM   3355  C  CE1   . TYR A 1 966  ? 144.573 187.257 146.606 1.00 201.55 ?  838  TYR A CE1   1 
ATOM   3356  C  CE2   . TYR A 1 966  ? 145.028 189.555 147.073 1.00 181.40 ?  838  TYR A CE2   1 
ATOM   3357  C  CZ    . TYR A 1 966  ? 144.321 188.591 146.385 1.00 200.01 ?  838  TYR A CZ    1 
ATOM   3358  O  OH    . TYR A 1 966  ? 143.362 188.960 145.469 1.00 217.76 ?  838  TYR A OH    1 
ATOM   3359  N  N     . GLN A 1 967  ? 144.821 187.453 151.850 1.00 227.57 ?  839  GLN A N     1 
ATOM   3360  C  CA    . GLN A 1 967  ? 144.143 188.148 152.943 1.00 206.69 ?  839  GLN A CA    1 
ATOM   3361  C  C     . GLN A 1 967  ? 143.900 187.252 154.150 1.00 207.62 ?  839  GLN A C     1 
ATOM   3362  O  O     . GLN A 1 967  ? 144.006 187.716 155.291 1.00 183.40 ?  839  GLN A O     1 
ATOM   3363  C  CB    . GLN A 1 967  ? 142.793 188.728 152.487 1.00 188.65 ?  839  GLN A CB    1 
ATOM   3364  C  CG    . GLN A 1 967  ? 142.861 190.014 151.664 1.00 174.14 ?  839  GLN A CG    1 
ATOM   3365  C  CD    . GLN A 1 967  ? 143.408 189.808 150.268 1.00 185.40 ?  839  GLN A CD    1 
ATOM   3366  O  OE1   . GLN A 1 967  ? 143.583 188.676 149.820 1.00 208.53 ?  839  GLN A OE1   1 
ATOM   3367  N  NE2   . GLN A 1 967  ? 143.706 190.906 149.580 1.00 151.31 ?  839  GLN A NE2   1 
ATOM   3368  N  N     . LYS A 1 968  ? 143.571 185.978 153.920 1.00 226.42 ?  840  LYS A N     1 
ATOM   3369  C  CA    . LYS A 1 968  ? 143.330 184.980 154.963 1.00 226.25 ?  840  LYS A CA    1 
ATOM   3370  C  C     . LYS A 1 968  ? 144.291 183.816 154.736 1.00 215.33 ?  840  LYS A C     1 
ATOM   3371  O  O     . LYS A 1 968  ? 143.896 182.764 154.212 1.00 201.86 ?  840  LYS A O     1 
ATOM   3372  C  CB    . LYS A 1 968  ? 141.872 184.517 154.946 1.00 215.83 ?  840  LYS A CB    1 
ATOM   3373  C  CG    . LYS A 1 968  ? 141.424 183.689 156.138 1.00 187.70 ?  840  LYS A CG    1 
ATOM   3374  C  CD    . LYS A 1 968  ? 139.941 183.349 156.022 1.00 162.24 ?  840  LYS A CD    1 
ATOM   3375  C  CE    . LYS A 1 968  ? 139.728 181.978 155.405 1.00 169.26 ?  840  LYS A CE    1 
ATOM   3376  N  NZ    . LYS A 1 968  ? 138.394 181.878 154.753 1.00 160.14 ?  840  LYS A NZ    1 
ATOM   3377  N  N     . PRO A 1 969  ? 145.574 183.965 155.130 1.00 206.65 ?  841  PRO A N     1 
ATOM   3378  C  CA    . PRO A 1 969  ? 146.580 182.939 154.804 1.00 194.69 ?  841  PRO A CA    1 
ATOM   3379  C  C     . PRO A 1 969  ? 146.478 181.677 155.646 1.00 193.47 ?  841  PRO A C     1 
ATOM   3380  O  O     . PRO A 1 969  ? 147.371 180.823 155.609 1.00 183.72 ?  841  PRO A O     1 
ATOM   3381  C  CB    . PRO A 1 969  ? 147.907 183.667 155.053 1.00 159.43 ?  841  PRO A CB    1 
ATOM   3382  C  CG    . PRO A 1 969  ? 147.582 184.668 156.101 1.00 175.07 ?  841  PRO A CG    1 
ATOM   3383  C  CD    . PRO A 1 969  ? 146.166 185.118 155.831 1.00 197.78 ?  841  PRO A CD    1 
ATOM   3384  N  N     . ASN A 1 970  ? 145.400 181.551 156.413 1.00 196.21 ?  842  ASN A N     1 
ATOM   3385  C  CA    . ASN A 1 970  ? 145.148 180.374 157.240 1.00 194.90 ?  842  ASN A CA    1 
ATOM   3386  C  C     . ASN A 1 970  ? 143.679 179.984 157.127 1.00 180.72 ?  842  ASN A C     1 
ATOM   3387  O  O     . ASN A 1 970  ? 142.893 180.185 158.061 1.00 173.67 ?  842  ASN A O     1 
ATOM   3388  C  CB    . ASN A 1 970  ? 145.544 180.640 158.692 1.00 202.67 ?  842  ASN A CB    1 
ATOM   3389  C  CG    . ASN A 1 970  ? 146.983 181.104 158.822 1.00 165.94 ?  842  ASN A CG    1 
ATOM   3390  O  OD1   . ASN A 1 970  ? 147.278 182.297 158.717 1.00 167.78 ?  842  ASN A OD1   1 
ATOM   3391  N  ND2   . ASN A 1 970  ? 147.890 180.158 159.032 1.00 140.71 ?  842  ASN A ND2   1 
ATOM   3392  N  N     . PRO A 1 971  ? 143.272 179.425 155.990 1.00 166.96 ?  843  PRO A N     1 
ATOM   3393  C  CA    . PRO A 1 971  ? 141.897 178.936 155.870 1.00 158.07 ?  843  PRO A CA    1 
ATOM   3394  C  C     . PRO A 1 971  ? 141.705 177.658 156.673 1.00 153.80 ?  843  PRO A C     1 
ATOM   3395  O  O     . PRO A 1 971  ? 142.649 176.919 156.960 1.00 149.64 ?  843  PRO A O     1 
ATOM   3396  C  CB    . PRO A 1 971  ? 141.744 178.679 154.368 1.00 158.12 ?  843  PRO A CB    1 
ATOM   3397  C  CG    . PRO A 1 971  ? 143.122 178.333 153.933 1.00 153.64 ?  843  PRO A CG    1 
ATOM   3398  C  CD    . PRO A 1 971  ? 144.040 179.202 154.752 1.00 162.58 ?  843  PRO A CD    1 
ATOM   3399  N  N     . SER A 1 972  ? 140.453 177.400 157.029 1.00 162.36 ?  844  SER A N     1 
ATOM   3400  C  CA    . SER A 1 972  ? 140.110 176.262 157.860 1.00 151.36 ?  844  SER A CA    1 
ATOM   3401  C  C     . SER A 1 972  ? 139.733 175.070 156.978 1.00 137.69 ?  844  SER A C     1 
ATOM   3402  O  O     . SER A 1 972  ? 139.797 175.133 155.748 1.00 138.82 ?  844  SER A O     1 
ATOM   3403  C  CB    . SER A 1 972  ? 138.987 176.644 158.828 1.00 164.23 ?  844  SER A CB    1 
ATOM   3404  O  OG    . SER A 1 972  ? 139.429 177.613 159.764 1.00 169.31 ?  844  SER A OG    1 
ATOM   3405  N  N     . ARG A 1 973  ? 139.320 173.971 157.617 1.00 132.24 ?  845  ARG A N     1 
ATOM   3406  C  CA    . ARG A 1 973  ? 139.029 172.724 156.913 1.00 128.59 ?  845  ARG A CA    1 
ATOM   3407  C  C     . ARG A 1 973  ? 137.914 172.864 155.884 1.00 134.33 ?  845  ARG A C     1 
ATOM   3408  O  O     . ARG A 1 973  ? 137.881 172.098 154.915 1.00 135.16 ?  845  ARG A O     1 
ATOM   3409  C  CB    . ARG A 1 973  ? 138.645 171.637 157.923 1.00 125.01 ?  845  ARG A CB    1 
ATOM   3410  C  CG    . ARG A 1 973  ? 138.403 170.245 157.338 1.00 109.61 ?  845  ARG A CG    1 
ATOM   3411  C  CD    . ARG A 1 973  ? 139.659 169.397 157.336 1.00 118.97 ?  845  ARG A CD    1 
ATOM   3412  N  NE    . ARG A 1 973  ? 140.805 170.094 156.766 1.00 124.02 ?  845  ARG A NE    1 
ATOM   3413  C  CZ    . ARG A 1 973  ? 142.015 169.561 156.641 1.00 134.79 ?  845  ARG A CZ    1 
ATOM   3414  N  NH1   . ARG A 1 973  ? 142.241 168.320 157.050 1.00 139.84 ?  845  ARG A NH1   1 
ATOM   3415  N  NH2   . ARG A 1 973  ? 143.001 170.272 156.111 1.00 135.72 ?  845  ARG A NH2   1 
ATOM   3416  N  N     . GLU A 1 974  ? 137.012 173.829 156.059 1.00 144.99 ?  846  GLU A N     1 
ATOM   3417  C  CA    . GLU A 1 974  ? 135.785 173.890 155.274 1.00 160.56 ?  846  GLU A CA    1 
ATOM   3418  C  C     . GLU A 1 974  ? 135.617 175.146 154.438 1.00 148.83 ?  846  GLU A C     1 
ATOM   3419  O  O     . GLU A 1 974  ? 134.736 175.158 153.570 1.00 158.08 ?  846  GLU A O     1 
ATOM   3420  C  CB    . GLU A 1 974  ? 134.561 173.744 156.188 1.00 186.73 ?  846  GLU A CB    1 
ATOM   3421  C  CG    . GLU A 1 974  ? 134.624 172.514 157.069 1.00 196.94 ?  846  GLU A CG    1 
ATOM   3422  C  CD    . GLU A 1 974  ? 133.383 172.332 157.913 1.00 252.09 ?  846  GLU A CD    1 
ATOM   3423  O  OE1   . GLU A 1 974  ? 132.489 173.206 157.873 1.00 244.59 ?  846  GLU A OE1   1 
ATOM   3424  O  OE2   . GLU A 1 974  ? 133.297 171.299 158.606 1.00 396.15 -1 846  GLU A OE2   1 
ATOM   3425  N  N     . GLU A 1 975  ? 136.390 176.206 154.677 1.00 147.16 ?  847  GLU A N     1 
ATOM   3426  C  CA    . GLU A 1 975  ? 136.376 177.338 153.758 1.00 159.81 ?  847  GLU A CA    1 
ATOM   3427  C  C     . GLU A 1 975  ? 136.735 176.889 152.349 1.00 157.56 ?  847  GLU A C     1 
ATOM   3428  O  O     . GLU A 1 975  ? 136.057 177.245 151.375 1.00 164.30 ?  847  GLU A O     1 
ATOM   3429  C  CB    . GLU A 1 975  ? 137.342 178.423 154.235 1.00 172.13 ?  847  GLU A CB    1 
ATOM   3430  C  CG    . GLU A 1 975  ? 136.777 179.320 155.318 1.00 202.01 ?  847  GLU A CG    1 
ATOM   3431  C  CD    . GLU A 1 975  ? 137.560 179.239 156.606 1.00 229.60 ?  847  GLU A CD    1 
ATOM   3432  O  OE1   . GLU A 1 975  ? 138.777 178.969 156.549 1.00 201.84 ?  847  GLU A OE1   1 
ATOM   3433  O  OE2   . GLU A 1 975  ? 136.955 179.443 157.678 1.00 377.07 -1 847  GLU A OE2   1 
ATOM   3434  N  N     . ARG A 1 976  ? 137.804 176.098 152.227 1.00 145.65 ?  848  ARG A N     1 
ATOM   3435  C  CA    . ARG A 1 976  ? 138.230 175.613 150.921 1.00 150.94 ?  848  ARG A CA    1 
ATOM   3436  C  C     . ARG A 1 976  ? 137.133 174.797 150.252 1.00 159.31 ?  848  ARG A C     1 
ATOM   3437  O  O     . ARG A 1 976  ? 136.925 174.900 149.039 1.00 156.09 ?  848  ARG A O     1 
ATOM   3438  C  CB    . ARG A 1 976  ? 139.497 174.770 151.066 1.00 152.76 ?  848  ARG A CB    1 
ATOM   3439  C  CG    . ARG A 1 976  ? 140.805 175.548 151.061 1.00 148.99 ?  848  ARG A CG    1 
ATOM   3440  C  CD    . ARG A 1 976  ? 141.561 175.297 152.352 1.00 146.09 ?  848  ARG A CD    1 
ATOM   3441  N  NE    . ARG A 1 976  ? 141.466 173.894 152.740 1.00 143.02 ?  848  ARG A NE    1 
ATOM   3442  C  CZ    . ARG A 1 976  ? 141.482 173.464 153.997 1.00 141.00 ?  848  ARG A CZ    1 
ATOM   3443  N  NH1   . ARG A 1 976  ? 141.600 174.330 154.995 1.00 137.90 ?  848  ARG A NH1   1 
ATOM   3444  N  NH2   . ARG A 1 976  ? 141.380 172.168 154.259 1.00 136.95 ?  848  ARG A NH2   1 
ATOM   3445  N  N     . ARG A 1 977  ? 136.417 173.979 151.029 1.00 155.81 ?  849  ARG A N     1 
ATOM   3446  C  CA    . ARG A 1 977  ? 135.411 173.094 150.448 1.00 143.77 ?  849  ARG A CA    1 
ATOM   3447  C  C     . ARG A 1 977  ? 134.191 173.875 149.966 1.00 140.02 ?  849  ARG A C     1 
ATOM   3448  O  O     . ARG A 1 977  ? 133.648 173.588 148.893 1.00 137.83 ?  849  ARG A O     1 
ATOM   3449  C  CB    . ARG A 1 977  ? 135.033 172.021 151.471 1.00 143.36 ?  849  ARG A CB    1 
ATOM   3450  C  CG    . ARG A 1 977  ? 136.256 171.407 152.160 1.00 131.95 ?  849  ARG A CG    1 
ATOM   3451  C  CD    . ARG A 1 977  ? 135.977 170.025 152.729 1.00 116.77 ?  849  ARG A CD    1 
ATOM   3452  N  NE    . ARG A 1 977  ? 135.106 170.098 153.899 1.00 149.95 ?  849  ARG A NE    1 
ATOM   3453  C  CZ    . ARG A 1 977  ? 133.848 169.672 153.919 1.00 178.08 ?  849  ARG A CZ    1 
ATOM   3454  N  NH1   . ARG A 1 977  ? 133.310 169.137 152.831 1.00 166.87 ?  849  ARG A NH1   1 
ATOM   3455  N  NH2   . ARG A 1 977  ? 133.129 169.783 155.025 1.00 201.84 ?  849  ARG A NH2   1 
ATOM   3456  N  N     . ARG A 1 978  ? 133.759 174.880 150.734 1.00 157.09 ?  850  ARG A N     1 
ATOM   3457  C  CA    . ARG A 1 978  ? 132.689 175.765 150.274 1.00 181.57 ?  850  ARG A CA    1 
ATOM   3458  C  C     . ARG A 1 978  ? 133.107 176.545 149.032 1.00 184.54 ?  850  ARG A C     1 
ATOM   3459  O  O     . ARG A 1 978  ? 132.292 176.771 148.126 1.00 179.55 ?  850  ARG A O     1 
ATOM   3460  C  CB    . ARG A 1 978  ? 132.282 176.719 151.400 1.00 190.33 ?  850  ARG A CB    1 
ATOM   3461  C  CG    . ARG A 1 978  ? 132.091 178.176 150.968 1.00 191.97 ?  850  ARG A CG    1 
ATOM   3462  C  CD    . ARG A 1 978  ? 131.523 179.031 152.091 1.00 160.49 ?  850  ARG A CD    1 
ATOM   3463  N  NE    . ARG A 1 978  ? 132.130 178.687 153.372 1.00 158.58 ?  850  ARG A NE    1 
ATOM   3464  C  CZ    . ARG A 1 978  ? 133.394 178.925 153.692 1.00 166.89 ?  850  ARG A CZ    1 
ATOM   3465  N  NH1   . ARG A 1 978  ? 134.211 179.507 152.824 1.00 176.28 ?  850  ARG A NH1   1 
ATOM   3466  N  NH2   . ARG A 1 978  ? 133.846 178.571 154.889 1.00 173.82 ?  850  ARG A NH2   1 
ATOM   3467  N  N     . TRP A 1 979  ? 134.373 176.972 148.976 1.00 168.32 ?  851  TRP A N     1 
ATOM   3468  C  CA    . TRP A 1 979  ? 134.857 177.702 147.807 1.00 145.01 ?  851  TRP A CA    1 
ATOM   3469  C  C     . TRP A 1 979  ? 134.870 176.809 146.570 1.00 144.30 ?  851  TRP A C     1 
ATOM   3470  O  O     . TRP A 1 979  ? 134.465 177.237 145.480 1.00 143.32 ?  851  TRP A O     1 
ATOM   3471  C  CB    . TRP A 1 979  ? 136.250 178.263 148.096 1.00 136.45 ?  851  TRP A CB    1 
ATOM   3472  C  CG    . TRP A 1 979  ? 136.263 179.285 149.196 1.00 137.10 ?  851  TRP A CG    1 
ATOM   3473  C  CD1   . TRP A 1 979  ? 135.210 180.040 149.616 1.00 145.76 ?  851  TRP A CD1   1 
ATOM   3474  C  CD2   . TRP A 1 979  ? 137.366 179.625 150.049 1.00 141.18 ?  851  TRP A CD2   1 
ATOM   3475  N  NE1   . TRP A 1 979  ? 135.592 180.849 150.658 1.00 161.40 ?  851  TRP A NE1   1 
ATOM   3476  C  CE2   . TRP A 1 979  ? 136.909 180.611 150.946 1.00 152.92 ?  851  TRP A CE2   1 
ATOM   3477  C  CE3   . TRP A 1 979  ? 138.695 179.200 150.135 1.00 136.18 ?  851  TRP A CE3   1 
ATOM   3478  C  CZ2   . TRP A 1 979  ? 137.732 181.180 151.913 1.00 148.22 ?  851  TRP A CZ2   1 
ATOM   3479  C  CZ3   . TRP A 1 979  ? 139.510 179.766 151.096 1.00 133.05 ?  851  TRP A CZ3   1 
ATOM   3480  C  CH2   . TRP A 1 979  ? 139.026 180.745 151.973 1.00 135.69 ?  851  TRP A CH2   1 
ATOM   3481  N  N     . ARG A 1 980  ? 135.320 175.560 146.726 1.00 143.64 ?  852  ARG A N     1 
ATOM   3482  C  CA    . ARG A 1 980  ? 135.265 174.602 145.626 1.00 138.85 ?  852  ARG A CA    1 
ATOM   3483  C  C     . ARG A 1 980  ? 133.830 174.358 145.185 1.00 147.48 ?  852  ARG A C     1 
ATOM   3484  O  O     . ARG A 1 980  ? 133.556 174.243 143.988 1.00 142.37 ?  852  ARG A O     1 
ATOM   3485  C  CB    . ARG A 1 980  ? 135.916 173.282 146.035 1.00 147.71 ?  852  ARG A CB    1 
ATOM   3486  C  CG    . ARG A 1 980  ? 136.431 172.442 144.870 1.00 126.49 ?  852  ARG A CG    1 
ATOM   3487  C  CD    . ARG A 1 980  ? 136.879 171.066 145.338 1.00 123.60 ?  852  ARG A CD    1 
ATOM   3488  N  NE    . ARG A 1 980  ? 137.702 171.148 146.541 1.00 147.54 ?  852  ARG A NE    1 
ATOM   3489  C  CZ    . ARG A 1 980  ? 137.832 170.165 147.425 1.00 128.91 ?  852  ARG A CZ    1 
ATOM   3490  N  NH1   . ARG A 1 980  ? 137.195 169.017 147.243 1.00 112.48 ?  852  ARG A NH1   1 
ATOM   3491  N  NH2   . ARG A 1 980  ? 138.600 170.332 148.493 1.00 115.06 ?  852  ARG A NH2   1 
ATOM   3492  N  N     . SER A 1 981  ? 132.899 174.279 146.139 1.00 156.84 ?  853  SER A N     1 
ATOM   3493  C  CA    . SER A 1 981  ? 131.505 174.029 145.785 1.00 149.18 ?  853  SER A CA    1 
ATOM   3494  C  C     . SER A 1 981  ? 130.906 175.194 144.994 1.00 163.08 ?  853  SER A C     1 
ATOM   3495  O  O     . SER A 1 981  ? 130.249 174.976 143.962 1.00 162.75 ?  853  SER A O     1 
ATOM   3496  C  CB    . SER A 1 981  ? 130.692 173.747 147.051 1.00 136.23 ?  853  SER A CB    1 
ATOM   3497  O  OG    . SER A 1 981  ? 129.313 173.593 146.764 1.00 124.93 ?  853  SER A OG    1 
ATOM   3498  N  N     . THR A 1 982  ? 131.120 176.438 145.454 1.00 171.06 ?  854  THR A N     1 
ATOM   3499  C  CA    . THR A 1 982  ? 130.556 177.581 144.731 1.00 169.48 ?  854  THR A CA    1 
ATOM   3500  C  C     . THR A 1 982  ? 131.216 177.743 143.368 1.00 163.35 ?  854  THR A C     1 
ATOM   3501  O  O     . THR A 1 982  ? 130.540 178.063 142.386 1.00 148.93 ?  854  THR A O     1 
ATOM   3502  C  CB    . THR A 1 982  ? 130.658 178.884 145.540 1.00 127.94 ?  854  THR A CB    1 
ATOM   3503  O  OG1   . THR A 1 982  ? 130.259 179.991 144.717 1.00 100.38 ?  854  THR A OG1   1 
ATOM   3504  C  CG2   . THR A 1 982  ? 132.064 179.143 146.035 1.00 115.96 ?  854  THR A CG2   1 
ATOM   3505  N  N     . LEU A 1 983  ? 132.524 177.486 143.279 1.00 158.89 ?  855  LEU A N     1 
ATOM   3506  C  CA    . LEU A 1 983  ? 133.198 177.514 141.984 1.00 154.95 ?  855  LEU A CA    1 
ATOM   3507  C  C     . LEU A 1 983  ? 132.646 176.449 141.043 1.00 152.26 ?  855  LEU A C     1 
ATOM   3508  O  O     . LEU A 1 983  ? 132.427 176.710 139.852 1.00 140.22 ?  855  LEU A O     1 
ATOM   3509  C  CB    . LEU A 1 983  ? 134.696 177.310 142.187 1.00 151.34 ?  855  LEU A CB    1 
ATOM   3510  C  CG    . LEU A 1 983  ? 135.542 177.061 140.940 1.00 145.68 ?  855  LEU A CG    1 
ATOM   3511  C  CD1   . LEU A 1 983  ? 135.300 178.130 139.882 1.00 158.14 ?  855  LEU A CD1   1 
ATOM   3512  C  CD2   . LEU A 1 983  ? 137.013 176.965 141.311 1.00 151.63 ?  855  LEU A CD2   1 
ATOM   3513  N  N     . ASP A 1 984  ? 132.427 175.239 141.556 1.00 168.05 ?  856  ASP A N     1 
ATOM   3514  C  CA    . ASP A 1 984  ? 131.998 174.135 140.710 1.00 189.06 ?  856  ASP A CA    1 
ATOM   3515  C  C     . ASP A 1 984  ? 130.597 174.374 140.168 1.00 169.12 ?  856  ASP A C     1 
ATOM   3516  O  O     . ASP A 1 984  ? 130.347 174.198 138.972 1.00 149.57 ?  856  ASP A O     1 
ATOM   3517  C  CB    . ASP A 1 984  ? 132.066 172.827 141.500 1.00 213.42 ?  856  ASP A CB    1 
ATOM   3518  C  CG    . ASP A 1 984  ? 132.271 171.614 140.610 1.00 251.36 ?  856  ASP A CG    1 
ATOM   3519  O  OD1   . ASP A 1 984  ? 131.587 171.508 139.569 1.00 223.48 ?  856  ASP A OD1   1 
ATOM   3520  O  OD2   . ASP A 1 984  ? 133.125 170.768 140.948 1.00 345.29 -1 856  ASP A OD2   1 
ATOM   3521  N  N     . LYS A 1 985  ? 129.666 174.784 141.031 1.00 154.39 ?  857  LYS A N     1 
ATOM   3522  C  CA    . LYS A 1 985  ? 128.322 175.067 140.535 1.00 142.76 ?  857  LYS A CA    1 
ATOM   3523  C  C     . LYS A 1 985  ? 128.260 176.372 139.742 1.00 145.43 ?  857  LYS A C     1 
ATOM   3524  O  O     . LYS A 1 985  ? 127.382 176.520 138.885 1.00 149.53 ?  857  LYS A O     1 
ATOM   3525  C  CB    . LYS A 1 985  ? 127.324 175.062 141.696 1.00 150.61 ?  857  LYS A CB    1 
ATOM   3526  C  CG    . LYS A 1 985  ? 127.159 173.675 142.330 1.00 112.61 ?  857  LYS A CG    1 
ATOM   3527  C  CD    . LYS A 1 985  ? 126.815 173.731 143.814 1.00 103.23 ?  857  LYS A CD    1 
ATOM   3528  C  CE    . LYS A 1 985  ? 125.334 173.997 144.035 1.00 107.15 ?  857  LYS A CE    1 
ATOM   3529  N  NZ    . LYS A 1 985  ? 124.963 173.910 145.476 1.00 85.41  ?  857  LYS A NZ    1 
ATOM   3530  N  N     . GLN A 1 986  ? 129.205 177.287 139.957 1.00 133.77 ?  858  GLN A N     1 
ATOM   3531  C  CA    . GLN A 1 986  ? 129.328 178.458 139.100 1.00 123.57 ?  858  GLN A CA    1 
ATOM   3532  C  C     . GLN A 1 986  ? 129.695 178.050 137.674 1.00 134.40 ?  858  GLN A C     1 
ATOM   3533  O  O     . GLN A 1 986  ? 129.061 178.481 136.696 1.00 151.25 ?  858  GLN A O     1 
ATOM   3534  C  CB    . GLN A 1 986  ? 130.374 179.393 139.712 1.00 91.83  ?  858  GLN A CB    1 
ATOM   3535  C  CG    . GLN A 1 986  ? 131.042 180.342 138.761 1.00 96.46  ?  858  GLN A CG    1 
ATOM   3536  C  CD    . GLN A 1 986  ? 130.420 181.713 138.812 1.00 117.46 ?  858  GLN A CD    1 
ATOM   3537  O  OE1   . GLN A 1 986  ? 129.293 181.879 139.281 1.00 120.66 ?  858  GLN A OE1   1 
ATOM   3538  N  NE2   . GLN A 1 986  ? 131.149 182.710 138.323 1.00 145.04 ?  858  GLN A NE2   1 
ATOM   3539  N  N     . LEU A 1 987  ? 130.723 177.207 137.538 1.00 124.93 ?  859  LEU A N     1 
ATOM   3540  C  CA    . LEU A 1 987  ? 131.055 176.642 136.233 1.00 120.92 ?  859  LEU A CA    1 
ATOM   3541  C  C     . LEU A 1 987  ? 129.884 175.858 135.656 1.00 127.26 ?  859  LEU A C     1 
ATOM   3542  O  O     . LEU A 1 987  ? 129.610 175.934 134.454 1.00 134.04 ?  859  LEU A O     1 
ATOM   3543  C  CB    . LEU A 1 987  ? 132.280 175.737 136.338 1.00 107.25 ?  859  LEU A CB    1 
ATOM   3544  C  CG    . LEU A 1 987  ? 133.604 176.288 135.818 1.00 92.98  ?  859  LEU A CG    1 
ATOM   3545  C  CD1   . LEU A 1 987  ? 134.579 175.138 135.637 1.00 84.30  ?  859  LEU A CD1   1 
ATOM   3546  C  CD2   . LEU A 1 987  ? 133.421 177.060 134.518 1.00 95.32  ?  859  LEU A CD2   1 
ATOM   3547  N  N     . ARG A 1 988  ? 129.200 175.078 136.499 1.00 124.75 ?  860  ARG A N     1 
ATOM   3548  C  CA    . ARG A 1 988  ? 128.012 174.341 136.075 1.00 128.83 ?  860  ARG A CA    1 
ATOM   3549  C  C     . ARG A 1 988  ? 126.964 175.268 135.473 1.00 147.57 ?  860  ARG A C     1 
ATOM   3550  O  O     . ARG A 1 988  ? 126.266 174.903 134.520 1.00 147.94 ?  860  ARG A O     1 
ATOM   3551  C  CB    . ARG A 1 988  ? 127.434 173.590 137.278 1.00 118.28 ?  860  ARG A CB    1 
ATOM   3552  C  CG    . ARG A 1 988  ? 125.952 173.258 137.194 1.00 119.06 ?  860  ARG A CG    1 
ATOM   3553  C  CD    . ARG A 1 988  ? 125.471 172.553 138.458 1.00 104.87 ?  860  ARG A CD    1 
ATOM   3554  N  NE    . ARG A 1 988  ? 126.077 171.236 138.621 1.00 115.17 ?  860  ARG A NE    1 
ATOM   3555  C  CZ    . ARG A 1 988  ? 125.794 170.182 137.860 1.00 122.70 ?  860  ARG A CZ    1 
ATOM   3556  N  NH1   . ARG A 1 988  ? 124.915 170.285 136.868 1.00 136.61 ?  860  ARG A NH1   1 
ATOM   3557  N  NH2   . ARG A 1 988  ? 126.396 169.020 138.085 1.00 112.28 ?  860  ARG A NH2   1 
ATOM   3558  N  N     . LYS A 1 989  ? 126.836 176.473 136.030 1.00 165.56 ?  861  LYS A N     1 
ATOM   3559  C  CA    . LYS A 1 989  ? 125.897 177.448 135.484 1.00 191.89 ?  861  LYS A CA    1 
ATOM   3560  C  C     . LYS A 1 989  ? 126.368 177.967 134.130 1.00 178.56 ?  861  LYS A C     1 
ATOM   3561  O  O     . LYS A 1 989  ? 125.596 177.994 133.163 1.00 172.53 ?  861  LYS A O     1 
ATOM   3562  C  CB    . LYS A 1 989  ? 125.705 178.612 136.461 1.00 212.16 ?  861  LYS A CB    1 
ATOM   3563  C  CG    . LYS A 1 989  ? 124.773 179.715 135.946 1.00 192.99 ?  861  LYS A CG    1 
ATOM   3564  C  CD    . LYS A 1 989  ? 124.629 180.870 136.939 1.00 167.63 ?  861  LYS A CD    1 
ATOM   3565  C  CE    . LYS A 1 989  ? 125.907 181.698 137.016 1.00 165.22 ?  861  LYS A CE    1 
ATOM   3566  N  NZ    . LYS A 1 989  ? 126.254 182.307 135.698 1.00 150.41 ?  861  LYS A NZ    1 
ATOM   3567  N  N     . LYS A 1 990  ? 127.635 178.379 134.033 1.00 155.06 ?  862  LYS A N     1 
ATOM   3568  C  CA    . LYS A 1 990  ? 128.094 179.014 132.794 1.00 122.62 ?  862  LYS A CA    1 
ATOM   3569  C  C     . LYS A 1 990  ? 128.627 178.008 131.771 1.00 127.32 ?  862  LYS A C     1 
ATOM   3570  O  O     . LYS A 1 990  ? 128.114 177.931 130.650 1.00 123.78 ?  862  LYS A O     1 
ATOM   3571  C  CB    . LYS A 1 990  ? 129.156 180.072 133.100 1.00 106.44 ?  862  LYS A CB    1 
ATOM   3572  C  CG    . LYS A 1 990  ? 128.591 181.394 133.579 1.00 120.53 ?  862  LYS A CG    1 
ATOM   3573  C  CD    . LYS A 1 990  ? 129.637 182.164 134.349 1.00 149.62 ?  862  LYS A CD    1 
ATOM   3574  C  CE    . LYS A 1 990  ? 130.255 181.276 135.419 1.00 147.00 ?  862  LYS A CE    1 
ATOM   3575  N  NZ    . LYS A 1 990  ? 129.243 180.560 136.240 1.00 158.58 ?  862  LYS A NZ    1 
ATOM   3576  N  N     . MET A 1 991  ? 129.661 177.248 132.127 1.00 139.42 ?  863  MET A N     1 
ATOM   3577  C  CA    . MET A 1 991  ? 130.274 176.308 131.193 1.00 141.67 ?  863  MET A CA    1 
ATOM   3578  C  C     . MET A 1 991  ? 129.634 174.926 131.212 1.00 134.02 ?  863  MET A C     1 
ATOM   3579  O  O     . MET A 1 991  ? 129.944 174.112 130.334 1.00 126.12 ?  863  MET A O     1 
ATOM   3580  C  CB    . MET A 1 991  ? 131.779 176.180 131.471 1.00 140.29 ?  863  MET A CB    1 
ATOM   3581  C  CG    . MET A 1 991  ? 132.609 177.340 130.959 1.00 132.08 ?  863  MET A CG    1 
ATOM   3582  S  SD    . MET A 1 991  ? 133.249 177.038 129.299 1.00 94.45  ?  863  MET A SD    1 
ATOM   3583  C  CE    . MET A 1 991  ? 131.888 177.642 128.297 1.00 110.22 ?  863  MET A CE    1 
ATOM   3584  N  N     . LYS A 1 992  ? 128.755 174.649 132.174 1.00 144.86 ?  864  LYS A N     1 
ATOM   3585  C  CA    . LYS A 1 992  ? 128.069 173.360 132.290 1.00 154.29 ?  864  LYS A CA    1 
ATOM   3586  C  C     . LYS A 1 992  ? 129.075 172.211 132.396 1.00 157.58 ?  864  LYS A C     1 
ATOM   3587  O  O     . LYS A 1 992  ? 129.105 171.287 131.579 1.00 158.72 ?  864  LYS A O     1 
ATOM   3588  C  CB    . LYS A 1 992  ? 127.099 173.145 131.123 1.00 160.17 ?  864  LYS A CB    1 
ATOM   3589  C  CG    . LYS A 1 992  ? 125.943 174.129 131.099 1.00 148.52 ?  864  LYS A CG    1 
ATOM   3590  C  CD    . LYS A 1 992  ? 124.771 173.623 131.921 1.00 147.78 ?  864  LYS A CD    1 
ATOM   3591  C  CE    . LYS A 1 992  ? 123.462 173.957 131.237 1.00 140.16 ?  864  LYS A CE    1 
ATOM   3592  N  NZ    . LYS A 1 992  ? 123.406 173.359 129.874 1.00 130.76 ?  864  LYS A NZ    1 
ATOM   3593  N  N     . LEU A 1 993  ? 129.893 172.282 133.439 1.00 144.85 ?  865  LEU A N     1 
ATOM   3594  C  CA    . LEU A 1 993  ? 130.947 171.305 133.698 1.00 124.67 ?  865  LEU A CA    1 
ATOM   3595  C  C     . LEU A 1 993  ? 130.685 170.690 135.068 1.00 114.17 ?  865  LEU A C     1 
ATOM   3596  O  O     . LEU A 1 993  ? 131.023 171.284 136.097 1.00 121.75 ?  865  LEU A O     1 
ATOM   3597  C  CB    . LEU A 1 993  ? 132.318 171.965 133.623 1.00 120.62 ?  865  LEU A CB    1 
ATOM   3598  C  CG    . LEU A 1 993  ? 132.814 172.194 132.195 1.00 118.38 ?  865  LEU A CG    1 
ATOM   3599  C  CD1   . LEU A 1 993  ? 134.229 172.757 132.172 1.00 92.88  ?  865  LEU A CD1   1 
ATOM   3600  C  CD2   . LEU A 1 993  ? 132.730 170.893 131.421 1.00 119.90 ?  865  LEU A CD2   1 
ATOM   3601  N  N     . LYS A 1 994  ? 130.068 169.510 135.074 1.00 97.32  ?  866  LYS A N     1 
ATOM   3602  C  CA    . LYS A 1 994  ? 129.732 168.843 136.320 1.00 105.99 ?  866  LYS A CA    1 
ATOM   3603  C  C     . LYS A 1 994  ? 131.002 168.540 137.118 1.00 113.84 ?  866  LYS A C     1 
ATOM   3604  O  O     . LYS A 1 994  ? 132.090 168.425 136.546 1.00 109.29 ?  866  LYS A O     1 
ATOM   3605  C  CB    . LYS A 1 994  ? 128.956 167.558 136.039 1.00 79.56  ?  866  LYS A CB    1 
ATOM   3606  C  CG    . LYS A 1 994  ? 129.769 166.496 135.331 1.00 87.15  ?  866  LYS A CG    1 
ATOM   3607  C  CD    . LYS A 1 994  ? 128.898 165.327 134.914 1.00 100.42 ?  866  LYS A CD    1 
ATOM   3608  C  CE    . LYS A 1 994  ? 129.700 164.319 134.107 1.00 147.23 ?  866  LYS A CE    1 
ATOM   3609  N  NZ    . LYS A 1 994  ? 130.628 163.527 134.964 1.00 151.41 ?  866  LYS A NZ    1 
ATOM   3610  N  N     . PRO A 1 995  ? 130.893 168.413 138.443 1.00 141.96 ?  867  PRO A N     1 
ATOM   3611  C  CA    . PRO A 1 995  ? 132.088 168.165 139.259 1.00 157.71 ?  867  PRO A CA    1 
ATOM   3612  C  C     . PRO A 1 995  ? 132.731 166.822 138.944 1.00 152.04 ?  867  PRO A C     1 
ATOM   3613  O  O     . PRO A 1 995  ? 132.085 165.889 138.466 1.00 159.11 ?  867  PRO A O     1 
ATOM   3614  C  CB    . PRO A 1 995  ? 131.549 168.201 140.693 1.00 200.64 ?  867  PRO A CB    1 
ATOM   3615  C  CG    . PRO A 1 995  ? 130.116 167.798 140.550 1.00 164.87 ?  867  PRO A CG    1 
ATOM   3616  C  CD    . PRO A 1 995  ? 129.668 168.438 139.266 1.00 159.17 ?  867  PRO A CD    1 
ATOM   3617  N  N     . VAL A 1 996  ? 134.033 166.728 139.221 1.00 142.55 ?  868  VAL A N     1 
ATOM   3618  C  CA    . VAL A 1 996  ? 134.822 165.541 138.925 1.00 126.65 ?  868  VAL A CA    1 
ATOM   3619  C  C     . VAL A 1 996  ? 135.701 165.210 140.124 1.00 110.67 ?  868  VAL A C     1 
ATOM   3620  O  O     . VAL A 1 996  ? 135.683 165.893 141.151 1.00 112.38 ?  868  VAL A O     1 
ATOM   3621  C  CB    . VAL A 1 996  ? 135.700 165.716 137.671 1.00 130.27 ?  868  VAL A CB    1 
ATOM   3622  C  CG1   . VAL A 1 996  ? 134.841 165.889 136.430 1.00 160.93 ?  868  VAL A CG1   1 
ATOM   3623  C  CG2   . VAL A 1 996  ? 136.668 166.872 137.856 1.00 119.66 ?  868  VAL A CG2   1 
ATOM   3624  N  N     . MET A 1 997  ? 136.483 164.146 139.974 1.00 103.29 ?  869  MET A N     1 
ATOM   3625  C  CA    . MET A 1 997  ? 137.513 163.764 140.930 1.00 108.97 ?  869  MET A CA    1 
ATOM   3626  C  C     . MET A 1 997  ? 138.918 164.011 140.408 1.00 111.63 ?  869  MET A C     1 
ATOM   3627  O  O     . MET A 1 997  ? 139.773 164.498 141.152 1.00 137.63 ?  869  MET A O     1 
ATOM   3628  C  CB    . MET A 1 997  ? 137.368 162.281 141.307 1.00 130.29 ?  869  MET A CB    1 
ATOM   3629  C  CG    . MET A 1 997  ? 138.704 161.549 141.467 1.00 145.17 ?  869  MET A CG    1 
ATOM   3630  S  SD    . MET A 1 997  ? 138.560 159.776 141.760 1.00 184.35 ?  869  MET A SD    1 
ATOM   3631  C  CE    . MET A 1 997  ? 140.177 159.211 141.224 1.00 150.60 ?  869  MET A CE    1 
ATOM   3632  N  N     . ARG A 1 998  ? 139.168 163.716 139.133 1.00 106.87 ?  870  ARG A N     1 
ATOM   3633  C  CA    . ARG A 1 998  ? 140.508 163.800 138.574 1.00 124.90 ?  870  ARG A CA    1 
ATOM   3634  C  C     . ARG A 1 998  ? 140.431 164.344 137.155 1.00 114.78 ?  870  ARG A C     1 
ATOM   3635  O  O     . ARG A 1 998  ? 139.429 164.164 136.456 1.00 125.90 ?  870  ARG A O     1 
ATOM   3636  C  CB    . ARG A 1 998  ? 141.203 162.434 138.601 1.00 167.74 ?  870  ARG A CB    1 
ATOM   3637  C  CG    . ARG A 1 998  ? 140.658 161.407 137.621 1.00 173.04 ?  870  ARG A CG    1 
ATOM   3638  C  CD    . ARG A 1 998  ? 141.469 160.117 137.684 1.00 176.71 ?  870  ARG A CD    1 
ATOM   3639  N  NE    . ARG A 1 998  ? 141.177 159.246 136.552 1.00 161.89 ?  870  ARG A NE    1 
ATOM   3640  C  CZ    . ARG A 1 998  ? 141.969 159.115 135.492 1.00 153.90 ?  870  ARG A CZ    1 
ATOM   3641  N  NH1   . ARG A 1 998  ? 141.627 158.309 134.496 1.00 148.23 ?  870  ARG A NH1   1 
ATOM   3642  N  NH2   . ARG A 1 998  ? 143.103 159.798 135.429 1.00 156.07 ?  870  ARG A NH2   1 
ATOM   3643  N  N     . MET A 1 999  ? 141.509 165.008 136.739 1.00 93.16  ?  871  MET A N     1 
ATOM   3644  C  CA    . MET A 1 999  ? 141.548 165.745 135.476 1.00 80.13  ?  871  MET A CA    1 
ATOM   3645  C  C     . MET A 1 999  ? 141.998 164.812 134.363 1.00 83.86  ?  871  MET A C     1 
ATOM   3646  O  O     . MET A 1 999  ? 143.191 164.611 134.130 1.00 81.36  ?  871  MET A O     1 
ATOM   3647  C  CB    . MET A 1 999  ? 142.469 166.950 135.589 1.00 64.93  ?  871  MET A CB    1 
ATOM   3648  C  CG    . MET A 1 999  ? 141.919 168.074 136.439 1.00 73.92  ?  871  MET A CG    1 
ATOM   3649  S  SD    . MET A 1 999  ? 141.281 167.490 138.024 1.00 104.07 ?  871  MET A SD    1 
ATOM   3650  C  CE    . MET A 1 999  ? 142.789 167.014 138.868 1.00 86.10  ?  871  MET A CE    1 
ATOM   3651  N  N     . ASN A 1 1000 ? 141.028 164.230 133.670 1.00 98.88  ?  872  ASN A N     1 
ATOM   3652  C  CA    . ASN A 1 1000 ? 141.294 163.475 132.455 1.00 104.60 ?  872  ASN A CA    1 
ATOM   3653  C  C     . ASN A 1 1000 ? 141.515 164.468 131.312 1.00 115.50 ?  872  ASN A C     1 
ATOM   3654  O  O     . ASN A 1 1000 ? 141.585 165.684 131.512 1.00 111.41 ?  872  ASN A O     1 
ATOM   3655  C  CB    . ASN A 1 1000 ? 140.160 162.487 132.189 1.00 123.29 ?  872  ASN A CB    1 
ATOM   3656  C  CG    . ASN A 1 1000 ? 138.975 163.116 131.473 1.00 132.71 ?  872  ASN A CG    1 
ATOM   3657  O  OD1   . ASN A 1 1000 ? 139.017 163.368 130.268 1.00 128.43 ?  872  ASN A OD1   1 
ATOM   3658  N  ND2   . ASN A 1 1000 ? 137.910 163.378 132.220 1.00 141.23 ?  872  ASN A ND2   1 
ATOM   3659  N  N     . GLY A 1 1001 ? 141.625 163.953 130.091 1.00 119.33 ?  873  GLY A N     1 
ATOM   3660  C  CA    . GLY A 1 1001 ? 141.915 164.774 128.932 1.00 127.77 ?  873  GLY A CA    1 
ATOM   3661  C  C     . GLY A 1 1001 ? 140.884 165.834 128.589 1.00 124.97 ?  873  GLY A C     1 
ATOM   3662  O  O     . GLY A 1 1001 ? 141.211 167.024 128.565 1.00 122.58 ?  873  GLY A O     1 
ATOM   3663  N  N     . ASN A 1 1002 ? 139.646 165.421 128.300 1.00 113.95 ?  874  ASN A N     1 
ATOM   3664  C  CA    . ASN A 1 1002 ? 138.640 166.364 127.809 1.00 102.68 ?  874  ASN A CA    1 
ATOM   3665  C  C     . ASN A 1 1002 ? 138.316 167.433 128.851 1.00 97.81  ?  874  ASN A C     1 
ATOM   3666  O  O     . ASN A 1 1002 ? 138.171 168.619 128.517 1.00 103.02 ?  874  ASN A O     1 
ATOM   3667  C  CB    . ASN A 1 1002 ? 137.375 165.607 127.403 1.00 87.22  ?  874  ASN A CB    1 
ATOM   3668  C  CG    . ASN A 1 1002 ? 136.294 166.521 126.865 1.00 90.31  ?  874  ASN A CG    1 
ATOM   3669  O  OD1   . ASN A 1 1002 ? 136.583 167.570 126.285 1.00 102.96 ?  874  ASN A OD1   1 
ATOM   3670  N  ND2   . ASN A 1 1002 ? 135.037 166.132 127.060 1.00 79.70  ?  874  ASN A ND2   1 
ATOM   3671  N  N     . TYR A 1 1003 ? 138.165 167.023 130.113 1.00 83.83  ?  875  TYR A N     1 
ATOM   3672  C  CA    . TYR A 1 1003 ? 137.921 167.968 131.198 1.00 73.30  ?  875  TYR A CA    1 
ATOM   3673  C  C     . TYR A 1 1003 ? 139.028 169.012 131.269 1.00 73.79  ?  875  TYR A C     1 
ATOM   3674  O  O     . TYR A 1 1003 ? 138.768 170.220 131.362 1.00 89.80  ?  875  TYR A O     1 
ATOM   3675  C  CB    . TYR A 1 1003 ? 137.797 167.205 132.522 1.00 75.37  ?  875  TYR A CB    1 
ATOM   3676  C  CG    . TYR A 1 1003 ? 137.510 168.069 133.734 1.00 100.51 ?  875  TYR A CG    1 
ATOM   3677  C  CD1   . TYR A 1 1003 ? 136.206 168.368 134.101 1.00 135.32 ?  875  TYR A CD1   1 
ATOM   3678  C  CD2   . TYR A 1 1003 ? 138.539 168.605 134.497 1.00 104.58 ?  875  TYR A CD2   1 
ATOM   3679  C  CE1   . TYR A 1 1003 ? 135.932 169.164 135.203 1.00 140.76 ?  875  TYR A CE1   1 
ATOM   3680  C  CE2   . TYR A 1 1003 ? 138.273 169.397 135.608 1.00 120.09 ?  875  TYR A CE2   1 
ATOM   3681  C  CZ    . TYR A 1 1003 ? 136.967 169.677 135.952 1.00 118.32 ?  875  TYR A CZ    1 
ATOM   3682  O  OH    . TYR A 1 1003 ? 136.689 170.466 137.048 1.00 82.39  ?  875  TYR A OH    1 
ATOM   3683  N  N     . ALA A 1 1004 ? 140.278 168.556 131.209 1.00 72.98  ?  876  ALA A N     1 
ATOM   3684  C  CA    . ALA A 1 1004 ? 141.408 169.472 131.238 1.00 86.90  ?  876  ALA A CA    1 
ATOM   3685  C  C     . ALA A 1 1004 ? 141.370 170.430 130.051 1.00 107.01 ?  876  ALA A C     1 
ATOM   3686  O  O     . ALA A 1 1004 ? 141.576 171.638 130.210 1.00 116.26 ?  876  ALA A O     1 
ATOM   3687  C  CB    . ALA A 1 1004 ? 142.716 168.681 131.259 1.00 101.29 ?  876  ALA A CB    1 
ATOM   3688  N  N     . ARG A 1 1005 ? 141.111 169.905 128.848 1.00 103.64 ?  877  ARG A N     1 
ATOM   3689  C  CA    . ARG A 1 1005 ? 141.043 170.758 127.661 1.00 102.00 ?  877  ARG A CA    1 
ATOM   3690  C  C     . ARG A 1 1005 ? 140.018 171.874 127.833 1.00 95.30  ?  877  ARG A C     1 
ATOM   3691  O  O     . ARG A 1 1005 ? 140.310 173.048 127.574 1.00 100.12 ?  877  ARG A O     1 
ATOM   3692  C  CB    . ARG A 1 1005 ? 140.708 169.942 126.409 1.00 108.55 ?  877  ARG A CB    1 
ATOM   3693  C  CG    . ARG A 1 1005 ? 141.826 169.061 125.876 1.00 124.84 ?  877  ARG A CG    1 
ATOM   3694  C  CD    . ARG A 1 1005 ? 141.400 168.342 124.594 1.00 111.20 ?  877  ARG A CD    1 
ATOM   3695  N  NE    . ARG A 1 1005 ? 142.221 167.170 124.316 1.00 117.40 ?  877  ARG A NE    1 
ATOM   3696  C  CZ    . ARG A 1 1005 ? 142.077 165.996 124.924 1.00 122.34 ?  877  ARG A CZ    1 
ATOM   3697  N  NH1   . ARG A 1 1005 ? 141.123 165.833 125.831 1.00 124.47 ?  877  ARG A NH1   1 
ATOM   3698  N  NH2   . ARG A 1 1005 ? 142.876 164.980 124.617 1.00 109.32 ?  877  ARG A NH2   1 
ATOM   3699  N  N     . ARG A 1 1006 ? 138.799 171.523 128.247 1.00 98.15  ?  878  ARG A N     1 
ATOM   3700  C  CA    . ARG A 1 1006 ? 137.766 172.547 128.380 1.00 110.43 ?  878  ARG A CA    1 
ATOM   3701  C  C     . ARG A 1 1006 ? 138.054 173.507 129.526 1.00 115.62 ?  878  ARG A C     1 
ATOM   3702  O  O     . ARG A 1 1006 ? 137.571 174.645 129.514 1.00 127.68 ?  878  ARG A O     1 
ATOM   3703  C  CB    . ARG A 1 1006 ? 136.377 171.926 128.573 1.00 111.01 ?  878  ARG A CB    1 
ATOM   3704  C  CG    . ARG A 1 1006 ? 135.247 172.916 128.253 1.00 111.68 ?  878  ARG A CG    1 
ATOM   3705  C  CD    . ARG A 1 1006 ? 133.845 172.340 128.403 1.00 97.58  ?  878  ARG A CD    1 
ATOM   3706  N  NE    . ARG A 1 1006 ? 133.758 170.926 128.070 1.00 158.03 ?  878  ARG A NE    1 
ATOM   3707  C  CZ    . ARG A 1 1006 ? 132.625 170.233 128.086 1.00 170.17 ?  878  ARG A CZ    1 
ATOM   3708  N  NH1   . ARG A 1 1006 ? 131.487 170.826 128.423 1.00 150.07 ?  878  ARG A NH1   1 
ATOM   3709  N  NH2   . ARG A 1 1006 ? 132.629 168.945 127.768 1.00 170.24 ?  878  ARG A NH2   1 
ATOM   3710  N  N     . LEU A 1 1007 ? 138.822 173.075 130.527 1.00 102.92 ?  879  LEU A N     1 
ATOM   3711  C  CA    . LEU A 1 1007 ? 139.046 173.947 131.676 1.00 103.82 ?  879  LEU A CA    1 
ATOM   3712  C  C     . LEU A 1 1007 ? 139.962 175.121 131.339 1.00 103.74 ?  879  LEU A C     1 
ATOM   3713  O  O     . LEU A 1 1007 ? 139.864 176.181 131.969 1.00 104.95 ?  879  LEU A O     1 
ATOM   3714  C  CB    . LEU A 1 1007 ? 139.615 173.148 132.846 1.00 94.16  ?  879  LEU A CB    1 
ATOM   3715  C  CG    . LEU A 1 1007 ? 138.991 173.524 134.193 1.00 104.10 ?  879  LEU A CG    1 
ATOM   3716  C  CD1   . LEU A 1 1007 ? 137.474 173.552 134.074 1.00 113.75 ?  879  LEU A CD1   1 
ATOM   3717  C  CD2   . LEU A 1 1007 ? 139.440 172.606 135.321 1.00 103.96 ?  879  LEU A CD2   1 
ATOM   3718  N  N     . MET A 1 1008 ? 140.859 174.956 130.368 1.00 108.87 ?  880  MET A N     1 
ATOM   3719  C  CA    . MET A 1 1008 ? 141.847 175.981 130.027 1.00 105.99 ?  880  MET A CA    1 
ATOM   3720  C  C     . MET A 1 1008 ? 141.374 176.744 128.795 1.00 105.05 ?  880  MET A C     1 
ATOM   3721  O  O     . MET A 1 1008 ? 141.871 176.568 127.684 1.00 89.70  ?  880  MET A O     1 
ATOM   3722  C  CB    . MET A 1 1008 ? 143.210 175.347 129.805 1.00 116.33 ?  880  MET A CB    1 
ATOM   3723  C  CG    . MET A 1 1008 ? 143.630 174.455 130.947 1.00 142.10 ?  880  MET A CG    1 
ATOM   3724  S  SD    . MET A 1 1008 ? 144.962 173.342 130.487 1.00 253.66 ?  880  MET A SD    1 
ATOM   3725  C  CE    . MET A 1 1008 ? 144.399 172.779 128.882 1.00 174.08 ?  880  MET A CE    1 
ATOM   3726  N  N     . THR A 1 1009 ? 140.398 177.616 129.014 1.00 117.78 ?  881  THR A N     1 
ATOM   3727  C  CA    . THR A 1 1009 ? 139.869 178.468 127.964 1.00 116.70 ?  881  THR A CA    1 
ATOM   3728  C  C     . THR A 1 1009 ? 139.610 179.852 128.537 1.00 106.78 ?  881  THR A C     1 
ATOM   3729  O  O     . THR A 1 1009 ? 139.277 180.004 129.716 1.00 99.91  ?  881  THR A O     1 
ATOM   3730  C  CB    . THR A 1 1009 ? 138.584 177.900 127.352 1.00 110.45 ?  881  THR A CB    1 
ATOM   3731  O  OG1   . THR A 1 1009 ? 137.770 177.340 128.388 1.00 104.76 ?  881  THR A OG1   1 
ATOM   3732  C  CG2   . THR A 1 1009 ? 138.911 176.824 126.330 1.00 87.94  ?  881  THR A CG2   1 
ATOM   3733  N  N     . ARG A 1 1010 ? 139.780 180.861 127.682 1.00 104.06 ?  882  ARG A N     1 
ATOM   3734  C  CA    . ARG A 1 1010 ? 139.587 182.241 128.105 1.00 107.08 ?  882  ARG A CA    1 
ATOM   3735  C  C     . ARG A 1 1010 ? 138.170 182.468 128.621 1.00 128.50 ?  882  ARG A C     1 
ATOM   3736  O  O     . ARG A 1 1010 ? 137.957 183.250 129.555 1.00 141.70 ?  882  ARG A O     1 
ATOM   3737  C  CB    . ARG A 1 1010 ? 139.910 183.182 126.940 1.00 144.06 ?  882  ARG A CB    1 
ATOM   3738  C  CG    . ARG A 1 1010 ? 139.693 184.662 127.232 1.00 191.94 ?  882  ARG A CG    1 
ATOM   3739  C  CD    . ARG A 1 1010 ? 140.050 185.541 126.031 1.00 208.61 ?  882  ARG A CD    1 
ATOM   3740  N  NE    . ARG A 1 1010 ? 140.172 186.954 126.394 1.00 199.74 ?  882  ARG A NE    1 
ATOM   3741  C  CZ    . ARG A 1 1010 ? 140.672 187.894 125.597 1.00 164.40 ?  882  ARG A CZ    1 
ATOM   3742  N  NH1   . ARG A 1 1010 ? 141.102 187.574 124.384 1.00 151.82 ?  882  ARG A NH1   1 
ATOM   3743  N  NH2   . ARG A 1 1010 ? 140.741 189.154 126.009 1.00 137.50 ?  882  ARG A NH2   1 
ATOM   3744  N  N     . GLU A 1 1011 ? 137.187 181.791 128.026 1.00 137.43 ?  883  GLU A N     1 
ATOM   3745  C  CA    . GLU A 1 1011 ? 135.799 181.989 128.431 1.00 149.28 ?  883  GLU A CA    1 
ATOM   3746  C  C     . GLU A 1 1011 ? 135.540 181.438 129.830 1.00 134.19 ?  883  GLU A C     1 
ATOM   3747  O  O     . GLU A 1 1011 ? 134.862 182.081 130.637 1.00 139.97 ?  883  GLU A O     1 
ATOM   3748  C  CB    . GLU A 1 1011 ? 134.852 181.345 127.415 1.00 161.09 ?  883  GLU A CB    1 
ATOM   3749  C  CG    . GLU A 1 1011 ? 134.945 181.898 125.988 1.00 195.38 ?  883  GLU A CG    1 
ATOM   3750  C  CD    . GLU A 1 1011 ? 136.163 181.415 125.217 1.00 230.41 ?  883  GLU A CD    1 
ATOM   3751  O  OE1   . GLU A 1 1011 ? 137.273 181.388 125.788 1.00 179.32 ?  883  GLU A OE1   1 
ATOM   3752  O  OE2   . GLU A 1 1011 ? 136.007 181.054 124.032 1.00 383.45 -1 883  GLU A OE2   1 
ATOM   3753  N  N     . ALA A 1 1012 ? 136.078 180.256 130.144 1.00 114.73 ?  884  ALA A N     1 
ATOM   3754  C  CA    . ALA A 1 1012 ? 135.947 179.729 131.499 1.00 96.01  ?  884  ALA A CA    1 
ATOM   3755  C  C     . ALA A 1 1012 ? 136.691 180.597 132.507 1.00 105.23 ?  884  ALA A C     1 
ATOM   3756  O  O     . ALA A 1 1012 ? 136.273 180.711 133.668 1.00 105.26 ?  884  ALA A O     1 
ATOM   3757  C  CB    . ALA A 1 1012 ? 136.452 178.287 131.547 1.00 85.64  ?  884  ALA A CB    1 
ATOM   3758  N  N     . VAL A 1 1013 ? 137.770 181.248 132.074 1.00 105.70 ?  885  VAL A N     1 
ATOM   3759  C  CA    . VAL A 1 1013 ? 138.520 182.126 132.966 1.00 103.82 ?  885  VAL A CA    1 
ATOM   3760  C  C     . VAL A 1 1013 ? 137.733 183.404 133.256 1.00 142.51 ?  885  VAL A C     1 
ATOM   3761  O  O     . VAL A 1 1013 ? 137.675 183.863 134.403 1.00 148.02 ?  885  VAL A O     1 
ATOM   3762  C  CB    . VAL A 1 1013 ? 139.907 182.415 132.363 1.00 89.89  ?  885  VAL A CB    1 
ATOM   3763  C  CG1   . VAL A 1 1013 ? 140.427 183.763 132.815 1.00 119.64 ?  885  VAL A CG1   1 
ATOM   3764  C  CG2   . VAL A 1 1013 ? 140.874 181.325 132.769 1.00 79.36  ?  885  VAL A CG2   1 
ATOM   3765  N  N     . GLU A 1 1014 ? 137.100 183.992 132.236 1.00 155.26 ?  886  GLU A N     1 
ATOM   3766  C  CA    . GLU A 1 1014 ? 136.212 185.126 132.491 1.00 157.39 ?  886  GLU A CA    1 
ATOM   3767  C  C     . GLU A 1 1014 ? 134.965 184.706 133.255 1.00 153.19 ?  886  GLU A C     1 
ATOM   3768  O  O     . GLU A 1 1014 ? 134.342 185.545 133.915 1.00 146.85 ?  886  GLU A O     1 
ATOM   3769  C  CB    . GLU A 1 1014 ? 135.810 185.811 131.182 1.00 159.30 ?  886  GLU A CB    1 
ATOM   3770  C  CG    . GLU A 1 1014 ? 136.968 186.384 130.374 1.00 170.49 ?  886  GLU A CG    1 
ATOM   3771  C  CD    . GLU A 1 1014 ? 136.540 186.880 129.002 1.00 186.79 ?  886  GLU A CD    1 
ATOM   3772  O  OE1   . GLU A 1 1014 ? 135.391 187.354 128.860 1.00 162.33 ?  886  GLU A OE1   1 
ATOM   3773  O  OE2   . GLU A 1 1014 ? 137.357 186.796 128.062 1.00 256.39 -1 886  GLU A OE2   1 
ATOM   3774  N  N     . ALA A 1 1015 ? 134.593 183.427 133.170 1.00 154.00 ?  887  ALA A N     1 
ATOM   3775  C  CA    . ALA A 1 1015 ? 133.469 182.908 133.939 1.00 160.23 ?  887  ALA A CA    1 
ATOM   3776  C  C     . ALA A 1 1015 ? 133.800 182.838 135.425 1.00 164.56 ?  887  ALA A C     1 
ATOM   3777  O  O     . ALA A 1 1015 ? 132.971 183.197 136.271 1.00 177.50 ?  887  ALA A O     1 
ATOM   3778  C  CB    . ALA A 1 1015 ? 133.083 181.529 133.406 1.00 133.04 ?  887  ALA A CB    1 
ATOM   3779  N  N     . VAL A 1 1016 ? 135.003 182.368 135.764 1.00 142.58 ?  888  VAL A N     1 
ATOM   3780  C  CA    . VAL A 1 1016 ? 135.427 182.398 137.163 1.00 130.96 ?  888  VAL A CA    1 
ATOM   3781  C  C     . VAL A 1 1016 ? 135.764 183.816 137.615 1.00 130.40 ?  888  VAL A C     1 
ATOM   3782  O  O     . VAL A 1 1016 ? 135.756 184.100 138.820 1.00 114.92 ?  888  VAL A O     1 
ATOM   3783  C  CB    . VAL A 1 1016 ? 136.624 181.465 137.414 1.00 139.10 ?  888  VAL A CB    1 
ATOM   3784  C  CG1   . VAL A 1 1016 ? 137.896 182.048 136.831 1.00 147.58 ?  888  VAL A CG1   1 
ATOM   3785  C  CG2   . VAL A 1 1016 ? 136.796 181.207 138.905 1.00 159.10 ?  888  VAL A CG2   1 
ATOM   3786  N  N     . CYS A 1 1017 ? 136.052 184.718 136.674 1.00 139.75 ?  889  CYS A N     1 
ATOM   3787  C  CA    . CYS A 1 1017 ? 136.245 186.121 137.016 1.00 134.68 ?  889  CYS A CA    1 
ATOM   3788  C  C     . CYS A 1 1017 ? 134.986 186.740 137.608 1.00 151.70 ?  889  CYS A C     1 
ATOM   3789  O  O     . CYS A 1 1017 ? 135.077 187.684 138.401 1.00 168.87 ?  889  CYS A O     1 
ATOM   3790  C  CB    . CYS A 1 1017 ? 136.681 186.905 135.781 1.00 140.62 ?  889  CYS A CB    1 
ATOM   3791  S  SG    . CYS A 1 1017 ? 138.428 186.729 135.398 1.00 172.55 ?  889  CYS A SG    1 
ATOM   3792  N  N     . GLU A 1 1018 ? 133.809 186.249 137.214 1.00 161.79 ?  890  GLU A N     1 
ATOM   3793  C  CA    . GLU A 1 1018 ? 132.553 186.768 137.753 1.00 174.46 ?  890  GLU A CA    1 
ATOM   3794  C  C     . GLU A 1 1018 ? 132.530 186.732 139.279 1.00 183.93 ?  890  GLU A C     1 
ATOM   3795  O  O     . GLU A 1 1018 ? 132.039 187.667 139.921 1.00 185.18 ?  890  GLU A O     1 
ATOM   3796  C  CB    . GLU A 1 1018 ? 131.371 185.978 137.178 1.00 193.42 ?  890  GLU A CB    1 
ATOM   3797  C  CG    . GLU A 1 1018 ? 130.087 186.042 138.015 1.00 220.51 ?  890  GLU A CG    1 
ATOM   3798  C  CD    . GLU A 1 1018 ? 129.077 184.967 137.630 1.00 224.27 ?  890  GLU A CD    1 
ATOM   3799  O  OE1   . GLU A 1 1018 ? 129.488 183.981 136.986 1.00 199.85 ?  890  GLU A OE1   1 
ATOM   3800  O  OE2   . GLU A 1 1018 ? 127.886 185.086 137.993 1.00 296.24 -1 890  GLU A OE2   1 
ATOM   3801  N  N     . LEU A 1 1019 ? 133.077 185.671 139.882 1.00 174.48 ?  891  LEU A N     1 
ATOM   3802  C  CA    . LEU A 1 1019 ? 132.949 185.472 141.326 1.00 168.55 ?  891  LEU A CA    1 
ATOM   3803  C  C     . LEU A 1 1019 ? 134.088 186.075 142.147 1.00 170.12 ?  891  LEU A C     1 
ATOM   3804  O  O     . LEU A 1 1019 ? 133.866 186.422 143.314 1.00 172.47 ?  891  LEU A O     1 
ATOM   3805  C  CB    . LEU A 1 1019 ? 132.821 183.979 141.663 1.00 134.40 ?  891  LEU A CB    1 
ATOM   3806  C  CG    . LEU A 1 1019 ? 131.411 183.366 141.655 1.00 109.38 ?  891  LEU A CG    1 
ATOM   3807  C  CD1   . LEU A 1 1019 ? 131.422 181.908 142.098 1.00 83.88  ?  891  LEU A CD1   1 
ATOM   3808  C  CD2   . LEU A 1 1019 ? 130.455 184.170 142.526 1.00 106.32 ?  891  LEU A CD2   1 
ATOM   3809  N  N     . VAL A 1 1020 ? 135.294 186.198 141.596 1.00 164.80 ?  892  VAL A N     1 
ATOM   3810  C  CA    . VAL A 1 1020 ? 136.401 186.771 142.382 1.00 164.72 ?  892  VAL A CA    1 
ATOM   3811  C  C     . VAL A 1 1020 ? 136.069 188.219 142.756 1.00 177.15 ?  892  VAL A C     1 
ATOM   3812  O  O     . VAL A 1 1020 ? 135.639 189.002 141.887 1.00 189.37 ?  892  VAL A O     1 
ATOM   3813  C  CB    . VAL A 1 1020 ? 137.737 186.664 141.606 1.00 121.69 ?  892  VAL A CB    1 
ATOM   3814  C  CG1   . VAL A 1 1020 ? 137.581 187.112 140.169 1.00 116.83 ?  892  VAL A CG1   1 
ATOM   3815  C  CG2   . VAL A 1 1020 ? 138.841 187.465 142.286 1.00 109.91 ?  892  VAL A CG2   1 
ATOM   3816  N  N     . PRO A 1 1021 ? 136.207 188.617 144.030 1.00 156.04 ?  893  PRO A N     1 
ATOM   3817  C  CA    . PRO A 1 1021 ? 135.736 189.959 144.435 1.00 147.92 ?  893  PRO A CA    1 
ATOM   3818  C  C     . PRO A 1 1021 ? 136.470 191.111 143.766 1.00 161.46 ?  893  PRO A C     1 
ATOM   3819  O  O     . PRO A 1 1021 ? 135.821 192.017 143.228 1.00 177.00 ?  893  PRO A O     1 
ATOM   3820  C  CB    . PRO A 1 1021 ? 135.942 189.956 145.959 1.00 120.78 ?  893  PRO A CB    1 
ATOM   3821  C  CG    . PRO A 1 1021 ? 136.939 188.885 146.217 1.00 134.03 ?  893  PRO A CG    1 
ATOM   3822  C  CD    . PRO A 1 1021 ? 136.694 187.835 145.178 1.00 151.24 ?  893  PRO A CD    1 
ATOM   3823  N  N     . SER A 1 1022 ? 137.800 191.120 143.802 1.00 156.67 ?  894  SER A N     1 
ATOM   3824  C  CA    . SER A 1 1022 ? 138.557 192.182 143.158 1.00 163.58 ?  894  SER A CA    1 
ATOM   3825  C  C     . SER A 1 1022 ? 138.669 191.931 141.656 1.00 183.11 ?  894  SER A C     1 
ATOM   3826  O  O     . SER A 1 1022 ? 138.462 190.818 141.164 1.00 187.28 ?  894  SER A O     1 
ATOM   3827  C  CB    . SER A 1 1022 ? 139.953 192.303 143.763 1.00 160.55 ?  894  SER A CB    1 
ATOM   3828  O  OG    . SER A 1 1022 ? 140.771 193.157 142.981 1.00 150.21 ?  894  SER A OG    1 
ATOM   3829  N  N     . GLU A 1 1023 ? 139.014 192.991 140.928 1.00 187.68 ?  895  GLU A N     1 
ATOM   3830  C  CA    . GLU A 1 1023 ? 139.089 192.948 139.475 1.00 202.09 ?  895  GLU A CA    1 
ATOM   3831  C  C     . GLU A 1 1023 ? 140.495 193.165 138.935 1.00 183.18 ?  895  GLU A C     1 
ATOM   3832  O  O     . GLU A 1 1023 ? 140.684 193.140 137.713 1.00 190.90 ?  895  GLU A O     1 
ATOM   3833  C  CB    . GLU A 1 1023 ? 138.140 193.984 138.855 1.00 230.08 ?  895  GLU A CB    1 
ATOM   3834  C  CG    . GLU A 1 1023 ? 136.707 193.499 138.646 1.00 265.10 ?  895  GLU A CG    1 
ATOM   3835  C  CD    . GLU A 1 1023 ? 136.098 192.876 139.889 1.00 280.45 ?  895  GLU A CD    1 
ATOM   3836  O  OE1   . GLU A 1 1023 ? 136.159 193.515 140.959 1.00 263.27 ?  895  GLU A OE1   1 
ATOM   3837  O  OE2   . GLU A 1 1023 ? 135.576 191.743 139.801 1.00 370.20 -1 895  GLU A OE2   1 
ATOM   3838  N  N     . GLU A 1 1024 ? 141.483 193.390 139.796 1.00 165.65 ?  896  GLU A N     1 
ATOM   3839  C  CA    . GLU A 1 1024 ? 142.852 193.502 139.311 1.00 173.30 ?  896  GLU A CA    1 
ATOM   3840  C  C     . GLU A 1 1024 ? 143.446 192.121 139.050 1.00 180.26 ?  896  GLU A C     1 
ATOM   3841  O  O     . GLU A 1 1024 ? 143.943 191.837 137.948 1.00 189.27 ?  896  GLU A O     1 
ATOM   3842  C  CB    . GLU A 1 1024 ? 143.701 194.280 140.315 1.00 161.32 ?  896  GLU A CB    1 
ATOM   3843  C  CG    . GLU A 1 1024 ? 144.983 194.791 139.712 1.00 203.25 ?  896  GLU A CG    1 
ATOM   3844  C  CD    . GLU A 1 1024 ? 144.806 195.165 138.252 1.00 237.53 ?  896  GLU A CD    1 
ATOM   3845  O  OE1   . GLU A 1 1024 ? 144.076 196.138 137.963 1.00 221.94 ?  896  GLU A OE1   1 
ATOM   3846  O  OE2   . GLU A 1 1024 ? 145.354 194.452 137.388 1.00 317.74 -1 896  GLU A OE2   1 
ATOM   3847  N  N     . ARG A 1 1025 ? 143.385 191.243 140.053 1.00 165.76 ?  897  ARG A N     1 
ATOM   3848  C  CA    . ARG A 1 1025 ? 143.798 189.860 139.847 1.00 168.12 ?  897  ARG A CA    1 
ATOM   3849  C  C     . ARG A 1 1025 ? 142.954 189.175 138.781 1.00 173.57 ?  897  ARG A C     1 
ATOM   3850  O  O     . ARG A 1 1025 ? 143.408 188.190 138.188 1.00 172.08 ?  897  ARG A O     1 
ATOM   3851  C  CB    . ARG A 1 1025 ? 143.732 189.085 141.164 1.00 188.92 ?  897  ARG A CB    1 
ATOM   3852  C  CG    . ARG A 1 1025 ? 143.957 189.935 142.406 1.00 183.82 ?  897  ARG A CG    1 
ATOM   3853  C  CD    . ARG A 1 1025 ? 145.405 189.860 142.898 1.00 200.88 ?  897  ARG A CD    1 
ATOM   3854  N  NE    . ARG A 1 1025 ? 145.698 188.640 143.646 1.00 221.23 ?  897  ARG A NE    1 
ATOM   3855  C  CZ    . ARG A 1 1025 ? 146.910 188.289 144.069 1.00 190.79 ?  897  ARG A CZ    1 
ATOM   3856  N  NH1   . ARG A 1 1025 ? 147.951 189.077 143.837 1.00 178.13 ?  897  ARG A NH1   1 
ATOM   3857  N  NH2   . ARG A 1 1025 ? 147.085 187.158 144.739 1.00 160.90 ?  897  ARG A NH2   1 
ATOM   3858  N  N     . ARG A 1 1026 ? 141.749 189.690 138.516 1.00 177.45 ?  898  ARG A N     1 
ATOM   3859  C  CA    . ARG A 1 1026 ? 140.962 189.248 137.370 1.00 183.29 ?  898  ARG A CA    1 
ATOM   3860  C  C     . ARG A 1 1026 ? 141.780 189.327 136.085 1.00 190.01 ?  898  ARG A C     1 
ATOM   3861  O  O     . ARG A 1 1026 ? 142.047 188.309 135.431 1.00 186.70 ?  898  ARG A O     1 
ATOM   3862  C  CB    . ARG A 1 1026 ? 139.703 190.110 137.246 1.00 198.88 ?  898  ARG A CB    1 
ATOM   3863  C  CG    . ARG A 1 1026 ? 138.394 189.441 137.629 1.00 209.91 ?  898  ARG A CG    1 
ATOM   3864  C  CD    . ARG A 1 1026 ? 137.210 190.247 137.091 1.00 243.32 ?  898  ARG A CD    1 
ATOM   3865  N  NE    . ARG A 1 1026 ? 135.921 189.813 137.626 1.00 226.73 ?  898  ARG A NE    1 
ATOM   3866  C  CZ    . ARG A 1 1026 ? 134.759 190.398 137.347 1.00 203.98 ?  898  ARG A CZ    1 
ATOM   3867  N  NH1   . ARG A 1 1026 ? 134.715 191.446 136.534 1.00 190.43 ?  898  ARG A NH1   1 
ATOM   3868  N  NH2   . ARG A 1 1026 ? 133.636 189.933 137.880 1.00 175.77 ?  898  ARG A NH2   1 
ATOM   3869  N  N     . GLU A 1 1027 ? 142.194 190.545 135.713 1.00 185.97 ?  899  GLU A N     1 
ATOM   3870  C  CA    . GLU A 1 1027 ? 142.977 190.728 134.494 1.00 177.59 ?  899  GLU A CA    1 
ATOM   3871  C  C     . GLU A 1 1027 ? 144.326 190.031 134.595 1.00 160.28 ?  899  GLU A C     1 
ATOM   3872  O  O     . GLU A 1 1027 ? 144.865 189.566 133.581 1.00 141.50 ?  899  GLU A O     1 
ATOM   3873  C  CB    . GLU A 1 1027 ? 143.148 192.226 134.201 1.00 166.98 ?  899  GLU A CB    1 
ATOM   3874  C  CG    . GLU A 1 1027 ? 143.596 192.546 132.778 1.00 163.61 ?  899  GLU A CG    1 
ATOM   3875  C  CD    . GLU A 1 1027 ? 145.079 192.320 132.552 1.00 173.31 ?  899  GLU A CD    1 
ATOM   3876  O  OE1   . GLU A 1 1027 ? 145.852 192.375 133.527 1.00 164.56 ?  899  GLU A OE1   1 
ATOM   3877  O  OE2   . GLU A 1 1027 ? 145.460 192.037 131.396 1.00 287.54 -1 899  GLU A OE2   1 
ATOM   3878  N  N     . ALA A 1 1028 ? 144.887 189.953 135.805 1.00 164.58 ?  900  ALA A N     1 
ATOM   3879  C  CA    . ALA A 1 1028 ? 146.138 189.224 135.994 1.00 141.53 ?  900  ALA A CA    1 
ATOM   3880  C  C     . ALA A 1 1028 ? 146.015 187.778 135.518 1.00 120.64 ?  900  ALA A C     1 
ATOM   3881  O  O     . ALA A 1 1028 ? 146.743 187.339 134.618 1.00 114.55 ?  900  ALA A O     1 
ATOM   3882  C  CB    . ALA A 1 1028 ? 146.553 189.280 137.464 1.00 139.14 ?  900  ALA A CB    1 
ATOM   3883  N  N     . LEU A 1 1029 ? 145.091 187.020 136.117 1.00 129.55 ?  901  LEU A N     1 
ATOM   3884  C  CA    . LEU A 1 1029 ? 144.900 185.626 135.727 1.00 133.37 ?  901  LEU A CA    1 
ATOM   3885  C  C     . LEU A 1 1029 ? 144.386 185.503 134.296 1.00 138.28 ?  901  LEU A C     1 
ATOM   3886  O  O     . LEU A 1 1029 ? 144.605 184.474 133.645 1.00 135.44 ?  901  LEU A O     1 
ATOM   3887  C  CB    . LEU A 1 1029 ? 143.953 184.915 136.706 1.00 138.98 ?  901  LEU A CB    1 
ATOM   3888  C  CG    . LEU A 1 1029 ? 142.541 185.456 136.982 1.00 151.91 ?  901  LEU A CG    1 
ATOM   3889  C  CD1   . LEU A 1 1029 ? 141.524 184.933 135.987 1.00 148.96 ?  901  LEU A CD1   1 
ATOM   3890  C  CD2   . LEU A 1 1029 ? 142.083 185.155 138.412 1.00 153.75 ?  901  LEU A CD2   1 
ATOM   3891  N  N     . LEU A 1 1030 ? 143.703 186.533 133.787 1.00 139.88 ?  902  LEU A N     1 
ATOM   3892  C  CA    . LEU A 1 1030 ? 143.296 186.518 132.385 1.00 138.91 ?  902  LEU A CA    1 
ATOM   3893  C  C     . LEU A 1 1030 ? 144.510 186.481 131.465 1.00 119.71 ?  902  LEU A C     1 
ATOM   3894  O  O     . LEU A 1 1030 ? 144.618 185.611 130.592 1.00 128.80 ?  902  LEU A O     1 
ATOM   3895  C  CB    . LEU A 1 1030 ? 142.419 187.733 132.076 1.00 146.83 ?  902  LEU A CB    1 
ATOM   3896  C  CG    . LEU A 1 1030 ? 140.991 187.442 131.604 1.00 154.87 ?  902  LEU A CG    1 
ATOM   3897  C  CD1   . LEU A 1 1030 ? 140.240 188.725 131.259 1.00 186.38 ?  902  LEU A CD1   1 
ATOM   3898  C  CD2   . LEU A 1 1030 ? 141.008 186.498 130.412 1.00 148.40 ?  902  LEU A CD2   1 
ATOM   3899  N  N     . LYS A 1 1031 ? 145.432 187.431 131.640 1.00 109.33 ?  903  LYS A N     1 
ATOM   3900  C  CA    . LYS A 1 1031 ? 146.686 187.403 130.889 1.00 96.53  ?  903  LYS A CA    1 
ATOM   3901  C  C     . LYS A 1 1031 ? 147.468 186.121 131.146 1.00 87.85  ?  903  LYS A C     1 
ATOM   3902  O  O     . LYS A 1 1031 ? 148.144 185.608 130.244 1.00 87.58  ?  903  LYS A O     1 
ATOM   3903  C  CB    . LYS A 1 1031 ? 147.534 188.618 131.250 1.00 104.80 ?  903  LYS A CB    1 
ATOM   3904  C  CG    . LYS A 1 1031 ? 148.965 188.542 130.752 1.00 99.77  ?  903  LYS A CG    1 
ATOM   3905  C  CD    . LYS A 1 1031 ? 149.849 189.516 131.506 1.00 117.04 ?  903  LYS A CD    1 
ATOM   3906  C  CE    . LYS A 1 1031 ? 151.321 189.244 131.245 1.00 132.31 ?  903  LYS A CE    1 
ATOM   3907  N  NZ    . LYS A 1 1031 ? 152.187 190.225 131.957 1.00 159.85 ?  903  LYS A NZ    1 
ATOM   3908  N  N     . LEU A 1 1032 ? 147.391 185.598 132.370 1.00 94.09  ?  904  LEU A N     1 
ATOM   3909  C  CA    . LEU A 1 1032 ? 148.047 184.339 132.705 1.00 89.31  ?  904  LEU A CA    1 
ATOM   3910  C  C     . LEU A 1 1032 ? 147.577 183.210 131.795 1.00 79.32  ?  904  LEU A C     1 
ATOM   3911  O  O     . LEU A 1 1032 ? 148.374 182.580 131.092 1.00 78.19  ?  904  LEU A O     1 
ATOM   3912  C  CB    . LEU A 1 1032 ? 147.767 183.988 134.165 1.00 108.76 ?  904  LEU A CB    1 
ATOM   3913  C  CG    . LEU A 1 1032 ? 148.523 182.777 134.708 1.00 101.52 ?  904  LEU A CG    1 
ATOM   3914  C  CD1   . LEU A 1 1032 ? 150.008 183.023 134.579 1.00 122.05 ?  904  LEU A CD1   1 
ATOM   3915  C  CD2   . LEU A 1 1032 ? 148.141 182.471 136.150 1.00 90.82  ?  904  LEU A CD2   1 
ATOM   3916  N  N     . MET A 1 1033 ? 146.274 182.923 131.825 1.00 90.86  ?  905  MET A N     1 
ATOM   3917  C  CA    . MET A 1 1033 ? 145.719 181.860 130.993 1.00 93.46  ?  905  MET A CA    1 
ATOM   3918  C  C     . MET A 1 1033 ? 145.894 182.168 129.510 1.00 115.54 ?  905  MET A C     1 
ATOM   3919  O  O     . MET A 1 1033 ? 146.000 181.247 128.692 1.00 110.38 ?  905  MET A O     1 
ATOM   3920  C  CB    . MET A 1 1033 ? 144.241 181.648 131.347 1.00 105.40 ?  905  MET A CB    1 
ATOM   3921  C  CG    . MET A 1 1033 ? 143.341 181.081 130.248 1.00 117.48 ?  905  MET A CG    1 
ATOM   3922  S  SD    . MET A 1 1033 ? 143.371 179.275 130.140 1.00 95.97  ?  905  MET A SD    1 
ATOM   3923  C  CE    . MET A 1 1033 ? 143.170 178.826 131.864 1.00 87.85  ?  905  MET A CE    1 
ATOM   3924  N  N     . ASP A 1 1034 ? 145.939 183.452 129.143 1.00 135.44 ?  906  ASP A N     1 
ATOM   3925  C  CA    . ASP A 1 1034 ? 146.206 183.826 127.757 1.00 158.95 ?  906  ASP A CA    1 
ATOM   3926  C  C     . ASP A 1 1034 ? 147.581 183.335 127.314 1.00 131.61 ?  906  ASP A C     1 
ATOM   3927  O  O     . ASP A 1 1034 ? 147.722 182.640 126.297 1.00 121.93 ?  906  ASP A O     1 
ATOM   3928  C  CB    . ASP A 1 1034 ? 146.091 185.345 127.600 1.00 163.50 ?  906  ASP A CB    1 
ATOM   3929  C  CG    . ASP A 1 1034 ? 145.843 185.772 126.162 1.00 211.83 ?  906  ASP A CG    1 
ATOM   3930  O  OD1   . ASP A 1 1034 ? 144.881 185.274 125.536 1.00 199.71 ?  906  ASP A OD1   1 
ATOM   3931  O  OD2   . ASP A 1 1034 ? 146.615 186.611 125.655 1.00 309.81 -1 906  ASP A OD2   1 
ATOM   3932  N  N     . LEU A 1 1035 ? 148.616 183.706 128.069 1.00 111.89 ?  907  LEU A N     1 
ATOM   3933  C  CA    . LEU A 1 1035 ? 149.957 183.214 127.777 1.00 95.97  ?  907  LEU A CA    1 
ATOM   3934  C  C     . LEU A 1 1035 ? 150.017 181.690 127.856 1.00 93.37  ?  907  LEU A C     1 
ATOM   3935  O  O     . LEU A 1 1035 ? 150.770 181.054 127.106 1.00 98.49  ?  907  LEU A O     1 
ATOM   3936  C  CB    . LEU A 1 1035 ? 150.956 183.861 128.737 1.00 87.09  ?  907  LEU A CB    1 
ATOM   3937  C  CG    . LEU A 1 1035 ? 151.002 185.393 128.691 1.00 76.61  ?  907  LEU A CG    1 
ATOM   3938  C  CD1   . LEU A 1 1035 ? 152.069 185.942 129.623 1.00 81.88  ?  907  LEU A CD1   1 
ATOM   3939  C  CD2   . LEU A 1 1035 ? 151.245 185.873 127.269 1.00 84.08  ?  907  LEU A CD2   1 
ATOM   3940  N  N     . TYR A 1 1036 ? 149.218 181.093 128.742 1.00 82.18  ?  908  TYR A N     1 
ATOM   3941  C  CA    . TYR A 1 1036 ? 149.147 179.639 128.836 1.00 78.87  ?  908  TYR A CA    1 
ATOM   3942  C  C     . TYR A 1 1036 ? 148.675 179.025 127.524 1.00 75.91  ?  908  TYR A C     1 
ATOM   3943  O  O     . TYR A 1 1036 ? 149.265 178.060 127.030 1.00 79.56  ?  908  TYR A O     1 
ATOM   3944  C  CB    . TYR A 1 1036 ? 148.227 179.234 129.994 1.00 94.32  ?  908  TYR A CB    1 
ATOM   3945  C  CG    . TYR A 1 1036 ? 148.097 177.735 130.189 1.00 124.02 ?  908  TYR A CG    1 
ATOM   3946  C  CD1   . TYR A 1 1036 ? 147.377 176.944 129.294 1.00 133.22 ?  908  TYR A CD1   1 
ATOM   3947  C  CD2   . TYR A 1 1036 ? 148.717 177.107 131.254 1.00 120.17 ?  908  TYR A CD2   1 
ATOM   3948  C  CE1   . TYR A 1 1036 ? 147.274 175.584 129.467 1.00 128.14 ?  908  TYR A CE1   1 
ATOM   3949  C  CE2   . TYR A 1 1036 ? 148.615 175.744 131.437 1.00 120.37 ?  908  TYR A CE2   1 
ATOM   3950  C  CZ    . TYR A 1 1036 ? 147.895 174.988 130.543 1.00 134.40 ?  908  TYR A CZ    1 
ATOM   3951  O  OH    . TYR A 1 1036 ? 147.797 173.630 130.730 1.00 156.11 ?  908  TYR A OH    1 
ATOM   3952  N  N     . LEU A 1 1037 ? 147.549 179.510 127.002 1.00 92.43  ?  909  LEU A N     1 
ATOM   3953  C  CA    . LEU A 1 1037 ? 147.082 179.077 125.686 1.00 102.78 ?  909  LEU A CA    1 
ATOM   3954  C  C     . LEU A 1 1037 ? 148.149 179.289 124.621 1.00 86.96  ?  909  LEU A C     1 
ATOM   3955  O  O     . LEU A 1 1037 ? 148.339 178.438 123.744 1.00 74.79  ?  909  LEU A O     1 
ATOM   3956  C  CB    . LEU A 1 1037 ? 145.798 179.821 125.307 1.00 129.06 ?  909  LEU A CB    1 
ATOM   3957  C  CG    . LEU A 1 1037 ? 144.464 179.062 125.286 1.00 126.88 ?  909  LEU A CG    1 
ATOM   3958  C  CD1   . LEU A 1 1037 ? 143.975 178.752 126.684 1.00 111.19 ?  909  LEU A CD1   1 
ATOM   3959  C  CD2   . LEU A 1 1037 ? 143.406 179.854 124.519 1.00 94.98  ?  909  LEU A CD2   1 
ATOM   3960  N  N     . GLN A 1 1038 ? 148.849 180.425 124.677 1.00 92.94  ?  910  GLN A N     1 
ATOM   3961  C  CA    . GLN A 1 1038 ? 149.865 180.714 123.667 1.00 89.09  ?  910  GLN A CA    1 
ATOM   3962  C  C     . GLN A 1 1038 ? 150.995 179.692 123.697 1.00 83.67  ?  910  GLN A C     1 
ATOM   3963  O  O     . GLN A 1 1038 ? 151.556 179.345 122.651 1.00 74.74  ?  910  GLN A O     1 
ATOM   3964  C  CB    . GLN A 1 1038 ? 150.412 182.124 123.867 1.00 80.13  ?  910  GLN A CB    1 
ATOM   3965  C  CG    . GLN A 1 1038 ? 149.458 183.210 123.437 1.00 81.91  ?  910  GLN A CG    1 
ATOM   3966  C  CD    . GLN A 1 1038 ? 149.097 183.107 121.972 1.00 75.75  ?  910  GLN A CD    1 
ATOM   3967  O  OE1   . GLN A 1 1038 ? 149.929 182.751 121.136 1.00 68.25  ?  910  GLN A OE1   1 
ATOM   3968  N  NE2   . GLN A 1 1038 ? 147.841 183.401 121.654 1.00 79.61  ?  910  GLN A NE2   1 
ATOM   3969  N  N     . MET A 1 1039 ? 151.354 179.211 124.887 1.00 84.12  ?  911  MET A N     1 
ATOM   3970  C  CA    . MET A 1 1039 ? 152.469 178.282 125.020 1.00 67.71  ?  911  MET A CA    1 
ATOM   3971  C  C     . MET A 1 1039 ? 152.049 176.820 125.064 1.00 70.24  ?  911  MET A C     1 
ATOM   3972  O  O     . MET A 1 1039 ? 152.923 175.943 125.058 1.00 67.94  ?  911  MET A O     1 
ATOM   3973  C  CB    . MET A 1 1039 ? 153.270 178.579 126.292 1.00 72.07  ?  911  MET A CB    1 
ATOM   3974  C  CG    . MET A 1 1039 ? 152.538 178.181 127.558 1.00 74.71  ?  911  MET A CG    1 
ATOM   3975  S  SD    . MET A 1 1039 ? 152.733 179.382 128.876 1.00 120.11 ?  911  MET A SD    1 
ATOM   3976  C  CE    . MET A 1 1039 ? 154.477 179.202 129.244 1.00 100.84 ?  911  MET A CE    1 
ATOM   3977  N  N     . LYS A 1 1040 ? 150.746 176.526 125.128 1.00 79.68  ?  912  LYS A N     1 
ATOM   3978  C  CA    . LYS A 1 1040 ? 150.309 175.153 125.351 1.00 101.40 ?  912  LYS A CA    1 
ATOM   3979  C  C     . LYS A 1 1040 ? 150.646 174.235 124.178 1.00 94.96  ?  912  LYS A C     1 
ATOM   3980  O  O     . LYS A 1 1040 ? 151.441 173.302 124.354 1.00 80.99  ?  912  LYS A O     1 
ATOM   3981  C  CB    . LYS A 1 1040 ? 148.804 175.084 125.649 1.00 103.35 ?  912  LYS A CB    1 
ATOM   3982  C  CG    . LYS A 1 1040 ? 148.243 173.661 125.545 1.00 102.82 ?  912  LYS A CG    1 
ATOM   3983  C  CD    . LYS A 1 1040 ? 146.881 173.584 124.874 1.00 91.52  ?  912  LYS A CD    1 
ATOM   3984  C  CE    . LYS A 1 1040 ? 146.568 172.149 124.449 1.00 62.82  ?  912  LYS A CE    1 
ATOM   3985  N  NZ    . LYS A 1 1040 ? 147.343 171.702 123.260 1.00 45.37  ?  912  LYS A NZ    1 
ATOM   3986  N  N     . PRO A 1 1041 ? 150.083 174.443 122.957 1.00 100.50 ?  913  PRO A N     1 
ATOM   3987  C  CA    . PRO A 1 1041 ? 150.242 173.413 121.920 1.00 77.05  ?  913  PRO A CA    1 
ATOM   3988  C  C     . PRO A 1 1041 ? 151.681 173.272 121.447 1.00 59.83  ?  913  PRO A C     1 
ATOM   3989  O  O     . PRO A 1 1041 ? 151.986 172.432 120.596 1.00 72.06  ?  913  PRO A O     1 
ATOM   3990  C  CB    . PRO A 1 1041 ? 149.319 173.908 120.800 1.00 89.15  ?  913  PRO A CB    1 
ATOM   3991  C  CG    . PRO A 1 1041 ? 149.409 175.370 120.910 1.00 109.82 ?  913  PRO A CG    1 
ATOM   3992  C  CD    . PRO A 1 1041 ? 149.430 175.647 122.400 1.00 111.48 ?  913  PRO A CD    1 
ATOM   3993  N  N     . VAL A 1 1042 ? 152.567 174.103 121.997 1.00 58.31  ?  914  VAL A N     1 
ATOM   3994  C  CA    . VAL A 1 1042 ? 153.990 174.002 121.697 1.00 50.50  ?  914  VAL A CA    1 
ATOM   3995  C  C     . VAL A 1 1042 ? 154.510 172.614 122.049 1.00 52.32  ?  914  VAL A C     1 
ATOM   3996  O  O     . VAL A 1 1042 ? 155.404 172.081 121.381 1.00 66.83  ?  914  VAL A O     1 
ATOM   3997  C  CB    . VAL A 1 1042 ? 154.772 175.108 122.435 1.00 68.72  ?  914  VAL A CB    1 
ATOM   3998  C  CG1   . VAL A 1 1042 ? 156.225 175.124 121.985 1.00 99.58  ?  914  VAL A CG1   1 
ATOM   3999  C  CG2   . VAL A 1 1042 ? 154.128 176.469 122.197 1.00 87.79  ?  914  VAL A CG2   1 
ATOM   4000  N  N     . TRP A 1 1043 ? 153.959 172.005 123.101 1.00 57.50  ?  915  TRP A N     1 
ATOM   4001  C  CA    . TRP A 1 1043 ? 154.437 170.710 123.580 1.00 77.51  ?  915  TRP A CA    1 
ATOM   4002  C  C     . TRP A 1 1043 ? 153.668 169.519 123.020 1.00 75.84  ?  915  TRP A C     1 
ATOM   4003  O  O     . TRP A 1 1043 ? 154.237 168.427 122.914 1.00 65.80  ?  915  TRP A O     1 
ATOM   4004  C  CB    . TRP A 1 1043 ? 154.417 170.660 125.118 1.00 79.92  ?  915  TRP A CB    1 
ATOM   4005  C  CG    . TRP A 1 1043 ? 153.083 170.924 125.762 1.00 85.52  ?  915  TRP A CG    1 
ATOM   4006  C  CD1   . TRP A 1 1043 ? 151.926 170.226 125.571 1.00 91.70  ?  915  TRP A CD1   1 
ATOM   4007  C  CD2   . TRP A 1 1043 ? 152.780 171.947 126.721 1.00 90.40  ?  915  TRP A CD2   1 
ATOM   4008  N  NE1   . TRP A 1 1043 ? 150.918 170.761 126.337 1.00 99.50  ?  915  TRP A NE1   1 
ATOM   4009  C  CE2   . TRP A 1 1043 ? 151.417 171.816 127.053 1.00 101.41 ?  915  TRP A CE2   1 
ATOM   4010  C  CE3   . TRP A 1 1043 ? 153.525 172.965 127.323 1.00 87.80  ?  915  TRP A CE3   1 
ATOM   4011  C  CZ2   . TRP A 1 1043 ? 150.786 172.660 127.959 1.00 109.59 ?  915  TRP A CZ2   1 
ATOM   4012  C  CZ3   . TRP A 1 1043 ? 152.896 173.802 128.221 1.00 84.61  ?  915  TRP A CZ3   1 
ATOM   4013  C  CH2   . TRP A 1 1043 ? 151.540 173.645 128.532 1.00 92.87  ?  915  TRP A CH2   1 
ATOM   4014  N  N     . ARG A 1 1044 ? 152.394 169.684 122.675 1.00 79.78  ?  916  ARG A N     1 
ATOM   4015  C  CA    . ARG A 1 1044 ? 151.608 168.601 122.091 1.00 65.68  ?  916  ARG A CA    1 
ATOM   4016  C  C     . ARG A 1 1044 ? 151.814 168.476 120.586 1.00 76.34  ?  916  ARG A C     1 
ATOM   4017  O  O     . ARG A 1 1044 ? 151.150 167.648 119.948 1.00 64.40  ?  916  ARG A O     1 
ATOM   4018  C  CB    . ARG A 1 1044 ? 150.123 168.804 122.408 1.00 57.30  ?  916  ARG A CB    1 
ATOM   4019  C  CG    . ARG A 1 1044 ? 149.366 167.516 122.664 1.00 51.02  ?  916  ARG A CG    1 
ATOM   4020  C  CD    . ARG A 1 1044 ? 147.904 167.781 122.973 1.00 55.96  ?  916  ARG A CD    1 
ATOM   4021  N  NE    . ARG A 1 1044 ? 147.215 166.548 123.343 1.00 80.56  ?  916  ARG A NE    1 
ATOM   4022  C  CZ    . ARG A 1 1044 ? 147.004 166.161 124.597 1.00 80.27  ?  916  ARG A CZ    1 
ATOM   4023  N  NH1   . ARG A 1 1044 ? 147.447 166.909 125.598 1.00 76.72  ?  916  ARG A NH1   1 
ATOM   4024  N  NH2   . ARG A 1 1044 ? 146.364 165.024 124.850 1.00 60.79  ?  916  ARG A NH2   1 
ATOM   4025  N  N     . SER A 1 1045 ? 152.718 169.273 120.015 1.00 91.37  ?  917  SER A N     1 
ATOM   4026  C  CA    . SER A 1 1045 ? 152.914 169.318 118.576 1.00 76.44  ?  917  SER A CA    1 
ATOM   4027  C  C     . SER A 1 1045 ? 153.609 168.053 118.078 1.00 50.06  ?  917  SER A C     1 
ATOM   4028  O  O     . SER A 1 1045 ? 153.993 167.160 118.843 1.00 46.49  ?  917  SER A O     1 
ATOM   4029  C  CB    . SER A 1 1045 ? 153.743 170.545 118.177 1.00 83.98  ?  917  SER A CB    1 
ATOM   4030  O  OG    . SER A 1 1045 ? 153.445 171.669 118.988 1.00 90.40  ?  917  SER A OG    1 
ATOM   4031  N  N     . THR A 1 1046 ? 153.756 167.985 116.761 1.00 53.55  ?  918  THR A N     1 
ATOM   4032  C  CA    . THR A 1 1046 ? 154.541 166.954 116.097 1.00 58.05  ?  918  THR A CA    1 
ATOM   4033  C  C     . THR A 1 1046 ? 155.834 167.494 115.506 1.00 71.73  ?  918  THR A C     1 
ATOM   4034  O  O     . THR A 1 1046 ? 156.865 166.823 115.577 1.00 70.34  ?  918  THR A O     1 
ATOM   4035  C  CB    . THR A 1 1046 ? 153.703 166.280 115.002 1.00 66.42  ?  918  THR A CB    1 
ATOM   4036  O  OG1   . THR A 1 1046 ? 152.630 165.553 115.613 1.00 51.29  ?  918  THR A OG1   1 
ATOM   4037  C  CG2   . THR A 1 1046 ? 154.546 165.305 114.198 1.00 66.06  ?  918  THR A CG2   1 
ATOM   4038  N  N     . CYS A 1 1047 ? 155.810 168.699 114.939 1.00 82.06  ?  919  CYS A N     1 
ATOM   4039  C  CA    . CYS A 1 1047 ? 157.022 169.398 114.530 1.00 97.25  ?  919  CYS A CA    1 
ATOM   4040  C  C     . CYS A 1 1047 ? 156.740 170.894 114.466 1.00 112.25 ?  919  CYS A C     1 
ATOM   4041  O  O     . CYS A 1 1047 ? 156.475 171.432 113.383 1.00 129.75 ?  919  CYS A O     1 
ATOM   4042  C  CB    . CYS A 1 1047 ? 157.526 168.882 113.181 1.00 102.44 ?  919  CYS A CB    1 
ATOM   4043  S  SG    . CYS A 1 1047 ? 159.034 169.673 112.553 1.00 74.14  ?  919  CYS A SG    1 
ATOM   4044  N  N     . PRO A 1 1048 ? 156.781 171.595 115.603 1.00 111.30 ?  920  PRO A N     1 
ATOM   4045  C  CA    . PRO A 1 1048 ? 156.458 173.033 115.599 1.00 126.45 ?  920  PRO A CA    1 
ATOM   4046  C  C     . PRO A 1 1048 ? 157.420 173.886 114.790 1.00 134.84 ?  920  PRO A C     1 
ATOM   4047  O  O     . PRO A 1 1048 ? 157.100 175.054 114.529 1.00 138.45 ?  920  PRO A O     1 
ATOM   4048  C  CB    . PRO A 1 1048 ? 156.488 173.405 117.087 1.00 106.70 ?  920  PRO A CB    1 
ATOM   4049  C  CG    . PRO A 1 1048 ? 157.367 172.381 117.714 1.00 97.58  ?  920  PRO A CG    1 
ATOM   4050  C  CD    . PRO A 1 1048 ? 157.140 171.110 116.946 1.00 95.10  ?  920  PRO A CD    1 
ATOM   4051  N  N     . SER A 1 1049 ? 158.574 173.349 114.383 1.00 128.04 ?  921  SER A N     1 
ATOM   4052  C  CA    . SER A 1 1049 ? 159.468 174.077 113.489 1.00 127.33 ?  921  SER A CA    1 
ATOM   4053  C  C     . SER A 1 1049 ? 158.776 174.472 112.189 1.00 130.03 ?  921  SER A C     1 
ATOM   4054  O  O     . SER A 1 1049 ? 159.180 175.455 111.557 1.00 131.47 ?  921  SER A O     1 
ATOM   4055  C  CB    . SER A 1 1049 ? 160.712 173.234 113.189 1.00 115.28 ?  921  SER A CB    1 
ATOM   4056  O  OG    . SER A 1 1049 ? 161.467 172.981 114.364 1.00 95.61  ?  921  SER A OG    1 
ATOM   4057  N  N     . ARG A 1 1050 ? 157.745 173.726 111.781 1.00 131.22 ?  922  ARG A N     1 
ATOM   4058  C  CA    . ARG A 1 1050 ? 156.896 174.072 110.647 1.00 134.99 ?  922  ARG A CA    1 
ATOM   4059  C  C     . ARG A 1 1050 ? 155.411 174.150 110.991 1.00 140.40 ?  922  ARG A C     1 
ATOM   4060  O  O     . ARG A 1 1050 ? 154.672 174.845 110.290 1.00 153.41 ?  922  ARG A O     1 
ATOM   4061  C  CB    . ARG A 1 1050 ? 157.107 173.074 109.488 1.00 127.79 ?  922  ARG A CB    1 
ATOM   4062  C  CG    . ARG A 1 1050 ? 156.002 172.035 109.295 1.00 131.05 ?  922  ARG A CG    1 
ATOM   4063  C  CD    . ARG A 1 1050 ? 156.249 170.775 110.117 1.00 120.83 ?  922  ARG A CD    1 
ATOM   4064  N  NE    . ARG A 1 1050 ? 155.337 169.691 109.753 1.00 127.68 ?  922  ARG A NE    1 
ATOM   4065  C  CZ    . ARG A 1 1050 ? 154.148 169.495 110.313 1.00 118.39 ?  922  ARG A CZ    1 
ATOM   4066  N  NH1   . ARG A 1 1050 ? 153.722 170.310 111.268 1.00 122.98 ?  922  ARG A NH1   1 
ATOM   4067  N  NH2   . ARG A 1 1050 ? 153.383 168.483 109.923 1.00 107.41 ?  922  ARG A NH2   1 
ATOM   4068  N  N     . ASP A 1 1051 ? 154.954 173.470 112.049 1.00 135.88 ?  923  ASP A N     1 
ATOM   4069  C  CA    . ASP A 1 1051 ? 153.536 173.521 112.414 1.00 138.66 ?  923  ASP A CA    1 
ATOM   4070  C  C     . ASP A 1 1051 ? 153.168 174.868 113.028 1.00 152.38 ?  923  ASP A C     1 
ATOM   4071  O  O     . ASP A 1 1051 ? 152.133 175.453 112.682 1.00 161.95 ?  923  ASP A O     1 
ATOM   4072  C  CB    . ASP A 1 1051 ? 153.195 172.383 113.384 1.00 133.87 ?  923  ASP A CB    1 
ATOM   4073  C  CG    . ASP A 1 1051 ? 151.723 172.379 113.801 1.00 149.07 ?  923  ASP A CG    1 
ATOM   4074  O  OD1   . ASP A 1 1051 ? 151.358 173.133 114.727 1.00 260.43 -1 923  ASP A OD1   1 
ATOM   4075  O  OD2   . ASP A 1 1051 ? 150.927 171.626 113.198 1.00 120.37 ?  923  ASP A OD2   1 
ATOM   4076  N  N     . CYS A 1 1052 ? 153.994 175.369 113.956 1.00 149.82 ?  924  CYS A N     1 
ATOM   4077  C  CA    . CYS A 1 1052 ? 153.760 176.654 114.608 1.00 153.38 ?  924  CYS A CA    1 
ATOM   4078  C  C     . CYS A 1 1052 ? 155.069 177.243 115.126 1.00 152.25 ?  924  CYS A C     1 
ATOM   4079  O  O     . CYS A 1 1052 ? 155.292 177.281 116.343 1.00 144.15 ?  924  CYS A O     1 
ATOM   4080  C  CB    . CYS A 1 1052 ? 152.768 176.511 115.762 1.00 143.92 ?  924  CYS A CB    1 
ATOM   4081  S  SG    . CYS A 1 1052 ? 152.877 174.949 116.666 1.00 184.99 ?  924  CYS A SG    1 
ATOM   4082  N  N     . PRO A 1 1053 ? 155.951 177.725 114.245 1.00 163.49 ?  925  PRO A N     1 
ATOM   4083  C  CA    . PRO A 1 1053 ? 157.231 178.273 114.722 1.00 167.64 ?  925  PRO A CA    1 
ATOM   4084  C  C     . PRO A 1 1053 ? 157.086 179.588 115.468 1.00 169.94 ?  925  PRO A C     1 
ATOM   4085  O  O     . PRO A 1 1053 ? 157.986 179.946 116.240 1.00 170.80 ?  925  PRO A O     1 
ATOM   4086  C  CB    . PRO A 1 1053 ? 158.039 178.438 113.429 1.00 161.80 ?  925  PRO A CB    1 
ATOM   4087  C  CG    . PRO A 1 1053 ? 156.995 178.727 112.402 1.00 158.33 ?  925  PRO A CG    1 
ATOM   4088  C  CD    . PRO A 1 1053 ? 155.806 177.870 112.784 1.00 166.31 ?  925  PRO A CD    1 
ATOM   4089  N  N     . ASP A 1 1054 ? 155.986 180.312 115.255 1.00 166.31 ?  926  ASP A N     1 
ATOM   4090  C  CA    . ASP A 1 1054 ? 155.733 181.542 115.995 1.00 172.91 ?  926  ASP A CA    1 
ATOM   4091  C  C     . ASP A 1 1054 ? 155.656 181.276 117.493 1.00 168.21 ?  926  ASP A C     1 
ATOM   4092  O  O     . ASP A 1 1054 ? 156.241 182.012 118.299 1.00 163.61 ?  926  ASP A O     1 
ATOM   4093  C  CB    . ASP A 1 1054 ? 154.439 182.184 115.494 1.00 193.59 ?  926  ASP A CB    1 
ATOM   4094  C  CG    . ASP A 1 1054 ? 153.328 181.164 115.273 1.00 197.55 ?  926  ASP A CG    1 
ATOM   4095  O  OD1   . ASP A 1 1054 ? 153.615 179.947 115.282 1.00 166.28 ?  926  ASP A OD1   1 
ATOM   4096  O  OD2   . ASP A 1 1054 ? 152.162 181.579 115.098 1.00 341.46 -1 926  ASP A OD2   1 
ATOM   4097  N  N     . GLN A 1 1055 ? 154.917 180.234 117.885 1.00 152.65 ?  927  GLN A N     1 
ATOM   4098  C  CA    . GLN A 1 1055 ? 154.773 179.918 119.300 1.00 140.41 ?  927  GLN A CA    1 
ATOM   4099  C  C     . GLN A 1 1055 ? 156.083 179.415 119.897 1.00 141.73 ?  927  GLN A C     1 
ATOM   4100  O  O     . GLN A 1 1055 ? 156.331 179.611 121.091 1.00 144.87 ?  927  GLN A O     1 
ATOM   4101  C  CB    . GLN A 1 1055 ? 153.658 178.890 119.503 1.00 118.52 ?  927  GLN A CB    1 
ATOM   4102  C  CG    . GLN A 1 1055 ? 152.273 179.365 119.064 1.00 103.60 ?  927  GLN A CG    1 
ATOM   4103  C  CD    . GLN A 1 1055 ? 151.171 178.386 119.441 1.00 73.94  ?  927  GLN A CD    1 
ATOM   4104  O  OE1   . GLN A 1 1055 ? 150.476 177.851 118.577 1.00 72.19  ?  927  GLN A OE1   1 
ATOM   4105  N  NE2   . GLN A 1 1055 ? 151.005 178.157 120.739 1.00 70.42  ?  927  GLN A NE2   1 
ATOM   4106  N  N     . LEU A 1 1056 ? 156.932 178.775 119.089 1.00 135.42 ?  928  LEU A N     1 
ATOM   4107  C  CA    . LEU A 1 1056 ? 158.261 178.391 119.556 1.00 131.28 ?  928  LEU A CA    1 
ATOM   4108  C  C     . LEU A 1 1056 ? 159.136 179.616 119.794 1.00 132.15 ?  928  LEU A C     1 
ATOM   4109  O  O     . LEU A 1 1056 ? 159.845 179.703 120.804 1.00 114.79 ?  928  LEU A O     1 
ATOM   4110  C  CB    . LEU A 1 1056 ? 158.927 177.457 118.541 1.00 111.72 ?  928  LEU A CB    1 
ATOM   4111  C  CG    . LEU A 1 1056 ? 160.460 177.509 118.496 1.00 89.65  ?  928  LEU A CG    1 
ATOM   4112  C  CD1   . LEU A 1 1056 ? 161.088 176.842 119.709 1.00 70.12  ?  928  LEU A CD1   1 
ATOM   4113  C  CD2   . LEU A 1 1056 ? 161.005 176.912 117.202 1.00 78.68  ?  928  LEU A CD2   1 
ATOM   4114  N  N     . CYS A 1 1057 ? 159.112 180.567 118.858 1.00 147.90 ?  929  CYS A N     1 
ATOM   4115  C  CA    . CYS A 1 1057 ? 159.941 181.760 118.988 1.00 143.96 ?  929  CYS A CA    1 
ATOM   4116  C  C     . CYS A 1 1057 ? 159.511 182.614 120.178 1.00 149.89 ?  929  CYS A C     1 
ATOM   4117  O  O     . CYS A 1 1057 ? 160.359 183.072 120.953 1.00 133.79 ?  929  CYS A O     1 
ATOM   4118  C  CB    . CYS A 1 1057 ? 159.890 182.571 117.692 1.00 156.22 ?  929  CYS A CB    1 
ATOM   4119  S  SG    . CYS A 1 1057 ? 161.060 183.949 117.598 1.00 173.98 ?  929  CYS A SG    1 
ATOM   4120  N  N     . GLN A 1 1058 ? 158.203 182.848 120.343 1.00 155.07 ?  930  GLN A N     1 
ATOM   4121  C  CA    . GLN A 1 1058 ? 157.741 183.662 121.467 1.00 141.13 ?  930  GLN A CA    1 
ATOM   4122  C  C     . GLN A 1 1058 ? 157.822 182.933 122.803 1.00 108.80 ?  930  GLN A C     1 
ATOM   4123  O  O     . GLN A 1 1058 ? 157.641 183.579 123.840 1.00 98.51  ?  930  GLN A O     1 
ATOM   4124  C  CB    . GLN A 1 1058 ? 156.296 184.134 121.251 1.00 131.22 ?  930  GLN A CB    1 
ATOM   4125  C  CG    . GLN A 1 1058 ? 155.961 184.622 119.851 1.00 137.16 ?  930  GLN A CG    1 
ATOM   4126  C  CD    . GLN A 1 1058 ? 156.927 185.664 119.335 1.00 143.24 ?  930  GLN A CD    1 
ATOM   4127  O  OE1   . GLN A 1 1058 ? 157.427 186.499 120.092 1.00 138.67 ?  930  GLN A OE1   1 
ATOM   4128  N  NE2   . GLN A 1 1058 ? 157.210 185.611 118.040 1.00 128.20 ?  930  GLN A NE2   1 
ATOM   4129  N  N     . TYR A 1 1059 ? 158.113 181.627 122.793 1.00 111.71 ?  931  TYR A N     1 
ATOM   4130  C  CA    . TYR A 1 1059 ? 157.945 180.792 123.981 1.00 116.67 ?  931  TYR A CA    1 
ATOM   4131  C  C     . TYR A 1 1059 ? 158.852 181.228 125.122 1.00 98.93  ?  931  TYR A C     1 
ATOM   4132  O  O     . TYR A 1 1059 ? 158.460 181.159 126.292 1.00 101.71 ?  931  TYR A O     1 
ATOM   4133  C  CB    . TYR A 1 1059 ? 158.223 179.327 123.637 1.00 145.02 ?  931  TYR A CB    1 
ATOM   4134  C  CG    . TYR A 1 1059 ? 157.813 178.353 124.723 1.00 145.01 ?  931  TYR A CG    1 
ATOM   4135  C  CD1   . TYR A 1 1059 ? 158.699 177.989 125.729 1.00 135.23 ?  931  TYR A CD1   1 
ATOM   4136  C  CD2   . TYR A 1 1059 ? 156.546 177.784 124.734 1.00 129.10 ?  931  TYR A CD2   1 
ATOM   4137  C  CE1   . TYR A 1 1059 ? 158.329 177.096 126.725 1.00 123.39 ?  931  TYR A CE1   1 
ATOM   4138  C  CE2   . TYR A 1 1059 ? 156.171 176.886 125.724 1.00 108.76 ?  931  TYR A CE2   1 
ATOM   4139  C  CZ    . TYR A 1 1059 ? 157.066 176.549 126.716 1.00 117.12 ?  931  TYR A CZ    1 
ATOM   4140  O  OH    . TYR A 1 1059 ? 156.693 175.661 127.698 1.00 112.88 ?  931  TYR A OH    1 
ATOM   4141  N  N     . SER A 1 1060 ? 160.084 181.629 124.810 1.00 87.26  ?  932  SER A N     1 
ATOM   4142  C  CA    . SER A 1 1060 ? 161.027 182.006 125.856 1.00 76.87  ?  932  SER A CA    1 
ATOM   4143  C  C     . SER A 1 1060 ? 160.463 183.137 126.710 1.00 84.38  ?  932  SER A C     1 
ATOM   4144  O  O     . SER A 1 1060 ? 160.226 182.973 127.913 1.00 80.49  ?  932  SER A O     1 
ATOM   4145  C  CB    . SER A 1 1060 ? 162.362 182.405 125.227 1.00 64.76  ?  932  SER A CB    1 
ATOM   4146  O  OG    . SER A 1 1060 ? 162.736 181.486 124.213 1.00 67.18  ?  932  SER A OG    1 
ATOM   4147  N  N     . TYR A 1 1061 ? 160.219 184.293 126.089 1.00 109.91 ?  933  TYR A N     1 
ATOM   4148  C  CA    . TYR A 1 1061 ? 159.673 185.436 126.812 1.00 124.13 ?  933  TYR A CA    1 
ATOM   4149  C  C     . TYR A 1 1061 ? 158.259 185.156 127.317 1.00 113.20 ?  933  TYR A C     1 
ATOM   4150  O  O     . TYR A 1 1061 ? 157.843 185.719 128.338 1.00 104.37 ?  933  TYR A O     1 
ATOM   4151  C  CB    . TYR A 1 1061 ? 159.716 186.676 125.910 1.00 133.74 ?  933  TYR A CB    1 
ATOM   4152  C  CG    . TYR A 1 1061 ? 158.541 187.610 126.057 1.00 135.57 ?  933  TYR A CG    1 
ATOM   4153  C  CD1   . TYR A 1 1061 ? 158.477 188.516 127.106 1.00 132.51 ?  933  TYR A CD1   1 
ATOM   4154  C  CD2   . TYR A 1 1061 ? 157.496 187.587 125.145 1.00 132.40 ?  933  TYR A CD2   1 
ATOM   4155  C  CE1   . TYR A 1 1061 ? 157.403 189.370 127.242 1.00 146.92 ?  933  TYR A CE1   1 
ATOM   4156  C  CE2   . TYR A 1 1061 ? 156.416 188.437 125.277 1.00 143.91 ?  933  TYR A CE2   1 
ATOM   4157  C  CZ    . TYR A 1 1061 ? 156.374 189.326 126.326 1.00 156.90 ?  933  TYR A CZ    1 
ATOM   4158  O  OH    . TYR A 1 1061 ? 155.302 190.177 126.464 1.00 169.36 ?  933  TYR A OH    1 
ATOM   4159  N  N     . ASN A 1 1062 ? 157.526 184.268 126.639 1.00 105.78 ?  934  ASN A N     1 
ATOM   4160  C  CA    . ASN A 1 1062 ? 156.203 183.854 127.095 1.00 99.18  ?  934  ASN A CA    1 
ATOM   4161  C  C     . ASN A 1 1062 ? 156.278 183.217 128.480 1.00 96.04  ?  934  ASN A C     1 
ATOM   4162  O  O     . ASN A 1 1062 ? 155.670 183.700 129.443 1.00 102.38 ?  934  ASN A O     1 
ATOM   4163  C  CB    . ASN A 1 1062 ? 155.610 182.880 126.070 1.00 78.68  ?  934  ASN A CB    1 
ATOM   4164  C  CG    . ASN A 1 1062 ? 154.097 182.862 126.077 1.00 84.44  ?  934  ASN A CG    1 
ATOM   4165  O  OD1   . ASN A 1 1062 ? 153.463 183.354 127.008 1.00 95.34  ?  934  ASN A OD1   1 
ATOM   4166  N  ND2   . ASN A 1 1062 ? 153.508 182.280 125.037 1.00 71.21  ?  934  ASN A ND2   1 
ATOM   4167  N  N     . SER A 1 1063 ? 157.031 182.123 128.591 1.00 87.34  ?  935  SER A N     1 
ATOM   4168  C  CA    . SER A 1 1063 ? 157.217 181.458 129.874 1.00 75.91  ?  935  SER A CA    1 
ATOM   4169  C  C     . SER A 1 1063 ? 157.904 182.363 130.883 1.00 76.78  ?  935  SER A C     1 
ATOM   4170  O  O     . SER A 1 1063 ? 157.703 182.207 132.092 1.00 69.84  ?  935  SER A O     1 
ATOM   4171  C  CB    . SER A 1 1063 ? 158.027 180.178 129.684 1.00 90.48  ?  935  SER A CB    1 
ATOM   4172  O  OG    . SER A 1 1063 ? 159.024 180.358 128.691 1.00 106.10 ?  935  SER A OG    1 
ATOM   4173  N  N     . GLN A 1 1064 ? 158.727 183.303 130.413 1.00 89.94  ?  936  GLN A N     1 
ATOM   4174  C  CA    . GLN A 1 1064 ? 159.361 184.243 131.332 1.00 96.98  ?  936  GLN A CA    1 
ATOM   4175  C  C     . GLN A 1 1064 ? 158.319 185.114 132.021 1.00 99.70  ?  936  GLN A C     1 
ATOM   4176  O  O     . GLN A 1 1064 ? 158.302 185.225 133.254 1.00 96.38  ?  936  GLN A O     1 
ATOM   4177  C  CB    . GLN A 1 1064 ? 160.376 185.108 130.585 1.00 94.16  ?  936  GLN A CB    1 
ATOM   4178  C  CG    . GLN A 1 1064 ? 160.980 186.214 131.433 1.00 93.75  ?  936  GLN A CG    1 
ATOM   4179  C  CD    . GLN A 1 1064 ? 161.483 185.714 132.775 1.00 82.32  ?  936  GLN A CD    1 
ATOM   4180  O  OE1   . GLN A 1 1064 ? 162.284 184.782 132.838 1.00 73.57  ?  936  GLN A OE1   1 
ATOM   4181  N  NE2   . GLN A 1 1064 ? 161.003 186.320 133.853 1.00 94.11  ?  936  GLN A NE2   1 
ATOM   4182  N  N     . GLN A 1 1065 ? 157.459 185.766 131.234 1.00 105.36 ?  937  GLN A N     1 
ATOM   4183  C  CA    . GLN A 1 1065 ? 156.349 186.515 131.819 1.00 105.36 ?  937  GLN A CA    1 
ATOM   4184  C  C     . GLN A 1 1065 ? 155.471 185.616 132.681 1.00 108.56 ?  937  GLN A C     1 
ATOM   4185  O  O     . GLN A 1 1065 ? 154.923 186.061 133.698 1.00 105.23 ?  937  GLN A O     1 
ATOM   4186  C  CB    . GLN A 1 1065 ? 155.506 187.176 130.731 1.00 98.06  ?  937  GLN A CB    1 
ATOM   4187  C  CG    . GLN A 1 1065 ? 155.751 188.660 130.558 1.00 97.55  ?  937  GLN A CG    1 
ATOM   4188  C  CD    . GLN A 1 1065 ? 154.999 189.224 129.374 1.00 125.75 ?  937  GLN A CD    1 
ATOM   4189  O  OE1   . GLN A 1 1065 ? 154.897 190.440 129.207 1.00 148.07 ?  937  GLN A OE1   1 
ATOM   4190  N  NE2   . GLN A 1 1065 ? 154.450 188.339 128.549 1.00 117.67 ?  937  GLN A NE2   1 
ATOM   4191  N  N     . PHE A 1 1066 ? 155.307 184.353 132.276 1.00 110.13 ?  938  PHE A N     1 
ATOM   4192  C  CA    . PHE A 1 1066 ? 154.497 183.422 133.055 1.00 106.42 ?  938  PHE A CA    1 
ATOM   4193  C  C     . PHE A 1 1066 ? 155.069 183.238 134.453 1.00 89.23  ?  938  PHE A C     1 
ATOM   4194  O  O     . PHE A 1 1066 ? 154.352 183.353 135.455 1.00 90.77  ?  938  PHE A O     1 
ATOM   4195  C  CB    . PHE A 1 1066 ? 154.393 182.077 132.330 1.00 86.24  ?  938  PHE A CB    1 
ATOM   4196  C  CG    . PHE A 1 1066 ? 153.150 181.300 132.668 1.00 96.66  ?  938  PHE A CG    1 
ATOM   4197  C  CD1   . PHE A 1 1066 ? 152.940 180.815 133.950 1.00 88.32  ?  938  PHE A CD1   1 
ATOM   4198  C  CD2   . PHE A 1 1066 ? 152.165 181.101 131.718 1.00 109.16 ?  938  PHE A CD2   1 
ATOM   4199  C  CE1   . PHE A 1 1066 ? 151.791 180.108 134.260 1.00 86.15  ?  938  PHE A CE1   1 
ATOM   4200  C  CE2   . PHE A 1 1066 ? 151.012 180.402 132.027 1.00 100.14 ?  938  PHE A CE2   1 
ATOM   4201  C  CZ    . PHE A 1 1066 ? 150.828 179.907 133.299 1.00 87.95  ?  938  PHE A CZ    1 
ATOM   4202  N  N     . ALA A 1 1067 ? 156.364 182.950 134.533 1.00 70.45  ?  939  ALA A N     1 
ATOM   4203  C  CA    . ALA A 1 1067 ? 157.017 182.818 135.826 1.00 79.34  ?  939  ALA A CA    1 
ATOM   4204  C  C     . ALA A 1 1067 ? 156.955 184.122 136.612 1.00 85.17  ?  939  ALA A C     1 
ATOM   4205  O  O     . ALA A 1 1067 ? 156.725 184.110 137.827 1.00 87.88  ?  939  ALA A O     1 
ATOM   4206  C  CB    . ALA A 1 1067 ? 158.465 182.378 135.633 1.00 85.22  ?  939  ALA A CB    1 
ATOM   4207  N  N     . ASP A 1 1068 ? 157.171 185.256 135.936 1.00 96.43  ?  940  ASP A N     1 
ATOM   4208  C  CA    . ASP A 1 1068 ? 157.139 186.550 136.617 1.00 115.47 ?  940  ASP A CA    1 
ATOM   4209  C  C     . ASP A 1 1068 ? 155.790 186.798 137.278 1.00 98.57  ?  940  ASP A C     1 
ATOM   4210  O  O     . ASP A 1 1068 ? 155.725 187.252 138.427 1.00 97.26  ?  940  ASP A O     1 
ATOM   4211  C  CB    . ASP A 1 1068 ? 157.464 187.678 135.634 1.00 143.74 ?  940  ASP A CB    1 
ATOM   4212  C  CG    . ASP A 1 1068 ? 157.817 188.993 136.334 1.00 185.47 ?  940  ASP A CG    1 
ATOM   4213  O  OD1   . ASP A 1 1068 ? 157.916 189.015 137.580 1.00 166.93 ?  940  ASP A OD1   1 
ATOM   4214  O  OD2   . ASP A 1 1068 ? 157.986 190.014 135.632 1.00 320.00 -1 940  ASP A OD2   1 
ATOM   4215  N  N     . LEU A 1 1069 ? 154.703 186.512 136.563 1.00 105.15 ?  941  LEU A N     1 
ATOM   4216  C  CA    . LEU A 1 1069 ? 153.377 186.707 137.134 1.00 128.19 ?  941  LEU A CA    1 
ATOM   4217  C  C     . LEU A 1 1069 ? 153.108 185.698 138.242 1.00 111.82 ?  941  LEU A C     1 
ATOM   4218  O  O     . LEU A 1 1069 ? 152.571 186.057 139.299 1.00 117.13 ?  941  LEU A O     1 
ATOM   4219  C  CB    . LEU A 1 1069 ? 152.314 186.609 136.039 1.00 187.17 ?  941  LEU A CB    1 
ATOM   4220  C  CG    . LEU A 1 1069 ? 150.846 186.664 136.472 1.00 204.82 ?  941  LEU A CG    1 
ATOM   4221  C  CD1   . LEU A 1 1069 ? 150.577 187.888 137.335 1.00 189.34 ?  941  LEU A CD1   1 
ATOM   4222  C  CD2   . LEU A 1 1069 ? 149.913 186.647 135.264 1.00 192.95 ?  941  LEU A CD2   1 
ATOM   4223  N  N     . LEU A 1 1070 ? 153.479 184.434 138.023 1.00 98.11  ?  942  LEU A N     1 
ATOM   4224  C  CA    . LEU A 1 1070 ? 153.272 183.418 139.047 1.00 95.84  ?  942  LEU A CA    1 
ATOM   4225  C  C     . LEU A 1 1070 ? 153.996 183.774 140.334 1.00 83.77  ?  942  LEU A C     1 
ATOM   4226  O  O     . LEU A 1 1070 ? 153.537 183.424 141.427 1.00 83.60  ?  942  LEU A O     1 
ATOM   4227  C  CB    . LEU A 1 1070 ? 153.742 182.059 138.535 1.00 100.02 ?  942  LEU A CB    1 
ATOM   4228  C  CG    . LEU A 1 1070 ? 152.703 181.263 137.746 1.00 103.51 ?  942  LEU A CG    1 
ATOM   4229  C  CD1   . LEU A 1 1070 ? 153.234 179.873 137.431 1.00 94.30  ?  942  LEU A CD1   1 
ATOM   4230  C  CD2   . LEU A 1 1070 ? 151.370 181.199 138.486 1.00 111.94 ?  942  LEU A CD2   1 
ATOM   4231  N  N     . SER A 1 1071 ? 155.125 184.468 140.223 1.00 93.61  ?  943  SER A N     1 
ATOM   4232  C  CA    . SER A 1 1071 ? 155.854 184.913 141.403 1.00 118.51 ?  943  SER A CA    1 
ATOM   4233  C  C     . SER A 1 1071 ? 155.216 186.152 142.024 1.00 130.11 ?  943  SER A C     1 
ATOM   4234  O  O     . SER A 1 1071 ? 154.965 186.189 143.232 1.00 132.12 ?  943  SER A O     1 
ATOM   4235  C  CB    . SER A 1 1071 ? 157.314 185.187 141.037 1.00 124.64 ?  943  SER A CB    1 
ATOM   4236  O  OG    . SER A 1 1071 ? 157.410 185.733 139.733 1.00 108.19 ?  943  SER A OG    1 
ATOM   4237  N  N     . SER A 1 1072 ? 154.933 187.176 141.214 1.00 114.25 ?  944  SER A N     1 
ATOM   4238  C  CA    . SER A 1 1072 ? 154.498 188.454 141.773 1.00 101.07 ?  944  SER A CA    1 
ATOM   4239  C  C     . SER A 1 1072 ? 153.105 188.355 142.380 1.00 103.08 ?  944  SER A C     1 
ATOM   4240  O  O     . SER A 1 1072 ? 152.828 188.971 143.418 1.00 87.46  ?  944  SER A O     1 
ATOM   4241  C  CB    . SER A 1 1072 ? 154.533 189.533 140.692 1.00 86.82  ?  944  SER A CB    1 
ATOM   4242  O  OG    . SER A 1 1072 ? 153.547 190.525 140.921 1.00 99.24  ?  944  SER A OG    1 
ATOM   4243  N  N     . MET A 1 1073 ? 152.216 187.589 141.755 1.00 115.30 ?  945  MET A N     1 
ATOM   4244  C  CA    . MET A 1 1073 ? 150.814 187.569 142.145 1.00 115.92 ?  945  MET A CA    1 
ATOM   4245  C  C     . MET A 1 1073 ? 150.435 186.349 142.979 1.00 108.60 ?  945  MET A C     1 
ATOM   4246  O  O     . MET A 1 1073 ? 149.518 186.429 143.794 1.00 109.95 ?  945  MET A O     1 
ATOM   4247  C  CB    . MET A 1 1073 ? 149.936 187.631 140.889 1.00 120.31 ?  945  MET A CB    1 
ATOM   4248  C  CG    . MET A 1 1073 ? 148.734 188.548 141.008 1.00 147.84 ?  945  MET A CG    1 
ATOM   4249  S  SD    . MET A 1 1073 ? 149.247 190.275 140.892 1.00 173.18 ?  945  MET A SD    1 
ATOM   4250  C  CE    . MET A 1 1073 ? 147.726 191.068 140.376 1.00 168.92 ?  945  MET A CE    1 
ATOM   4251  N  N     . PHE A 1 1074 ? 151.128 185.220 142.795 1.00 103.91 ?  946  PHE A N     1 
ATOM   4252  C  CA    . PHE A 1 1074 ? 150.721 183.949 143.381 1.00 96.65  ?  946  PHE A CA    1 
ATOM   4253  C  C     . PHE A 1 1074 ? 151.735 183.360 144.355 1.00 96.18  ?  946  PHE A C     1 
ATOM   4254  O  O     . PHE A 1 1074 ? 151.597 182.191 144.733 1.00 102.52 ?  946  PHE A O     1 
ATOM   4255  C  CB    . PHE A 1 1074 ? 150.422 182.928 142.279 1.00 95.73  ?  946  PHE A CB    1 
ATOM   4256  C  CG    . PHE A 1 1074 ? 149.564 183.461 141.170 1.00 98.72  ?  946  PHE A CG    1 
ATOM   4257  C  CD1   . PHE A 1 1074 ? 150.124 184.170 140.124 1.00 100.49 ?  946  PHE A CD1   1 
ATOM   4258  C  CD2   . PHE A 1 1074 ? 148.198 183.243 141.168 1.00 121.85 ?  946  PHE A CD2   1 
ATOM   4259  C  CE1   . PHE A 1 1074 ? 149.345 184.657 139.102 1.00 113.83 ?  946  PHE A CE1   1 
ATOM   4260  C  CE2   . PHE A 1 1074 ? 147.412 183.728 140.142 1.00 149.79 ?  946  PHE A CE2   1 
ATOM   4261  C  CZ    . PHE A 1 1074 ? 147.989 184.437 139.109 1.00 156.71 ?  946  PHE A CZ    1 
ATOM   4262  N  N     . LYS A 1 1075 ? 152.739 184.125 144.786 1.00 102.05 ?  947  LYS A N     1 
ATOM   4263  C  CA    . LYS A 1 1075 ? 153.798 183.552 145.617 1.00 107.15 ?  947  LYS A CA    1 
ATOM   4264  C  C     . LYS A 1 1075 ? 153.292 183.138 146.998 1.00 110.48 ?  947  LYS A C     1 
ATOM   4265  O  O     . LYS A 1 1075 ? 154.062 182.623 147.816 1.00 122.62 ?  947  LYS A O     1 
ATOM   4266  C  CB    . LYS A 1 1075 ? 154.960 184.534 145.768 1.00 120.83 ?  947  LYS A CB    1 
ATOM   4267  C  CG    . LYS A 1 1075 ? 156.304 183.863 146.048 1.00 123.86 ?  947  LYS A CG    1 
ATOM   4268  C  CD    . LYS A 1 1075 ? 157.082 184.588 147.140 1.00 130.68 ?  947  LYS A CD    1 
ATOM   4269  C  CE    . LYS A 1 1075 ? 158.364 183.844 147.483 1.00 120.51 ?  947  LYS A CE    1 
ATOM   4270  N  NZ    . LYS A 1 1075 ? 159.190 184.577 148.480 1.00 111.59 ?  947  LYS A NZ    1 
ATOM   4271  N  N     . TYR A 1 1076 ? 152.001 183.356 147.274 1.00 105.12 ?  948  TYR A N     1 
ATOM   4272  C  CA    . TYR A 1 1076 ? 151.395 182.808 148.481 1.00 105.98 ?  948  TYR A CA    1 
ATOM   4273  C  C     . TYR A 1 1076 ? 151.492 181.289 148.536 1.00 113.96 ?  948  TYR A C     1 
ATOM   4274  O  O     . TYR A 1 1076 ? 151.348 180.706 149.618 1.00 113.82 ?  948  TYR A O     1 
ATOM   4275  C  CB    . TYR A 1 1076 ? 149.923 183.231 148.585 1.00 123.04 ?  948  TYR A CB    1 
ATOM   4276  C  CG    . TYR A 1 1076 ? 149.095 182.899 147.356 1.00 128.45 ?  948  TYR A CG    1 
ATOM   4277  C  CD1   . TYR A 1 1076 ? 148.609 181.616 147.149 1.00 125.68 ?  948  TYR A CD1   1 
ATOM   4278  C  CD2   . TYR A 1 1076 ? 148.757 183.878 146.428 1.00 129.21 ?  948  TYR A CD2   1 
ATOM   4279  C  CE1   . TYR A 1 1076 ? 147.847 181.305 146.037 1.00 115.17 ?  948  TYR A CE1   1 
ATOM   4280  C  CE2   . TYR A 1 1076 ? 147.981 183.575 145.312 1.00 121.19 ?  948  TYR A CE2   1 
ATOM   4281  C  CZ    . TYR A 1 1076 ? 147.533 182.284 145.123 1.00 107.28 ?  948  TYR A CZ    1 
ATOM   4282  O  OH    . TYR A 1 1076 ? 146.767 181.960 144.024 1.00 99.24  ?  948  TYR A OH    1 
ATOM   4283  N  N     . ARG A 1 1077 ? 151.724 180.635 147.398 1.00 116.01 ?  949  ARG A N     1 
ATOM   4284  C  CA    . ARG A 1 1077 ? 151.739 179.180 147.298 1.00 111.54 ?  949  ARG A CA    1 
ATOM   4285  C  C     . ARG A 1 1077 ? 153.060 178.613 146.794 1.00 103.24 ?  949  ARG A C     1 
ATOM   4286  O  O     . ARG A 1 1077 ? 153.492 177.565 147.280 1.00 106.03 ?  949  ARG A O     1 
ATOM   4287  C  CB    . ARG A 1 1077 ? 150.604 178.712 146.376 1.00 112.76 ?  949  ARG A CB    1 
ATOM   4288  C  CG    . ARG A 1 1077 ? 150.582 177.217 146.128 1.00 103.00 ?  949  ARG A CG    1 
ATOM   4289  C  CD    . ARG A 1 1077 ? 149.398 176.819 145.267 1.00 111.15 ?  949  ARG A CD    1 
ATOM   4290  N  NE    . ARG A 1 1077 ? 148.275 176.349 146.069 1.00 107.75 ?  949  ARG A NE    1 
ATOM   4291  C  CZ    . ARG A 1 1077 ? 147.300 177.135 146.509 1.00 109.40 ?  949  ARG A CZ    1 
ATOM   4292  N  NH1   . ARG A 1 1077 ? 147.304 178.426 146.207 1.00 111.97 ?  949  ARG A NH1   1 
ATOM   4293  N  NH2   . ARG A 1 1077 ? 146.313 176.629 147.237 1.00 125.82 ?  949  ARG A NH2   1 
ATOM   4294  N  N     . TYR A 1 1078 ? 153.722 179.273 145.835 1.00 106.37 ?  950  TYR A N     1 
ATOM   4295  C  CA    . TYR A 1 1078 ? 154.926 178.744 145.196 1.00 100.52 ?  950  TYR A CA    1 
ATOM   4296  C  C     . TYR A 1 1078 ? 156.203 179.173 145.903 1.00 111.23 ?  950  TYR A C     1 
ATOM   4297  O  O     . TYR A 1 1078 ? 157.267 179.239 145.269 1.00 101.67 ?  950  TYR A O     1 
ATOM   4298  C  CB    . TYR A 1 1078 ? 154.996 179.158 143.722 1.00 92.64  ?  950  TYR A CB    1 
ATOM   4299  C  CG    . TYR A 1 1078 ? 153.790 178.807 142.877 1.00 112.33 ?  950  TYR A CG    1 
ATOM   4300  C  CD1   . TYR A 1 1078 ? 152.739 178.062 143.392 1.00 121.84 ?  950  TYR A CD1   1 
ATOM   4301  C  CD2   . TYR A 1 1078 ? 153.703 179.231 141.560 1.00 119.14 ?  950  TYR A CD2   1 
ATOM   4302  C  CE1   . TYR A 1 1078 ? 151.643 177.754 142.626 1.00 149.53 ?  950  TYR A CE1   1 
ATOM   4303  C  CE2   . TYR A 1 1078 ? 152.607 178.922 140.780 1.00 126.79 ?  950  TYR A CE2   1 
ATOM   4304  C  CZ    . TYR A 1 1078 ? 151.579 178.183 141.320 1.00 146.96 ?  950  TYR A CZ    1 
ATOM   4305  O  OH    . TYR A 1 1078 ? 150.481 177.868 140.553 1.00 164.44 ?  950  TYR A OH    1 
ATOM   4306  N  N     . ASP A 1 1079 ? 156.124 179.486 147.197 1.00 141.73 ?  951  ASP A N     1 
ATOM   4307  C  CA    . ASP A 1 1079 ? 157.312 179.848 147.964 1.00 167.74 ?  951  ASP A CA    1 
ATOM   4308  C  C     . ASP A 1 1079 ? 158.344 178.725 147.948 1.00 164.18 ?  951  ASP A C     1 
ATOM   4309  O  O     . ASP A 1 1079 ? 159.504 178.933 147.577 1.00 145.30 ?  951  ASP A O     1 
ATOM   4310  C  CB    . ASP A 1 1079 ? 156.913 180.216 149.396 1.00 201.11 ?  951  ASP A CB    1 
ATOM   4311  C  CG    . ASP A 1 1079 ? 155.868 179.272 149.980 1.00 222.70 ?  951  ASP A CG    1 
ATOM   4312  O  OD1   . ASP A 1 1079 ? 154.913 178.911 149.261 1.00 176.48 ?  951  ASP A OD1   1 
ATOM   4313  O  OD2   . ASP A 1 1079 ? 156.010 178.877 151.158 1.00 391.82 -1 951  ASP A OD2   1 
ATOM   4314  N  N     . GLY A 1 1080 ? 157.940 177.522 148.348 1.00 146.08 ?  952  GLY A N     1 
ATOM   4315  C  CA    . GLY A 1 1080 ? 158.864 176.408 148.390 1.00 104.47 ?  952  GLY A CA    1 
ATOM   4316  C  C     . GLY A 1 1080 ? 158.391 175.178 147.644 1.00 77.24  ?  952  GLY A C     1 
ATOM   4317  O  O     . GLY A 1 1080 ? 159.210 174.348 147.245 1.00 78.74  ?  952  GLY A O     1 
ATOM   4318  N  N     . LYS A 1 1081 ? 157.084 175.054 147.428 1.00 83.18  ?  953  LYS A N     1 
ATOM   4319  C  CA    . LYS A 1 1081 ? 156.503 173.862 146.830 1.00 80.60  ?  953  LYS A CA    1 
ATOM   4320  C  C     . LYS A 1 1081 ? 156.162 174.100 145.362 1.00 69.48  ?  953  LYS A C     1 
ATOM   4321  O  O     . LYS A 1 1081 ? 155.590 175.131 145.003 1.00 84.93  ?  953  LYS A O     1 
ATOM   4322  C  CB    . LYS A 1 1081 ? 155.251 173.422 147.600 1.00 81.38  ?  953  LYS A CB    1 
ATOM   4323  C  CG    . LYS A 1 1081 ? 154.181 174.505 147.754 1.00 94.99  ?  953  LYS A CG    1 
ATOM   4324  C  CD    . LYS A 1 1081 ? 152.970 174.013 148.545 1.00 101.81 ?  953  LYS A CD    1 
ATOM   4325  C  CE    . LYS A 1 1081 ? 151.972 175.143 148.788 1.00 90.26  ?  953  LYS A CE    1 
ATOM   4326  N  NZ    . LYS A 1 1081 ? 150.781 174.710 149.573 1.00 79.99  ?  953  LYS A NZ    1 
ATOM   4327  N  N     . ILE A 1 1082 ? 156.521 173.131 144.522 1.00 68.50  ?  954  ILE A N     1 
ATOM   4328  C  CA    . ILE A 1 1082 ? 156.194 173.130 143.097 1.00 71.38  ?  954  ILE A CA    1 
ATOM   4329  C  C     . ILE A 1 1082 ? 155.880 171.695 142.688 1.00 95.10  ?  954  ILE A C     1 
ATOM   4330  O  O     . ILE A 1 1082 ? 156.519 170.754 143.161 1.00 101.55 ?  954  ILE A O     1 
ATOM   4331  C  CB    . ILE A 1 1082 ? 157.343 173.721 142.241 1.00 48.35  ?  954  ILE A CB    1 
ATOM   4332  C  CG1   . ILE A 1 1082 ? 157.598 175.187 142.583 1.00 48.80  ?  954  ILE A CG1   1 
ATOM   4333  C  CG2   . ILE A 1 1082 ? 157.067 173.584 140.760 1.00 50.60  ?  954  ILE A CG2   1 
ATOM   4334  C  CD1   . ILE A 1 1082 ? 158.449 175.885 141.552 1.00 57.34  ?  954  ILE A CD1   1 
ATOM   4335  N  N     . THR A 1 1083 ? 154.875 171.524 141.825 1.00 96.15  ?  955  THR A N     1 
ATOM   4336  C  CA    . THR A 1 1083 ? 154.644 170.234 141.179 1.00 100.42 ?  955  THR A CA    1 
ATOM   4337  C  C     . THR A 1 1083 ? 155.661 170.041 140.061 1.00 79.37  ?  955  THR A C     1 
ATOM   4338  O  O     . THR A 1 1083 ? 155.955 170.970 139.306 1.00 66.14  ?  955  THR A O     1 
ATOM   4339  C  CB    . THR A 1 1083 ? 153.217 170.134 140.621 1.00 96.14  ?  955  THR A CB    1 
ATOM   4340  O  OG1   . THR A 1 1083 ? 152.303 169.822 141.680 1.00 99.75  ?  955  THR A OG1   1 
ATOM   4341  C  CG2   . THR A 1 1083 ? 153.110 169.053 139.538 1.00 62.34  ?  955  THR A CG2   1 
ATOM   4342  N  N     . ASN A 1 1084 ? 156.211 168.825 139.981 1.00 76.11  ?  956  ASN A N     1 
ATOM   4343  C  CA    . ASN A 1 1084 ? 157.224 168.505 138.978 1.00 76.24  ?  956  ASN A CA    1 
ATOM   4344  C  C     . ASN A 1 1084 ? 156.809 168.968 137.587 1.00 54.76  ?  956  ASN A C     1 
ATOM   4345  O  O     . ASN A 1 1084 ? 157.585 169.626 136.881 1.00 53.58  ?  956  ASN A O     1 
ATOM   4346  C  CB    . ASN A 1 1084 ? 157.491 166.999 138.985 1.00 95.52  ?  956  ASN A CB    1 
ATOM   4347  C  CG    . ASN A 1 1084 ? 158.918 166.660 139.355 1.00 98.95  ?  956  ASN A CG    1 
ATOM   4348  O  OD1   . ASN A 1 1084 ? 159.846 167.390 139.002 1.00 90.62  ?  956  ASN A OD1   1 
ATOM   4349  N  ND2   . ASN A 1 1084 ? 159.106 165.550 140.064 1.00 78.01  ?  956  ASN A ND2   1 
ATOM   4350  N  N     . TYR A 1 1085 ? 155.581 168.628 137.187 1.00 37.44  ?  957  TYR A N     1 
ATOM   4351  C  CA    . TYR A 1 1085 ? 155.043 169.016 135.888 1.00 42.72  ?  957  TYR A CA    1 
ATOM   4352  C  C     . TYR A 1 1085 ? 155.319 170.478 135.576 1.00 42.42  ?  957  TYR A C     1 
ATOM   4353  O  O     . TYR A 1 1085 ? 155.743 170.827 134.469 1.00 49.63  ?  957  TYR A O     1 
ATOM   4354  C  CB    . TYR A 1 1085 ? 153.540 168.754 135.867 1.00 36.81  ?  957  TYR A CB    1 
ATOM   4355  C  CG    . TYR A 1 1085 ? 153.179 167.387 135.363 1.00 52.03  ?  957  TYR A CG    1 
ATOM   4356  C  CD1   . TYR A 1 1085 ? 153.753 166.254 135.915 1.00 83.74  ?  957  TYR A CD1   1 
ATOM   4357  C  CD2   . TYR A 1 1085 ? 152.282 167.227 134.320 1.00 68.46  ?  957  TYR A CD2   1 
ATOM   4358  C  CE1   . TYR A 1 1085 ? 153.432 164.999 135.447 1.00 115.13 ?  957  TYR A CE1   1 
ATOM   4359  C  CE2   . TYR A 1 1085 ? 151.954 165.974 133.846 1.00 71.23  ?  957  TYR A CE2   1 
ATOM   4360  C  CZ    . TYR A 1 1085 ? 152.532 164.864 134.411 1.00 92.80  ?  957  TYR A CZ    1 
ATOM   4361  O  OH    . TYR A 1 1085 ? 152.213 163.610 133.945 1.00 89.59  ?  957  TYR A OH    1 
ATOM   4362  N  N     . LEU A 1 1086 ? 155.076 171.342 136.561 1.00 57.17  ?  958  LEU A N     1 
ATOM   4363  C  CA    . LEU A 1 1086 ? 155.290 172.771 136.387 1.00 71.45  ?  958  LEU A CA    1 
ATOM   4364  C  C     . LEU A 1 1086 ? 156.739 173.073 136.039 1.00 64.15  ?  958  LEU A C     1 
ATOM   4365  O  O     . LEU A 1 1086 ? 157.023 173.815 135.090 1.00 60.41  ?  958  LEU A O     1 
ATOM   4366  C  CB    . LEU A 1 1086 ? 154.877 173.517 137.657 1.00 97.97  ?  958  LEU A CB    1 
ATOM   4367  C  CG    . LEU A 1 1086 ? 155.052 175.035 137.644 1.00 113.23 ?  958  LEU A CG    1 
ATOM   4368  C  CD1   . LEU A 1 1086 ? 154.347 175.642 136.448 1.00 115.34 ?  958  LEU A CD1   1 
ATOM   4369  C  CD2   . LEU A 1 1086 ? 154.551 175.667 138.942 1.00 114.42 ?  958  LEU A CD2   1 
ATOM   4370  N  N     . HIS A 1 1087 ? 157.673 172.514 136.805 1.00 57.89  ?  959  HIS A N     1 
ATOM   4371  C  CA    . HIS A 1 1087 ? 159.078 172.780 136.537 1.00 57.53  ?  959  HIS A CA    1 
ATOM   4372  C  C     . HIS A 1 1087 ? 159.474 172.309 135.146 1.00 51.88  ?  959  HIS A C     1 
ATOM   4373  O  O     . HIS A 1 1087 ? 160.128 173.039 134.393 1.00 57.00  ?  959  HIS A O     1 
ATOM   4374  C  CB    . HIS A 1 1087 ? 159.962 172.106 137.575 1.00 58.85  ?  959  HIS A CB    1 
ATOM   4375  C  CG    . HIS A 1 1087 ? 161.324 171.791 137.052 1.00 82.13  ?  959  HIS A CG    1 
ATOM   4376  N  ND1   . HIS A 1 1087 ? 162.257 172.769 136.778 1.00 91.93  ?  959  HIS A ND1   1 
ATOM   4377  C  CD2   . HIS A 1 1087 ? 161.879 170.619 136.667 1.00 89.46  ?  959  HIS A CD2   1 
ATOM   4378  C  CE1   . HIS A 1 1087 ? 163.349 172.204 136.295 1.00 97.34  ?  959  HIS A CE1   1 
ATOM   4379  N  NE2   . HIS A 1 1087 ? 163.144 170.901 136.215 1.00 94.84  ?  959  HIS A NE2   1 
ATOM   4380  N  N     . LYS A 1 1088 ? 159.105 171.075 134.797 1.00 46.04  ?  960  LYS A N     1 
ATOM   4381  C  CA    . LYS A 1 1088 ? 159.515 170.529 133.507 1.00 43.68  ?  960  LYS A CA    1 
ATOM   4382  C  C     . LYS A 1 1088 ? 158.947 171.350 132.356 1.00 41.05  ?  960  LYS A C     1 
ATOM   4383  O  O     . LYS A 1 1088 ? 159.646 171.613 131.370 1.00 33.02  ?  960  LYS A O     1 
ATOM   4384  C  CB    . LYS A 1 1088 ? 159.096 169.062 133.398 1.00 51.03  ?  960  LYS A CB    1 
ATOM   4385  C  CG    . LYS A 1 1088 ? 159.296 168.253 134.685 1.00 67.66  ?  960  LYS A CG    1 
ATOM   4386  C  CD    . LYS A 1 1088 ? 159.106 166.746 134.469 1.00 68.17  ?  960  LYS A CD    1 
ATOM   4387  C  CE    . LYS A 1 1088 ? 159.013 165.983 135.798 1.00 57.21  ?  960  LYS A CE    1 
ATOM   4388  N  NZ    . LYS A 1 1088 ? 159.057 164.497 135.626 1.00 29.14  ?  960  LYS A NZ    1 
ATOM   4389  N  N     . THR A 1 1089 ? 157.685 171.772 132.467 1.00 54.80  ?  961  THR A N     1 
ATOM   4390  C  CA    . THR A 1 1089 ? 157.061 172.554 131.406 1.00 77.20  ?  961  THR A CA    1 
ATOM   4391  C  C     . THR A 1 1089 ? 157.532 174.005 131.384 1.00 67.59  ?  961  THR A C     1 
ATOM   4392  O  O     . THR A 1 1089 ? 157.389 174.676 130.357 1.00 73.00  ?  961  THR A O     1 
ATOM   4393  C  CB    . THR A 1 1089 ? 155.527 172.494 131.525 1.00 86.61  ?  961  THR A CB    1 
ATOM   4394  O  OG1   . THR A 1 1089 ? 154.927 173.006 130.328 1.00 81.85  ?  961  THR A OG1   1 
ATOM   4395  C  CG2   . THR A 1 1089 ? 155.039 173.306 132.709 1.00 68.40  ?  961  THR A CG2   1 
ATOM   4396  N  N     . LEU A 1 1090 ? 158.088 174.506 132.484 1.00 54.88  ?  962  LEU A N     1 
ATOM   4397  C  CA    . LEU A 1 1090 ? 158.572 175.879 132.505 1.00 56.22  ?  962  LEU A CA    1 
ATOM   4398  C  C     . LEU A 1 1090 ? 160.036 176.012 132.115 1.00 74.69  ?  962  LEU A C     1 
ATOM   4399  O  O     . LEU A 1 1090 ? 160.420 177.032 131.532 1.00 88.11  ?  962  LEU A O     1 
ATOM   4400  C  CB    . LEU A 1 1090 ? 158.359 176.497 133.891 1.00 55.10  ?  962  LEU A CB    1 
ATOM   4401  C  CG    . LEU A 1 1090 ? 156.954 177.015 134.211 1.00 48.22  ?  962  LEU A CG    1 
ATOM   4402  C  CD1   . LEU A 1 1090 ? 156.979 178.032 135.341 1.00 48.65  ?  962  LEU A CD1   1 
ATOM   4403  C  CD2   . LEU A 1 1090 ? 156.351 177.641 132.969 1.00 61.53  ?  962  LEU A CD2   1 
ATOM   4404  N  N     . ALA A 1 1091 ? 160.870 175.023 132.422 1.00 77.89  ?  963  ALA A N     1 
ATOM   4405  C  CA    . ALA A 1 1091 ? 162.314 175.216 132.325 1.00 92.34  ?  963  ALA A CA    1 
ATOM   4406  C  C     . ALA A 1 1091 ? 162.870 174.882 130.942 1.00 95.21  ?  963  ALA A C     1 
ATOM   4407  O  O     . ALA A 1 1091 ? 163.478 175.736 130.290 1.00 101.73 ?  963  ALA A O     1 
ATOM   4408  C  CB    . ALA A 1 1091 ? 163.021 174.385 133.403 1.00 90.84  ?  963  ALA A CB    1 
ATOM   4409  N  N     . HIS A 1 1092 ? 162.670 173.650 130.481 1.00 81.76  ?  964  HIS A N     1 
ATOM   4410  C  CA    . HIS A 1 1092 ? 163.505 173.099 129.425 1.00 87.61  ?  964  HIS A CA    1 
ATOM   4411  C  C     . HIS A 1 1092 ? 162.804 172.878 128.096 1.00 73.74  ?  964  HIS A C     1 
ATOM   4412  O  O     . HIS A 1 1092 ? 163.483 172.573 127.112 1.00 65.07  ?  964  HIS A O     1 
ATOM   4413  C  CB    . HIS A 1 1092 ? 164.096 171.768 129.891 1.00 96.65  ?  964  HIS A CB    1 
ATOM   4414  C  CG    . HIS A 1 1092 ? 164.491 171.769 131.331 1.00 92.19  ?  964  HIS A CG    1 
ATOM   4415  N  ND1   . HIS A 1 1092 ? 163.793 171.064 132.287 1.00 85.80  ?  964  HIS A ND1   1 
ATOM   4416  C  CD2   . HIS A 1 1092 ? 165.502 172.392 131.981 1.00 93.06  ?  964  HIS A CD2   1 
ATOM   4417  C  CE1   . HIS A 1 1092 ? 164.364 171.245 133.462 1.00 89.94  ?  964  HIS A CE1   1 
ATOM   4418  N  NE2   . HIS A 1 1092 ? 165.401 172.048 133.306 1.00 95.40  ?  964  HIS A NE2   1 
ATOM   4419  N  N     . VAL A 1 1093 ? 161.487 173.030 128.035 1.00 60.38  ?  965  VAL A N     1 
ATOM   4420  C  CA    . VAL A 1 1093 ? 160.704 172.680 126.851 1.00 57.65  ?  965  VAL A CA    1 
ATOM   4421  C  C     . VAL A 1 1093 ? 161.345 173.213 125.569 1.00 60.93  ?  965  VAL A C     1 
ATOM   4422  O  O     . VAL A 1 1093 ? 161.601 172.417 124.652 1.00 49.67  ?  965  VAL A O     1 
ATOM   4423  C  CB    . VAL A 1 1093 ? 159.253 173.160 127.006 1.00 57.03  ?  965  VAL A CB    1 
ATOM   4424  C  CG1   . VAL A 1 1093 ? 158.404 172.670 125.854 1.00 42.78  ?  965  VAL A CG1   1 
ATOM   4425  C  CG2   . VAL A 1 1093 ? 158.693 172.665 128.318 1.00 38.97  ?  965  VAL A CG2   1 
ATOM   4426  N  N     . PRO A 1 1094 ? 161.654 174.515 125.446 1.00 79.51  ?  966  PRO A N     1 
ATOM   4427  C  CA    . PRO A 1 1094 ? 162.233 174.975 124.168 1.00 78.52  ?  966  PRO A CA    1 
ATOM   4428  C  C     . PRO A 1 1094 ? 163.573 174.336 123.871 1.00 58.87  ?  966  PRO A C     1 
ATOM   4429  O  O     . PRO A 1 1094 ? 163.856 173.973 122.722 1.00 60.26  ?  966  PRO A O     1 
ATOM   4430  C  CB    . PRO A 1 1094 ? 162.354 176.491 124.366 1.00 81.14  ?  966  PRO A CB    1 
ATOM   4431  C  CG    . PRO A 1 1094 ? 162.519 176.647 125.827 1.00 72.79  ?  966  PRO A CG    1 
ATOM   4432  C  CD    . PRO A 1 1094 ? 161.604 175.620 126.428 1.00 90.06  ?  966  PRO A CD    1 
ATOM   4433  N  N     . GLU A 1 1095 ? 164.409 174.188 124.895 1.00 59.44  ?  967  GLU A N     1 
ATOM   4434  C  CA    . GLU A 1 1095 ? 165.670 173.485 124.723 1.00 70.80  ?  967  GLU A CA    1 
ATOM   4435  C  C     . GLU A 1 1095 ? 165.430 172.043 124.295 1.00 67.24  ?  967  GLU A C     1 
ATOM   4436  O  O     . GLU A 1 1095 ? 166.172 171.502 123.467 1.00 89.71  ?  967  GLU A O     1 
ATOM   4437  C  CB    . GLU A 1 1095 ? 166.473 173.556 126.024 1.00 99.20  ?  967  GLU A CB    1 
ATOM   4438  C  CG    . GLU A 1 1095 ? 167.400 172.380 126.270 1.00 147.04 ?  967  GLU A CG    1 
ATOM   4439  C  CD    . GLU A 1 1095 ? 168.492 172.249 125.221 1.00 198.49 ?  967  GLU A CD    1 
ATOM   4440  O  OE1   . GLU A 1 1095 ? 168.785 173.244 124.526 1.00 182.07 ?  967  GLU A OE1   1 
ATOM   4441  O  OE2   . GLU A 1 1095 ? 169.040 171.136 125.073 1.00 342.34 -1 967  GLU A OE2   1 
ATOM   4442  N  N     . ILE A 1 1096 ? 164.394 171.401 124.844 1.00 48.06  ?  968  ILE A N     1 
ATOM   4443  C  CA    . ILE A 1 1096 ? 164.099 170.018 124.463 1.00 48.71  ?  968  ILE A CA    1 
ATOM   4444  C  C     . ILE A 1 1096 ? 163.752 169.938 122.984 1.00 52.83  ?  968  ILE A C     1 
ATOM   4445  O  O     . ILE A 1 1096 ? 164.282 169.098 122.244 1.00 63.69  ?  968  ILE A O     1 
ATOM   4446  C  CB    . ILE A 1 1096 ? 162.967 169.436 125.329 1.00 49.79  ?  968  ILE A CB    1 
ATOM   4447  C  CG1   . ILE A 1 1096 ? 163.289 169.570 126.816 1.00 59.55  ?  968  ILE A CG1   1 
ATOM   4448  C  CG2   . ILE A 1 1096 ? 162.717 167.981 124.965 1.00 36.57  ?  968  ILE A CG2   1 
ATOM   4449  C  CD1   . ILE A 1 1096 ? 162.072 169.468 127.712 1.00 58.46  ?  968  ILE A CD1   1 
ATOM   4450  N  N     . VAL A 1 1097 ? 162.834 170.798 122.537 1.00 62.86  ?  969  VAL A N     1 
ATOM   4451  C  CA    . VAL A 1 1097 ? 162.447 170.792 121.131 1.00 72.64  ?  969  VAL A CA    1 
ATOM   4452  C  C     . VAL A 1 1097 ? 163.641 171.119 120.246 1.00 79.54  ?  969  VAL A C     1 
ATOM   4453  O  O     . VAL A 1 1097 ? 163.765 170.587 119.139 1.00 90.76  ?  969  VAL A O     1 
ATOM   4454  C  CB    . VAL A 1 1097 ? 161.270 171.758 120.887 1.00 73.26  ?  969  VAL A CB    1 
ATOM   4455  C  CG1   . VAL A 1 1097 ? 160.582 171.433 119.571 1.00 74.87  ?  969  VAL A CG1   1 
ATOM   4456  C  CG2   . VAL A 1 1097 ? 160.263 171.663 122.014 1.00 70.42  ?  969  VAL A CG2   1 
ATOM   4457  N  N     . GLU A 1 1098 ? 164.543 171.983 120.715 1.00 82.82  ?  970  GLU A N     1 
ATOM   4458  C  CA    . GLU A 1 1098 ? 165.733 172.296 119.929 1.00 96.96  ?  970  GLU A CA    1 
ATOM   4459  C  C     . GLU A 1 1098 ? 166.659 171.091 119.819 1.00 96.77  ?  970  GLU A C     1 
ATOM   4460  O  O     . GLU A 1 1098 ? 167.230 170.834 118.752 1.00 103.44 ?  970  GLU A O     1 
ATOM   4461  C  CB    . GLU A 1 1098 ? 166.470 173.483 120.546 1.00 117.15 ?  970  GLU A CB    1 
ATOM   4462  C  CG    . GLU A 1 1098 ? 166.787 174.592 119.556 1.00 188.95 ?  970  GLU A CG    1 
ATOM   4463  C  CD    . GLU A 1 1098 ? 168.072 174.339 118.788 1.00 234.87 ?  970  GLU A CD    1 
ATOM   4464  O  OE1   . GLU A 1 1098 ? 168.906 173.541 119.264 1.00 200.45 ?  970  GLU A OE1   1 
ATOM   4465  O  OE2   . GLU A 1 1098 ? 168.239 174.927 117.698 1.00 417.65 -1 970  GLU A OE2   1 
ATOM   4466  N  N     . ARG A 1 1099 ? 166.819 170.340 120.911 1.00 88.26  ?  971  ARG A N     1 
ATOM   4467  C  CA    . ARG A 1 1099 ? 167.743 169.206 120.930 1.00 88.66  ?  971  ARG A CA    1 
ATOM   4468  C  C     . ARG A 1 1099 ? 167.224 168.020 120.135 1.00 74.39  ?  971  ARG A C     1 
ATOM   4469  O  O     . ARG A 1 1099 ? 168.016 167.276 119.547 1.00 65.72  ?  971  ARG A O     1 
ATOM   4470  C  CB    . ARG A 1 1099 ? 168.010 168.767 122.370 1.00 87.45  ?  971  ARG A CB    1 
ATOM   4471  C  CG    . ARG A 1 1099 ? 169.032 167.636 122.508 1.00 68.96  ?  971  ARG A CG    1 
ATOM   4472  C  CD    . ARG A 1 1099 ? 168.346 166.341 122.922 1.00 45.57  ?  971  ARG A CD    1 
ATOM   4473  N  NE    . ARG A 1 1099 ? 168.478 166.110 124.356 1.00 43.29  ?  971  ARG A NE    1 
ATOM   4474  C  CZ    . ARG A 1 1099 ? 167.513 165.619 125.130 1.00 33.60  ?  971  ARG A CZ    1 
ATOM   4475  N  NH1   . ARG A 1 1099 ? 167.729 165.443 126.427 1.00 77.60  ?  971  ARG A NH1   1 
ATOM   4476  N  NH2   . ARG A 1 1099 ? 166.336 165.303 124.609 1.00 30.63  ?  971  ARG A NH2   1 
ATOM   4477  N  N     . ASP A 1 1100 ? 165.915 167.812 120.126 1.00 83.19  ?  972  ASP A N     1 
ATOM   4478  C  CA    . ASP A 1 1100 ? 165.349 166.637 119.484 1.00 89.57  ?  972  ASP A CA    1 
ATOM   4479  C  C     . ASP A 1 1100 ? 164.637 166.965 118.178 1.00 113.79 ?  972  ASP A C     1 
ATOM   4480  O  O     . ASP A 1 1100 ? 164.928 166.346 117.150 1.00 112.11 ?  972  ASP A O     1 
ATOM   4481  C  CB    . ASP A 1 1100 ? 164.384 165.947 120.458 1.00 104.58 ?  972  ASP A CB    1 
ATOM   4482  C  CG    . ASP A 1 1100 ? 163.295 165.153 119.764 1.00 141.17 ?  972  ASP A CG    1 
ATOM   4483  O  OD1   . ASP A 1 1100 ? 163.564 164.491 118.736 1.00 123.75 ?  972  ASP A OD1   1 
ATOM   4484  O  OD2   . ASP A 1 1100 ? 162.141 165.217 120.235 1.00 269.83 -1 972  ASP A OD2   1 
ATOM   4485  N  N     . GLY A 1 1101 ? 163.743 167.953 118.178 1.00 122.92 ?  973  GLY A N     1 
ATOM   4486  C  CA    . GLY A 1 1101 ? 162.935 168.294 117.019 1.00 124.90 ?  973  GLY A CA    1 
ATOM   4487  C  C     . GLY A 1 1101 ? 161.430 168.162 117.208 1.00 106.30 ?  973  GLY A C     1 
ATOM   4488  O  O     . GLY A 1 1101 ? 160.681 168.575 116.309 1.00 91.58  ?  973  GLY A O     1 
ATOM   4489  N  N     . SER A 1 1102 ? 160.945 167.617 118.324 1.00 92.28  ?  974  SER A N     1 
ATOM   4490  C  CA    . SER A 1 1102 ? 159.517 167.507 118.631 1.00 53.69  ?  974  SER A CA    1 
ATOM   4491  C  C     . SER A 1 1102 ? 159.373 167.175 120.114 1.00 39.70  ?  974  SER A C     1 
ATOM   4492  O  O     . SER A 1 1102 ? 160.360 167.111 120.852 1.00 57.91  ?  974  SER A O     1 
ATOM   4493  C  CB    . SER A 1 1102 ? 158.829 166.442 117.772 1.00 44.72  ?  974  SER A CB    1 
ATOM   4494  O  OG    . SER A 1 1102 ? 157.784 165.816 118.502 1.00 31.83  ?  974  SER A OG    1 
ATOM   4495  N  N     . ILE A 1 1103 ? 158.134 166.975 120.553 1.00 21.88  ?  975  ILE A N     1 
ATOM   4496  C  CA    . ILE A 1 1103 ? 157.861 166.470 121.890 1.00 20.57  ?  975  ILE A CA    1 
ATOM   4497  C  C     . ILE A 1 1103 ? 156.932 165.267 121.775 1.00 18.47  ?  975  ILE A C     1 
ATOM   4498  O  O     . ILE A 1 1103 ? 157.210 164.195 122.321 1.00 19.63  ?  975  ILE A O     1 
ATOM   4499  C  CB    . ILE A 1 1103 ? 157.275 167.568 122.795 1.00 26.60  ?  975  ILE A CB    1 
ATOM   4500  C  CG1   . ILE A 1 1103 ? 158.287 168.705 122.952 1.00 45.11  ?  975  ILE A CG1   1 
ATOM   4501  C  CG2   . ILE A 1 1103 ? 156.907 167.003 124.151 1.00 39.78  ?  975  ILE A CG2   1 
ATOM   4502  C  CD1   . ILE A 1 1103 ? 157.976 169.667 124.072 1.00 50.82  ?  975  ILE A CD1   1 
ATOM   4503  N  N     . GLY A 1 1104 ? 155.825 165.437 121.053 1.00 24.52  ?  976  GLY A N     1 
ATOM   4504  C  CA    . GLY A 1 1104 ? 154.873 164.351 120.900 1.00 22.88  ?  976  GLY A CA    1 
ATOM   4505  C  C     . GLY A 1 1104 ? 155.443 163.127 120.209 1.00 20.28  ?  976  GLY A C     1 
ATOM   4506  O  O     . GLY A 1 1104 ? 154.967 162.012 120.433 1.00 22.30  ?  976  GLY A O     1 
ATOM   4507  N  N     . ALA A 1 1105 ? 156.475 163.306 119.374 1.00 23.74  ?  977  ALA A N     1 
ATOM   4508  C  CA    . ALA A 1 1105 ? 157.017 162.238 118.518 1.00 21.74  ?  977  ALA A CA    1 
ATOM   4509  C  C     . ALA A 1 1105 ? 157.670 161.123 119.285 1.00 16.83  ?  977  ALA A C     1 
ATOM   4510  O  O     . ALA A 1 1105 ? 158.233 160.219 118.656 1.00 30.77  ?  977  ALA A O     1 
ATOM   4511  C  CB    . ALA A 1 1105 ? 158.023 162.821 117.526 1.00 34.14  ?  977  ALA A CB    1 
ATOM   4512  N  N     . TRP A 1 1106 ? 157.640 161.149 120.616 1.00 14.82  ?  978  TRP A N     1 
ATOM   4513  C  CA    . TRP A 1 1106 ? 158.152 160.048 121.420 1.00 19.92  ?  978  TRP A CA    1 
ATOM   4514  C  C     . TRP A 1 1106 ? 157.194 159.700 122.552 1.00 19.10  ?  978  TRP A C     1 
ATOM   4515  O  O     . TRP A 1 1106 ? 157.613 159.133 123.566 1.00 21.93  ?  978  TRP A O     1 
ATOM   4516  C  CB    . TRP A 1 1106 ? 159.540 160.373 121.974 1.00 25.14  ?  978  TRP A CB    1 
ATOM   4517  C  CG    . TRP A 1 1106 ? 160.473 161.045 121.003 1.00 23.49  ?  978  TRP A CG    1 
ATOM   4518  C  CD1   . TRP A 1 1106 ? 160.833 162.358 121.000 1.00 42.95  ?  978  TRP A CD1   1 
ATOM   4519  C  CD2   . TRP A 1 1106 ? 161.171 160.438 119.906 1.00 19.89  ?  978  TRP A CD2   1 
ATOM   4520  N  NE1   . TRP A 1 1106 ? 161.707 162.609 119.973 1.00 50.66  ?  978  TRP A NE1   1 
ATOM   4521  C  CE2   . TRP A 1 1106 ? 161.930 161.448 119.285 1.00 24.61  ?  978  TRP A CE2   1 
ATOM   4522  C  CE3   . TRP A 1 1106 ? 161.225 159.143 119.388 1.00 27.11  ?  978  TRP A CE3   1 
ATOM   4523  C  CZ2   . TRP A 1 1106 ? 162.730 161.207 118.178 1.00 28.42  ?  978  TRP A CZ2   1 
ATOM   4524  C  CZ3   . TRP A 1 1106 ? 162.020 158.908 118.292 1.00 34.44  ?  978  TRP A CZ3   1 
ATOM   4525  C  CH2   . TRP A 1 1106 ? 162.763 159.933 117.697 1.00 27.44  ?  978  TRP A CH2   1 
ATOM   4526  N  N     . ALA A 1 1107 ? 155.919 160.037 122.401 1.00 24.18  ?  979  ALA A N     1 
ATOM   4527  C  CA    . ALA A 1 1107 ? 154.950 159.756 123.447 1.00 42.34  ?  979  ALA A CA    1 
ATOM   4528  C  C     . ALA A 1 1107 ? 154.869 158.259 123.707 1.00 38.46  ?  979  ALA A C     1 
ATOM   4529  O  O     . ALA A 1 1107 ? 154.704 157.460 122.782 1.00 38.12  ?  979  ALA A O     1 
ATOM   4530  C  CB    . ALA A 1 1107 ? 153.576 160.302 123.059 1.00 81.36  ?  979  ALA A CB    1 
ATOM   4531  N  N     . SER A 1 1108 ? 154.994 157.884 124.979 1.00 32.27  ?  980  SER A N     1 
ATOM   4532  C  CA    . SER A 1 1108 ? 154.837 156.485 125.355 1.00 30.11  ?  980  SER A CA    1 
ATOM   4533  C  C     . SER A 1 1108 ? 153.421 155.993 125.075 1.00 62.93  ?  980  SER A C     1 
ATOM   4534  O  O     . SER A 1 1108 ? 153.210 154.789 124.880 1.00 74.51  ?  980  SER A O     1 
ATOM   4535  C  CB    . SER A 1 1108 ? 155.205 156.314 126.834 1.00 16.78  ?  980  SER A CB    1 
ATOM   4536  O  OG    . SER A 1 1108 ? 154.905 155.018 127.310 1.00 22.26  ?  980  SER A OG    1 
ATOM   4537  N  N     . GLU A 1 1109 ? 152.449 156.913 125.030 1.00 82.46  ?  981  GLU A N     1 
ATOM   4538  C  CA    . GLU A 1 1109 ? 151.031 156.578 124.875 1.00 112.48 ?  981  GLU A CA    1 
ATOM   4539  C  C     . GLU A 1 1109 ? 150.776 155.482 123.851 1.00 100.22 ?  981  GLU A C     1 
ATOM   4540  O  O     . GLU A 1 1109 ? 149.994 154.559 124.097 1.00 99.31  ?  981  GLU A O     1 
ATOM   4541  C  CB    . GLU A 1 1109 ? 150.246 157.836 124.489 1.00 125.29 ?  981  GLU A CB    1 
ATOM   4542  C  CG    . GLU A 1 1109 ? 148.844 157.541 123.945 1.00 164.06 ?  981  GLU A CG    1 
ATOM   4543  C  CD    . GLU A 1 1109 ? 148.790 157.535 122.426 1.00 187.32 ?  981  GLU A CD    1 
ATOM   4544  O  OE1   . GLU A 1 1109 ? 149.869 157.564 121.797 1.00 140.35 ?  981  GLU A OE1   1 
ATOM   4545  O  OE2   . GLU A 1 1109 ? 147.676 157.476 121.862 1.00 315.66 -1 981  GLU A OE2   1 
ATOM   4546  N  N     . GLY A 1 1110 ? 151.404 155.597 122.685 1.00 81.67  ?  982  GLY A N     1 
ATOM   4547  C  CA    . GLY A 1 1110 ? 151.298 154.599 121.643 1.00 77.04  ?  982  GLY A CA    1 
ATOM   4548  C  C     . GLY A 1 1110 ? 151.388 153.181 122.160 1.00 73.89  ?  982  GLY A C     1 
ATOM   4549  O  O     . GLY A 1 1110 ? 150.437 152.401 122.017 1.00 70.29  ?  982  GLY A O     1 
ATOM   4550  N  N     . ASN A 1 1111 ? 152.517 152.844 122.793 1.00 78.76  ?  983  ASN A N     1 
ATOM   4551  C  CA    . ASN A 1 1111 ? 152.691 151.490 123.312 1.00 71.06  ?  983  ASN A CA    1 
ATOM   4552  C  C     . ASN A 1 1111 ? 151.606 151.149 124.324 1.00 72.79  ?  983  ASN A C     1 
ATOM   4553  O  O     . ASN A 1 1111 ? 151.115 150.014 124.347 1.00 79.85  ?  983  ASN A O     1 
ATOM   4554  C  CB    . ASN A 1 1111 ? 154.083 151.335 123.940 1.00 53.22  ?  983  ASN A CB    1 
ATOM   4555  C  CG    . ASN A 1 1111 ? 154.353 149.920 124.460 1.00 39.77  ?  983  ASN A CG    1 
ATOM   4556  O  OD1   . ASN A 1 1111 ? 153.773 148.940 123.979 1.00 42.79  ?  983  ASN A OD1   1 
ATOM   4557  N  ND2   . ASN A 1 1111 ? 155.233 149.814 125.453 1.00 31.56  ?  983  ASN A ND2   1 
ATOM   4558  N  N     . GLU A 1 1112 ? 151.191 152.120 125.148 1.00 84.59  ?  984  GLU A N     1 
ATOM   4559  C  CA    . GLU A 1 1112 ? 150.134 151.846 126.121 1.00 107.75 ?  984  GLU A CA    1 
ATOM   4560  C  C     . GLU A 1 1112 ? 148.825 151.537 125.418 1.00 76.62  ?  984  GLU A C     1 
ATOM   4561  O  O     . GLU A 1 1112 ? 148.061 150.675 125.868 1.00 92.96  ?  984  GLU A O     1 
ATOM   4562  C  CB    . GLU A 1 1112 ? 149.949 153.025 127.087 1.00 162.56 ?  984  GLU A CB    1 
ATOM   4563  C  CG    . GLU A 1 1112 ? 148.965 152.748 128.243 1.00 197.31 ?  984  GLU A CG    1 
ATOM   4564  C  CD    . GLU A 1 1112 ? 149.637 152.521 129.596 1.00 225.65 ?  984  GLU A CD    1 
ATOM   4565  O  OE1   . GLU A 1 1112 ? 149.401 151.466 130.218 1.00 207.99 ?  984  GLU A OE1   1 
ATOM   4566  O  OE2   . GLU A 1 1112 ? 150.367 153.426 130.062 1.00 326.55 -1 984  GLU A OE2   1 
ATOM   4567  N  N     . SER A 1 1113 ? 148.558 152.215 124.304 1.00 62.44  ?  985  SER A N     1 
ATOM   4568  C  CA    . SER A 1 1113 ? 147.438 151.818 123.471 1.00 67.06  ?  985  SER A CA    1 
ATOM   4569  C  C     . SER A 1 1113 ? 147.510 150.324 123.175 1.00 70.80  ?  985  SER A C     1 
ATOM   4570  O  O     . SER A 1 1113 ? 146.547 149.582 123.402 1.00 80.56  ?  985  SER A O     1 
ATOM   4571  C  CB    . SER A 1 1113 ? 147.450 152.641 122.183 1.00 86.11  ?  985  SER A CB    1 
ATOM   4572  O  OG    . SER A 1 1113 ? 146.715 152.006 121.164 1.00 105.59 ?  985  SER A OG    1 
ATOM   4573  N  N     . GLY A 1 1114 ? 148.680 149.854 122.748 1.00 60.09  ?  986  GLY A N     1 
ATOM   4574  C  CA    . GLY A 1 1114 ? 148.877 148.463 122.382 1.00 57.39  ?  986  GLY A CA    1 
ATOM   4575  C  C     . GLY A 1 1114 ? 148.443 147.461 123.434 1.00 51.98  ?  986  GLY A C     1 
ATOM   4576  O  O     . GLY A 1 1114 ? 148.214 146.286 123.120 1.00 50.31  ?  986  GLY A O     1 
ATOM   4577  N  N     . ASN A 1 1115 ? 148.323 147.913 124.688 1.00 58.73  ?  987  ASN A N     1 
ATOM   4578  C  CA    . ASN A 1 1115 ? 147.845 147.026 125.745 1.00 53.55  ?  987  ASN A CA    1 
ATOM   4579  C  C     . ASN A 1 1115 ? 146.504 146.399 125.387 1.00 36.26  ?  987  ASN A C     1 
ATOM   4580  O  O     . ASN A 1 1115 ? 146.325 145.182 125.516 1.00 32.84  ?  987  ASN A O     1 
ATOM   4581  C  CB    . ASN A 1 1115 ? 147.754 147.777 127.074 1.00 96.46  ?  987  ASN A CB    1 
ATOM   4582  C  CG    . ASN A 1 1115 ? 149.027 148.527 127.413 1.00 125.91 ?  987  ASN A CG    1 
ATOM   4583  O  OD1   . ASN A 1 1115 ? 149.950 148.618 126.597 1.00 117.13 ?  987  ASN A OD1   1 
ATOM   4584  N  ND2   . ASN A 1 1115 ? 149.083 149.074 128.623 1.00 163.01 ?  987  ASN A ND2   1 
ATOM   4585  N  N     . LYS A 1 1116 ? 145.548 147.208 124.918 1.00 37.56  ?  988  LYS A N     1 
ATOM   4586  C  CA    . LYS A 1 1116 ? 144.232 146.645 124.631 1.00 33.82  ?  988  LYS A CA    1 
ATOM   4587  C  C     . LYS A 1 1116 ? 144.315 145.529 123.600 1.00 21.94  ?  988  LYS A C     1 
ATOM   4588  O  O     . LYS A 1 1116 ? 143.441 144.656 123.566 1.00 22.85  ?  988  LYS A O     1 
ATOM   4589  C  CB    . LYS A 1 1116 ? 143.265 147.743 124.167 1.00 56.33  ?  988  LYS A CB    1 
ATOM   4590  C  CG    . LYS A 1 1116 ? 143.735 148.535 122.966 1.00 67.44  ?  988  LYS A CG    1 
ATOM   4591  C  CD    . LYS A 1 1116 ? 142.823 149.720 122.686 1.00 74.18  ?  988  LYS A CD    1 
ATOM   4592  C  CE    . LYS A 1 1116 ? 142.621 149.909 121.192 1.00 113.71 ?  988  LYS A CE    1 
ATOM   4593  N  NZ    . LYS A 1 1116 ? 143.858 150.347 120.489 1.00 151.26 ?  988  LYS A NZ    1 
ATOM   4594  N  N     . LEU A 1 1117 ? 145.368 145.519 122.780 1.00 19.45  ?  989  LEU A N     1 
ATOM   4595  C  CA    . LEU A 1 1117 ? 145.616 144.381 121.906 1.00 11.14  ?  989  LEU A CA    1 
ATOM   4596  C  C     . LEU A 1 1117 ? 145.994 143.157 122.722 1.00 12.08  ?  989  LEU A C     1 
ATOM   4597  O  O     . LEU A 1 1117 ? 145.289 142.142 122.709 1.00 12.63  ?  989  LEU A O     1 
ATOM   4598  C  CB    . LEU A 1 1117 ? 146.732 144.723 120.923 1.00 12.21  ?  989  LEU A CB    1 
ATOM   4599  C  CG    . LEU A 1 1117 ? 146.441 145.823 119.910 1.00 26.28  ?  989  LEU A CG    1 
ATOM   4600  C  CD1   . LEU A 1 1117 ? 147.530 145.846 118.863 1.00 31.32  ?  989  LEU A CD1   1 
ATOM   4601  C  CD2   . LEU A 1 1117 ? 145.089 145.595 119.275 1.00 32.24  ?  989  LEU A CD2   1 
ATOM   4602  N  N     . PHE A 1 1118 ? 147.113 143.251 123.446 1.00 12.86  ?  990  PHE A N     1 
ATOM   4603  C  CA    . PHE A 1 1118 ? 147.712 142.087 124.088 1.00 13.10  ?  990  PHE A CA    1 
ATOM   4604  C  C     . PHE A 1 1118 ? 146.670 141.315 124.878 1.00 13.53  ?  990  PHE A C     1 
ATOM   4605  O  O     . PHE A 1 1118 ? 146.411 140.137 124.608 1.00 21.79  ?  990  PHE A O     1 
ATOM   4606  C  CB    . PHE A 1 1118 ? 148.875 142.519 124.989 1.00 23.78  ?  990  PHE A CB    1 
ATOM   4607  C  CG    . PHE A 1 1118 ? 149.414 141.414 125.853 1.00 14.47  ?  990  PHE A CG    1 
ATOM   4608  C  CD1   . PHE A 1 1118 ? 150.195 140.407 125.319 1.00 10.24  ?  990  PHE A CD1   1 
ATOM   4609  C  CD2   . PHE A 1 1118 ? 149.106 141.364 127.196 1.00 16.75  ?  990  PHE A CD2   1 
ATOM   4610  C  CE1   . PHE A 1 1118 ? 150.673 139.392 126.119 1.00 12.37  ?  990  PHE A CE1   1 
ATOM   4611  C  CE2   . PHE A 1 1118 ? 149.580 140.351 127.991 1.00 13.02  ?  990  PHE A CE2   1 
ATOM   4612  C  CZ    . PHE A 1 1118 ? 150.362 139.368 127.455 1.00 16.12  ?  990  PHE A CZ    1 
ATOM   4613  N  N     . ARG A 1 1119 ? 146.031 141.986 125.836 1.00 18.13  ?  991  ARG A N     1 
ATOM   4614  C  CA    . ARG A 1 1119 ? 145.027 141.323 126.656 1.00 22.35  ?  991  ARG A CA    1 
ATOM   4615  C  C     . ARG A 1 1119 ? 143.979 140.639 125.789 1.00 19.00  ?  991  ARG A C     1 
ATOM   4616  O  O     . ARG A 1 1119 ? 143.686 139.453 125.969 1.00 36.65  ?  991  ARG A O     1 
ATOM   4617  C  CB    . ARG A 1 1119 ? 144.379 142.322 127.624 1.00 48.73  ?  991  ARG A CB    1 
ATOM   4618  C  CG    . ARG A 1 1119 ? 143.969 143.663 127.025 1.00 53.40  ?  991  ARG A CG    1 
ATOM   4619  C  CD    . ARG A 1 1119 ? 143.163 144.478 128.037 1.00 72.07  ?  991  ARG A CD    1 
ATOM   4620  N  NE    . ARG A 1 1119 ? 143.982 144.946 129.151 1.00 47.44  ?  991  ARG A NE    1 
ATOM   4621  C  CZ    . ARG A 1 1119 ? 144.723 146.049 129.117 1.00 48.11  ?  991  ARG A CZ    1 
ATOM   4622  N  NH1   . ARG A 1 1119 ? 145.442 146.400 130.178 1.00 61.58  ?  991  ARG A NH1   1 
ATOM   4623  N  NH2   . ARG A 1 1119 ? 144.744 146.802 128.022 1.00 51.58  ?  991  ARG A NH2   1 
ATOM   4624  N  N     . ARG A 1 1120 ? 143.433 141.352 124.811 1.00 12.20  ?  992  ARG A N     1 
ATOM   4625  C  CA    . ARG A 1 1120 ? 142.396 140.730 124.006 1.00 13.62  ?  992  ARG A CA    1 
ATOM   4626  C  C     . ARG A 1 1120 ? 142.975 139.651 123.102 1.00 18.21  ?  992  ARG A C     1 
ATOM   4627  O  O     . ARG A 1 1120 ? 142.300 138.657 122.811 1.00 19.80  ?  992  ARG A O     1 
ATOM   4628  C  CB    . ARG A 1 1120 ? 141.656 141.772 123.185 1.00 17.50  ?  992  ARG A CB    1 
ATOM   4629  C  CG    . ARG A 1 1120 ? 140.529 141.162 122.398 1.00 24.85  ?  992  ARG A CG    1 
ATOM   4630  C  CD    . ARG A 1 1120 ? 140.737 141.374 120.933 1.00 37.80  ?  992  ARG A CD    1 
ATOM   4631  N  NE    . ARG A 1 1120 ? 140.473 142.765 120.605 1.00 92.67  ?  992  ARG A NE    1 
ATOM   4632  C  CZ    . ARG A 1 1120 ? 139.272 143.241 120.312 1.00 124.76 ?  992  ARG A CZ    1 
ATOM   4633  N  NH1   . ARG A 1 1120 ? 138.219 142.434 120.326 1.00 97.87  ?  992  ARG A NH1   1 
ATOM   4634  N  NH2   . ARG A 1 1120 ? 139.119 144.527 120.019 1.00 150.43 ?  992  ARG A NH2   1 
ATOM   4635  N  N     . PHE A 1 1121 ? 144.223 139.817 122.664 1.00 20.18  ?  993  PHE A N     1 
ATOM   4636  C  CA    . PHE A 1 1121 ? 144.864 138.745 121.915 1.00 20.14  ?  993  PHE A CA    1 
ATOM   4637  C  C     . PHE A 1 1121 ? 145.005 137.488 122.750 1.00 7.65   ?  993  PHE A C     1 
ATOM   4638  O  O     . PHE A 1 1121 ? 145.093 136.389 122.193 1.00 7.82   ?  993  PHE A O     1 
ATOM   4639  C  CB    . PHE A 1 1121 ? 146.233 139.176 121.409 1.00 8.05   ?  993  PHE A CB    1 
ATOM   4640  C  CG    . PHE A 1 1121 ? 146.272 139.435 119.944 1.00 20.15  ?  993  PHE A CG    1 
ATOM   4641  C  CD1   . PHE A 1 1121 ? 145.948 138.430 119.064 1.00 9.36   ?  993  PHE A CD1   1 
ATOM   4642  C  CD2   . PHE A 1 1121 ? 146.670 140.653 119.438 1.00 10.74  ?  993  PHE A CD2   1 
ATOM   4643  C  CE1   . PHE A 1 1121 ? 145.989 138.645 117.714 1.00 8.66   ?  993  PHE A CE1   1 
ATOM   4644  C  CE2   . PHE A 1 1121 ? 146.715 140.865 118.078 1.00 11.17  ?  993  PHE A CE2   1 
ATOM   4645  C  CZ    . PHE A 1 1121 ? 146.374 139.859 117.225 1.00 7.28   ?  993  PHE A CZ    1 
ATOM   4646  N  N     . ARG A 1 1122 ? 145.032 137.636 124.071 1.00 12.93  ?  994  ARG A N     1 
ATOM   4647  C  CA    . ARG A 1 1122 ? 145.062 136.473 124.944 1.00 11.67  ?  994  ARG A CA    1 
ATOM   4648  C  C     . ARG A 1 1122 ? 143.758 135.698 124.862 1.00 13.13  ?  994  ARG A C     1 
ATOM   4649  O  O     . ARG A 1 1122 ? 143.752 134.466 124.951 1.00 17.13  ?  994  ARG A O     1 
ATOM   4650  C  CB    . ARG A 1 1122 ? 145.327 136.919 126.383 1.00 15.59  ?  994  ARG A CB    1 
ATOM   4651  C  CG    . ARG A 1 1122 ? 145.240 135.811 127.418 1.00 20.86  ?  994  ARG A CG    1 
ATOM   4652  C  CD    . ARG A 1 1122 ? 146.604 135.493 128.009 1.00 52.98  ?  994  ARG A CD    1 
ATOM   4653  N  NE    . ARG A 1 1122 ? 146.528 134.444 129.028 1.00 92.71  ?  994  ARG A NE    1 
ATOM   4654  C  CZ    . ARG A 1 1122 ? 146.465 134.648 130.340 1.00 96.94  ?  994  ARG A CZ    1 
ATOM   4655  N  NH1   . ARG A 1 1122 ? 146.478 135.876 130.838 1.00 77.88  ?  994  ARG A NH1   1 
ATOM   4656  N  NH2   . ARG A 1 1122 ? 146.398 133.608 131.163 1.00 113.23 ?  994  ARG A NH2   1 
ATOM   4657  N  N     . LYS A 1 1123 ? 142.642 136.406 124.690 1.00 19.75  ?  995  LYS A N     1 
ATOM   4658  C  CA    . LYS A 1 1123 ? 141.336 135.793 124.907 1.00 33.14  ?  995  LYS A CA    1 
ATOM   4659  C  C     . LYS A 1 1123 ? 140.933 134.895 123.751 1.00 41.69  ?  995  LYS A C     1 
ATOM   4660  O  O     . LYS A 1 1123 ? 140.509 133.754 123.961 1.00 41.89  ?  995  LYS A O     1 
ATOM   4661  C  CB    . LYS A 1 1123 ? 140.279 136.879 125.125 1.00 31.95  ?  995  LYS A CB    1 
ATOM   4662  C  CG    . LYS A 1 1123 ? 138.848 136.448 124.807 1.00 36.06  ?  995  LYS A CG    1 
ATOM   4663  C  CD    . LYS A 1 1123 ? 137.920 136.650 126.002 1.00 46.98  ?  995  LYS A CD    1 
ATOM   4664  C  CE    . LYS A 1 1123 ? 137.830 138.119 126.397 1.00 67.71  ?  995  LYS A CE    1 
ATOM   4665  N  NZ    . LYS A 1 1123 ? 137.270 138.966 125.308 1.00 59.18  ?  995  LYS A NZ    1 
ATOM   4666  N  N     . MET A 1 1124 ? 141.061 135.393 122.530 1.00 31.07  ?  996  MET A N     1 
ATOM   4667  C  CA    . MET A 1 1124 ? 140.489 134.722 121.377 1.00 31.91  ?  996  MET A CA    1 
ATOM   4668  C  C     . MET A 1 1124 ? 141.453 133.760 120.697 1.00 33.58  ?  996  MET A C     1 
ATOM   4669  O  O     . MET A 1 1124 ? 140.998 132.791 120.077 1.00 45.83  ?  996  MET A O     1 
ATOM   4670  C  CB    . MET A 1 1124 ? 139.990 135.767 120.371 1.00 33.20  ?  996  MET A CB    1 
ATOM   4671  C  CG    . MET A 1 1124 ? 138.941 136.713 120.952 1.00 37.48  ?  996  MET A CG    1 
ATOM   4672  S  SD    . MET A 1 1124 ? 138.246 137.829 119.715 1.00 64.81  ?  996  MET A SD    1 
ATOM   4673  C  CE    . MET A 1 1124 ? 137.318 138.986 120.726 1.00 45.17  ?  996  MET A CE    1 
ATOM   4674  N  N     . ASN A 1 1125 ? 142.757 133.983 120.799 1.00 22.86  ?  997  ASN A N     1 
ATOM   4675  C  CA    . ASN A 1 1125 ? 143.724 133.127 120.125 1.00 18.00  ?  997  ASN A CA    1 
ATOM   4676  C  C     . ASN A 1 1125 ? 144.660 132.462 121.128 1.00 20.55  ?  997  ASN A C     1 
ATOM   4677  O  O     . ASN A 1 1125 ? 145.875 132.395 120.930 1.00 30.89  ?  997  ASN A O     1 
ATOM   4678  C  CB    . ASN A 1 1125 ? 144.506 133.914 119.080 1.00 14.67  ?  997  ASN A CB    1 
ATOM   4679  C  CG    . ASN A 1 1125 ? 143.603 134.516 118.004 1.00 17.72  ?  997  ASN A CG    1 
ATOM   4680  O  OD1   . ASN A 1 1125 ? 142.432 134.806 118.241 1.00 24.90  ?  997  ASN A OD1   1 
ATOM   4681  N  ND2   . ASN A 1 1125 ? 144.145 134.679 116.809 1.00 21.18  ?  997  ASN A ND2   1 
ATOM   4682  N  N     . ALA A 1 1126 ? 144.098 131.958 122.223 1.00 34.25  ?  998  ALA A N     1 
ATOM   4683  C  CA    . ALA A 1 1126 ? 144.887 131.234 123.206 1.00 41.32  ?  998  ALA A CA    1 
ATOM   4684  C  C     . ALA A 1 1126 ? 145.395 129.917 122.611 1.00 51.09  ?  998  ALA A C     1 
ATOM   4685  O  O     . ALA A 1 1126 ? 145.013 129.512 121.508 1.00 54.23  ?  998  ALA A O     1 
ATOM   4686  C  CB    . ALA A 1 1126 ? 144.064 130.984 124.471 1.00 48.57  ?  998  ALA A CB    1 
ATOM   4687  N  N     . ARG A 1 1127 ? 146.268 129.239 123.362 1.00 52.42  ?  999  ARG A N     1 
ATOM   4688  C  CA    . ARG A 1 1127 ? 146.915 128.017 122.888 1.00 60.26  ?  999  ARG A CA    1 
ATOM   4689  C  C     . ARG A 1 1127 ? 146.375 126.724 123.496 1.00 81.97  ?  999  ARG A C     1 
ATOM   4690  O  O     . ARG A 1 1127 ? 146.125 125.780 122.739 1.00 85.03  ?  999  ARG A O     1 
ATOM   4691  C  CB    . ARG A 1 1127 ? 148.440 128.091 123.094 1.00 53.58  ?  999  ARG A CB    1 
ATOM   4692  C  CG    . ARG A 1 1127 ? 149.185 126.883 122.521 1.00 46.41  ?  999  ARG A CG    1 
ATOM   4693  C  CD    . ARG A 1 1127 ? 149.392 127.024 121.024 1.00 42.32  ?  999  ARG A CD    1 
ATOM   4694  N  NE    . ARG A 1 1127 ? 150.805 127.004 120.644 1.00 42.80  ?  999  ARG A NE    1 
ATOM   4695  C  CZ    . ARG A 1 1127 ? 151.589 125.931 120.684 1.00 28.07  ?  999  ARG A CZ    1 
ATOM   4696  N  NH1   . ARG A 1 1127 ? 152.859 126.028 120.312 1.00 31.14  ?  999  ARG A NH1   1 
ATOM   4697  N  NH2   . ARG A 1 1127 ? 151.108 124.763 121.080 1.00 34.78  ?  999  ARG A NH2   1 
ATOM   4698  N  N     . GLN A 1 1128 ? 146.189 126.598 124.822 1.00 70.18  ?  1000 GLN A N     1 
ATOM   4699  C  CA    . GLN A 1 1128 ? 146.497 127.570 125.876 1.00 46.81  ?  1000 GLN A CA    1 
ATOM   4700  C  C     . GLN A 1 1128 ? 147.206 126.932 127.069 1.00 25.69  ?  1000 GLN A C     1 
ATOM   4701  O  O     . GLN A 1 1128 ? 146.574 126.493 128.033 1.00 24.66  ?  1000 GLN A O     1 
ATOM   4702  C  CB    . GLN A 1 1128 ? 145.215 128.252 126.352 1.00 51.60  ?  1000 GLN A CB    1 
ATOM   4703  C  CG    . GLN A 1 1128 ? 144.037 127.306 126.493 1.00 45.99  ?  1000 GLN A CG    1 
ATOM   4704  C  CD    . GLN A 1 1128 ? 142.884 127.927 127.247 1.00 46.43  ?  1000 GLN A CD    1 
ATOM   4705  O  OE1   . GLN A 1 1128 ? 142.902 129.117 127.575 1.00 39.82  ?  1000 GLN A OE1   1 
ATOM   4706  N  NE2   . GLN A 1 1128 ? 141.879 127.117 127.547 1.00 54.41  ?  1000 GLN A NE2   1 
ATOM   4707  N  N     . SER A 1 1129 ? 148.530 126.900 126.987 1.00 33.50  ?  1001 SER A N     1 
ATOM   4708  C  CA    . SER A 1 1129 ? 149.400 126.504 128.082 1.00 38.06  ?  1001 SER A CA    1 
ATOM   4709  C  C     . SER A 1 1129 ? 150.574 127.472 128.090 1.00 52.49  ?  1001 SER A C     1 
ATOM   4710  O  O     . SER A 1 1129 ? 151.152 127.755 127.035 1.00 50.56  ?  1001 SER A O     1 
ATOM   4711  C  CB    . SER A 1 1129 ? 149.859 125.046 127.930 1.00 65.51  ?  1001 SER A CB    1 
ATOM   4712  O  OG    . SER A 1 1129 ? 150.125 124.735 126.574 1.00 64.36  ?  1001 SER A OG    1 
ATOM   4713  N  N     . LYS A 1 1130 ? 150.909 127.992 129.273 1.00 42.31  ?  1002 LYS A N     1 
ATOM   4714  C  CA    . LYS A 1 1130 ? 151.827 129.123 129.382 1.00 51.84  ?  1002 LYS A CA    1 
ATOM   4715  C  C     . LYS A 1 1130 ? 153.205 128.853 128.779 1.00 56.75  ?  1002 LYS A C     1 
ATOM   4716  O  O     . LYS A 1 1130 ? 153.940 129.809 128.501 1.00 45.08  ?  1002 LYS A O     1 
ATOM   4717  C  CB    . LYS A 1 1130 ? 151.960 129.531 130.848 1.00 42.50  ?  1002 LYS A CB    1 
ATOM   4718  C  CG    . LYS A 1 1130 ? 150.629 129.659 131.572 1.00 34.12  ?  1002 LYS A CG    1 
ATOM   4719  C  CD    . LYS A 1 1130 ? 150.783 129.419 133.058 1.00 42.81  ?  1002 LYS A CD    1 
ATOM   4720  C  CE    . LYS A 1 1130 ? 151.495 128.097 133.302 1.00 56.27  ?  1002 LYS A CE    1 
ATOM   4721  N  NZ    . LYS A 1 1130 ? 151.880 127.908 134.723 1.00 76.24  ?  1002 LYS A NZ    1 
ATOM   4722  N  N     . THR A 1 1131 ? 153.577 127.588 128.582 1.00 62.96  ?  1003 THR A N     1 
ATOM   4723  C  CA    . THR A 1 1131 ? 154.800 127.290 127.844 1.00 55.39  ?  1003 THR A CA    1 
ATOM   4724  C  C     . THR A 1 1131 ? 154.689 127.733 126.389 1.00 42.80  ?  1003 THR A C     1 
ATOM   4725  O  O     . THR A 1 1131 ? 155.685 128.152 125.785 1.00 37.82  ?  1003 THR A O     1 
ATOM   4726  C  CB    . THR A 1 1131 ? 155.122 125.792 127.923 1.00 71.27  ?  1003 THR A CB    1 
ATOM   4727  O  OG1   . THR A 1 1131 ? 154.468 125.099 126.852 1.00 73.18  ?  1003 THR A OG1   1 
ATOM   4728  C  CG2   . THR A 1 1131 ? 154.664 125.201 129.252 1.00 60.42  ?  1003 THR A CG2   1 
ATOM   4729  N  N     . PHE A 1 1132 ? 153.484 127.662 125.818 1.00 45.56  ?  1004 PHE A N     1 
ATOM   4730  C  CA    . PHE A 1 1132 ? 153.229 127.971 124.415 1.00 47.17  ?  1004 PHE A CA    1 
ATOM   4731  C  C     . PHE A 1 1132 ? 152.475 129.277 124.199 1.00 44.63  ?  1004 PHE A C     1 
ATOM   4732  O  O     . PHE A 1 1132 ? 152.583 129.866 123.122 1.00 56.35  ?  1004 PHE A O     1 
ATOM   4733  C  CB    . PHE A 1 1132 ? 152.416 126.848 123.761 1.00 45.34  ?  1004 PHE A CB    1 
ATOM   4734  C  CG    . PHE A 1 1132 ? 153.143 125.535 123.649 1.00 63.43  ?  1004 PHE A CG    1 
ATOM   4735  C  CD1   . PHE A 1 1132 ? 154.309 125.431 122.913 1.00 78.08  ?  1004 PHE A CD1   1 
ATOM   4736  C  CD2   . PHE A 1 1132 ? 152.632 124.393 124.243 1.00 71.49  ?  1004 PHE A CD2   1 
ATOM   4737  C  CE1   . PHE A 1 1132 ? 154.966 124.217 122.797 1.00 85.01  ?  1004 PHE A CE1   1 
ATOM   4738  C  CE2   . PHE A 1 1132 ? 153.288 123.174 124.129 1.00 72.42  ?  1004 PHE A CE2   1 
ATOM   4739  C  CZ    . PHE A 1 1132 ? 154.453 123.090 123.406 1.00 76.47  ?  1004 PHE A CZ    1 
ATOM   4740  N  N     . GLU A 1 1133 ? 151.687 129.714 125.181 1.00 36.29  ?  1005 GLU A N     1 
ATOM   4741  C  CA    . GLU A 1 1133 ? 150.775 130.844 125.006 1.00 26.42  ?  1005 GLU A CA    1 
ATOM   4742  C  C     . GLU A 1 1133 ? 151.464 132.081 124.442 1.00 18.00  ?  1005 GLU A C     1 
ATOM   4743  O  O     . GLU A 1 1133 ? 150.993 132.693 123.471 1.00 20.05  ?  1005 GLU A O     1 
ATOM   4744  C  CB    . GLU A 1 1133 ? 150.143 131.165 126.348 1.00 36.78  ?  1005 GLU A CB    1 
ATOM   4745  C  CG    . GLU A 1 1133 ? 149.365 132.429 126.353 1.00 56.29  ?  1005 GLU A CG    1 
ATOM   4746  C  CD    . GLU A 1 1133 ? 148.525 132.526 127.594 1.00 150.74 ?  1005 GLU A CD    1 
ATOM   4747  O  OE1   . GLU A 1 1133 ? 147.285 132.455 127.478 1.00 138.56 ?  1005 GLU A OE1   1 
ATOM   4748  O  OE2   . GLU A 1 1133 ? 149.106 132.630 128.694 1.00 279.79 -1 1005 GLU A OE2   1 
ATOM   4749  N  N     . LEU A 1 1134 ? 152.576 132.472 125.061 1.00 14.25  ?  1006 LEU A N     1 
ATOM   4750  C  CA    . LEU A 1 1134 ? 153.317 133.644 124.606 1.00 15.97  ?  1006 LEU A CA    1 
ATOM   4751  C  C     . LEU A 1 1134 ? 153.763 133.500 123.156 1.00 26.90  ?  1006 LEU A C     1 
ATOM   4752  O  O     . LEU A 1 1134 ? 153.782 134.484 122.412 1.00 29.06  ?  1006 LEU A O     1 
ATOM   4753  C  CB    . LEU A 1 1134 ? 154.524 133.900 125.509 1.00 18.81  ?  1006 LEU A CB    1 
ATOM   4754  C  CG    . LEU A 1 1134 ? 154.257 134.589 126.844 1.00 25.66  ?  1006 LEU A CG    1 
ATOM   4755  C  CD1   . LEU A 1 1134 ? 155.557 135.084 127.481 1.00 42.66  ?  1006 LEU A CD1   1 
ATOM   4756  C  CD2   . LEU A 1 1134 ? 153.314 135.741 126.595 1.00 23.75  ?  1006 LEU A CD2   1 
ATOM   4757  N  N     . GLU A 1 1135 ? 154.169 132.297 122.749 1.00 30.91  ?  1007 GLU A N     1 
ATOM   4758  C  CA    . GLU A 1 1135 ? 154.620 132.090 121.376 1.00 40.60  ?  1007 GLU A CA    1 
ATOM   4759  C  C     . GLU A 1 1135 ? 153.590 132.618 120.381 1.00 29.48  ?  1007 GLU A C     1 
ATOM   4760  O  O     . GLU A 1 1135 ? 153.889 133.481 119.544 1.00 31.89  ?  1007 GLU A O     1 
ATOM   4761  C  CB    . GLU A 1 1135 ? 154.894 130.599 121.139 1.00 90.96  ?  1007 GLU A CB    1 
ATOM   4762  C  CG    . GLU A 1 1135 ? 156.173 130.267 120.381 1.00 133.97 ?  1007 GLU A CG    1 
ATOM   4763  C  CD    . GLU A 1 1135 ? 156.544 128.787 120.488 1.00 160.72 ?  1007 GLU A CD    1 
ATOM   4764  O  OE1   . GLU A 1 1135 ? 157.110 128.386 121.525 1.00 103.58 ?  1007 GLU A OE1   1 
ATOM   4765  O  OE2   . GLU A 1 1135 ? 156.257 128.022 119.541 1.00 355.53 -1 1007 GLU A OE2   1 
ATOM   4766  N  N     . ASP A 1 1136 ? 152.355 132.133 120.492 1.00 40.02  ?  1008 ASP A N     1 
ATOM   4767  C  CA    . ASP A 1 1136 ? 151.300 132.538 119.571 1.00 77.19  ?  1008 ASP A CA    1 
ATOM   4768  C  C     . ASP A 1 1136 ? 150.906 133.994 119.783 1.00 44.42  ?  1008 ASP A C     1 
ATOM   4769  O  O     . ASP A 1 1136 ? 150.656 134.717 118.810 1.00 38.07  ?  1008 ASP A O     1 
ATOM   4770  C  CB    . ASP A 1 1136 ? 150.081 131.623 119.731 1.00 157.73 ?  1008 ASP A CB    1 
ATOM   4771  C  CG    . ASP A 1 1136 ? 149.907 130.653 118.559 1.00 200.26 ?  1008 ASP A CG    1 
ATOM   4772  O  OD1   . ASP A 1 1136 ? 150.540 130.864 117.499 1.00 159.32 ?  1008 ASP A OD1   1 
ATOM   4773  O  OD2   . ASP A 1 1136 ? 149.140 129.678 118.694 1.00 302.77 -1 1008 ASP A OD2   1 
ATOM   4774  N  N     . ILE A 1 1137 ? 150.809 134.434 121.043 1.00 31.69  ?  1009 ILE A N     1 
ATOM   4775  C  CA    . ILE A 1 1137 ? 150.469 135.835 121.297 1.00 14.32  ?  1009 ILE A CA    1 
ATOM   4776  C  C     . ILE A 1 1137 ? 151.429 136.759 120.559 1.00 12.02  ?  1009 ILE A C     1 
ATOM   4777  O  O     . ILE A 1 1137 ? 151.013 137.650 119.809 1.00 12.83  ?  1009 ILE A O     1 
ATOM   4778  C  CB    . ILE A 1 1137 ? 150.456 136.123 122.808 1.00 12.03  ?  1009 ILE A CB    1 
ATOM   4779  C  CG1   . ILE A 1 1137 ? 149.114 135.693 123.404 1.00 27.38  ?  1009 ILE A CG1   1 
ATOM   4780  C  CG2   . ILE A 1 1137 ? 150.751 137.591 123.072 1.00 11.04  ?  1009 ILE A CG2   1 
ATOM   4781  C  CD1   . ILE A 1 1137 ? 148.847 136.230 124.790 1.00 33.60  ?  1009 ILE A CD1   1 
ATOM   4782  N  N     . LEU A 1 1138 ? 152.725 136.555 120.765 1.00 7.63   ?  1010 LEU A N     1 
ATOM   4783  C  CA    . LEU A 1 1138 ? 153.733 137.386 120.127 1.00 18.25  ?  1010 LEU A CA    1 
ATOM   4784  C  C     . LEU A 1 1138 ? 153.686 137.258 118.617 1.00 6.50   ?  1010 LEU A C     1 
ATOM   4785  O  O     . LEU A 1 1138 ? 153.775 138.259 117.897 1.00 11.43  ?  1010 LEU A O     1 
ATOM   4786  C  CB    . LEU A 1 1138 ? 155.107 137.008 120.655 1.00 7.21   ?  1010 LEU A CB    1 
ATOM   4787  C  CG    . LEU A 1 1138 ? 156.234 137.785 119.998 1.00 17.24  ?  1010 LEU A CG    1 
ATOM   4788  C  CD1   . LEU A 1 1138 ? 156.247 139.203 120.509 1.00 22.85  ?  1010 LEU A CD1   1 
ATOM   4789  C  CD2   . LEU A 1 1138 ? 157.529 137.108 120.319 1.00 21.13  ?  1010 LEU A CD2   1 
ATOM   4790  N  N     . LYS A 1 1139 ? 153.596 136.027 118.119 1.00 10.24  ?  1011 LYS A N     1 
ATOM   4791  C  CA    . LYS A 1 1139 ? 153.495 135.817 116.683 1.00 13.17  ?  1011 LYS A CA    1 
ATOM   4792  C  C     . LYS A 1 1139 ? 152.400 136.696 116.094 1.00 9.72   ?  1011 LYS A C     1 
ATOM   4793  O  O     . LYS A 1 1139 ? 152.634 137.478 115.164 1.00 44.18  ?  1011 LYS A O     1 
ATOM   4794  C  CB    . LYS A 1 1139 ? 153.225 134.338 116.413 1.00 24.68  ?  1011 LYS A CB    1 
ATOM   4795  C  CG    . LYS A 1 1139 ? 153.476 133.914 114.988 1.00 40.81  ?  1011 LYS A CG    1 
ATOM   4796  C  CD    . LYS A 1 1139 ? 153.579 132.403 114.869 1.00 32.72  ?  1011 LYS A CD    1 
ATOM   4797  C  CE    . LYS A 1 1139 ? 152.478 131.857 113.979 1.00 27.39  ?  1011 LYS A CE    1 
ATOM   4798  N  NZ    . LYS A 1 1139 ? 152.561 132.415 112.596 1.00 59.42  ?  1011 LYS A NZ    1 
ATOM   4799  N  N     . HIS A 1 1140 ? 151.206 136.610 116.667 1.00 13.22  ?  1012 HIS A N     1 
ATOM   4800  C  CA    . HIS A 1 1140 ? 150.067 137.319 116.104 1.00 12.41  ?  1012 HIS A CA    1 
ATOM   4801  C  C     . HIS A 1 1140 ? 150.207 138.825 116.271 1.00 15.32  ?  1012 HIS A C     1 
ATOM   4802  O  O     . HIS A 1 1140 ? 149.837 139.588 115.371 1.00 22.79  ?  1012 HIS A O     1 
ATOM   4803  C  CB    . HIS A 1 1140 ? 148.780 136.805 116.737 1.00 14.15  ?  1012 HIS A CB    1 
ATOM   4804  C  CG    . HIS A 1 1140 ? 148.285 135.529 116.127 1.00 16.41  ?  1012 HIS A CG    1 
ATOM   4805  N  ND1   . HIS A 1 1140 ? 146.999 135.067 116.307 1.00 17.14  ?  1012 HIS A ND1   1 
ATOM   4806  C  CD2   . HIS A 1 1140 ? 148.907 134.616 115.346 1.00 17.94  ?  1012 HIS A CD2   1 
ATOM   4807  C  CE1   . HIS A 1 1140 ? 146.849 133.926 115.660 1.00 20.06  ?  1012 HIS A CE1   1 
ATOM   4808  N  NE2   . HIS A 1 1140 ? 147.992 133.630 115.070 1.00 22.84  ?  1012 HIS A NE2   1 
ATOM   4809  N  N     . HIS A 1 1141 ? 150.719 139.277 117.413 1.00 24.69  ?  1013 HIS A N     1 
ATOM   4810  C  CA    . HIS A 1 1141 ? 150.910 140.708 117.605 1.00 22.03  ?  1013 HIS A CA    1 
ATOM   4811  C  C     . HIS A 1 1141 ? 151.839 141.259 116.528 1.00 26.30  ?  1013 HIS A C     1 
ATOM   4812  O  O     . HIS A 1 1141 ? 151.493 142.213 115.815 1.00 11.67  ?  1013 HIS A O     1 
ATOM   4813  C  CB    . HIS A 1 1141 ? 151.452 140.955 119.015 1.00 22.06  ?  1013 HIS A CB    1 
ATOM   4814  C  CG    . HIS A 1 1141 ? 151.459 142.392 119.445 1.00 24.90  ?  1013 HIS A CG    1 
ATOM   4815  N  ND1   . HIS A 1 1141 ? 151.510 143.443 118.557 1.00 25.50  ?  1013 HIS A ND1   1 
ATOM   4816  C  CD2   . HIS A 1 1141 ? 151.438 142.946 120.682 1.00 8.07   ?  1013 HIS A CD2   1 
ATOM   4817  C  CE1   . HIS A 1 1141 ? 151.517 144.581 119.227 1.00 26.78  ?  1013 HIS A CE1   1 
ATOM   4818  N  NE2   . HIS A 1 1141 ? 151.475 144.307 120.517 1.00 12.67  ?  1013 HIS A NE2   1 
ATOM   4819  N  N     . TRP A 1 1142 ? 153.007 140.634 116.359 1.00 26.48  ?  1014 TRP A N     1 
ATOM   4820  C  CA    . TRP A 1 1142 ? 153.919 141.051 115.300 1.00 27.89  ?  1014 TRP A CA    1 
ATOM   4821  C  C     . TRP A 1 1142 ? 153.233 141.066 113.951 1.00 24.29  ?  1014 TRP A C     1 
ATOM   4822  O  O     . TRP A 1 1142 ? 153.351 142.036 113.193 1.00 26.20  ?  1014 TRP A O     1 
ATOM   4823  C  CB    . TRP A 1 1142 ? 155.151 140.150 115.248 1.00 47.67  ?  1014 TRP A CB    1 
ATOM   4824  C  CG    . TRP A 1 1142 ? 156.132 140.565 114.191 1.00 34.99  ?  1014 TRP A CG    1 
ATOM   4825  C  CD1   . TRP A 1 1142 ? 155.944 140.576 112.839 1.00 38.41  ?  1014 TRP A CD1   1 
ATOM   4826  C  CD2   . TRP A 1 1142 ? 157.399 141.140 114.416 1.00 67.07  ?  1014 TRP A CD2   1 
ATOM   4827  N  NE1   . TRP A 1 1142 ? 157.054 141.061 112.210 1.00 37.22  ?  1014 TRP A NE1   1 
ATOM   4828  C  CE2   . TRP A 1 1142 ? 157.963 141.423 113.162 1.00 62.81  ?  1014 TRP A CE2   1 
ATOM   4829  C  CE3   . TRP A 1 1142 ? 158.130 141.420 115.561 1.00 38.11  ?  1014 TRP A CE3   1 
ATOM   4830  C  CZ2   . TRP A 1 1142 ? 159.221 141.970 113.026 1.00 35.39  ?  1014 TRP A CZ2   1 
ATOM   4831  C  CZ3   . TRP A 1 1142 ? 159.371 141.959 115.428 1.00 49.10  ?  1014 TRP A CZ3   1 
ATOM   4832  C  CH2   . TRP A 1 1142 ? 159.912 142.233 114.171 1.00 62.08  ?  1014 TRP A CH2   1 
ATOM   4833  N  N     . LEU A 1 1143 ? 152.549 139.977 113.615 1.00 15.87  ?  1015 LEU A N     1 
ATOM   4834  C  CA    . LEU A 1 1143 ? 151.797 139.941 112.367 1.00 25.67  ?  1015 LEU A CA    1 
ATOM   4835  C  C     . LEU A 1 1143 ? 150.932 141.183 112.222 1.00 12.29  ?  1015 LEU A C     1 
ATOM   4836  O  O     . LEU A 1 1143 ? 150.857 141.782 111.144 1.00 11.72  ?  1015 LEU A O     1 
ATOM   4837  C  CB    . LEU A 1 1143 ? 150.944 138.677 112.317 1.00 17.63  ?  1015 LEU A CB    1 
ATOM   4838  C  CG    . LEU A 1 1143 ? 151.562 137.543 111.502 1.00 33.13  ?  1015 LEU A CG    1 
ATOM   4839  C  CD1   . LEU A 1 1143 ? 151.602 137.951 110.047 1.00 44.46  ?  1015 LEU A CD1   1 
ATOM   4840  C  CD2   . LEU A 1 1143 ? 152.959 137.196 111.995 1.00 72.50  ?  1015 LEU A CD2   1 
ATOM   4841  N  N     . TYR A 1 1144 ? 150.280 141.588 113.308 1.00 10.66  ?  1016 TYR A N     1 
ATOM   4842  C  CA    . TYR A 1 1144 ? 149.412 142.760 113.263 1.00 7.90   ?  1016 TYR A CA    1 
ATOM   4843  C  C     . TYR A 1 1144 ? 150.200 144.014 112.928 1.00 14.06  ?  1016 TYR A C     1 
ATOM   4844  O  O     . TYR A 1 1144 ? 149.748 144.850 112.141 1.00 17.14  ?  1016 TYR A O     1 
ATOM   4845  C  CB    . TYR A 1 1144 ? 148.690 142.924 114.598 1.00 10.23  ?  1016 TYR A CB    1 
ATOM   4846  C  CG    . TYR A 1 1144 ? 147.613 143.987 114.599 1.00 12.41  ?  1016 TYR A CG    1 
ATOM   4847  C  CD1   . TYR A 1 1144 ? 147.079 144.466 113.416 1.00 13.54  ?  1016 TYR A CD1   1 
ATOM   4848  C  CD2   . TYR A 1 1144 ? 147.113 144.492 115.785 1.00 34.19  ?  1016 TYR A CD2   1 
ATOM   4849  C  CE1   . TYR A 1 1144 ? 146.101 145.430 113.420 1.00 32.24  ?  1016 TYR A CE1   1 
ATOM   4850  C  CE2   . TYR A 1 1144 ? 146.124 145.456 115.798 1.00 19.83  ?  1016 TYR A CE2   1 
ATOM   4851  C  CZ    . TYR A 1 1144 ? 145.621 145.920 114.613 1.00 30.55  ?  1016 TYR A CZ    1 
ATOM   4852  O  OH    . TYR A 1 1144 ? 144.633 146.879 114.607 1.00 25.89  ?  1016 TYR A OH    1 
ATOM   4853  N  N     . THR A 1 1145 ? 151.386 144.159 113.502 1.00 6.68   ?  1017 THR A N     1 
ATOM   4854  C  CA    . THR A 1 1145 ? 152.071 145.446 113.447 1.00 19.12  ?  1017 THR A CA    1 
ATOM   4855  C  C     . THR A 1 1145 ? 153.100 145.523 112.341 1.00 18.55  ?  1017 THR A C     1 
ATOM   4856  O  O     . THR A 1 1145 ? 154.165 146.119 112.523 1.00 16.05  ?  1017 THR A O     1 
ATOM   4857  C  CB    . THR A 1 1145 ? 152.730 145.748 114.775 1.00 21.57  ?  1017 THR A CB    1 
ATOM   4858  O  OG1   . THR A 1 1145 ? 153.643 146.837 114.609 1.00 22.72  ?  1017 THR A OG1   1 
ATOM   4859  C  CG2   . THR A 1 1145 ? 153.505 144.553 115.219 1.00 65.86  ?  1017 THR A CG2   1 
ATOM   4860  N  N     . SER A 1 1146 ? 152.840 144.928 111.188 1.00 16.97  ?  1018 SER A N     1 
ATOM   4861  C  CA    . SER A 1 1146 ? 153.759 145.043 110.067 1.00 23.66  ?  1018 SER A CA    1 
ATOM   4862  C  C     . SER A 1 1146 ? 153.183 145.965 109.001 1.00 23.15  ?  1018 SER A C     1 
ATOM   4863  O  O     . SER A 1 1146 ? 151.981 145.947 108.728 1.00 22.11  ?  1018 SER A O     1 
ATOM   4864  C  CB    . SER A 1 1146 ? 154.069 143.675 109.464 1.00 35.87  ?  1018 SER A CB    1 
ATOM   4865  O  OG    . SER A 1 1146 ? 154.638 143.817 108.178 1.00 54.67  ?  1018 SER A OG    1 
ATOM   4866  N  N     . LYS A 1 1147 ? 154.060 146.776 108.408 1.00 26.88  ?  1019 LYS A N     1 
ATOM   4867  C  CA    . LYS A 1 1147 ? 153.661 147.651 107.311 1.00 22.42  ?  1019 LYS A CA    1 
ATOM   4868  C  C     . LYS A 1 1147 ? 153.083 146.852 106.152 1.00 29.77  ?  1019 LYS A C     1 
ATOM   4869  O  O     . LYS A 1 1147 ? 152.134 147.295 105.498 1.00 34.94  ?  1019 LYS A O     1 
ATOM   4870  C  CB    . LYS A 1 1147 ? 154.863 148.471 106.834 1.00 22.00  ?  1019 LYS A CB    1 
ATOM   4871  C  CG    . LYS A 1 1147 ? 154.548 149.835 106.248 1.00 16.80  ?  1019 LYS A CG    1 
ATOM   4872  C  CD    . LYS A 1 1147 ? 154.064 150.802 107.308 1.00 22.87  ?  1019 LYS A CD    1 
ATOM   4873  C  CE    . LYS A 1 1147 ? 155.071 150.906 108.444 1.00 19.02  ?  1019 LYS A CE    1 
ATOM   4874  N  NZ    . LYS A 1 1147 ? 154.581 151.731 109.586 1.00 24.70  ?  1019 LYS A NZ    1 
ATOM   4875  N  N     . TYR A 1 1148 ? 153.670 145.687 105.866 1.00 33.53  ?  1020 TYR A N     1 
ATOM   4876  C  CA    . TYR A 1 1148 ? 153.315 144.918 104.675 1.00 28.87  ?  1020 TYR A CA    1 
ATOM   4877  C  C     . TYR A 1 1148 ? 151.843 144.552 104.679 1.00 17.86  ?  1020 TYR A C     1 
ATOM   4878  O  O     . TYR A 1 1148 ? 151.126 144.768 103.697 1.00 34.72  ?  1020 TYR A O     1 
ATOM   4879  C  CB    . TYR A 1 1148 ? 154.152 143.644 104.597 1.00 40.05  ?  1020 TYR A CB    1 
ATOM   4880  C  CG    . TYR A 1 1148 ? 154.194 143.014 103.218 1.00 35.39  ?  1020 TYR A CG    1 
ATOM   4881  C  CD1   . TYR A 1 1148 ? 153.634 143.654 102.127 1.00 39.42  ?  1020 TYR A CD1   1 
ATOM   4882  C  CD2   . TYR A 1 1148 ? 154.802 141.783 103.008 1.00 44.02  ?  1020 TYR A CD2   1 
ATOM   4883  C  CE1   . TYR A 1 1148 ? 153.678 143.093 100.874 1.00 59.19  ?  1020 TYR A CE1   1 
ATOM   4884  C  CE2   . TYR A 1 1148 ? 154.849 141.211 101.746 1.00 43.08  ?  1020 TYR A CE2   1 
ATOM   4885  C  CZ    . TYR A 1 1148 ? 154.282 141.872 100.686 1.00 52.51  ?  1020 TYR A CZ    1 
ATOM   4886  O  OH    . TYR A 1 1148 ? 154.322 141.315 99.429  1.00 61.25  ?  1020 TYR A OH    1 
ATOM   4887  N  N     . LEU A 1 1149 ? 151.387 143.954 105.772 1.00 13.99  ?  1021 LEU A N     1 
ATOM   4888  C  CA    . LEU A 1 1149 ? 150.031 143.445 105.820 1.00 15.80  ?  1021 LEU A CA    1 
ATOM   4889  C  C     . LEU A 1 1149 ? 149.006 144.562 105.945 1.00 16.62  ?  1021 LEU A C     1 
ATOM   4890  O  O     . LEU A 1 1149 ? 147.832 144.350 105.624 1.00 15.35  ?  1021 LEU A O     1 
ATOM   4891  C  CB    . LEU A 1 1149 ? 149.901 142.474 106.986 1.00 15.02  ?  1021 LEU A CB    1 
ATOM   4892  C  CG    . LEU A 1 1149 ? 150.590 141.155 106.671 1.00 14.22  ?  1021 LEU A CG    1 
ATOM   4893  C  CD1   . LEU A 1 1149 ? 152.023 141.162 107.174 1.00 17.22  ?  1021 LEU A CD1   1 
ATOM   4894  C  CD2   . LEU A 1 1149 ? 149.807 140.015 107.262 1.00 32.46  ?  1021 LEU A CD2   1 
ATOM   4895  N  N     . GLN A 1 1150 ? 149.426 145.747 106.388 1.00 18.10  ?  1022 GLN A N     1 
ATOM   4896  C  CA    . GLN A 1 1150 ? 148.517 146.883 106.427 1.00 16.34  ?  1022 GLN A CA    1 
ATOM   4897  C  C     . GLN A 1 1150 ? 148.407 147.541 105.060 1.00 28.71  ?  1022 GLN A C     1 
ATOM   4898  O  O     . GLN A 1 1150 ? 147.325 147.994 104.670 1.00 37.57  ?  1022 GLN A O     1 
ATOM   4899  C  CB    . GLN A 1 1150 ? 148.973 147.913 107.464 1.00 12.61  ?  1022 GLN A CB    1 
ATOM   4900  C  CG    . GLN A 1 1150 ? 148.815 147.467 108.908 1.00 13.38  ?  1022 GLN A CG    1 
ATOM   4901  C  CD    . GLN A 1 1150 ? 149.836 148.089 109.849 1.00 14.95  ?  1022 GLN A CD    1 
ATOM   4902  O  OE1   . GLN A 1 1150 ? 150.993 148.304 109.490 1.00 24.96  ?  1022 GLN A OE1   1 
ATOM   4903  N  NE2   . GLN A 1 1150 ? 149.407 148.364 111.076 1.00 11.81  ?  1022 GLN A NE2   1 
ATOM   4904  N  N     . LYS A 1 1151 ? 149.517 147.597 104.325 1.00 43.06  ?  1023 LYS A N     1 
ATOM   4905  C  CA    . LYS A 1 1151 ? 149.513 148.202 103.001 1.00 44.75  ?  1023 LYS A CA    1 
ATOM   4906  C  C     . LYS A 1 1151 ? 148.527 147.524 102.064 1.00 60.78  ?  1023 LYS A C     1 
ATOM   4907  O  O     . LYS A 1 1151 ? 148.139 148.118 101.054 1.00 90.34  ?  1023 LYS A O     1 
ATOM   4908  C  CB    . LYS A 1 1151 ? 150.926 148.176 102.409 1.00 48.69  ?  1023 LYS A CB    1 
ATOM   4909  C  CG    . LYS A 1 1151 ? 151.242 149.410 101.574 1.00 76.45  ?  1023 LYS A CG    1 
ATOM   4910  C  CD    . LYS A 1 1151 ? 151.676 150.584 102.451 1.00 104.21 ?  1023 LYS A CD    1 
ATOM   4911  C  CE    . LYS A 1 1151 ? 152.679 151.501 101.751 1.00 113.40 ?  1023 LYS A CE    1 
ATOM   4912  N  NZ    . LYS A 1 1151 ? 152.000 152.440 100.807 1.00 94.30  ?  1023 LYS A NZ    1 
ATOM   4913  N  N     . PHE A 1 1152 ? 148.115 146.298 102.378 1.00 49.20  ?  1024 PHE A N     1 
ATOM   4914  C  CA    . PHE A 1 1152 ? 147.051 145.644 101.625 1.00 38.04  ?  1024 PHE A CA    1 
ATOM   4915  C  C     . PHE A 1 1152 ? 145.676 146.021 102.150 1.00 37.53  ?  1024 PHE A C     1 
ATOM   4916  O  O     . PHE A 1 1152 ? 144.707 146.047 101.383 1.00 46.53  ?  1024 PHE A O     1 
ATOM   4917  C  CB    . PHE A 1 1152 ? 147.243 144.131 101.662 1.00 37.90  ?  1024 PHE A CB    1 
ATOM   4918  C  CG    . PHE A 1 1152 ? 148.464 143.658 100.924 1.00 69.25  ?  1024 PHE A CG    1 
ATOM   4919  C  CD1   . PHE A 1 1152 ? 149.134 144.504 100.053 1.00 99.83  ?  1024 PHE A CD1   1 
ATOM   4920  C  CD2   . PHE A 1 1152 ? 148.938 142.371 101.089 1.00 66.05  ?  1024 PHE A CD2   1 
ATOM   4921  C  CE1   . PHE A 1 1152 ? 150.252 144.073 99.374  1.00 120.19 ?  1024 PHE A CE1   1 
ATOM   4922  C  CE2   . PHE A 1 1152 ? 150.057 141.940 100.406 1.00 83.49  ?  1024 PHE A CE2   1 
ATOM   4923  C  CZ    . PHE A 1 1152 ? 150.707 142.788 99.550  1.00 115.79 ?  1024 PHE A CZ    1 
ATOM   4924  N  N     . MET A 1 1153 ? 145.574 146.321 103.443 1.00 36.81  ?  1025 MET A N     1 
ATOM   4925  C  CA    . MET A 1 1153 ? 144.312 146.750 104.042 1.00 46.66  ?  1025 MET A CA    1 
ATOM   4926  C  C     . MET A 1 1153 ? 144.091 148.245 103.794 1.00 51.68  ?  1025 MET A C     1 
ATOM   4927  O  O     . MET A 1 1153 ? 143.856 149.037 104.702 1.00 42.03  ?  1025 MET A O     1 
ATOM   4928  C  CB    . MET A 1 1153 ? 144.315 146.421 105.526 1.00 43.57  ?  1025 MET A CB    1 
ATOM   4929  C  CG    . MET A 1 1153 ? 142.940 146.335 106.128 1.00 62.83  ?  1025 MET A CG    1 
ATOM   4930  S  SD    . MET A 1 1153 ? 142.146 144.797 105.635 1.00 69.77  ?  1025 MET A SD    1 
ATOM   4931  C  CE    . MET A 1 1153 ? 141.894 143.968 107.212 1.00 94.51  ?  1025 MET A CE    1 
ATOM   4932  N  N     . GLU A 1 1154 ? 144.199 148.627 102.520 1.00 75.80  ?  1026 GLU A N     1 
ATOM   4933  C  CA    . GLU A 1 1154 ? 144.158 150.029 102.135 1.00 91.69  ?  1026 GLU A CA    1 
ATOM   4934  C  C     . GLU A 1 1154 ? 142.810 150.659 102.445 1.00 98.46  ?  1026 GLU A C     1 
ATOM   4935  O  O     . GLU A 1 1154 ? 142.706 151.520 103.322 1.00 98.15  ?  1026 GLU A O     1 
ATOM   4936  C  CB    . GLU A 1 1154 ? 144.453 150.181 100.636 1.00 121.13 ?  1026 GLU A CB    1 
ATOM   4937  C  CG    . GLU A 1 1154 ? 145.918 150.325 100.280 1.00 169.51 ?  1026 GLU A CG    1 
ATOM   4938  C  CD    . GLU A 1 1154 ? 146.392 151.768 100.342 1.00 229.20 ?  1026 GLU A CD    1 
ATOM   4939  O  OE1   . GLU A 1 1154 ? 146.326 152.353 101.442 1.00 191.80 ?  1026 GLU A OE1   1 
ATOM   4940  O  OE2   . GLU A 1 1154 ? 146.803 152.309 99.290  1.00 424.87 -1 1026 GLU A OE2   1 
ATOM   4941  N  N     . ALA A 1 1155 ? 141.772 150.210 101.736 1.00 81.60  ?  1027 ALA A N     1 
ATOM   4942  C  CA    . ALA A 1 1155 ? 140.432 150.782 101.819 1.00 73.40  ?  1027 ALA A CA    1 
ATOM   4943  C  C     . ALA A 1 1155 ? 140.474 152.311 101.747 1.00 89.04  ?  1027 ALA A C     1 
ATOM   4944  O  O     . ALA A 1 1155 ? 139.943 153.030 102.604 1.00 80.91  ?  1027 ALA A O     1 
ATOM   4945  C  CB    . ALA A 1 1155 ? 139.718 150.301 103.080 1.00 92.52  ?  1027 ALA A CB    1 
ATOM   4946  N  N     . HIS A 1 1156 ? 141.102 152.768 100.661 1.00 108.84 ?  1028 HIS A N     1 
ATOM   4947  C  CA    . HIS A 1 1156 ? 141.446 154.150 100.336 1.00 122.76 ?  1028 HIS A CA    1 
ATOM   4948  C  C     . HIS A 1 1156 ? 140.797 155.239 101.201 1.00 127.90 ?  1028 HIS A C     1 
ATOM   4949  O  O     . HIS A 1 1156 ? 139.880 155.939 100.773 1.00 135.43 ?  1028 HIS A O     1 
ATOM   4950  C  CB    . HIS A 1 1156 ? 141.108 154.434 98.859  1.00 135.53 ?  1028 HIS A CB    1 
ATOM   4951  C  CG    . HIS A 1 1156 ? 142.146 153.946 97.879  1.00 169.78 ?  1028 HIS A CG    1 
ATOM   4952  N  ND1   . HIS A 1 1156 ? 143.415 153.548 98.254  1.00 193.75 ?  1028 HIS A ND1   1 
ATOM   4953  C  CD2   . HIS A 1 1156 ? 142.104 153.840 96.530  1.00 173.83 ?  1028 HIS A CD2   1 
ATOM   4954  C  CE1   . HIS A 1 1156 ? 144.093 153.196 97.179  1.00 210.03 ?  1028 HIS A CE1   1 
ATOM   4955  N  NE2   . HIS A 1 1156 ? 143.322 153.366 96.122  1.00 192.19 ?  1028 HIS A NE2   1 
ATOM   4956  N  N     . MET B 2 4    ? 164.344 121.356 170.962 1.00 126.44 ?  1    MET B N     1 
ATOM   4957  C  CA    . MET B 2 4    ? 163.905 121.292 169.572 1.00 114.38 ?  1    MET B CA    1 
ATOM   4958  C  C     . MET B 2 4    ? 162.413 121.576 169.450 1.00 101.92 ?  1    MET B C     1 
ATOM   4959  O  O     . MET B 2 4    ? 161.617 120.680 169.168 1.00 89.20  ?  1    MET B O     1 
ATOM   4960  C  CB    . MET B 2 4    ? 164.242 119.928 168.967 1.00 114.33 ?  1    MET B CB    1 
ATOM   4961  C  CG    . MET B 2 4    ? 165.728 119.596 168.970 1.00 135.20 ?  1    MET B CG    1 
ATOM   4962  S  SD    . MET B 2 4    ? 166.752 120.888 168.227 1.00 130.08 ?  1    MET B SD    1 
ATOM   4963  C  CE    . MET B 2 4    ? 166.014 121.047 166.605 1.00 92.58  ?  1    MET B CE    1 
ATOM   4964  N  N     . SER B 2 5    ? 162.047 122.839 169.653 1.00 115.33 ?  2    SER B N     1 
ATOM   4965  C  CA    . SER B 2 5    ? 160.662 123.274 169.585 1.00 113.17 ?  2    SER B CA    1 
ATOM   4966  C  C     . SER B 2 5    ? 160.548 124.473 168.654 1.00 96.38  ?  2    SER B C     1 
ATOM   4967  O  O     . SER B 2 5    ? 161.472 125.285 168.540 1.00 85.59  ?  2    SER B O     1 
ATOM   4968  C  CB    . SER B 2 5    ? 160.117 123.631 170.976 1.00 125.54 ?  2    SER B CB    1 
ATOM   4969  O  OG    . SER B 2 5    ? 158.774 124.070 170.907 1.00 115.17 ?  2    SER B OG    1 
ATOM   4970  N  N     . LEU B 2 6    ? 159.395 124.568 167.992 1.00 98.71  ?  3    LEU B N     1 
ATOM   4971  C  CA    . LEU B 2 6    ? 159.099 125.616 167.027 1.00 96.64  ?  3    LEU B CA    1 
ATOM   4972  C  C     . LEU B 2 6    ? 157.879 126.410 167.473 1.00 109.41 ?  3    LEU B C     1 
ATOM   4973  O  O     . LEU B 2 6    ? 156.913 125.846 167.997 1.00 104.69 ?  3    LEU B O     1 
ATOM   4974  C  CB    . LEU B 2 6    ? 158.851 125.028 165.632 1.00 78.58  ?  3    LEU B CB    1 
ATOM   4975  C  CG    . LEU B 2 6    ? 157.835 123.887 165.520 1.00 73.80  ?  3    LEU B CG    1 
ATOM   4976  C  CD1   . LEU B 2 6    ? 156.431 124.382 165.183 1.00 49.70  ?  3    LEU B CD1   1 
ATOM   4977  C  CD2   . LEU B 2 6    ? 158.317 122.870 164.504 1.00 85.87  ?  3    LEU B CD2   1 
ATOM   4978  N  N     . GLN B 2 7    ? 157.938 127.723 167.259 1.00 107.57 ?  4    GLN B N     1 
ATOM   4979  C  CA    . GLN B 2 7    ? 156.789 128.604 167.429 1.00 95.89  ?  4    GLN B CA    1 
ATOM   4980  C  C     . GLN B 2 7    ? 156.588 129.364 166.124 1.00 95.23  ?  4    GLN B C     1 
ATOM   4981  O  O     . GLN B 2 7    ? 157.532 130.030 165.643 1.00 99.46  ?  4    GLN B O     1 
ATOM   4982  C  CB    . GLN B 2 7    ? 156.946 129.560 168.623 1.00 81.69  ?  4    GLN B CB    1 
ATOM   4983  C  CG    . GLN B 2 7    ? 158.186 130.464 168.620 1.00 81.39  ?  4    GLN B CG    1 
ATOM   4984  C  CD    . GLN B 2 7    ? 159.457 129.737 169.023 1.00 110.29 ?  4    GLN B CD    1 
ATOM   4985  O  OE1   . GLN B 2 7    ? 159.509 128.508 169.034 1.00 113.54 ?  4    GLN B OE1   1 
ATOM   4986  N  NE2   . GLN B 2 7    ? 160.493 130.499 169.353 1.00 120.08 ?  4    GLN B NE2   1 
ATOM   4987  N  N     . PRO B 2 8    ? 155.419 129.256 165.491 1.00 84.92  ?  5    PRO B N     1 
ATOM   4988  C  CA    . PRO B 2 8    ? 155.147 130.083 164.311 1.00 89.96  ?  5    PRO B CA    1 
ATOM   4989  C  C     . PRO B 2 8    ? 154.955 131.540 164.711 1.00 101.39 ?  5    PRO B C     1 
ATOM   4990  O  O     . PRO B 2 8    ? 154.112 131.866 165.549 1.00 93.50  ?  5    PRO B O     1 
ATOM   4991  C  CB    . PRO B 2 8    ? 153.866 129.472 163.731 1.00 65.66  ?  5    PRO B CB    1 
ATOM   4992  C  CG    . PRO B 2 8    ? 153.230 128.774 164.882 1.00 66.37  ?  5    PRO B CG    1 
ATOM   4993  C  CD    . PRO B 2 8    ? 154.359 128.261 165.725 1.00 77.64  ?  5    PRO B CD    1 
ATOM   4994  N  N     . LEU B 2 9    ? 155.751 132.416 164.104 1.00 109.64 ?  6    LEU B N     1 
ATOM   4995  C  CA    . LEU B 2 9    ? 155.656 133.844 164.351 1.00 113.97 ?  6    LEU B CA    1 
ATOM   4996  C  C     . LEU B 2 9    ? 154.631 134.442 163.388 1.00 117.42 ?  6    LEU B C     1 
ATOM   4997  O  O     . LEU B 2 9    ? 153.958 133.730 162.639 1.00 114.22 ?  6    LEU B O     1 
ATOM   4998  C  CB    . LEU B 2 9    ? 157.033 134.499 164.217 1.00 90.90  ?  6    LEU B CB    1 
ATOM   4999  C  CG    . LEU B 2 9    ? 158.209 133.698 164.784 1.00 80.08  ?  6    LEU B CG    1 
ATOM   5000  C  CD1   . LEU B 2 9    ? 159.525 134.393 164.481 1.00 64.33  ?  6    LEU B CD1   1 
ATOM   5001  C  CD2   . LEU B 2 9    ? 158.052 133.453 166.280 1.00 95.52  ?  6    LEU B CD2   1 
ATOM   5002  N  N     . THR B 2 10   ? 154.490 135.764 163.403 1.00 113.37 ?  7    THR B N     1 
ATOM   5003  C  CA    . THR B 2 10   ? 153.601 136.448 162.479 1.00 105.75 ?  7    THR B CA    1 
ATOM   5004  C  C     . THR B 2 10   ? 154.299 137.698 161.969 1.00 100.55 ?  7    THR B C     1 
ATOM   5005  O  O     . THR B 2 10   ? 154.994 138.382 162.724 1.00 105.70 ?  7    THR B O     1 
ATOM   5006  C  CB    . THR B 2 10   ? 152.256 136.815 163.131 1.00 143.99 ?  7    THR B CB    1 
ATOM   5007  O  OG1   . THR B 2 10   ? 152.487 137.431 164.403 1.00 179.77 ?  7    THR B OG1   1 
ATOM   5008  C  CG2   . THR B 2 10   ? 151.390 135.573 163.323 1.00 129.90 ?  7    THR B CG2   1 
ATOM   5009  N  N     . ALA B 2 11   ? 154.122 137.979 160.681 1.00 101.29 ?  8    ALA B N     1 
ATOM   5010  C  CA    . ALA B 2 11   ? 154.699 139.168 160.058 1.00 112.34 ?  8    ALA B CA    1 
ATOM   5011  C  C     . ALA B 2 11   ? 153.873 140.376 160.476 1.00 128.00 ?  8    ALA B C     1 
ATOM   5012  O  O     . ALA B 2 11   ? 152.818 140.650 159.903 1.00 132.25 ?  8    ALA B O     1 
ATOM   5013  C  CB    . ALA B 2 11   ? 154.736 139.020 158.543 1.00 127.16 ?  8    ALA B CB    1 
ATOM   5014  N  N     . VAL B 2 12   ? 154.353 141.099 161.490 1.00 140.95 ?  9    VAL B N     1 
ATOM   5015  C  CA    . VAL B 2 12   ? 153.643 142.281 161.970 1.00 161.16 ?  9    VAL B CA    1 
ATOM   5016  C  C     . VAL B 2 12   ? 153.609 143.360 160.889 1.00 155.85 ?  9    VAL B C     1 
ATOM   5017  O  O     . VAL B 2 12   ? 152.536 143.822 160.485 1.00 161.30 ?  9    VAL B O     1 
ATOM   5018  C  CB    . VAL B 2 12   ? 154.260 142.787 163.289 1.00 149.02 ?  9    VAL B CB    1 
ATOM   5019  C  CG1   . VAL B 2 12   ? 155.770 142.873 163.202 1.00 125.30 ?  9    VAL B CG1   1 
ATOM   5020  C  CG2   . VAL B 2 12   ? 153.683 144.144 163.668 1.00 150.28 ?  9    VAL B CG2   1 
ATOM   5021  N  N     . ASN B 2 13   ? 154.774 143.771 160.403 1.00 131.46 ?  10   ASN B N     1 
ATOM   5022  C  CA    . ASN B 2 13   ? 154.861 144.747 159.327 1.00 130.74 ?  10   ASN B CA    1 
ATOM   5023  C  C     . ASN B 2 13   ? 156.183 144.543 158.601 1.00 143.29 ?  10   ASN B C     1 
ATOM   5024  O  O     . ASN B 2 13   ? 157.013 143.723 159.002 1.00 128.93 ?  10   ASN B O     1 
ATOM   5025  C  CB    . ASN B 2 13   ? 154.729 146.179 159.855 1.00 119.89 ?  10   ASN B CB    1 
ATOM   5026  C  CG    . ASN B 2 13   ? 155.786 146.518 160.886 1.00 118.76 ?  10   ASN B CG    1 
ATOM   5027  O  OD1   . ASN B 2 13   ? 156.131 145.699 161.734 1.00 117.34 ?  10   ASN B OD1   1 
ATOM   5028  N  ND2   . ASN B 2 13   ? 156.304 147.740 160.819 1.00 118.47 ?  10   ASN B ND2   1 
ATOM   5029  N  N     . CYS B 2 14   ? 156.372 145.302 157.523 1.00 157.59 ?  11   CYS B N     1 
ATOM   5030  C  CA    . CYS B 2 14   ? 157.599 145.258 156.730 1.00 148.04 ?  11   CYS B CA    1 
ATOM   5031  C  C     . CYS B 2 14   ? 157.878 143.854 156.195 1.00 124.12 ?  11   CYS B C     1 
ATOM   5032  O  O     . CYS B 2 14   ? 159.032 143.425 156.114 1.00 94.08  ?  11   CYS B O     1 
ATOM   5033  C  CB    . CYS B 2 14   ? 158.796 145.776 157.535 1.00 148.69 ?  11   CYS B CB    1 
ATOM   5034  S  SG    . CYS B 2 14   ? 158.435 147.219 158.570 1.00 180.30 ?  11   CYS B SG    1 
ATOM   5035  N  N     . GLY B 2 15   ? 156.817 143.132 155.827 1.00 140.29 ?  12   GLY B N     1 
ATOM   5036  C  CA    . GLY B 2 15   ? 156.935 141.781 155.318 1.00 131.44 ?  12   GLY B CA    1 
ATOM   5037  C  C     . GLY B 2 15   ? 157.185 141.652 153.832 1.00 99.03  ?  12   GLY B C     1 
ATOM   5038  O  O     . GLY B 2 15   ? 157.485 140.553 153.359 1.00 103.84 ?  12   GLY B O     1 
ATOM   5039  N  N     . SER B 2 16   ? 157.067 142.745 153.078 1.00 83.49  ?  13   SER B N     1 
ATOM   5040  C  CA    . SER B 2 16   ? 157.418 142.775 151.663 1.00 61.27  ?  13   SER B CA    1 
ATOM   5041  C  C     . SER B 2 16   ? 158.890 143.078 151.433 1.00 48.91  ?  13   SER B C     1 
ATOM   5042  O  O     . SER B 2 16   ? 159.256 143.537 150.343 1.00 46.08  ?  13   SER B O     1 
ATOM   5043  C  CB    . SER B 2 16   ? 156.553 143.803 150.930 1.00 73.19  ?  13   SER B CB    1 
ATOM   5044  O  OG    . SER B 2 16   ? 156.859 145.123 151.344 1.00 58.78  ?  13   SER B OG    1 
ATOM   5045  N  N     . LEU B 2 17   ? 159.737 142.826 152.431 1.00 48.09  ?  14   LEU B N     1 
ATOM   5046  C  CA    . LEU B 2 17   ? 161.105 143.318 152.430 1.00 40.34  ?  14   LEU B CA    1 
ATOM   5047  C  C     . LEU B 2 17   ? 162.137 142.204 152.583 1.00 31.19  ?  14   LEU B C     1 
ATOM   5048  O  O     . LEU B 2 17   ? 163.323 142.497 152.778 1.00 28.47  ?  14   LEU B O     1 
ATOM   5049  C  CB    . LEU B 2 17   ? 161.273 144.346 153.554 1.00 45.96  ?  14   LEU B CB    1 
ATOM   5050  C  CG    . LEU B 2 17   ? 160.307 145.535 153.510 1.00 60.48  ?  14   LEU B CG    1 
ATOM   5051  C  CD1   . LEU B 2 17   ? 160.690 146.599 154.525 1.00 105.77 ?  14   LEU B CD1   1 
ATOM   5052  C  CD2   . LEU B 2 17   ? 160.227 146.141 152.115 1.00 44.38  ?  14   LEU B CD2   1 
ATOM   5053  N  N     . VAL B 2 18   ? 161.723 140.940 152.513 1.00 29.64  ?  15   VAL B N     1 
ATOM   5054  C  CA    . VAL B 2 18   ? 162.623 139.802 152.626 1.00 15.89  ?  15   VAL B CA    1 
ATOM   5055  C  C     . VAL B 2 18   ? 162.561 139.013 151.335 1.00 23.52  ?  15   VAL B C     1 
ATOM   5056  O  O     . VAL B 2 18   ? 161.474 138.727 150.821 1.00 26.22  ?  15   VAL B O     1 
ATOM   5057  C  CB    . VAL B 2 18   ? 162.275 138.902 153.818 1.00 21.17  ?  15   VAL B CB    1 
ATOM   5058  C  CG1   . VAL B 2 18   ? 163.297 137.790 153.952 1.00 20.60  ?  15   VAL B CG1   1 
ATOM   5059  C  CG2   . VAL B 2 18   ? 162.212 139.728 155.077 1.00 34.54  ?  15   VAL B CG2   1 
ATOM   5060  N  N     . GLN B 2 19   ? 163.724 138.649 150.830 1.00 32.17  ?  16   GLN B N     1 
ATOM   5061  C  CA    . GLN B 2 19   ? 163.866 137.968 149.560 1.00 38.32  ?  16   GLN B CA    1 
ATOM   5062  C  C     . GLN B 2 19   ? 164.464 136.589 149.796 1.00 32.90  ?  16   GLN B C     1 
ATOM   5063  O  O     . GLN B 2 19   ? 165.057 136.336 150.852 1.00 32.12  ?  16   GLN B O     1 
ATOM   5064  C  CB    . GLN B 2 19   ? 164.747 138.801 148.619 1.00 57.06  ?  16   GLN B CB    1 
ATOM   5065  C  CG    . GLN B 2 19   ? 165.996 139.356 149.261 1.00 68.92  ?  16   GLN B CG    1 
ATOM   5066  C  CD    . GLN B 2 19   ? 166.855 140.085 148.256 1.00 85.08  ?  16   GLN B CD    1 
ATOM   5067  O  OE1   . GLN B 2 19   ? 166.562 140.072 147.061 1.00 73.89  ?  16   GLN B OE1   1 
ATOM   5068  N  NE2   . GLN B 2 19   ? 167.940 140.694 148.724 1.00 84.52  ?  16   GLN B NE2   1 
ATOM   5069  N  N     . PRO B 2 20   ? 164.299 135.663 148.848 1.00 40.64  ?  17   PRO B N     1 
ATOM   5070  C  CA    . PRO B 2 20   ? 164.738 134.274 149.087 1.00 52.65  ?  17   PRO B CA    1 
ATOM   5071  C  C     . PRO B 2 20   ? 166.168 134.142 149.588 1.00 40.07  ?  17   PRO B C     1 
ATOM   5072  O  O     . PRO B 2 20   ? 166.425 133.348 150.502 1.00 39.60  ?  17   PRO B O     1 
ATOM   5073  C  CB    . PRO B 2 20   ? 164.547 133.622 147.708 1.00 64.64  ?  17   PRO B CB    1 
ATOM   5074  C  CG    . PRO B 2 20   ? 163.483 134.460 147.065 1.00 47.40  ?  17   PRO B CG    1 
ATOM   5075  C  CD    . PRO B 2 20   ? 163.806 135.844 147.471 1.00 49.22  ?  17   PRO B CD    1 
ATOM   5076  N  N     . GLY B 2 21   ? 167.112 134.878 149.011 1.00 28.05  ?  18   GLY B N     1 
ATOM   5077  C  CA    . GLY B 2 21   ? 168.447 134.955 149.571 1.00 20.18  ?  18   GLY B CA    1 
ATOM   5078  C  C     . GLY B 2 21   ? 168.553 136.160 150.490 1.00 31.29  ?  18   GLY B C     1 
ATOM   5079  O  O     . GLY B 2 21   ? 168.036 137.229 150.189 1.00 37.92  ?  18   GLY B O     1 
ATOM   5080  N  N     . PHE B 2 22   ? 169.229 135.967 151.619 1.00 27.77  ?  19   PHE B N     1 
ATOM   5081  C  CA    . PHE B 2 22   ? 169.441 137.021 152.605 1.00 23.80  ?  19   PHE B CA    1 
ATOM   5082  C  C     . PHE B 2 22   ? 170.377 136.471 153.675 1.00 32.62  ?  19   PHE B C     1 
ATOM   5083  O  O     . PHE B 2 22   ? 170.616 135.265 153.749 1.00 34.55  ?  19   PHE B O     1 
ATOM   5084  C  CB    . PHE B 2 22   ? 168.122 137.514 153.215 1.00 21.95  ?  19   PHE B CB    1 
ATOM   5085  C  CG    . PHE B 2 22   ? 167.495 136.556 154.187 1.00 21.14  ?  19   PHE B CG    1 
ATOM   5086  C  CD1   . PHE B 2 22   ? 167.309 135.225 153.866 1.00 28.12  ?  19   PHE B CD1   1 
ATOM   5087  C  CD2   . PHE B 2 22   ? 167.100 136.994 155.433 1.00 19.02  ?  19   PHE B CD2   1 
ATOM   5088  C  CE1   . PHE B 2 22   ? 166.733 134.355 154.769 1.00 28.60  ?  19   PHE B CE1   1 
ATOM   5089  C  CE2   . PHE B 2 22   ? 166.527 136.122 156.337 1.00 18.85  ?  19   PHE B CE2   1 
ATOM   5090  C  CZ    . PHE B 2 22   ? 166.344 134.812 156.005 1.00 26.89  ?  19   PHE B CZ    1 
ATOM   5091  N  N     . SER B 2 23   ? 170.906 137.371 154.511 1.00 36.50  ?  20   SER B N     1 
ATOM   5092  C  CA    . SER B 2 23   ? 171.852 136.993 155.559 1.00 34.70  ?  20   SER B CA    1 
ATOM   5093  C  C     . SER B 2 23   ? 171.479 137.658 156.882 1.00 38.43  ?  20   SER B C     1 
ATOM   5094  O  O     . SER B 2 23   ? 170.913 138.754 156.910 1.00 40.98  ?  20   SER B O     1 
ATOM   5095  C  CB    . SER B 2 23   ? 173.305 137.364 155.179 1.00 26.33  ?  20   SER B CB    1 
ATOM   5096  O  OG    . SER B 2 23   ? 173.609 136.995 153.843 1.00 22.88  ?  20   SER B OG    1 
ATOM   5097  N  N     . LEU B 2 24   ? 171.805 136.980 157.985 1.00 34.43  ?  21   LEU B N     1 
ATOM   5098  C  CA    . LEU B 2 24   ? 171.597 137.491 159.339 1.00 34.04  ?  21   LEU B CA    1 
ATOM   5099  C  C     . LEU B 2 24   ? 172.953 137.575 160.030 1.00 28.84  ?  21   LEU B C     1 
ATOM   5100  O  O     . LEU B 2 24   ? 173.679 136.580 160.100 1.00 29.06  ?  21   LEU B O     1 
ATOM   5101  C  CB    . LEU B 2 24   ? 170.623 136.604 160.140 1.00 34.08  ?  21   LEU B CB    1 
ATOM   5102  C  CG    . LEU B 2 24   ? 169.148 136.442 159.712 1.00 29.11  ?  21   LEU B CG    1 
ATOM   5103  C  CD1   . LEU B 2 24   ? 168.212 136.014 160.862 1.00 36.69  ?  21   LEU B CD1   1 
ATOM   5104  C  CD2   . LEU B 2 24   ? 168.626 137.719 159.071 1.00 33.89  ?  21   LEU B CD2   1 
ATOM   5105  N  N     . LEU B 2 25   ? 173.296 138.761 160.531 1.00 33.62  ?  22   LEU B N     1 
ATOM   5106  C  CA    . LEU B 2 25   ? 174.528 138.982 161.275 1.00 35.27  ?  22   LEU B CA    1 
ATOM   5107  C  C     . LEU B 2 25   ? 174.187 139.012 162.761 1.00 70.00  ?  22   LEU B C     1 
ATOM   5108  O  O     . LEU B 2 25   ? 173.498 139.927 163.234 1.00 71.72  ?  22   LEU B O     1 
ATOM   5109  C  CB    . LEU B 2 25   ? 175.205 140.275 160.832 1.00 40.76  ?  22   LEU B CB    1 
ATOM   5110  C  CG    . LEU B 2 25   ? 175.453 140.319 159.329 1.00 30.39  ?  22   LEU B CG    1 
ATOM   5111  C  CD1   . LEU B 2 25   ? 176.228 141.571 158.945 1.00 37.40  ?  22   LEU B CD1   1 
ATOM   5112  C  CD2   . LEU B 2 25   ? 176.162 139.057 158.861 1.00 30.03  ?  22   LEU B CD2   1 
ATOM   5113  N  N     . ASP B 2 26   ? 174.651 137.989 163.479 1.00 106.34 ?  23   ASP B N     1 
ATOM   5114  C  CA    . ASP B 2 26   ? 174.484 137.877 164.923 1.00 144.73 ?  23   ASP B CA    1 
ATOM   5115  C  C     . ASP B 2 26   ? 175.698 138.506 165.596 1.00 106.94 ?  23   ASP B C     1 
ATOM   5116  O  O     . ASP B 2 26   ? 176.806 137.968 165.521 1.00 95.11  ?  23   ASP B O     1 
ATOM   5117  C  CB    . ASP B 2 26   ? 174.321 136.417 165.341 1.00 214.02 ?  23   ASP B CB    1 
ATOM   5118  C  CG    . ASP B 2 26   ? 173.548 136.256 166.644 1.00 249.42 ?  23   ASP B CG    1 
ATOM   5119  O  OD1   . ASP B 2 26   ? 173.802 137.044 167.581 1.00 222.03 ?  23   ASP B OD1   1 
ATOM   5120  O  OD2   . ASP B 2 26   ? 172.696 135.348 166.737 1.00 352.15 -1 23   ASP B OD2   1 
ATOM   5121  N  N     . LEU B 2 27   ? 175.488 139.644 166.253 1.00 77.42  ?  24   LEU B N     1 
ATOM   5122  C  CA    . LEU B 2 27   ? 176.565 140.308 166.969 1.00 77.71  ?  24   LEU B CA    1 
ATOM   5123  C  C     . LEU B 2 27   ? 175.950 141.273 167.970 1.00 79.48  ?  24   LEU B C     1 
ATOM   5124  O  O     . LEU B 2 27   ? 174.974 141.959 167.658 1.00 80.79  ?  24   LEU B O     1 
ATOM   5125  C  CB    . LEU B 2 27   ? 177.509 141.040 166.005 1.00 71.82  ?  24   LEU B CB    1 
ATOM   5126  C  CG    . LEU B 2 27   ? 177.019 142.160 165.077 1.00 42.49  ?  24   LEU B CG    1 
ATOM   5127  C  CD1   . LEU B 2 27   ? 177.068 143.522 165.756 1.00 56.65  ?  24   LEU B CD1   1 
ATOM   5128  C  CD2   . LEU B 2 27   ? 177.804 142.181 163.773 1.00 30.50  ?  24   LEU B CD2   1 
ATOM   5129  N  N     . GLU B 2 28   ? 176.527 141.309 169.167 1.00 92.91  ?  25   GLU B N     1 
ATOM   5130  C  CA    . GLU B 2 28   ? 176.136 142.242 170.220 1.00 101.95 ?  25   GLU B CA    1 
ATOM   5131  C  C     . GLU B 2 28   ? 174.632 142.188 170.471 1.00 93.03  ?  25   GLU B C     1 
ATOM   5132  O  O     . GLU B 2 28   ? 173.893 143.138 170.215 1.00 94.14  ?  25   GLU B O     1 
ATOM   5133  C  CB    . GLU B 2 28   ? 176.593 143.667 169.892 1.00 100.79 ?  25   GLU B CB    1 
ATOM   5134  C  CG    . GLU B 2 28   ? 178.038 143.938 170.263 1.00 123.20 ?  25   GLU B CG    1 
ATOM   5135  C  CD    . GLU B 2 28   ? 179.001 142.993 169.586 1.00 175.18 ?  25   GLU B CD    1 
ATOM   5136  O  OE1   . GLU B 2 28   ? 178.751 142.615 168.423 1.00 140.39 ?  25   GLU B OE1   1 
ATOM   5137  O  OE2   . GLU B 2 28   ? 179.994 142.597 170.228 1.00 380.68 -1 25   GLU B OE2   1 
ATOM   5138  N  N     . GLY B 2 29   ? 174.191 141.044 170.981 1.00 101.12 ?  26   GLY B N     1 
ATOM   5139  C  CA    . GLY B 2 29   ? 172.793 140.856 171.302 1.00 142.51 ?  26   GLY B CA    1 
ATOM   5140  C  C     . GLY B 2 29   ? 171.898 140.815 170.082 1.00 155.12 ?  26   GLY B C     1 
ATOM   5141  O  O     . GLY B 2 29   ? 172.008 139.902 169.256 1.00 147.83 ?  26   GLY B O     1 
ATOM   5142  N  N     . ASP B 2 30   ? 171.003 141.798 169.969 1.00 189.15 ?  27   ASP B N     1 
ATOM   5143  C  CA    . ASP B 2 30   ? 170.053 141.833 168.863 1.00 208.58 ?  27   ASP B CA    1 
ATOM   5144  C  C     . ASP B 2 30   ? 170.783 141.834 167.523 1.00 150.31 ?  27   ASP B C     1 
ATOM   5145  O  O     . ASP B 2 30   ? 171.836 142.460 167.366 1.00 116.91 ?  27   ASP B O     1 
ATOM   5146  C  CB    . ASP B 2 30   ? 169.130 143.054 168.981 1.00 268.07 ?  27   ASP B CB    1 
ATOM   5147  C  CG    . ASP B 2 30   ? 167.933 142.804 169.907 1.00 305.10 ?  27   ASP B CG    1 
ATOM   5148  O  OD1   . ASP B 2 30   ? 167.894 141.741 170.565 1.00 280.35 ?  27   ASP B OD1   1 
ATOM   5149  O  OD2   . ASP B 2 30   ? 167.027 143.664 169.972 1.00 387.37 -1 27   ASP B OD2   1 
ATOM   5150  N  N     . VAL B 2 31   ? 170.214 141.114 166.557 1.00 130.84 ?  28   VAL B N     1 
ATOM   5151  C  CA    . VAL B 2 31   ? 170.902 140.790 165.321 1.00 92.28  ?  28   VAL B CA    1 
ATOM   5152  C  C     . VAL B 2 31   ? 170.346 141.636 164.181 1.00 67.09  ?  28   VAL B C     1 
ATOM   5153  O  O     . VAL B 2 31   ? 169.255 142.219 164.259 1.00 70.58  ?  28   VAL B O     1 
ATOM   5154  C  CB    . VAL B 2 31   ? 170.816 139.273 165.011 1.00 115.02 ?  28   VAL B CB    1 
ATOM   5155  C  CG1   . VAL B 2 31   ? 171.056 138.473 166.275 1.00 157.86 ?  28   VAL B CG1   1 
ATOM   5156  C  CG2   . VAL B 2 31   ? 169.484 138.894 164.403 1.00 93.33  ?  28   VAL B CG2   1 
ATOM   5157  N  N     . TYR B 2 32   ? 171.136 141.736 163.113 1.00 55.98  ?  29   TYR B N     1 
ATOM   5158  C  CA    . TYR B 2 32   ? 170.865 142.648 162.007 1.00 43.72  ?  29   TYR B CA    1 
ATOM   5159  C  C     . TYR B 2 32   ? 170.691 141.853 160.719 1.00 39.51  ?  29   TYR B C     1 
ATOM   5160  O  O     . TYR B 2 32   ? 171.561 141.056 160.356 1.00 41.97  ?  29   TYR B O     1 
ATOM   5161  C  CB    . TYR B 2 32   ? 171.992 143.675 161.868 1.00 36.97  ?  29   TYR B CB    1 
ATOM   5162  C  CG    . TYR B 2 32   ? 172.355 144.368 163.165 1.00 51.71  ?  29   TYR B CG    1 
ATOM   5163  C  CD1   . TYR B 2 32   ? 171.390 144.623 164.131 1.00 79.17  ?  29   TYR B CD1   1 
ATOM   5164  C  CD2   . TYR B 2 32   ? 173.662 144.731 163.443 1.00 65.08  ?  29   TYR B CD2   1 
ATOM   5165  C  CE1   . TYR B 2 32   ? 171.711 145.243 165.319 1.00 103.12 ?  29   TYR B CE1   1 
ATOM   5166  C  CE2   . TYR B 2 32   ? 173.995 145.353 164.635 1.00 100.05 ?  29   TYR B CE2   1 
ATOM   5167  C  CZ    . TYR B 2 32   ? 173.014 145.605 165.568 1.00 111.91 ?  29   TYR B CZ    1 
ATOM   5168  O  OH    . TYR B 2 32   ? 173.335 146.222 166.756 1.00 113.37 ?  29   TYR B OH    1 
ATOM   5169  N  N     . LEU B 2 33   ? 169.572 142.071 160.029 1.00 40.69  ?  30   LEU B N     1 
ATOM   5170  C  CA    . LEU B 2 33   ? 169.356 141.460 158.720 1.00 27.80  ?  30   LEU B CA    1 
ATOM   5171  C  C     . LEU B 2 33   ? 170.018 142.297 157.633 1.00 23.31  ?  30   LEU B C     1 
ATOM   5172  O  O     . LEU B 2 33   ? 170.022 143.533 157.692 1.00 28.58  ?  30   LEU B O     1 
ATOM   5173  C  CB    . LEU B 2 33   ? 167.857 141.283 158.416 1.00 19.84  ?  30   LEU B CB    1 
ATOM   5174  C  CG    . LEU B 2 33   ? 167.387 140.984 156.973 1.00 10.33  ?  30   LEU B CG    1 
ATOM   5175  C  CD1   . LEU B 2 33   ? 166.118 140.159 156.958 1.00 11.56  ?  30   LEU B CD1   1 
ATOM   5176  C  CD2   . LEU B 2 33   ? 167.132 142.245 156.157 1.00 14.52  ?  30   LEU B CD2   1 
ATOM   5177  N  N     . PHE B 2 34   ? 170.562 141.606 156.628 1.00 16.86  ?  31   PHE B N     1 
ATOM   5178  C  CA    . PHE B 2 34   ? 171.238 142.220 155.498 1.00 17.11  ?  31   PHE B CA    1 
ATOM   5179  C  C     . PHE B 2 34   ? 170.809 141.507 154.226 1.00 25.23  ?  31   PHE B C     1 
ATOM   5180  O  O     . PHE B 2 34   ? 170.605 140.288 154.224 1.00 36.40  ?  31   PHE B O     1 
ATOM   5181  C  CB    . PHE B 2 34   ? 172.766 142.155 155.648 1.00 16.98  ?  31   PHE B CB    1 
ATOM   5182  C  CG    . PHE B 2 34   ? 173.511 142.890 154.567 1.00 22.74  ?  31   PHE B CG    1 
ATOM   5183  C  CD1   . PHE B 2 34   ? 173.886 142.261 153.395 1.00 18.31  ?  31   PHE B CD1   1 
ATOM   5184  C  CD2   . PHE B 2 34   ? 173.863 144.213 154.739 1.00 32.90  ?  31   PHE B CD2   1 
ATOM   5185  C  CE1   . PHE B 2 34   ? 174.575 142.951 152.416 1.00 24.78  ?  31   PHE B CE1   1 
ATOM   5186  C  CE2   . PHE B 2 34   ? 174.551 144.902 153.755 1.00 39.39  ?  31   PHE B CE2   1 
ATOM   5187  C  CZ    . PHE B 2 34   ? 174.905 144.268 152.602 1.00 34.97  ?  31   PHE B CZ    1 
ATOM   5188  N  N     . GLY B 2 35   ? 170.692 142.275 153.148 1.00 31.26  ?  32   GLY B N     1 
ATOM   5189  C  CA    . GLY B 2 35   ? 170.275 141.752 151.863 1.00 34.92  ?  32   GLY B CA    1 
ATOM   5190  C  C     . GLY B 2 35   ? 168.809 141.940 151.526 1.00 38.34  ?  32   GLY B C     1 
ATOM   5191  O  O     . GLY B 2 35   ? 168.127 140.978 151.169 1.00 50.75  ?  32   GLY B O     1 
ATOM   5192  N  N     . GLN B 2 36   ? 168.310 143.164 151.652 1.00 37.58  ?  33   GLN B N     1 
ATOM   5193  C  CA    . GLN B 2 36   ? 166.942 143.473 151.268 1.00 43.33  ?  33   GLN B CA    1 
ATOM   5194  C  C     . GLN B 2 36   ? 166.734 143.319 149.766 1.00 45.19  ?  33   GLN B C     1 
ATOM   5195  O  O     . GLN B 2 36   ? 167.669 143.398 148.966 1.00 50.12  ?  33   GLN B O     1 
ATOM   5196  C  CB    . GLN B 2 36   ? 166.571 144.900 151.658 1.00 49.13  ?  33   GLN B CB    1 
ATOM   5197  C  CG    . GLN B 2 36   ? 165.085 145.161 151.637 1.00 54.70  ?  33   GLN B CG    1 
ATOM   5198  C  CD    . GLN B 2 36   ? 164.690 146.323 152.500 1.00 84.61  ?  33   GLN B CD    1 
ATOM   5199  O  OE1   . GLN B 2 36   ? 163.705 146.261 153.236 1.00 86.95  ?  33   GLN B OE1   1 
ATOM   5200  N  NE2   . GLN B 2 36   ? 165.469 147.397 152.432 1.00 86.67  ?  33   GLN B NE2   1 
ATOM   5201  N  N     . LYS B 2 37   ? 165.475 143.111 149.387 1.00 42.46  ?  34   LYS B N     1 
ATOM   5202  C  CA    . LYS B 2 37   ? 165.100 143.060 147.983 1.00 43.59  ?  34   LYS B CA    1 
ATOM   5203  C  C     . LYS B 2 37   ? 164.885 144.465 147.434 1.00 32.21  ?  34   LYS B C     1 
ATOM   5204  O  O     . LYS B 2 37   ? 164.288 145.321 148.090 1.00 34.91  ?  34   LYS B O     1 
ATOM   5205  C  CB    . LYS B 2 37   ? 163.832 142.227 147.794 1.00 33.74  ?  34   LYS B CB    1 
ATOM   5206  C  CG    . LYS B 2 37   ? 163.190 142.385 146.431 1.00 35.27  ?  34   LYS B CG    1 
ATOM   5207  C  CD    . LYS B 2 37   ? 161.687 142.226 146.511 1.00 48.07  ?  34   LYS B CD    1 
ATOM   5208  C  CE    . LYS B 2 37   ? 161.337 140.906 147.165 1.00 58.19  ?  34   LYS B CE    1 
ATOM   5209  N  NZ    . LYS B 2 37   ? 159.870 140.744 147.303 1.00 65.58  ?  34   LYS B NZ    1 
ATOM   5210  N  N     . GLY B 2 38   ? 165.370 144.693 146.217 1.00 25.69  ?  35   GLY B N     1 
ATOM   5211  C  CA    . GLY B 2 38   ? 165.324 146.010 145.614 1.00 17.02  ?  35   GLY B CA    1 
ATOM   5212  C  C     . GLY B 2 38   ? 166.285 146.972 146.283 1.00 17.94  ?  35   GLY B C     1 
ATOM   5213  O  O     . GLY B 2 38   ? 166.683 146.775 147.437 1.00 25.14  ?  35   GLY B O     1 
ATOM   5214  N  N     . TRP B 2 39   ? 166.657 148.030 145.561 1.00 15.76  ?  36   TRP B N     1 
ATOM   5215  C  CA    . TRP B 2 39   ? 167.624 148.994 146.065 1.00 16.15  ?  36   TRP B CA    1 
ATOM   5216  C  C     . TRP B 2 39   ? 167.103 149.663 147.341 1.00 19.74  ?  36   TRP B C     1 
ATOM   5217  O  O     . TRP B 2 39   ? 165.905 149.626 147.632 1.00 29.49  ?  36   TRP B O     1 
ATOM   5218  C  CB    . TRP B 2 39   ? 167.926 150.031 144.981 1.00 16.53  ?  36   TRP B CB    1 
ATOM   5219  C  CG    . TRP B 2 39   ? 168.793 149.478 143.897 1.00 12.53  ?  36   TRP B CG    1 
ATOM   5220  C  CD1   . TRP B 2 39   ? 168.389 148.708 142.839 1.00 15.75  ?  36   TRP B CD1   1 
ATOM   5221  C  CD2   . TRP B 2 39   ? 170.205 149.638 143.754 1.00 12.24  ?  36   TRP B CD2   1 
ATOM   5222  N  NE1   . TRP B 2 39   ? 169.464 148.382 142.050 1.00 13.52  ?  36   TRP B NE1   1 
ATOM   5223  C  CE2   . TRP B 2 39   ? 170.590 148.942 142.589 1.00 12.96  ?  36   TRP B CE2   1 
ATOM   5224  C  CE3   . TRP B 2 39   ? 171.184 150.300 144.495 1.00 13.90  ?  36   TRP B CE3   1 
ATOM   5225  C  CZ2   . TRP B 2 39   ? 171.906 148.896 142.151 1.00 12.78  ?  36   TRP B CZ2   1 
ATOM   5226  C  CZ3   . TRP B 2 39   ? 172.485 150.255 144.057 1.00 17.58  ?  36   TRP B CZ3   1 
ATOM   5227  C  CH2   . TRP B 2 39   ? 172.838 149.557 142.898 1.00 12.47  ?  36   TRP B CH2   1 
ATOM   5228  N  N     . PRO B 2 40   ? 167.993 150.254 148.139 1.00 15.74  ?  37   PRO B N     1 
ATOM   5229  C  CA    . PRO B 2 40   ? 167.553 150.887 149.394 1.00 26.65  ?  37   PRO B CA    1 
ATOM   5230  C  C     . PRO B 2 40   ? 166.585 152.035 149.137 1.00 46.64  ?  37   PRO B C     1 
ATOM   5231  O  O     . PRO B 2 40   ? 166.910 152.998 148.441 1.00 47.12  ?  37   PRO B O     1 
ATOM   5232  C  CB    . PRO B 2 40   ? 168.866 151.380 150.014 1.00 34.21  ?  37   PRO B CB    1 
ATOM   5233  C  CG    . PRO B 2 40   ? 169.913 150.507 149.389 1.00 22.66  ?  37   PRO B CG    1 
ATOM   5234  C  CD    . PRO B 2 40   ? 169.457 150.307 147.988 1.00 14.10  ?  37   PRO B CD    1 
ATOM   5235  N  N     . LYS B 2 41   ? 165.384 151.928 149.704 1.00 45.31  ?  38   LYS B N     1 
ATOM   5236  C  CA    . LYS B 2 41   ? 164.414 153.016 149.634 1.00 51.64  ?  38   LYS B CA    1 
ATOM   5237  C  C     . LYS B 2 41   ? 164.865 154.186 150.512 1.00 81.75  ?  38   LYS B C     1 
ATOM   5238  O  O     . LYS B 2 41   ? 165.812 154.082 151.297 1.00 84.99  ?  38   LYS B O     1 
ATOM   5239  C  CB    . LYS B 2 41   ? 163.026 152.542 150.072 1.00 44.70  ?  38   LYS B CB    1 
ATOM   5240  C  CG    . LYS B 2 41   ? 162.777 151.052 149.889 1.00 63.44  ?  38   LYS B CG    1 
ATOM   5241  C  CD    . LYS B 2 41   ? 162.016 150.760 148.603 1.00 74.00  ?  38   LYS B CD    1 
ATOM   5242  C  CE    . LYS B 2 41   ? 161.542 149.312 148.558 1.00 56.19  ?  38   LYS B CE    1 
ATOM   5243  N  NZ    . LYS B 2 41   ? 160.773 148.923 149.772 1.00 53.07  ?  38   LYS B NZ    1 
ATOM   5244  N  N     . ARG B 2 42   ? 164.169 155.318 150.376 1.00 82.23  ?  39   ARG B N     1 
ATOM   5245  C  CA    . ARG B 2 42   ? 164.525 156.497 151.161 1.00 76.75  ?  39   ARG B CA    1 
ATOM   5246  C  C     . ARG B 2 42   ? 164.330 156.242 152.650 1.00 61.96  ?  39   ARG B C     1 
ATOM   5247  O  O     . ARG B 2 42   ? 165.072 156.785 153.480 1.00 48.38  ?  39   ARG B O     1 
ATOM   5248  C  CB    . ARG B 2 42   ? 163.697 157.698 150.702 1.00 83.58  ?  39   ARG B CB    1 
ATOM   5249  C  CG    . ARG B 2 42   ? 163.445 158.731 151.779 1.00 90.22  ?  39   ARG B CG    1 
ATOM   5250  C  CD    . ARG B 2 42   ? 164.658 159.615 151.993 1.00 67.64  ?  39   ARG B CD    1 
ATOM   5251  N  NE    . ARG B 2 42   ? 164.242 160.935 152.452 1.00 89.17  ?  39   ARG B NE    1 
ATOM   5252  C  CZ    . ARG B 2 42   ? 163.555 161.797 151.708 1.00 99.00  ?  39   ARG B CZ    1 
ATOM   5253  N  NH1   . ARG B 2 42   ? 163.199 161.473 150.472 1.00 82.76  ?  39   ARG B NH1   1 
ATOM   5254  N  NH2   . ARG B 2 42   ? 163.213 162.979 152.204 1.00 111.74 ?  39   ARG B NH2   1 
ATOM   5255  N  N     . SER B 2 43   ? 163.348 155.402 152.998 1.00 59.77  ?  40   SER B N     1 
ATOM   5256  C  CA    . SER B 2 43   ? 163.092 155.056 154.391 1.00 44.13  ?  40   SER B CA    1 
ATOM   5257  C  C     . SER B 2 43   ? 164.342 154.531 155.088 1.00 48.80  ?  40   SER B C     1 
ATOM   5258  O  O     . SER B 2 43   ? 164.524 154.763 156.287 1.00 59.79  ?  40   SER B O     1 
ATOM   5259  C  CB    . SER B 2 43   ? 161.959 154.024 154.480 1.00 29.03  ?  40   SER B CB    1 
ATOM   5260  O  OG    . SER B 2 43   ? 160.961 154.259 153.502 1.00 35.42  ?  40   SER B OG    1 
ATOM   5261  N  N     . CYS B 2 44   ? 165.219 153.839 154.359 1.00 51.79  ?  41   CYS B N     1 
ATOM   5262  C  CA    . CYS B 2 44   ? 166.455 153.303 154.928 1.00 45.78  ?  41   CYS B CA    1 
ATOM   5263  C  C     . CYS B 2 44   ? 167.573 153.352 153.894 1.00 52.60  ?  41   CYS B C     1 
ATOM   5264  O  O     . CYS B 2 44   ? 167.715 152.442 153.069 1.00 46.48  ?  41   CYS B O     1 
ATOM   5265  C  CB    . CYS B 2 44   ? 166.249 151.879 155.446 1.00 28.79  ?  41   CYS B CB    1 
ATOM   5266  S  SG    . CYS B 2 44   ? 167.734 151.030 156.004 1.00 47.23  ?  41   CYS B SG    1 
ATOM   5267  N  N     . PRO B 2 45   ? 168.393 154.411 153.907 1.00 58.21  ?  42   PRO B N     1 
ATOM   5268  C  CA    . PRO B 2 45   ? 169.573 154.439 153.026 1.00 49.72  ?  42   PRO B CA    1 
ATOM   5269  C  C     . PRO B 2 45   ? 170.639 153.422 153.394 1.00 29.39  ?  42   PRO B C     1 
ATOM   5270  O  O     . PRO B 2 45   ? 171.532 153.161 152.574 1.00 26.18  ?  42   PRO B O     1 
ATOM   5271  C  CB    . PRO B 2 45   ? 170.080 155.877 153.180 1.00 53.26  ?  42   PRO B CB    1 
ATOM   5272  C  CG    . PRO B 2 45   ? 169.703 156.234 154.578 1.00 64.22  ?  42   PRO B CG    1 
ATOM   5273  C  CD    . PRO B 2 45   ? 168.342 155.598 154.779 1.00 74.91  ?  42   PRO B CD    1 
ATOM   5274  N  N     . THR B 2 46   ? 170.566 152.844 154.591 1.00 28.37  ?  43   THR B N     1 
ATOM   5275  C  CA    . THR B 2 46   ? 171.498 151.811 155.022 1.00 39.60  ?  43   THR B CA    1 
ATOM   5276  C  C     . THR B 2 46   ? 171.181 150.477 154.351 1.00 31.33  ?  43   THR B C     1 
ATOM   5277  O  O     . THR B 2 46   ? 172.040 149.875 153.701 1.00 33.55  ?  43   THR B O     1 
ATOM   5278  C  CB    . THR B 2 46   ? 171.441 151.698 156.552 1.00 67.66  ?  43   THR B CB    1 
ATOM   5279  O  OG1   . THR B 2 46   ? 171.804 152.954 157.140 1.00 64.50  ?  43   THR B OG1   1 
ATOM   5280  C  CG2   . THR B 2 46   ? 172.394 150.633 157.073 1.00 82.72  ?  43   THR B CG2   1 
ATOM   5281  N  N     . GLY B 2 47   ? 169.947 150.005 154.498 1.00 32.33  ?  44   GLY B N     1 
ATOM   5282  C  CA    . GLY B 2 47   ? 169.564 148.686 154.035 1.00 19.75  ?  44   GLY B CA    1 
ATOM   5283  C  C     . GLY B 2 47   ? 169.612 147.652 155.142 1.00 20.25  ?  44   GLY B C     1 
ATOM   5284  O  O     . GLY B 2 47   ? 168.742 146.782 155.237 1.00 21.41  ?  44   GLY B O     1 
ATOM   5285  N  N     . ILE B 2 48   ? 170.646 147.740 155.982 1.00 28.30  ?  45   ILE B N     1 
ATOM   5286  C  CA    . ILE B 2 48   ? 170.753 146.873 157.147 1.00 28.97  ?  45   ILE B CA    1 
ATOM   5287  C  C     . ILE B 2 48   ? 169.624 147.196 158.109 1.00 30.53  ?  45   ILE B C     1 
ATOM   5288  O  O     . ILE B 2 48   ? 169.345 148.366 158.398 1.00 34.86  ?  45   ILE B O     1 
ATOM   5289  C  CB    . ILE B 2 48   ? 172.117 147.055 157.835 1.00 36.51  ?  45   ILE B CB    1 
ATOM   5290  C  CG1   . ILE B 2 48   ? 173.262 146.990 156.823 1.00 32.15  ?  45   ILE B CG1   1 
ATOM   5291  C  CG2   . ILE B 2 48   ? 172.305 146.036 158.955 1.00 41.97  ?  45   ILE B CG2   1 
ATOM   5292  C  CD1   . ILE B 2 48   ? 174.647 147.108 157.447 1.00 63.05  ?  45   ILE B CD1   1 
ATOM   5293  N  N     . PHE B 2 49   ? 168.972 146.162 158.626 1.00 33.91  ?  46   PHE B N     1 
ATOM   5294  C  CA    . PHE B 2 49   ? 167.921 146.359 159.611 1.00 37.52  ?  46   PHE B CA    1 
ATOM   5295  C  C     . PHE B 2 49   ? 168.297 145.677 160.916 1.00 38.61  ?  46   PHE B C     1 
ATOM   5296  O  O     . PHE B 2 49   ? 169.110 144.753 160.942 1.00 43.22  ?  46   PHE B O     1 
ATOM   5297  C  CB    . PHE B 2 49   ? 166.580 145.795 159.135 1.00 39.73  ?  46   PHE B CB    1 
ATOM   5298  C  CG    . PHE B 2 49   ? 165.982 146.516 157.965 1.00 54.36  ?  46   PHE B CG    1 
ATOM   5299  C  CD1   . PHE B 2 49   ? 166.478 147.733 157.543 1.00 48.87  ?  46   PHE B CD1   1 
ATOM   5300  C  CD2   . PHE B 2 49   ? 164.925 145.958 157.273 1.00 57.65  ?  46   PHE B CD2   1 
ATOM   5301  C  CE1   . PHE B 2 49   ? 165.921 148.376 156.463 1.00 57.27  ?  46   PHE B CE1   1 
ATOM   5302  C  CE2   . PHE B 2 49   ? 164.368 146.606 156.188 1.00 80.22  ?  46   PHE B CE2   1 
ATOM   5303  C  CZ    . PHE B 2 49   ? 164.869 147.813 155.787 1.00 81.02  ?  46   PHE B CZ    1 
ATOM   5304  N  N     . GLY B 2 50   ? 167.674 146.121 162.004 1.00 37.89  ?  47   GLY B N     1 
ATOM   5305  C  CA    . GLY B 2 50   ? 167.719 145.397 163.260 1.00 38.00  ?  47   GLY B CA    1 
ATOM   5306  C  C     . GLY B 2 50   ? 166.418 144.634 163.423 1.00 42.77  ?  47   GLY B C     1 
ATOM   5307  O  O     . GLY B 2 50   ? 165.333 145.193 163.244 1.00 46.59  ?  47   GLY B O     1 
ATOM   5308  N  N     . VAL B 2 51   ? 166.535 143.344 163.732 1.00 43.50  ?  48   VAL B N     1 
ATOM   5309  C  CA    . VAL B 2 51   ? 165.368 142.485 163.902 1.00 58.50  ?  48   VAL B CA    1 
ATOM   5310  C  C     . VAL B 2 51   ? 165.218 142.123 165.372 1.00 81.34  ?  48   VAL B C     1 
ATOM   5311  O  O     . VAL B 2 51   ? 166.190 141.751 166.036 1.00 111.05 ?  48   VAL B O     1 
ATOM   5312  C  CB    . VAL B 2 51   ? 165.446 141.223 163.020 1.00 60.10  ?  48   VAL B CB    1 
ATOM   5313  C  CG1   . VAL B 2 51   ? 166.799 140.590 163.117 1.00 61.71  ?  48   VAL B CG1   1 
ATOM   5314  C  CG2   . VAL B 2 51   ? 164.400 140.218 163.462 1.00 55.36  ?  48   VAL B CG2   1 
ATOM   5315  N  N     . ARG B 2 52   ? 163.993 142.239 165.876 1.00 78.66  ?  49   ARG B N     1 
ATOM   5316  C  CA    . ARG B 2 52   ? 163.678 141.919 167.254 1.00 82.95  ?  49   ARG B CA    1 
ATOM   5317  C  C     . ARG B 2 52   ? 162.527 140.925 167.287 1.00 65.36  ?  49   ARG B C     1 
ATOM   5318  O  O     . ARG B 2 52   ? 161.725 140.841 166.351 1.00 69.04  ?  49   ARG B O     1 
ATOM   5319  C  CB    . ARG B 2 52   ? 163.324 143.188 168.056 1.00 113.51 ?  49   ARG B CB    1 
ATOM   5320  C  CG    . ARG B 2 52   ? 164.508 144.130 168.283 1.00 130.05 ?  49   ARG B CG    1 
ATOM   5321  C  CD    . ARG B 2 52   ? 164.185 145.231 169.291 1.00 117.59 ?  49   ARG B CD    1 
ATOM   5322  N  NE    . ARG B 2 52   ? 162.873 145.821 169.046 1.00 119.80 ?  49   ARG B NE    1 
ATOM   5323  C  CZ    . ARG B 2 52   ? 162.646 146.787 168.162 1.00 102.56 ?  49   ARG B CZ    1 
ATOM   5324  N  NH1   . ARG B 2 52   ? 161.420 147.264 167.997 1.00 113.49 ?  49   ARG B NH1   1 
ATOM   5325  N  NH2   . ARG B 2 52   ? 163.645 147.271 167.437 1.00 76.03  ?  49   ARG B NH2   1 
ATOM   5326  N  N     . ILE B 2 53   ? 162.458 140.165 168.375 1.00 73.10  ?  50   ILE B N     1 
ATOM   5327  C  CA    . ILE B 2 53   ? 161.383 139.211 168.600 1.00 101.96 ?  50   ILE B CA    1 
ATOM   5328  C  C     . ILE B 2 53   ? 160.641 139.651 169.854 1.00 140.40 ?  50   ILE B C     1 
ATOM   5329  O  O     . ILE B 2 53   ? 161.196 139.618 170.960 1.00 117.91 ?  50   ILE B O     1 
ATOM   5330  C  CB    . ILE B 2 53   ? 161.905 137.775 168.725 1.00 90.65  ?  50   ILE B CB    1 
ATOM   5331  C  CG1   . ILE B 2 53   ? 162.583 137.360 167.418 1.00 69.25  ?  50   ILE B CG1   1 
ATOM   5332  C  CG2   . ILE B 2 53   ? 160.782 136.826 169.114 1.00 127.08 ?  50   ILE B CG2   1 
ATOM   5333  C  CD1   . ILE B 2 53   ? 161.693 136.597 166.458 1.00 99.13  ?  50   ILE B CD1   1 
ATOM   5334  N  N     . LYS B 2 54   ? 159.387 140.067 169.682 1.00 163.05 ?  51   LYS B N     1 
ATOM   5335  C  CA    . LYS B 2 54   ? 158.535 140.527 170.778 1.00 144.52 ?  51   LYS B CA    1 
ATOM   5336  C  C     . LYS B 2 54   ? 157.339 139.593 170.878 1.00 142.45 ?  51   LYS B C     1 
ATOM   5337  O  O     . LYS B 2 54   ? 156.476 139.593 169.996 1.00 157.12 ?  51   LYS B O     1 
ATOM   5338  C  CB    . LYS B 2 54   ? 158.088 141.973 170.562 1.00 125.20 ?  51   LYS B CB    1 
ATOM   5339  C  CG    . LYS B 2 54   ? 157.495 142.635 171.796 1.00 127.54 ?  51   LYS B CG    1 
ATOM   5340  C  CD    . LYS B 2 54   ? 158.427 142.504 172.993 1.00 147.91 ?  51   LYS B CD    1 
ATOM   5341  C  CE    . LYS B 2 54   ? 159.769 143.180 172.750 1.00 137.21 ?  51   LYS B CE    1 
ATOM   5342  N  NZ    . LYS B 2 54   ? 160.513 143.411 174.019 1.00 119.98 ?  51   LYS B NZ    1 
ATOM   5343  N  N     . LYS B 2 55   ? 157.284 138.825 171.963 1.00 137.07 ?  52   LYS B N     1 
ATOM   5344  C  CA    . LYS B 2 55   ? 156.315 137.745 172.176 1.00 153.49 ?  52   LYS B CA    1 
ATOM   5345  C  C     . LYS B 2 55   ? 156.056 136.965 170.886 1.00 173.12 ?  52   LYS B C     1 
ATOM   5346  O  O     . LYS B 2 55   ? 154.929 136.841 170.407 1.00 196.55 ?  52   LYS B O     1 
ATOM   5347  C  CB    . LYS B 2 55   ? 155.002 138.254 172.794 1.00 178.50 ?  52   LYS B CB    1 
ATOM   5348  C  CG    . LYS B 2 55   ? 154.341 139.478 172.156 1.00 175.73 ?  52   LYS B CG    1 
ATOM   5349  C  CD    . LYS B 2 55   ? 152.862 139.587 172.542 1.00 180.37 ?  52   LYS B CD    1 
ATOM   5350  C  CE    . LYS B 2 55   ? 152.620 139.193 173.995 1.00 170.44 ?  52   LYS B CE    1 
ATOM   5351  N  NZ    . LYS B 2 55   ? 151.169 139.077 174.319 1.00 144.46 ?  52   LYS B NZ    1 
ATOM   5352  N  N     . GLY B 2 56   ? 157.138 136.431 170.326 1.00 165.30 ?  53   GLY B N     1 
ATOM   5353  C  CA    . GLY B 2 56   ? 157.043 135.644 169.111 1.00 174.98 ?  53   GLY B CA    1 
ATOM   5354  C  C     . GLY B 2 56   ? 156.602 136.412 167.884 1.00 200.33 ?  53   GLY B C     1 
ATOM   5355  O  O     . GLY B 2 56   ? 156.008 135.820 166.978 1.00 188.38 ?  53   GLY B O     1 
ATOM   5356  N  N     . GLU B 2 57   ? 156.873 137.716 167.822 1.00 208.30 ?  54   GLU B N     1 
ATOM   5357  C  CA    . GLU B 2 57   ? 156.524 138.528 166.663 1.00 195.24 ?  54   GLU B CA    1 
ATOM   5358  C  C     . GLU B 2 57   ? 157.764 139.227 166.128 1.00 151.37 ?  54   GLU B C     1 
ATOM   5359  O  O     . GLU B 2 57   ? 158.688 139.558 166.879 1.00 147.72 ?  54   GLU B O     1 
ATOM   5360  C  CB    . GLU B 2 57   ? 155.438 139.569 166.993 1.00 207.55 ?  54   GLU B CB    1 
ATOM   5361  C  CG    . GLU B 2 57   ? 154.303 139.053 167.877 1.00 221.74 ?  54   GLU B CG    1 
ATOM   5362  C  CD    . GLU B 2 57   ? 153.563 137.854 167.302 1.00 247.28 ?  54   GLU B CD    1 
ATOM   5363  O  OE1   . GLU B 2 57   ? 153.776 137.502 166.123 1.00 208.28 ?  54   GLU B OE1   1 
ATOM   5364  O  OE2   . GLU B 2 57   ? 152.778 137.238 168.052 1.00 366.71 -1 54   GLU B OE2   1 
ATOM   5365  N  N     . LEU B 2 58   ? 157.748 139.479 164.824 1.00 115.77 ?  55   LEU B N     1 
ATOM   5366  C  CA    . LEU B 2 58   ? 158.937 139.799 164.044 1.00 92.99  ?  55   LEU B CA    1 
ATOM   5367  C  C     . LEU B 2 58   ? 159.014 141.309 163.814 1.00 87.60  ?  55   LEU B C     1 
ATOM   5368  O  O     . LEU B 2 58   ? 158.629 141.817 162.760 1.00 80.93  ?  55   LEU B O     1 
ATOM   5369  C  CB    . LEU B 2 58   ? 158.865 139.037 162.748 1.00 84.20  ?  55   LEU B CB    1 
ATOM   5370  C  CG    . LEU B 2 58   ? 160.014 139.169 161.768 1.00 100.79 ?  55   LEU B CG    1 
ATOM   5371  C  CD1   . LEU B 2 58   ? 161.304 138.843 162.484 1.00 105.10 ?  55   LEU B CD1   1 
ATOM   5372  C  CD2   . LEU B 2 58   ? 159.771 138.242 160.593 1.00 79.46  ?  55   LEU B CD2   1 
ATOM   5373  N  N     . LYS B 2 59   ? 159.534 142.031 164.803 1.00 91.21  ?  56   LYS B N     1 
ATOM   5374  C  CA    . LYS B 2 59   ? 159.623 143.483 164.699 1.00 93.49  ?  56   LYS B CA    1 
ATOM   5375  C  C     . LYS B 2 59   ? 160.896 143.892 163.961 1.00 79.84  ?  56   LYS B C     1 
ATOM   5376  O  O     . LYS B 2 59   ? 161.938 143.242 164.074 1.00 77.02  ?  56   LYS B O     1 
ATOM   5377  C  CB    . LYS B 2 59   ? 159.574 144.125 166.090 1.00 108.56 ?  56   LYS B CB    1 
ATOM   5378  C  CG    . LYS B 2 59   ? 159.496 145.646 166.079 1.00 105.65 ?  56   LYS B CG    1 
ATOM   5379  C  CD    . LYS B 2 59   ? 158.127 146.139 166.507 1.00 105.33 ?  56   LYS B CD    1 
ATOM   5380  C  CE    . LYS B 2 59   ? 158.029 147.654 166.423 1.00 126.01 ?  56   LYS B CE    1 
ATOM   5381  N  NZ    . LYS B 2 59   ? 156.669 148.128 166.798 1.00 155.23 ?  56   LYS B NZ    1 
ATOM   5382  N  N     . LEU B 2 60   ? 160.804 144.997 163.215 1.00 67.42  ?  57   LEU B N     1 
ATOM   5383  C  CA    . LEU B 2 60   ? 161.857 145.417 162.290 1.00 43.64  ?  57   LEU B CA    1 
ATOM   5384  C  C     . LEU B 2 60   ? 162.128 146.905 162.445 1.00 33.83  ?  57   LEU B C     1 
ATOM   5385  O  O     . LEU B 2 60   ? 161.274 147.723 162.092 1.00 43.12  ?  57   LEU B O     1 
ATOM   5386  C  CB    . LEU B 2 60   ? 161.459 145.115 160.849 1.00 37.36  ?  57   LEU B CB    1 
ATOM   5387  C  CG    . LEU B 2 60   ? 162.255 144.000 160.199 1.00 41.03  ?  57   LEU B CG    1 
ATOM   5388  C  CD1   . LEU B 2 60   ? 161.771 143.766 158.782 1.00 49.96  ?  57   LEU B CD1   1 
ATOM   5389  C  CD2   . LEU B 2 60   ? 163.706 144.385 160.235 1.00 24.20  ?  57   LEU B CD2   1 
ATOM   5390  N  N     . ARG B 2 61   ? 163.314 147.264 162.926 1.00 35.63  ?  58   ARG B N     1 
ATOM   5391  C  CA    . ARG B 2 61   ? 163.693 148.665 163.038 1.00 55.35  ?  58   ARG B CA    1 
ATOM   5392  C  C     . ARG B 2 61   ? 164.855 148.970 162.097 1.00 31.61  ?  58   ARG B C     1 
ATOM   5393  O  O     . ARG B 2 61   ? 165.562 148.072 161.625 1.00 35.37  ?  58   ARG B O     1 
ATOM   5394  C  CB    . ARG B 2 61   ? 164.028 149.036 164.499 1.00 74.56  ?  58   ARG B CB    1 
ATOM   5395  C  CG    . ARG B 2 61   ? 165.487 148.933 164.941 1.00 81.71  ?  58   ARG B CG    1 
ATOM   5396  C  CD    . ARG B 2 61   ? 165.685 149.546 166.345 1.00 103.51 ?  58   ARG B CD    1 
ATOM   5397  N  NE    . ARG B 2 61   ? 165.979 150.980 166.292 1.00 104.56 ?  58   ARG B NE    1 
ATOM   5398  C  CZ    . ARG B 2 61   ? 165.354 151.909 167.013 1.00 86.79  ?  58   ARG B CZ    1 
ATOM   5399  N  NH1   . ARG B 2 61   ? 164.400 151.561 167.868 1.00 92.11  ?  58   ARG B NH1   1 
ATOM   5400  N  NH2   . ARG B 2 61   ? 165.694 153.188 166.888 1.00 60.10  ?  58   ARG B NH2   1 
ATOM   5401  N  N     . ALA B 2 62   ? 165.036 150.259 161.815 1.00 23.45  ?  59   ALA B N     1 
ATOM   5402  C  CA    . ALA B 2 62   ? 165.957 150.727 160.789 1.00 20.89  ?  59   ALA B CA    1 
ATOM   5403  C  C     . ALA B 2 62   ? 167.243 151.238 161.422 1.00 21.49  ?  59   ALA B C     1 
ATOM   5404  O  O     . ALA B 2 62   ? 167.203 151.967 162.415 1.00 35.74  ?  59   ALA B O     1 
ATOM   5405  C  CB    . ALA B 2 62   ? 165.311 151.832 159.954 1.00 17.04  ?  59   ALA B CB    1 
ATOM   5406  N  N     . ILE B 2 63   ? 168.380 150.864 160.835 1.00 19.18  ?  60   ILE B N     1 
ATOM   5407  C  CA    . ILE B 2 63   ? 169.699 151.247 161.332 1.00 15.69  ?  60   ILE B CA    1 
ATOM   5408  C  C     . ILE B 2 63   ? 170.284 152.373 160.496 1.00 14.73  ?  60   ILE B C     1 
ATOM   5409  O  O     . ILE B 2 63   ? 169.786 152.681 159.410 1.00 19.55  ?  60   ILE B O     1 
ATOM   5410  C  CB    . ILE B 2 63   ? 170.651 150.037 161.355 1.00 16.34  ?  60   ILE B CB    1 
ATOM   5411  C  CG1   . ILE B 2 63   ? 169.865 148.753 161.636 1.00 31.88  ?  60   ILE B CG1   1 
ATOM   5412  C  CG2   . ILE B 2 63   ? 171.795 150.242 162.348 1.00 25.46  ?  60   ILE B CG2   1 
ATOM   5413  C  CD1   . ILE B 2 63   ? 169.264 148.689 163.026 1.00 49.15  ?  60   ILE B CD1   1 
ATOM   5414  N  N     . SER B 2 64   ? 171.340 152.999 161.003 1.00 15.94  ?  61   SER B N     1 
ATOM   5415  C  CA    . SER B 2 64   ? 172.112 153.972 160.253 1.00 22.62  ?  61   SER B CA    1 
ATOM   5416  C  C     . SER B 2 64   ? 173.579 153.581 160.311 1.00 32.67  ?  61   SER B C     1 
ATOM   5417  O  O     . SER B 2 64   ? 174.002 152.787 161.156 1.00 30.02  ?  61   SER B O     1 
ATOM   5418  C  CB    . SER B 2 64   ? 171.930 155.396 160.795 1.00 32.37  ?  61   SER B CB    1 
ATOM   5419  O  OG    . SER B 2 64   ? 172.777 155.632 161.905 1.00 35.85  ?  61   SER B OG    1 
ATOM   5420  N  N     . PHE B 2 65   ? 174.350 154.152 159.393 1.00 46.78  ?  62   PHE B N     1 
ATOM   5421  C  CA    . PHE B 2 65   ? 175.779 153.917 159.336 1.00 54.36  ?  62   PHE B CA    1 
ATOM   5422  C  C     . PHE B 2 65   ? 176.506 154.954 160.181 1.00 49.37  ?  62   PHE B C     1 
ATOM   5423  O  O     . PHE B 2 65   ? 175.901 155.784 160.864 1.00 49.60  ?  62   PHE B O     1 
ATOM   5424  C  CB    . PHE B 2 65   ? 176.276 153.963 157.893 1.00 57.02  ?  62   PHE B CB    1 
ATOM   5425  C  CG    . PHE B 2 65   ? 176.076 152.685 157.146 1.00 76.64  ?  62   PHE B CG    1 
ATOM   5426  C  CD1   . PHE B 2 65   ? 176.329 151.473 157.755 1.00 69.93  ?  62   PHE B CD1   1 
ATOM   5427  C  CD2   . PHE B 2 65   ? 175.645 152.691 155.833 1.00 99.06  ?  62   PHE B CD2   1 
ATOM   5428  C  CE1   . PHE B 2 65   ? 176.149 150.291 157.073 1.00 99.32  ?  62   PHE B CE1   1 
ATOM   5429  C  CE2   . PHE B 2 65   ? 175.467 151.505 155.143 1.00 90.74  ?  62   PHE B CE2   1 
ATOM   5430  C  CZ    . PHE B 2 65   ? 175.721 150.306 155.767 1.00 97.27  ?  62   PHE B CZ    1 
ATOM   5431  N  N     . SER B 2 66   ? 177.828 154.903 160.123 1.00 48.81  ?  63   SER B N     1 
ATOM   5432  C  CA    . SER B 2 66   ? 178.659 155.957 160.677 1.00 47.99  ?  63   SER B CA    1 
ATOM   5433  C  C     . SER B 2 66   ? 178.698 157.108 159.673 1.00 45.72  ?  63   SER B C     1 
ATOM   5434  O  O     . SER B 2 66   ? 177.932 157.158 158.706 1.00 51.88  ?  63   SER B O     1 
ATOM   5435  C  CB    . SER B 2 66   ? 180.046 155.413 161.013 1.00 66.72  ?  63   SER B CB    1 
ATOM   5436  O  OG    . SER B 2 66   ? 180.982 155.720 159.995 1.00 60.57  ?  63   SER B OG    1 
ATOM   5437  N  N     . ASN B 2 67   ? 179.593 158.058 159.899 1.00 40.70  ?  64   ASN B N     1 
ATOM   5438  C  CA    . ASN B 2 67   ? 179.789 159.166 158.981 1.00 42.67  ?  64   ASN B CA    1 
ATOM   5439  C  C     . ASN B 2 67   ? 180.955 158.930 158.039 1.00 51.26  ?  64   ASN B C     1 
ATOM   5440  O  O     . ASN B 2 67   ? 180.842 159.202 156.840 1.00 56.62  ?  64   ASN B O     1 
ATOM   5441  C  CB    . ASN B 2 67   ? 180.015 160.454 159.773 1.00 46.76  ?  64   ASN B CB    1 
ATOM   5442  C  CG    . ASN B 2 67   ? 179.185 160.499 161.039 1.00 58.04  ?  64   ASN B CG    1 
ATOM   5443  O  OD1   . ASN B 2 67   ? 178.067 159.977 161.084 1.00 46.38  ?  64   ASN B OD1   1 
ATOM   5444  N  ND2   . ASN B 2 67   ? 179.732 161.111 162.082 1.00 76.13  ?  64   ASN B ND2   1 
ATOM   5445  N  N     . ASN B 2 68   ? 182.067 158.411 158.559 1.00 50.69  ?  65   ASN B N     1 
ATOM   5446  C  CA    . ASN B 2 68   ? 183.252 158.119 157.772 1.00 59.87  ?  65   ASN B CA    1 
ATOM   5447  C  C     . ASN B 2 68   ? 183.260 156.697 157.224 1.00 42.29  ?  65   ASN B C     1 
ATOM   5448  O  O     . ASN B 2 68   ? 184.336 156.168 156.924 1.00 44.41  ?  65   ASN B O     1 
ATOM   5449  C  CB    . ASN B 2 68   ? 184.508 158.370 158.610 1.00 76.40  ?  65   ASN B CB    1 
ATOM   5450  C  CG    . ASN B 2 68   ? 184.452 159.690 159.364 1.00 89.33  ?  65   ASN B CG    1 
ATOM   5451  O  OD1   . ASN B 2 68   ? 183.499 160.461 159.226 1.00 73.61  ?  65   ASN B OD1   1 
ATOM   5452  N  ND2   . ASN B 2 68   ? 185.483 159.961 160.158 1.00 103.49 ?  65   ASN B ND2   1 
ATOM   5453  N  N     . SER B 2 69   ? 182.094 156.071 157.102 1.00 53.97  ?  66   SER B N     1 
ATOM   5454  C  CA    . SER B 2 69   ? 181.957 154.716 156.591 1.00 68.08  ?  66   SER B CA    1 
ATOM   5455  C  C     . SER B 2 69   ? 181.622 154.734 155.098 1.00 77.52  ?  66   SER B C     1 
ATOM   5456  O  O     . SER B 2 69   ? 181.268 155.767 154.528 1.00 75.50  ?  66   SER B O     1 
ATOM   5457  C  CB    . SER B 2 69   ? 180.879 153.949 157.371 1.00 67.46  ?  66   SER B CB    1 
ATOM   5458  O  OG    . SER B 2 69   ? 179.803 154.797 157.744 1.00 56.60  ?  66   SER B OG    1 
ATOM   5459  N  N     . SER B 2 70   ? 181.745 153.564 154.468 1.00 83.25  ?  67   SER B N     1 
ATOM   5460  C  CA    . SER B 2 70   ? 181.371 153.364 153.075 1.00 67.04  ?  67   SER B CA    1 
ATOM   5461  C  C     . SER B 2 70   ? 180.035 152.630 152.984 1.00 69.05  ?  67   SER B C     1 
ATOM   5462  O  O     . SER B 2 70   ? 179.692 151.821 153.849 1.00 67.83  ?  67   SER B O     1 
ATOM   5463  C  CB    . SER B 2 70   ? 182.449 152.581 152.316 1.00 56.44  ?  67   SER B CB    1 
ATOM   5464  O  OG    . SER B 2 70   ? 182.768 151.365 152.976 1.00 70.93  ?  67   SER B OG    1 
ATOM   5465  N  N     . TYR B 2 71   ? 179.292 152.908 151.911 1.00 72.30  ?  68   TYR B N     1 
ATOM   5466  C  CA    . TYR B 2 71   ? 177.952 152.366 151.718 1.00 66.01  ?  68   TYR B CA    1 
ATOM   5467  C  C     . TYR B 2 71   ? 177.998 151.150 150.806 1.00 56.29  ?  68   TYR B C     1 
ATOM   5468  O  O     . TYR B 2 71   ? 178.708 151.139 149.794 1.00 50.26  ?  68   TYR B O     1 
ATOM   5469  C  CB    . TYR B 2 71   ? 177.008 153.424 151.136 1.00 66.32  ?  68   TYR B CB    1 
ATOM   5470  C  CG    . TYR B 2 71   ? 176.764 154.577 152.083 1.00 86.46  ?  68   TYR B CG    1 
ATOM   5471  C  CD1   . TYR B 2 71   ? 177.645 155.644 152.137 1.00 98.53  ?  68   TYR B CD1   1 
ATOM   5472  C  CD2   . TYR B 2 71   ? 175.668 154.593 152.934 1.00 83.60  ?  68   TYR B CD2   1 
ATOM   5473  C  CE1   . TYR B 2 71   ? 177.444 156.698 153.010 1.00 103.15 ?  68   TYR B CE1   1 
ATOM   5474  C  CE2   . TYR B 2 71   ? 175.458 155.649 153.812 1.00 100.05 ?  68   TYR B CE2   1 
ATOM   5475  C  CZ    . TYR B 2 71   ? 176.351 156.698 153.844 1.00 104.51 ?  68   TYR B CZ    1 
ATOM   5476  O  OH    . TYR B 2 71   ? 176.172 157.761 154.701 1.00 103.28 ?  68   TYR B OH    1 
ATOM   5477  N  N     . LEU B 2 72   ? 177.232 150.122 151.177 1.00 42.36  ?  69   LEU B N     1 
ATOM   5478  C  CA    . LEU B 2 72   ? 177.263 148.840 150.497 1.00 34.90  ?  69   LEU B CA    1 
ATOM   5479  C  C     . LEU B 2 72   ? 175.957 148.575 149.781 1.00 20.12  ?  69   LEU B C     1 
ATOM   5480  O  O     . LEU B 2 72   ? 174.885 148.711 150.385 1.00 24.27  ?  69   LEU B O     1 
ATOM   5481  C  CB    . LEU B 2 72   ? 177.526 147.712 151.481 1.00 25.67  ?  69   LEU B CB    1 
ATOM   5482  C  CG    . LEU B 2 72   ? 178.983 147.303 151.634 1.00 43.37  ?  69   LEU B CG    1 
ATOM   5483  C  CD1   . LEU B 2 72   ? 179.843 148.492 152.034 1.00 75.19  ?  69   LEU B CD1   1 
ATOM   5484  C  CD2   . LEU B 2 72   ? 179.069 146.182 152.642 1.00 59.82  ?  69   LEU B CD2   1 
ATOM   5485  N  N     . PRO B 2 73   ? 176.007 148.187 148.509 1.00 19.17  ?  70   PRO B N     1 
ATOM   5486  C  CA    . PRO B 2 73   ? 174.789 147.737 147.841 1.00 15.40  ?  70   PRO B CA    1 
ATOM   5487  C  C     . PRO B 2 73   ? 174.239 146.498 148.492 1.00 11.60  ?  70   PRO B C     1 
ATOM   5488  O  O     . PRO B 2 73   ? 174.987 145.698 149.091 1.00 55.82  ?  70   PRO B O     1 
ATOM   5489  C  CB    . PRO B 2 73   ? 175.263 147.473 146.404 1.00 12.67  ?  70   PRO B CB    1 
ATOM   5490  C  CG    . PRO B 2 73   ? 176.735 147.196 146.549 1.00 11.29  ?  70   PRO B CG    1 
ATOM   5491  C  CD    . PRO B 2 73   ? 177.196 148.094 147.646 1.00 15.03  ?  70   PRO B CD    1 
ATOM   5492  N  N     . PRO B 2 74   ? 172.904 146.284 148.438 1.00 10.32  ?  71   PRO B N     1 
ATOM   5493  C  CA    . PRO B 2 74   ? 172.318 145.128 149.132 1.00 12.42  ?  71   PRO B CA    1 
ATOM   5494  C  C     . PRO B 2 74   ? 172.551 143.823 148.376 1.00 16.82  ?  71   PRO B C     1 
ATOM   5495  O  O     . PRO B 2 74   ? 171.728 143.343 147.594 1.00 19.87  ?  71   PRO B O     1 
ATOM   5496  C  CB    . PRO B 2 74   ? 170.837 145.503 149.216 1.00 11.45  ?  71   PRO B CB    1 
ATOM   5497  C  CG    . PRO B 2 74   ? 170.599 146.387 148.035 1.00 15.50  ?  71   PRO B CG    1 
ATOM   5498  C  CD    . PRO B 2 74   ? 171.937 146.867 147.498 1.00 10.64  ?  71   PRO B CD    1 
ATOM   5499  N  N     . LEU B 2 75   ? 173.728 143.245 148.616 1.00 13.83  ?  72   LEU B N     1 
ATOM   5500  C  CA    . LEU B 2 75   ? 174.106 141.989 147.984 1.00 10.05  ?  72   LEU B CA    1 
ATOM   5501  C  C     . LEU B 2 75   ? 173.107 140.894 148.349 1.00 11.44  ?  72   LEU B C     1 
ATOM   5502  O  O     . LEU B 2 75   ? 172.466 140.926 149.402 1.00 12.63  ?  72   LEU B O     1 
ATOM   5503  C  CB    . LEU B 2 75   ? 175.524 141.597 148.400 1.00 10.20  ?  72   LEU B CB    1 
ATOM   5504  C  CG    . LEU B 2 75   ? 176.544 142.737 148.517 1.00 30.78  ?  72   LEU B CG    1 
ATOM   5505  C  CD1   . LEU B 2 75   ? 177.942 142.227 148.862 1.00 70.33  ?  72   LEU B CD1   1 
ATOM   5506  C  CD2   . LEU B 2 75   ? 176.595 143.557 147.241 1.00 41.57  ?  72   LEU B CD2   1 
ATOM   5507  N  N     . ARG B 2 76   ? 172.966 139.921 147.459 1.00 10.63  ?  73   ARG B N     1 
ATOM   5508  C  CA    . ARG B 2 76   ? 171.875 138.970 147.603 1.00 11.78  ?  73   ARG B CA    1 
ATOM   5509  C  C     . ARG B 2 76   ? 172.285 137.703 148.340 1.00 10.88  ?  73   ARG B C     1 
ATOM   5510  O  O     . ARG B 2 76   ? 171.743 137.397 149.406 1.00 12.23  ?  73   ARG B O     1 
ATOM   5511  C  CB    . ARG B 2 76   ? 171.319 138.603 146.233 1.00 20.78  ?  73   ARG B CB    1 
ATOM   5512  C  CG    . ARG B 2 76   ? 169.839 138.351 146.243 1.00 42.26  ?  73   ARG B CG    1 
ATOM   5513  C  CD    . ARG B 2 76   ? 169.148 139.451 145.496 1.00 36.72  ?  73   ARG B CD    1 
ATOM   5514  N  NE    . ARG B 2 76   ? 169.789 139.630 144.204 1.00 40.92  ?  73   ARG B NE    1 
ATOM   5515  C  CZ    . ARG B 2 76   ? 169.549 138.861 143.154 1.00 66.47  ?  73   ARG B CZ    1 
ATOM   5516  N  NH1   . ARG B 2 76   ? 168.690 137.854 143.251 1.00 75.73  ?  73   ARG B NH1   1 
ATOM   5517  N  NH2   . ARG B 2 76   ? 170.170 139.085 142.000 1.00 71.27  ?  73   ARG B NH2   1 
ATOM   5518  N  N     . CYS B 2 77   ? 173.247 136.966 147.790 1.00 11.22  ?  74   CYS B N     1 
ATOM   5519  C  CA    . CYS B 2 77   ? 173.695 135.699 148.358 1.00 9.25   ?  74   CYS B CA    1 
ATOM   5520  C  C     . CYS B 2 77   ? 175.206 135.737 148.540 1.00 6.79   ?  74   CYS B C     1 
ATOM   5521  O  O     . CYS B 2 77   ? 175.951 134.995 147.886 1.00 10.34  ?  74   CYS B O     1 
ATOM   5522  C  CB    . CYS B 2 77   ? 173.283 134.525 147.480 1.00 8.67   ?  74   CYS B CB    1 
ATOM   5523  S  SG    . CYS B 2 77   ? 171.563 134.626 146.944 1.00 83.35  ?  74   CYS B SG    1 
ATOM   5524  N  N     . PRO B 2 78   ? 175.687 136.578 149.427 1.00 9.05   ?  75   PRO B N     1 
ATOM   5525  C  CA    . PRO B 2 78   ? 177.131 136.701 149.625 1.00 12.71  ?  75   PRO B CA    1 
ATOM   5526  C  C     . PRO B 2 78   ? 177.653 135.584 150.501 1.00 11.66  ?  75   PRO B C     1 
ATOM   5527  O  O     . PRO B 2 78   ? 176.906 134.663 150.848 1.00 11.24  ?  75   PRO B O     1 
ATOM   5528  C  CB    . PRO B 2 78   ? 177.249 138.054 150.319 1.00 23.44  ?  75   PRO B CB    1 
ATOM   5529  C  CG    . PRO B 2 78   ? 176.048 138.039 151.225 1.00 19.66  ?  75   PRO B CG    1 
ATOM   5530  C  CD    . PRO B 2 78   ? 174.944 137.299 150.476 1.00 10.27  ?  75   PRO B CD    1 
ATOM   5531  N  N     . ALA B 2 79   ? 178.928 135.659 150.871 1.00 16.31  ?  76   ALA B N     1 
ATOM   5532  C  CA    . ALA B 2 79   ? 179.498 134.793 151.895 1.00 25.04  ?  76   ALA B CA    1 
ATOM   5533  C  C     . ALA B 2 79   ? 179.842 135.628 153.121 1.00 15.45  ?  76   ALA B C     1 
ATOM   5534  O  O     . ALA B 2 79   ? 180.574 136.617 153.016 1.00 15.27  ?  76   ALA B O     1 
ATOM   5535  C  CB    . ALA B 2 79   ? 180.739 134.057 151.383 1.00 23.18  ?  76   ALA B CB    1 
ATOM   5536  N  N     . ILE B 2 80   ? 179.313 135.222 154.276 1.00 15.74  ?  77   ILE B N     1 
ATOM   5537  C  CA    . ILE B 2 80   ? 179.536 135.888 155.554 1.00 16.23  ?  77   ILE B CA    1 
ATOM   5538  C  C     . ILE B 2 80   ? 180.653 135.139 156.263 1.00 19.92  ?  77   ILE B C     1 
ATOM   5539  O  O     . ILE B 2 80   ? 180.713 133.906 156.206 1.00 34.76  ?  77   ILE B O     1 
ATOM   5540  C  CB    . ILE B 2 80   ? 178.239 135.895 156.392 1.00 18.52  ?  77   ILE B CB    1 
ATOM   5541  C  CG1   . ILE B 2 80   ? 177.346 137.091 156.041 1.00 14.37  ?  77   ILE B CG1   1 
ATOM   5542  C  CG2   . ILE B 2 80   ? 178.530 135.891 157.899 1.00 16.98  ?  77   ILE B CG2   1 
ATOM   5543  C  CD1   . ILE B 2 80   ? 176.850 137.129 154.604 1.00 10.66  ?  77   ILE B CD1   1 
ATOM   5544  N  N     . ALA B 2 81   ? 181.544 135.869 156.925 1.00 19.04  ?  78   ALA B N     1 
ATOM   5545  C  CA    . ALA B 2 81   ? 182.622 135.248 157.685 1.00 21.76  ?  78   ALA B CA    1 
ATOM   5546  C  C     . ALA B 2 81   ? 182.774 136.008 158.991 1.00 24.71  ?  78   ALA B C     1 
ATOM   5547  O  O     . ALA B 2 81   ? 183.109 137.194 158.979 1.00 36.36  ?  78   ALA B O     1 
ATOM   5548  C  CB    . ALA B 2 81   ? 183.936 135.262 156.897 1.00 27.17  ?  78   ALA B CB    1 
ATOM   5549  N  N     . HIS B 2 82   ? 182.522 135.340 160.114 1.00 25.87  ?  79   HIS B N     1 
ATOM   5550  C  CA    . HIS B 2 82   ? 182.612 135.989 161.422 1.00 40.11  ?  79   HIS B CA    1 
ATOM   5551  C  C     . HIS B 2 82   ? 184.073 136.258 161.746 1.00 43.92  ?  79   HIS B C     1 
ATOM   5552  O  O     . HIS B 2 82   ? 184.812 135.353 162.134 1.00 59.73  ?  79   HIS B O     1 
ATOM   5553  C  CB    . HIS B 2 82   ? 181.967 135.116 162.493 1.00 47.07  ?  79   HIS B CB    1 
ATOM   5554  C  CG    . HIS B 2 82   ? 181.892 135.754 163.847 1.00 49.01  ?  79   HIS B CG    1 
ATOM   5555  N  ND1   . HIS B 2 82   ? 183.011 136.116 164.567 1.00 51.57  ?  79   HIS B ND1   1 
ATOM   5556  C  CD2   . HIS B 2 82   ? 180.828 136.085 164.617 1.00 47.08  ?  79   HIS B CD2   1 
ATOM   5557  C  CE1   . HIS B 2 82   ? 182.639 136.640 165.721 1.00 47.41  ?  79   HIS B CE1   1 
ATOM   5558  N  NE2   . HIS B 2 82   ? 181.320 136.635 165.774 1.00 48.37  ?  79   HIS B NE2   1 
ATOM   5559  N  N     . PHE B 2 83   ? 184.514 137.499 161.563 1.00 66.57  ?  80   PHE B N     1 
ATOM   5560  C  CA    . PHE B 2 83   ? 185.825 137.917 162.050 1.00 84.30  ?  80   PHE B CA    1 
ATOM   5561  C  C     . PHE B 2 83   ? 185.724 137.977 163.566 1.00 103.58 ?  80   PHE B C     1 
ATOM   5562  O  O     . PHE B 2 83   ? 185.220 138.950 164.137 1.00 110.43 ?  80   PHE B O     1 
ATOM   5563  C  CB    . PHE B 2 83   ? 186.228 139.264 161.460 1.00 87.79  ?  80   PHE B CB    1 
ATOM   5564  C  CG    . PHE B 2 83   ? 187.583 139.762 161.917 1.00 95.94  ?  80   PHE B CG    1 
ATOM   5565  C  CD1   . PHE B 2 83   ? 188.458 138.942 162.614 1.00 94.39  ?  80   PHE B CD1   1 
ATOM   5566  C  CD2   . PHE B 2 83   ? 187.957 141.074 161.683 1.00 114.11 ?  80   PHE B CD2   1 
ATOM   5567  C  CE1   . PHE B 2 83   ? 189.674 139.417 163.051 1.00 115.00 ?  80   PHE B CE1   1 
ATOM   5568  C  CE2   . PHE B 2 83   ? 189.181 141.551 162.118 1.00 136.61 ?  80   PHE B CE2   1 
ATOM   5569  C  CZ    . PHE B 2 83   ? 190.037 140.719 162.801 1.00 136.30 ?  80   PHE B CZ    1 
ATOM   5570  N  N     . GLU B 2 84   ? 186.214 136.922 164.210 1.00 106.87 ?  81   GLU B N     1 
ATOM   5571  C  CA    . GLU B 2 84   ? 186.068 136.737 165.645 1.00 121.53 ?  81   GLU B CA    1 
ATOM   5572  C  C     . GLU B 2 84   ? 186.731 137.874 166.412 1.00 125.20 ?  81   GLU B C     1 
ATOM   5573  O  O     . GLU B 2 84   ? 187.695 138.493 165.952 1.00 111.10 ?  81   GLU B O     1 
ATOM   5574  C  CB    . GLU B 2 84   ? 186.663 135.382 166.049 1.00 143.29 ?  81   GLU B CB    1 
ATOM   5575  C  CG    . GLU B 2 84   ? 186.396 134.954 167.478 1.00 167.04 ?  81   GLU B CG    1 
ATOM   5576  C  CD    . GLU B 2 84   ? 187.587 135.201 168.377 1.00 217.39 ?  81   GLU B CD    1 
ATOM   5577  O  OE1   . GLU B 2 84   ? 188.651 135.596 167.856 1.00 193.10 ?  81   GLU B OE1   1 
ATOM   5578  O  OE2   . GLU B 2 84   ? 187.460 135.001 169.603 1.00 358.13 -1 81   GLU B OE2   1 
ATOM   5579  N  N     . ALA B 2 85   ? 186.183 138.158 167.589 1.00 123.23 ?  82   ALA B N     1 
ATOM   5580  C  CA    . ALA B 2 85   ? 186.681 139.241 168.421 1.00 107.72 ?  82   ALA B CA    1 
ATOM   5581  C  C     . ALA B 2 85   ? 188.129 138.995 168.808 1.00 118.28 ?  82   ALA B C     1 
ATOM   5582  O  O     . ALA B 2 85   ? 188.446 137.982 169.438 1.00 154.00 ?  82   ALA B O     1 
ATOM   5583  C  CB    . ALA B 2 85   ? 185.815 139.377 169.672 1.00 118.49 ?  82   ALA B CB    1 
ATOM   5584  N  N     . GLN B 2 86   ? 189.005 139.924 168.444 1.00 100.94 ?  83   GLN B N     1 
ATOM   5585  C  CA    . GLN B 2 86   ? 190.423 139.786 168.743 1.00 105.46 ?  83   GLN B CA    1 
ATOM   5586  C  C     . GLN B 2 86   ? 191.104 141.116 168.469 1.00 104.69 ?  83   GLN B C     1 
ATOM   5587  O  O     . GLN B 2 86   ? 190.541 142.012 167.834 1.00 110.07 ?  83   GLN B O     1 
ATOM   5588  C  CB    . GLN B 2 86   ? 191.075 138.685 167.903 1.00 111.73 ?  83   GLN B CB    1 
ATOM   5589  C  CG    . GLN B 2 86   ? 190.864 138.868 166.409 1.00 108.12 ?  83   GLN B CG    1 
ATOM   5590  C  CD    . GLN B 2 86   ? 191.986 138.264 165.590 1.00 125.61 ?  83   GLN B CD    1 
ATOM   5591  O  OE1   . GLN B 2 86   ? 191.743 137.469 164.683 1.00 129.90 ?  83   GLN B OE1   1 
ATOM   5592  N  NE2   . GLN B 2 86   ? 193.221 138.629 165.911 1.00 124.95 ?  83   GLN B NE2   1 
ATOM   5593  N  N     . ASP B 2 87   ? 192.332 141.228 168.961 1.00 111.18 ?  84   ASP B N     1 
ATOM   5594  C  CA    . ASP B 2 87   ? 193.213 142.304 168.541 1.00 118.58 ?  84   ASP B CA    1 
ATOM   5595  C  C     . ASP B 2 87   ? 193.356 142.275 167.022 1.00 131.13 ?  84   ASP B C     1 
ATOM   5596  O  O     . ASP B 2 87   ? 193.473 141.204 166.420 1.00 134.13 ?  84   ASP B O     1 
ATOM   5597  C  CB    . ASP B 2 87   ? 194.569 142.135 169.229 1.00 127.39 ?  84   ASP B CB    1 
ATOM   5598  C  CG    . ASP B 2 87   ? 195.547 143.220 168.871 1.00 155.76 ?  84   ASP B CG    1 
ATOM   5599  O  OD1   . ASP B 2 87   ? 195.438 144.336 169.427 1.00 135.04 ?  84   ASP B OD1   1 
ATOM   5600  O  OD2   . ASP B 2 87   ? 196.431 142.956 168.035 1.00 261.71 -1 84   ASP B OD2   1 
ATOM   5601  N  N     . GLY B 2 88   ? 193.339 143.450 166.393 1.00 123.73 ?  85   GLY B N     1 
ATOM   5602  C  CA    . GLY B 2 88   ? 193.282 144.728 167.077 1.00 109.26 ?  85   GLY B CA    1 
ATOM   5603  C  C     . GLY B 2 88   ? 191.904 145.241 167.430 1.00 106.93 ?  85   GLY B C     1 
ATOM   5604  O  O     . GLY B 2 88   ? 191.625 145.497 168.598 1.00 106.84 ?  85   GLY B O     1 
ATOM   5605  N  N     . LYS B 2 89   ? 191.042 145.396 166.425 1.00 106.42 ?  86   LYS B N     1 
ATOM   5606  C  CA    . LYS B 2 89   ? 189.718 145.970 166.650 1.00 113.60 ?  86   LYS B CA    1 
ATOM   5607  C  C     . LYS B 2 89   ? 188.635 144.921 166.457 1.00 89.44  ?  86   LYS B C     1 
ATOM   5608  O  O     . LYS B 2 89   ? 188.170 144.705 165.327 1.00 78.17  ?  86   LYS B O     1 
ATOM   5609  C  CB    . LYS B 2 89   ? 189.466 147.161 165.726 1.00 114.76 ?  86   LYS B CB    1 
ATOM   5610  C  CG    . LYS B 2 89   ? 188.401 148.096 166.279 1.00 119.29 ?  86   LYS B CG    1 
ATOM   5611  C  CD    . LYS B 2 89   ? 187.860 149.058 165.235 1.00 153.87 ?  86   LYS B CD    1 
ATOM   5612  C  CE    . LYS B 2 89   ? 186.387 148.791 164.956 1.00 152.30 ?  86   LYS B CE    1 
ATOM   5613  N  NZ    . LYS B 2 89   ? 185.721 149.954 164.305 1.00 145.55 ?  86   LYS B NZ    1 
ATOM   5614  N  N     . PRO B 2 90   ? 188.192 144.257 167.513 1.00 95.17  ?  87   PRO B N     1 
ATOM   5615  C  CA    . PRO B 2 90   ? 186.996 143.424 167.426 1.00 90.40  ?  87   PRO B CA    1 
ATOM   5616  C  C     . PRO B 2 90   ? 185.748 144.297 167.392 1.00 94.43  ?  87   PRO B C     1 
ATOM   5617  O  O     . PRO B 2 90   ? 185.780 145.491 167.698 1.00 87.74  ?  87   PRO B O     1 
ATOM   5618  C  CB    . PRO B 2 90   ? 187.071 142.602 168.715 1.00 117.54 ?  87   PRO B CB    1 
ATOM   5619  C  CG    . PRO B 2 90   ? 187.746 143.503 169.677 1.00 128.31 ?  87   PRO B CG    1 
ATOM   5620  C  CD    . PRO B 2 90   ? 188.726 144.320 168.885 1.00 113.91 ?  87   PRO B CD    1 
ATOM   5621  N  N     . GLU B 2 91   ? 184.629 143.688 167.000 1.00 101.78 ?  88   GLU B N     1 
ATOM   5622  C  CA    . GLU B 2 91   ? 184.565 142.349 166.415 1.00 94.40  ?  88   GLU B CA    1 
ATOM   5623  C  C     . GLU B 2 91   ? 183.827 142.534 165.109 1.00 97.25  ?  88   GLU B C     1 
ATOM   5624  O  O     . GLU B 2 91   ? 182.980 143.425 165.013 1.00 111.48 ?  88   GLU B O     1 
ATOM   5625  C  CB    . GLU B 2 91   ? 183.845 141.364 167.340 1.00 106.85 ?  88   GLU B CB    1 
ATOM   5626  C  CG    . GLU B 2 91   ? 182.381 141.703 167.581 1.00 137.32 ?  88   GLU B CG    1 
ATOM   5627  C  CD    . GLU B 2 91   ? 181.633 140.620 168.348 1.00 182.79 ?  88   GLU B CD    1 
ATOM   5628  O  OE1   . GLU B 2 91   ? 182.283 139.788 169.018 1.00 171.31 ?  88   GLU B OE1   1 
ATOM   5629  O  OE2   . GLU B 2 91   ? 180.387 140.593 168.266 1.00 315.71 -1 88   GLU B OE2   1 
ATOM   5630  N  N     . CYS B 2 92   ? 184.118 141.734 164.086 1.00 100.59 ?  89   CYS B N     1 
ATOM   5631  C  CA    . CYS B 2 92   ? 183.693 142.146 162.757 1.00 86.45  ?  89   CYS B CA    1 
ATOM   5632  C  C     . CYS B 2 92   ? 183.024 141.005 162.001 1.00 60.22  ?  89   CYS B C     1 
ATOM   5633  O  O     . CYS B 2 92   ? 183.033 139.843 162.417 1.00 68.96  ?  89   CYS B O     1 
ATOM   5634  C  CB    . CYS B 2 92   ? 184.883 142.706 161.959 1.00 103.29 ?  89   CYS B CB    1 
ATOM   5635  S  SG    . CYS B 2 92   ? 185.713 144.123 162.747 1.00 135.50 ?  89   CYS B SG    1 
ATOM   5636  N  N     . TYR B 2 93   ? 182.425 141.368 160.870 1.00 35.15  ?  90   TYR B N     1 
ATOM   5637  C  CA    . TYR B 2 93   ? 181.936 140.415 159.880 1.00 30.44  ?  90   TYR B CA    1 
ATOM   5638  C  C     . TYR B 2 93   ? 182.525 140.777 158.524 1.00 32.15  ?  90   TYR B C     1 
ATOM   5639  O  O     . TYR B 2 93   ? 182.452 141.933 158.099 1.00 42.71  ?  90   TYR B O     1 
ATOM   5640  C  CB    . TYR B 2 93   ? 180.401 140.389 159.817 1.00 15.52  ?  90   TYR B CB    1 
ATOM   5641  C  CG    . TYR B 2 93   ? 179.778 139.446 160.822 1.00 18.08  ?  90   TYR B CG    1 
ATOM   5642  C  CD1   . TYR B 2 93   ? 179.816 139.721 162.176 1.00 32.78  ?  90   TYR B CD1   1 
ATOM   5643  C  CD2   . TYR B 2 93   ? 179.161 138.271 160.414 1.00 21.11  ?  90   TYR B CD2   1 
ATOM   5644  C  CE1   . TYR B 2 93   ? 179.250 138.856 163.098 1.00 50.38  ?  90   TYR B CE1   1 
ATOM   5645  C  CE2   . TYR B 2 93   ? 178.590 137.399 161.329 1.00 26.77  ?  90   TYR B CE2   1 
ATOM   5646  C  CZ    . TYR B 2 93   ? 178.640 137.699 162.673 1.00 35.43  ?  90   TYR B CZ    1 
ATOM   5647  O  OH    . TYR B 2 93   ? 178.081 136.846 163.601 1.00 31.10  ?  90   TYR B OH    1 
ATOM   5648  N  N     . LEU B 2 94   ? 183.133 139.802 157.859 1.00 25.55  ?  91   LEU B N     1 
ATOM   5649  C  CA    . LEU B 2 94   ? 183.649 139.986 156.511 1.00 30.17  ?  91   LEU B CA    1 
ATOM   5650  C  C     . LEU B 2 94   ? 182.589 139.539 155.507 1.00 29.34  ?  91   LEU B C     1 
ATOM   5651  O  O     . LEU B 2 94   ? 182.068 138.421 155.599 1.00 25.80  ?  91   LEU B O     1 
ATOM   5652  C  CB    . LEU B 2 94   ? 184.962 139.213 156.336 1.00 34.11  ?  91   LEU B CB    1 
ATOM   5653  C  CG    . LEU B 2 94   ? 186.200 139.772 157.064 1.00 43.23  ?  91   LEU B CG    1 
ATOM   5654  C  CD1   . LEU B 2 94   ? 187.498 139.154 156.550 1.00 79.35  ?  91   LEU B CD1   1 
ATOM   5655  C  CD2   . LEU B 2 94   ? 186.277 141.293 156.959 1.00 63.51  ?  91   LEU B CD2   1 
ATOM   5656  N  N     . ILE B 2 95   ? 182.254 140.431 154.571 1.00 29.87  ?  92   ILE B N     1 
ATOM   5657  C  CA    . ILE B 2 95   ? 181.236 140.194 153.553 1.00 23.94  ?  92   ILE B CA    1 
ATOM   5658  C  C     . ILE B 2 95   ? 181.906 140.244 152.190 1.00 18.92  ?  92   ILE B C     1 
ATOM   5659  O  O     . ILE B 2 95   ? 182.573 141.231 151.852 1.00 24.46  ?  92   ILE B O     1 
ATOM   5660  C  CB    . ILE B 2 95   ? 180.087 141.219 153.624 1.00 25.75  ?  92   ILE B CB    1 
ATOM   5661  C  CG1   . ILE B 2 95   ? 179.082 140.855 154.716 1.00 22.49  ?  92   ILE B CG1   1 
ATOM   5662  C  CG2   . ILE B 2 95   ? 179.363 141.321 152.296 1.00 22.12  ?  92   ILE B CG2   1 
ATOM   5663  C  CD1   . ILE B 2 95   ? 177.827 141.728 154.725 1.00 12.89  ?  92   ILE B CD1   1 
ATOM   5664  N  N     . HIS B 2 96   ? 181.729 139.176 151.421 1.00 15.13  ?  93   HIS B N     1 
ATOM   5665  C  CA    . HIS B 2 96   ? 182.136 139.086 150.029 1.00 17.83  ?  93   HIS B CA    1 
ATOM   5666  C  C     . HIS B 2 96   ? 181.615 137.763 149.502 1.00 17.18  ?  93   HIS B C     1 
ATOM   5667  O  O     . HIS B 2 96   ? 181.591 136.777 150.238 1.00 17.82  ?  93   HIS B O     1 
ATOM   5668  C  CB    . HIS B 2 96   ? 183.662 139.177 149.882 1.00 19.77  ?  93   HIS B CB    1 
ATOM   5669  C  CG    . HIS B 2 96   ? 184.172 138.767 148.534 1.00 25.81  ?  93   HIS B CG    1 
ATOM   5670  N  ND1   . HIS B 2 96   ? 184.408 137.452 148.196 1.00 39.77  ?  93   HIS B ND1   1 
ATOM   5671  C  CD2   . HIS B 2 96   ? 184.460 139.497 147.432 1.00 41.06  ?  93   HIS B CD2   1 
ATOM   5672  C  CE1   . HIS B 2 96   ? 184.842 137.393 146.951 1.00 44.62  ?  93   HIS B CE1   1 
ATOM   5673  N  NE2   . HIS B 2 96   ? 184.880 138.620 146.465 1.00 49.67  ?  93   HIS B NE2   1 
ATOM   5674  N  N     . GLY B 2 97   ? 181.173 137.755 148.251 1.00 22.79  ?  94   GLY B N     1 
ATOM   5675  C  CA    . GLY B 2 97   ? 181.057 138.971 147.474 1.00 20.44  ?  94   GLY B CA    1 
ATOM   5676  C  C     . GLY B 2 97   ? 179.640 139.151 146.990 1.00 19.02  ?  94   GLY B C     1 
ATOM   5677  O  O     . GLY B 2 97   ? 179.201 140.276 146.764 1.00 30.20  ?  94   GLY B O     1 
ATOM   5678  N  N     . GLY B 2 98   ? 178.925 138.034 146.853 1.00 19.83  ?  95   GLY B N     1 
ATOM   5679  C  CA    . GLY B 2 98   ? 177.544 138.042 146.400 1.00 25.73  ?  95   GLY B CA    1 
ATOM   5680  C  C     . GLY B 2 98   ? 177.300 138.755 145.080 1.00 43.44  ?  95   GLY B C     1 
ATOM   5681  O  O     . GLY B 2 98   ? 178.226 138.973 144.294 1.00 39.15  ?  95   GLY B O     1 
ATOM   5682  N  N     . ARG B 2 99   ? 176.043 139.138 144.832 1.00 36.24  ?  96   ARG B N     1 
ATOM   5683  C  CA    . ARG B 2 99   ? 175.649 139.829 143.608 1.00 20.13  ?  96   ARG B CA    1 
ATOM   5684  C  C     . ARG B 2 99   ? 174.621 140.912 143.922 1.00 28.86  ?  96   ARG B C     1 
ATOM   5685  O  O     . ARG B 2 99   ? 173.861 140.808 144.889 1.00 23.40  ?  96   ARG B O     1 
ATOM   5686  C  CB    . ARG B 2 99   ? 175.083 138.847 142.582 1.00 10.82  ?  96   ARG B CB    1 
ATOM   5687  C  CG    . ARG B 2 99   ? 173.946 138.037 143.153 1.00 14.80  ?  96   ARG B CG    1 
ATOM   5688  C  CD    . ARG B 2 99   ? 173.597 136.890 142.243 1.00 25.78  ?  96   ARG B CD    1 
ATOM   5689  N  NE    . ARG B 2 99   ? 172.399 137.161 141.463 1.00 55.11  ?  96   ARG B NE    1 
ATOM   5690  C  CZ    . ARG B 2 99   ? 171.739 136.236 140.776 1.00 55.31  ?  96   ARG B CZ    1 
ATOM   5691  N  NH1   . ARG B 2 99   ? 170.652 136.562 140.094 1.00 63.08  ?  96   ARG B NH1   1 
ATOM   5692  N  NH2   . ARG B 2 99   ? 172.167 134.984 140.781 1.00 48.11  ?  96   ARG B NH2   1 
ATOM   5693  N  N     . THR B 2 100  ? 174.607 141.950 143.079 1.00 39.57  ?  97   THR B N     1 
ATOM   5694  C  CA    . THR B 2 100  ? 173.848 143.179 143.307 1.00 47.78  ?  97   THR B CA    1 
ATOM   5695  C  C     . THR B 2 100  ? 172.382 143.009 142.899 1.00 37.25  ?  97   THR B C     1 
ATOM   5696  O  O     . THR B 2 100  ? 172.015 142.018 142.264 1.00 40.72  ?  97   THR B O     1 
ATOM   5697  C  CB    . THR B 2 100  ? 174.504 144.327 142.542 1.00 51.10  ?  97   THR B CB    1 
ATOM   5698  O  OG1   . THR B 2 100  ? 174.149 144.247 141.158 1.00 54.92  ?  97   THR B OG1   1 
ATOM   5699  C  CG2   . THR B 2 100  ? 176.027 144.281 142.669 1.00 56.64  ?  97   THR B CG2   1 
ATOM   5700  N  N     . PRO B 2 101  ? 171.501 143.952 143.281 1.00 11.91  ?  98   PRO B N     1 
ATOM   5701  C  CA    . PRO B 2 101  ? 170.117 143.888 142.773 1.00 8.04   ?  98   PRO B CA    1 
ATOM   5702  C  C     . PRO B 2 101  ? 170.031 143.724 141.268 1.00 12.56  ?  98   PRO B C     1 
ATOM   5703  O  O     . PRO B 2 101  ? 169.374 142.795 140.786 1.00 11.18  ?  98   PRO B O     1 
ATOM   5704  C  CB    . PRO B 2 101  ? 169.528 145.219 143.245 1.00 11.52  ?  98   PRO B CB    1 
ATOM   5705  C  CG    . PRO B 2 101  ? 170.206 145.432 144.529 1.00 13.73  ?  98   PRO B CG    1 
ATOM   5706  C  CD    . PRO B 2 101  ? 171.630 145.010 144.303 1.00 11.14  ?  98   PRO B CD    1 
ATOM   5707  N  N     . ASN B 2 102  ? 170.676 144.601 140.509 1.00 9.51   ?  99   ASN B N     1 
ATOM   5708  C  CA    . ASN B 2 102  ? 170.912 144.304 139.107 1.00 15.82  ?  99   ASN B CA    1 
ATOM   5709  C  C     . ASN B 2 102  ? 171.839 143.103 139.037 1.00 11.83  ?  99   ASN B C     1 
ATOM   5710  O  O     . ASN B 2 102  ? 172.862 143.062 139.726 1.00 23.60  ?  99   ASN B O     1 
ATOM   5711  C  CB    . ASN B 2 102  ? 171.544 145.498 138.391 1.00 11.67  ?  99   ASN B CB    1 
ATOM   5712  C  CG    . ASN B 2 102  ? 171.027 146.832 138.901 1.00 18.57  ?  99   ASN B CG    1 
ATOM   5713  O  OD1   . ASN B 2 102  ? 169.868 146.956 139.297 1.00 17.60  ?  99   ASN B OD1   1 
ATOM   5714  N  ND2   . ASN B 2 102  ? 171.885 147.848 138.867 1.00 21.16  ?  99   ASN B ND2   1 
ATOM   5715  N  N     . ASN B 2 103  ? 171.493 142.117 138.214 1.00 13.49  ?  100  ASN B N     1 
ATOM   5716  C  CA    . ASN B 2 103  ? 172.232 140.863 138.289 1.00 20.01  ?  100  ASN B CA    1 
ATOM   5717  C  C     . ASN B 2 103  ? 173.646 140.968 137.745 1.00 17.09  ?  100  ASN B C     1 
ATOM   5718  O  O     . ASN B 2 103  ? 173.999 140.342 136.741 1.00 26.22  ?  100  ASN B O     1 
ATOM   5719  C  CB    . ASN B 2 103  ? 171.492 139.737 137.578 1.00 37.32  ?  100  ASN B CB    1 
ATOM   5720  C  CG    . ASN B 2 103  ? 170.625 138.953 138.518 1.00 66.76  ?  100  ASN B CG    1 
ATOM   5721  O  OD1   . ASN B 2 103  ? 170.815 139.013 139.734 1.00 70.21  ?  100  ASN B OD1   1 
ATOM   5722  N  ND2   . ASN B 2 103  ? 169.685 138.193 137.973 1.00 73.89  ?  100  ASN B ND2   1 
ATOM   5723  N  N     . GLU B 2 104  ? 174.464 141.743 138.438 1.00 24.56  ?  101  GLU B N     1 
ATOM   5724  C  CA    . GLU B 2 104  ? 175.896 141.798 138.227 1.00 36.98  ?  101  GLU B CA    1 
ATOM   5725  C  C     . GLU B 2 104  ? 176.579 141.455 139.544 1.00 33.97  ?  101  GLU B C     1 
ATOM   5726  O  O     . GLU B 2 104  ? 175.985 141.551 140.622 1.00 31.82  ?  101  GLU B O     1 
ATOM   5727  C  CB    . GLU B 2 104  ? 176.332 143.179 137.698 1.00 77.79  ?  101  GLU B CB    1 
ATOM   5728  C  CG    . GLU B 2 104  ? 176.052 144.348 138.640 1.00 107.84 ?  101  GLU B CG    1 
ATOM   5729  C  CD    . GLU B 2 104  ? 176.316 145.713 137.997 1.00 149.85 ?  101  GLU B CD    1 
ATOM   5730  O  OE1   . GLU B 2 104  ? 175.353 146.359 137.527 1.00 114.58 ?  101  GLU B OE1   1 
ATOM   5731  O  OE2   . GLU B 2 104  ? 177.485 146.152 137.977 1.00 326.13 -1 101  GLU B OE2   1 
ATOM   5732  N  N     . LEU B 2 105  ? 177.832 141.040 139.446 1.00 24.49  ?  102  LEU B N     1 
ATOM   5733  C  CA    . LEU B 2 105  ? 178.527 140.424 140.562 1.00 15.61  ?  102  LEU B CA    1 
ATOM   5734  C  C     . LEU B 2 105  ? 179.560 141.394 141.122 1.00 12.72  ?  102  LEU B C     1 
ATOM   5735  O  O     . LEU B 2 105  ? 180.054 142.275 140.416 1.00 20.81  ?  102  LEU B O     1 
ATOM   5736  C  CB    . LEU B 2 105  ? 179.167 139.112 140.114 1.00 20.83  ?  102  LEU B CB    1 
ATOM   5737  C  CG    . LEU B 2 105  ? 178.218 137.905 140.093 1.00 20.68  ?  102  LEU B CG    1 
ATOM   5738  C  CD1   . LEU B 2 105  ? 177.128 138.039 139.053 1.00 12.85  ?  102  LEU B CD1   1 
ATOM   5739  C  CD2   . LEU B 2 105  ? 179.013 136.654 139.818 1.00 33.57  ?  102  LEU B CD2   1 
ATOM   5740  N  N     . SER B 2 106  ? 179.870 141.240 142.408 1.00 12.99  ?  103  SER B N     1 
ATOM   5741  C  CA    . SER B 2 106  ? 180.554 142.299 143.145 1.00 22.04  ?  103  SER B CA    1 
ATOM   5742  C  C     . SER B 2 106  ? 182.062 142.314 142.889 1.00 39.25  ?  103  SER B C     1 
ATOM   5743  O  O     . SER B 2 106  ? 182.595 143.281 142.340 1.00 51.18  ?  103  SER B O     1 
ATOM   5744  C  CB    . SER B 2 106  ? 180.258 142.141 144.637 1.00 25.87  ?  103  SER B CB    1 
ATOM   5745  O  OG    . SER B 2 106  ? 181.085 142.968 145.435 1.00 31.19  ?  103  SER B OG    1 
ATOM   5746  N  N     . SER B 2 107  ? 182.761 141.245 143.277 1.00 48.13  ?  104  SER B N     1 
ATOM   5747  C  CA    . SER B 2 107  ? 184.231 141.207 143.333 1.00 49.51  ?  104  SER B CA    1 
ATOM   5748  C  C     . SER B 2 107  ? 184.769 142.365 144.172 1.00 46.89  ?  104  SER B C     1 
ATOM   5749  O  O     . SER B 2 107  ? 185.609 143.150 143.734 1.00 44.71  ?  104  SER B O     1 
ATOM   5750  C  CB    . SER B 2 107  ? 184.859 141.194 141.933 1.00 34.54  ?  104  SER B CB    1 
ATOM   5751  O  OG    . SER B 2 107  ? 186.112 141.866 141.903 1.00 33.49  ?  104  SER B OG    1 
ATOM   5752  N  N     . SER B 2 108  ? 184.273 142.458 145.404 1.00 46.15  ?  105  SER B N     1 
ATOM   5753  C  CA    . SER B 2 108  ? 184.627 143.555 146.298 1.00 46.56  ?  105  SER B CA    1 
ATOM   5754  C  C     . SER B 2 108  ? 184.499 143.096 147.745 1.00 41.53  ?  105  SER B C     1 
ATOM   5755  O  O     . SER B 2 108  ? 183.405 142.749 148.195 1.00 42.77  ?  105  SER B O     1 
ATOM   5756  C  CB    . SER B 2 108  ? 183.744 144.777 146.024 1.00 78.15  ?  105  SER B CB    1 
ATOM   5757  O  OG    . SER B 2 108  ? 182.376 144.516 146.294 1.00 67.99  ?  105  SER B OG    1 
ATOM   5758  N  N     . LEU B 2 109  ? 185.617 143.098 148.468 1.00 37.41  ?  106  LEU B N     1 
ATOM   5759  C  CA    . LEU B 2 109  ? 185.628 142.707 149.871 1.00 31.51  ?  106  LEU B CA    1 
ATOM   5760  C  C     . LEU B 2 109  ? 185.145 143.851 150.746 1.00 38.75  ?  106  LEU B C     1 
ATOM   5761  O  O     . LEU B 2 109  ? 185.456 145.019 150.499 1.00 47.18  ?  106  LEU B O     1 
ATOM   5762  C  CB    . LEU B 2 109  ? 187.032 142.283 150.307 1.00 47.51  ?  106  LEU B CB    1 
ATOM   5763  C  CG    . LEU B 2 109  ? 187.238 141.879 151.771 1.00 60.03  ?  106  LEU B CG    1 
ATOM   5764  C  CD1   . LEU B 2 109  ? 188.296 140.805 151.848 1.00 122.84 ?  106  LEU B CD1   1 
ATOM   5765  C  CD2   . LEU B 2 109  ? 187.650 143.047 152.660 1.00 37.80  ?  106  LEU B CD2   1 
ATOM   5766  N  N     . TYR B 2 110  ? 184.408 143.500 151.795 1.00 40.14  ?  107  TYR B N     1 
ATOM   5767  C  CA    . TYR B 2 110  ? 183.874 144.486 152.717 1.00 46.90  ?  107  TYR B CA    1 
ATOM   5768  C  C     . TYR B 2 110  ? 184.071 143.999 154.146 1.00 41.97  ?  107  TYR B C     1 
ATOM   5769  O  O     . TYR B 2 110  ? 183.988 142.799 154.428 1.00 49.46  ?  107  TYR B O     1 
ATOM   5770  C  CB    . TYR B 2 110  ? 182.386 144.742 152.460 1.00 70.39  ?  107  TYR B CB    1 
ATOM   5771  C  CG    . TYR B 2 110  ? 182.083 145.428 151.144 1.00 95.92  ?  107  TYR B CG    1 
ATOM   5772  C  CD1   . TYR B 2 110  ? 182.591 146.687 150.863 1.00 121.39 ?  107  TYR B CD1   1 
ATOM   5773  C  CD2   . TYR B 2 110  ? 181.248 144.838 150.203 1.00 85.69  ?  107  TYR B CD2   1 
ATOM   5774  C  CE1   . TYR B 2 110  ? 182.303 147.329 149.667 1.00 147.92 ?  107  TYR B CE1   1 
ATOM   5775  C  CE2   . TYR B 2 110  ? 180.950 145.476 149.006 1.00 78.18  ?  107  TYR B CE2   1 
ATOM   5776  C  CZ    . TYR B 2 110  ? 181.482 146.720 148.744 1.00 124.47 ?  107  TYR B CZ    1 
ATOM   5777  O  OH    . TYR B 2 110  ? 181.191 147.355 147.556 1.00 121.35 ?  107  TYR B OH    1 
ATOM   5778  N  N     . MET B 2 111  ? 184.305 144.944 155.053 1.00 30.99  ?  108  MET B N     1 
ATOM   5779  C  CA    . MET B 2 111  ? 184.437 144.669 156.475 1.00 32.50  ?  108  MET B CA    1 
ATOM   5780  C  C     . MET B 2 111  ? 183.374 145.461 157.222 1.00 32.68  ?  108  MET B C     1 
ATOM   5781  O  O     . MET B 2 111  ? 183.161 146.638 156.923 1.00 57.59  ?  108  MET B O     1 
ATOM   5782  C  CB    . MET B 2 111  ? 185.841 145.043 156.952 1.00 31.26  ?  108  MET B CB    1 
ATOM   5783  C  CG    . MET B 2 111  ? 186.057 144.908 158.437 1.00 40.87  ?  108  MET B CG    1 
ATOM   5784  S  SD    . MET B 2 111  ? 187.711 145.470 158.865 1.00 130.10 ?  108  MET B SD    1 
ATOM   5785  C  CE    . MET B 2 111  ? 188.639 144.866 157.455 1.00 52.14  ?  108  MET B CE    1 
ATOM   5786  N  N     . LEU B 2 112  ? 182.696 144.822 158.177 1.00 38.03  ?  109  LEU B N     1 
ATOM   5787  C  CA    . LEU B 2 112  ? 181.618 145.453 158.932 1.00 38.67  ?  109  LEU B CA    1 
ATOM   5788  C  C     . LEU B 2 112  ? 181.888 145.351 160.429 1.00 53.23  ?  109  LEU B C     1 
ATOM   5789  O  O     . LEU B 2 112  ? 182.232 144.276 160.932 1.00 49.34  ?  109  LEU B O     1 
ATOM   5790  C  CB    . LEU B 2 112  ? 180.268 144.808 158.595 1.00 26.77  ?  109  LEU B CB    1 
ATOM   5791  C  CG    . LEU B 2 112  ? 178.973 145.514 158.995 1.00 25.06  ?  109  LEU B CG    1 
ATOM   5792  C  CD1   . LEU B 2 112  ? 177.859 145.029 158.097 1.00 31.78  ?  109  LEU B CD1   1 
ATOM   5793  C  CD2   . LEU B 2 112  ? 178.590 145.275 160.454 1.00 29.39  ?  109  LEU B CD2   1 
ATOM   5794  N  N     . SER B 2 113  ? 181.690 146.467 161.143 1.00 87.62  ?  110  SER B N     1 
ATOM   5795  C  CA    . SER B 2 113  ? 181.903 146.515 162.589 1.00 94.39  ?  110  SER B CA    1 
ATOM   5796  C  C     . SER B 2 113  ? 180.882 147.450 163.237 1.00 103.26 ?  110  SER B C     1 
ATOM   5797  O  O     . SER B 2 113  ? 180.129 148.163 162.560 1.00 98.66  ?  110  SER B O     1 
ATOM   5798  C  CB    . SER B 2 113  ? 183.339 146.957 162.930 1.00 78.08  ?  110  SER B CB    1 
ATOM   5799  O  OG    . SER B 2 113  ? 183.432 147.485 164.243 1.00 72.33  ?  110  SER B OG    1 
ATOM   5800  N  N     . VAL B 2 114  ? 180.855 147.419 164.573 1.00 112.81 ?  111  VAL B N     1 
ATOM   5801  C  CA    . VAL B 2 114  ? 180.029 148.311 165.377 1.00 112.11 ?  111  VAL B CA    1 
ATOM   5802  C  C     . VAL B 2 114  ? 180.924 149.426 165.910 1.00 132.03 ?  111  VAL B C     1 
ATOM   5803  O  O     . VAL B 2 114  ? 182.146 149.277 166.028 1.00 119.03 ?  111  VAL B O     1 
ATOM   5804  C  CB    . VAL B 2 114  ? 179.311 147.550 166.527 1.00 82.25  ?  111  VAL B CB    1 
ATOM   5805  C  CG1   . VAL B 2 114  ? 180.284 147.212 167.657 1.00 94.12  ?  111  VAL B CG1   1 
ATOM   5806  C  CG2   . VAL B 2 114  ? 178.118 148.335 167.056 1.00 99.41  ?  111  VAL B CG2   1 
ATOM   5807  N  N     . ASP B 2 115  ? 180.320 150.582 166.207 1.00 153.00 ?  112  ASP B N     1 
ATOM   5808  C  CA    . ASP B 2 115  ? 181.082 151.720 166.715 1.00 167.12 ?  112  ASP B CA    1 
ATOM   5809  C  C     . ASP B 2 115  ? 180.675 152.129 168.128 1.00 197.58 ?  112  ASP B C     1 
ATOM   5810  O  O     . ASP B 2 115  ? 181.531 152.148 169.020 1.00 196.58 ?  112  ASP B O     1 
ATOM   5811  C  CB    . ASP B 2 115  ? 180.947 152.896 165.737 1.00 169.95 ?  112  ASP B CB    1 
ATOM   5812  C  CG    . ASP B 2 115  ? 181.555 154.173 166.270 1.00 207.50 ?  112  ASP B CG    1 
ATOM   5813  O  OD1   . ASP B 2 115  ? 182.792 154.236 166.437 1.00 184.91 ?  112  ASP B OD1   1 
ATOM   5814  O  OD2   . ASP B 2 115  ? 180.782 155.116 166.528 1.00 323.43 -1 112  ASP B OD2   1 
ATOM   5815  N  N     . SER B 2 116  ? 179.401 152.435 168.375 1.00 190.22 ?  113  SER B N     1 
ATOM   5816  C  CA    . SER B 2 116  ? 178.977 153.001 169.657 1.00 162.32 ?  113  SER B CA    1 
ATOM   5817  C  C     . SER B 2 116  ? 177.453 152.941 169.765 1.00 138.31 ?  113  SER B C     1 
ATOM   5818  O  O     . SER B 2 116  ? 176.757 152.506 168.843 1.00 133.91 ?  113  SER B O     1 
ATOM   5819  C  CB    . SER B 2 116  ? 179.472 154.439 169.821 1.00 170.46 ?  113  SER B CB    1 
ATOM   5820  O  OG    . SER B 2 116  ? 178.978 155.266 168.782 1.00 173.42 ?  113  SER B OG    1 
ATOM   5821  N  N     . ARG B 2 117  ? 176.944 153.416 170.903 1.00 119.63 ?  114  ARG B N     1 
ATOM   5822  C  CA    . ARG B 2 117  ? 175.539 153.337 171.297 1.00 120.60 ?  114  ARG B CA    1 
ATOM   5823  C  C     . ARG B 2 117  ? 175.408 154.055 172.642 1.00 133.52 ?  114  ARG B C     1 
ATOM   5824  O  O     . ARG B 2 117  ? 176.412 154.323 173.309 1.00 136.80 ?  114  ARG B O     1 
ATOM   5825  C  CB    . ARG B 2 117  ? 175.081 151.868 171.368 1.00 105.20 ?  114  ARG B CB    1 
ATOM   5826  C  CG    . ARG B 2 117  ? 174.829 151.316 172.764 1.00 91.33  ?  114  ARG B CG    1 
ATOM   5827  C  CD    . ARG B 2 117  ? 174.906 149.806 172.753 1.00 87.99  ?  114  ARG B CD    1 
ATOM   5828  N  NE    . ARG B 2 117  ? 176.243 149.355 172.378 1.00 113.85 ?  114  ARG B NE    1 
ATOM   5829  C  CZ    . ARG B 2 117  ? 176.530 148.135 171.934 1.00 100.75 ?  114  ARG B CZ    1 
ATOM   5830  N  NH1   . ARG B 2 117  ? 177.782 147.823 171.617 1.00 69.62  ?  114  ARG B NH1   1 
ATOM   5831  N  NH2   . ARG B 2 117  ? 175.571 147.224 171.816 1.00 103.52 ?  114  ARG B NH2   1 
ATOM   5832  N  N     . GLY B 2 118  ? 174.172 154.375 173.036 1.00 144.77 ?  115  GLY B N     1 
ATOM   5833  C  CA    . GLY B 2 118  ? 172.987 154.290 172.199 1.00 151.77 ?  115  GLY B CA    1 
ATOM   5834  C  C     . GLY B 2 118  ? 172.711 155.468 171.279 1.00 157.50 ?  115  GLY B C     1 
ATOM   5835  O  O     . GLY B 2 118  ? 172.781 155.314 170.062 1.00 154.35 ?  115  GLY B O     1 
ATOM   5836  N  N     . CYS B 2 119  ? 172.400 156.641 171.835 1.00 149.86 ?  116  CYS B N     1 
ATOM   5837  C  CA    . CYS B 2 119  ? 172.231 156.850 173.274 1.00 141.39 ?  116  CYS B CA    1 
ATOM   5838  C  C     . CYS B 2 119  ? 171.030 156.100 173.857 1.00 126.04 ?  116  CYS B C     1 
ATOM   5839  O  O     . CYS B 2 119  ? 171.114 155.553 174.954 1.00 126.54 ?  116  CYS B O     1 
ATOM   5840  C  CB    . CYS B 2 119  ? 172.098 158.345 173.578 1.00 139.68 ?  116  CYS B CB    1 
ATOM   5841  S  SG    . CYS B 2 119  ? 170.549 159.085 173.015 1.00 164.87 ?  116  CYS B SG    1 
ATOM   5842  N  N     . ASN B 2 120  ? 169.923 156.072 173.119 1.00 114.97 ?  117  ASN B N     1 
ATOM   5843  C  CA    . ASN B 2 120  ? 168.696 155.400 173.551 1.00 117.88 ?  117  ASN B CA    1 
ATOM   5844  C  C     . ASN B 2 120  ? 168.488 154.172 172.664 1.00 149.04 ?  117  ASN B C     1 
ATOM   5845  O  O     . ASN B 2 120  ? 167.837 154.248 171.621 1.00 159.03 ?  117  ASN B O     1 
ATOM   5846  C  CB    . ASN B 2 120  ? 167.504 156.369 173.490 1.00 101.23 ?  117  ASN B CB    1 
ATOM   5847  C  CG    . ASN B 2 120  ? 166.166 155.684 173.738 1.00 115.66 ?  117  ASN B CG    1 
ATOM   5848  O  OD1   . ASN B 2 120  ? 165.514 155.201 172.812 1.00 129.54 ?  117  ASN B OD1   1 
ATOM   5849  N  ND2   . ASN B 2 120  ? 165.752 155.642 175.000 1.00 150.80 ?  117  ASN B ND2   1 
ATOM   5850  N  N     . ARG B 2 121  ? 169.080 153.042 173.072 1.00 139.95 ?  118  ARG B N     1 
ATOM   5851  C  CA    . ARG B 2 121  ? 168.864 151.737 172.445 1.00 134.70 ?  118  ARG B CA    1 
ATOM   5852  C  C     . ARG B 2 121  ? 169.305 151.693 170.987 1.00 134.90 ?  118  ARG B C     1 
ATOM   5853  O  O     . ARG B 2 121  ? 169.110 150.680 170.310 1.00 124.69 ?  118  ARG B O     1 
ATOM   5854  C  CB    . ARG B 2 121  ? 167.390 151.335 172.533 1.00 136.03 ?  118  ARG B CB    1 
ATOM   5855  C  CG    . ARG B 2 121  ? 166.841 151.180 173.937 1.00 128.97 ?  118  ARG B CG    1 
ATOM   5856  C  CD    . ARG B 2 121  ? 166.953 149.747 174.419 1.00 125.93 ?  118  ARG B CD    1 
ATOM   5857  N  NE    . ARG B 2 121  ? 166.189 149.532 175.644 1.00 152.73 ?  118  ARG B NE    1 
ATOM   5858  C  CZ    . ARG B 2 121  ? 166.311 148.463 176.422 1.00 159.36 ?  118  ARG B CZ    1 
ATOM   5859  N  NH1   . ARG B 2 121  ? 167.167 147.504 176.102 1.00 161.67 ?  118  ARG B NH1   1 
ATOM   5860  N  NH2   . ARG B 2 121  ? 165.574 148.350 177.520 1.00 142.92 ?  118  ARG B NH2   1 
ATOM   5861  N  N     . LYS B 2 122  ? 169.888 152.778 170.496 1.00 140.61 ?  119  LYS B N     1 
ATOM   5862  C  CA    . LYS B 2 122  ? 170.199 152.919 169.084 1.00 119.49 ?  119  LYS B CA    1 
ATOM   5863  C  C     . LYS B 2 122  ? 171.636 152.482 168.816 1.00 121.31 ?  119  LYS B C     1 
ATOM   5864  O  O     . LYS B 2 122  ? 172.501 152.535 169.691 1.00 127.32 ?  119  LYS B O     1 
ATOM   5865  C  CB    . LYS B 2 122  ? 169.962 154.369 168.649 1.00 130.11 ?  119  LYS B CB    1 
ATOM   5866  C  CG    . LYS B 2 122  ? 170.549 154.771 167.313 1.00 138.43 ?  119  LYS B CG    1 
ATOM   5867  C  CD    . LYS B 2 122  ? 170.755 156.276 167.248 1.00 160.56 ?  119  LYS B CD    1 
ATOM   5868  C  CE    . LYS B 2 122  ? 171.618 156.664 166.060 1.00 160.06 ?  119  LYS B CE    1 
ATOM   5869  N  NZ    . LYS B 2 122  ? 171.056 156.141 164.785 1.00 166.29 ?  119  LYS B NZ    1 
ATOM   5870  N  N     . VAL B 2 123  ? 171.876 152.024 167.592 1.00 108.24 ?  120  VAL B N     1 
ATOM   5871  C  CA    . VAL B 2 123  ? 173.152 151.431 167.227 1.00 105.88 ?  120  VAL B CA    1 
ATOM   5872  C  C     . VAL B 2 123  ? 173.825 152.292 166.168 1.00 90.52  ?  120  VAL B C     1 
ATOM   5873  O  O     . VAL B 2 123  ? 173.165 152.935 165.345 1.00 94.93  ?  120  VAL B O     1 
ATOM   5874  C  CB    . VAL B 2 123  ? 172.966 149.983 166.725 1.00 119.39 ?  120  VAL B CB    1 
ATOM   5875  C  CG1   . VAL B 2 123  ? 174.301 149.247 166.706 1.00 125.02 ?  120  VAL B CG1   1 
ATOM   5876  C  CG2   . VAL B 2 123  ? 171.936 149.249 167.584 1.00 131.84 ?  120  VAL B CG2   1 
ATOM   5877  N  N     . THR B 2 124  ? 175.154 152.311 166.209 1.00 89.38  ?  121  THR B N     1 
ATOM   5878  C  CA    . THR B 2 124  ? 175.982 152.922 165.177 1.00 84.96  ?  121  THR B CA    1 
ATOM   5879  C  C     . THR B 2 124  ? 176.838 151.831 164.542 1.00 102.75 ?  121  THR B C     1 
ATOM   5880  O  O     . THR B 2 124  ? 177.594 151.143 165.240 1.00 127.04 ?  121  THR B O     1 
ATOM   5881  C  CB    . THR B 2 124  ? 176.858 154.034 165.757 1.00 112.87 ?  121  THR B CB    1 
ATOM   5882  O  OG1   . THR B 2 124  ? 177.824 153.465 166.649 1.00 155.88 ?  121  THR B OG1   1 
ATOM   5883  C  CG2   . THR B 2 124  ? 176.012 155.042 166.519 1.00 87.08  ?  121  THR B CG2   1 
ATOM   5884  N  N     . LEU B 2 125  ? 176.729 151.678 163.225 1.00 73.42  ?  122  LEU B N     1 
ATOM   5885  C  CA    . LEU B 2 125  ? 177.452 150.646 162.498 1.00 59.81  ?  122  LEU B CA    1 
ATOM   5886  C  C     . LEU B 2 125  ? 178.333 151.278 161.428 1.00 51.62  ?  122  LEU B C     1 
ATOM   5887  O  O     . LEU B 2 125  ? 178.068 152.389 160.956 1.00 54.25  ?  122  LEU B O     1 
ATOM   5888  C  CB    . LEU B 2 125  ? 176.485 149.638 161.869 1.00 47.19  ?  122  LEU B CB    1 
ATOM   5889  C  CG    . LEU B 2 125  ? 175.649 148.833 162.864 1.00 55.04  ?  122  LEU B CG    1 
ATOM   5890  C  CD1   . LEU B 2 125  ? 174.732 147.886 162.129 1.00 43.10  ?  122  LEU B CD1   1 
ATOM   5891  C  CD2   . LEU B 2 125  ? 176.553 148.052 163.800 1.00 62.12  ?  122  LEU B CD2   1 
ATOM   5892  N  N     . ARG B 2 126  ? 179.391 150.562 161.049 1.00 54.39  ?  123  ARG B N     1 
ATOM   5893  C  CA    . ARG B 2 126  ? 180.356 151.076 160.093 1.00 59.49  ?  123  ARG B CA    1 
ATOM   5894  C  C     . ARG B 2 126  ? 180.755 149.980 159.115 1.00 59.73  ?  123  ARG B C     1 
ATOM   5895  O  O     . ARG B 2 126  ? 180.851 148.803 159.477 1.00 71.19  ?  123  ARG B O     1 
ATOM   5896  C  CB    . ARG B 2 126  ? 181.588 151.658 160.813 1.00 63.56  ?  123  ARG B CB    1 
ATOM   5897  C  CG    . ARG B 2 126  ? 182.932 151.240 160.246 1.00 64.85  ?  123  ARG B CG    1 
ATOM   5898  C  CD    . ARG B 2 126  ? 184.017 152.199 160.683 1.00 76.39  ?  123  ARG B CD    1 
ATOM   5899  N  NE    . ARG B 2 126  ? 183.983 153.402 159.857 1.00 77.52  ?  123  ARG B NE    1 
ATOM   5900  C  CZ    . ARG B 2 126  ? 184.818 154.425 159.985 1.00 90.01  ?  123  ARG B CZ    1 
ATOM   5901  N  NH1   . ARG B 2 126  ? 184.706 155.474 159.182 1.00 85.26  ?  123  ARG B NH1   1 
ATOM   5902  N  NH2   . ARG B 2 126  ? 185.772 154.397 160.905 1.00 111.39 ?  123  ARG B NH2   1 
ATOM   5903  N  N     . CYS B 2 127  ? 180.995 150.396 157.866 1.00 54.09  ?  124  CYS B N     1 
ATOM   5904  C  CA    . CYS B 2 127  ? 181.333 149.492 156.768 1.00 60.22  ?  124  CYS B CA    1 
ATOM   5905  C  C     . CYS B 2 127  ? 182.529 150.050 156.003 1.00 72.26  ?  124  CYS B C     1 
ATOM   5906  O  O     . CYS B 2 127  ? 182.413 151.084 155.338 1.00 68.41  ?  124  CYS B O     1 
ATOM   5907  C  CB    . CYS B 2 127  ? 180.136 149.288 155.839 1.00 43.88  ?  124  CYS B CB    1 
ATOM   5908  S  SG    . CYS B 2 127  ? 178.819 148.316 156.583 1.00 115.53 ?  124  CYS B SG    1 
ATOM   5909  N  N     . GLU B 2 128  ? 183.674 149.364 156.091 1.00 79.39  ?  125  GLU B N     1 
ATOM   5910  C  CA    . GLU B 2 128  ? 184.897 149.759 155.396 1.00 62.34  ?  125  GLU B CA    1 
ATOM   5911  C  C     . GLU B 2 128  ? 185.179 148.826 154.226 1.00 41.53  ?  125  GLU B C     1 
ATOM   5912  O  O     . GLU B 2 128  ? 185.306 147.608 154.405 1.00 35.89  ?  125  GLU B O     1 
ATOM   5913  C  CB    . GLU B 2 128  ? 186.099 149.773 156.339 1.00 73.17  ?  125  GLU B CB    1 
ATOM   5914  C  CG    . GLU B 2 128  ? 185.854 150.470 157.651 1.00 106.06 ?  125  GLU B CG    1 
ATOM   5915  C  CD    . GLU B 2 128  ? 187.126 151.022 158.262 1.00 135.76 ?  125  GLU B CD    1 
ATOM   5916  O  OE1   . GLU B 2 128  ? 188.191 150.377 158.151 1.00 98.25  ?  125  GLU B OE1   1 
ATOM   5917  O  OE2   . GLU B 2 128  ? 187.060 152.120 158.850 1.00 215.49 -1 125  GLU B OE2   1 
ATOM   5918  N  N     . GLU B 2 129  ? 185.295 149.402 153.037 1.00 40.20  ?  126  GLU B N     1 
ATOM   5919  C  CA    . GLU B 2 129  ? 185.731 148.626 151.890 1.00 47.61  ?  126  GLU B CA    1 
ATOM   5920  C  C     . GLU B 2 129  ? 187.244 148.476 151.919 1.00 53.14  ?  126  GLU B C     1 
ATOM   5921  O  O     . GLU B 2 129  ? 187.979 149.438 152.156 1.00 63.76  ?  126  GLU B O     1 
ATOM   5922  C  CB    . GLU B 2 129  ? 185.299 149.295 150.585 1.00 82.86  ?  126  GLU B CB    1 
ATOM   5923  C  CG    . GLU B 2 129  ? 186.222 148.975 149.416 1.00 113.04 ?  126  GLU B CG    1 
ATOM   5924  C  CD    . GLU B 2 129  ? 185.537 149.114 148.066 1.00 174.92 ?  126  GLU B CD    1 
ATOM   5925  O  OE1   . GLU B 2 129  ? 184.315 149.374 148.035 1.00 186.37 ?  126  GLU B OE1   1 
ATOM   5926  O  OE2   . GLU B 2 129  ? 186.219 148.933 147.034 1.00 239.56 -1 126  GLU B OE2   1 
ATOM   5927  N  N     . LYS B 2 130  ? 187.711 147.258 151.686 1.00 51.76  ?  127  LYS B N     1 
ATOM   5928  C  CA    . LYS B 2 130  ? 189.135 146.967 151.633 1.00 49.32  ?  127  LYS B CA    1 
ATOM   5929  C  C     . LYS B 2 130  ? 189.456 146.484 150.228 1.00 42.46  ?  127  LYS B C     1 
ATOM   5930  O  O     . LYS B 2 130  ? 188.895 145.483 149.769 1.00 45.63  ?  127  LYS B O     1 
ATOM   5931  C  CB    . LYS B 2 130  ? 189.517 145.931 152.687 1.00 51.09  ?  127  LYS B CB    1 
ATOM   5932  C  CG    . LYS B 2 130  ? 190.460 146.461 153.744 1.00 62.92  ?  127  LYS B CG    1 
ATOM   5933  C  CD    . LYS B 2 130  ? 189.755 147.415 154.692 1.00 58.36  ?  127  LYS B CD    1 
ATOM   5934  C  CE    . LYS B 2 130  ? 190.539 147.578 155.980 1.00 78.61  ?  127  LYS B CE    1 
ATOM   5935  N  NZ    . LYS B 2 130  ? 191.954 147.954 155.706 1.00 130.69 ?  127  LYS B NZ    1 
ATOM   5936  N  N     . GLU B 2 131  ? 190.316 147.222 149.535 1.00 56.45  ?  128  GLU B N     1 
ATOM   5937  C  CA    . GLU B 2 131  ? 190.796 146.786 148.233 1.00 72.74  ?  128  GLU B CA    1 
ATOM   5938  C  C     . GLU B 2 131  ? 191.535 145.458 148.370 1.00 109.38 ?  128  GLU B C     1 
ATOM   5939  O  O     . GLU B 2 131  ? 192.134 145.161 149.407 1.00 109.70 ?  128  GLU B O     1 
ATOM   5940  C  CB    . GLU B 2 131  ? 191.699 147.870 147.618 1.00 108.41 ?  128  GLU B CB    1 
ATOM   5941  C  CG    . GLU B 2 131  ? 192.660 147.414 146.513 1.00 197.12 ?  128  GLU B CG    1 
ATOM   5942  C  CD    . GLU B 2 131  ? 193.932 146.754 147.047 1.00 235.31 ?  128  GLU B CD    1 
ATOM   5943  O  OE1   . GLU B 2 131  ? 194.223 146.891 148.252 1.00 200.00 ?  128  GLU B OE1   1 
ATOM   5944  O  OE2   . GLU B 2 131  ? 194.621 146.068 146.260 1.00 389.19 -1 128  GLU B OE2   1 
ATOM   5945  N  N     . LEU B 2 132  ? 191.497 144.656 147.304 1.00 133.86 ?  129  LEU B N     1 
ATOM   5946  C  CA    . LEU B 2 132  ? 192.173 143.363 147.253 1.00 138.80 ?  129  LEU B CA    1 
ATOM   5947  C  C     . LEU B 2 132  ? 193.250 143.387 146.174 1.00 152.97 ?  129  LEU B C     1 
ATOM   5948  O  O     . LEU B 2 132  ? 192.936 143.552 144.989 1.00 149.29 ?  129  LEU B O     1 
ATOM   5949  C  CB    . LEU B 2 132  ? 191.173 142.238 146.981 1.00 115.71 ?  129  LEU B CB    1 
ATOM   5950  C  CG    . LEU B 2 132  ? 190.300 141.833 148.166 1.00 152.63 ?  129  LEU B CG    1 
ATOM   5951  C  CD1   . LEU B 2 132  ? 189.861 140.384 148.023 1.00 191.56 ?  129  LEU B CD1   1 
ATOM   5952  C  CD2   . LEU B 2 132  ? 191.027 142.059 149.483 1.00 178.44 ?  129  LEU B CD2   1 
ATOM   5953  N  N     . VAL B 2 133  ? 194.513 143.206 146.577 1.00 158.32 ?  130  VAL B N     1 
ATOM   5954  C  CA    . VAL B 2 133  ? 195.634 143.175 145.641 1.00 147.69 ?  130  VAL B CA    1 
ATOM   5955  C  C     . VAL B 2 133  ? 196.091 141.732 145.463 1.00 137.30 ?  130  VAL B C     1 
ATOM   5956  O  O     . VAL B 2 133  ? 195.821 140.851 146.285 1.00 142.54 ?  130  VAL B O     1 
ATOM   5957  C  CB    . VAL B 2 133  ? 196.820 144.073 146.097 1.00 150.43 ?  130  VAL B CB    1 
ATOM   5958  C  CG1   . VAL B 2 133  ? 197.623 143.414 147.213 1.00 155.36 ?  130  VAL B CG1   1 
ATOM   5959  C  CG2   . VAL B 2 133  ? 197.719 144.448 144.913 1.00 128.17 ?  130  VAL B CG2   1 
ATOM   5960  N  N     . GLY B 2 134  ? 196.803 141.485 144.368 1.00 123.85 ?  131  GLY B N     1 
ATOM   5961  C  CA    . GLY B 2 134  ? 197.301 140.163 144.064 1.00 112.07 ?  131  GLY B CA    1 
ATOM   5962  C  C     . GLY B 2 134  ? 197.575 139.984 142.584 1.00 124.93 ?  131  GLY B C     1 
ATOM   5963  O  O     . GLY B 2 134  ? 198.219 140.860 141.998 1.00 137.28 ?  131  GLY B O     1 
ATOM   5964  N  N     . ASP B 2 135  ? 197.121 138.901 141.939 1.00 133.10 ?  132  ASP B N     1 
ATOM   5965  C  CA    . ASP B 2 135  ? 196.377 137.755 142.494 1.00 138.09 ?  132  ASP B CA    1 
ATOM   5966  C  C     . ASP B 2 135  ? 195.065 138.118 143.203 1.00 118.70 ?  132  ASP B C     1 
ATOM   5967  O  O     . ASP B 2 135  ? 194.910 137.879 144.401 1.00 126.57 ?  132  ASP B O     1 
ATOM   5968  C  CB    . ASP B 2 135  ? 197.272 136.939 143.439 1.00 174.16 ?  132  ASP B CB    1 
ATOM   5969  C  CG    . ASP B 2 135  ? 196.766 135.522 143.646 1.00 201.17 ?  132  ASP B CG    1 
ATOM   5970  O  OD1   . ASP B 2 135  ? 195.562 135.267 143.436 1.00 182.26 ?  132  ASP B OD1   1 
ATOM   5971  O  OD2   . ASP B 2 135  ? 197.578 134.652 144.021 1.00 321.00 -1 132  ASP B OD2   1 
ATOM   5972  N  N     . VAL B 2 136  ? 194.124 138.683 142.453 1.00 102.76 ?  133  VAL B N     1 
ATOM   5973  C  CA    . VAL B 2 136  ? 192.816 139.045 142.989 1.00 82.73  ?  133  VAL B CA    1 
ATOM   5974  C  C     . VAL B 2 136  ? 191.873 137.860 142.809 1.00 57.54  ?  133  VAL B C     1 
ATOM   5975  O  O     . VAL B 2 136  ? 192.132 136.982 141.972 1.00 62.29  ?  133  VAL B O     1 
ATOM   5976  C  CB    . VAL B 2 136  ? 192.273 140.314 142.311 1.00 77.39  ?  133  VAL B CB    1 
ATOM   5977  C  CG1   . VAL B 2 136  ? 193.376 141.351 142.168 1.00 104.18 ?  133  VAL B CG1   1 
ATOM   5978  C  CG2   . VAL B 2 136  ? 191.653 139.985 140.958 1.00 72.37  ?  133  VAL B CG2   1 
ATOM   5979  N  N     . PRO B 2 137  ? 190.796 137.772 143.579 1.00 44.63  ?  134  PRO B N     1 
ATOM   5980  C  CA    . PRO B 2 137  ? 189.782 136.750 143.328 1.00 38.17  ?  134  PRO B CA    1 
ATOM   5981  C  C     . PRO B 2 137  ? 188.785 137.242 142.288 1.00 34.38  ?  134  PRO B C     1 
ATOM   5982  O  O     . PRO B 2 137  ? 188.743 138.420 141.925 1.00 35.42  ?  134  PRO B O     1 
ATOM   5983  C  CB    . PRO B 2 137  ? 189.110 136.589 144.694 1.00 30.82  ?  134  PRO B CB    1 
ATOM   5984  C  CG    . PRO B 2 137  ? 189.156 137.963 145.236 1.00 48.57  ?  134  PRO B CG    1 
ATOM   5985  C  CD    . PRO B 2 137  ? 190.481 138.551 144.788 1.00 47.86  ?  134  PRO B CD    1 
ATOM   5986  N  N     . SER B 2 138  ? 187.973 136.313 141.817 1.00 45.85  ?  135  SER B N     1 
ATOM   5987  C  CA    . SER B 2 138  ? 186.949 136.617 140.835 1.00 46.29  ?  135  SER B CA    1 
ATOM   5988  C  C     . SER B 2 138  ? 185.585 136.677 141.512 1.00 35.38  ?  135  SER B C     1 
ATOM   5989  O  O     . SER B 2 138  ? 185.310 135.930 142.456 1.00 32.79  ?  135  SER B O     1 
ATOM   5990  C  CB    . SER B 2 138  ? 186.960 135.584 139.703 1.00 74.25  ?  135  SER B CB    1 
ATOM   5991  O  OG    . SER B 2 138  ? 186.679 134.285 140.180 1.00 60.04  ?  135  SER B OG    1 
ATOM   5992  N  N     . ALA B 2 139  ? 184.754 137.605 141.049 1.00 22.31  ?  136  ALA B N     1 
ATOM   5993  C  CA    . ALA B 2 139  ? 183.385 137.688 141.523 1.00 13.61  ?  136  ALA B CA    1 
ATOM   5994  C  C     . ALA B 2 139  ? 182.647 136.390 141.231 1.00 14.53  ?  136  ALA B C     1 
ATOM   5995  O  O     . ALA B 2 139  ? 182.850 135.756 140.195 1.00 27.06  ?  136  ALA B O     1 
ATOM   5996  C  CB    . ALA B 2 139  ? 182.650 138.849 140.857 1.00 19.19  ?  136  ALA B CB    1 
ATOM   5997  N  N     . ARG B 2 140  ? 181.763 136.019 142.150 1.00 11.87  ?  137  ARG B N     1 
ATOM   5998  C  CA    . ARG B 2 140  ? 181.018 134.774 142.111 1.00 12.91  ?  137  ARG B CA    1 
ATOM   5999  C  C     . ARG B 2 140  ? 180.080 134.806 143.312 1.00 14.42  ?  137  ARG B C     1 
ATOM   6000  O  O     . ARG B 2 140  ? 180.177 135.694 144.164 1.00 18.30  ?  137  ARG B O     1 
ATOM   6001  C  CB    . ARG B 2 140  ? 181.959 133.569 142.146 1.00 21.45  ?  137  ARG B CB    1 
ATOM   6002  C  CG    . ARG B 2 140  ? 182.968 133.668 143.273 1.00 36.59  ?  137  ARG B CG    1 
ATOM   6003  C  CD    . ARG B 2 140  ? 184.007 132.566 143.242 1.00 45.75  ?  137  ARG B CD    1 
ATOM   6004  N  NE    . ARG B 2 140  ? 185.199 132.948 142.488 1.00 39.82  ?  137  ARG B NE    1 
ATOM   6005  C  CZ    . ARG B 2 140  ? 186.143 132.096 142.105 1.00 45.39  ?  137  ARG B CZ    1 
ATOM   6006  N  NH1   . ARG B 2 140  ? 186.036 130.806 142.402 1.00 78.22  ?  137  ARG B NH1   1 
ATOM   6007  N  NH2   . ARG B 2 140  ? 187.197 132.533 141.430 1.00 43.07  ?  137  ARG B NH2   1 
ATOM   6008  N  N     . TYR B 2 141  ? 179.169 133.837 143.378 1.00 18.96  ?  138  TYR B N     1 
ATOM   6009  C  CA    . TYR B 2 141  ? 178.179 133.818 144.448 1.00 19.88  ?  138  TYR B CA    1 
ATOM   6010  C  C     . TYR B 2 141  ? 178.020 132.387 144.945 1.00 25.37  ?  138  TYR B C     1 
ATOM   6011  O  O     . TYR B 2 141  ? 178.252 131.428 144.204 1.00 46.32  ?  138  TYR B O     1 
ATOM   6012  C  CB    . TYR B 2 141  ? 176.816 134.375 143.995 1.00 29.37  ?  138  TYR B CB    1 
ATOM   6013  C  CG    . TYR B 2 141  ? 175.993 133.454 143.104 1.00 27.53  ?  138  TYR B CG    1 
ATOM   6014  C  CD1   . TYR B 2 141  ? 176.542 132.836 141.991 1.00 41.31  ?  138  TYR B CD1   1 
ATOM   6015  C  CD2   . TYR B 2 141  ? 174.656 133.204 143.384 1.00 25.63  ?  138  TYR B CD2   1 
ATOM   6016  C  CE1   . TYR B 2 141  ? 175.781 132.005 141.184 1.00 43.38  ?  138  TYR B CE1   1 
ATOM   6017  C  CE2   . TYR B 2 141  ? 173.893 132.375 142.584 1.00 28.62  ?  138  TYR B CE2   1 
ATOM   6018  C  CZ    . TYR B 2 141  ? 174.461 131.778 141.485 1.00 34.32  ?  138  TYR B CZ    1 
ATOM   6019  O  OH    . TYR B 2 141  ? 173.706 130.952 140.684 1.00 42.96  ?  138  TYR B OH    1 
ATOM   6020  N  N     . GLY B 2 142  ? 177.618 132.244 146.202 1.00 24.95  ?  139  GLY B N     1 
ATOM   6021  C  CA    . GLY B 2 142  ? 177.457 130.935 146.805 1.00 23.21  ?  139  GLY B CA    1 
ATOM   6022  C  C     . GLY B 2 142  ? 178.729 130.295 147.320 1.00 21.64  ?  139  GLY B C     1 
ATOM   6023  O  O     . GLY B 2 142  ? 178.666 129.185 147.862 1.00 23.84  ?  139  GLY B O     1 
ATOM   6024  N  N     . HIS B 2 143  ? 179.877 130.951 147.165 1.00 21.61  ?  140  HIS B N     1 
ATOM   6025  C  CA    . HIS B 2 143  ? 181.131 130.435 147.691 1.00 24.00  ?  140  HIS B CA    1 
ATOM   6026  C  C     . HIS B 2 143  ? 181.157 130.576 149.212 1.00 17.97  ?  140  HIS B C     1 
ATOM   6027  O  O     . HIS B 2 143  ? 180.191 131.006 149.837 1.00 18.34  ?  140  HIS B O     1 
ATOM   6028  C  CB    . HIS B 2 143  ? 182.315 131.144 147.039 1.00 25.38  ?  140  HIS B CB    1 
ATOM   6029  C  CG    . HIS B 2 143  ? 182.374 132.620 147.300 1.00 22.80  ?  140  HIS B CG    1 
ATOM   6030  N  ND1   . HIS B 2 143  ? 182.204 133.171 148.552 1.00 18.62  ?  140  HIS B ND1   1 
ATOM   6031  C  CD2   . HIS B 2 143  ? 182.616 133.657 146.465 1.00 27.46  ?  140  HIS B CD2   1 
ATOM   6032  C  CE1   . HIS B 2 143  ? 182.324 134.483 148.472 1.00 22.43  ?  140  HIS B CE1   1 
ATOM   6033  N  NE2   . HIS B 2 143  ? 182.576 134.802 147.217 1.00 27.60  ?  140  HIS B NE2   1 
ATOM   6034  N  N     . THR B 2 144  ? 182.288 130.223 149.822 1.00 21.75  ?  141  THR B N     1 
ATOM   6035  C  CA    . THR B 2 144  ? 182.388 130.235 151.275 1.00 17.16  ?  141  THR B CA    1 
ATOM   6036  C  C     . THR B 2 144  ? 183.699 130.858 151.730 1.00 18.02  ?  141  THR B C     1 
ATOM   6037  O  O     . THR B 2 144  ? 184.761 130.612 151.147 1.00 26.57  ?  141  THR B O     1 
ATOM   6038  C  CB    . THR B 2 144  ? 182.257 128.827 151.860 1.00 26.66  ?  141  THR B CB    1 
ATOM   6039  O  OG1   . THR B 2 144  ? 182.905 127.882 151.004 1.00 37.45  ?  141  THR B OG1   1 
ATOM   6040  C  CG2   . THR B 2 144  ? 180.802 128.457 152.010 1.00 42.42  ?  141  THR B CG2   1 
ATOM   6041  N  N     . LEU B 2 145  ? 183.606 131.646 152.796 1.00 14.62  ?  142  LEU B N     1 
ATOM   6042  C  CA    . LEU B 2 145  ? 184.742 132.275 153.443 1.00 16.28  ?  142  LEU B CA    1 
ATOM   6043  C  C     . LEU B 2 145  ? 184.883 131.740 154.861 1.00 32.87  ?  142  LEU B C     1 
ATOM   6044  O  O     . LEU B 2 145  ? 183.923 131.243 155.455 1.00 31.11  ?  142  LEU B O     1 
ATOM   6045  C  CB    . LEU B 2 145  ? 184.583 133.798 153.477 1.00 11.11  ?  142  LEU B CB    1 
ATOM   6046  C  CG    . LEU B 2 145  ? 185.875 134.597 153.599 1.00 16.84  ?  142  LEU B CG    1 
ATOM   6047  C  CD1   . LEU B 2 145  ? 186.793 134.366 152.423 1.00 29.03  ?  142  LEU B CD1   1 
ATOM   6048  C  CD2   . LEU B 2 145  ? 185.563 136.067 153.755 1.00 29.43  ?  142  LEU B CD2   1 
ATOM   6049  N  N     . SER B 2 146  ? 186.099 131.838 155.400 1.00 40.58  ?  143  SER B N     1 
ATOM   6050  C  CA    . SER B 2 146  ? 186.343 131.485 156.797 1.00 47.51  ?  143  SER B CA    1 
ATOM   6051  C  C     . SER B 2 146  ? 187.585 132.217 157.294 1.00 37.82  ?  143  SER B C     1 
ATOM   6052  O  O     . SER B 2 146  ? 188.452 132.604 156.510 1.00 37.29  ?  143  SER B O     1 
ATOM   6053  C  CB    . SER B 2 146  ? 186.495 129.970 156.982 1.00 51.93  ?  143  SER B CB    1 
ATOM   6054  O  OG    . SER B 2 146  ? 185.248 129.308 156.836 1.00 45.36  ?  143  SER B OG    1 
ATOM   6055  N  N     . VAL B 2 147  ? 187.647 132.413 158.613 1.00 37.63  ?  144  VAL B N     1 
ATOM   6056  C  CA    . VAL B 2 147  ? 188.786 133.027 159.287 1.00 44.14  ?  144  VAL B CA    1 
ATOM   6057  C  C     . VAL B 2 147  ? 189.485 131.953 160.112 1.00 69.10  ?  144  VAL B C     1 
ATOM   6058  O  O     . VAL B 2 147  ? 188.824 131.155 160.786 1.00 57.13  ?  144  VAL B O     1 
ATOM   6059  C  CB    . VAL B 2 147  ? 188.351 134.217 160.169 1.00 27.93  ?  144  VAL B CB    1 
ATOM   6060  C  CG1   . VAL B 2 147  ? 189.525 135.137 160.465 1.00 34.15  ?  144  VAL B CG1   1 
ATOM   6061  C  CG2   . VAL B 2 147  ? 187.237 135.001 159.495 1.00 35.58  ?  144  VAL B CG2   1 
ATOM   6062  N  N     . ILE B 2 148  ? 190.822 131.924 160.051 1.00 93.44  ?  145  ILE B N     1 
ATOM   6063  C  CA    . ILE B 2 148  ? 191.614 130.942 160.788 1.00 86.62  ?  145  ILE B CA    1 
ATOM   6064  C  C     . ILE B 2 148  ? 192.818 131.637 161.412 1.00 82.16  ?  145  ILE B C     1 
ATOM   6065  O  O     . ILE B 2 148  ? 193.217 132.733 161.004 1.00 81.29  ?  145  ILE B O     1 
ATOM   6066  C  CB    . ILE B 2 148  ? 192.067 129.741 159.910 1.00 80.60  ?  145  ILE B CB    1 
ATOM   6067  C  CG1   . ILE B 2 148  ? 192.437 130.163 158.479 1.00 76.74  ?  145  ILE B CG1   1 
ATOM   6068  C  CG2   . ILE B 2 148  ? 190.997 128.644 159.890 1.00 55.37  ?  145  ILE B CG2   1 
ATOM   6069  C  CD1   . ILE B 2 148  ? 193.647 131.080 158.347 1.00 72.17  ?  145  ILE B CD1   1 
ATOM   6070  N  N     . ASN B 2 149  ? 193.407 130.971 162.406 1.00 83.49  ?  146  ASN B N     1 
ATOM   6071  C  CA    . ASN B 2 149  ? 194.470 131.536 163.235 1.00 88.42  ?  146  ASN B CA    1 
ATOM   6072  C  C     . ASN B 2 149  ? 195.589 130.503 163.329 1.00 104.74 ?  146  ASN B C     1 
ATOM   6073  O  O     . ASN B 2 149  ? 195.442 129.487 164.015 1.00 124.25 ?  146  ASN B O     1 
ATOM   6074  C  CB    . ASN B 2 149  ? 193.941 131.895 164.617 1.00 82.12  ?  146  ASN B CB    1 
ATOM   6075  C  CG    . ASN B 2 149  ? 192.518 132.410 164.573 1.00 96.19  ?  146  ASN B CG    1 
ATOM   6076  O  OD1   . ASN B 2 149  ? 192.274 133.590 164.320 1.00 107.00 ?  146  ASN B OD1   1 
ATOM   6077  N  ND2   . ASN B 2 149  ? 191.561 131.511 164.784 1.00 93.92  ?  146  ASN B ND2   1 
ATOM   6078  N  N     . SER B 2 150  ? 196.699 130.748 162.639 1.00 100.44 ?  147  SER B N     1 
ATOM   6079  C  CA    . SER B 2 150  ? 197.829 129.825 162.607 1.00 112.47 ?  147  SER B CA    1 
ATOM   6080  C  C     . SER B 2 150  ? 199.091 130.557 163.059 1.00 119.50 ?  147  SER B C     1 
ATOM   6081  O  O     . SER B 2 150  ? 199.711 131.278 162.270 1.00 124.49 ?  147  SER B O     1 
ATOM   6082  C  CB    . SER B 2 150  ? 198.006 129.228 161.212 1.00 132.15 ?  147  SER B CB    1 
ATOM   6083  O  OG    . SER B 2 150  ? 199.337 128.783 161.006 1.00 152.18 ?  147  SER B OG    1 
ATOM   6084  N  N     . ARG B 2 151  ? 199.410 130.425 164.352 1.00 126.88 ?  148  ARG B N     1 
ATOM   6085  C  CA    . ARG B 2 151  ? 200.767 130.552 164.887 1.00 151.06 ?  148  ARG B CA    1 
ATOM   6086  C  C     . ARG B 2 151  ? 201.550 131.734 164.307 1.00 146.59 ?  148  ARG B C     1 
ATOM   6087  O  O     . ARG B 2 151  ? 202.498 131.534 163.538 1.00 149.09 ?  148  ARG B O     1 
ATOM   6088  C  CB    . ARG B 2 151  ? 201.496 129.205 164.679 1.00 160.79 ?  148  ARG B CB    1 
ATOM   6089  C  CG    . ARG B 2 151  ? 202.986 129.115 165.048 1.00 146.25 ?  148  ARG B CG    1 
ATOM   6090  C  CD    . ARG B 2 151  ? 203.781 128.526 163.886 1.00 121.62 ?  148  ARG B CD    1 
ATOM   6091  N  NE    . ARG B 2 151  ? 203.482 129.212 162.632 1.00 126.41 ?  148  ARG B NE    1 
ATOM   6092  C  CZ    . ARG B 2 151  ? 202.793 128.671 161.633 1.00 126.46 ?  148  ARG B CZ    1 
ATOM   6093  N  NH1   . ARG B 2 151  ? 202.561 129.377 160.539 1.00 131.97 ?  148  ARG B NH1   1 
ATOM   6094  N  NH2   . ARG B 2 151  ? 202.333 127.428 161.727 1.00 120.72 ?  148  ARG B NH2   1 
ATOM   6095  N  N     . GLY B 2 152  ? 201.135 132.966 164.596 1.00 121.99 ?  149  GLY B N     1 
ATOM   6096  C  CA    . GLY B 2 152  ? 199.917 133.277 165.325 1.00 104.30 ?  149  GLY B CA    1 
ATOM   6097  C  C     . GLY B 2 152  ? 199.097 134.194 164.446 1.00 92.05  ?  149  GLY B C     1 
ATOM   6098  O  O     . GLY B 2 152  ? 198.315 135.013 164.923 1.00 84.82  ?  149  GLY B O     1 
ATOM   6099  N  N     . LYS B 2 153  ? 199.298 134.047 163.141 1.00 98.99  ?  150  LYS B N     1 
ATOM   6100  C  CA    . LYS B 2 153  ? 198.747 134.972 162.164 1.00 97.15  ?  150  LYS B CA    1 
ATOM   6101  C  C     . LYS B 2 153  ? 197.319 134.580 161.808 1.00 95.53  ?  150  LYS B C     1 
ATOM   6102  O  O     . LYS B 2 153  ? 197.016 133.401 161.619 1.00 94.50  ?  150  LYS B O     1 
ATOM   6103  C  CB    . LYS B 2 153  ? 199.620 134.993 160.907 1.00 109.50 ?  150  LYS B CB    1 
ATOM   6104  C  CG    . LYS B 2 153  ? 199.346 136.157 159.985 1.00 125.42 ?  150  LYS B CG    1 
ATOM   6105  C  CD    . LYS B 2 153  ? 200.610 136.968 159.763 1.00 149.11 ?  150  LYS B CD    1 
ATOM   6106  C  CE    . LYS B 2 153  ? 201.028 137.700 161.033 1.00 126.10 ?  150  LYS B CE    1 
ATOM   6107  N  NZ    . LYS B 2 153  ? 202.354 138.363 160.888 1.00 124.24 ?  150  LYS B NZ    1 
ATOM   6108  N  N     . THR B 2 154  ? 196.447 135.576 161.721 1.00 84.80  ?  151  THR B N     1 
ATOM   6109  C  CA    . THR B 2 154  ? 195.042 135.368 161.402 1.00 66.03  ?  151  THR B CA    1 
ATOM   6110  C  C     . THR B 2 154  ? 194.807 135.705 159.936 1.00 55.85  ?  151  THR B C     1 
ATOM   6111  O  O     . THR B 2 154  ? 194.995 136.852 159.520 1.00 56.61  ?  151  THR B O     1 
ATOM   6112  C  CB    . THR B 2 154  ? 194.151 136.222 162.301 1.00 59.78  ?  151  THR B CB    1 
ATOM   6113  O  OG1   . THR B 2 154  ? 194.477 135.974 163.676 1.00 61.67  ?  151  THR B OG1   1 
ATOM   6114  C  CG2   . THR B 2 154  ? 192.687 135.909 162.063 1.00 65.04  ?  151  THR B CG2   1 
ATOM   6115  N  N     . ALA B 2 155  ? 194.405 134.707 159.160 1.00 54.64  ?  152  ALA B N     1 
ATOM   6116  C  CA    . ALA B 2 155  ? 194.163 134.877 157.732 1.00 57.74  ?  152  ALA B CA    1 
ATOM   6117  C  C     . ALA B 2 155  ? 192.743 134.422 157.396 1.00 80.78  ?  152  ALA B C     1 
ATOM   6118  O  O     . ALA B 2 155  ? 191.974 134.008 158.277 1.00 89.26  ?  152  ALA B O     1 
ATOM   6119  C  CB    . ALA B 2 155  ? 195.208 134.115 156.908 1.00 57.02  ?  152  ALA B CB    1 
ATOM   6120  N  N     . CYS B 2 156  ? 192.395 134.483 156.104 1.00 72.73  ?  153  CYS B N     1 
ATOM   6121  C  CA    . CYS B 2 156  ? 191.066 134.110 155.636 1.00 58.70  ?  153  CYS B CA    1 
ATOM   6122  C  C     . CYS B 2 156  ? 191.167 133.215 154.408 1.00 49.47  ?  153  CYS B C     1 
ATOM   6123  O  O     . CYS B 2 156  ? 192.037 133.406 153.559 1.00 49.16  ?  153  CYS B O     1 
ATOM   6124  C  CB    . CYS B 2 156  ? 190.220 135.347 155.312 1.00 60.05  ?  153  CYS B CB    1 
ATOM   6125  S  SG    . CYS B 2 156  ? 189.546 136.146 156.785 1.00 121.97 ?  153  CYS B SG    1 
ATOM   6126  N  N     . VAL B 2 157  ? 190.285 132.223 154.326 1.00 45.64  ?  154  VAL B N     1 
ATOM   6127  C  CA    . VAL B 2 157  ? 190.278 131.261 153.229 1.00 52.83  ?  154  VAL B CA    1 
ATOM   6128  C  C     . VAL B 2 157  ? 188.958 131.384 152.484 1.00 46.50  ?  154  VAL B C     1 
ATOM   6129  O  O     . VAL B 2 157  ? 187.889 131.431 153.104 1.00 40.35  ?  154  VAL B O     1 
ATOM   6130  C  CB    . VAL B 2 157  ? 190.493 129.815 153.718 1.00 66.25  ?  154  VAL B CB    1 
ATOM   6131  C  CG1   . VAL B 2 157  ? 189.599 129.496 154.916 1.00 64.36  ?  154  VAL B CG1   1 
ATOM   6132  C  CG2   . VAL B 2 157  ? 190.269 128.817 152.581 1.00 62.32  ?  154  VAL B CG2   1 
ATOM   6133  N  N     . LEU B 2 158  ? 189.036 131.440 151.158 1.00 45.85  ?  155  LEU B N     1 
ATOM   6134  C  CA    . LEU B 2 158  ? 187.858 131.455 150.305 1.00 32.20  ?  155  LEU B CA    1 
ATOM   6135  C  C     . LEU B 2 158  ? 187.901 130.239 149.393 1.00 26.45  ?  155  LEU B C     1 
ATOM   6136  O  O     . LEU B 2 158  ? 188.956 129.905 148.838 1.00 41.15  ?  155  LEU B O     1 
ATOM   6137  C  CB    . LEU B 2 158  ? 187.784 132.743 149.474 1.00 34.88  ?  155  LEU B CB    1 
ATOM   6138  C  CG    . LEU B 2 158  ? 186.814 132.790 148.295 1.00 35.98  ?  155  LEU B CG    1 
ATOM   6139  C  CD1   . LEU B 2 158  ? 186.230 134.179 148.211 1.00 69.31  ?  155  LEU B CD1   1 
ATOM   6140  C  CD2   . LEU B 2 158  ? 187.464 132.443 146.974 1.00 37.13  ?  155  LEU B CD2   1 
ATOM   6141  N  N     . PHE B 2 159  ? 186.754 129.580 149.240 1.00 15.49  ?  156  PHE B N     1 
ATOM   6142  C  CA    . PHE B 2 159  ? 186.686 128.412 148.373 1.00 22.09  ?  156  PHE B CA    1 
ATOM   6143  C  C     . PHE B 2 159  ? 185.314 128.337 147.724 1.00 36.04  ?  156  PHE B C     1 
ATOM   6144  O  O     . PHE B 2 159  ? 184.322 128.828 148.273 1.00 34.46  ?  156  PHE B O     1 
ATOM   6145  C  CB    . PHE B 2 159  ? 186.964 127.104 149.127 1.00 35.17  ?  156  PHE B CB    1 
ATOM   6146  C  CG    . PHE B 2 159  ? 186.518 125.870 148.379 1.00 56.60  ?  156  PHE B CG    1 
ATOM   6147  C  CD1   . PHE B 2 159  ? 187.252 125.389 147.305 1.00 60.02  ?  156  PHE B CD1   1 
ATOM   6148  C  CD2   . PHE B 2 159  ? 185.350 125.215 148.721 1.00 58.13  ?  156  PHE B CD2   1 
ATOM   6149  C  CE1   . PHE B 2 159  ? 186.836 124.265 146.608 1.00 72.93  ?  156  PHE B CE1   1 
ATOM   6150  C  CE2   . PHE B 2 159  ? 184.936 124.091 148.024 1.00 67.23  ?  156  PHE B CE2   1 
ATOM   6151  C  CZ    . PHE B 2 159  ? 185.680 123.621 146.971 1.00 70.18  ?  156  PHE B CZ    1 
ATOM   6152  N  N     . GLY B 2 160  ? 185.272 127.714 146.547 1.00 48.90  ?  157  GLY B N     1 
ATOM   6153  C  CA    . GLY B 2 160  ? 184.031 127.420 145.872 1.00 54.43  ?  157  GLY B CA    1 
ATOM   6154  C  C     . GLY B 2 160  ? 183.505 128.603 145.082 1.00 59.17  ?  157  GLY B C     1 
ATOM   6155  O  O     . GLY B 2 160  ? 184.149 129.651 144.948 1.00 54.10  ?  157  GLY B O     1 
ATOM   6156  N  N     . GLY B 2 161  ? 182.304 128.422 144.548 1.00 61.80  ?  158  GLY B N     1 
ATOM   6157  C  CA    . GLY B 2 161  ? 181.612 129.494 143.857 1.00 63.60  ?  158  GLY B CA    1 
ATOM   6158  C  C     . GLY B 2 161  ? 181.117 129.148 142.466 1.00 60.24  ?  158  GLY B C     1 
ATOM   6159  O  O     . GLY B 2 161  ? 181.723 128.357 141.738 1.00 63.88  ?  158  GLY B O     1 
ATOM   6160  N  N     . ARG B 2 162  ? 179.988 129.746 142.096 1.00 39.59  ?  159  ARG B N     1 
ATOM   6161  C  CA    . ARG B 2 162  ? 179.444 129.666 140.752 1.00 24.99  ?  159  ARG B CA    1 
ATOM   6162  C  C     . ARG B 2 162  ? 179.541 131.037 140.104 1.00 12.92  ?  159  ARG B C     1 
ATOM   6163  O  O     . ARG B 2 162  ? 179.489 132.066 140.782 1.00 15.23  ?  159  ARG B O     1 
ATOM   6164  C  CB    . ARG B 2 162  ? 177.987 129.198 140.781 1.00 27.41  ?  159  ARG B CB    1 
ATOM   6165  C  CG    . ARG B 2 162  ? 177.830 127.743 141.161 1.00 33.22  ?  159  ARG B CG    1 
ATOM   6166  C  CD    . ARG B 2 162  ? 176.480 127.472 141.775 1.00 31.18  ?  159  ARG B CD    1 
ATOM   6167  N  NE    . ARG B 2 162  ? 175.802 126.377 141.096 1.00 43.12  ?  159  ARG B NE    1 
ATOM   6168  C  CZ    . ARG B 2 162  ? 174.533 126.043 141.304 1.00 46.72  ?  159  ARG B CZ    1 
ATOM   6169  N  NH1   . ARG B 2 162  ? 173.812 126.718 142.187 1.00 59.23  ?  159  ARG B NH1   1 
ATOM   6170  N  NH2   . ARG B 2 162  ? 173.987 125.033 140.635 1.00 54.57  ?  159  ARG B NH2   1 
ATOM   6171  N  N     . SER B 2 163  ? 179.672 131.058 138.785 1.00 12.11  ?  160  SER B N     1 
ATOM   6172  C  CA    . SER B 2 163  ? 179.816 132.330 138.100 1.00 12.61  ?  160  SER B CA    1 
ATOM   6173  C  C     . SER B 2 163  ? 179.268 132.195 136.690 1.00 16.12  ?  160  SER B C     1 
ATOM   6174  O  O     . SER B 2 163  ? 179.002 131.095 136.207 1.00 17.90  ?  160  SER B O     1 
ATOM   6175  C  CB    . SER B 2 163  ? 181.279 132.793 138.096 1.00 9.98   ?  160  SER B CB    1 
ATOM   6176  O  OG    . SER B 2 163  ? 181.536 133.664 137.007 1.00 13.57  ?  160  SER B OG    1 
ATOM   6177  N  N     . TYR B 2 164  ? 179.099 133.337 136.030 1.00 16.89  ?  161  TYR B N     1 
ATOM   6178  C  CA    . TYR B 2 164  ? 178.679 133.324 134.640 1.00 20.35  ?  161  TYR B CA    1 
ATOM   6179  C  C     . TYR B 2 164  ? 179.833 132.870 133.756 1.00 18.12  ?  161  TYR B C     1 
ATOM   6180  O  O     . TYR B 2 164  ? 180.993 132.841 134.170 1.00 17.20  ?  161  TYR B O     1 
ATOM   6181  C  CB    . TYR B 2 164  ? 178.203 134.712 134.207 1.00 34.30  ?  161  TYR B CB    1 
ATOM   6182  C  CG    . TYR B 2 164  ? 176.944 135.149 134.912 1.00 33.52  ?  161  TYR B CG    1 
ATOM   6183  C  CD1   . TYR B 2 164  ? 175.771 134.436 134.763 1.00 27.91  ?  161  TYR B CD1   1 
ATOM   6184  C  CD2   . TYR B 2 164  ? 176.924 136.284 135.712 1.00 34.17  ?  161  TYR B CD2   1 
ATOM   6185  C  CE1   . TYR B 2 164  ? 174.612 134.826 135.399 1.00 40.22  ?  161  TYR B CE1   1 
ATOM   6186  C  CE2   . TYR B 2 164  ? 175.764 136.683 136.350 1.00 24.43  ?  161  TYR B CE2   1 
ATOM   6187  C  CZ    . TYR B 2 164  ? 174.612 135.948 136.190 1.00 39.62  ?  161  TYR B CZ    1 
ATOM   6188  O  OH    . TYR B 2 164  ? 173.452 136.333 136.824 1.00 36.66  ?  161  TYR B OH    1 
ATOM   6189  N  N     . MET B 2 165  ? 179.492 132.495 132.532 1.00 21.57  ?  162  MET B N     1 
ATOM   6190  C  CA    . MET B 2 165  ? 180.485 132.083 131.554 1.00 25.80  ?  162  MET B CA    1 
ATOM   6191  C  C     . MET B 2 165  ? 181.603 133.119 131.456 1.00 31.08  ?  162  MET B C     1 
ATOM   6192  O  O     . MET B 2 165  ? 181.342 134.323 131.573 1.00 39.48  ?  162  MET B O     1 
ATOM   6193  C  CB    . MET B 2 165  ? 179.814 131.888 130.193 1.00 43.85  ?  162  MET B CB    1 
ATOM   6194  C  CG    . MET B 2 165  ? 178.817 130.735 130.162 1.00 53.60  ?  162  MET B CG    1 
ATOM   6195  S  SD    . MET B 2 165  ? 178.053 130.538 128.534 1.00 84.06  ?  162  MET B SD    1 
ATOM   6196  C  CE    . MET B 2 165  ? 177.164 128.996 128.757 1.00 80.63  ?  162  MET B CE    1 
ATOM   6197  N  N     . PRO B 2 166  ? 182.848 132.697 131.256 1.00 35.09  ?  163  PRO B N     1 
ATOM   6198  C  CA    . PRO B 2 166  ? 183.927 133.659 131.049 1.00 41.72  ?  163  PRO B CA    1 
ATOM   6199  C  C     . PRO B 2 166  ? 183.634 134.516 129.836 1.00 46.09  ?  163  PRO B C     1 
ATOM   6200  O  O     . PRO B 2 166  ? 183.028 134.040 128.863 1.00 46.99  ?  163  PRO B O     1 
ATOM   6201  C  CB    . PRO B 2 166  ? 185.168 132.778 130.832 1.00 55.02  ?  163  PRO B CB    1 
ATOM   6202  C  CG    . PRO B 2 166  ? 184.763 131.417 131.318 1.00 65.97  ?  163  PRO B CG    1 
ATOM   6203  C  CD    . PRO B 2 166  ? 183.303 131.308 131.084 1.00 44.29  ?  163  PRO B CD    1 
ATOM   6204  N  N     . PRO B 2 167  ? 184.045 135.781 129.848 1.00 46.00  ?  164  PRO B N     1 
ATOM   6205  C  CA    . PRO B 2 167  ? 183.571 136.710 128.811 1.00 50.10  ?  164  PRO B CA    1 
ATOM   6206  C  C     . PRO B 2 167  ? 184.159 136.426 127.436 1.00 48.19  ?  164  PRO B C     1 
ATOM   6207  O  O     . PRO B 2 167  ? 184.639 137.329 126.744 1.00 41.53  ?  164  PRO B O     1 
ATOM   6208  C  CB    . PRO B 2 167  ? 184.024 138.080 129.338 1.00 53.37  ?  164  PRO B CB    1 
ATOM   6209  C  CG    . PRO B 2 167  ? 185.136 137.766 130.296 1.00 52.03  ?  164  PRO B CG    1 
ATOM   6210  C  CD    . PRO B 2 167  ? 184.742 136.480 130.940 1.00 40.84  ?  164  PRO B CD    1 
ATOM   6211  N  N     . THR B 2 168  ? 184.106 135.158 127.033 1.00 46.16  ?  165  THR B N     1 
ATOM   6212  C  CA    . THR B 2 168  ? 184.439 134.727 125.685 1.00 55.51  ?  165  THR B CA    1 
ATOM   6213  C  C     . THR B 2 168  ? 183.215 134.154 124.987 1.00 43.16  ?  165  THR B C     1 
ATOM   6214  O  O     . THR B 2 168  ? 182.850 134.612 123.900 1.00 49.53  ?  165  THR B O     1 
ATOM   6215  C  CB    . THR B 2 168  ? 185.574 133.688 125.698 1.00 73.18  ?  165  THR B CB    1 
ATOM   6216  O  OG1   . THR B 2 168  ? 185.109 132.470 126.294 1.00 68.78  ?  165  THR B OG1   1 
ATOM   6217  C  CG2   . THR B 2 168  ? 186.781 134.200 126.477 1.00 78.15  ?  165  THR B CG2   1 
ATOM   6218  N  N     . GLU B 2 169  ? 182.569 133.162 125.595 1.00 43.94  ?  166  GLU B N     1 
ATOM   6219  C  CA    . GLU B 2 169  ? 181.331 132.588 125.091 1.00 63.32  ?  166  GLU B CA    1 
ATOM   6220  C  C     . GLU B 2 169  ? 180.118 133.100 125.853 1.00 71.31  ?  166  GLU B C     1 
ATOM   6221  O  O     . GLU B 2 169  ? 179.053 132.472 125.822 1.00 66.56  ?  166  GLU B O     1 
ATOM   6222  C  CB    . GLU B 2 169  ? 181.374 131.061 125.159 1.00 107.05 ?  166  GLU B CB    1 
ATOM   6223  C  CG    . GLU B 2 169  ? 182.192 130.497 126.314 1.00 133.44 ?  166  GLU B CG    1 
ATOM   6224  C  CD    . GLU B 2 169  ? 182.310 128.979 126.258 1.00 219.75 ?  166  GLU B CD    1 
ATOM   6225  O  OE1   . GLU B 2 169  ? 181.606 128.351 125.436 1.00 205.97 ?  166  GLU B OE1   1 
ATOM   6226  O  OE2   . GLU B 2 169  ? 183.078 128.409 127.061 1.00 297.80 -1 166  GLU B OE2   1 
ATOM   6227  N  N     . ARG B 2 170  ? 180.256 134.222 126.549 1.00 42.97  ?  167  ARG B N     1 
ATOM   6228  C  CA    . ARG B 2 170  ? 179.145 134.786 127.300 1.00 21.55  ?  167  ARG B CA    1 
ATOM   6229  C  C     . ARG B 2 170  ? 178.141 135.305 126.281 1.00 14.08  ?  167  ARG B C     1 
ATOM   6230  O  O     . ARG B 2 170  ? 178.283 136.404 125.750 1.00 16.70  ?  167  ARG B O     1 
ATOM   6231  C  CB    . ARG B 2 170  ? 179.640 135.888 128.230 1.00 22.39  ?  167  ARG B CB    1 
ATOM   6232  C  CG    . ARG B 2 170  ? 178.548 136.611 129.009 1.00 29.24  ?  167  ARG B CG    1 
ATOM   6233  C  CD    . ARG B 2 170  ? 178.942 136.789 130.478 1.00 40.14  ?  167  ARG B CD    1 
ATOM   6234  N  NE    . ARG B 2 170  ? 178.191 137.852 131.151 1.00 43.75  ?  167  ARG B NE    1 
ATOM   6235  C  CZ    . ARG B 2 170  ? 176.930 137.755 131.560 1.00 23.97  ?  167  ARG B CZ    1 
ATOM   6236  N  NH1   . ARG B 2 170  ? 176.355 138.780 132.177 1.00 20.98  ?  167  ARG B NH1   1 
ATOM   6237  N  NH2   . ARG B 2 170  ? 176.244 136.639 131.367 1.00 21.91  ?  167  ARG B NH2   1 
ATOM   6238  N  N     . THR B 2 171  ? 177.129 134.495 125.988 1.00 14.76  ?  168  THR B N     1 
ATOM   6239  C  CA    . THR B 2 171  ? 176.218 134.711 124.872 1.00 16.17  ?  168  THR B CA    1 
ATOM   6240  C  C     . THR B 2 171  ? 174.845 135.124 125.389 1.00 16.62  ?  168  THR B C     1 
ATOM   6241  O  O     . THR B 2 171  ? 174.352 134.574 126.377 1.00 16.13  ?  168  THR B O     1 
ATOM   6242  C  CB    . THR B 2 171  ? 176.105 133.440 124.009 1.00 20.65  ?  168  THR B CB    1 
ATOM   6243  O  OG1   . THR B 2 171  ? 176.140 132.277 124.847 1.00 14.32  ?  168  THR B OG1   1 
ATOM   6244  C  CG2   . THR B 2 171  ? 177.239 133.359 122.992 1.00 22.77  ?  168  THR B CG2   1 
ATOM   6245  N  N     . THR B 2 172  ? 174.210 136.064 124.689 1.00 20.00  ?  169  THR B N     1 
ATOM   6246  C  CA    . THR B 2 172  ? 172.914 136.642 125.055 1.00 12.04  ?  169  THR B CA    1 
ATOM   6247  C  C     . THR B 2 172  ? 171.725 135.666 124.902 1.00 10.50  ?  169  THR B C     1 
ATOM   6248  O  O     . THR B 2 172  ? 170.535 136.001 125.054 1.00 17.96  ?  169  THR B O     1 
ATOM   6249  C  CB    . THR B 2 172  ? 172.651 137.888 124.212 1.00 12.04  ?  169  THR B CB    1 
ATOM   6250  O  OG1   . THR B 2 172  ? 172.016 137.512 122.992 1.00 25.80  ?  169  THR B OG1   1 
ATOM   6251  C  CG2   . THR B 2 172  ? 173.948 138.603 123.906 1.00 29.07  ?  169  THR B CG2   1 
ATOM   6252  N  N     . GLN B 2 173  ? 172.011 134.391 124.613 1.00 13.48  ?  170  GLN B N     1 
ATOM   6253  C  CA    . GLN B 2 173  ? 171.044 133.337 124.741 1.00 16.06  ?  170  GLN B CA    1 
ATOM   6254  C  C     . GLN B 2 173  ? 171.313 132.475 125.969 1.00 19.16  ?  170  GLN B C     1 
ATOM   6255  O  O     . GLN B 2 173  ? 170.410 131.747 126.421 1.00 17.88  ?  170  GLN B O     1 
ATOM   6256  C  CB    . GLN B 2 173  ? 171.042 132.453 123.475 1.00 19.34  ?  170  GLN B CB    1 
ATOM   6257  C  CG    . GLN B 2 173  ? 171.049 133.255 122.144 1.00 19.39  ?  170  GLN B CG    1 
ATOM   6258  C  CD    . GLN B 2 173  ? 171.301 132.355 120.930 1.00 41.04  ?  170  GLN B CD    1 
ATOM   6259  O  OE1   . GLN B 2 173  ? 172.174 131.493 120.987 1.00 77.33  ?  170  GLN B OE1   1 
ATOM   6260  N  NE2   . GLN B 2 173  ? 170.582 132.600 119.832 1.00 29.52  ?  170  GLN B NE2   1 
ATOM   6261  N  N     . ASN B 2 174  ? 172.510 132.564 126.541 1.00 17.79  ?  171  ASN B N     1 
ATOM   6262  C  CA    . ASN B 2 174  ? 172.853 131.965 127.825 1.00 13.99  ?  171  ASN B CA    1 
ATOM   6263  C  C     . ASN B 2 174  ? 173.322 133.014 128.828 1.00 15.66  ?  171  ASN B C     1 
ATOM   6264  O  O     . ASN B 2 174  ? 173.919 132.660 129.855 1.00 21.48  ?  171  ASN B O     1 
ATOM   6265  C  CB    . ASN B 2 174  ? 173.944 130.893 127.656 1.00 16.66  ?  171  ASN B CB    1 
ATOM   6266  C  CG    . ASN B 2 174  ? 173.703 129.979 126.473 1.00 21.88  ?  171  ASN B CG    1 
ATOM   6267  O  OD1   . ASN B 2 174  ? 172.567 129.751 126.074 1.00 23.36  ?  171  ASN B OD1   1 
ATOM   6268  N  ND2   . ASN B 2 174  ? 174.789 129.441 125.910 1.00 17.12  ?  171  ASN B ND2   1 
ATOM   6269  N  N     . TRP B 2 175  ? 173.066 134.297 128.548 1.00 10.72  ?  172  TRP B N     1 
ATOM   6270  C  CA    . TRP B 2 175  ? 173.680 135.418 129.247 1.00 10.07  ?  172  TRP B CA    1 
ATOM   6271  C  C     . TRP B 2 175  ? 173.408 135.402 130.749 1.00 10.38  ?  172  TRP B C     1 
ATOM   6272  O  O     . TRP B 2 175  ? 174.019 136.176 131.482 1.00 9.14   ?  172  TRP B O     1 
ATOM   6273  C  CB    . TRP B 2 175  ? 173.185 136.732 128.635 1.00 13.13  ?  172  TRP B CB    1 
ATOM   6274  C  CG    . TRP B 2 175  ? 174.053 137.888 128.943 1.00 11.90  ?  172  TRP B CG    1 
ATOM   6275  C  CD1   . TRP B 2 175  ? 175.310 138.112 128.465 1.00 24.75  ?  172  TRP B CD1   1 
ATOM   6276  C  CD2   . TRP B 2 175  ? 173.766 138.964 129.830 1.00 13.53  ?  172  TRP B CD2   1 
ATOM   6277  N  NE1   . TRP B 2 175  ? 175.813 139.275 128.988 1.00 34.20  ?  172  TRP B NE1   1 
ATOM   6278  C  CE2   . TRP B 2 175  ? 174.888 139.816 129.831 1.00 78.86  ?  172  TRP B CE2   1 
ATOM   6279  C  CE3   . TRP B 2 175  ? 172.665 139.302 130.623 1.00 18.82  ?  172  TRP B CE3   1 
ATOM   6280  C  CZ2   . TRP B 2 175  ? 174.944 140.974 130.588 1.00 21.21  ?  172  TRP B CZ2   1 
ATOM   6281  C  CZ3   . TRP B 2 175  ? 172.724 140.449 131.368 1.00 25.55  ?  172  TRP B CZ3   1 
ATOM   6282  C  CH2   . TRP B 2 175  ? 173.854 141.274 131.349 1.00 32.68  ?  172  TRP B CH2   1 
ATOM   6283  N  N     . ASN B 2 176  ? 172.531 134.521 131.229 1.00 14.25  ?  173  ASN B N     1 
ATOM   6284  C  CA    . ASN B 2 176  ? 172.290 134.344 132.656 1.00 30.04  ?  173  ASN B CA    1 
ATOM   6285  C  C     . ASN B 2 176  ? 172.288 132.846 133.016 1.00 38.36  ?  173  ASN B C     1 
ATOM   6286  O  O     . ASN B 2 176  ? 171.446 132.369 133.778 1.00 34.22  ?  173  ASN B O     1 
ATOM   6287  C  CB    . ASN B 2 176  ? 170.994 135.035 133.107 1.00 32.77  ?  173  ASN B CB    1 
ATOM   6288  C  CG    . ASN B 2 176  ? 169.835 134.789 132.153 1.00 25.54  ?  173  ASN B CG    1 
ATOM   6289  O  OD1   . ASN B 2 176  ? 169.011 133.907 132.381 1.00 31.86  ?  173  ASN B OD1   1 
ATOM   6290  N  ND2   . ASN B 2 176  ? 169.793 135.544 131.057 1.00 19.36  ?  173  ASN B ND2   1 
ATOM   6291  N  N     . SER B 2 177  ? 173.245 132.096 132.465 1.00 35.12  ?  174  SER B N     1 
ATOM   6292  C  CA    . SER B 2 177  ? 173.537 130.727 132.876 1.00 26.24  ?  174  SER B CA    1 
ATOM   6293  C  C     . SER B 2 177  ? 174.819 130.699 133.704 1.00 23.64  ?  174  SER B C     1 
ATOM   6294  O  O     . SER B 2 177  ? 175.692 131.557 133.557 1.00 22.29  ?  174  SER B O     1 
ATOM   6295  C  CB    . SER B 2 177  ? 173.682 129.794 131.665 1.00 19.97  ?  174  SER B CB    1 
ATOM   6296  O  OG    . SER B 2 177  ? 174.024 128.478 132.065 1.00 19.89  ?  174  SER B OG    1 
ATOM   6297  N  N     . VAL B 2 178  ? 174.945 129.684 134.558 1.00 18.80  ?  175  VAL B N     1 
ATOM   6298  C  CA    . VAL B 2 178  ? 176.030 129.625 135.522 1.00 17.93  ?  175  VAL B CA    1 
ATOM   6299  C  C     . VAL B 2 178  ? 176.921 128.431 135.204 1.00 29.63  ?  175  VAL B C     1 
ATOM   6300  O  O     . VAL B 2 178  ? 176.568 127.535 134.437 1.00 35.06  ?  175  VAL B O     1 
ATOM   6301  C  CB    . VAL B 2 178  ? 175.520 129.540 136.974 1.00 18.79  ?  175  VAL B CB    1 
ATOM   6302  C  CG1   . VAL B 2 178  ? 174.367 130.494 137.180 1.00 33.72  ?  175  VAL B CG1   1 
ATOM   6303  C  CG2   . VAL B 2 178  ? 175.144 128.114 137.342 1.00 39.71  ?  175  VAL B CG2   1 
ATOM   6304  N  N     . VAL B 2 179  ? 178.102 128.445 135.812 1.00 31.93  ?  176  VAL B N     1 
ATOM   6305  C  CA    . VAL B 2 179  ? 179.061 127.357 135.706 1.00 37.65  ?  176  VAL B CA    1 
ATOM   6306  C  C     . VAL B 2 179  ? 179.944 127.418 136.949 1.00 41.79  ?  176  VAL B C     1 
ATOM   6307  O  O     . VAL B 2 179  ? 180.176 128.490 137.519 1.00 32.47  ?  176  VAL B O     1 
ATOM   6308  C  CB    . VAL B 2 179  ? 179.869 127.424 134.379 1.00 28.60  ?  176  VAL B CB    1 
ATOM   6309  C  CG1   . VAL B 2 179  ? 181.063 128.361 134.488 1.00 24.94  ?  176  VAL B CG1   1 
ATOM   6310  C  CG2   . VAL B 2 179  ? 180.288 126.030 133.931 1.00 59.47  ?  176  VAL B CG2   1 
ATOM   6311  N  N     . ASP B 2 180  ? 180.370 126.246 137.418 1.00 74.11  ?  177  ASP B N     1 
ATOM   6312  C  CA    . ASP B 2 180  ? 181.223 126.181 138.596 1.00 77.80  ?  177  ASP B CA    1 
ATOM   6313  C  C     . ASP B 2 180  ? 182.514 126.950 138.347 1.00 56.96  ?  177  ASP B C     1 
ATOM   6314  O  O     . ASP B 2 180  ? 183.138 126.830 137.290 1.00 66.37  ?  177  ASP B O     1 
ATOM   6315  C  CB    . ASP B 2 180  ? 181.541 124.719 138.956 1.00 116.58 ?  177  ASP B CB    1 
ATOM   6316  C  CG    . ASP B 2 180  ? 180.361 123.774 138.715 1.00 156.67 ?  177  ASP B CG    1 
ATOM   6317  O  OD1   . ASP B 2 180  ? 179.214 124.142 139.042 1.00 128.56 ?  177  ASP B OD1   1 
ATOM   6318  O  OD2   . ASP B 2 180  ? 180.582 122.650 138.211 1.00 282.83 -1 177  ASP B OD2   1 
ATOM   6319  N  N     . CYS B 2 181  ? 182.903 127.764 139.316 1.00 47.50  ?  178  CYS B N     1 
ATOM   6320  C  CA    . CYS B 2 181  ? 184.209 128.381 139.242 1.00 47.84  ?  178  CYS B CA    1 
ATOM   6321  C  C     . CYS B 2 181  ? 185.284 127.299 139.357 1.00 60.78  ?  178  CYS B C     1 
ATOM   6322  O  O     . CYS B 2 181  ? 185.059 126.249 139.965 1.00 66.05  ?  178  CYS B O     1 
ATOM   6323  C  CB    . CYS B 2 181  ? 184.377 129.416 140.349 1.00 51.63  ?  178  CYS B CB    1 
ATOM   6324  S  SG    . CYS B 2 181  ? 184.863 128.679 141.912 1.00 93.56  ?  178  CYS B SG    1 
ATOM   6325  N  N     . PRO B 2 182  ? 186.452 127.520 138.764 1.00 74.78  ?  179  PRO B N     1 
ATOM   6326  C  CA    . PRO B 2 182  ? 187.538 126.533 138.869 1.00 91.20  ?  179  PRO B CA    1 
ATOM   6327  C  C     . PRO B 2 182  ? 188.004 126.398 140.308 1.00 97.83  ?  179  PRO B C     1 
ATOM   6328  O  O     . PRO B 2 182  ? 188.208 127.406 141.000 1.00 87.88  ?  179  PRO B O     1 
ATOM   6329  C  CB    . PRO B 2 182  ? 188.638 127.114 137.964 1.00 92.61  ?  179  PRO B CB    1 
ATOM   6330  C  CG    . PRO B 2 182  ? 187.931 128.157 137.111 1.00 90.81  ?  179  PRO B CG    1 
ATOM   6331  C  CD    . PRO B 2 182  ? 186.838 128.690 137.958 1.00 71.47  ?  179  PRO B CD    1 
ATOM   6332  N  N     . PRO B 2 183  ? 188.176 125.155 140.809 1.00 95.40  ?  180  PRO B N     1 
ATOM   6333  C  CA    . PRO B 2 183  ? 188.444 124.971 142.245 1.00 84.90  ?  180  PRO B CA    1 
ATOM   6334  C  C     . PRO B 2 183  ? 189.856 125.357 142.671 1.00 76.07  ?  180  PRO B C     1 
ATOM   6335  O  O     . PRO B 2 183  ? 190.736 124.497 142.776 1.00 86.22  ?  180  PRO B O     1 
ATOM   6336  C  CB    . PRO B 2 183  ? 188.200 123.468 142.459 1.00 87.34  ?  180  PRO B CB    1 
ATOM   6337  C  CG    . PRO B 2 183  ? 188.390 122.857 141.112 1.00 88.59  ?  180  PRO B CG    1 
ATOM   6338  C  CD    . PRO B 2 183  ? 187.856 123.876 140.148 1.00 82.19  ?  180  PRO B CD    1 
ATOM   6339  N  N     . GLN B 2 184  ? 190.079 126.648 142.914 1.00 52.35  ?  181  GLN B N     1 
ATOM   6340  C  CA    . GLN B 2 184  ? 191.339 127.144 143.461 1.00 40.01  ?  181  GLN B CA    1 
ATOM   6341  C  C     . GLN B 2 184  ? 191.020 127.970 144.696 1.00 31.84  ?  181  GLN B C     1 
ATOM   6342  O  O     . GLN B 2 184  ? 190.506 129.087 144.579 1.00 45.66  ?  181  GLN B O     1 
ATOM   6343  C  CB    . GLN B 2 184  ? 192.120 127.992 142.453 1.00 39.59  ?  181  GLN B CB    1 
ATOM   6344  C  CG    . GLN B 2 184  ? 192.557 127.269 141.200 1.00 58.37  ?  181  GLN B CG    1 
ATOM   6345  C  CD    . GLN B 2 184  ? 191.443 127.162 140.194 1.00 82.64  ?  181  GLN B CD    1 
ATOM   6346  O  OE1   . GLN B 2 184  ? 190.728 128.133 139.946 1.00 78.92  ?  181  GLN B OE1   1 
ATOM   6347  N  NE2   . GLN B 2 184  ? 191.257 125.971 139.636 1.00 99.67  ?  181  GLN B NE2   1 
ATOM   6348  N  N     . VAL B 2 185  ? 191.323 127.431 145.878 1.00 34.36  ?  182  VAL B N     1 
ATOM   6349  C  CA    . VAL B 2 185  ? 191.136 128.200 147.097 1.00 41.13  ?  182  VAL B CA    1 
ATOM   6350  C  C     . VAL B 2 185  ? 192.078 129.403 147.094 1.00 43.59  ?  182  VAL B C     1 
ATOM   6351  O  O     . VAL B 2 185  ? 193.179 129.366 146.524 1.00 45.56  ?  182  VAL B O     1 
ATOM   6352  C  CB    . VAL B 2 185  ? 191.350 127.319 148.340 1.00 35.15  ?  182  VAL B CB    1 
ATOM   6353  C  CG1   . VAL B 2 185  ? 190.674 125.977 148.143 1.00 34.75  ?  182  VAL B CG1   1 
ATOM   6354  C  CG2   . VAL B 2 185  ? 192.832 127.135 148.630 1.00 42.50  ?  182  VAL B CG2   1 
ATOM   6355  N  N     . TYR B 2 186  ? 191.625 130.497 147.701 1.00 43.55  ?  183  TYR B N     1 
ATOM   6356  C  CA    . TYR B 2 186  ? 192.459 131.673 147.903 1.00 46.86  ?  183  TYR B CA    1 
ATOM   6357  C  C     . TYR B 2 186  ? 192.697 131.899 149.389 1.00 44.88  ?  183  TYR B C     1 
ATOM   6358  O  O     . TYR B 2 186  ? 191.818 131.665 150.226 1.00 42.10  ?  183  TYR B O     1 
ATOM   6359  C  CB    . TYR B 2 186  ? 191.851 132.950 147.292 1.00 64.25  ?  183  TYR B CB    1 
ATOM   6360  C  CG    . TYR B 2 186  ? 191.532 132.904 145.803 1.00 66.59  ?  183  TYR B CG    1 
ATOM   6361  C  CD1   . TYR B 2 186  ? 190.380 132.297 145.332 1.00 60.59  ?  183  TYR B CD1   1 
ATOM   6362  C  CD2   . TYR B 2 186  ? 192.356 133.530 144.874 1.00 73.20  ?  183  TYR B CD2   1 
ATOM   6363  C  CE1   . TYR B 2 186  ? 190.074 132.277 143.980 1.00 41.33  ?  183  TYR B CE1   1 
ATOM   6364  C  CE2   . TYR B 2 186  ? 192.059 133.507 143.515 1.00 54.40  ?  183  TYR B CE2   1 
ATOM   6365  C  CZ    . TYR B 2 186  ? 190.914 132.880 143.077 1.00 27.10  ?  183  TYR B CZ    1 
ATOM   6366  O  OH    . TYR B 2 186  ? 190.602 132.848 141.737 1.00 25.34  ?  183  TYR B OH    1 
ATOM   6367  N  N     . LEU B 2 187  ? 193.898 132.371 149.701 1.00 55.96  ?  184  LEU B N     1 
ATOM   6368  C  CA    . LEU B 2 187  ? 194.284 132.743 151.054 1.00 73.72  ?  184  LEU B CA    1 
ATOM   6369  C  C     . LEU B 2 187  ? 194.485 134.252 151.078 1.00 85.87  ?  184  LEU B C     1 
ATOM   6370  O  O     . LEU B 2 187  ? 195.296 134.788 150.316 1.00 96.38  ?  184  LEU B O     1 
ATOM   6371  C  CB    . LEU B 2 187  ? 195.550 132.003 151.487 1.00 103.65 ?  184  LEU B CB    1 
ATOM   6372  C  CG    . LEU B 2 187  ? 195.391 130.480 151.528 1.00 107.98 ?  184  LEU B CG    1 
ATOM   6373  C  CD1   . LEU B 2 187  ? 196.543 129.818 152.285 1.00 145.83 ?  184  LEU B CD1   1 
ATOM   6374  C  CD2   . LEU B 2 187  ? 194.044 130.077 152.109 1.00 100.55 ?  184  LEU B CD2   1 
ATOM   6375  N  N     . ILE B 2 188  ? 193.739 134.929 151.942 1.00 69.91  ?  185  ILE B N     1 
ATOM   6376  C  CA    . ILE B 2 188  ? 193.610 136.376 151.937 1.00 77.10  ?  185  ILE B CA    1 
ATOM   6377  C  C     . ILE B 2 188  ? 194.037 136.900 153.300 1.00 83.67  ?  185  ILE B C     1 
ATOM   6378  O  O     . ILE B 2 188  ? 193.540 136.437 154.334 1.00 73.02  ?  185  ILE B O     1 
ATOM   6379  C  CB    . ILE B 2 188  ? 192.166 136.792 151.612 1.00 69.87  ?  185  ILE B CB    1 
ATOM   6380  C  CG1   . ILE B 2 188  ? 191.952 136.749 150.098 1.00 79.29  ?  185  ILE B CG1   1 
ATOM   6381  C  CG2   . ILE B 2 188  ? 191.881 138.174 152.156 1.00 128.66 ?  185  ILE B CG2   1 
ATOM   6382  C  CD1   . ILE B 2 188  ? 190.512 136.840 149.663 1.00 72.92  ?  185  ILE B CD1   1 
ATOM   6383  N  N     . ASP B 2 189  ? 194.970 137.845 153.303 1.00 111.25 ?  186  ASP B N     1 
ATOM   6384  C  CA    . ASP B 2 189  ? 195.346 138.553 154.517 1.00 135.91 ?  186  ASP B CA    1 
ATOM   6385  C  C     . ASP B 2 189  ? 194.473 139.792 154.656 1.00 130.39 ?  186  ASP B C     1 
ATOM   6386  O  O     . ASP B 2 189  ? 194.087 140.410 153.660 1.00 129.49 ?  186  ASP B O     1 
ATOM   6387  C  CB    . ASP B 2 189  ? 196.829 138.940 154.479 1.00 175.72 ?  186  ASP B CB    1 
ATOM   6388  C  CG    . ASP B 2 189  ? 197.319 139.564 155.785 1.00 213.67 ?  186  ASP B CG    1 
ATOM   6389  O  OD1   . ASP B 2 189  ? 196.640 140.453 156.342 1.00 191.78 ?  186  ASP B OD1   1 
ATOM   6390  O  OD2   . ASP B 2 189  ? 198.406 139.164 156.253 1.00 370.62 -1 186  ASP B OD2   1 
ATOM   6391  N  N     . LEU B 2 190  ? 194.160 140.148 155.901 1.00 130.71 ?  187  LEU B N     1 
ATOM   6392  C  CA    . LEU B 2 190  ? 193.330 141.325 156.137 1.00 125.64 ?  187  LEU B CA    1 
ATOM   6393  C  C     . LEU B 2 190  ? 194.105 142.609 155.864 1.00 138.32 ?  187  LEU B C     1 
ATOM   6394  O  O     . LEU B 2 190  ? 193.599 143.513 155.195 1.00 137.32 ?  187  LEU B O     1 
ATOM   6395  C  CB    . LEU B 2 190  ? 192.801 141.317 157.572 1.00 118.37 ?  187  LEU B CB    1 
ATOM   6396  C  CG    . LEU B 2 190  ? 191.465 140.619 157.832 1.00 120.02 ?  187  LEU B CG    1 
ATOM   6397  C  CD1   . LEU B 2 190  ? 191.504 139.161 157.407 1.00 109.27 ?  187  LEU B CD1   1 
ATOM   6398  C  CD2   . LEU B 2 190  ? 191.094 140.734 159.297 1.00 120.82 ?  187  LEU B CD2   1 
ATOM   6399  N  N     . GLU B 2 191  ? 195.341 142.695 156.355 1.00 159.71 ?  188  GLU B N     1 
ATOM   6400  C  CA    . GLU B 2 191  ? 196.185 143.869 156.144 1.00 159.04 ?  188  GLU B CA    1 
ATOM   6401  C  C     . GLU B 2 191  ? 197.633 143.416 156.023 1.00 174.05 ?  188  GLU B C     1 
ATOM   6402  O  O     . GLU B 2 191  ? 198.224 142.981 157.015 1.00 167.23 ?  188  GLU B O     1 
ATOM   6403  C  CB    . GLU B 2 191  ? 196.029 144.888 157.272 1.00 144.01 ?  188  GLU B CB    1 
ATOM   6404  C  CG    . GLU B 2 191  ? 196.001 146.314 156.766 1.00 173.33 ?  188  GLU B CG    1 
ATOM   6405  C  CD    . GLU B 2 191  ? 195.290 146.439 155.431 1.00 196.80 ?  188  GLU B CD    1 
ATOM   6406  O  OE1   . GLU B 2 191  ? 194.093 146.111 155.350 1.00 170.24 ?  188  GLU B OE1   1 
ATOM   6407  O  OE2   . GLU B 2 191  ? 195.961 146.798 154.439 1.00 288.96 -1 188  GLU B OE2   1 
ATOM   6408  N  N     . PHE B 2 192  ? 198.212 143.540 154.826 1.00 177.73 ?  189  PHE B N     1 
ATOM   6409  C  CA    . PHE B 2 192  ? 197.557 144.157 153.674 1.00 166.80 ?  189  PHE B CA    1 
ATOM   6410  C  C     . PHE B 2 192  ? 196.645 143.167 152.949 1.00 164.55 ?  189  PHE B C     1 
ATOM   6411  O  O     . PHE B 2 192  ? 196.450 142.041 153.406 1.00 172.01 ?  189  PHE B O     1 
ATOM   6412  C  CB    . PHE B 2 192  ? 198.598 144.709 152.695 1.00 153.99 ?  189  PHE B CB    1 
ATOM   6413  C  CG    . PHE B 2 192  ? 199.908 145.068 153.347 1.00 143.17 ?  189  PHE B CG    1 
ATOM   6414  C  CD1   . PHE B 2 192  ? 199.999 146.150 154.205 1.00 148.91 ?  189  PHE B CD1   1 
ATOM   6415  C  CD2   . PHE B 2 192  ? 201.054 144.330 153.086 1.00 120.78 ?  189  PHE B CD2   1 
ATOM   6416  C  CE1   . PHE B 2 192  ? 201.200 146.481 154.801 1.00 131.03 ?  189  PHE B CE1   1 
ATOM   6417  C  CE2   . PHE B 2 192  ? 202.257 144.659 153.678 1.00 107.95 ?  189  PHE B CE2   1 
ATOM   6418  C  CZ    . PHE B 2 192  ? 202.329 145.735 154.536 1.00 115.84 ?  189  PHE B CZ    1 
ATOM   6419  N  N     . GLY B 2 193  ? 196.088 143.587 151.819 1.00 148.40 ?  190  GLY B N     1 
ATOM   6420  C  CA    . GLY B 2 193  ? 195.211 142.721 151.058 1.00 148.55 ?  190  GLY B CA    1 
ATOM   6421  C  C     . GLY B 2 193  ? 195.929 141.898 150.008 1.00 156.71 ?  190  GLY B C     1 
ATOM   6422  O  O     . GLY B 2 193  ? 195.423 141.729 148.894 1.00 158.86 ?  190  GLY B O     1 
ATOM   6423  N  N     . CYS B 2 194  ? 197.107 141.373 150.349 1.00 163.17 ?  191  CYS B N     1 
ATOM   6424  C  CA    . CYS B 2 194  ? 197.903 140.577 149.416 1.00 159.67 ?  191  CYS B CA    1 
ATOM   6425  C  C     . CYS B 2 194  ? 197.289 139.182 149.304 1.00 149.84 ?  191  CYS B C     1 
ATOM   6426  O  O     . CYS B 2 194  ? 197.731 138.215 149.928 1.00 145.38 ?  191  CYS B O     1 
ATOM   6427  C  CB    . CYS B 2 194  ? 199.365 140.520 149.850 1.00 146.85 ?  191  CYS B CB    1 
ATOM   6428  S  SG    . CYS B 2 194  ? 199.666 140.261 151.618 1.00 152.50 ?  191  CYS B SG    1 
ATOM   6429  N  N     . CYS B 2 195  ? 196.242 139.087 148.486 1.00 146.34 ?  192  CYS B N     1 
ATOM   6430  C  CA    . CYS B 2 195  ? 195.582 137.812 148.250 1.00 138.90 ?  192  CYS B CA    1 
ATOM   6431  C  C     . CYS B 2 195  ? 196.493 136.870 147.468 1.00 153.75 ?  192  CYS B C     1 
ATOM   6432  O  O     . CYS B 2 195  ? 197.352 137.299 146.689 1.00 159.73 ?  192  CYS B O     1 
ATOM   6433  C  CB    . CYS B 2 195  ? 194.279 138.019 147.477 1.00 132.95 ?  192  CYS B CB    1 
ATOM   6434  S  SG    . CYS B 2 195  ? 193.304 139.445 147.989 1.00 159.32 ?  192  CYS B SG    1 
ATOM   6435  N  N     . THR B 2 196  ? 196.289 135.570 147.669 1.00 140.85 ?  193  THR B N     1 
ATOM   6436  C  CA    . THR B 2 196  ? 197.125 134.541 147.068 1.00 136.27 ?  193  THR B CA    1 
ATOM   6437  C  C     . THR B 2 196  ? 196.258 133.461 146.432 1.00 115.22 ?  193  THR B C     1 
ATOM   6438  O  O     . THR B 2 196  ? 195.244 133.049 147.001 1.00 94.73  ?  193  THR B O     1 
ATOM   6439  C  CB    . THR B 2 196  ? 198.069 133.896 148.103 1.00 133.96 ?  193  THR B CB    1 
ATOM   6440  O  OG1   . THR B 2 196  ? 197.309 133.114 149.032 1.00 117.64 ?  193  THR B OG1   1 
ATOM   6441  C  CG2   . THR B 2 196  ? 198.867 134.952 148.859 1.00 152.50 ?  193  THR B CG2   1 
ATOM   6442  N  N     . ALA B 2 197  ? 196.665 133.011 145.247 1.00 130.15 ?  194  ALA B N     1 
ATOM   6443  C  CA    . ALA B 2 197  ? 196.027 131.897 144.565 1.00 107.61 ?  194  ALA B CA    1 
ATOM   6444  C  C     . ALA B 2 197  ? 196.697 130.593 144.965 1.00 91.66  ?  194  ALA B C     1 
ATOM   6445  O  O     . ALA B 2 197  ? 197.903 130.542 145.216 1.00 116.77 ?  194  ALA B O     1 
ATOM   6446  C  CB    . ALA B 2 197  ? 196.100 132.067 143.047 1.00 130.71 ?  194  ALA B CB    1 
ATOM   6447  N  N     . HIS B 2 198  ? 195.905 129.530 145.003 1.00 59.88  ?  195  HIS B N     1 
ATOM   6448  C  CA    . HIS B 2 198  ? 196.414 128.239 145.428 1.00 69.91  ?  195  HIS B CA    1 
ATOM   6449  C  C     . HIS B 2 198  ? 195.652 127.143 144.704 1.00 64.57  ?  195  HIS B C     1 
ATOM   6450  O  O     . HIS B 2 198  ? 194.588 127.374 144.127 1.00 55.38  ?  195  HIS B O     1 
ATOM   6451  C  CB    . HIS B 2 198  ? 196.312 128.073 146.949 1.00 73.94  ?  195  HIS B CB    1 
ATOM   6452  C  CG    . HIS B 2 198  ? 197.304 128.894 147.718 1.00 99.90  ?  195  HIS B CG    1 
ATOM   6453  N  ND1   . HIS B 2 198  ? 198.495 129.329 147.174 1.00 122.39 ?  195  HIS B ND1   1 
ATOM   6454  C  CD2   . HIS B 2 198  ? 197.282 129.355 148.990 1.00 102.50 ?  195  HIS B CD2   1 
ATOM   6455  C  CE1   . HIS B 2 198  ? 199.167 130.014 148.082 1.00 127.31 ?  195  HIS B CE1   1 
ATOM   6456  N  NE2   . HIS B 2 198  ? 198.451 130.047 149.191 1.00 120.67 ?  195  HIS B NE2   1 
ATOM   6457  N  N     . THR B 2 199  ? 196.236 125.948 144.714 1.00 83.39  ?  196  THR B N     1 
ATOM   6458  C  CA    . THR B 2 199  ? 195.616 124.758 144.157 1.00 84.50  ?  196  THR B CA    1 
ATOM   6459  C  C     . THR B 2 199  ? 196.037 123.558 144.985 1.00 85.37  ?  196  THR B C     1 
ATOM   6460  O  O     . THR B 2 199  ? 197.015 123.606 145.736 1.00 98.46  ?  196  THR B O     1 
ATOM   6461  C  CB    . THR B 2 199  ? 196.005 124.529 142.693 1.00 86.02  ?  196  THR B CB    1 
ATOM   6462  O  OG1   . THR B 2 199  ? 195.633 123.199 142.309 1.00 78.11  ?  196  THR B OG1   1 
ATOM   6463  C  CG2   . THR B 2 199  ? 197.500 124.692 142.517 1.00 89.43  ?  196  THR B CG2   1 
ATOM   6464  N  N     . LEU B 2 200  ? 195.291 122.465 144.828 1.00 77.62  ?  197  LEU B N     1 
ATOM   6465  C  CA    . LEU B 2 200  ? 195.638 121.210 145.450 1.00 91.30  ?  197  LEU B CA    1 
ATOM   6466  C  C     . LEU B 2 200  ? 195.075 120.119 144.559 1.00 95.36  ?  197  LEU B C     1 
ATOM   6467  O  O     . LEU B 2 200  ? 193.931 120.235 144.091 1.00 96.54  ?  197  LEU B O     1 
ATOM   6468  C  CB    . LEU B 2 200  ? 195.085 121.078 146.871 1.00 103.20 ?  197  LEU B CB    1 
ATOM   6469  C  CG    . LEU B 2 200  ? 196.081 121.378 147.997 1.00 128.21 ?  197  LEU B CG    1 
ATOM   6470  C  CD1   . LEU B 2 200  ? 195.665 120.710 149.296 1.00 109.56 ?  197  LEU B CD1   1 
ATOM   6471  C  CD2   . LEU B 2 200  ? 197.501 120.966 147.619 1.00 119.55 ?  197  LEU B CD2   1 
ATOM   6472  N  N     . PRO B 2 201  ? 195.843 119.060 144.309 1.00 109.27 ?  198  PRO B N     1 
ATOM   6473  C  CA    . PRO B 2 201  ? 195.385 118.020 143.374 1.00 127.01 ?  198  PRO B CA    1 
ATOM   6474  C  C     . PRO B 2 201  ? 194.165 117.230 143.846 1.00 144.90 ?  198  PRO B C     1 
ATOM   6475  O  O     . PRO B 2 201  ? 193.622 116.454 143.050 1.00 157.90 ?  198  PRO B O     1 
ATOM   6476  C  CB    . PRO B 2 201  ? 196.627 117.121 143.219 1.00 161.21 ?  198  PRO B CB    1 
ATOM   6477  C  CG    . PRO B 2 201  ? 197.784 117.942 143.807 1.00 132.79 ?  198  PRO B CG    1 
ATOM   6478  C  CD    . PRO B 2 201  ? 197.166 118.755 144.876 1.00 116.43 ?  198  PRO B CD    1 
ATOM   6479  N  N     . GLU B 2 202  ? 193.700 117.408 145.087 1.00 132.00 ?  199  GLU B N     1 
ATOM   6480  C  CA    . GLU B 2 202  ? 192.497 116.727 145.564 1.00 121.11 ?  199  GLU B CA    1 
ATOM   6481  C  C     . GLU B 2 202  ? 191.228 117.519 145.293 1.00 111.93 ?  199  GLU B C     1 
ATOM   6482  O  O     . GLU B 2 202  ? 190.126 116.988 145.483 1.00 93.85  ?  199  GLU B O     1 
ATOM   6483  C  CB    . GLU B 2 202  ? 192.593 116.437 147.066 1.00 111.63 ?  199  GLU B CB    1 
ATOM   6484  C  CG    . GLU B 2 202  ? 193.930 115.888 147.526 1.00 131.44 ?  199  GLU B CG    1 
ATOM   6485  C  CD    . GLU B 2 202  ? 194.589 115.022 146.482 1.00 187.36 ?  199  GLU B CD    1 
ATOM   6486  O  OE1   . GLU B 2 202  ? 194.123 113.885 146.262 1.00 184.50 ?  199  GLU B OE1   1 
ATOM   6487  O  OE2   . GLU B 2 202  ? 195.558 115.500 145.860 1.00 330.64 -1 199  GLU B OE2   1 
ATOM   6488  N  N     . LEU B 2 203  ? 191.364 118.771 144.869 1.00 108.39 ?  200  LEU B N     1 
ATOM   6489  C  CA    . LEU B 2 203  ? 190.233 119.616 144.511 1.00 96.76  ?  200  LEU B CA    1 
ATOM   6490  C  C     . LEU B 2 203  ? 189.696 119.165 143.162 1.00 99.90  ?  200  LEU B C     1 
ATOM   6491  O  O     . LEU B 2 203  ? 189.854 119.861 142.152 1.00 102.52 ?  200  LEU B O     1 
ATOM   6492  C  CB    . LEU B 2 203  ? 190.655 121.086 144.472 1.00 96.04  ?  200  LEU B CB    1 
ATOM   6493  C  CG    . LEU B 2 203  ? 190.648 121.869 145.792 1.00 96.98  ?  200  LEU B CG    1 
ATOM   6494  C  CD1   . LEU B 2 203  ? 191.395 121.140 146.902 1.00 89.48  ?  200  LEU B CD1   1 
ATOM   6495  C  CD2   . LEU B 2 203  ? 191.216 123.268 145.603 1.00 97.41  ?  200  LEU B CD2   1 
ATOM   6496  N  N     . THR B 2 204  ? 189.081 117.981 143.141 1.00 102.13 ?  201  THR B N     1 
ATOM   6497  C  CA    . THR B 2 204  ? 188.656 117.379 141.883 1.00 119.59 ?  201  THR B CA    1 
ATOM   6498  C  C     . THR B 2 204  ? 187.623 118.236 141.164 1.00 149.29 ?  201  THR B C     1 
ATOM   6499  O  O     . THR B 2 204  ? 187.547 118.208 139.929 1.00 141.69 ?  201  THR B O     1 
ATOM   6500  C  CB    . THR B 2 204  ? 188.107 115.974 142.145 1.00 127.29 ?  201  THR B CB    1 
ATOM   6501  O  OG1   . THR B 2 204  ? 188.843 115.370 143.216 1.00 106.34 ?  201  THR B OG1   1 
ATOM   6502  C  CG2   . THR B 2 204  ? 188.246 115.102 140.903 1.00 152.85 ?  201  THR B CG2   1 
ATOM   6503  N  N     . ASP B 2 205  ? 186.834 119.013 141.905 1.00 159.02 ?  202  ASP B N     1 
ATOM   6504  C  CA    . ASP B 2 205  ? 185.847 119.892 141.289 1.00 156.89 ?  202  ASP B CA    1 
ATOM   6505  C  C     . ASP B 2 205  ? 185.395 120.924 142.314 1.00 129.89 ?  202  ASP B C     1 
ATOM   6506  O  O     . ASP B 2 205  ? 185.388 120.659 143.519 1.00 124.79 ?  202  ASP B O     1 
ATOM   6507  C  CB    . ASP B 2 205  ? 184.646 119.094 140.763 1.00 173.18 ?  202  ASP B CB    1 
ATOM   6508  C  CG    . ASP B 2 205  ? 183.520 119.985 140.273 1.00 208.98 ?  202  ASP B CG    1 
ATOM   6509  O  OD1   . ASP B 2 205  ? 183.793 121.123 139.829 1.00 176.22 ?  202  ASP B OD1   1 
ATOM   6510  O  OD2   . ASP B 2 205  ? 182.353 119.549 140.344 1.00 339.31 -1 202  ASP B OD2   1 
ATOM   6511  N  N     . GLY B 2 206  ? 185.012 122.100 141.820 1.00 95.34  ?  203  GLY B N     1 
ATOM   6512  C  CA    . GLY B 2 206  ? 184.455 123.137 142.669 1.00 78.77  ?  203  GLY B CA    1 
ATOM   6513  C  C     . GLY B 2 206  ? 182.945 123.020 142.759 1.00 75.41  ?  203  GLY B C     1 
ATOM   6514  O  O     . GLY B 2 206  ? 182.257 122.936 141.739 1.00 82.18  ?  203  GLY B O     1 
ATOM   6515  N  N     . GLN B 2 207  ? 182.435 123.022 143.984 1.00 67.76  ?  204  GLN B N     1 
ATOM   6516  C  CA    . GLN B 2 207  ? 181.013 122.936 144.278 1.00 63.01  ?  204  GLN B CA    1 
ATOM   6517  C  C     . GLN B 2 207  ? 180.577 124.219 144.987 1.00 55.72  ?  204  GLN B C     1 
ATOM   6518  O  O     . GLN B 2 207  ? 181.389 125.110 145.248 1.00 50.49  ?  204  GLN B O     1 
ATOM   6519  C  CB    . GLN B 2 207  ? 180.722 121.678 145.103 1.00 104.91 ?  204  GLN B CB    1 
ATOM   6520  C  CG    . GLN B 2 207  ? 181.624 121.484 146.325 1.00 132.77 ?  204  GLN B CG    1 
ATOM   6521  C  CD    . GLN B 2 207  ? 181.204 120.304 147.194 1.00 132.47 ?  204  GLN B CD    1 
ATOM   6522  O  OE1   . GLN B 2 207  ? 180.059 119.853 147.140 1.00 122.41 ?  204  GLN B OE1   1 
ATOM   6523  N  NE2   . GLN B 2 207  ? 182.130 119.810 148.012 1.00 102.06 ?  204  GLN B NE2   1 
ATOM   6524  N  N     . SER B 2 208  ? 179.284 124.310 145.305 1.00 57.84  ?  205  SER B N     1 
ATOM   6525  C  CA    . SER B 2 208  ? 178.725 125.524 145.889 1.00 43.56  ?  205  SER B CA    1 
ATOM   6526  C  C     . SER B 2 208  ? 177.674 125.173 146.934 1.00 37.84  ?  205  SER B C     1 
ATOM   6527  O  O     . SER B 2 208  ? 177.226 124.030 147.044 1.00 48.28  ?  205  SER B O     1 
ATOM   6528  C  CB    . SER B 2 208  ? 178.113 126.437 144.819 1.00 35.75  ?  205  SER B CB    1 
ATOM   6529  O  OG    . SER B 2 208  ? 179.100 126.846 143.889 1.00 53.70  ?  205  SER B OG    1 
ATOM   6530  N  N     . PHE B 2 209  ? 177.293 126.187 147.711 1.00 30.85  ?  206  PHE B N     1 
ATOM   6531  C  CA    . PHE B 2 209  ? 176.237 126.093 148.722 1.00 37.36  ?  206  PHE B CA    1 
ATOM   6532  C  C     . PHE B 2 209  ? 176.608 125.120 149.840 1.00 33.62  ?  206  PHE B C     1 
ATOM   6533  O  O     . PHE B 2 209  ? 175.742 124.469 150.431 1.00 33.48  ?  206  PHE B O     1 
ATOM   6534  C  CB    . PHE B 2 209  ? 174.895 125.698 148.100 1.00 55.56  ?  206  PHE B CB    1 
ATOM   6535  C  CG    . PHE B 2 209  ? 174.209 126.821 147.376 1.00 76.46  ?  206  PHE B CG    1 
ATOM   6536  C  CD1   . PHE B 2 209  ? 174.849 128.030 147.182 1.00 58.72  ?  206  PHE B CD1   1 
ATOM   6537  C  CD2   . PHE B 2 209  ? 172.903 126.685 146.937 1.00 99.93  ?  206  PHE B CD2   1 
ATOM   6538  C  CE1   . PHE B 2 209  ? 174.222 129.061 146.522 1.00 54.99  ?  206  PHE B CE1   1 
ATOM   6539  C  CE2   . PHE B 2 209  ? 172.269 127.727 146.286 1.00 96.57  ?  206  PHE B CE2   1 
ATOM   6540  C  CZ    . PHE B 2 209  ? 172.928 128.908 146.081 1.00 78.02  ?  206  PHE B CZ    1 
ATOM   6541  N  N     . HIS B 2 210  ? 177.900 125.024 150.126 1.00 31.08  ?  207  HIS B N     1 
ATOM   6542  C  CA    . HIS B 2 210  ? 178.460 124.096 151.104 1.00 42.76  ?  207  HIS B CA    1 
ATOM   6543  C  C     . HIS B 2 210  ? 178.983 124.886 152.298 1.00 36.44  ?  207  HIS B C     1 
ATOM   6544  O  O     . HIS B 2 210  ? 180.086 125.432 152.251 1.00 34.74  ?  207  HIS B O     1 
ATOM   6545  C  CB    . HIS B 2 210  ? 179.568 123.265 150.466 1.00 55.68  ?  207  HIS B CB    1 
ATOM   6546  C  CG    . HIS B 2 210  ? 180.580 124.075 149.705 1.00 46.18  ?  207  HIS B CG    1 
ATOM   6547  N  ND1   . HIS B 2 210  ? 181.436 124.966 150.317 1.00 31.67  ?  207  HIS B ND1   1 
ATOM   6548  C  CD2   . HIS B 2 210  ? 180.855 124.142 148.380 1.00 67.43  ?  207  HIS B CD2   1 
ATOM   6549  C  CE1   . HIS B 2 210  ? 182.208 125.529 149.404 1.00 34.32  ?  207  HIS B CE1   1 
ATOM   6550  N  NE2   . HIS B 2 210  ? 181.874 125.048 148.221 1.00 44.56  ?  207  HIS B NE2   1 
ATOM   6551  N  N     . VAL B 2 211  ? 178.189 124.952 153.366 1.00 44.69  ?  208  VAL B N     1 
ATOM   6552  C  CA    . VAL B 2 211  ? 178.628 125.661 154.557 1.00 42.90  ?  208  VAL B CA    1 
ATOM   6553  C  C     . VAL B 2 211  ? 179.863 124.965 155.116 1.00 44.40  ?  208  VAL B C     1 
ATOM   6554  O  O     . VAL B 2 211  ? 179.878 123.743 155.310 1.00 56.74  ?  208  VAL B O     1 
ATOM   6555  C  CB    . VAL B 2 211  ? 177.480 125.747 155.576 1.00 43.80  ?  208  VAL B CB    1 
ATOM   6556  C  CG1   . VAL B 2 211  ? 177.988 126.236 156.931 1.00 28.65  ?  208  VAL B CG1   1 
ATOM   6557  C  CG2   . VAL B 2 211  ? 176.378 126.660 155.047 1.00 41.49  ?  208  VAL B CG2   1 
ATOM   6558  N  N     . ALA B 2 212  ? 180.929 125.735 155.324 1.00 37.05  ?  209  ALA B N     1 
ATOM   6559  C  CA    . ALA B 2 212  ? 182.175 125.225 155.871 1.00 37.89  ?  209  ALA B CA    1 
ATOM   6560  C  C     . ALA B 2 212  ? 182.192 125.435 157.381 1.00 40.31  ?  209  ALA B C     1 
ATOM   6561  O  O     . ALA B 2 212  ? 181.277 126.023 157.958 1.00 35.10  ?  209  ALA B O     1 
ATOM   6562  C  CB    . ALA B 2 212  ? 183.366 125.916 155.214 1.00 49.84  ?  209  ALA B CB    1 
ATOM   6563  N  N     . LEU B 2 213  ? 183.255 124.964 158.029 1.00 44.06  ?  210  LEU B N     1 
ATOM   6564  C  CA    . LEU B 2 213  ? 183.440 125.216 159.453 1.00 47.57  ?  210  LEU B CA    1 
ATOM   6565  C  C     . LEU B 2 213  ? 184.913 125.042 159.802 1.00 68.41  ?  210  LEU B C     1 
ATOM   6566  O  O     . LEU B 2 213  ? 185.500 124.001 159.506 1.00 73.73  ?  210  LEU B O     1 
ATOM   6567  C  CB    . LEU B 2 213  ? 182.555 124.285 160.293 1.00 41.70  ?  210  LEU B CB    1 
ATOM   6568  C  CG    . LEU B 2 213  ? 181.455 125.005 161.082 1.00 58.93  ?  210  LEU B CG    1 
ATOM   6569  C  CD1   . LEU B 2 213  ? 180.532 124.029 161.805 1.00 75.26  ?  210  LEU B CD1   1 
ATOM   6570  C  CD2   . LEU B 2 213  ? 182.087 125.970 162.070 1.00 65.63  ?  210  LEU B CD2   1 
ATOM   6571  N  N     . ALA B 2 214  ? 185.503 126.061 160.422 1.00 71.81  ?  211  ALA B N     1 
ATOM   6572  C  CA    . ALA B 2 214  ? 186.914 126.065 160.777 1.00 81.25  ?  211  ALA B CA    1 
ATOM   6573  C  C     . ALA B 2 214  ? 187.090 126.108 162.287 1.00 99.46  ?  211  ALA B C     1 
ATOM   6574  O  O     . ALA B 2 214  ? 186.227 126.606 163.019 1.00 97.23  ?  211  ALA B O     1 
ATOM   6575  C  CB    . ALA B 2 214  ? 187.640 127.263 160.154 1.00 70.62  ?  211  ALA B CB    1 
ATOM   6576  N  N     . ARG B 2 215  ? 188.229 125.593 162.743 1.00 91.30  ?  212  ARG B N     1 
ATOM   6577  C  CA    . ARG B 2 215  ? 188.617 125.686 164.145 1.00 81.60  ?  212  ARG B CA    1 
ATOM   6578  C  C     . ARG B 2 215  ? 190.105 125.396 164.218 1.00 91.54  ?  212  ARG B C     1 
ATOM   6579  O  O     . ARG B 2 215  ? 190.568 124.419 163.622 1.00 125.76 ?  212  ARG B O     1 
ATOM   6580  C  CB    . ARG B 2 215  ? 187.853 124.687 165.019 1.00 81.37  ?  212  ARG B CB    1 
ATOM   6581  C  CG    . ARG B 2 215  ? 188.048 124.933 166.496 1.00 65.21  ?  212  ARG B CG    1 
ATOM   6582  C  CD    . ARG B 2 215  ? 187.608 123.746 167.326 1.00 83.63  ?  212  ARG B CD    1 
ATOM   6583  N  NE    . ARG B 2 215  ? 188.554 122.640 167.209 1.00 131.42 ?  212  ARG B NE    1 
ATOM   6584  C  CZ    . ARG B 2 215  ? 189.784 122.661 167.711 1.00 150.73 ?  212  ARG B CZ    1 
ATOM   6585  N  NH1   . ARG B 2 215  ? 190.223 123.732 168.362 1.00 134.19 ?  212  ARG B NH1   1 
ATOM   6586  N  NH2   . ARG B 2 215  ? 190.580 121.613 167.561 1.00 154.74 ?  212  ARG B NH2   1 
ATOM   6587  N  N     . GLN B 2 216  ? 190.846 126.236 164.936 1.00 92.51  ?  213  GLN B N     1 
ATOM   6588  C  CA    . GLN B 2 216  ? 192.272 126.026 165.194 1.00 138.70 ?  213  GLN B CA    1 
ATOM   6589  C  C     . GLN B 2 216  ? 193.007 125.658 163.901 1.00 164.30 ?  213  GLN B C     1 
ATOM   6590  O  O     . GLN B 2 216  ? 193.591 124.582 163.762 1.00 189.11 ?  213  GLN B O     1 
ATOM   6591  C  CB    . GLN B 2 216  ? 192.466 124.953 166.274 1.00 156.85 ?  213  GLN B CB    1 
ATOM   6592  C  CG    . GLN B 2 216  ? 193.880 124.833 166.836 1.00 174.54 ?  213  GLN B CG    1 
ATOM   6593  C  CD    . GLN B 2 216  ? 194.249 125.999 167.734 1.00 198.72 ?  213  GLN B CD    1 
ATOM   6594  O  OE1   . GLN B 2 216  ? 193.386 126.783 168.136 1.00 191.95 ?  213  GLN B OE1   1 
ATOM   6595  N  NE2   . GLN B 2 216  ? 195.535 126.128 168.042 1.00 213.98 ?  213  GLN B NE2   1 
ATOM   6596  N  N     . ASP B 2 217  ? 192.941 126.577 162.936 1.00 144.97 ?  214  ASP B N     1 
ATOM   6597  C  CA    . ASP B 2 217  ? 193.511 126.447 161.594 1.00 148.97 ?  214  ASP B CA    1 
ATOM   6598  C  C     . ASP B 2 217  ? 193.348 125.054 160.988 1.00 162.10 ?  214  ASP B C     1 
ATOM   6599  O  O     . ASP B 2 217  ? 194.266 124.540 160.343 1.00 154.68 ?  214  ASP B O     1 
ATOM   6600  C  CB    . ASP B 2 217  ? 194.999 126.841 161.570 1.00 173.17 ?  214  ASP B CB    1 
ATOM   6601  C  CG    . ASP B 2 217  ? 195.796 126.242 162.714 1.00 215.55 ?  214  ASP B CG    1 
ATOM   6602  O  OD1   . ASP B 2 217  ? 196.147 125.044 162.642 1.00 215.21 ?  214  ASP B OD1   1 
ATOM   6603  O  OD2   . ASP B 2 217  ? 196.060 126.970 163.693 1.00 320.13 -1 214  ASP B OD2   1 
ATOM   6604  N  N     . CYS B 2 218  ? 192.182 124.440 161.175 1.00 146.06 ?  215  CYS B N     1 
ATOM   6605  C  CA    . CYS B 2 218  ? 191.785 123.263 160.410 1.00 137.91 ?  215  CYS B CA    1 
ATOM   6606  C  C     . CYS B 2 218  ? 190.331 123.454 160.004 1.00 119.99 ?  215  CYS B C     1 
ATOM   6607  O  O     . CYS B 2 218  ? 189.475 123.714 160.856 1.00 113.32 ?  215  CYS B O     1 
ATOM   6608  C  CB    . CYS B 2 218  ? 191.968 121.958 161.207 1.00 132.73 ?  215  CYS B CB    1 
ATOM   6609  S  SG    . CYS B 2 218  ? 193.668 121.289 161.316 1.00 104.95 ?  215  CYS B SG    1 
ATOM   6610  N  N     . VAL B 2 219  ? 190.061 123.353 158.703 1.00 108.30 ?  216  VAL B N     1 
ATOM   6611  C  CA    . VAL B 2 219  ? 188.754 123.690 158.157 1.00 88.45  ?  216  VAL B CA    1 
ATOM   6612  C  C     . VAL B 2 219  ? 188.149 122.439 157.536 1.00 81.43  ?  216  VAL B C     1 
ATOM   6613  O  O     . VAL B 2 219  ? 188.863 121.550 157.060 1.00 78.08  ?  216  VAL B O     1 
ATOM   6614  C  CB    . VAL B 2 219  ? 188.846 124.840 157.128 1.00 77.73  ?  216  VAL B CB    1 
ATOM   6615  C  CG1   . VAL B 2 219  ? 187.476 125.460 156.905 1.00 70.61  ?  216  VAL B CG1   1 
ATOM   6616  C  CG2   . VAL B 2 219  ? 189.855 125.893 157.585 1.00 68.77  ?  216  VAL B CG2   1 
ATOM   6617  N  N     . TYR B 2 220  ? 186.820 122.365 157.568 1.00 80.35  ?  217  TYR B N     1 
ATOM   6618  C  CA    . TYR B 2 220  ? 186.079 121.210 157.087 1.00 79.66  ?  217  TYR B CA    1 
ATOM   6619  C  C     . TYR B 2 220  ? 184.915 121.705 156.240 1.00 50.61  ?  217  TYR B C     1 
ATOM   6620  O  O     . TYR B 2 220  ? 184.130 122.550 156.684 1.00 44.98  ?  217  TYR B O     1 
ATOM   6621  C  CB    . TYR B 2 220  ? 185.560 120.336 158.245 1.00 92.78  ?  217  TYR B CB    1 
ATOM   6622  C  CG    . TYR B 2 220  ? 186.634 119.677 159.110 1.00 119.13 ?  217  TYR B CG    1 
ATOM   6623  C  CD1   . TYR B 2 220  ? 187.454 120.434 159.939 1.00 127.63 ?  217  TYR B CD1   1 
ATOM   6624  C  CD2   . TYR B 2 220  ? 186.816 118.297 159.104 1.00 115.43 ?  217  TYR B CD2   1 
ATOM   6625  C  CE1   . TYR B 2 220  ? 188.432 119.839 160.725 1.00 113.63 ?  217  TYR B CE1   1 
ATOM   6626  C  CE2   . TYR B 2 220  ? 187.794 117.691 159.894 1.00 115.62 ?  217  TYR B CE2   1 
ATOM   6627  C  CZ    . TYR B 2 220  ? 188.597 118.471 160.701 1.00 117.50 ?  217  TYR B CZ    1 
ATOM   6628  O  OH    . TYR B 2 220  ? 189.574 117.903 161.492 1.00 118.67 ?  217  TYR B OH    1 
ATOM   6629  N  N     . PHE B 2 221  ? 184.819 121.179 155.022 1.00 56.66  ?  218  PHE B N     1 
ATOM   6630  C  CA    . PHE B 2 221  ? 183.783 121.540 154.068 1.00 42.27  ?  218  PHE B CA    1 
ATOM   6631  C  C     . PHE B 2 221  ? 182.815 120.375 153.977 1.00 46.49  ?  218  PHE B C     1 
ATOM   6632  O  O     . PHE B 2 221  ? 183.240 119.217 153.843 1.00 71.79  ?  218  PHE B O     1 
ATOM   6633  C  CB    . PHE B 2 221  ? 184.368 121.823 152.687 1.00 56.10  ?  218  PHE B CB    1 
ATOM   6634  C  CG    . PHE B 2 221  ? 185.296 122.995 152.636 1.00 59.52  ?  218  PHE B CG    1 
ATOM   6635  C  CD1   . PHE B 2 221  ? 185.461 123.821 153.730 1.00 60.20  ?  218  PHE B CD1   1 
ATOM   6636  C  CD2   . PHE B 2 221  ? 186.063 123.227 151.514 1.00 70.88  ?  218  PHE B CD2   1 
ATOM   6637  C  CE1   . PHE B 2 221  ? 186.331 124.884 153.683 1.00 80.46  ?  218  PHE B CE1   1 
ATOM   6638  C  CE2   . PHE B 2 221  ? 186.944 124.286 151.467 1.00 92.19  ?  218  PHE B CE2   1 
ATOM   6639  C  CZ    . PHE B 2 221  ? 187.074 125.115 152.552 1.00 105.35 ?  218  PHE B CZ    1 
ATOM   6640  N  N     . LEU B 2 222  ? 181.528 120.686 154.019 1.00 37.07  ?  219  LEU B N     1 
ATOM   6641  C  CA    . LEU B 2 222  ? 180.478 119.697 154.147 1.00 47.27  ?  219  LEU B CA    1 
ATOM   6642  C  C     . LEU B 2 222  ? 179.763 119.544 152.813 1.00 60.60  ?  219  LEU B C     1 
ATOM   6643  O  O     . LEU B 2 222  ? 180.151 120.152 151.806 1.00 62.65  ?  219  LEU B O     1 
ATOM   6644  C  CB    . LEU B 2 222  ? 179.525 120.109 155.265 1.00 43.93  ?  219  LEU B CB    1 
ATOM   6645  C  CG    . LEU B 2 222  ? 180.202 120.794 156.452 1.00 51.77  ?  219  LEU B CG    1 
ATOM   6646  C  CD1   . LEU B 2 222  ? 179.174 121.048 157.529 1.00 127.90 ?  219  LEU B CD1   1 
ATOM   6647  C  CD2   . LEU B 2 222  ? 181.369 119.993 157.018 1.00 68.16  ?  219  LEU B CD2   1 
ATOM   6648  N  N     . GLY B 2 223  ? 178.712 118.724 152.811 1.00 66.27  ?  220  GLY B N     1 
ATOM   6649  C  CA    . GLY B 2 223  ? 177.905 118.489 151.631 1.00 80.10  ?  220  GLY B CA    1 
ATOM   6650  C  C     . GLY B 2 223  ? 177.533 119.753 150.881 1.00 102.39 ?  220  GLY B C     1 
ATOM   6651  O  O     . GLY B 2 223  ? 177.086 120.740 151.476 1.00 87.92  ?  220  GLY B O     1 
ATOM   6652  N  N     . GLY B 2 224  ? 177.740 119.739 149.568 1.00 111.86 ?  221  GLY B N     1 
ATOM   6653  C  CA    . GLY B 2 224  ? 177.453 120.860 148.703 1.00 105.58 ?  221  GLY B CA    1 
ATOM   6654  C  C     . GLY B 2 224  ? 176.723 120.414 147.451 1.00 83.75  ?  221  GLY B C     1 
ATOM   6655  O  O     . GLY B 2 224  ? 175.941 119.459 147.463 1.00 74.92  ?  221  GLY B O     1 
ATOM   6656  N  N     . HIS B 2 225  ? 176.999 121.115 146.356 1.00 64.34  ?  222  HIS B N     1 
ATOM   6657  C  CA    . HIS B 2 225  ? 176.297 120.840 145.113 1.00 62.82  ?  222  HIS B CA    1 
ATOM   6658  C  C     . HIS B 2 225  ? 177.244 121.003 143.938 1.00 59.50  ?  222  HIS B C     1 
ATOM   6659  O  O     . HIS B 2 225  ? 177.865 122.056 143.773 1.00 49.84  ?  222  HIS B O     1 
ATOM   6660  C  CB    . HIS B 2 225  ? 175.091 121.767 144.956 1.00 79.52  ?  222  HIS B CB    1 
ATOM   6661  C  CG    . HIS B 2 225  ? 174.120 121.322 143.909 1.00 84.60  ?  222  HIS B CG    1 
ATOM   6662  N  ND1   . HIS B 2 225  ? 172.774 121.173 144.161 1.00 81.36  ?  222  HIS B ND1   1 
ATOM   6663  C  CD2   . HIS B 2 225  ? 174.299 120.995 142.607 1.00 79.29  ?  222  HIS B CD2   1 
ATOM   6664  C  CE1   . HIS B 2 225  ? 172.166 120.776 143.058 1.00 90.91  ?  222  HIS B CE1   1 
ATOM   6665  N  NE2   . HIS B 2 225  ? 173.069 120.657 142.102 1.00 89.63  ?  222  HIS B NE2   1 
ATOM   6666  N  N     . ILE B 2 226  ? 177.327 119.961 143.122 1.00 83.07  ?  223  ILE B N     1 
ATOM   6667  C  CA    . ILE B 2 226  ? 178.141 119.934 141.917 1.00 93.61  ?  223  ILE B CA    1 
ATOM   6668  C  C     . ILE B 2 226  ? 177.194 119.857 140.729 1.00 104.60 ?  223  ILE B C     1 
ATOM   6669  O  O     . ILE B 2 226  ? 176.218 119.100 140.755 1.00 115.34 ?  223  ILE B O     1 
ATOM   6670  C  CB    . ILE B 2 226  ? 179.115 118.737 141.929 1.00 131.14 ?  223  ILE B CB    1 
ATOM   6671  C  CG1   . ILE B 2 226  ? 180.367 119.059 142.750 1.00 136.45 ?  223  ILE B CG1   1 
ATOM   6672  C  CG2   . ILE B 2 226  ? 179.494 118.330 140.517 1.00 158.75 ?  223  ILE B CG2   1 
ATOM   6673  C  CD1   . ILE B 2 226  ? 181.425 117.965 142.728 1.00 149.80 ?  223  ILE B CD1   1 
ATOM   6674  N  N     . LEU B 2 227  ? 177.464 120.657 139.700 1.00 101.40 ?  224  LEU B N     1 
ATOM   6675  C  CA    . LEU B 2 227  ? 176.657 120.635 138.486 1.00 105.17 ?  224  LEU B CA    1 
ATOM   6676  C  C     . LEU B 2 227  ? 177.295 119.834 137.356 1.00 113.84 ?  224  LEU B C     1 
ATOM   6677  O  O     . LEU B 2 227  ? 176.567 119.264 136.536 1.00 116.19 ?  224  LEU B O     1 
ATOM   6678  C  CB    . LEU B 2 227  ? 176.378 122.065 138.007 1.00 106.97 ?  224  LEU B CB    1 
ATOM   6679  C  CG    . LEU B 2 227  ? 175.379 122.187 136.855 1.00 116.75 ?  224  LEU B CG    1 
ATOM   6680  C  CD1   . LEU B 2 227  ? 174.070 121.519 137.233 1.00 112.30 ?  224  LEU B CD1   1 
ATOM   6681  C  CD2   . LEU B 2 227  ? 175.149 123.647 136.478 1.00 87.80  ?  224  LEU B CD2   1 
ATOM   6682  N  N     . SER B 2 228  ? 178.630 119.774 137.302 1.00 118.05 ?  225  SER B N     1 
ATOM   6683  C  CA    . SER B 2 228  ? 179.327 119.058 136.234 1.00 104.14 ?  225  SER B CA    1 
ATOM   6684  C  C     . SER B 2 228  ? 178.824 117.623 136.102 1.00 106.48 ?  225  SER B C     1 
ATOM   6685  O  O     . SER B 2 228  ? 178.272 117.235 135.068 1.00 102.17 ?  225  SER B O     1 
ATOM   6686  C  CB    . SER B 2 228  ? 180.837 119.076 136.492 1.00 120.85 ?  225  SER B CB    1 
ATOM   6687  O  OG    . SER B 2 228  ? 181.316 120.401 136.647 1.00 155.93 ?  225  SER B OG    1 
ATOM   6688  N  N     . SER B 2 229  ? 179.029 116.812 137.141 1.00 124.02 ?  226  SER B N     1 
ATOM   6689  C  CA    . SER B 2 229  ? 178.418 115.491 137.214 1.00 131.83 ?  226  SER B CA    1 
ATOM   6690  C  C     . SER B 2 229  ? 176.971 115.549 137.680 1.00 128.78 ?  226  SER B C     1 
ATOM   6691  O  O     . SER B 2 229  ? 176.303 114.509 137.709 1.00 129.43 ?  226  SER B O     1 
ATOM   6692  C  CB    . SER B 2 229  ? 179.230 114.576 138.145 1.00 159.62 ?  226  SER B CB    1 
ATOM   6693  O  OG    . SER B 2 229  ? 179.283 115.086 139.468 1.00 158.64 ?  226  SER B OG    1 
ATOM   6694  N  N     . ASP B 2 230  ? 176.485 116.739 138.036 1.00 130.91 ?  227  ASP B N     1 
ATOM   6695  C  CA    . ASP B 2 230  ? 175.160 116.937 138.624 1.00 132.03 ?  227  ASP B CA    1 
ATOM   6696  C  C     . ASP B 2 230  ? 174.986 116.141 139.917 1.00 132.14 ?  227  ASP B C     1 
ATOM   6697  O  O     . ASP B 2 230  ? 173.869 115.773 140.289 1.00 119.49 ?  227  ASP B O     1 
ATOM   6698  C  CB    . ASP B 2 230  ? 174.045 116.596 137.636 1.00 134.67 ?  227  ASP B CB    1 
ATOM   6699  C  CG    . ASP B 2 230  ? 172.723 117.203 138.040 1.00 178.12 ?  227  ASP B CG    1 
ATOM   6700  O  OD1   . ASP B 2 230  ? 172.520 118.416 137.819 1.00 169.78 ?  227  ASP B OD1   1 
ATOM   6701  O  OD2   . ASP B 2 230  ? 171.911 116.474 138.645 1.00 299.94 -1 227  ASP B OD2   1 
ATOM   6702  N  N     . CYS B 2 231  ? 176.084 115.875 140.614 1.00 144.65 ?  228  CYS B N     1 
ATOM   6703  C  CA    . CYS B 2 231  ? 176.038 115.128 141.860 1.00 135.42 ?  228  CYS B CA    1 
ATOM   6704  C  C     . CYS B 2 231  ? 175.998 116.068 143.062 1.00 92.60  ?  228  CYS B C     1 
ATOM   6705  O  O     . CYS B 2 231  ? 176.420 117.226 142.999 1.00 96.40  ?  228  CYS B O     1 
ATOM   6706  C  CB    . CYS B 2 231  ? 177.238 114.176 141.975 1.00 167.81 ?  228  CYS B CB    1 
ATOM   6707  S  SG    . CYS B 2 231  ? 178.887 114.941 142.073 1.00 191.11 ?  228  CYS B SG    1 
ATOM   6708  N  N     . ARG B 2 232  ? 175.479 115.555 144.161 1.00 66.78  ?  229  ARG B N     1 
ATOM   6709  C  CA    . ARG B 2 232  ? 175.517 116.225 145.450 1.00 56.26  ?  229  ARG B CA    1 
ATOM   6710  C  C     . ARG B 2 232  ? 176.343 115.354 146.380 1.00 75.91  ?  229  ARG B C     1 
ATOM   6711  O  O     . ARG B 2 232  ? 175.809 114.738 147.317 1.00 78.34  ?  229  ARG B O     1 
ATOM   6712  C  CB    . ARG B 2 232  ? 174.112 116.418 145.985 1.00 34.00  ?  229  ARG B CB    1 
ATOM   6713  C  CG    . ARG B 2 232  ? 173.178 115.402 145.392 1.00 41.84  ?  229  ARG B CG    1 
ATOM   6714  C  CD    . ARG B 2 232  ? 171.791 115.602 145.902 1.00 68.67  ?  229  ARG B CD    1 
ATOM   6715  N  NE    . ARG B 2 232  ? 171.444 117.016 145.970 1.00 74.13  ?  229  ARG B NE    1 
ATOM   6716  C  CZ    . ARG B 2 232  ? 171.229 117.789 144.910 1.00 106.38 ?  229  ARG B CZ    1 
ATOM   6717  N  NH1   . ARG B 2 232  ? 171.330 117.285 143.690 1.00 106.22 ?  229  ARG B NH1   1 
ATOM   6718  N  NH2   . ARG B 2 232  ? 170.914 119.061 145.081 1.00 134.86 ?  229  ARG B NH2   1 
ATOM   6719  N  N     . PRO B 2 233  ? 177.647 115.271 146.148 1.00 96.40  ?  230  PRO B N     1 
ATOM   6720  C  CA    . PRO B 2 233  ? 178.431 114.179 146.731 1.00 109.26 ?  230  PRO B CA    1 
ATOM   6721  C  C     . PRO B 2 233  ? 178.619 114.331 148.232 1.00 99.55  ?  230  PRO B C     1 
ATOM   6722  O  O     . PRO B 2 233  ? 178.696 115.436 148.777 1.00 95.23  ?  230  PRO B O     1 
ATOM   6723  C  CB    . PRO B 2 233  ? 179.766 114.279 145.986 1.00 108.88 ?  230  PRO B CB    1 
ATOM   6724  C  CG    . PRO B 2 233  ? 179.885 115.732 145.681 1.00 102.84 ?  230  PRO B CG    1 
ATOM   6725  C  CD    . PRO B 2 233  ? 178.492 116.235 145.423 1.00 98.33  ?  230  PRO B CD    1 
ATOM   6726  N  N     . SER B 2 234  ? 178.697 113.180 148.898 1.00 105.11 ?  231  SER B N     1 
ATOM   6727  C  CA    . SER B 2 234  ? 178.872 113.087 150.343 1.00 86.09  ?  231  SER B CA    1 
ATOM   6728  C  C     . SER B 2 234  ? 180.322 113.226 150.779 1.00 75.09  ?  231  SER B C     1 
ATOM   6729  O  O     . SER B 2 234  ? 180.601 113.170 151.982 1.00 68.75  ?  231  SER B O     1 
ATOM   6730  C  CB    . SER B 2 234  ? 178.325 111.750 150.855 1.00 111.41 ?  231  SER B CB    1 
ATOM   6731  O  OG    . SER B 2 234  ? 179.081 111.281 151.957 1.00 108.84 ?  231  SER B OG    1 
ATOM   6732  N  N     . ARG B 2 235  ? 181.244 113.423 149.842 1.00 90.39  ?  232  ARG B N     1 
ATOM   6733  C  CA    . ARG B 2 235  ? 182.656 113.434 150.183 1.00 85.76  ?  232  ARG B CA    1 
ATOM   6734  C  C     . ARG B 2 235  ? 182.974 114.681 150.984 1.00 63.53  ?  232  ARG B C     1 
ATOM   6735  O  O     . ARG B 2 235  ? 183.245 115.741 150.417 1.00 79.21  ?  232  ARG B O     1 
ATOM   6736  C  CB    . ARG B 2 235  ? 183.524 113.383 148.924 1.00 108.76 ?  232  ARG B CB    1 
ATOM   6737  C  CG    . ARG B 2 235  ? 183.040 114.302 147.809 1.00 111.34 ?  232  ARG B CG    1 
ATOM   6738  C  CD    . ARG B 2 235  ? 184.127 114.609 146.782 1.00 142.79 ?  232  ARG B CD    1 
ATOM   6739  N  NE    . ARG B 2 235  ? 184.741 115.918 147.016 1.00 152.91 ?  232  ARG B NE    1 
ATOM   6740  C  CZ    . ARG B 2 235  ? 185.236 116.696 146.056 1.00 149.68 ?  232  ARG B CZ    1 
ATOM   6741  N  NH1   . ARG B 2 235  ? 185.776 117.860 146.372 1.00 123.55 ?  232  ARG B NH1   1 
ATOM   6742  N  NH2   . ARG B 2 235  ? 185.185 116.316 144.784 1.00 151.98 ?  232  ARG B NH2   1 
ATOM   6743  N  N     . LEU B 2 236  ? 182.931 114.559 152.304 1.00 45.62  ?  233  LEU B N     1 
ATOM   6744  C  CA    . LEU B 2 236  ? 183.371 115.651 153.150 1.00 49.26  ?  233  LEU B CA    1 
ATOM   6745  C  C     . LEU B 2 236  ? 184.862 115.879 152.944 1.00 53.49  ?  233  LEU B C     1 
ATOM   6746  O  O     . LEU B 2 236  ? 185.639 114.928 152.822 1.00 61.48  ?  233  LEU B O     1 
ATOM   6747  C  CB    . LEU B 2 236  ? 183.071 115.336 154.614 1.00 49.30  ?  233  LEU B CB    1 
ATOM   6748  C  CG    . LEU B 2 236  ? 183.315 116.468 155.604 1.00 70.08  ?  233  LEU B CG    1 
ATOM   6749  C  CD1   . LEU B 2 236  ? 182.288 116.398 156.710 1.00 84.59  ?  233  LEU B CD1   1 
ATOM   6750  C  CD2   . LEU B 2 236  ? 184.724 116.410 156.193 1.00 76.40  ?  233  LEU B CD2   1 
ATOM   6751  N  N     . ILE B 2 237  ? 185.262 117.149 152.894 1.00 64.52  ?  234  ILE B N     1 
ATOM   6752  C  CA    . ILE B 2 237  ? 186.658 117.493 152.648 1.00 67.22  ?  234  ILE B CA    1 
ATOM   6753  C  C     . ILE B 2 237  ? 187.208 118.132 153.911 1.00 65.90  ?  234  ILE B C     1 
ATOM   6754  O  O     . ILE B 2 237  ? 186.491 118.831 154.635 1.00 73.97  ?  234  ILE B O     1 
ATOM   6755  C  CB    . ILE B 2 237  ? 186.836 118.453 151.443 1.00 74.18  ?  234  ILE B CB    1 
ATOM   6756  C  CG1   . ILE B 2 237  ? 186.105 117.933 150.202 1.00 89.14  ?  234  ILE B CG1   1 
ATOM   6757  C  CG2   . ILE B 2 237  ? 188.316 118.687 151.127 1.00 58.69  ?  234  ILE B CG2   1 
ATOM   6758  C  CD1   . ILE B 2 237  ? 186.436 116.512 149.831 1.00 93.77  ?  234  ILE B CD1   1 
ATOM   6759  N  N     . ARG B 2 238  ? 188.489 117.899 154.176 1.00 62.28  ?  235  ARG B N     1 
ATOM   6760  C  CA    . ARG B 2 238  ? 189.153 118.547 155.290 1.00 72.06  ?  235  ARG B CA    1 
ATOM   6761  C  C     . ARG B 2 238  ? 190.442 119.161 154.773 1.00 66.57  ?  235  ARG B C     1 
ATOM   6762  O  O     . ARG B 2 238  ? 191.045 118.656 153.825 1.00 74.67  ?  235  ARG B O     1 
ATOM   6763  C  CB    . ARG B 2 238  ? 189.403 117.542 156.430 1.00 108.70 ?  235  ARG B CB    1 
ATOM   6764  C  CG    . ARG B 2 238  ? 190.517 117.882 157.408 1.00 132.07 ?  235  ARG B CG    1 
ATOM   6765  C  CD    . ARG B 2 238  ? 190.866 116.668 158.268 1.00 130.10 ?  235  ARG B CD    1 
ATOM   6766  N  NE    . ARG B 2 238  ? 191.817 116.997 159.324 1.00 116.41 ?  235  ARG B NE    1 
ATOM   6767  C  CZ    . ARG B 2 238  ? 193.123 116.765 159.255 1.00 83.41  ?  235  ARG B CZ    1 
ATOM   6768  N  NH1   . ARG B 2 238  ? 193.915 117.102 160.266 1.00 73.08  ?  235  ARG B NH1   1 
ATOM   6769  N  NH2   . ARG B 2 238  ? 193.641 116.194 158.175 1.00 76.80  ?  235  ARG B NH2   1 
ATOM   6770  N  N     . LEU B 2 239  ? 190.846 120.276 155.371 1.00 62.32  ?  236  LEU B N     1 
ATOM   6771  C  CA    . LEU B 2 239  ? 192.100 120.895 154.982 1.00 69.64  ?  236  LEU B CA    1 
ATOM   6772  C  C     . LEU B 2 239  ? 192.722 121.568 156.191 1.00 88.22  ?  236  LEU B C     1 
ATOM   6773  O  O     . LEU B 2 239  ? 192.054 121.865 157.186 1.00 92.24  ?  236  LEU B O     1 
ATOM   6774  C  CB    . LEU B 2 239  ? 191.909 121.896 153.840 1.00 51.94  ?  236  LEU B CB    1 
ATOM   6775  C  CG    . LEU B 2 239  ? 190.978 123.067 154.123 1.00 45.87  ?  236  LEU B CG    1 
ATOM   6776  C  CD1   . LEU B 2 239  ? 191.766 124.313 154.490 1.00 49.06  ?  236  LEU B CD1   1 
ATOM   6777  C  CD2   . LEU B 2 239  ? 190.112 123.307 152.909 1.00 66.67  ?  236  LEU B CD2   1 
ATOM   6778  N  N     . HIS B 2 240  ? 194.022 121.812 156.077 1.00 104.24 ?  237  HIS B N     1 
ATOM   6779  C  CA    . HIS B 2 240  ? 194.813 122.410 157.139 1.00 115.99 ?  237  HIS B CA    1 
ATOM   6780  C  C     . HIS B 2 240  ? 195.810 123.361 156.494 1.00 136.72 ?  237  HIS B C     1 
ATOM   6781  O  O     . HIS B 2 240  ? 196.585 122.953 155.621 1.00 135.95 ?  237  HIS B O     1 
ATOM   6782  C  CB    . HIS B 2 240  ? 195.517 121.325 157.963 1.00 117.76 ?  237  HIS B CB    1 
ATOM   6783  C  CG    . HIS B 2 240  ? 196.451 121.857 159.001 1.00 143.45 ?  237  HIS B CG    1 
ATOM   6784  N  ND1   . HIS B 2 240  ? 196.320 123.116 159.546 1.00 163.58 ?  237  HIS B ND1   1 
ATOM   6785  C  CD2   . HIS B 2 240  ? 197.530 121.298 159.597 1.00 155.33 ?  237  HIS B CD2   1 
ATOM   6786  C  CE1   . HIS B 2 240  ? 197.279 123.309 160.432 1.00 184.98 ?  237  HIS B CE1   1 
ATOM   6787  N  NE2   . HIS B 2 240  ? 198.026 122.221 160.482 1.00 174.71 ?  237  HIS B NE2   1 
ATOM   6788  N  N     . VAL B 2 241  ? 195.767 124.630 156.897 1.00 143.72 ?  238  VAL B N     1 
ATOM   6789  C  CA    . VAL B 2 241  ? 196.660 125.655 156.373 1.00 145.71 ?  238  VAL B CA    1 
ATOM   6790  C  C     . VAL B 2 241  ? 197.553 126.146 157.504 1.00 153.52 ?  238  VAL B C     1 
ATOM   6791  O  O     . VAL B 2 241  ? 197.202 126.077 158.684 1.00 158.55 ?  238  VAL B O     1 
ATOM   6792  C  CB    . VAL B 2 241  ? 195.898 126.837 155.741 1.00 142.68 ?  238  VAL B CB    1 
ATOM   6793  C  CG1   . VAL B 2 241  ? 194.749 126.337 154.898 1.00 147.27 ?  238  VAL B CG1   1 
ATOM   6794  C  CG2   . VAL B 2 241  ? 195.396 127.793 156.822 1.00 152.64 ?  238  VAL B CG2   1 
ATOM   6795  N  N     . GLU B 2 242  ? 198.733 126.635 157.130 1.00 160.63 ?  239  GLU B N     1 
ATOM   6796  C  CA    . GLU B 2 242  ? 199.645 127.221 158.103 1.00 167.80 ?  239  GLU B CA    1 
ATOM   6797  C  C     . GLU B 2 242  ? 200.548 128.223 157.400 1.00 149.53 ?  239  GLU B C     1 
ATOM   6798  O  O     . GLU B 2 242  ? 201.109 127.928 156.339 1.00 147.52 ?  239  GLU B O     1 
ATOM   6799  C  CB    . GLU B 2 242  ? 200.482 126.156 158.826 1.00 205.44 ?  239  GLU B CB    1 
ATOM   6800  C  CG    . GLU B 2 242  ? 200.820 124.887 158.035 1.00 253.80 ?  239  GLU B CG    1 
ATOM   6801  C  CD    . GLU B 2 242  ? 199.851 123.737 158.284 1.00 259.60 ?  239  GLU B CD    1 
ATOM   6802  O  OE1   . GLU B 2 242  ? 200.273 122.742 158.910 1.00 239.99 ?  239  GLU B OE1   1 
ATOM   6803  O  OE2   . GLU B 2 242  ? 198.697 123.799 157.822 1.00 344.26 -1 239  GLU B OE2   1 
ATOM   6804  N  N     . LEU B 2 243  ? 200.672 129.411 157.991 1.00 149.35 ?  240  LEU B N     1 
ATOM   6805  C  CA    . LEU B 2 243  ? 201.513 130.470 157.438 1.00 145.79 ?  240  LEU B CA    1 
ATOM   6806  C  C     . LEU B 2 243  ? 202.930 130.287 157.971 1.00 143.73 ?  240  LEU B C     1 
ATOM   6807  O  O     . LEU B 2 243  ? 203.340 130.885 158.969 1.00 146.14 ?  240  LEU B O     1 
ATOM   6808  C  CB    . LEU B 2 243  ? 200.954 131.843 157.793 1.00 158.33 ?  240  LEU B CB    1 
ATOM   6809  C  CG    . LEU B 2 243  ? 199.453 132.101 157.625 1.00 153.74 ?  240  LEU B CG    1 
ATOM   6810  C  CD1   . LEU B 2 243  ? 198.696 131.866 158.923 1.00 131.45 ?  240  LEU B CD1   1 
ATOM   6811  C  CD2   . LEU B 2 243  ? 199.205 133.515 157.116 1.00 131.26 ?  240  LEU B CD2   1 
ATOM   6812  N  N     . LEU B 2 244  ? 203.692 129.422 157.300 1.00 145.26 ?  241  LEU B N     1 
ATOM   6813  C  CA    . LEU B 2 244  ? 205.114 129.272 157.598 1.00 165.92 ?  241  LEU B CA    1 
ATOM   6814  C  C     . LEU B 2 244  ? 205.858 130.378 156.847 1.00 186.00 ?  241  LEU B C     1 
ATOM   6815  O  O     . LEU B 2 244  ? 206.630 130.141 155.916 1.00 189.19 ?  241  LEU B O     1 
ATOM   6816  C  CB    . LEU B 2 244  ? 205.603 127.882 157.209 1.00 157.05 ?  241  LEU B CB    1 
ATOM   6817  C  CG    . LEU B 2 244  ? 206.967 127.417 157.734 1.00 143.65 ?  241  LEU B CG    1 
ATOM   6818  C  CD1   . LEU B 2 244  ? 207.078 127.667 159.228 1.00 140.25 ?  241  LEU B CD1   1 
ATOM   6819  C  CD2   . LEU B 2 244  ? 207.226 125.948 157.407 1.00 123.54 ?  241  LEU B CD2   1 
ATOM   6820  N  N     . LEU B 2 245  ? 205.590 131.617 157.273 1.00 184.53 ?  242  LEU B N     1 
ATOM   6821  C  CA    . LEU B 2 245  ? 206.011 132.807 156.534 1.00 183.28 ?  242  LEU B CA    1 
ATOM   6822  C  C     . LEU B 2 245  ? 207.507 132.798 156.251 1.00 179.05 ?  242  LEU B C     1 
ATOM   6823  O  O     . LEU B 2 245  ? 208.316 132.429 157.106 1.00 185.37 ?  242  LEU B O     1 
ATOM   6824  C  CB    . LEU B 2 245  ? 205.642 134.074 157.311 1.00 174.82 ?  242  LEU B CB    1 
ATOM   6825  C  CG    . LEU B 2 245  ? 204.158 134.419 157.461 1.00 168.38 ?  242  LEU B CG    1 
ATOM   6826  C  CD1   . LEU B 2 245  ? 203.643 134.057 158.842 1.00 167.10 ?  242  LEU B CD1   1 
ATOM   6827  C  CD2   . LEU B 2 245  ? 203.924 135.894 157.163 1.00 148.76 ?  242  LEU B CD2   1 
ATOM   6828  N  N     . GLY B 2 246  ? 207.873 133.222 155.041 1.00 172.48 ?  243  GLY B N     1 
ATOM   6829  C  CA    . GLY B 2 246  ? 206.926 133.702 154.045 1.00 160.25 ?  243  GLY B CA    1 
ATOM   6830  C  C     . GLY B 2 246  ? 206.391 132.670 153.062 1.00 160.81 ?  243  GLY B C     1 
ATOM   6831  O  O     . GLY B 2 246  ? 206.540 132.825 151.848 1.00 138.95 ?  243  GLY B O     1 
ATOM   6832  N  N     . SER B 2 247  ? 205.768 131.618 153.584 1.00 171.64 ?  244  SER B N     1 
ATOM   6833  C  CA    . SER B 2 247  ? 205.173 130.561 152.766 1.00 164.19 ?  244  SER B CA    1 
ATOM   6834  C  C     . SER B 2 247  ? 203.814 130.167 153.326 1.00 143.30 ?  244  SER B C     1 
ATOM   6835  O  O     . SER B 2 247  ? 203.746 129.567 154.419 1.00 143.69 ?  244  SER B O     1 
ATOM   6836  C  CB    . SER B 2 247  ? 206.088 129.340 152.699 1.00 177.19 ?  244  SER B CB    1 
ATOM   6837  O  OG    . SER B 2 247  ? 206.475 128.914 153.995 1.00 179.27 ?  244  SER B OG    1 
ATOM   6838  N  N     . PRO B 2 248  ? 202.724 130.463 152.637 1.00 115.58 ?  245  PRO B N     1 
ATOM   6839  C  CA    . PRO B 2 248  ? 201.411 129.954 153.080 1.00 108.16 ?  245  PRO B CA    1 
ATOM   6840  C  C     . PRO B 2 248  ? 201.210 128.491 152.688 1.00 107.48 ?  245  PRO B C     1 
ATOM   6841  O  O     . PRO B 2 248  ? 200.570 128.143 151.696 1.00 104.96 ?  245  PRO B O     1 
ATOM   6842  C  CB    . PRO B 2 248  ? 200.436 130.888 152.360 1.00 140.19 ?  245  PRO B CB    1 
ATOM   6843  C  CG    . PRO B 2 248  ? 201.158 131.256 151.103 1.00 115.40 ?  245  PRO B CG    1 
ATOM   6844  C  CD    . PRO B 2 248  ? 202.606 131.389 151.498 1.00 100.49 ?  245  PRO B CD    1 
ATOM   6845  N  N     . VAL B 2 249  ? 201.776 127.583 153.486 1.00 114.45 ?  246  VAL B N     1 
ATOM   6846  C  CA    . VAL B 2 249  ? 201.761 126.172 153.119 1.00 113.77 ?  246  VAL B CA    1 
ATOM   6847  C  C     . VAL B 2 249  ? 200.397 125.589 153.460 1.00 102.16 ?  246  VAL B C     1 
ATOM   6848  O  O     . VAL B 2 249  ? 199.746 126.000 154.433 1.00 124.10 ?  246  VAL B O     1 
ATOM   6849  C  CB    . VAL B 2 249  ? 202.916 125.411 153.804 1.00 133.11 ?  246  VAL B CB    1 
ATOM   6850  C  CG1   . VAL B 2 249  ? 202.945 125.674 155.298 1.00 153.28 ?  246  VAL B CG1   1 
ATOM   6851  C  CG2   . VAL B 2 249  ? 202.848 123.914 153.511 1.00 122.81 ?  246  VAL B CG2   1 
ATOM   6852  N  N     . LEU B 2 250  ? 199.939 124.650 152.634 1.00 85.74  ?  247  LEU B N     1 
ATOM   6853  C  CA    . LEU B 2 250  ? 198.576 124.149 152.710 1.00 87.35  ?  247  LEU B CA    1 
ATOM   6854  C  C     . LEU B 2 250  ? 198.585 122.642 152.483 1.00 89.55  ?  247  LEU B C     1 
ATOM   6855  O  O     . LEU B 2 250  ? 199.480 122.105 151.825 1.00 89.79  ?  247  LEU B O     1 
ATOM   6856  C  CB    . LEU B 2 250  ? 197.696 124.869 151.670 1.00 96.76  ?  247  LEU B CB    1 
ATOM   6857  C  CG    . LEU B 2 250  ? 196.200 125.109 151.893 1.00 105.76 ?  247  LEU B CG    1 
ATOM   6858  C  CD1   . LEU B 2 250  ? 195.704 126.221 150.973 1.00 84.04  ?  247  LEU B CD1   1 
ATOM   6859  C  CD2   . LEU B 2 250  ? 195.369 123.851 151.680 1.00 116.15 ?  247  LEU B CD2   1 
ATOM   6860  N  N     . THR B 2 251  ? 197.588 121.960 153.048 1.00 91.08  ?  248  THR B N     1 
ATOM   6861  C  CA    . THR B 2 251  ? 197.354 120.549 152.768 1.00 82.74  ?  248  THR B CA    1 
ATOM   6862  C  C     . THR B 2 251  ? 195.867 120.274 152.935 1.00 85.27  ?  248  THR B C     1 
ATOM   6863  O  O     . THR B 2 251  ? 195.135 121.071 153.527 1.00 95.81  ?  248  THR B O     1 
ATOM   6864  C  CB    . THR B 2 251  ? 198.187 119.632 153.679 1.00 82.32  ?  248  THR B CB    1 
ATOM   6865  O  OG1   . THR B 2 251  ? 197.695 118.290 153.586 1.00 74.32  ?  248  THR B OG1   1 
ATOM   6866  C  CG2   . THR B 2 251  ? 198.102 120.087 155.125 1.00 98.93  ?  248  THR B CG2   1 
ATOM   6867  N  N     . CYS B 2 252  ? 195.422 119.131 152.414 1.00 83.48  ?  249  CYS B N     1 
ATOM   6868  C  CA    . CYS B 2 252  ? 194.031 118.718 152.566 1.00 92.61  ?  249  CYS B CA    1 
ATOM   6869  C  C     . CYS B 2 252  ? 193.959 117.194 152.502 1.00 89.28  ?  249  CYS B C     1 
ATOM   6870  O  O     . CYS B 2 252  ? 194.970 116.506 152.325 1.00 91.78  ?  249  CYS B O     1 
ATOM   6871  C  CB    . CYS B 2 252  ? 193.129 119.357 151.500 1.00 104.93 ?  249  CYS B CB    1 
ATOM   6872  S  SG    . CYS B 2 252  ? 193.032 118.450 149.940 1.00 121.05 ?  249  CYS B SG    1 
ATOM   6873  N  N     . THR B 2 253  ? 192.744 116.671 152.643 1.00 88.30  ?  250  THR B N     1 
ATOM   6874  C  CA    . THR B 2 253  ? 192.483 115.239 152.599 1.00 79.93  ?  250  THR B CA    1 
ATOM   6875  C  C     . THR B 2 253  ? 190.983 115.019 152.438 1.00 78.53  ?  250  THR B C     1 
ATOM   6876  O  O     . THR B 2 253  ? 190.163 115.894 152.749 1.00 86.65  ?  250  THR B O     1 
ATOM   6877  C  CB    . THR B 2 253  ? 193.008 114.519 153.853 1.00 72.70  ?  250  THR B CB    1 
ATOM   6878  O  OG1   . THR B 2 253  ? 192.457 113.198 153.914 1.00 65.80  ?  250  THR B OG1   1 
ATOM   6879  C  CG2   . THR B 2 253  ? 192.630 115.276 155.107 1.00 85.76  ?  250  THR B CG2   1 
ATOM   6880  N  N     . ILE B 2 254  ? 190.639 113.844 151.902 1.00 75.31  ?  251  ILE B N     1 
ATOM   6881  C  CA    . ILE B 2 254  ? 189.258 113.395 151.783 1.00 79.66  ?  251  ILE B CA    1 
ATOM   6882  C  C     . ILE B 2 254  ? 188.905 112.635 153.049 1.00 60.65  ?  251  ILE B C     1 
ATOM   6883  O  O     . ILE B 2 254  ? 189.732 111.918 153.620 1.00 77.99  ?  251  ILE B O     1 
ATOM   6884  C  CB    . ILE B 2 254  ? 189.059 112.516 150.529 1.00 87.44  ?  251  ILE B CB    1 
ATOM   6885  C  CG1   . ILE B 2 254  ? 189.753 113.138 149.310 1.00 93.63  ?  251  ILE B CG1   1 
ATOM   6886  C  CG2   . ILE B 2 254  ? 187.579 112.229 150.283 1.00 64.20  ?  251  ILE B CG2   1 
ATOM   6887  C  CD1   . ILE B 2 254  ? 189.217 114.486 148.894 1.00 77.50  ?  251  ILE B CD1   1 
ATOM   6888  N  N     . LEU B 2 255  ? 187.670 112.792 153.500 1.00 49.36  ?  252  LEU B N     1 
ATOM   6889  C  CA    . LEU B 2 255  ? 187.173 112.060 154.648 1.00 51.22  ?  252  LEU B CA    1 
ATOM   6890  C  C     . LEU B 2 255  ? 185.965 111.235 154.235 1.00 47.34  ?  252  LEU B C     1 
ATOM   6891  O  O     . LEU B 2 255  ? 185.398 111.407 153.153 1.00 44.83  ?  252  LEU B O     1 
ATOM   6892  C  CB    . LEU B 2 255  ? 186.830 113.006 155.808 1.00 59.07  ?  252  LEU B CB    1 
ATOM   6893  C  CG    . LEU B 2 255  ? 187.993 113.355 156.751 1.00 62.30  ?  252  LEU B CG    1 
ATOM   6894  C  CD1   . LEU B 2 255  ? 189.130 114.085 156.058 1.00 50.66  ?  252  LEU B CD1   1 
ATOM   6895  C  CD2   . LEU B 2 255  ? 187.494 114.163 157.944 1.00 75.47  ?  252  LEU B CD2   1 
ATOM   6896  N  N     . HIS B 2 256  ? 185.586 110.310 155.113 1.00 58.32  ?  253  HIS B N     1 
ATOM   6897  C  CA    . HIS B 2 256  ? 184.480 109.420 154.793 1.00 81.27  ?  253  HIS B CA    1 
ATOM   6898  C  C     . HIS B 2 256  ? 183.145 110.149 154.867 1.00 111.48 ?  253  HIS B C     1 
ATOM   6899  O  O     . HIS B 2 256  ? 182.436 110.274 153.863 1.00 118.79 ?  253  HIS B O     1 
ATOM   6900  C  CB    . HIS B 2 256  ? 184.479 108.219 155.734 1.00 125.49 ?  253  HIS B CB    1 
ATOM   6901  C  CG    . HIS B 2 256  ? 183.139 107.564 155.859 1.00 179.21 ?  253  HIS B CG    1 
ATOM   6902  N  ND1   . HIS B 2 256  ? 182.369 107.660 156.998 1.00 182.00 ?  253  HIS B ND1   1 
ATOM   6903  C  CD2   . HIS B 2 256  ? 182.419 106.829 154.977 1.00 182.59 ?  253  HIS B CD2   1 
ATOM   6904  C  CE1   . HIS B 2 256  ? 181.240 106.998 156.818 1.00 171.65 ?  253  HIS B CE1   1 
ATOM   6905  N  NE2   . HIS B 2 256  ? 181.246 106.485 155.601 1.00 170.90 ?  253  HIS B NE2   1 
ATOM   6906  N  N     . GLU B 2 257  ? 182.791 110.653 156.045 1.00 129.47 ?  254  GLU B N     1 
ATOM   6907  C  CA    . GLU B 2 257  ? 181.416 111.036 156.341 1.00 171.25 ?  254  GLU B CA    1 
ATOM   6908  C  C     . GLU B 2 257  ? 181.224 112.536 156.140 1.00 155.50 ?  254  GLU B C     1 
ATOM   6909  O  O     . GLU B 2 257  ? 181.813 113.344 156.864 1.00 135.71 ?  254  GLU B O     1 
ATOM   6910  C  CB    . GLU B 2 257  ? 181.040 110.636 157.767 1.00 171.09 ?  254  GLU B CB    1 
ATOM   6911  C  CG    . GLU B 2 257  ? 179.677 111.141 158.198 1.00 207.67 ?  254  GLU B CG    1 
ATOM   6912  C  CD    . GLU B 2 257  ? 178.607 110.863 157.156 1.00 216.21 ?  254  GLU B CD    1 
ATOM   6913  O  OE1   . GLU B 2 257  ? 178.233 109.683 156.975 1.00 198.99 ?  254  GLU B OE1   1 
ATOM   6914  O  OE2   . GLU B 2 257  ? 178.176 111.823 156.482 1.00 287.63 -1 254  GLU B OE2   1 
ATOM   6915  N  N     . GLY B 2 258  ? 180.385 112.896 155.167 1.00 131.81 ?  255  GLY B N     1 
ATOM   6916  C  CA    . GLY B 2 258  ? 179.825 114.229 155.036 1.00 75.49  ?  255  GLY B CA    1 
ATOM   6917  C  C     . GLY B 2 258  ? 178.415 114.123 154.492 1.00 68.93  ?  255  GLY B C     1 
ATOM   6918  O  O     . GLY B 2 258  ? 178.218 113.564 153.411 1.00 81.37  ?  255  GLY B O     1 
ATOM   6919  N  N     . LEU B 2 259  ? 177.424 114.630 155.218 1.00 65.29  ?  256  LEU B N     1 
ATOM   6920  C  CA    . LEU B 2 259  ? 176.046 114.356 154.838 1.00 86.13  ?  256  LEU B CA    1 
ATOM   6921  C  C     . LEU B 2 259  ? 175.705 115.032 153.510 1.00 100.95 ?  256  LEU B C     1 
ATOM   6922  O  O     . LEU B 2 259  ? 176.293 116.045 153.123 1.00 94.97  ?  256  LEU B O     1 
ATOM   6923  C  CB    . LEU B 2 259  ? 175.075 114.804 155.937 1.00 104.06 ?  256  LEU B CB    1 
ATOM   6924  C  CG    . LEU B 2 259  ? 173.587 114.426 155.797 1.00 120.70 ?  256  LEU B CG    1 
ATOM   6925  C  CD1   . LEU B 2 259  ? 173.398 112.932 155.552 1.00 135.06 ?  256  LEU B CD1   1 
ATOM   6926  C  CD2   . LEU B 2 259  ? 172.745 114.886 156.989 1.00 112.77 ?  256  LEU B CD2   1 
ATOM   6927  N  N     . THR B 2 260  ? 174.736 114.440 152.806 1.00 101.15 ?  257  THR B N     1 
ATOM   6928  C  CA    . THR B 2 260  ? 174.305 114.918 151.492 1.00 98.51  ?  257  THR B CA    1 
ATOM   6929  C  C     . THR B 2 260  ? 173.232 115.985 151.694 1.00 108.47 ?  257  THR B C     1 
ATOM   6930  O  O     . THR B 2 260  ? 172.030 115.741 151.580 1.00 88.94  ?  257  THR B O     1 
ATOM   6931  C  CB    . THR B 2 260  ? 173.795 113.764 150.635 1.00 76.77  ?  257  THR B CB    1 
ATOM   6932  O  OG1   . THR B 2 260  ? 172.657 113.162 151.264 1.00 72.58  ?  257  THR B OG1   1 
ATOM   6933  C  CG2   . THR B 2 260  ? 174.871 112.714 150.451 1.00 76.84  ?  257  THR B CG2   1 
ATOM   6934  N  N     . ILE B 2 261  ? 173.689 117.195 152.015 1.00 99.21  ?  258  ILE B N     1 
ATOM   6935  C  CA    . ILE B 2 261  ? 172.808 118.318 152.305 1.00 76.78  ?  258  ILE B CA    1 
ATOM   6936  C  C     . ILE B 2 261  ? 173.367 119.559 151.624 1.00 88.47  ?  258  ILE B C     1 
ATOM   6937  O  O     . ILE B 2 261  ? 174.577 119.685 151.426 1.00 86.35  ?  258  ILE B O     1 
ATOM   6938  C  CB    . ILE B 2 261  ? 172.649 118.529 153.826 1.00 64.28  ?  258  ILE B CB    1 
ATOM   6939  C  CG1   . ILE B 2 261  ? 174.014 118.517 154.521 1.00 64.78  ?  258  ILE B CG1   1 
ATOM   6940  C  CG2   . ILE B 2 261  ? 171.756 117.455 154.401 1.00 55.21  ?  258  ILE B CG2   1 
ATOM   6941  C  CD1   . ILE B 2 261  ? 173.949 118.611 156.044 1.00 52.67  ?  258  ILE B CD1   1 
ATOM   6942  N  N     . THR B 2 262  ? 172.471 120.474 151.252 1.00 80.28  ?  259  THR B N     1 
ATOM   6943  C  CA    . THR B 2 262  ? 172.816 121.683 150.517 1.00 60.85  ?  259  THR B CA    1 
ATOM   6944  C  C     . THR B 2 262  ? 172.241 122.901 151.230 1.00 59.59  ?  259  THR B C     1 
ATOM   6945  O  O     . THR B 2 262  ? 171.185 122.820 151.862 1.00 65.47  ?  259  THR B O     1 
ATOM   6946  C  CB    . THR B 2 262  ? 172.275 121.632 149.076 1.00 43.50  ?  259  THR B CB    1 
ATOM   6947  O  OG1   . THR B 2 262  ? 170.991 120.999 149.070 1.00 46.58  ?  259  THR B OG1   1 
ATOM   6948  C  CG2   . THR B 2 262  ? 173.207 120.844 148.172 1.00 43.14  ?  259  THR B CG2   1 
ATOM   6949  N  N     . SER B 2 263  ? 172.943 124.034 151.129 1.00 55.23  ?  260  SER B N     1 
ATOM   6950  C  CA    . SER B 2 263  ? 172.427 125.331 151.580 1.00 65.84  ?  260  SER B CA    1 
ATOM   6951  C  C     . SER B 2 263  ? 172.059 125.309 153.069 1.00 80.17  ?  260  SER B C     1 
ATOM   6952  O  O     . SER B 2 263  ? 170.901 125.460 153.461 1.00 81.99  ?  260  SER B O     1 
ATOM   6953  C  CB    . SER B 2 263  ? 171.225 125.746 150.723 1.00 80.86  ?  260  SER B CB    1 
ATOM   6954  O  OG    . SER B 2 263  ? 170.356 126.621 151.425 1.00 68.67  ?  260  SER B OG    1 
ATOM   6955  N  N     . ALA B 2 264  ? 173.084 125.124 153.895 1.00 82.10  ?  261  ALA B N     1 
ATOM   6956  C  CA    . ALA B 2 264  ? 172.869 124.858 155.313 1.00 119.66 ?  261  ALA B CA    1 
ATOM   6957  C  C     . ALA B 2 264  ? 172.596 126.131 156.119 1.00 109.39 ?  261  ALA B C     1 
ATOM   6958  O  O     . ALA B 2 264  ? 173.014 127.230 155.750 1.00 84.67  ?  261  ALA B O     1 
ATOM   6959  C  CB    . ALA B 2 264  ? 174.079 124.124 155.898 1.00 139.31 ?  261  ALA B CB    1 
ATOM   6960  N  N     . ILE B 2 265  ? 171.889 125.959 157.240 1.00 104.24 ?  262  ILE B N     1 
ATOM   6961  C  CA    . ILE B 2 265  ? 171.552 127.039 158.175 1.00 72.29  ?  262  ILE B CA    1 
ATOM   6962  C  C     . ILE B 2 265  ? 172.249 126.700 159.490 1.00 62.39  ?  262  ILE B C     1 
ATOM   6963  O  O     . ILE B 2 265  ? 171.698 125.998 160.342 1.00 59.52  ?  262  ILE B O     1 
ATOM   6964  C  CB    . ILE B 2 265  ? 170.038 127.187 158.368 1.00 62.38  ?  262  ILE B CB    1 
ATOM   6965  C  CG1   . ILE B 2 265  ? 169.314 127.229 157.017 1.00 86.32  ?  262  ILE B CG1   1 
ATOM   6966  C  CG2   . ILE B 2 265  ? 169.707 128.433 159.171 1.00 66.92  ?  262  ILE B CG2   1 
ATOM   6967  C  CD1   . ILE B 2 265  ? 167.826 127.621 157.092 1.00 58.50  ?  262  ILE B CD1   1 
ATOM   6968  N  N     . ALA B 2 266  ? 173.464 127.216 159.681 1.00 49.88  ?  263  ALA B N     1 
ATOM   6969  C  CA    . ALA B 2 266  ? 174.337 126.803 160.780 1.00 47.71  ?  263  ALA B CA    1 
ATOM   6970  C  C     . ALA B 2 266  ? 174.065 127.642 162.028 1.00 53.28  ?  263  ALA B C     1 
ATOM   6971  O  O     . ALA B 2 266  ? 174.368 128.837 162.051 1.00 65.97  ?  263  ALA B O     1 
ATOM   6972  C  CB    . ALA B 2 266  ? 175.799 126.935 160.364 1.00 38.75  ?  263  ALA B CB    1 
ATOM   6973  N  N     . SER B 2 267  ? 173.523 127.012 163.082 1.00 51.30  ?  264  SER B N     1 
ATOM   6974  C  CA    . SER B 2 267  ? 173.310 127.692 164.352 1.00 50.16  ?  264  SER B CA    1 
ATOM   6975  C  C     . SER B 2 267  ? 174.296 127.159 165.380 1.00 67.26  ?  264  SER B C     1 
ATOM   6976  O  O     . SER B 2 267  ? 174.314 125.941 165.639 1.00 72.43  ?  264  SER B O     1 
ATOM   6977  C  CB    . SER B 2 267  ? 171.880 127.494 164.840 1.00 62.06  ?  264  SER B CB    1 
ATOM   6978  O  OG    . SER B 2 267  ? 171.643 128.121 166.092 1.00 65.45  ?  264  SER B OG    1 
ATOM   6979  N  N     . PRO B 2 268  ? 175.143 128.004 165.967 1.00 64.47  ?  265  PRO B N     1 
ATOM   6980  C  CA    . PRO B 2 268  ? 176.002 127.544 167.060 1.00 70.73  ?  265  PRO B CA    1 
ATOM   6981  C  C     . PRO B 2 268  ? 175.272 127.644 168.388 1.00 73.12  ?  265  PRO B C     1 
ATOM   6982  O  O     . PRO B 2 268  ? 174.552 128.603 168.669 1.00 75.17  ?  265  PRO B O     1 
ATOM   6983  C  CB    . PRO B 2 268  ? 177.180 128.523 167.005 1.00 59.31  ?  265  PRO B CB    1 
ATOM   6984  C  CG    . PRO B 2 268  ? 176.548 129.783 166.542 1.00 61.00  ?  265  PRO B CG    1 
ATOM   6985  C  CD    . PRO B 2 268  ? 175.452 129.388 165.577 1.00 61.52  ?  265  PRO B CD    1 
ATOM   6986  N  N     . ILE B 2 269  ? 175.456 126.626 169.209 1.00 77.25  ?  266  ILE B N     1 
ATOM   6987  C  CA    . ILE B 2 269  ? 174.914 126.592 170.556 1.00 89.84  ?  266  ILE B CA    1 
ATOM   6988  C  C     . ILE B 2 269  ? 176.016 126.732 171.596 1.00 90.45  ?  266  ILE B C     1 
ATOM   6989  O  O     . ILE B 2 269  ? 175.942 127.582 172.486 1.00 87.08  ?  266  ILE B O     1 
ATOM   6990  C  CB    . ILE B 2 269  ? 174.076 125.313 170.789 1.00 103.48 ?  266  ILE B CB    1 
ATOM   6991  C  CG1   . ILE B 2 269  ? 174.851 124.052 170.406 1.00 93.50  ?  266  ILE B CG1   1 
ATOM   6992  C  CG2   . ILE B 2 269  ? 172.789 125.370 170.002 1.00 101.93 ?  266  ILE B CG2   1 
ATOM   6993  C  CD1   . ILE B 2 269  ? 174.064 122.765 170.609 1.00 94.23  ?  266  ILE B CD1   1 
ATOM   6994  N  N     . GLY B 2 270  ? 177.067 125.925 171.478 1.00 88.31  ?  267  GLY B N     1 
ATOM   6995  C  CA    . GLY B 2 270  ? 178.166 125.944 172.394 1.00 85.01  ?  267  GLY B CA    1 
ATOM   6996  C  C     . GLY B 2 270  ? 179.439 126.472 171.770 1.00 61.56  ?  267  GLY B C     1 
ATOM   6997  O  O     . GLY B 2 270  ? 179.426 127.180 170.755 1.00 58.67  ?  267  GLY B O     1 
ATOM   6998  N  N     . TYR B 2 271  ? 180.559 126.129 172.401 1.00 64.44  ?  268  TYR B N     1 
ATOM   6999  C  CA    . TYR B 2 271  ? 181.861 126.553 171.916 1.00 71.86  ?  268  TYR B CA    1 
ATOM   7000  C  C     . TYR B 2 271  ? 182.057 126.127 170.464 1.00 67.41  ?  268  TYR B C     1 
ATOM   7001  O  O     . TYR B 2 271  ? 182.147 126.964 169.561 1.00 69.73  ?  268  TYR B O     1 
ATOM   7002  C  CB    . TYR B 2 271  ? 182.948 125.973 172.825 1.00 95.57  ?  268  TYR B CB    1 
ATOM   7003  C  CG    . TYR B 2 271  ? 184.181 126.840 172.958 1.00 119.22 ?  268  TYR B CG    1 
ATOM   7004  C  CD1   . TYR B 2 271  ? 184.909 127.221 171.843 1.00 119.57 ?  268  TYR B CD1   1 
ATOM   7005  C  CD2   . TYR B 2 271  ? 184.618 127.276 174.205 1.00 121.06 ?  268  TYR B CD2   1 
ATOM   7006  C  CE1   . TYR B 2 271  ? 186.038 128.010 171.959 1.00 114.27 ?  268  TYR B CE1   1 
ATOM   7007  C  CE2   . TYR B 2 271  ? 185.748 128.068 174.332 1.00 125.68 ?  268  TYR B CE2   1 
ATOM   7008  C  CZ    . TYR B 2 271  ? 186.454 128.432 173.204 1.00 122.81 ?  268  TYR B CZ    1 
ATOM   7009  O  OH    . TYR B 2 271  ? 187.579 129.220 173.313 1.00 110.09 ?  268  TYR B OH    1 
ATOM   7010  N  N     . HIS B 2 272  ? 182.097 124.820 170.218 1.00 69.22  ?  269  HIS B N     1 
ATOM   7011  C  CA    . HIS B 2 272  ? 182.251 124.279 168.870 1.00 67.64  ?  269  HIS B CA    1 
ATOM   7012  C  C     . HIS B 2 272  ? 181.303 123.107 168.660 1.00 69.61  ?  269  HIS B C     1 
ATOM   7013  O  O     . HIS B 2 272  ? 181.667 122.067 168.110 1.00 72.42  ?  269  HIS B O     1 
ATOM   7014  C  CB    . HIS B 2 272  ? 183.698 123.875 168.603 1.00 71.30  ?  269  HIS B CB    1 
ATOM   7015  C  CG    . HIS B 2 272  ? 184.614 125.040 168.399 1.00 74.12  ?  269  HIS B CG    1 
ATOM   7016  N  ND1   . HIS B 2 272  ? 185.595 125.384 169.303 1.00 85.95  ?  269  HIS B ND1   1 
ATOM   7017  C  CD2   . HIS B 2 272  ? 184.699 125.939 167.391 1.00 66.04  ?  269  HIS B CD2   1 
ATOM   7018  C  CE1   . HIS B 2 272  ? 186.242 126.448 168.864 1.00 82.95  ?  269  HIS B CE1   1 
ATOM   7019  N  NE2   . HIS B 2 272  ? 185.719 126.803 167.704 1.00 78.82  ?  269  HIS B NE2   1 
ATOM   7020  N  N     . GLU B 2 273  ? 180.066 123.265 169.114 1.00 68.52  ?  270  GLU B N     1 
ATOM   7021  C  CA    . GLU B 2 273  ? 178.997 122.325 168.819 1.00 87.76  ?  270  GLU B CA    1 
ATOM   7022  C  C     . GLU B 2 273  ? 177.983 123.057 167.958 1.00 62.05  ?  270  GLU B C     1 
ATOM   7023  O  O     . GLU B 2 273  ? 177.441 124.087 168.374 1.00 62.35  ?  270  GLU B O     1 
ATOM   7024  C  CB    . GLU B 2 273  ? 178.355 121.790 170.101 1.00 129.57 ?  270  GLU B CB    1 
ATOM   7025  C  CG    . GLU B 2 273  ? 179.352 121.216 171.103 1.00 161.71 ?  270  GLU B CG    1 
ATOM   7026  C  CD    . GLU B 2 273  ? 178.675 120.492 172.253 1.00 246.49 ?  270  GLU B CD    1 
ATOM   7027  O  OE1   . GLU B 2 273  ? 177.506 120.078 172.095 1.00 220.90 ?  270  GLU B OE1   1 
ATOM   7028  O  OE2   . GLU B 2 273  ? 179.309 120.336 173.317 1.00 393.28 -1 270  GLU B OE2   1 
ATOM   7029  N  N     . TYR B 2 274  ? 177.742 122.543 166.755 1.00 50.82  ?  271  TYR B N     1 
ATOM   7030  C  CA    . TYR B 2 274  ? 176.958 123.255 165.756 1.00 40.45  ?  271  TYR B CA    1 
ATOM   7031  C  C     . TYR B 2 274  ? 175.759 122.422 165.339 1.00 42.45  ?  271  TYR B C     1 
ATOM   7032  O  O     . TYR B 2 274  ? 175.915 121.277 164.896 1.00 45.37  ?  271  TYR B O     1 
ATOM   7033  C  CB    . TYR B 2 274  ? 177.819 123.614 164.545 1.00 30.04  ?  271  TYR B CB    1 
ATOM   7034  C  CG    . TYR B 2 274  ? 178.641 124.855 164.783 1.00 44.77  ?  271  TYR B CG    1 
ATOM   7035  C  CD1   . TYR B 2 274  ? 179.525 124.937 165.847 1.00 56.92  ?  271  TYR B CD1   1 
ATOM   7036  C  CD2   . TYR B 2 274  ? 178.503 125.964 163.965 1.00 48.80  ?  271  TYR B CD2   1 
ATOM   7037  C  CE1   . TYR B 2 274  ? 180.261 126.075 166.076 1.00 63.83  ?  271  TYR B CE1   1 
ATOM   7038  C  CE2   . TYR B 2 274  ? 179.238 127.110 164.186 1.00 59.81  ?  271  TYR B CE2   1 
ATOM   7039  C  CZ    . TYR B 2 274  ? 180.116 127.158 165.244 1.00 68.51  ?  271  TYR B CZ    1 
ATOM   7040  O  OH    . TYR B 2 274  ? 180.853 128.296 165.470 1.00 83.51  ?  271  TYR B OH    1 
ATOM   7041  N  N     . ILE B 2 275  ? 174.563 122.989 165.497 1.00 36.53  ?  272  ILE B N     1 
ATOM   7042  C  CA    . ILE B 2 275  ? 173.356 122.365 164.977 1.00 40.61  ?  272  ILE B CA    1 
ATOM   7043  C  C     . ILE B 2 275  ? 173.129 122.871 163.561 1.00 35.77  ?  272  ILE B C     1 
ATOM   7044  O  O     . ILE B 2 275  ? 173.154 124.081 163.295 1.00 43.27  ?  272  ILE B O     1 
ATOM   7045  C  CB    . ILE B 2 275  ? 172.139 122.628 165.883 1.00 79.33  ?  272  ILE B CB    1 
ATOM   7046  C  CG1   . ILE B 2 275  ? 170.885 121.942 165.324 1.00 85.85  ?  272  ILE B CG1   1 
ATOM   7047  C  CG2   . ILE B 2 275  ? 171.895 124.109 166.118 1.00 98.51  ?  272  ILE B CG2   1 
ATOM   7048  C  CD1   . ILE B 2 275  ? 169.641 122.105 166.193 1.00 79.42  ?  272  ILE B CD1   1 
ATOM   7049  N  N     . ILE B 2 276  ? 172.954 121.935 162.639 1.00 33.21  ?  273  ILE B N     1 
ATOM   7050  C  CA    . ILE B 2 276  ? 172.840 122.215 161.218 1.00 34.86  ?  273  ILE B CA    1 
ATOM   7051  C  C     . ILE B 2 276  ? 171.467 121.735 160.776 1.00 43.48  ?  273  ILE B C     1 
ATOM   7052  O  O     . ILE B 2 276  ? 171.141 120.550 160.926 1.00 63.34  ?  273  ILE B O     1 
ATOM   7053  C  CB    . ILE B 2 276  ? 173.959 121.532 160.419 1.00 36.46  ?  273  ILE B CB    1 
ATOM   7054  C  CG1   . ILE B 2 276  ? 175.327 121.760 161.088 1.00 32.31  ?  273  ILE B CG1   1 
ATOM   7055  C  CG2   . ILE B 2 276  ? 173.946 121.997 158.984 1.00 49.56  ?  273  ILE B CG2   1 
ATOM   7056  C  CD1   . ILE B 2 276  ? 175.698 123.200 161.373 1.00 33.82  ?  273  ILE B CD1   1 
ATOM   7057  N  N     . PHE B 2 277  ? 170.643 122.668 160.289 1.00 40.67  ?  274  PHE B N     1 
ATOM   7058  C  CA    . PHE B 2 277  ? 169.368 122.315 159.669 1.00 44.28  ?  274  PHE B CA    1 
ATOM   7059  C  C     . PHE B 2 277  ? 169.567 121.827 158.248 1.00 69.58  ?  274  PHE B C     1 
ATOM   7060  O  O     . PHE B 2 277  ? 169.095 120.747 157.881 1.00 92.01  ?  274  PHE B O     1 
ATOM   7061  C  CB    . PHE B 2 277  ? 168.399 123.499 159.681 1.00 47.09  ?  274  PHE B CB    1 
ATOM   7062  C  CG    . PHE B 2 277  ? 167.771 123.735 161.005 1.00 51.93  ?  274  PHE B CG    1 
ATOM   7063  C  CD1   . PHE B 2 277  ? 168.542 123.825 162.141 1.00 66.73  ?  274  PHE B CD1   1 
ATOM   7064  C  CD2   . PHE B 2 277  ? 166.396 123.792 161.128 1.00 67.92  ?  274  PHE B CD2   1 
ATOM   7065  C  CE1   . PHE B 2 277  ? 167.964 124.008 163.366 1.00 115.97 ?  274  PHE B CE1   1 
ATOM   7066  C  CE2   . PHE B 2 277  ? 165.812 123.974 162.361 1.00 123.02 ?  274  PHE B CE2   1 
ATOM   7067  C  CZ    . PHE B 2 277  ? 166.598 124.080 163.476 1.00 149.43 ?  274  PHE B CZ    1 
ATOM   7068  N  N     . GLY B 2 278  ? 170.265 122.611 157.438 1.00 82.68  ?  275  GLY B N     1 
ATOM   7069  C  CA    . GLY B 2 278  ? 170.415 122.308 156.033 1.00 109.17 ?  275  GLY B CA    1 
ATOM   7070  C  C     . GLY B 2 278  ? 169.233 122.824 155.250 1.00 72.56  ?  275  GLY B C     1 
ATOM   7071  O  O     . GLY B 2 278  ? 168.145 122.981 155.807 1.00 43.87  ?  275  GLY B O     1 
ATOM   7072  N  N     . GLY B 2 279  ? 169.440 123.133 153.977 1.00 58.91  ?  276  GLY B N     1 
ATOM   7073  C  CA    . GLY B 2 279  ? 168.340 123.448 153.092 1.00 46.46  ?  276  GLY B CA    1 
ATOM   7074  C  C     . GLY B 2 279  ? 167.670 122.208 152.541 1.00 47.79  ?  276  GLY B C     1 
ATOM   7075  O  O     . GLY B 2 279  ? 166.487 121.962 152.814 1.00 52.09  ?  276  GLY B O     1 
ATOM   7076  N  N     . TYR B 2 280  ? 168.402 121.407 151.775 1.00 50.92  ?  277  TYR B N     1 
ATOM   7077  C  CA    . TYR B 2 280  ? 167.782 120.348 150.988 1.00 54.00  ?  277  TYR B CA    1 
ATOM   7078  C  C     . TYR B 2 280  ? 168.678 119.116 150.902 1.00 59.54  ?  277  TYR B C     1 
ATOM   7079  O  O     . TYR B 2 280  ? 169.901 119.236 150.761 1.00 54.59  ?  277  TYR B O     1 
ATOM   7080  C  CB    . TYR B 2 280  ? 167.456 120.843 149.565 1.00 77.78  ?  277  TYR B CB    1 
ATOM   7081  C  CG    . TYR B 2 280  ? 166.680 122.142 149.513 1.00 95.28  ?  277  TYR B CG    1 
ATOM   7082  C  CD1   . TYR B 2 280  ? 167.334 123.365 149.602 1.00 101.31 ?  277  TYR B CD1   1 
ATOM   7083  C  CD2   . TYR B 2 280  ? 165.297 122.151 149.456 1.00 101.34 ?  277  TYR B CD2   1 
ATOM   7084  C  CE1   . TYR B 2 280  ? 166.636 124.567 149.562 1.00 104.39 ?  277  TYR B CE1   1 
ATOM   7085  C  CE2   . TYR B 2 280  ? 164.586 123.351 149.427 1.00 105.42 ?  277  TYR B CE2   1 
ATOM   7086  C  CZ    . TYR B 2 280  ? 165.263 124.551 149.481 1.00 105.74 ?  277  TYR B CZ    1 
ATOM   7087  O  OH    . TYR B 2 280  ? 164.578 125.743 149.454 1.00 80.96  ?  277  TYR B OH    1 
ATOM   7088  N  N     . GLN B 2 281  ? 168.064 117.934 150.953 1.00 61.24  ?  278  GLN B N     1 
ATOM   7089  C  CA    . GLN B 2 281  ? 168.826 116.709 150.734 1.00 54.31  ?  278  GLN B CA    1 
ATOM   7090  C  C     . GLN B 2 281  ? 169.199 116.540 149.264 1.00 58.14  ?  278  GLN B C     1 
ATOM   7091  O  O     . GLN B 2 281  ? 170.382 116.525 148.908 1.00 59.73  ?  278  GLN B O     1 
ATOM   7092  C  CB    . GLN B 2 281  ? 168.018 115.506 151.243 1.00 59.57  ?  278  GLN B CB    1 
ATOM   7093  C  CG    . GLN B 2 281  ? 168.519 114.154 150.743 1.00 63.75  ?  278  GLN B CG    1 
ATOM   7094  C  CD    . GLN B 2 281  ? 167.857 113.012 151.455 1.00 75.62  ?  278  GLN B CD    1 
ATOM   7095  O  OE1   . GLN B 2 281  ? 167.680 111.922 150.895 1.00 77.72  ?  278  GLN B OE1   1 
ATOM   7096  N  NE2   . GLN B 2 281  ? 167.454 113.226 152.719 1.00 72.42  ?  278  GLN B NE2   1 
ATOM   7097  N  N     . SER B 2 282  ? 168.192 116.466 148.392 1.00 61.89  ?  279  SER B N     1 
ATOM   7098  C  CA    . SER B 2 282  ? 168.355 116.331 146.946 1.00 79.54  ?  279  SER B CA    1 
ATOM   7099  C  C     . SER B 2 282  ? 167.618 117.450 146.209 1.00 92.39  ?  279  SER B C     1 
ATOM   7100  O  O     . SER B 2 282  ? 166.794 118.163 146.789 1.00 92.69  ?  279  SER B O     1 
ATOM   7101  C  CB    . SER B 2 282  ? 167.835 114.968 146.461 1.00 64.01  ?  279  SER B CB    1 
ATOM   7102  O  OG    . SER B 2 282  ? 167.674 114.937 145.054 1.00 71.12  ?  279  SER B OG    1 
ATOM   7103  N  N     . GLU B 2 283  ? 167.922 117.593 144.911 1.00 103.18 ?  280  GLU B N     1 
ATOM   7104  C  CA    . GLU B 2 283  ? 167.401 118.685 144.085 1.00 101.76 ?  280  GLU B CA    1 
ATOM   7105  C  C     . GLU B 2 283  ? 165.886 118.778 144.118 1.00 66.71  ?  280  GLU B C     1 
ATOM   7106  O  O     . GLU B 2 283  ? 165.324 119.864 143.900 1.00 57.25  ?  280  GLU B O     1 
ATOM   7107  C  CB    . GLU B 2 283  ? 167.871 118.513 142.634 1.00 122.72 ?  280  GLU B CB    1 
ATOM   7108  C  CG    . GLU B 2 283  ? 169.047 119.411 142.255 1.00 165.95 ?  280  GLU B CG    1 
ATOM   7109  C  CD    . GLU B 2 283  ? 169.952 118.799 141.187 1.00 215.11 ?  280  GLU B CD    1 
ATOM   7110  O  OE1   . GLU B 2 283  ? 169.772 117.606 140.862 1.00 212.08 ?  280  GLU B OE1   1 
ATOM   7111  O  OE2   . GLU B 2 283  ? 170.883 119.493 140.719 1.00 303.91 -1 280  GLU B OE2   1 
ATOM   7112  N  N     . THR B 2 284  ? 165.213 117.661 144.343 1.00 63.65  ?  281  THR B N     1 
ATOM   7113  C  CA    . THR B 2 284  ? 163.761 117.597 144.441 1.00 57.34  ?  281  THR B CA    1 
ATOM   7114  C  C     . THR B 2 284  ? 163.290 117.408 145.878 1.00 64.23  ?  281  THR B C     1 
ATOM   7115  O  O     . THR B 2 284  ? 162.535 118.230 146.396 1.00 70.84  ?  281  THR B O     1 
ATOM   7116  C  CB    . THR B 2 284  ? 163.266 116.462 143.539 1.00 69.01  ?  281  THR B CB    1 
ATOM   7117  O  OG1   . THR B 2 284  ? 163.265 115.239 144.282 1.00 95.12  ?  281  THR B OG1   1 
ATOM   7118  C  CG2   . THR B 2 284  ? 164.180 116.320 142.320 1.00 63.10  ?  281  THR B CG2   1 
ATOM   7119  N  N     . GLN B 2 285  ? 163.764 116.369 146.558 1.00 71.26  ?  282  GLN B N     1 
ATOM   7120  C  CA    . GLN B 2 285  ? 163.266 116.025 147.888 1.00 83.08  ?  282  GLN B CA    1 
ATOM   7121  C  C     . GLN B 2 285  ? 164.135 116.716 148.938 1.00 83.81  ?  282  GLN B C     1 
ATOM   7122  O  O     . GLN B 2 285  ? 165.269 116.308 149.200 1.00 76.72  ?  282  GLN B O     1 
ATOM   7123  C  CB    . GLN B 2 285  ? 163.237 114.506 148.079 1.00 93.63  ?  282  GLN B CB    1 
ATOM   7124  C  CG    . GLN B 2 285  ? 162.435 114.030 149.294 1.00 91.86  ?  282  GLN B CG    1 
ATOM   7125  C  CD    . GLN B 2 285  ? 163.287 113.607 150.474 1.00 104.20 ?  282  GLN B CD    1 
ATOM   7126  O  OE1   . GLN B 2 285  ? 164.190 114.329 150.899 1.00 108.99 ?  282  GLN B OE1   1 
ATOM   7127  N  NE2   . GLN B 2 285  ? 162.975 112.444 151.040 1.00 103.18 ?  282  GLN B NE2   1 
ATOM   7128  N  N     . LYS B 2 286  ? 163.593 117.775 149.538 1.00 77.27  ?  283  LYS B N     1 
ATOM   7129  C  CA    . LYS B 2 286  ? 164.276 118.504 150.597 1.00 65.80  ?  283  LYS B CA    1 
ATOM   7130  C  C     . LYS B 2 286  ? 164.437 117.626 151.829 1.00 76.17  ?  283  LYS B C     1 
ATOM   7131  O  O     . LYS B 2 286  ? 163.543 116.853 152.180 1.00 97.71  ?  283  LYS B O     1 
ATOM   7132  C  CB    . LYS B 2 286  ? 163.477 119.748 150.983 1.00 48.11  ?  283  LYS B CB    1 
ATOM   7133  C  CG    . LYS B 2 286  ? 161.971 119.524 150.888 1.00 45.20  ?  283  LYS B CG    1 
ATOM   7134  C  CD    . LYS B 2 286  ? 161.190 120.400 151.839 1.00 29.86  ?  283  LYS B CD    1 
ATOM   7135  C  CE    . LYS B 2 286  ? 159.751 119.942 151.897 1.00 52.23  ?  283  LYS B CE    1 
ATOM   7136  N  NZ    . LYS B 2 286  ? 159.083 120.185 150.588 1.00 61.12  ?  283  LYS B NZ    1 
ATOM   7137  N  N     . ARG B 2 287  ? 165.570 117.767 152.511 1.00 61.86  ?  284  ARG B N     1 
ATOM   7138  C  CA    . ARG B 2 287  ? 165.684 117.163 153.829 1.00 68.83  ?  284  ARG B CA    1 
ATOM   7139  C  C     . ARG B 2 287  ? 164.739 117.871 154.806 1.00 86.41  ?  284  ARG B C     1 
ATOM   7140  O  O     . ARG B 2 287  ? 164.303 119.003 154.580 1.00 80.55  ?  284  ARG B O     1 
ATOM   7141  C  CB    . ARG B 2 287  ? 167.131 117.221 154.316 1.00 41.74  ?  284  ARG B CB    1 
ATOM   7142  C  CG    . ARG B 2 287  ? 167.478 118.546 154.942 1.00 53.89  ?  284  ARG B CG    1 
ATOM   7143  C  CD    . ARG B 2 287  ? 168.758 118.472 155.728 1.00 65.55  ?  284  ARG B CD    1 
ATOM   7144  N  NE    . ARG B 2 287  ? 168.722 117.425 156.743 1.00 76.62  ?  284  ARG B NE    1 
ATOM   7145  C  CZ    . ARG B 2 287  ? 169.788 116.997 157.410 1.00 82.09  ?  284  ARG B CZ    1 
ATOM   7146  N  NH1   . ARG B 2 287  ? 170.977 117.551 157.196 1.00 60.10  ?  284  ARG B NH1   1 
ATOM   7147  N  NH2   . ARG B 2 287  ? 169.663 116.039 158.313 1.00 93.24  ?  284  ARG B NH2   1 
ATOM   7148  N  N     . MET B 2 288  ? 164.409 117.183 155.900 1.00 102.21 ?  285  MET B N     1 
ATOM   7149  C  CA    . MET B 2 288  ? 163.442 117.691 156.873 1.00 102.32 ?  285  MET B CA    1 
ATOM   7150  C  C     . MET B 2 288  ? 163.993 117.691 158.293 1.00 104.41 ?  285  MET B C     1 
ATOM   7151  O  O     . MET B 2 288  ? 163.545 118.473 159.138 1.00 90.29  ?  285  MET B O     1 
ATOM   7152  C  CB    . MET B 2 288  ? 162.153 116.862 156.834 1.00 100.06 ?  285  MET B CB    1 
ATOM   7153  C  CG    . MET B 2 288  ? 161.684 116.466 155.448 1.00 117.41 ?  285  MET B CG    1 
ATOM   7154  S  SD    . MET B 2 288  ? 160.643 117.746 154.715 1.00 83.44  ?  285  MET B SD    1 
ATOM   7155  C  CE    . MET B 2 288  ? 159.417 117.897 156.007 1.00 75.25  ?  285  MET B CE    1 
ATOM   7156  N  N     . GLU B 2 289  ? 164.968 116.824 158.563 1.00 121.66 ?  286  GLU B N     1 
ATOM   7157  C  CA    . GLU B 2 289  ? 165.417 116.555 159.924 1.00 130.08 ?  286  GLU B CA    1 
ATOM   7158  C  C     . GLU B 2 289  ? 166.436 117.582 160.397 1.00 110.03 ?  286  GLU B C     1 
ATOM   7159  O  O     . GLU B 2 289  ? 166.657 118.606 159.741 1.00 101.38 ?  286  GLU B O     1 
ATOM   7160  C  CB    . GLU B 2 289  ? 166.020 115.151 160.004 1.00 146.12 ?  286  GLU B CB    1 
ATOM   7161  C  CG    . GLU B 2 289  ? 166.686 114.733 158.700 1.00 147.11 ?  286  GLU B CG    1 
ATOM   7162  C  CD    . GLU B 2 289  ? 167.581 113.519 158.848 1.00 186.95 ?  286  GLU B CD    1 
ATOM   7163  O  OE1   . GLU B 2 289  ? 168.297 113.418 159.868 1.00 173.79 ?  286  GLU B OE1   1 
ATOM   7164  O  OE2   . GLU B 2 289  ? 167.598 112.682 157.921 1.00 277.70 -1 286  GLU B OE2   1 
ATOM   7165  N  N     . CYS B 2 290  ? 167.049 117.306 161.545 1.00 96.37  ?  287  CYS B N     1 
ATOM   7166  C  CA    . CYS B 2 290  ? 168.095 118.123 162.143 1.00 79.71  ?  287  CYS B CA    1 
ATOM   7167  C  C     . CYS B 2 290  ? 169.447 117.435 161.947 1.00 74.95  ?  287  CYS B C     1 
ATOM   7168  O  O     . CYS B 2 290  ? 169.541 116.351 161.366 1.00 80.18  ?  287  CYS B O     1 
ATOM   7169  C  CB    . CYS B 2 290  ? 167.794 118.355 163.627 1.00 79.26  ?  287  CYS B CB    1 
ATOM   7170  S  SG    . CYS B 2 290  ? 166.046 118.637 163.984 1.00 83.28  ?  287  CYS B SG    1 
ATOM   7171  N  N     . THR B 2 291  ? 170.509 118.086 162.421 1.00 64.88  ?  288  THR B N     1 
ATOM   7172  C  CA    . THR B 2 291  ? 171.824 117.461 162.482 1.00 52.88  ?  288  THR B CA    1 
ATOM   7173  C  C     . THR B 2 291  ? 172.627 118.155 163.572 1.00 48.68  ?  288  THR B C     1 
ATOM   7174  O  O     . THR B 2 291  ? 172.529 119.368 163.734 1.00 53.01  ?  288  THR B O     1 
ATOM   7175  C  CB    . THR B 2 291  ? 172.565 117.550 161.139 1.00 46.64  ?  288  THR B CB    1 
ATOM   7176  O  OG1   . THR B 2 291  ? 171.829 116.843 160.135 1.00 56.73  ?  288  THR B OG1   1 
ATOM   7177  C  CG2   . THR B 2 291  ? 173.958 116.942 161.249 1.00 42.87  ?  288  THR B CG2   1 
ATOM   7178  N  N     . TYR B 2 292  ? 173.402 117.383 164.323 1.00 68.00  ?  289  TYR B N     1 
ATOM   7179  C  CA    . TYR B 2 292  ? 174.293 117.909 165.342 1.00 80.78  ?  289  TYR B CA    1 
ATOM   7180  C  C     . TYR B 2 292  ? 175.703 117.483 164.983 1.00 67.28  ?  289  TYR B C     1 
ATOM   7181  O  O     . TYR B 2 292  ? 175.937 116.307 164.674 1.00 75.47  ?  289  TYR B O     1 
ATOM   7182  C  CB    . TYR B 2 292  ? 173.902 117.401 166.740 1.00 113.41 ?  289  TYR B CB    1 
ATOM   7183  C  CG    . TYR B 2 292  ? 174.963 117.558 167.820 1.00 106.22 ?  289  TYR B CG    1 
ATOM   7184  C  CD1   . TYR B 2 292  ? 176.020 116.660 167.929 1.00 100.40 ?  289  TYR B CD1   1 
ATOM   7185  C  CD2   . TYR B 2 292  ? 174.901 118.600 168.733 1.00 104.36 ?  289  TYR B CD2   1 
ATOM   7186  C  CE1   . TYR B 2 292  ? 176.978 116.800 168.905 1.00 110.48 ?  289  TYR B CE1   1 
ATOM   7187  C  CE2   . TYR B 2 292  ? 175.861 118.746 169.715 1.00 113.61 ?  289  TYR B CE2   1 
ATOM   7188  C  CZ    . TYR B 2 292  ? 176.896 117.842 169.795 1.00 131.72 ?  289  TYR B CZ    1 
ATOM   7189  O  OH    . TYR B 2 292  ? 177.856 117.977 170.770 1.00 167.80 ?  289  TYR B OH    1 
ATOM   7190  N  N     . VAL B 2 293  ? 176.640 118.425 165.037 1.00 55.94  ?  290  VAL B N     1 
ATOM   7191  C  CA    . VAL B 2 293  ? 178.029 118.133 164.728 1.00 45.41  ?  290  VAL B CA    1 
ATOM   7192  C  C     . VAL B 2 293  ? 178.888 118.713 165.836 1.00 54.88  ?  290  VAL B C     1 
ATOM   7193  O  O     . VAL B 2 293  ? 178.920 119.937 166.035 1.00 57.89  ?  290  VAL B O     1 
ATOM   7194  C  CB    . VAL B 2 293  ? 178.455 118.681 163.363 1.00 48.93  ?  290  VAL B CB    1 
ATOM   7195  C  CG1   . VAL B 2 293  ? 179.955 118.939 163.340 1.00 47.42  ?  290  VAL B CG1   1 
ATOM   7196  C  CG2   . VAL B 2 293  ? 178.062 117.706 162.287 1.00 79.33  ?  290  VAL B CG2   1 
ATOM   7197  N  N     . GLY B 2 294  ? 179.545 117.837 166.584 1.00 85.69  ?  291  GLY B N     1 
ATOM   7198  C  CA    . GLY B 2 294  ? 180.683 118.251 167.360 1.00 103.66 ?  291  GLY B CA    1 
ATOM   7199  C  C     . GLY B 2 294  ? 181.953 118.193 166.541 1.00 99.46  ?  291  GLY B C     1 
ATOM   7200  O  O     . GLY B 2 294  ? 182.028 117.529 165.506 1.00 96.21  ?  291  GLY B O     1 
ATOM   7201  N  N     . LEU B 2 295  ? 182.974 118.896 167.014 1.00 85.81  ?  292  LEU B N     1 
ATOM   7202  C  CA    . LEU B 2 295  ? 184.220 118.957 166.270 1.00 76.35  ?  292  LEU B CA    1 
ATOM   7203  C  C     . LEU B 2 295  ? 185.329 119.451 167.179 1.00 87.52  ?  292  LEU B C     1 
ATOM   7204  O  O     . LEU B 2 295  ? 185.122 120.330 168.021 1.00 97.09  ?  292  LEU B O     1 
ATOM   7205  C  CB    . LEU B 2 295  ? 184.111 119.879 165.052 1.00 66.37  ?  292  LEU B CB    1 
ATOM   7206  C  CG    . LEU B 2 295  ? 183.605 121.282 165.376 1.00 48.73  ?  292  LEU B CG    1 
ATOM   7207  C  CD1   . LEU B 2 295  ? 184.168 122.276 164.388 1.00 68.15  ?  292  LEU B CD1   1 
ATOM   7208  C  CD2   . LEU B 2 295  ? 182.085 121.322 165.338 1.00 73.47  ?  292  LEU B CD2   1 
ATOM   7209  N  N     . ASP B 2 296  ? 186.507 118.891 166.975 1.00 104.11 ?  293  ASP B N     1 
ATOM   7210  C  CA    . ASP B 2 296  ? 187.736 119.309 167.639 1.00 136.58 ?  293  ASP B CA    1 
ATOM   7211  C  C     . ASP B 2 296  ? 188.876 118.676 166.853 1.00 151.94 ?  293  ASP B C     1 
ATOM   7212  O  O     . ASP B 2 296  ? 188.665 118.128 165.763 1.00 139.60 ?  293  ASP B O     1 
ATOM   7213  C  CB    . ASP B 2 296  ? 187.741 118.913 169.116 1.00 153.96 ?  293  ASP B CB    1 
ATOM   7214  C  CG    . ASP B 2 296  ? 188.682 119.768 169.946 1.00 204.78 ?  293  ASP B CG    1 
ATOM   7215  O  OD1   . ASP B 2 296  ? 189.822 120.030 169.502 1.00 184.94 ?  293  ASP B OD1   1 
ATOM   7216  O  OD2   . ASP B 2 296  ? 188.265 120.199 171.040 1.00 381.11 -1 293  ASP B OD2   1 
ATOM   7217  N  N     . ASP B 2 297  ? 190.089 118.754 167.399 1.00 167.67 ?  294  ASP B N     1 
ATOM   7218  C  CA    . ASP B 2 297  ? 191.223 118.089 166.773 1.00 177.73 ?  294  ASP B CA    1 
ATOM   7219  C  C     . ASP B 2 297  ? 191.012 116.585 166.641 1.00 179.91 ?  294  ASP B C     1 
ATOM   7220  O  O     . ASP B 2 297  ? 191.738 115.939 165.878 1.00 185.96 ?  294  ASP B O     1 
ATOM   7221  C  CB    . ASP B 2 297  ? 192.498 118.386 167.565 1.00 157.06 ?  294  ASP B CB    1 
ATOM   7222  C  CG    . ASP B 2 297  ? 192.467 117.804 168.963 1.00 185.69 ?  294  ASP B CG    1 
ATOM   7223  O  OD1   . ASP B 2 297  ? 191.365 117.634 169.527 1.00 182.96 ?  294  ASP B OD1   1 
ATOM   7224  O  OD2   . ASP B 2 297  ? 193.553 117.520 169.505 1.00 295.95 -1 294  ASP B OD2   1 
ATOM   7225  N  N     . VAL B 2 298  ? 190.038 116.020 167.357 1.00 155.45 ?  295  VAL B N     1 
ATOM   7226  C  CA    . VAL B 2 298  ? 189.608 114.649 167.098 1.00 131.46 ?  295  VAL B CA    1 
ATOM   7227  C  C     . VAL B 2 298  ? 188.952 114.561 165.725 1.00 117.77 ?  295  VAL B C     1 
ATOM   7228  O  O     . VAL B 2 298  ? 189.362 113.773 164.865 1.00 108.40 ?  295  VAL B O     1 
ATOM   7229  C  CB    . VAL B 2 298  ? 188.653 114.167 168.204 1.00 111.51 ?  295  VAL B CB    1 
ATOM   7230  C  CG1   . VAL B 2 298  ? 188.377 112.677 168.065 1.00 112.07 ?  295  VAL B CG1   1 
ATOM   7231  C  CG2   . VAL B 2 298  ? 189.211 114.502 169.581 1.00 114.44 ?  295  VAL B CG2   1 
ATOM   7232  N  N     . GLY B 2 299  ? 187.928 115.369 165.506 1.00 114.41 ?  296  GLY B N     1 
ATOM   7233  C  CA    . GLY B 2 299  ? 187.221 115.394 164.244 1.00 98.89  ?  296  GLY B CA    1 
ATOM   7234  C  C     . GLY B 2 299  ? 185.747 115.662 164.483 1.00 95.15  ?  296  GLY B C     1 
ATOM   7235  O  O     . GLY B 2 299  ? 185.328 115.998 165.586 1.00 104.82 ?  296  GLY B O     1 
ATOM   7236  N  N     . VAL B 2 300  ? 184.969 115.500 163.416 1.00 86.89  ?  297  VAL B N     1 
ATOM   7237  C  CA    . VAL B 2 300  ? 183.524 115.673 163.489 1.00 84.03  ?  297  VAL B CA    1 
ATOM   7238  C  C     . VAL B 2 300  ? 182.887 114.442 164.121 1.00 94.10  ?  297  VAL B C     1 
ATOM   7239  O  O     . VAL B 2 300  ? 183.165 113.306 163.724 1.00 101.34 ?  297  VAL B O     1 
ATOM   7240  C  CB    . VAL B 2 300  ? 182.935 115.940 162.096 1.00 97.32  ?  297  VAL B CB    1 
ATOM   7241  C  CG1   . VAL B 2 300  ? 183.497 114.955 161.084 1.00 104.93 ?  297  VAL B CG1   1 
ATOM   7242  C  CG2   . VAL B 2 300  ? 181.417 115.822 162.144 1.00 69.01  ?  297  VAL B CG2   1 
ATOM   7243  N  N     . HIS B 2 301  ? 182.020 114.669 165.101 1.00 97.98  ?  298  HIS B N     1 
ATOM   7244  C  CA    . HIS B 2 301  ? 181.186 113.624 165.668 1.00 107.39 ?  298  HIS B CA    1 
ATOM   7245  C  C     . HIS B 2 301  ? 179.733 113.947 165.359 1.00 91.97  ?  298  HIS B C     1 
ATOM   7246  O  O     . HIS B 2 301  ? 179.288 115.087 165.548 1.00 88.38  ?  298  HIS B O     1 
ATOM   7247  C  CB    . HIS B 2 301  ? 181.416 113.480 167.174 1.00 137.57 ?  298  HIS B CB    1 
ATOM   7248  C  CG    . HIS B 2 301  ? 182.855 113.291 167.547 1.00 157.71 ?  298  HIS B CG    1 
ATOM   7249  N  ND1   . HIS B 2 301  ? 183.831 114.226 167.271 1.00 139.43 ?  298  HIS B ND1   1 
ATOM   7250  C  CD2   . HIS B 2 301  ? 183.488 112.256 168.148 1.00 163.01 ?  298  HIS B CD2   1 
ATOM   7251  C  CE1   . HIS B 2 301  ? 184.997 113.784 167.705 1.00 135.12 ?  298  HIS B CE1   1 
ATOM   7252  N  NE2   . HIS B 2 301  ? 184.817 112.590 168.239 1.00 143.29 ?  298  HIS B NE2   1 
ATOM   7253  N  N     . MET B 2 302  ? 179.010 112.950 164.870 1.00 85.29  ?  299  MET B N     1 
ATOM   7254  C  CA    . MET B 2 302  ? 177.677 113.147 164.335 1.00 91.55  ?  299  MET B CA    1 
ATOM   7255  C  C     . MET B 2 302  ? 176.614 112.907 165.395 1.00 87.01  ?  299  MET B C     1 
ATOM   7256  O  O     . MET B 2 302  ? 176.850 112.256 166.414 1.00 86.92  ?  299  MET B O     1 
ATOM   7257  C  CB    . MET B 2 302  ? 177.434 112.210 163.152 1.00 112.62 ?  299  MET B CB    1 
ATOM   7258  C  CG    . MET B 2 302  ? 176.341 112.693 162.234 1.00 133.87 ?  299  MET B CG    1 
ATOM   7259  S  SD    . MET B 2 302  ? 176.589 114.432 161.837 1.00 164.29 ?  299  MET B SD    1 
ATOM   7260  C  CE    . MET B 2 302  ? 178.232 114.370 161.115 1.00 137.29 ?  299  MET B CE    1 
ATOM   7261  N  N     . GLU B 2 303  ? 175.425 113.442 165.130 1.00 82.66  ?  300  GLU B N     1 
ATOM   7262  C  CA    . GLU B 2 303  ? 174.239 113.136 165.914 1.00 74.86  ?  300  GLU B CA    1 
ATOM   7263  C  C     . GLU B 2 303  ? 173.022 113.621 165.134 1.00 78.49  ?  300  GLU B C     1 
ATOM   7264  O  O     . GLU B 2 303  ? 173.121 114.548 164.325 1.00 79.66  ?  300  GLU B O     1 
ATOM   7265  C  CB    . GLU B 2 303  ? 174.326 113.790 167.304 1.00 86.34  ?  300  GLU B CB    1 
ATOM   7266  C  CG    . GLU B 2 303  ? 173.305 113.341 168.336 1.00 126.99 ?  300  GLU B CG    1 
ATOM   7267  C  CD    . GLU B 2 303  ? 172.005 114.110 168.246 1.00 153.85 ?  300  GLU B CD    1 
ATOM   7268  O  OE1   . GLU B 2 303  ? 171.937 115.076 167.463 1.00 125.06 ?  300  GLU B OE1   1 
ATOM   7269  O  OE2   . GLU B 2 303  ? 171.054 113.758 168.975 1.00 276.90 -1 300  GLU B OE2   1 
ATOM   7270  N  N     . SER B 2 304  ? 171.880 112.977 165.371 1.00 92.49  ?  301  SER B N     1 
ATOM   7271  C  CA    . SER B 2 304  ? 170.592 113.371 164.795 1.00 85.01  ?  301  SER B CA    1 
ATOM   7272  C  C     . SER B 2 304  ? 169.620 113.625 165.945 1.00 98.61  ?  301  SER B C     1 
ATOM   7273  O  O     . SER B 2 304  ? 168.990 112.695 166.448 1.00 115.37 ?  301  SER B O     1 
ATOM   7274  C  CB    . SER B 2 304  ? 170.055 112.293 163.844 1.00 75.67  ?  301  SER B CB    1 
ATOM   7275  O  OG    . SER B 2 304  ? 168.640 112.348 163.756 1.00 70.19  ?  301  SER B OG    1 
ATOM   7276  N  N     . ARG B 2 305  ? 169.488 114.882 166.357 1.00 99.35  ?  302  ARG B N     1 
ATOM   7277  C  CA    . ARG B 2 305  ? 168.620 115.226 167.479 1.00 104.31 ?  302  ARG B CA    1 
ATOM   7278  C  C     . ARG B 2 305  ? 167.151 115.094 167.074 1.00 102.14 ?  302  ARG B C     1 
ATOM   7279  O  O     . ARG B 2 305  ? 166.804 114.679 165.964 1.00 86.21  ?  302  ARG B O     1 
ATOM   7280  C  CB    . ARG B 2 305  ? 168.933 116.624 168.004 1.00 118.65 ?  302  ARG B CB    1 
ATOM   7281  C  CG    . ARG B 2 305  ? 169.915 116.689 169.180 1.00 133.40 ?  302  ARG B CG    1 
ATOM   7282  C  CD    . ARG B 2 305  ? 169.401 115.892 170.384 1.00 149.70 ?  302  ARG B CD    1 
ATOM   7283  N  NE    . ARG B 2 305  ? 168.390 116.621 171.156 1.00 141.57 ?  302  ARG B NE    1 
ATOM   7284  C  CZ    . ARG B 2 305  ? 168.114 116.403 172.440 1.00 125.68 ?  302  ARG B CZ    1 
ATOM   7285  N  NH1   . ARG B 2 305  ? 167.173 117.114 173.048 1.00 111.19 ?  302  ARG B NH1   1 
ATOM   7286  N  NH2   . ARG B 2 305  ? 168.761 115.461 173.114 1.00 120.77 ?  302  ARG B NH2   1 
ATOM   7287  N  N     . GLU B 2 306  ? 166.269 115.455 167.992 1.00 129.92 ?  303  GLU B N     1 
ATOM   7288  C  CA    . GLU B 2 306  ? 164.843 115.310 167.752 1.00 150.88 ?  303  GLU B CA    1 
ATOM   7289  C  C     . GLU B 2 306  ? 164.392 116.302 166.686 1.00 144.80 ?  303  GLU B C     1 
ATOM   7290  O  O     . GLU B 2 306  ? 164.667 117.503 166.806 1.00 126.65 ?  303  GLU B O     1 
ATOM   7291  C  CB    . GLU B 2 306  ? 164.069 115.527 169.052 1.00 179.06 ?  303  GLU B CB    1 
ATOM   7292  C  CG    . GLU B 2 306  ? 162.566 115.486 168.887 1.00 225.32 ?  303  GLU B CG    1 
ATOM   7293  C  CD    . GLU B 2 306  ? 162.016 114.075 168.906 1.00 255.74 ?  303  GLU B CD    1 
ATOM   7294  O  OE1   . GLU B 2 306  ? 162.775 113.140 169.230 1.00 234.71 ?  303  GLU B OE1   1 
ATOM   7295  O  OE2   . GLU B 2 306  ? 160.826 113.903 168.568 1.00 384.34 -1 303  GLU B OE2   1 
ATOM   7296  N  N     . PRO B 2 307  ? 163.732 115.849 165.626 1.00 147.69 ?  304  PRO B N     1 
ATOM   7297  C  CA    . PRO B 2 307  ? 163.149 116.785 164.661 1.00 128.80 ?  304  PRO B CA    1 
ATOM   7298  C  C     . PRO B 2 307  ? 161.870 117.398 165.201 1.00 128.07 ?  304  PRO B C     1 
ATOM   7299  O  O     . PRO B 2 307  ? 160.880 116.686 165.431 1.00 131.12 ?  304  PRO B O     1 
ATOM   7300  C  CB    . PRO B 2 307  ? 162.879 115.901 163.437 1.00 119.48 ?  304  PRO B CB    1 
ATOM   7301  C  CG    . PRO B 2 307  ? 162.647 114.540 164.013 1.00 127.19 ?  304  PRO B CG    1 
ATOM   7302  C  CD    . PRO B 2 307  ? 163.556 114.444 165.213 1.00 147.45 ?  304  PRO B CD    1 
ATOM   7303  N  N     . PRO B 2 308  ? 161.847 118.714 165.421 1.00 105.56 ?  305  PRO B N     1 
ATOM   7304  C  CA    . PRO B 2 308  ? 160.605 119.355 165.867 1.00 98.36  ?  305  PRO B CA    1 
ATOM   7305  C  C     . PRO B 2 308  ? 159.489 119.096 164.866 1.00 114.56 ?  305  PRO B C     1 
ATOM   7306  O  O     . PRO B 2 308  ? 159.716 119.031 163.656 1.00 115.12 ?  305  PRO B O     1 
ATOM   7307  C  CB    . PRO B 2 308  ? 160.972 120.842 165.938 1.00 76.81  ?  305  PRO B CB    1 
ATOM   7308  C  CG    . PRO B 2 308  ? 162.457 120.859 166.046 1.00 65.24  ?  305  PRO B CG    1 
ATOM   7309  C  CD    . PRO B 2 308  ? 162.931 119.692 165.240 1.00 80.05  ?  305  PRO B CD    1 
ATOM   7310  N  N     . GLN B 2 309  ? 158.276 118.937 165.384 1.00 119.46 ?  306  GLN B N     1 
ATOM   7311  C  CA    . GLN B 2 309  ? 157.144 118.507 164.568 1.00 137.69 ?  306  GLN B CA    1 
ATOM   7312  C  C     . GLN B 2 309  ? 156.788 119.602 163.566 1.00 137.17 ?  306  GLN B C     1 
ATOM   7313  O  O     . GLN B 2 309  ? 156.182 120.616 163.914 1.00 122.70 ?  306  GLN B O     1 
ATOM   7314  C  CB    . GLN B 2 309  ? 155.956 118.132 165.455 1.00 125.25 ?  306  GLN B CB    1 
ATOM   7315  C  CG    . GLN B 2 309  ? 155.483 119.185 166.473 1.00 121.95 ?  306  GLN B CG    1 
ATOM   7316  C  CD    . GLN B 2 309  ? 156.446 119.402 167.628 1.00 122.59 ?  306  GLN B CD    1 
ATOM   7317  O  OE1   . GLN B 2 309  ? 157.552 119.910 167.442 1.00 105.06 ?  306  GLN B OE1   1 
ATOM   7318  N  NE2   . GLN B 2 309  ? 156.030 119.009 168.826 1.00 135.42 ?  306  GLN B NE2   1 
ATOM   7319  N  N     . TRP B 2 310  ? 157.182 119.399 162.308 1.00 132.15 ?  307  TRP B N     1 
ATOM   7320  C  CA    . TRP B 2 310  ? 156.841 120.352 161.260 1.00 109.07 ?  307  TRP B CA    1 
ATOM   7321  C  C     . TRP B 2 310  ? 155.332 120.421 161.061 1.00 115.69 ?  307  TRP B C     1 
ATOM   7322  O  O     . TRP B 2 310  ? 154.617 119.427 161.205 1.00 119.64 ?  307  TRP B O     1 
ATOM   7323  C  CB    . TRP B 2 310  ? 157.526 119.974 159.939 1.00 102.00 ?  307  TRP B CB    1 
ATOM   7324  C  CG    . TRP B 2 310  ? 159.025 119.792 160.005 1.00 98.36  ?  307  TRP B CG    1 
ATOM   7325  C  CD1   . TRP B 2 310  ? 159.755 118.824 159.377 1.00 86.97  ?  307  TRP B CD1   1 
ATOM   7326  C  CD2   . TRP B 2 310  ? 159.974 120.616 160.701 1.00 105.96 ?  307  TRP B CD2   1 
ATOM   7327  N  NE1   . TRP B 2 310  ? 161.091 118.979 159.654 1.00 85.44  ?  307  TRP B NE1   1 
ATOM   7328  C  CE2   . TRP B 2 310  ? 161.253 120.071 160.462 1.00 89.38  ?  307  TRP B CE2   1 
ATOM   7329  C  CE3   . TRP B 2 310  ? 159.868 121.755 161.509 1.00 103.32 ?  307  TRP B CE3   1 
ATOM   7330  C  CZ2   . TRP B 2 310  ? 162.409 120.623 161.000 1.00 83.80  ?  307  TRP B CZ2   1 
ATOM   7331  C  CZ3   . TRP B 2 310  ? 161.013 122.298 162.041 1.00 94.60  ?  307  TRP B CZ3   1 
ATOM   7332  C  CH2   . TRP B 2 310  ? 162.270 121.734 161.785 1.00 93.53  ?  307  TRP B CH2   1 
ATOM   7333  N  N     . THR B 2 311  ? 154.850 121.617 160.738 1.00 117.37 ?  308  THR B N     1 
ATOM   7334  C  CA    . THR B 2 311  ? 153.470 121.783 160.313 1.00 129.76 ?  308  THR B CA    1 
ATOM   7335  C  C     . THR B 2 311  ? 153.260 121.071 158.973 1.00 138.26 ?  308  THR B C     1 
ATOM   7336  O  O     . THR B 2 311  ? 154.209 120.636 158.312 1.00 137.19 ?  308  THR B O     1 
ATOM   7337  C  CB    . THR B 2 311  ? 153.127 123.273 160.219 1.00 111.67 ?  308  THR B CB    1 
ATOM   7338  O  OG1   . THR B 2 311  ? 153.765 123.974 161.294 1.00 109.24 ?  308  THR B OG1   1 
ATOM   7339  C  CG2   . THR B 2 311  ? 151.626 123.501 160.323 1.00 110.76 ?  308  THR B CG2   1 
ATOM   7340  N  N     . SER B 2 312  ? 151.991 120.930 158.583 1.00 135.51 ?  309  SER B N     1 
ATOM   7341  C  CA    . SER B 2 312  ? 151.663 120.246 157.336 1.00 135.30 ?  309  SER B CA    1 
ATOM   7342  C  C     . SER B 2 312  ? 152.239 120.983 156.130 1.00 123.46 ?  309  SER B C     1 
ATOM   7343  O  O     . SER B 2 312  ? 152.785 120.364 155.208 1.00 124.50 ?  309  SER B O     1 
ATOM   7344  C  CB    . SER B 2 312  ? 150.147 120.096 157.209 1.00 131.40 ?  309  SER B CB    1 
ATOM   7345  O  OG    . SER B 2 312  ? 149.483 121.310 157.522 1.00 125.46 ?  309  SER B OG    1 
ATOM   7346  N  N     . GLU B 2 313  ? 152.124 122.309 156.120 1.00 111.37 ?  310  GLU B N     1 
ATOM   7347  C  CA    . GLU B 2 313  ? 152.564 123.087 154.967 1.00 103.97 ?  310  GLU B CA    1 
ATOM   7348  C  C     . GLU B 2 313  ? 154.075 122.990 154.764 1.00 104.66 ?  310  GLU B C     1 
ATOM   7349  O  O     . GLU B 2 313  ? 154.540 122.695 153.658 1.00 110.13 ?  310  GLU B O     1 
ATOM   7350  C  CB    . GLU B 2 313  ? 152.121 124.540 155.126 1.00 114.97 ?  310  GLU B CB    1 
ATOM   7351  C  CG    . GLU B 2 313  ? 152.372 125.112 156.504 1.00 119.19 ?  310  GLU B CG    1 
ATOM   7352  C  CD    . GLU B 2 313  ? 151.860 126.527 156.636 1.00 143.53 ?  310  GLU B CD    1 
ATOM   7353  O  OE1   . GLU B 2 313  ? 150.742 126.815 156.155 1.00 125.94 ?  310  GLU B OE1   1 
ATOM   7354  O  OE2   . GLU B 2 313  ? 152.580 127.350 157.230 1.00 252.51 -1 310  GLU B OE2   1 
ATOM   7355  N  N     . ILE B 2 314  ? 154.860 123.236 155.821 1.00 90.86  ?  311  ILE B N     1 
ATOM   7356  C  CA    . ILE B 2 314  ? 156.321 123.201 155.712 1.00 66.75  ?  311  ILE B CA    1 
ATOM   7357  C  C     . ILE B 2 314  ? 156.808 121.820 155.300 1.00 67.57  ?  311  ILE B C     1 
ATOM   7358  O  O     . ILE B 2 314  ? 157.808 121.689 154.581 1.00 63.03  ?  311  ILE B O     1 
ATOM   7359  C  CB    . ILE B 2 314  ? 156.976 123.661 157.033 1.00 61.08  ?  311  ILE B CB    1 
ATOM   7360  C  CG1   . ILE B 2 314  ? 158.475 123.341 157.046 1.00 56.29  ?  311  ILE B CG1   1 
ATOM   7361  C  CG2   . ILE B 2 314  ? 156.283 123.062 158.224 1.00 72.33  ?  311  ILE B CG2   1 
ATOM   7362  C  CD1   . ILE B 2 314  ? 159.210 123.881 158.259 1.00 73.26  ?  311  ILE B CD1   1 
ATOM   7363  N  N     . SER B 2 315  ? 156.115 120.772 155.739 1.00 93.69  ?  312  SER B N     1 
ATOM   7364  C  CA    . SER B 2 315  ? 156.432 119.427 155.273 1.00 108.00 ?  312  SER B CA    1 
ATOM   7365  C  C     . SER B 2 315  ? 156.028 119.232 153.816 1.00 129.50 ?  312  SER B C     1 
ATOM   7366  O  O     . SER B 2 315  ? 156.640 118.420 153.111 1.00 114.13 ?  312  SER B O     1 
ATOM   7367  C  CB    . SER B 2 315  ? 155.750 118.389 156.171 1.00 103.32 ?  312  SER B CB    1 
ATOM   7368  O  OG    . SER B 2 315  ? 155.998 117.062 155.736 1.00 89.05  ?  312  SER B OG    1 
ATOM   7369  N  N     . HIS B 2 316  ? 155.009 119.964 153.349 1.00 135.67 ?  313  HIS B N     1 
ATOM   7370  C  CA    . HIS B 2 316  ? 154.495 119.819 151.989 1.00 127.77 ?  313  HIS B CA    1 
ATOM   7371  C  C     . HIS B 2 316  ? 154.837 120.984 151.064 1.00 123.87 ?  313  HIS B C     1 
ATOM   7372  O  O     . HIS B 2 316  ? 154.537 120.905 149.868 1.00 115.99 ?  313  HIS B O     1 
ATOM   7373  C  CB    . HIS B 2 316  ? 152.972 119.630 152.014 1.00 103.87 ?  313  HIS B CB    1 
ATOM   7374  C  CG    . HIS B 2 316  ? 152.539 118.196 152.051 1.00 130.88 ?  313  HIS B CG    1 
ATOM   7375  N  ND1   . HIS B 2 316  ? 152.799 117.368 153.122 1.00 147.10 ?  313  HIS B ND1   1 
ATOM   7376  C  CD2   . HIS B 2 316  ? 151.878 117.439 151.142 1.00 133.80 ?  313  HIS B CD2   1 
ATOM   7377  C  CE1   . HIS B 2 316  ? 152.307 116.167 152.877 1.00 143.79 ?  313  HIS B CE1   1 
ATOM   7378  N  NE2   . HIS B 2 316  ? 151.745 116.182 151.682 1.00 142.99 ?  313  HIS B NE2   1 
ATOM   7379  N  N     . SER B 2 317  ? 155.437 122.060 151.571 1.00 126.44 ?  314  SER B N     1 
ATOM   7380  C  CA    . SER B 2 317  ? 155.845 123.165 150.709 1.00 110.06 ?  314  SER B CA    1 
ATOM   7381  C  C     . SER B 2 317  ? 157.081 122.780 149.905 1.00 102.37 ?  314  SER B C     1 
ATOM   7382  O  O     . SER B 2 317  ? 157.868 121.919 150.306 1.00 101.39 ?  314  SER B O     1 
ATOM   7383  C  CB    . SER B 2 317  ? 156.129 124.425 151.530 1.00 79.61  ?  314  SER B CB    1 
ATOM   7384  O  OG    . SER B 2 317  ? 156.920 125.359 150.811 1.00 47.27  ?  314  SER B OG    1 
ATOM   7385  N  N     . ARG B 2 318  ? 157.245 123.431 148.752 1.00 90.61  ?  315  ARG B N     1 
ATOM   7386  C  CA    . ARG B 2 318  ? 158.353 123.101 147.860 1.00 83.97  ?  315  ARG B CA    1 
ATOM   7387  C  C     . ARG B 2 318  ? 159.694 123.423 148.502 1.00 66.55  ?  315  ARG B C     1 
ATOM   7388  O  O     . ARG B 2 318  ? 160.533 122.540 148.712 1.00 66.00  ?  315  ARG B O     1 
ATOM   7389  C  CB    . ARG B 2 318  ? 158.200 123.852 146.534 1.00 71.82  ?  315  ARG B CB    1 
ATOM   7390  C  CG    . ARG B 2 318  ? 159.166 123.390 145.456 1.00 50.99  ?  315  ARG B CG    1 
ATOM   7391  C  CD    . ARG B 2 318  ? 159.255 121.883 145.451 1.00 60.27  ?  315  ARG B CD    1 
ATOM   7392  N  NE    . ARG B 2 318  ? 160.101 121.376 144.379 1.00 66.73  ?  315  ARG B NE    1 
ATOM   7393  C  CZ    . ARG B 2 318  ? 159.645 121.037 143.179 1.00 79.47  ?  315  ARG B CZ    1 
ATOM   7394  N  NH1   . ARG B 2 318  ? 160.474 120.570 142.254 1.00 100.38 ?  315  ARG B NH1   1 
ATOM   7395  N  NH2   . ARG B 2 318  ? 158.350 121.148 142.909 1.00 96.15  ?  315  ARG B NH2   1 
ATOM   7396  N  N     . THR B 2 319  ? 159.916 124.690 148.807 1.00 50.58  ?  316  THR B N     1 
ATOM   7397  C  CA    . THR B 2 319  ? 161.205 125.171 149.260 1.00 45.79  ?  316  THR B CA    1 
ATOM   7398  C  C     . THR B 2 319  ? 161.064 125.865 150.605 1.00 46.79  ?  316  THR B C     1 
ATOM   7399  O  O     . THR B 2 319  ? 159.962 126.153 151.075 1.00 49.15  ?  316  THR B O     1 
ATOM   7400  C  CB    . THR B 2 319  ? 161.817 126.139 148.243 1.00 45.71  ?  316  THR B CB    1 
ATOM   7401  O  OG1   . THR B 2 319  ? 161.250 127.439 148.435 1.00 45.22  ?  316  THR B OG1   1 
ATOM   7402  C  CG2   . THR B 2 319  ? 161.570 125.669 146.823 1.00 57.77  ?  316  THR B CG2   1 
ATOM   7403  N  N     . TRP B 2 320  ? 162.211 126.133 151.222 1.00 34.82  ?  317  TRP B N     1 
ATOM   7404  C  CA    . TRP B 2 320  ? 162.260 126.947 152.425 1.00 35.06  ?  317  TRP B CA    1 
ATOM   7405  C  C     . TRP B 2 320  ? 163.702 127.355 152.660 1.00 28.90  ?  317  TRP B C     1 
ATOM   7406  O  O     . TRP B 2 320  ? 164.631 126.659 152.247 1.00 25.12  ?  317  TRP B O     1 
ATOM   7407  C  CB    . TRP B 2 320  ? 161.722 126.208 153.655 1.00 58.06  ?  317  TRP B CB    1 
ATOM   7408  C  CG    . TRP B 2 320  ? 162.166 124.771 153.804 1.00 62.63  ?  317  TRP B CG    1 
ATOM   7409  C  CD1   . TRP B 2 320  ? 161.498 123.654 153.393 1.00 42.35  ?  317  TRP B CD1   1 
ATOM   7410  C  CD2   . TRP B 2 320  ? 163.356 124.306 154.459 1.00 46.54  ?  317  TRP B CD2   1 
ATOM   7411  N  NE1   . TRP B 2 320  ? 162.201 122.527 153.740 1.00 27.15  ?  317  TRP B NE1   1 
ATOM   7412  C  CE2   . TRP B 2 320  ? 163.346 122.899 154.391 1.00 43.56  ?  317  TRP B CE2   1 
ATOM   7413  C  CE3   . TRP B 2 320  ? 164.429 124.946 155.088 1.00 38.26  ?  317  TRP B CE3   1 
ATOM   7414  C  CZ2   . TRP B 2 320  ? 164.357 122.127 154.925 1.00 47.99  ?  317  TRP B CZ2   1 
ATOM   7415  C  CZ3   . TRP B 2 320  ? 165.427 124.184 155.612 1.00 25.72  ?  317  TRP B CZ3   1 
ATOM   7416  C  CH2   . TRP B 2 320  ? 165.385 122.784 155.534 1.00 35.28  ?  317  TRP B CH2   1 
ATOM   7417  N  N     . PHE B 2 321  ? 163.879 128.480 153.341 1.00 32.05  ?  318  PHE B N     1 
ATOM   7418  C  CA    . PHE B 2 321  ? 165.212 129.020 153.597 1.00 27.80  ?  318  PHE B CA    1 
ATOM   7419  C  C     . PHE B 2 321  ? 165.215 129.567 155.020 1.00 30.99  ?  318  PHE B C     1 
ATOM   7420  O  O     . PHE B 2 321  ? 164.332 129.255 155.826 1.00 44.13  ?  318  PHE B O     1 
ATOM   7421  C  CB    . PHE B 2 321  ? 165.583 130.051 152.516 1.00 51.53  ?  318  PHE B CB    1 
ATOM   7422  C  CG    . PHE B 2 321  ? 164.531 131.113 152.282 1.00 58.91  ?  318  PHE B CG    1 
ATOM   7423  C  CD1   . PHE B 2 321  ? 164.276 132.092 153.224 1.00 60.90  ?  318  PHE B CD1   1 
ATOM   7424  C  CD2   . PHE B 2 321  ? 163.764 131.098 151.127 1.00 59.55  ?  318  PHE B CD2   1 
ATOM   7425  C  CE1   . PHE B 2 321  ? 163.309 133.062 152.996 1.00 56.30  ?  318  PHE B CE1   1 
ATOM   7426  C  CE2   . PHE B 2 321  ? 162.788 132.059 150.909 1.00 49.94  ?  318  PHE B CE2   1 
ATOM   7427  C  CZ    . PHE B 2 321  ? 162.567 133.037 151.842 1.00 51.32  ?  318  PHE B CZ    1 
ATOM   7428  N  N     . GLY B 2 322  ? 166.208 130.380 155.358 1.00 23.81  ?  319  GLY B N     1 
ATOM   7429  C  CA    . GLY B 2 322  ? 166.202 131.026 156.655 1.00 31.31  ?  319  GLY B CA    1 
ATOM   7430  C  C     . GLY B 2 322  ? 167.606 131.423 157.071 1.00 31.14  ?  319  GLY B C     1 
ATOM   7431  O  O     . GLY B 2 322  ? 168.516 131.490 156.251 1.00 31.25  ?  319  GLY B O     1 
ATOM   7432  N  N     . GLY B 2 323  ? 167.744 131.678 158.371 1.00 39.68  ?  320  GLY B N     1 
ATOM   7433  C  CA    . GLY B 2 323  ? 168.992 132.156 158.928 1.00 40.84  ?  320  GLY B CA    1 
ATOM   7434  C  C     . GLY B 2 323  ? 169.167 131.745 160.374 1.00 44.10  ?  320  GLY B C     1 
ATOM   7435  O  O     . GLY B 2 323  ? 168.240 131.267 161.032 1.00 51.58  ?  320  GLY B O     1 
ATOM   7436  N  N     . SER B 2 324  ? 170.392 131.930 160.858 1.00 44.25  ?  321  SER B N     1 
ATOM   7437  C  CA    . SER B 2 324  ? 170.751 131.582 162.227 1.00 65.45  ?  321  SER B CA    1 
ATOM   7438  C  C     . SER B 2 324  ? 170.390 132.757 163.120 1.00 64.56  ?  321  SER B C     1 
ATOM   7439  O  O     . SER B 2 324  ? 171.084 133.773 163.146 1.00 72.92  ?  321  SER B O     1 
ATOM   7440  C  CB    . SER B 2 324  ? 172.229 131.233 162.335 1.00 79.20  ?  321  SER B CB    1 
ATOM   7441  O  OG    . SER B 2 324  ? 173.002 132.352 162.734 1.00 65.47  ?  321  SER B OG    1 
ATOM   7442  N  N     . LEU B 2 325  ? 169.293 132.620 163.863 1.00 66.87  ?  322  LEU B N     1 
ATOM   7443  C  CA    . LEU B 2 325  ? 168.933 133.649 164.824 1.00 81.44  ?  322  LEU B CA    1 
ATOM   7444  C  C     . LEU B 2 325  ? 169.932 133.701 165.979 1.00 109.11 ?  322  LEU B C     1 
ATOM   7445  O  O     . LEU B 2 325  ? 169.999 134.715 166.672 1.00 119.36 ?  322  LEU B O     1 
ATOM   7446  C  CB    . LEU B 2 325  ? 167.506 133.398 165.315 1.00 76.08  ?  322  LEU B CB    1 
ATOM   7447  C  CG    . LEU B 2 325  ? 166.676 134.535 165.917 1.00 69.96  ?  322  LEU B CG    1 
ATOM   7448  C  CD1   . LEU B 2 325  ? 167.046 134.913 167.350 1.00 92.67  ?  322  LEU B CD1   1 
ATOM   7449  C  CD2   . LEU B 2 325  ? 166.779 135.741 164.987 1.00 44.11  ?  322  LEU B CD2   1 
ATOM   7450  N  N     . GLY B 2 326  ? 170.735 132.652 166.152 1.00 112.20 ?  323  GLY B N     1 
ATOM   7451  C  CA    . GLY B 2 326  ? 171.800 132.634 167.142 1.00 104.20 ?  323  GLY B CA    1 
ATOM   7452  C  C     . GLY B 2 326  ? 171.434 132.006 168.472 1.00 101.69 ?  323  GLY B C     1 
ATOM   7453  O  O     . GLY B 2 326  ? 170.326 132.195 168.978 1.00 104.40 ?  323  GLY B O     1 
ATOM   7454  N  N     . LYS B 2 327  ? 172.382 131.273 169.055 1.00 95.75  ?  324  LYS B N     1 
ATOM   7455  C  CA    . LYS B 2 327  ? 172.211 130.583 170.336 1.00 112.96 ?  324  LYS B CA    1 
ATOM   7456  C  C     . LYS B 2 327  ? 171.066 129.564 170.273 1.00 131.66 ?  324  LYS B C     1 
ATOM   7457  O  O     . LYS B 2 327  ? 170.091 129.626 171.027 1.00 150.58 ?  324  LYS B O     1 
ATOM   7458  C  CB    . LYS B 2 327  ? 172.008 131.586 171.485 1.00 100.90 ?  324  LYS B CB    1 
ATOM   7459  C  CG    . LYS B 2 327  ? 172.804 132.888 171.373 1.00 73.89  ?  324  LYS B CG    1 
ATOM   7460  C  CD    . LYS B 2 327  ? 174.309 132.620 171.392 1.00 89.77  ?  324  LYS B CD    1 
ATOM   7461  C  CE    . LYS B 2 327  ? 174.844 132.420 172.804 1.00 94.33  ?  324  LYS B CE    1 
ATOM   7462  N  NZ    . LYS B 2 327  ? 176.333 132.291 172.807 1.00 83.03  ?  324  LYS B NZ    1 
ATOM   7463  N  N     . GLY B 2 328  ? 171.202 128.609 169.350 1.00 100.51 ?  325  GLY B N     1 
ATOM   7464  C  CA    . GLY B 2 328  ? 170.235 127.536 169.191 1.00 73.90  ?  325  GLY B CA    1 
ATOM   7465  C  C     . GLY B 2 328  ? 168.955 127.954 168.496 1.00 68.54  ?  325  GLY B C     1 
ATOM   7466  O  O     . GLY B 2 328  ? 168.242 127.121 167.926 1.00 53.40  ?  325  GLY B O     1 
ATOM   7467  N  N     . THR B 2 329  ? 168.659 129.249 168.554 1.00 115.65 ?  326  THR B N     1 
ATOM   7468  C  CA    . THR B 2 329  ? 167.522 129.806 167.839 1.00 138.93 ?  326  THR B CA    1 
ATOM   7469  C  C     . THR B 2 329  ? 167.845 129.907 166.355 1.00 120.13 ?  326  THR B C     1 
ATOM   7470  O  O     . THR B 2 329  ? 168.984 130.176 165.967 1.00 113.38 ?  326  THR B O     1 
ATOM   7471  C  CB    . THR B 2 329  ? 167.151 131.191 168.388 1.00 142.63 ?  326  THR B CB    1 
ATOM   7472  O  OG1   . THR B 2 329  ? 168.279 132.070 168.292 1.00 128.12 ?  326  THR B OG1   1 
ATOM   7473  C  CG2   . THR B 2 329  ? 166.707 131.109 169.841 1.00 135.82 ?  326  THR B CG2   1 
ATOM   7474  N  N     . ALA B 2 330  ? 166.833 129.690 165.523 1.00 99.67  ?  327  ALA B N     1 
ATOM   7475  C  CA    . ALA B 2 330  ? 166.991 129.795 164.083 1.00 87.00  ?  327  ALA B CA    1 
ATOM   7476  C  C     . ALA B 2 330  ? 165.659 130.219 163.488 1.00 87.87  ?  327  ALA B C     1 
ATOM   7477  O  O     . ALA B 2 330  ? 164.597 129.809 163.968 1.00 81.78  ?  327  ALA B O     1 
ATOM   7478  C  CB    . ALA B 2 330  ? 167.459 128.470 163.470 1.00 83.15  ?  327  ALA B CB    1 
ATOM   7479  N  N     . LEU B 2 331  ? 165.723 131.047 162.451 1.00 79.97  ?  328  LEU B N     1 
ATOM   7480  C  CA    . LEU B 2 331  ? 164.537 131.521 161.756 1.00 58.52  ?  328  LEU B CA    1 
ATOM   7481  C  C     . LEU B 2 331  ? 164.392 130.767 160.444 1.00 41.86  ?  328  LEU B C     1 
ATOM   7482  O  O     . LEU B 2 331  ? 165.210 130.939 159.537 1.00 37.67  ?  328  LEU B O     1 
ATOM   7483  C  CB    . LEU B 2 331  ? 164.624 133.019 161.495 1.00 33.65  ?  328  LEU B CB    1 
ATOM   7484  C  CG    . LEU B 2 331  ? 163.484 133.516 160.620 1.00 25.57  ?  328  LEU B CG    1 
ATOM   7485  C  CD1   . LEU B 2 331  ? 162.141 133.128 161.215 1.00 60.56  ?  328  LEU B CD1   1 
ATOM   7486  C  CD2   . LEU B 2 331  ? 163.599 135.005 160.466 1.00 27.53  ?  328  LEU B CD2   1 
ATOM   7487  N  N     . VAL B 2 332  ? 163.351 129.939 160.341 1.00 49.47  ?  329  VAL B N     1 
ATOM   7488  C  CA    . VAL B 2 332  ? 163.015 129.270 159.089 1.00 44.08  ?  329  VAL B CA    1 
ATOM   7489  C  C     . VAL B 2 332  ? 161.871 130.032 158.441 1.00 57.73  ?  329  VAL B C     1 
ATOM   7490  O  O     . VAL B 2 332  ? 160.944 130.488 159.123 1.00 62.23  ?  329  VAL B O     1 
ATOM   7491  C  CB    . VAL B 2 332  ? 162.657 127.783 159.300 1.00 50.22  ?  329  VAL B CB    1 
ATOM   7492  C  CG1   . VAL B 2 332  ? 163.917 126.930 159.387 1.00 67.53  ?  329  VAL B CG1   1 
ATOM   7493  C  CG2   . VAL B 2 332  ? 161.808 127.587 160.549 1.00 69.32  ?  329  VAL B CG2   1 
ATOM   7494  N  N     . ALA B 2 333  ? 161.945 130.188 157.121 1.00 51.95  ?  330  ALA B N     1 
ATOM   7495  C  CA    . ALA B 2 333  ? 160.944 130.906 156.352 1.00 51.72  ?  330  ALA B CA    1 
ATOM   7496  C  C     . ALA B 2 333  ? 160.483 130.041 155.192 1.00 42.06  ?  330  ALA B C     1 
ATOM   7497  O  O     . ALA B 2 333  ? 161.301 129.484 154.447 1.00 38.48  ?  330  ALA B O     1 
ATOM   7498  C  CB    . ALA B 2 333  ? 161.486 132.240 155.825 1.00 61.18  ?  330  ALA B CB    1 
ATOM   7499  N  N     . ILE B 2 334  ? 159.165 129.950 155.050 1.00 51.15  ?  331  ILE B N     1 
ATOM   7500  C  CA    . ILE B 2 334  ? 158.522 129.161 154.012 1.00 55.05  ?  331  ILE B CA    1 
ATOM   7501  C  C     . ILE B 2 334  ? 157.841 130.139 153.069 1.00 54.84  ?  331  ILE B C     1 
ATOM   7502  O  O     . ILE B 2 334  ? 157.126 131.029 153.532 1.00 65.56  ?  331  ILE B O     1 
ATOM   7503  C  CB    . ILE B 2 334  ? 157.482 128.174 154.573 1.00 61.92  ?  331  ILE B CB    1 
ATOM   7504  C  CG1   . ILE B 2 334  ? 157.876 127.686 155.967 1.00 94.73  ?  331  ILE B CG1   1 
ATOM   7505  C  CG2   . ILE B 2 334  ? 157.276 127.025 153.608 1.00 50.08  ?  331  ILE B CG2   1 
ATOM   7506  C  CD1   . ILE B 2 334  ? 159.126 126.855 156.019 1.00 121.51 ?  331  ILE B CD1   1 
ATOM   7507  N  N     . PRO B 2 335  ? 158.000 130.001 151.776 1.00 54.83  ?  332  PRO B N     1 
ATOM   7508  C  CA    . PRO B 2 335  ? 157.183 130.807 150.871 1.00 62.95  ?  332  PRO B CA    1 
ATOM   7509  C  C     . PRO B 2 335  ? 155.746 130.320 150.928 1.00 62.66  ?  332  PRO B C     1 
ATOM   7510  O  O     . PRO B 2 335  ? 155.396 129.291 150.344 1.00 62.89  ?  332  PRO B O     1 
ATOM   7511  C  CB    . PRO B 2 335  ? 157.835 130.565 149.507 1.00 65.83  ?  332  PRO B CB    1 
ATOM   7512  C  CG    . PRO B 2 335  ? 158.463 129.213 149.637 1.00 51.29  ?  332  PRO B CG    1 
ATOM   7513  C  CD    . PRO B 2 335  ? 158.938 129.126 151.057 1.00 47.71  ?  332  PRO B CD    1 
ATOM   7514  N  N     . SER B 2 336  ? 154.904 131.071 151.633 1.00 74.13  ?  333  SER B N     1 
ATOM   7515  C  CA    . SER B 2 336  ? 153.539 130.636 151.899 1.00 79.09  ?  333  SER B CA    1 
ATOM   7516  C  C     . SER B 2 336  ? 152.688 130.896 150.666 1.00 95.28  ?  333  SER B C     1 
ATOM   7517  O  O     . SER B 2 336  ? 152.489 132.051 150.274 1.00 108.24 ?  333  SER B O     1 
ATOM   7518  C  CB    . SER B 2 336  ? 152.969 131.355 153.123 1.00 81.98  ?  333  SER B CB    1 
ATOM   7519  O  OG    . SER B 2 336  ? 152.645 132.706 152.844 1.00 95.58  ?  333  SER B OG    1 
ATOM   7520  N  N     . GLU B 2 337  ? 152.190 129.831 150.052 1.00 107.85 ?  334  GLU B N     1 
ATOM   7521  C  CA    . GLU B 2 337  ? 151.396 129.939 148.839 1.00 143.34 ?  334  GLU B CA    1 
ATOM   7522  C  C     . GLU B 2 337  ? 149.939 129.666 149.176 1.00 140.45 ?  334  GLU B C     1 
ATOM   7523  O  O     . GLU B 2 337  ? 149.590 128.562 149.610 1.00 113.55 ?  334  GLU B O     1 
ATOM   7524  C  CB    . GLU B 2 337  ? 151.886 128.980 147.758 1.00 168.43 ?  334  GLU B CB    1 
ATOM   7525  C  CG    . GLU B 2 337  ? 151.172 129.178 146.433 1.00 230.33 ?  334  GLU B CG    1 
ATOM   7526  C  CD    . GLU B 2 337  ? 151.217 130.625 145.960 1.00 254.85 ?  334  GLU B CD    1 
ATOM   7527  O  OE1   . GLU B 2 337  ? 152.297 131.248 146.034 1.00 229.83 ?  334  GLU B OE1   1 
ATOM   7528  O  OE2   . GLU B 2 337  ? 150.164 131.147 145.533 1.00 342.04 -1 334  GLU B OE2   1 
ATOM   7529  N  N     . GLY B 2 338  ? 149.099 130.674 148.974 1.00 166.27 ?  335  GLY B N     1 
ATOM   7530  C  CA    . GLY B 2 338  ? 147.671 130.544 149.178 1.00 171.35 ?  335  GLY B CA    1 
ATOM   7531  C  C     . GLY B 2 338  ? 146.955 131.685 148.496 1.00 207.83 ?  335  GLY B C     1 
ATOM   7532  O  O     . GLY B 2 338  ? 147.554 132.714 148.164 1.00 208.52 ?  335  GLY B O     1 
ATOM   7533  N  N     . ASN B 2 339  ? 145.655 131.492 148.287 1.00 248.04 ?  336  ASN B N     1 
ATOM   7534  C  CA    . ASN B 2 339  ? 144.833 132.490 147.619 1.00 277.94 ?  336  ASN B CA    1 
ATOM   7535  C  C     . ASN B 2 339  ? 143.978 133.219 148.643 1.00 293.84 ?  336  ASN B C     1 
ATOM   7536  O  O     . ASN B 2 339  ? 143.223 132.564 149.381 1.00 291.46 ?  336  ASN B O     1 
ATOM   7537  C  CB    . ASN B 2 339  ? 143.950 131.836 146.561 1.00 281.93 ?  336  ASN B CB    1 
ATOM   7538  C  CG    . ASN B 2 339  ? 144.740 131.356 145.357 1.00 267.61 ?  336  ASN B CG    1 
ATOM   7539  O  OD1   . ASN B 2 339  ? 145.954 131.166 145.433 1.00 256.49 ?  336  ASN B OD1   1 
ATOM   7540  N  ND2   . ASN B 2 339  ? 144.052 131.160 144.236 1.00 251.46 ?  336  ASN B ND2   1 
ATOM   7541  N  N     . PRO B 2 340  ? 144.057 134.557 148.736 1.00 288.94 ?  337  PRO B N     1 
ATOM   7542  C  CA    . PRO B 2 340  ? 144.958 135.368 147.913 1.00 285.57 ?  337  PRO B CA    1 
ATOM   7543  C  C     . PRO B 2 340  ? 146.325 135.588 148.562 1.00 265.68 ?  337  PRO B C     1 
ATOM   7544  O  O     . PRO B 2 340  ? 146.524 135.204 149.715 1.00 258.31 ?  337  PRO B O     1 
ATOM   7545  C  CB    . PRO B 2 340  ? 144.206 136.692 147.790 1.00 284.99 ?  337  PRO B CB    1 
ATOM   7546  C  CG    . PRO B 2 340  ? 143.462 136.800 149.079 1.00 254.98 ?  337  PRO B CG    1 
ATOM   7547  C  CD    . PRO B 2 340  ? 143.124 135.392 149.514 1.00 266.38 ?  337  PRO B CD    1 
ATOM   7548  N  N     . THR B 2 341  ? 147.256 136.193 147.824 1.00 240.21 ?  338  THR B N     1 
ATOM   7549  C  CA    . THR B 2 341  ? 148.542 136.573 148.398 1.00 216.54 ?  338  THR B CA    1 
ATOM   7550  C  C     . THR B 2 341  ? 148.359 137.833 149.241 1.00 246.56 ?  338  THR B C     1 
ATOM   7551  O  O     . THR B 2 341  ? 147.748 138.798 148.769 1.00 257.27 ?  338  THR B O     1 
ATOM   7552  C  CB    . THR B 2 341  ? 149.571 136.806 147.291 1.00 175.90 ?  338  THR B CB    1 
ATOM   7553  O  OG1   . THR B 2 341  ? 149.396 135.821 146.262 1.00 146.98 ?  338  THR B OG1   1 
ATOM   7554  C  CG2   . THR B 2 341  ? 150.980 136.649 147.834 1.00 186.16 ?  338  THR B CG2   1 
ATOM   7555  N  N     . PRO B 2 342  ? 148.854 137.865 150.478 1.00 233.86 ?  339  PRO B N     1 
ATOM   7556  C  CA    . PRO B 2 342  ? 148.448 138.927 151.427 1.00 230.03 ?  339  PRO B CA    1 
ATOM   7557  C  C     . PRO B 2 342  ? 148.923 140.328 151.056 1.00 240.42 ?  339  PRO B C     1 
ATOM   7558  O  O     . PRO B 2 342  ? 148.268 141.303 151.452 1.00 232.84 ?  339  PRO B O     1 
ATOM   7559  C  CB    . PRO B 2 342  ? 149.072 138.461 152.751 1.00 196.88 ?  339  PRO B CB    1 
ATOM   7560  C  CG    . PRO B 2 342  ? 149.110 136.978 152.618 1.00 183.82 ?  339  PRO B CG    1 
ATOM   7561  C  CD    . PRO B 2 342  ? 149.478 136.729 151.177 1.00 205.33 ?  339  PRO B CD    1 
ATOM   7562  N  N     . PRO B 2 343  ? 150.040 140.510 150.311 1.00 220.80 ?  340  PRO B N     1 
ATOM   7563  C  CA    . PRO B 2 343  ? 151.050 139.735 149.583 1.00 209.04 ?  340  PRO B CA    1 
ATOM   7564  C  C     . PRO B 2 343  ? 152.178 139.202 150.455 1.00 190.77 ?  340  PRO B C     1 
ATOM   7565  O  O     . PRO B 2 343  ? 153.237 138.854 149.938 1.00 179.22 ?  340  PRO B O     1 
ATOM   7566  C  CB    . PRO B 2 343  ? 151.588 140.752 148.577 1.00 150.25 ?  340  PRO B CB    1 
ATOM   7567  C  CG    . PRO B 2 343  ? 151.577 142.008 149.335 1.00 118.04 ?  340  PRO B CG    1 
ATOM   7568  C  CD    . PRO B 2 343  ? 150.329 141.955 150.197 1.00 182.24 ?  340  PRO B CD    1 
ATOM   7569  N  N     . GLU B 2 344  ? 151.952 139.143 151.764 1.00 188.23 ?  341  GLU B N     1 
ATOM   7570  C  CA    . GLU B 2 344  ? 152.926 138.522 152.647 1.00 167.35 ?  341  GLU B CA    1 
ATOM   7571  C  C     . GLU B 2 344  ? 152.902 137.019 152.397 1.00 155.34 ?  341  GLU B C     1 
ATOM   7572  O  O     . GLU B 2 344  ? 152.123 136.291 153.018 1.00 160.45 ?  341  GLU B O     1 
ATOM   7573  C  CB    . GLU B 2 344  ? 152.615 138.856 154.109 1.00 180.54 ?  341  GLU B CB    1 
ATOM   7574  C  CG    . GLU B 2 344  ? 153.790 138.693 155.058 1.00 220.06 ?  341  GLU B CG    1 
ATOM   7575  C  CD    . GLU B 2 344  ? 154.413 137.315 154.996 1.00 237.06 ?  341  GLU B CD    1 
ATOM   7576  O  OE1   . GLU B 2 344  ? 153.737 136.338 155.373 1.00 209.69 ?  341  GLU B OE1   1 
ATOM   7577  O  OE2   . GLU B 2 344  ? 155.562 137.205 154.512 1.00 325.86 -1 341  GLU B OE2   1 
ATOM   7578  N  N     . ALA B 2 345  ? 153.762 136.551 151.492 1.00 126.94 ?  342  ALA B N     1 
ATOM   7579  C  CA    . ALA B 2 345  ? 153.804 135.156 151.075 1.00 112.51 ?  342  ALA B CA    1 
ATOM   7580  C  C     . ALA B 2 345  ? 154.933 134.369 151.739 1.00 120.51 ?  342  ALA B C     1 
ATOM   7581  O  O     . ALA B 2 345  ? 155.398 133.377 151.168 1.00 106.47 ?  342  ALA B O     1 
ATOM   7582  C  CB    . ALA B 2 345  ? 153.927 135.066 149.552 1.00 83.22  ?  342  ALA B CB    1 
ATOM   7583  N  N     . TYR B 2 346  ? 155.381 134.782 152.927 1.00 128.35 ?  343  TYR B N     1 
ATOM   7584  C  CA    . TYR B 2 346  ? 156.474 134.112 153.633 1.00 106.28 ?  343  TYR B CA    1 
ATOM   7585  C  C     . TYR B 2 346  ? 156.125 133.964 155.108 1.00 103.26 ?  343  TYR B C     1 
ATOM   7586  O  O     . TYR B 2 346  ? 156.106 134.952 155.847 1.00 121.37 ?  343  TYR B O     1 
ATOM   7587  C  CB    . TYR B 2 346  ? 157.783 134.882 153.469 1.00 87.71  ?  343  TYR B CB    1 
ATOM   7588  C  CG    . TYR B 2 346  ? 158.345 134.799 152.078 1.00 76.69  ?  343  TYR B CG    1 
ATOM   7589  C  CD1   . TYR B 2 346  ? 159.161 133.745 151.704 1.00 68.86  ?  343  TYR B CD1   1 
ATOM   7590  C  CD2   . TYR B 2 346  ? 158.039 135.760 151.130 1.00 92.46  ?  343  TYR B CD2   1 
ATOM   7591  C  CE1   . TYR B 2 346  ? 159.672 133.658 150.424 1.00 67.01  ?  343  TYR B CE1   1 
ATOM   7592  C  CE2   . TYR B 2 346  ? 158.544 135.682 149.853 1.00 105.25 ?  343  TYR B CE2   1 
ATOM   7593  C  CZ    . TYR B 2 346  ? 159.362 134.630 149.504 1.00 86.67  ?  343  TYR B CZ    1 
ATOM   7594  O  OH    . TYR B 2 346  ? 159.865 134.551 148.227 1.00 94.40  ?  343  TYR B OH    1 
ATOM   7595  N  N     . HIS B 2 347  ? 155.880 132.734 155.544 1.00 84.56  ?  344  HIS B N     1 
ATOM   7596  C  CA    . HIS B 2 347  ? 155.589 132.462 156.946 1.00 70.98  ?  344  HIS B CA    1 
ATOM   7597  C  C     . HIS B 2 347  ? 156.859 132.056 157.684 1.00 64.55  ?  344  HIS B C     1 
ATOM   7598  O  O     . HIS B 2 347  ? 157.686 131.306 157.158 1.00 64.84  ?  344  HIS B O     1 
ATOM   7599  C  CB    . HIS B 2 347  ? 154.505 131.390 157.088 1.00 72.53  ?  344  HIS B CB    1 
ATOM   7600  C  CG    . HIS B 2 347  ? 153.108 131.930 156.983 1.00 76.95  ?  344  HIS B CG    1 
ATOM   7601  N  ND1   . HIS B 2 347  ? 152.112 131.296 156.273 1.00 91.19  ?  344  HIS B ND1   1 
ATOM   7602  C  CD2   . HIS B 2 347  ? 152.543 133.042 157.509 1.00 74.16  ?  344  HIS B CD2   1 
ATOM   7603  C  CE1   . HIS B 2 347  ? 150.996 131.997 156.361 1.00 85.90  ?  344  HIS B CE1   1 
ATOM   7604  N  NE2   . HIS B 2 347  ? 151.230 133.061 157.107 1.00 80.97  ?  344  HIS B NE2   1 
ATOM   7605  N  N     . PHE B 2 348  ? 157.010 132.569 158.907 1.00 79.77  ?  345  PHE B N     1 
ATOM   7606  C  CA    . PHE B 2 348  ? 158.242 132.446 159.679 1.00 73.86  ?  345  PHE B CA    1 
ATOM   7607  C  C     . PHE B 2 348  ? 158.001 131.607 160.927 1.00 80.35  ?  345  PHE B C     1 
ATOM   7608  O  O     . PHE B 2 348  ? 157.020 131.822 161.647 1.00 91.44  ?  345  PHE B O     1 
ATOM   7609  C  CB    . PHE B 2 348  ? 158.778 133.824 160.076 1.00 64.30  ?  345  PHE B CB    1 
ATOM   7610  C  CG    . PHE B 2 348  ? 159.203 134.662 158.910 1.00 58.57  ?  345  PHE B CG    1 
ATOM   7611  C  CD1   . PHE B 2 348  ? 158.279 135.407 158.201 1.00 72.49  ?  345  PHE B CD1   1 
ATOM   7612  C  CD2   . PHE B 2 348  ? 160.518 134.661 158.486 1.00 55.69  ?  345  PHE B CD2   1 
ATOM   7613  C  CE1   . PHE B 2 348  ? 158.669 136.166 157.118 1.00 85.67  ?  345  PHE B CE1   1 
ATOM   7614  C  CE2   . PHE B 2 348  ? 160.909 135.413 157.400 1.00 58.07  ?  345  PHE B CE2   1 
ATOM   7615  C  CZ    . PHE B 2 348  ? 159.984 136.164 156.716 1.00 76.49  ?  345  PHE B CZ    1 
ATOM   7616  N  N     . TYR B 2 349  ? 158.896 130.654 161.177 1.00 82.30  ?  346  TYR B N     1 
ATOM   7617  C  CA    . TYR B 2 349  ? 158.913 129.889 162.413 1.00 84.67  ?  346  TYR B CA    1 
ATOM   7618  C  C     . TYR B 2 349  ? 160.251 130.109 163.103 1.00 79.16  ?  346  TYR B C     1 
ATOM   7619  O  O     . TYR B 2 349  ? 161.301 130.156 162.448 1.00 78.16  ?  346  TYR B O     1 
ATOM   7620  C  CB    . TYR B 2 349  ? 158.711 128.383 162.169 1.00 86.74  ?  346  TYR B CB    1 
ATOM   7621  C  CG    . TYR B 2 349  ? 157.602 128.028 161.202 1.00 92.28  ?  346  TYR B CG    1 
ATOM   7622  C  CD1   . TYR B 2 349  ? 156.388 128.693 161.225 1.00 91.38  ?  346  TYR B CD1   1 
ATOM   7623  C  CD2   . TYR B 2 349  ? 157.780 127.026 160.255 1.00 98.02  ?  346  TYR B CD2   1 
ATOM   7624  C  CE1   . TYR B 2 349  ? 155.378 128.366 160.338 1.00 106.53 ?  346  TYR B CE1   1 
ATOM   7625  C  CE2   . TYR B 2 349  ? 156.776 126.693 159.363 1.00 92.35  ?  346  TYR B CE2   1 
ATOM   7626  C  CZ    . TYR B 2 349  ? 155.579 127.366 159.408 1.00 107.87 ?  346  TYR B CZ    1 
ATOM   7627  O  OH    . TYR B 2 349  ? 154.579 127.034 158.521 1.00 128.21 ?  346  TYR B OH    1 
ATOM   7628  N  N     . GLN B 2 350  ? 160.215 130.266 164.423 1.00 80.98  ?  347  GLN B N     1 
ATOM   7629  C  CA    . GLN B 2 350  ? 161.432 130.297 165.221 1.00 76.93  ?  347  GLN B CA    1 
ATOM   7630  C  C     . GLN B 2 350  ? 161.600 128.942 165.889 1.00 79.23  ?  347  GLN B C     1 
ATOM   7631  O  O     . GLN B 2 350  ? 160.646 128.406 166.462 1.00 86.48  ?  347  GLN B O     1 
ATOM   7632  C  CB    . GLN B 2 350  ? 161.396 131.411 166.265 1.00 82.16  ?  347  GLN B CB    1 
ATOM   7633  C  CG    . GLN B 2 350  ? 162.674 131.508 167.083 1.00 85.02  ?  347  GLN B CG    1 
ATOM   7634  C  CD    . GLN B 2 350  ? 162.625 132.615 168.112 1.00 104.05 ?  347  GLN B CD    1 
ATOM   7635  O  OE1   . GLN B 2 350  ? 161.715 133.446 168.106 1.00 125.70 ?  347  GLN B OE1   1 
ATOM   7636  N  NE2   . GLN B 2 350  ? 163.607 132.634 169.007 1.00 98.72  ?  347  GLN B NE2   1 
ATOM   7637  N  N     . VAL B 2 351  ? 162.803 128.382 165.798 1.00 68.26  ?  348  VAL B N     1 
ATOM   7638  C  CA    . VAL B 2 351  ? 163.081 127.052 166.322 1.00 63.93  ?  348  VAL B CA    1 
ATOM   7639  C  C     . VAL B 2 351  ? 164.257 127.142 167.283 1.00 68.14  ?  348  VAL B C     1 
ATOM   7640  O  O     . VAL B 2 351  ? 165.178 127.937 167.075 1.00 73.07  ?  348  VAL B O     1 
ATOM   7641  C  CB    . VAL B 2 351  ? 163.360 126.055 165.180 1.00 63.52  ?  348  VAL B CB    1 
ATOM   7642  C  CG1   . VAL B 2 351  ? 162.080 125.747 164.427 1.00 53.82  ?  348  VAL B CG1   1 
ATOM   7643  C  CG2   . VAL B 2 351  ? 164.381 126.635 164.231 1.00 71.76  ?  348  VAL B CG2   1 
ATOM   7644  N  N     . SER B 2 352  ? 164.216 126.344 168.349 1.00 76.26  ?  349  SER B N     1 
ATOM   7645  C  CA    . SER B 2 352  ? 165.277 126.357 169.349 1.00 78.88  ?  349  SER B CA    1 
ATOM   7646  C  C     . SER B 2 352  ? 165.571 124.938 169.810 1.00 91.97  ?  349  SER B C     1 
ATOM   7647  O  O     . SER B 2 352  ? 164.682 124.084 169.832 1.00 107.00 ?  349  SER B O     1 
ATOM   7648  C  CB    . SER B 2 352  ? 164.910 127.230 170.558 1.00 91.02  ?  349  SER B CB    1 
ATOM   7649  O  OG    . SER B 2 352  ? 163.696 126.797 171.152 1.00 92.05  ?  349  SER B OG    1 
ATOM   7650  N  N     . PHE B 2 353  ? 166.828 124.696 170.176 1.00 92.19  ?  350  PHE B N     1 
ATOM   7651  C  CA    . PHE B 2 353  ? 167.218 123.399 170.714 1.00 132.39 ?  350  PHE B CA    1 
ATOM   7652  C  C     . PHE B 2 353  ? 166.806 123.304 172.182 1.00 155.05 ?  350  PHE B C     1 
ATOM   7653  O  O     . PHE B 2 353  ? 166.646 124.317 172.870 1.00 140.74 ?  350  PHE B O     1 
ATOM   7654  C  CB    . PHE B 2 353  ? 168.730 123.178 170.552 1.00 142.33 ?  350  PHE B CB    1 
ATOM   7655  C  CG    . PHE B 2 353  ? 169.285 122.011 171.347 1.00 177.59 ?  350  PHE B CG    1 
ATOM   7656  C  CD1   . PHE B 2 353  ? 168.965 120.701 171.007 1.00 179.57 ?  350  PHE B CD1   1 
ATOM   7657  C  CD2   . PHE B 2 353  ? 170.149 122.223 172.412 1.00 165.13 ?  350  PHE B CD2   1 
ATOM   7658  C  CE1   . PHE B 2 353  ? 169.479 119.634 171.730 1.00 166.48 ?  350  PHE B CE1   1 
ATOM   7659  C  CE2   . PHE B 2 353  ? 170.668 121.155 173.134 1.00 141.05 ?  350  PHE B CE2   1 
ATOM   7660  C  CZ    . PHE B 2 353  ? 170.331 119.865 172.793 1.00 145.38 ?  350  PHE B CZ    1 
ATOM   7661  N  N     . GLN B 2 354  ? 166.603 122.070 172.646 1.00 164.52 ?  351  GLN B N     1 
ATOM   7662  C  CA    . GLN B 2 354  ? 166.244 121.762 174.037 1.00 158.20 ?  351  GLN B CA    1 
ATOM   7663  C  C     . GLN B 2 354  ? 164.903 122.387 174.436 1.00 110.68 ?  351  GLN B C     1 
ATOM   7664  O  O     . GLN B 2 354  ? 164.850 123.473 175.015 1.00 112.16 ?  351  GLN B O     1 
ATOM   7665  C  CB    . GLN B 2 354  ? 167.357 122.217 175.001 1.00 176.44 ?  351  GLN B CB    1 
ATOM   7666  C  CG    . GLN B 2 354  ? 168.192 121.076 175.622 1.00 154.27 ?  351  GLN B CG    1 
ATOM   7667  C  CD    . GLN B 2 354  ? 169.517 121.553 176.219 1.00 93.32  ?  351  GLN B CD    1 
ATOM   7668  O  OE1   . GLN B 2 354  ? 169.935 122.689 175.998 1.00 90.92  ?  351  GLN B OE1   1 
ATOM   7669  N  NE2   . GLN B 2 354  ? 170.182 120.679 176.971 1.00 73.12  ?  351  GLN B NE2   1 
ATOM   7670  N  N     . GLY C 1 536  ? 145.481 169.058 62.197  1.00 242.21 ?  408  GLY C N     1 
ATOM   7671  C  CA    . GLY C 1 536  ? 146.071 167.871 62.790  1.00 250.83 ?  408  GLY C CA    1 
ATOM   7672  C  C     . GLY C 1 536  ? 145.257 167.304 63.936  1.00 225.50 ?  408  GLY C C     1 
ATOM   7673  O  O     . GLY C 1 536  ? 144.029 167.267 63.873  1.00 225.01 ?  408  GLY C O     1 
ATOM   7674  N  N     . GLY C 1 537  ? 145.940 166.862 64.989  1.00 232.11 ?  409  GLY C N     1 
ATOM   7675  C  CA    . GLY C 1 537  ? 145.256 166.308 66.142  1.00 222.28 ?  409  GLY C CA    1 
ATOM   7676  C  C     . GLY C 1 537  ? 146.109 165.422 67.027  1.00 262.73 ?  409  GLY C C     1 
ATOM   7677  O  O     . GLY C 1 537  ? 146.995 164.715 66.537  1.00 292.81 ?  409  GLY C O     1 
ATOM   7678  N  N     . ARG C 1 538  ? 145.852 165.455 68.332  1.00 261.47 ?  410  ARG C N     1 
ATOM   7679  C  CA    . ARG C 1 538  ? 146.486 164.500 69.228  1.00 276.59 ?  410  ARG C CA    1 
ATOM   7680  C  C     . ARG C 1 538  ? 146.024 163.093 68.857  1.00 280.72 ?  410  ARG C C     1 
ATOM   7681  O  O     . ARG C 1 538  ? 144.842 162.893 68.561  1.00 269.89 ?  410  ARG C O     1 
ATOM   7682  C  CB    . ARG C 1 538  ? 146.140 164.825 70.687  1.00 258.36 ?  410  ARG C CB    1 
ATOM   7683  C  CG    . ARG C 1 538  ? 147.042 164.149 71.708  1.00 254.37 ?  410  ARG C CG    1 
ATOM   7684  C  CD    . ARG C 1 538  ? 146.710 164.539 73.136  1.00 256.16 ?  410  ARG C CD    1 
ATOM   7685  N  NE    . ARG C 1 538  ? 145.329 164.257 73.494  1.00 239.74 ?  410  ARG C NE    1 
ATOM   7686  C  CZ    . ARG C 1 538  ? 144.668 164.901 74.449  1.00 245.68 ?  410  ARG C CZ    1 
ATOM   7687  N  NH1   . ARG C 1 538  ? 145.267 165.867 75.130  1.00 261.29 ?  410  ARG C NH1   1 
ATOM   7688  N  NH2   . ARG C 1 538  ? 143.409 164.586 74.717  1.00 241.01 ?  410  ARG C NH2   1 
ATOM   7689  N  N     . PRO C 1 539  ? 146.930 162.111 68.836  1.00 289.82 ?  411  PRO C N     1 
ATOM   7690  C  CA    . PRO C 1 539  ? 146.588 160.802 68.266  1.00 281.37 ?  411  PRO C CA    1 
ATOM   7691  C  C     . PRO C 1 539  ? 145.311 160.220 68.853  1.00 269.17 ?  411  PRO C C     1 
ATOM   7692  O  O     . PRO C 1 539  ? 145.066 160.291 70.060  1.00 256.24 ?  411  PRO C O     1 
ATOM   7693  C  CB    . PRO C 1 539  ? 147.805 159.936 68.611  1.00 256.06 ?  411  PRO C CB    1 
ATOM   7694  C  CG    . PRO C 1 539  ? 148.917 160.891 68.732  1.00 248.61 ?  411  PRO C CG    1 
ATOM   7695  C  CD    . PRO C 1 539  ? 148.339 162.165 69.271  1.00 277.69 ?  411  PRO C CD    1 
ATOM   7696  N  N     . ARG C 1 540  ? 144.493 159.648 67.976  1.00 256.07 ?  412  ARG C N     1 
ATOM   7697  C  CA    . ARG C 1 540  ? 143.271 158.982 68.399  1.00 245.99 ?  412  ARG C CA    1 
ATOM   7698  C  C     . ARG C 1 540  ? 143.624 157.769 69.249  1.00 264.21 ?  412  ARG C C     1 
ATOM   7699  O  O     . ARG C 1 540  ? 144.197 156.797 68.747  1.00 262.68 ?  412  ARG C O     1 
ATOM   7700  C  CB    . ARG C 1 540  ? 142.450 158.564 67.181  1.00 222.03 ?  412  ARG C CB    1 
ATOM   7701  C  CG    . ARG C 1 540  ? 141.650 159.689 66.551  1.00 230.12 ?  412  ARG C CG    1 
ATOM   7702  C  CD    . ARG C 1 540  ? 140.436 159.134 65.831  1.00 247.00 ?  412  ARG C CD    1 
ATOM   7703  N  NE    . ARG C 1 540  ? 139.449 160.166 65.536  1.00 283.84 ?  412  ARG C NE    1 
ATOM   7704  C  CZ    . ARG C 1 540  ? 138.141 159.941 65.458  1.00 298.04 ?  412  ARG C CZ    1 
ATOM   7705  N  NH1   . ARG C 1 540  ? 137.668 158.719 65.665  1.00 300.44 ?  412  ARG C NH1   1 
ATOM   7706  N  NH2   . ARG C 1 540  ? 137.306 160.936 65.191  1.00 287.78 ?  412  ARG C NH2   1 
ATOM   7707  N  N     . GLN C 1 541  ? 143.279 157.823 70.532  1.00 253.42 ?  413  GLN C N     1 
ATOM   7708  C  CA    . GLN C 1 541  ? 143.626 156.761 71.464  1.00 246.99 ?  413  GLN C CA    1 
ATOM   7709  C  C     . GLN C 1 541  ? 142.614 155.620 71.364  1.00 242.94 ?  413  GLN C C     1 
ATOM   7710  O  O     . GLN C 1 541  ? 141.486 155.796 70.898  1.00 248.32 ?  413  GLN C O     1 
ATOM   7711  C  CB    . GLN C 1 541  ? 143.693 157.307 72.896  1.00 211.50 ?  413  GLN C CB    1 
ATOM   7712  C  CG    . GLN C 1 541  ? 144.260 158.727 72.997  1.00 183.87 ?  413  GLN C CG    1 
ATOM   7713  C  CD    . GLN C 1 541  ? 144.080 159.353 74.371  1.00 155.18 ?  413  GLN C CD    1 
ATOM   7714  O  OE1   . GLN C 1 541  ? 143.811 158.660 75.354  1.00 143.17 ?  413  GLN C OE1   1 
ATOM   7715  N  NE2   . GLN C 1 541  ? 144.217 160.673 74.443  1.00 176.17 ?  413  GLN C NE2   1 
ATOM   7716  N  N     . HIS C 1 542  ? 143.038 154.436 71.801  1.00 235.10 ?  414  HIS C N     1 
ATOM   7717  C  CA    . HIS C 1 542  ? 142.189 153.254 71.707  1.00 232.49 ?  414  HIS C CA    1 
ATOM   7718  C  C     . HIS C 1 542  ? 140.972 153.405 72.617  1.00 255.81 ?  414  HIS C C     1 
ATOM   7719  O  O     . HIS C 1 542  ? 141.061 153.977 73.706  1.00 255.11 ?  414  HIS C O     1 
ATOM   7720  C  CB    . HIS C 1 542  ? 142.988 151.999 72.067  1.00 212.74 ?  414  HIS C CB    1 
ATOM   7721  C  CG    . HIS C 1 542  ? 142.187 150.735 72.026  1.00 211.27 ?  414  HIS C CG    1 
ATOM   7722  N  ND1   . HIS C 1 542  ? 141.315 150.369 73.028  1.00 218.95 ?  414  HIS C ND1   1 
ATOM   7723  C  CD2   . HIS C 1 542  ? 142.117 149.758 71.092  1.00 210.34 ?  414  HIS C CD2   1 
ATOM   7724  C  CE1   . HIS C 1 542  ? 140.750 149.216 72.718  1.00 227.67 ?  414  HIS C CE1   1 
ATOM   7725  N  NE2   . HIS C 1 542  ? 141.219 148.825 71.547  1.00 225.11 ?  414  HIS C NE2   1 
ATOM   7726  N  N     . LEU C 1 543  ? 139.828 152.881 72.159  1.00 255.93 ?  415  LEU C N     1 
ATOM   7727  C  CA    . LEU C 1 543  ? 138.541 153.177 72.793  1.00 249.99 ?  415  LEU C CA    1 
ATOM   7728  C  C     . LEU C 1 543  ? 138.492 152.760 74.259  1.00 224.48 ?  415  LEU C C     1 
ATOM   7729  O  O     . LEU C 1 543  ? 137.844 153.428 75.072  1.00 215.39 ?  415  LEU C O     1 
ATOM   7730  C  CB    . LEU C 1 543  ? 137.408 152.490 72.021  1.00 231.93 ?  415  LEU C CB    1 
ATOM   7731  C  CG    . LEU C 1 543  ? 136.037 152.350 72.699  1.00 186.38 ?  415  LEU C CG    1 
ATOM   7732  C  CD1   . LEU C 1 543  ? 135.407 153.708 72.978  1.00 196.69 ?  415  LEU C CD1   1 
ATOM   7733  C  CD2   . LEU C 1 543  ? 135.094 151.474 71.881  1.00 165.47 ?  415  LEU C CD2   1 
ATOM   7734  N  N     . LEU C 1 544  ? 139.171 151.672 74.623  1.00 215.08 ?  416  LEU C N     1 
ATOM   7735  C  CA    . LEU C 1 544  ? 138.956 151.082 75.940  1.00 204.24 ?  416  LEU C CA    1 
ATOM   7736  C  C     . LEU C 1 544  ? 139.617 151.889 77.055  1.00 213.00 ?  416  LEU C C     1 
ATOM   7737  O  O     . LEU C 1 544  ? 138.989 152.144 78.089  1.00 219.99 ?  416  LEU C O     1 
ATOM   7738  C  CB    . LEU C 1 544  ? 139.458 149.639 75.952  1.00 205.25 ?  416  LEU C CB    1 
ATOM   7739  C  CG    . LEU C 1 544  ? 138.510 148.630 75.298  1.00 208.59 ?  416  LEU C CG    1 
ATOM   7740  C  CD1   . LEU C 1 544  ? 139.137 147.245 75.251  1.00 231.38 ?  416  LEU C CD1   1 
ATOM   7741  C  CD2   . LEU C 1 544  ? 137.164 148.594 76.013  1.00 192.22 ?  416  LEU C CD2   1 
ATOM   7742  N  N     . SER C 1 545  ? 140.867 152.309 76.869  1.00 209.77 ?  417  SER C N     1 
ATOM   7743  C  CA    . SER C 1 545  ? 141.608 152.992 77.926  1.00 192.08 ?  417  SER C CA    1 
ATOM   7744  C  C     . SER C 1 545  ? 141.146 154.428 78.167  1.00 209.17 ?  417  SER C C     1 
ATOM   7745  O  O     . SER C 1 545  ? 141.754 155.123 78.988  1.00 206.57 ?  417  SER C O     1 
ATOM   7746  C  CB    . SER C 1 545  ? 143.109 152.979 77.608  1.00 174.87 ?  417  SER C CB    1 
ATOM   7747  O  OG    . SER C 1 545  ? 143.421 153.846 76.532  1.00 196.96 ?  417  SER C OG    1 
ATOM   7748  N  N     . LEU C 1 546  ? 140.094 154.888 77.491  1.00 231.88 ?  418  LEU C N     1 
ATOM   7749  C  CA    . LEU C 1 546  ? 139.628 156.259 77.643  1.00 251.98 ?  418  LEU C CA    1 
ATOM   7750  C  C     . LEU C 1 546  ? 138.794 156.426 78.917  1.00 240.07 ?  418  LEU C C     1 
ATOM   7751  O  O     . LEU C 1 546  ? 138.431 155.461 79.597  1.00 225.06 ?  418  LEU C O     1 
ATOM   7752  C  CB    . LEU C 1 546  ? 138.806 156.682 76.426  1.00 249.41 ?  418  LEU C CB    1 
ATOM   7753  C  CG    . LEU C 1 546  ? 139.408 156.340 75.065  1.00 260.95 ?  418  LEU C CG    1 
ATOM   7754  C  CD1   . LEU C 1 546  ? 138.449 156.692 73.944  1.00 245.28 ?  418  LEU C CD1   1 
ATOM   7755  C  CD2   . LEU C 1 546  ? 140.733 157.062 74.888  1.00 261.57 ?  418  LEU C CD2   1 
ATOM   7756  N  N     . THR C 1 547  ? 138.484 157.685 79.229  1.00 227.94 ?  419  THR C N     1 
ATOM   7757  C  CA    . THR C 1 547  ? 137.620 158.018 80.350  1.00 201.69 ?  419  THR C CA    1 
ATOM   7758  C  C     . THR C 1 547  ? 136.153 157.903 79.946  1.00 198.19 ?  419  THR C C     1 
ATOM   7759  O  O     . THR C 1 547  ? 135.806 157.898 78.762  1.00 201.86 ?  419  THR C O     1 
ATOM   7760  C  CB    . THR C 1 547  ? 137.901 159.431 80.862  1.00 179.17 ?  419  THR C CB    1 
ATOM   7761  O  OG1   . THR C 1 547  ? 138.189 160.298 79.758  1.00 198.24 ?  419  THR C OG1   1 
ATOM   7762  C  CG2   . THR C 1 547  ? 139.079 159.428 81.820  1.00 176.51 ?  419  THR C CG2   1 
ATOM   7763  N  N     . ARG C 1 548  ? 135.288 157.802 80.958  1.00 182.40 ?  420  ARG C N     1 
ATOM   7764  C  CA    . ARG C 1 548  ? 133.853 157.716 80.701  1.00 178.58 ?  420  ARG C CA    1 
ATOM   7765  C  C     . ARG C 1 548  ? 133.365 158.911 79.892  1.00 185.48 ?  420  ARG C C     1 
ATOM   7766  O  O     . ARG C 1 548  ? 132.569 158.756 78.958  1.00 182.77 ?  420  ARG C O     1 
ATOM   7767  C  CB    . ARG C 1 548  ? 133.094 157.610 82.022  1.00 156.57 ?  420  ARG C CB    1 
ATOM   7768  C  CG    . ARG C 1 548  ? 133.569 156.471 82.905  1.00 145.45 ?  420  ARG C CG    1 
ATOM   7769  C  CD    . ARG C 1 548  ? 132.445 155.962 83.783  1.00 156.88 ?  420  ARG C CD    1 
ATOM   7770  N  NE    . ARG C 1 548  ? 132.856 155.862 85.177  1.00 152.39 ?  420  ARG C NE    1 
ATOM   7771  C  CZ    . ARG C 1 548  ? 133.173 154.720 85.779  1.00 145.99 ?  420  ARG C CZ    1 
ATOM   7772  N  NH1   . ARG C 1 548  ? 133.125 153.579 85.106  1.00 140.05 ?  420  ARG C NH1   1 
ATOM   7773  N  NH2   . ARG C 1 548  ? 133.537 154.721 87.053  1.00 167.12 ?  420  ARG C NH2   1 
ATOM   7774  N  N     . ARG C 1 549  ? 133.844 160.111 80.230  1.00 183.66 ?  421  ARG C N     1 
ATOM   7775  C  CA    . ARG C 1 549  ? 133.527 161.296 79.439  1.00 181.51 ?  421  ARG C CA    1 
ATOM   7776  C  C     . ARG C 1 549  ? 133.983 161.131 77.991  1.00 197.13 ?  421  ARG C C     1 
ATOM   7777  O  O     . ARG C 1 549  ? 133.230 161.413 77.052  1.00 196.77 ?  421  ARG C O     1 
ATOM   7778  C  CB    . ARG C 1 549  ? 134.171 162.528 80.076  1.00 170.36 ?  421  ARG C CB    1 
ATOM   7779  C  CG    . ARG C 1 549  ? 134.082 163.768 79.215  1.00 186.86 ?  421  ARG C CG    1 
ATOM   7780  C  CD    . ARG C 1 549  ? 132.854 164.607 79.514  1.00 215.30 ?  421  ARG C CD    1 
ATOM   7781  N  NE    . ARG C 1 549  ? 133.083 166.022 79.229  1.00 231.90 ?  421  ARG C NE    1 
ATOM   7782  C  CZ    . ARG C 1 549  ? 133.149 166.532 78.004  1.00 230.13 ?  421  ARG C CZ    1 
ATOM   7783  N  NH1   . ARG C 1 549  ? 133.013 165.742 76.947  1.00 214.69 ?  421  ARG C NH1   1 
ATOM   7784  N  NH2   . ARG C 1 549  ? 133.361 167.828 77.827  1.00 247.21 ?  421  ARG C NH2   1 
ATOM   7785  N  N     . ALA C 1 550  ? 135.213 160.653 77.793  1.00 204.64 ?  422  ALA C N     1 
ATOM   7786  C  CA    . ALA C 1 550  ? 135.760 160.516 76.445  1.00 208.57 ?  422  ALA C CA    1 
ATOM   7787  C  C     . ALA C 1 550  ? 135.048 159.425 75.655  1.00 189.44 ?  422  ALA C C     1 
ATOM   7788  O  O     . ALA C 1 550  ? 134.753 159.604 74.466  1.00 189.29 ?  422  ALA C O     1 
ATOM   7789  C  CB    . ALA C 1 550  ? 137.251 160.215 76.524  1.00 215.87 ?  422  ALA C CB    1 
ATOM   7790  N  N     . GLN C 1 551  ? 134.787 158.281 76.289  1.00 182.84 ?  423  GLN C N     1 
ATOM   7791  C  CA    . GLN C 1 551  ? 134.079 157.202 75.612  1.00 171.66 ?  423  GLN C CA    1 
ATOM   7792  C  C     . GLN C 1 551  ? 132.677 157.640 75.217  1.00 180.09 ?  423  GLN C C     1 
ATOM   7793  O  O     . GLN C 1 551  ? 132.215 157.363 74.102  1.00 191.09 ?  423  GLN C O     1 
ATOM   7794  C  CB    . GLN C 1 551  ? 134.032 155.970 76.515  1.00 169.69 ?  423  GLN C CB    1 
ATOM   7795  C  CG    . GLN C 1 551  ? 135.395 155.360 76.774  1.00 176.91 ?  423  GLN C CG    1 
ATOM   7796  C  CD    . GLN C 1 551  ? 135.542 154.850 78.191  1.00 180.25 ?  423  GLN C CD    1 
ATOM   7797  O  OE1   . GLN C 1 551  ? 134.676 155.073 79.036  1.00 171.69 ?  423  GLN C OE1   1 
ATOM   7798  N  NE2   . GLN C 1 551  ? 136.648 154.167 78.461  1.00 199.61 ?  423  GLN C NE2   1 
ATOM   7799  N  N     . LYS C 1 552  ? 131.979 158.322 76.130  1.00 175.98 ?  424  LYS C N     1 
ATOM   7800  C  CA    . LYS C 1 552  ? 130.665 158.870 75.809  1.00 177.04 ?  424  LYS C CA    1 
ATOM   7801  C  C     . LYS C 1 552  ? 130.739 159.839 74.631  1.00 190.75 ?  424  LYS C C     1 
ATOM   7802  O  O     . LYS C 1 552  ? 129.919 159.767 73.708  1.00 188.06 ?  424  LYS C O     1 
ATOM   7803  C  CB    . LYS C 1 552  ? 130.080 159.556 77.045  1.00 166.89 ?  424  LYS C CB    1 
ATOM   7804  C  CG    . LYS C 1 552  ? 129.492 158.599 78.076  1.00 159.64 ?  424  LYS C CG    1 
ATOM   7805  C  CD    . LYS C 1 552  ? 129.081 159.334 79.345  1.00 159.01 ?  424  LYS C CD    1 
ATOM   7806  C  CE    . LYS C 1 552  ? 128.357 158.408 80.309  1.00 223.00 ?  424  LYS C CE    1 
ATOM   7807  N  NZ    . LYS C 1 552  ? 127.790 159.147 81.469  1.00 287.17 ?  424  LYS C NZ    1 
ATOM   7808  N  N     . HIS C 1 553  ? 131.717 160.753 74.644  1.00 202.50 ?  425  HIS C N     1 
ATOM   7809  C  CA    . HIS C 1 553  ? 131.865 161.712 73.547  1.00 204.24 ?  425  HIS C CA    1 
ATOM   7810  C  C     . HIS C 1 553  ? 132.063 161.003 72.214  1.00 188.27 ?  425  HIS C C     1 
ATOM   7811  O  O     . HIS C 1 553  ? 131.425 161.348 71.213  1.00 168.47 ?  425  HIS C O     1 
ATOM   7812  C  CB    . HIS C 1 553  ? 133.034 162.661 73.839  1.00 214.00 ?  425  HIS C CB    1 
ATOM   7813  C  CG    . HIS C 1 553  ? 133.407 163.555 72.692  1.00 197.02 ?  425  HIS C CG    1 
ATOM   7814  N  ND1   . HIS C 1 553  ? 134.124 163.108 71.602  1.00 191.77 ?  425  HIS C ND1   1 
ATOM   7815  C  CD2   . HIS C 1 553  ? 133.176 164.872 72.473  1.00 186.92 ?  425  HIS C CD2   1 
ATOM   7816  C  CE1   . HIS C 1 553  ? 134.311 164.108 70.759  1.00 181.21 ?  425  HIS C CE1   1 
ATOM   7817  N  NE2   . HIS C 1 553  ? 133.746 165.189 71.264  1.00 187.26 ?  425  HIS C NE2   1 
ATOM   7818  N  N     . ARG C 1 554  ? 132.948 160.007 72.182  1.00 199.44 ?  426  ARG C N     1 
ATOM   7819  C  CA    . ARG C 1 554  ? 133.263 159.344 70.920  1.00 201.29 ?  426  ARG C CA    1 
ATOM   7820  C  C     . ARG C 1 554  ? 132.124 158.455 70.432  1.00 191.29 ?  426  ARG C C     1 
ATOM   7821  O  O     . ARG C 1 554  ? 131.944 158.299 69.219  1.00 185.05 ?  426  ARG C O     1 
ATOM   7822  C  CB    . ARG C 1 554  ? 134.546 158.523 71.058  1.00 221.42 ?  426  ARG C CB    1 
ATOM   7823  C  CG    . ARG C 1 554  ? 135.778 159.334 71.424  1.00 225.98 ?  426  ARG C CG    1 
ATOM   7824  C  CD    . ARG C 1 554  ? 137.053 158.513 71.301  1.00 225.05 ?  426  ARG C CD    1 
ATOM   7825  N  NE    . ARG C 1 554  ? 137.347 158.131 69.923  1.00 252.90 ?  426  ARG C NE    1 
ATOM   7826  C  CZ    . ARG C 1 554  ? 138.475 157.546 69.532  1.00 261.21 ?  426  ARG C CZ    1 
ATOM   7827  N  NH1   . ARG C 1 554  ? 139.426 157.267 70.416  1.00 258.00 ?  426  ARG C NH1   1 
ATOM   7828  N  NH2   . ARG C 1 554  ? 138.652 157.234 68.254  1.00 276.69 ?  426  ARG C NH2   1 
ATOM   7829  N  N     . LEU C 1 555  ? 131.356 157.859 71.343  1.00 195.89 ?  427  LEU C N     1 
ATOM   7830  C  CA    . LEU C 1 555  ? 130.340 156.890 70.953  1.00 185.12 ?  427  LEU C CA    1 
ATOM   7831  C  C     . LEU C 1 555  ? 128.936 157.470 70.868  1.00 174.88 ?  427  LEU C C     1 
ATOM   7832  O  O     . LEU C 1 555  ? 128.032 156.755 70.429  1.00 165.54 ?  427  LEU C O     1 
ATOM   7833  C  CB    . LEU C 1 555  ? 130.340 155.711 71.933  1.00 191.56 ?  427  LEU C CB    1 
ATOM   7834  C  CG    . LEU C 1 555  ? 131.669 154.964 72.006  1.00 213.30 ?  427  LEU C CG    1 
ATOM   7835  C  CD1   . LEU C 1 555  ? 131.560 153.776 72.942  1.00 216.43 ?  427  LEU C CD1   1 
ATOM   7836  C  CD2   . LEU C 1 555  ? 132.104 154.524 70.617  1.00 212.90 ?  427  LEU C CD2   1 
ATOM   7837  N  N     . ARG C 1 556  ? 128.738 158.727 71.270  1.00 184.95 ?  428  ARG C N     1 
ATOM   7838  C  CA    . ARG C 1 556  ? 127.424 159.361 71.323  1.00 188.51 ?  428  ARG C CA    1 
ATOM   7839  C  C     . ARG C 1 556  ? 126.572 159.138 70.076  1.00 193.50 ?  428  ARG C C     1 
ATOM   7840  O  O     . ARG C 1 556  ? 125.379 158.842 70.185  1.00 192.34 ?  428  ARG C O     1 
ATOM   7841  C  CB    . ARG C 1 556  ? 127.600 160.862 71.580  1.00 192.14 ?  428  ARG C CB    1 
ATOM   7842  C  CG    . ARG C 1 556  ? 126.305 161.605 71.863  1.00 210.87 ?  428  ARG C CG    1 
ATOM   7843  C  CD    . ARG C 1 556  ? 126.558 162.891 72.637  1.00 198.12 ?  428  ARG C CD    1 
ATOM   7844  N  NE    . ARG C 1 556  ? 125.487 163.865 72.451  1.00 209.13 ?  428  ARG C NE    1 
ATOM   7845  C  CZ    . ARG C 1 556  ? 125.497 164.810 71.516  1.00 215.98 ?  428  ARG C CZ    1 
ATOM   7846  N  NH1   . ARG C 1 556  ? 126.527 164.909 70.687  1.00 201.34 ?  428  ARG C NH1   1 
ATOM   7847  N  NH2   . ARG C 1 556  ? 124.482 165.658 71.414  1.00 235.28 ?  428  ARG C NH2   1 
ATOM   7848  N  N     . ASP C 1 557  ? 127.166 159.279 68.890  1.00 204.24 ?  429  ASP C N     1 
ATOM   7849  C  CA    . ASP C 1 557  ? 126.392 159.146 67.658  1.00 215.09 ?  429  ASP C CA    1 
ATOM   7850  C  C     . ASP C 1 557  ? 125.845 157.731 67.502  1.00 199.28 ?  429  ASP C C     1 
ATOM   7851  O  O     . ASP C 1 557  ? 124.639 157.534 67.290  1.00 197.37 ?  429  ASP C O     1 
ATOM   7852  C  CB    . ASP C 1 557  ? 127.259 159.532 66.460  1.00 233.48 ?  429  ASP C CB    1 
ATOM   7853  C  CG    . ASP C 1 557  ? 127.821 160.938 66.577  1.00 274.79 ?  429  ASP C CG    1 
ATOM   7854  O  OD1   . ASP C 1 557  ? 128.008 161.412 67.718  1.00 242.32 ?  429  ASP C OD1   1 
ATOM   7855  O  OD2   . ASP C 1 557  ? 128.077 161.572 65.531  1.00 404.41 -1 429  ASP C OD2   1 
ATOM   7856  N  N     . LEU C 1 558  ? 126.722 156.731 67.601  1.00 185.27 ?  430  LEU C N     1 
ATOM   7857  C  CA    . LEU C 1 558  ? 126.274 155.346 67.531  1.00 188.64 ?  430  LEU C CA    1 
ATOM   7858  C  C     . LEU C 1 558  ? 125.301 155.019 68.655  1.00 200.19 ?  430  LEU C C     1 
ATOM   7859  O  O     . LEU C 1 558  ? 124.394 154.200 68.473  1.00 209.04 ?  430  LEU C O     1 
ATOM   7860  C  CB    . LEU C 1 558  ? 127.479 154.408 67.573  1.00 178.89 ?  430  LEU C CB    1 
ATOM   7861  C  CG    . LEU C 1 558  ? 127.138 152.922 67.462  1.00 195.27 ?  430  LEU C CG    1 
ATOM   7862  C  CD1   . LEU C 1 558  ? 126.638 152.578 66.066  1.00 191.99 ?  430  LEU C CD1   1 
ATOM   7863  C  CD2   . LEU C 1 558  ? 128.326 152.056 67.847  1.00 214.05 ?  430  LEU C CD2   1 
ATOM   7864  N  N     . LYS C 1 559  ? 125.464 155.654 69.817  1.00 179.42 ?  431  LYS C N     1 
ATOM   7865  C  CA    . LYS C 1 559  ? 124.554 155.398 70.926  1.00 173.80 ?  431  LYS C CA    1 
ATOM   7866  C  C     . LYS C 1 559  ? 123.158 155.941 70.634  1.00 188.37 ?  431  LYS C C     1 
ATOM   7867  O  O     . LYS C 1 559  ? 122.159 155.311 70.990  1.00 191.22 ?  431  LYS C O     1 
ATOM   7868  C  CB    . LYS C 1 559  ? 125.108 155.995 72.219  1.00 142.45 ?  431  LYS C CB    1 
ATOM   7869  C  CG    . LYS C 1 559  ? 124.269 155.662 73.444  1.00 129.31 ?  431  LYS C CG    1 
ATOM   7870  C  CD    . LYS C 1 559  ? 124.891 156.201 74.719  1.00 121.09 ?  431  LYS C CD    1 
ATOM   7871  C  CE    . LYS C 1 559  ? 123.893 156.151 75.869  1.00 128.91 ?  431  LYS C CE    1 
ATOM   7872  N  NZ    . LYS C 1 559  ? 124.338 156.971 77.031  1.00 216.44 ?  431  LYS C NZ    1 
ATOM   7873  N  N     . ASN C 1 560  ? 123.064 157.100 69.971  1.00 187.86 ?  432  ASN C N     1 
ATOM   7874  C  CA    . ASN C 1 560  ? 121.756 157.588 69.529  1.00 177.20 ?  432  ASN C CA    1 
ATOM   7875  C  C     . ASN C 1 560  ? 121.157 156.701 68.444  1.00 183.18 ?  432  ASN C C     1 
ATOM   7876  O  O     . ASN C 1 560  ? 119.933 156.529 68.397  1.00 187.82 ?  432  ASN C O     1 
ATOM   7877  C  CB    . ASN C 1 560  ? 121.838 159.032 69.024  1.00 166.97 ?  432  ASN C CB    1 
ATOM   7878  C  CG    . ASN C 1 560  ? 122.720 159.915 69.882  1.00 183.80 ?  432  ASN C CG    1 
ATOM   7879  O  OD1   . ASN C 1 560  ? 122.770 159.767 71.103  1.00 185.46 ?  432  ASN C OD1   1 
ATOM   7880  N  ND2   . ASN C 1 560  ? 123.431 160.839 69.243  1.00 198.91 ?  432  ASN C ND2   1 
ATOM   7881  N  N     . GLN C 1 561  ? 121.994 156.150 67.558  1.00 186.25 ?  433  GLN C N     1 
ATOM   7882  C  CA    . GLN C 1 561  ? 121.493 155.185 66.577  1.00 180.98 ?  433  GLN C CA    1 
ATOM   7883  C  C     . GLN C 1 561  ? 120.898 153.954 67.260  1.00 186.70 ?  433  GLN C C     1 
ATOM   7884  O  O     . GLN C 1 561  ? 119.811 153.493 66.891  1.00 182.44 ?  433  GLN C O     1 
ATOM   7885  C  CB    . GLN C 1 561  ? 122.611 154.780 65.617  1.00 182.46 ?  433  GLN C CB    1 
ATOM   7886  C  CG    . GLN C 1 561  ? 123.358 155.942 64.988  1.00 183.28 ?  433  GLN C CG    1 
ATOM   7887  C  CD    . GLN C 1 561  ? 124.688 155.528 64.387  1.00 175.40 ?  433  GLN C CD    1 
ATOM   7888  O  OE1   . GLN C 1 561  ? 124.848 154.402 63.914  1.00 168.85 ?  433  GLN C OE1   1 
ATOM   7889  N  NE2   . GLN C 1 561  ? 125.654 156.441 64.403  0.00 181.47 ?  433  GLN C NE2   1 
ATOM   7890  N  N     . VAL C 1 562  ? 121.602 153.406 68.254  1.00 204.45 ?  434  VAL C N     1 
ATOM   7891  C  CA    . VAL C 1 562  ? 121.073 152.273 69.014  1.00 205.99 ?  434  VAL C CA    1 
ATOM   7892  C  C     . VAL C 1 562  ? 119.814 152.674 69.772  1.00 197.02 ?  434  VAL C C     1 
ATOM   7893  O  O     . VAL C 1 562  ? 118.873 151.884 69.908  1.00 199.50 ?  434  VAL C O     1 
ATOM   7894  C  CB    . VAL C 1 562  ? 122.145 151.709 69.969  1.00 216.25 ?  434  VAL C CB    1 
ATOM   7895  C  CG1   . VAL C 1 562  ? 121.617 150.486 70.704  1.00 194.86 ?  434  VAL C CG1   1 
ATOM   7896  C  CG2   . VAL C 1 562  ? 123.400 151.337 69.199  1.00 235.99 ?  434  VAL C CG2   1 
ATOM   7897  N  N     . LYS C 1 563  ? 119.777 153.908 70.279  1.00 200.14 ?  435  LYS C N     1 
ATOM   7898  C  CA    . LYS C 1 563  ? 118.610 154.384 71.014  1.00 212.78 ?  435  LYS C CA    1 
ATOM   7899  C  C     . LYS C 1 563  ? 117.375 154.415 70.119  1.00 233.12 ?  435  LYS C C     1 
ATOM   7900  O  O     . LYS C 1 563  ? 116.313 153.897 70.487  1.00 243.41 ?  435  LYS C O     1 
ATOM   7901  C  CB    . LYS C 1 563  ? 118.905 155.766 71.601  1.00 211.33 ?  435  LYS C CB    1 
ATOM   7902  C  CG    . LYS C 1 563  ? 117.874 156.279 72.594  1.00 219.18 ?  435  LYS C CG    1 
ATOM   7903  C  CD    . LYS C 1 563  ? 117.569 155.247 73.667  1.00 192.12 ?  435  LYS C CD    1 
ATOM   7904  C  CE    . LYS C 1 563  ? 116.328 155.614 74.464  1.00 173.87 ?  435  LYS C CE    1 
ATOM   7905  N  NZ    . LYS C 1 563  ? 115.150 155.790 73.576  1.00 229.23 ?  435  LYS C NZ    1 
ATOM   7906  N  N     . THR C 1 564  ? 117.495 155.020 68.930  1.00 238.27 ?  436  THR C N     1 
ATOM   7907  C  CA    . THR C 1 564  ? 116.349 155.068 68.022  1.00 262.41 ?  436  THR C CA    1 
ATOM   7908  C  C     . THR C 1 564  ? 116.002 153.682 67.489  1.00 266.82 ?  436  THR C C     1 
ATOM   7909  O  O     . THR C 1 564  ? 114.822 153.389 67.260  1.00 273.27 ?  436  THR C O     1 
ATOM   7910  C  CB    . THR C 1 564  ? 116.588 156.050 66.862  1.00 261.11 ?  436  THR C CB    1 
ATOM   7911  O  OG1   . THR C 1 564  ? 115.512 155.945 65.919  1.00 251.43 ?  436  THR C OG1   1 
ATOM   7912  C  CG2   . THR C 1 564  ? 117.885 155.758 66.136  1.00 231.43 ?  436  THR C CG2   1 
ATOM   7913  N  N     . PHE C 1 565  ? 117.000 152.807 67.312  1.00 244.11 ?  437  PHE C N     1 
ATOM   7914  C  CA    . PHE C 1 565  ? 116.706 151.433 66.915  1.00 250.61 ?  437  PHE C CA    1 
ATOM   7915  C  C     . PHE C 1 565  ? 115.891 150.722 67.989  1.00 258.80 ?  437  PHE C C     1 
ATOM   7916  O  O     . PHE C 1 565  ? 114.930 150.004 67.682  1.00 270.85 ?  437  PHE C O     1 
ATOM   7917  C  CB    . PHE C 1 565  ? 118.011 150.680 66.625  1.00 215.49 ?  437  PHE C CB    1 
ATOM   7918  C  CG    . PHE C 1 565  ? 117.812 149.310 66.025  1.00 225.56 ?  437  PHE C CG    1 
ATOM   7919  C  CD1   . PHE C 1 565  ? 117.605 148.202 66.832  1.00 223.29 ?  437  PHE C CD1   1 
ATOM   7920  C  CD2   . PHE C 1 565  ? 117.827 149.135 64.650  1.00 224.53 ?  437  PHE C CD2   1 
ATOM   7921  C  CE1   . PHE C 1 565  ? 117.423 146.944 66.278  1.00 212.49 ?  437  PHE C CE1   1 
ATOM   7922  C  CE2   . PHE C 1 565  ? 117.643 147.879 64.092  1.00 231.74 ?  437  PHE C CE2   1 
ATOM   7923  C  CZ    . PHE C 1 565  ? 117.441 146.785 64.907  1.00 222.61 ?  437  PHE C CZ    1 
ATOM   7924  N  N     . ALA C 1 566  ? 116.251 150.923 69.258  1.00 240.68 ?  438  ALA C N     1 
ATOM   7925  C  CA    . ALA C 1 566  ? 115.505 150.310 70.349  1.00 245.45 ?  438  ALA C CA    1 
ATOM   7926  C  C     . ALA C 1 566  ? 114.088 150.864 70.431  1.00 256.45 ?  438  ALA C C     1 
ATOM   7927  O  O     . ALA C 1 566  ? 113.137 150.107 70.651  1.00 254.86 ?  438  ALA C O     1 
ATOM   7928  C  CB    . ALA C 1 566  ? 116.245 150.514 71.671  1.00 239.11 ?  438  ALA C CB    1 
ATOM   7929  N  N     . GLU C 1 567  ? 113.926 152.180 70.252  1.00 260.08 ?  439  GLU C N     1 
ATOM   7930  C  CA    . GLU C 1 567  ? 112.581 152.755 70.226  1.00 253.69 ?  439  GLU C CA    1 
ATOM   7931  C  C     . GLU C 1 567  ? 111.741 152.156 69.103  1.00 262.48 ?  439  GLU C C     1 
ATOM   7932  O  O     . GLU C 1 567  ? 110.551 151.874 69.289  1.00 260.89 ?  439  GLU C O     1 
ATOM   7933  C  CB    . GLU C 1 567  ? 112.641 154.276 70.074  1.00 244.82 ?  439  GLU C CB    1 
ATOM   7934  C  CG    . GLU C 1 567  ? 113.353 155.016 71.189  1.00 261.86 ?  439  GLU C CG    1 
ATOM   7935  C  CD    . GLU C 1 567  ? 114.253 156.118 70.665  1.00 290.78 ?  439  GLU C CD    1 
ATOM   7936  O  OE1   . GLU C 1 567  ? 113.914 156.728 69.629  1.00 277.18 ?  439  GLU C OE1   1 
ATOM   7937  O  OE2   . GLU C 1 567  ? 115.301 156.375 71.292  1.00 389.10 -1 439  GLU C OE2   1 
ATOM   7938  N  N     . LYS C 1 568  ? 112.344 151.962 67.926  1.00 278.88 ?  440  LYS C N     1 
ATOM   7939  C  CA    . LYS C 1 568  ? 111.587 151.497 66.769  1.00 298.82 ?  440  LYS C CA    1 
ATOM   7940  C  C     . LYS C 1 568  ? 111.211 150.022 66.888  1.00 306.88 ?  440  LYS C C     1 
ATOM   7941  O  O     . LYS C 1 568  ? 110.116 149.624 66.471  1.00 312.05 ?  440  LYS C O     1 
ATOM   7942  C  CB    . LYS C 1 568  ? 112.391 151.744 65.491  1.00 301.80 ?  440  LYS C CB    1 
ATOM   7943  C  CG    . LYS C 1 568  ? 112.528 153.209 65.089  1.00 267.17 ?  440  LYS C CG    1 
ATOM   7944  C  CD    . LYS C 1 568  ? 113.376 153.350 63.827  1.00 243.03 ?  440  LYS C CD    1 
ATOM   7945  C  CE    . LYS C 1 568  ? 113.571 154.807 63.434  1.00 187.47 ?  440  LYS C CE    1 
ATOM   7946  N  NZ    . LYS C 1 568  ? 114.468 154.949 62.252  1.00 170.14 ?  440  LYS C NZ    1 
ATOM   7947  N  N     . GLU C 1 569  ? 112.093 149.191 67.444  1.00 298.84 ?  441  GLU C N     1 
ATOM   7948  C  CA    . GLU C 1 569  ? 111.856 147.746 67.452  1.00 300.77 ?  441  GLU C CA    1 
ATOM   7949  C  C     . GLU C 1 569  ? 111.504 147.176 68.818  1.00 285.32 ?  441  GLU C C     1 
ATOM   7950  O  O     . GLU C 1 569  ? 110.518 146.450 68.937  1.00 277.97 ?  441  GLU C O     1 
ATOM   7951  C  CB    . GLU C 1 569  ? 113.086 146.991 66.910  1.00 304.37 ?  441  GLU C CB    1 
ATOM   7952  C  CG    . GLU C 1 569  ? 113.974 147.720 65.884  1.00 309.51 ?  441  GLU C CG    1 
ATOM   7953  C  CD    . GLU C 1 569  ? 113.230 148.447 64.766  1.00 339.25 ?  441  GLU C CD    1 
ATOM   7954  O  OE1   . GLU C 1 569  ? 112.055 148.127 64.483  1.00 330.35 ?  441  GLU C OE1   1 
ATOM   7955  O  OE2   . GLU C 1 569  ? 113.830 149.372 64.182  1.00 454.45 -1 441  GLU C OE2   1 
ATOM   7956  N  N     . GLU C 1 570  ? 112.281 147.476 69.863  1.00 273.17 ?  442  GLU C N     1 
ATOM   7957  C  CA    . GLU C 1 570  ? 112.107 146.851 71.168  1.00 264.14 ?  442  GLU C CA    1 
ATOM   7958  C  C     . GLU C 1 570  ? 111.636 147.822 72.242  1.00 254.32 ?  442  GLU C C     1 
ATOM   7959  O  O     . GLU C 1 570  ? 111.713 147.498 73.433  1.00 254.16 ?  442  GLU C O     1 
ATOM   7960  C  CB    . GLU C 1 570  ? 113.410 146.173 71.602  1.00 276.29 ?  442  GLU C CB    1 
ATOM   7961  C  CG    . GLU C 1 570  ? 113.599 144.781 71.019  1.00 289.71 ?  442  GLU C CG    1 
ATOM   7962  C  CD    . GLU C 1 570  ? 112.650 143.750 71.609  1.00 305.49 ?  442  GLU C CD    1 
ATOM   7963  O  OE1   . GLU C 1 570  ? 111.762 144.112 72.410  1.00 276.40 ?  442  GLU C OE1   1 
ATOM   7964  O  OE2   . GLU C 1 570  ? 112.777 142.564 71.244  1.00 399.75 -1 442  GLU C OE2   1 
ATOM   7965  N  N     . GLY C 1 571  ? 111.159 149.002 71.859  1.00 243.65 ?  443  GLY C N     1 
ATOM   7966  C  CA    . GLY C 1 571  ? 110.605 149.935 72.829  1.00 220.27 ?  443  GLY C CA    1 
ATOM   7967  C  C     . GLY C 1 571  ? 111.601 150.492 73.823  1.00 217.97 ?  443  GLY C C     1 
ATOM   7968  O  O     . GLY C 1 571  ? 111.306 150.552 75.023  1.00 198.08 ?  443  GLY C O     1 
ATOM   7969  N  N     . GLY C 1 572  ? 112.778 150.899 73.354  1.00 239.30 ?  444  GLY C N     1 
ATOM   7970  C  CA    . GLY C 1 572  ? 113.759 151.538 74.211  1.00 242.29 ?  444  GLY C CA    1 
ATOM   7971  C  C     . GLY C 1 572  ? 114.484 150.640 75.188  1.00 242.82 ?  444  GLY C C     1 
ATOM   7972  O  O     . GLY C 1 572  ? 115.203 151.149 76.053  1.00 223.71 ?  444  GLY C O     1 
ATOM   7973  N  N     . ASP C 1 573  ? 114.328 149.320 75.084  1.00 265.06 ?  445  ASP C N     1 
ATOM   7974  C  CA    . ASP C 1 573  ? 115.043 148.386 75.956  1.00 275.50 ?  445  ASP C CA    1 
ATOM   7975  C  C     . ASP C 1 573  ? 116.477 148.217 75.438  1.00 263.16 ?  445  ASP C C     1 
ATOM   7976  O  O     . ASP C 1 573  ? 116.903 147.146 75.007  1.00 264.01 ?  445  ASP C O     1 
ATOM   7977  C  CB    . ASP C 1 573  ? 114.287 147.061 76.032  1.00 293.75 ?  445  ASP C CB    1 
ATOM   7978  C  CG    . ASP C 1 573  ? 114.997 146.007 76.885  1.00 305.90 ?  445  ASP C CG    1 
ATOM   7979  O  OD1   . ASP C 1 573  ? 115.908 146.362 77.662  1.00 272.15 ?  445  ASP C OD1   1 
ATOM   7980  O  OD2   . ASP C 1 573  ? 114.632 144.814 76.779  1.00 393.01 -1 445  ASP C OD2   1 
ATOM   7981  N  N     . VAL C 1 574  ? 117.219 149.330 75.465  1.00 231.53 ?  446  VAL C N     1 
ATOM   7982  C  CA    . VAL C 1 574  ? 118.577 149.357 74.924  1.00 214.88 ?  446  VAL C CA    1 
ATOM   7983  C  C     . VAL C 1 574  ? 119.480 148.388 75.675  1.00 220.08 ?  446  VAL C C     1 
ATOM   7984  O  O     . VAL C 1 574  ? 120.411 147.810 75.095  1.00 225.46 ?  446  VAL C O     1 
ATOM   7985  C  CB    . VAL C 1 574  ? 119.141 150.794 74.963  1.00 177.52 ?  446  VAL C CB    1 
ATOM   7986  C  CG1   . VAL C 1 574  ? 120.392 150.906 74.104  1.00 156.87 ?  446  VAL C CG1   1 
ATOM   7987  C  CG2   . VAL C 1 574  ? 118.089 151.801 74.517  1.00 179.90 ?  446  VAL C CG2   1 
ATOM   7988  N  N     . LYS C 1 575  ? 119.221 148.196 76.970  1.00 208.94 ?  447  LYS C N     1 
ATOM   7989  C  CA    . LYS C 1 575  ? 120.051 147.326 77.797  1.00 204.87 ?  447  LYS C CA    1 
ATOM   7990  C  C     . LYS C 1 575  ? 120.093 145.901 77.249  1.00 227.04 ?  447  LYS C C     1 
ATOM   7991  O  O     . LYS C 1 575  ? 121.169 145.365 76.953  1.00 229.47 ?  447  LYS C O     1 
ATOM   7992  C  CB    . LYS C 1 575  ? 119.529 147.343 79.233  1.00 175.61 ?  447  LYS C CB    1 
ATOM   7993  C  CG    . LYS C 1 575  ? 120.136 146.280 80.113  1.00 195.69 ?  447  LYS C CG    1 
ATOM   7994  C  CD    . LYS C 1 575  ? 119.736 146.469 81.557  1.00 218.93 ?  447  LYS C CD    1 
ATOM   7995  C  CE    . LYS C 1 575  ? 120.472 145.486 82.442  1.00 251.23 ?  447  LYS C CE    1 
ATOM   7996  N  NZ    . LYS C 1 575  ? 120.100 145.658 83.868  1.00 296.17 ?  447  LYS C NZ    1 
ATOM   7997  N  N     . SER C 1 576  ? 118.923 145.267 77.116  1.00 229.21 ?  448  SER C N     1 
ATOM   7998  C  CA    . SER C 1 576  ? 118.869 143.898 76.606  1.00 223.97 ?  448  SER C CA    1 
ATOM   7999  C  C     . SER C 1 576  ? 119.381 143.805 75.171  1.00 225.57 ?  448  SER C C     1 
ATOM   8000  O  O     . SER C 1 576  ? 119.975 142.788 74.792  1.00 216.12 ?  448  SER C O     1 
ATOM   8001  C  CB    . SER C 1 576  ? 117.440 143.354 76.698  1.00 218.22 ?  448  SER C CB    1 
ATOM   8002  O  OG    . SER C 1 576  ? 116.922 143.466 78.014  1.00 225.17 ?  448  SER C OG    1 
ATOM   8003  N  N     . VAL C 1 577  ? 119.182 144.855 74.369  1.00 236.30 ?  449  VAL C N     1 
ATOM   8004  C  CA    . VAL C 1 577  ? 119.642 144.844 72.979  1.00 240.17 ?  449  VAL C CA    1 
ATOM   8005  C  C     . VAL C 1 577  ? 121.166 144.770 72.919  1.00 244.09 ?  449  VAL C C     1 
ATOM   8006  O  O     . VAL C 1 577  ? 121.735 143.878 72.275  1.00 237.58 ?  449  VAL C O     1 
ATOM   8007  C  CB    . VAL C 1 577  ? 119.105 146.073 72.221  1.00 236.66 ?  449  VAL C CB    1 
ATOM   8008  C  CG1   . VAL C 1 577  ? 119.711 146.154 70.827  1.00 236.23 ?  449  VAL C CG1   1 
ATOM   8009  C  CG2   . VAL C 1 577  ? 117.585 146.022 72.121  1.00 232.19 ?  449  VAL C CG2   1 
ATOM   8010  N  N     . CYS C 1 578  ? 121.851 145.708 73.587  1.00 235.05 ?  450  CYS C N     1 
ATOM   8011  C  CA    . CYS C 1 578  ? 123.313 145.678 73.573  1.00 210.24 ?  450  CYS C CA    1 
ATOM   8012  C  C     . CYS C 1 578  ? 123.853 144.451 74.299  1.00 206.34 ?  450  CYS C C     1 
ATOM   8013  O  O     . CYS C 1 578  ? 124.934 143.953 73.958  1.00 194.21 ?  450  CYS C O     1 
ATOM   8014  C  CB    . CYS C 1 578  ? 123.887 146.964 74.174  1.00 178.75 ?  450  CYS C CB    1 
ATOM   8015  S  SG    . CYS C 1 578  ? 123.370 147.352 75.857  1.00 226.15 ?  450  CYS C SG    1 
ATOM   8016  N  N     . LEU C 1 579  ? 123.106 143.932 75.279  1.00 215.51 ?  451  LEU C N     1 
ATOM   8017  C  CA    . LEU C 1 579  ? 123.486 142.673 75.913  1.00 205.56 ?  451  LEU C CA    1 
ATOM   8018  C  C     . LEU C 1 579  ? 123.509 141.532 74.903  1.00 197.25 ?  451  LEU C C     1 
ATOM   8019  O  O     . LEU C 1 579  ? 124.452 140.735 74.872  1.00 190.38 ?  451  LEU C O     1 
ATOM   8020  C  CB    . LEU C 1 579  ? 122.522 142.352 77.053  1.00 209.08 ?  451  LEU C CB    1 
ATOM   8021  C  CG    . LEU C 1 579  ? 122.569 140.896 77.522  1.00 203.09 ?  451  LEU C CG    1 
ATOM   8022  C  CD1   . LEU C 1 579  ? 123.884 140.602 78.228  1.00 196.77 ?  451  LEU C CD1   1 
ATOM   8023  C  CD2   . LEU C 1 579  ? 121.380 140.544 78.404  1.00 209.55 ?  451  LEU C CD2   1 
ATOM   8024  N  N     . THR C 1 580  ? 122.457 141.420 74.087  1.00 200.42 ?  452  THR C N     1 
ATOM   8025  C  CA    . THR C 1 580  ? 122.412 140.364 73.079  1.00 195.22 ?  452  THR C CA    1 
ATOM   8026  C  C     . THR C 1 580  ? 123.490 140.570 72.020  1.00 189.97 ?  452  THR C C     1 
ATOM   8027  O  O     . THR C 1 580  ? 124.079 139.597 71.526  1.00 188.51 ?  452  THR C O     1 
ATOM   8028  C  CB    . THR C 1 580  ? 121.020 140.308 72.441  1.00 191.79 ?  452  THR C CB    1 
ATOM   8029  O  OG1   . THR C 1 580  ? 120.025 140.631 73.420  1.00 185.65 ?  452  THR C OG1   1 
ATOM   8030  C  CG2   . THR C 1 580  ? 120.731 138.918 71.895  1.00 191.25 ?  452  THR C CG2   1 
ATOM   8031  N  N     . LEU C 1 581  ? 123.760 141.830 71.659  1.00 186.45 ?  453  LEU C N     1 
ATOM   8032  C  CA    . LEU C 1 581  ? 124.879 142.129 70.765  1.00 165.18 ?  453  LEU C CA    1 
ATOM   8033  C  C     . LEU C 1 581  ? 126.183 141.574 71.319  1.00 149.86 ?  453  LEU C C     1 
ATOM   8034  O  O     . LEU C 1 581  ? 126.949 140.918 70.604  1.00 146.84 ?  453  LEU C O     1 
ATOM   8035  C  CB    . LEU C 1 581  ? 125.004 143.638 70.545  1.00 175.44 ?  453  LEU C CB    1 
ATOM   8036  C  CG    . LEU C 1 581  ? 123.795 144.410 70.016  1.00 212.95 ?  453  LEU C CG    1 
ATOM   8037  C  CD1   . LEU C 1 581  ? 124.154 145.869 69.757  1.00 216.92 ?  453  LEU C CD1   1 
ATOM   8038  C  CD2   . LEU C 1 581  ? 123.264 143.752 68.752  1.00 205.15 ?  453  LEU C CD2   1 
ATOM   8039  N  N     . PHE C 1 582  ? 126.452 141.845 72.598  1.00 161.87 ?  454  PHE C N     1 
ATOM   8040  C  CA    . PHE C 1 582  ? 127.660 141.325 73.232  1.00 171.34 ?  454  PHE C CA    1 
ATOM   8041  C  C     . PHE C 1 582  ? 127.664 139.802 73.264  1.00 190.82 ?  454  PHE C C     1 
ATOM   8042  O  O     . PHE C 1 582  ? 128.694 139.176 72.992  1.00 193.69 ?  454  PHE C O     1 
ATOM   8043  C  CB    . PHE C 1 582  ? 127.795 141.888 74.649  1.00 183.92 ?  454  PHE C CB    1 
ATOM   8044  C  CG    . PHE C 1 582  ? 129.192 141.819 75.198  1.00 200.54 ?  454  PHE C CG    1 
ATOM   8045  C  CD1   . PHE C 1 582  ? 130.154 142.733 74.809  1.00 214.37 ?  454  PHE C CD1   1 
ATOM   8046  C  CD2   . PHE C 1 582  ? 129.549 140.823 76.089  1.00 216.55 ?  454  PHE C CD2   1 
ATOM   8047  C  CE1   . PHE C 1 582  ? 131.441 142.660 75.311  1.00 223.20 ?  454  PHE C CE1   1 
ATOM   8048  C  CE2   . PHE C 1 582  ? 130.832 140.748 76.591  1.00 229.88 ?  454  PHE C CE2   1 
ATOM   8049  C  CZ    . PHE C 1 582  ? 131.778 141.669 76.201  1.00 230.25 ?  454  PHE C CZ    1 
ATOM   8050  N  N     . LEU C 1 583  ? 126.525 139.190 73.601  1.00 190.31 ?  455  LEU C N     1 
ATOM   8051  C  CA    . LEU C 1 583  ? 126.446 137.730 73.681  1.00 189.37 ?  455  LEU C CA    1 
ATOM   8052  C  C     . LEU C 1 583  ? 126.814 137.082 72.355  1.00 173.77 ?  455  LEU C C     1 
ATOM   8053  O  O     . LEU C 1 583  ? 127.620 136.143 72.307  1.00 174.38 ?  455  LEU C O     1 
ATOM   8054  C  CB    . LEU C 1 583  ? 125.043 137.299 74.109  1.00 176.31 ?  455  LEU C CB    1 
ATOM   8055  C  CG    . LEU C 1 583  ? 124.593 137.573 75.544  1.00 175.80 ?  455  LEU C CG    1 
ATOM   8056  C  CD1   . LEU C 1 583  ? 123.079 137.702 75.616  1.00 171.15 ?  455  LEU C CD1   1 
ATOM   8057  C  CD2   . LEU C 1 583  ? 125.074 136.455 76.456  1.00 164.80 ?  455  LEU C CD2   1 
ATOM   8058  N  N     . LEU C 1 584  ? 126.231 137.572 71.264  1.00 177.07 ?  456  LEU C N     1 
ATOM   8059  C  CA    . LEU C 1 584  ? 126.491 136.952 69.969  1.00 185.66 ?  456  LEU C CA    1 
ATOM   8060  C  C     . LEU C 1 584  ? 127.872 137.320 69.429  1.00 180.63 ?  456  LEU C C     1 
ATOM   8061  O  O     . LEU C 1 584  ? 128.529 136.487 68.792  1.00 190.68 ?  456  LEU C O     1 
ATOM   8062  C  CB    . LEU C 1 584  ? 125.391 137.326 68.978  1.00 207.60 ?  456  LEU C CB    1 
ATOM   8063  C  CG    . LEU C 1 584  ? 123.982 136.852 69.355  1.00 204.02 ?  456  LEU C CG    1 
ATOM   8064  C  CD1   . LEU C 1 584  ? 123.062 136.897 68.143  1.00 223.76 ?  456  LEU C CD1   1 
ATOM   8065  C  CD2   . LEU C 1 584  ? 124.004 135.448 69.964  1.00 173.77 ?  456  LEU C CD2   1 
ATOM   8066  N  N     . ALA C 1 585  ? 128.342 138.546 69.678  1.00 153.87 ?  457  ALA C N     1 
ATOM   8067  C  CA    . ALA C 1 585  ? 129.701 138.898 69.284  1.00 123.19 ?  457  ALA C CA    1 
ATOM   8068  C  C     . ALA C 1 585  ? 130.730 138.049 70.022  1.00 147.69 ?  457  ALA C C     1 
ATOM   8069  O  O     . ALA C 1 585  ? 131.791 137.739 69.470  1.00 148.95 ?  457  ALA C O     1 
ATOM   8070  C  CB    . ALA C 1 585  ? 129.954 140.384 69.532  1.00 93.69  ?  457  ALA C CB    1 
ATOM   8071  N  N     . LEU C 1 586  ? 130.434 137.661 71.267  1.00 169.73 ?  458  LEU C N     1 
ATOM   8072  C  CA    . LEU C 1 586  ? 131.316 136.755 71.996  1.00 185.17 ?  458  LEU C CA    1 
ATOM   8073  C  C     . LEU C 1 586  ? 131.244 135.342 71.431  1.00 203.08 ?  458  LEU C C     1 
ATOM   8074  O  O     . LEU C 1 586  ? 132.278 134.722 71.149  1.00 216.84 ?  458  LEU C O     1 
ATOM   8075  C  CB    . LEU C 1 586  ? 130.968 136.748 73.485  1.00 189.64 ?  458  LEU C CB    1 
ATOM   8076  C  CG    . LEU C 1 586  ? 132.045 137.248 74.455  1.00 190.16 ?  458  LEU C CG    1 
ATOM   8077  C  CD1   . LEU C 1 586  ? 131.731 136.851 75.896  1.00 175.40 ?  458  LEU C CD1   1 
ATOM   8078  C  CD2   . LEU C 1 586  ? 133.413 136.731 74.041  1.00 194.03 ?  458  LEU C CD2   1 
ATOM   8079  N  N     . ARG C 1 587  ? 130.029 134.809 71.267  1.00 198.51 ?  459  ARG C N     1 
ATOM   8080  C  CA    . ARG C 1 587  ? 129.890 133.458 70.730  1.00 196.74 ?  459  ARG C CA    1 
ATOM   8081  C  C     . ARG C 1 587  ? 130.477 133.339 69.328  1.00 197.99 ?  459  ARG C C     1 
ATOM   8082  O  O     . ARG C 1 587  ? 130.802 132.230 68.893  1.00 204.92 ?  459  ARG C O     1 
ATOM   8083  C  CB    . ARG C 1 587  ? 128.421 133.028 70.727  1.00 193.97 ?  459  ARG C CB    1 
ATOM   8084  C  CG    . ARG C 1 587  ? 127.915 132.607 72.100  1.00 182.50 ?  459  ARG C CG    1 
ATOM   8085  C  CD    . ARG C 1 587  ? 127.024 131.379 72.021  1.00 193.69 ?  459  ARG C CD    1 
ATOM   8086  N  NE    . ARG C 1 587  ? 126.503 131.004 73.331  1.00 192.78 ?  459  ARG C NE    1 
ATOM   8087  C  CZ    . ARG C 1 587  ? 127.253 130.547 74.329  1.00 192.46 ?  459  ARG C CZ    1 
ATOM   8088  N  NH1   . ARG C 1 587  ? 128.564 130.423 74.180  1.00 188.82 ?  459  ARG C NH1   1 
ATOM   8089  N  NH2   . ARG C 1 587  ? 126.693 130.220 75.485  1.00 201.84 ?  459  ARG C NH2   1 
ATOM   8090  N  N     . ALA C 1 588  ? 130.619 134.457 68.612  1.00 204.42 ?  460  ALA C N     1 
ATOM   8091  C  CA    . ALA C 1 588  ? 131.385 134.451 67.372  1.00 219.24 ?  460  ALA C CA    1 
ATOM   8092  C  C     . ALA C 1 588  ? 132.882 134.344 67.637  1.00 216.79 ?  460  ALA C C     1 
ATOM   8093  O  O     . ALA C 1 588  ? 133.606 133.730 66.846  1.00 230.84 ?  460  ALA C O     1 
ATOM   8094  C  CB    . ALA C 1 588  ? 131.078 135.707 66.557  1.00 219.60 ?  460  ALA C CB    1 
ATOM   8095  N  N     . GLY C 1 589  ? 133.362 134.926 68.738  1.00 213.44 ?  461  GLY C N     1 
ATOM   8096  C  CA    . GLY C 1 589  ? 134.777 134.890 69.064  1.00 227.56 ?  461  GLY C CA    1 
ATOM   8097  C  C     . GLY C 1 589  ? 135.299 133.559 69.563  1.00 249.19 ?  461  GLY C C     1 
ATOM   8098  O  O     . GLY C 1 589  ? 136.514 133.414 69.727  1.00 256.16 ?  461  GLY C O     1 
ATOM   8099  N  N     . ASN C 1 590  ? 134.410 132.599 69.820  1.00 259.56 ?  462  ASN C N     1 
ATOM   8100  C  CA    . ASN C 1 590  ? 134.662 131.202 70.193  1.00 274.52 ?  462  ASN C CA    1 
ATOM   8101  C  C     . ASN C 1 590  ? 135.034 131.003 71.664  1.00 272.88 ?  462  ASN C C     1 
ATOM   8102  O  O     . ASN C 1 590  ? 135.232 129.854 72.071  1.00 271.55 ?  462  ASN C O     1 
ATOM   8103  C  CB    . ASN C 1 590  ? 135.750 130.543 69.324  1.00 282.10 ?  462  ASN C CB    1 
ATOM   8104  C  CG    . ASN C 1 590  ? 135.490 129.064 69.080  1.00 287.42 ?  462  ASN C CG    1 
ATOM   8105  O  OD1   . ASN C 1 590  ? 135.974 128.487 68.104  1.00 289.73 ?  462  ASN C OD1   1 
ATOM   8106  N  ND2   . ASN C 1 590  ? 134.715 128.446 69.964  1.00 279.87 ?  462  ASN C ND2   1 
ATOM   8107  N  N     . GLU C 1 591  ? 135.125 132.056 72.474  1.00 262.63 ?  463  GLU C N     1 
ATOM   8108  C  CA    . GLU C 1 591  ? 135.427 131.890 73.898  1.00 246.98 ?  463  GLU C CA    1 
ATOM   8109  C  C     . GLU C 1 591  ? 134.126 131.695 74.681  1.00 219.20 ?  463  GLU C C     1 
ATOM   8110  O  O     . GLU C 1 591  ? 133.748 132.496 75.537  1.00 213.05 ?  463  GLU C O     1 
ATOM   8111  C  CB    . GLU C 1 591  ? 136.221 133.081 74.436  1.00 257.24 ?  463  GLU C CB    1 
ATOM   8112  C  CG    . GLU C 1 591  ? 137.246 133.684 73.477  1.00 288.72 ?  463  GLU C CG    1 
ATOM   8113  C  CD    . GLU C 1 591  ? 136.632 134.663 72.487  1.00 315.28 ?  463  GLU C CD    1 
ATOM   8114  O  OE1   . GLU C 1 591  ? 135.402 134.617 72.283  1.00 285.87 ?  463  GLU C OE1   1 
ATOM   8115  O  OE2   . GLU C 1 591  ? 137.385 135.451 71.874  1.00 456.97 -1 463  GLU C OE2   1 
ATOM   8116  N  N     . HIS C 1 592  ? 133.427 130.603 74.351  1.00 212.86 ?  464  HIS C N     1 
ATOM   8117  C  CA    . HIS C 1 592  ? 132.069 130.394 74.842  1.00 198.26 ?  464  HIS C CA    1 
ATOM   8118  C  C     . HIS C 1 592  ? 132.002 130.224 76.356  1.00 192.15 ?  464  HIS C C     1 
ATOM   8119  O  O     . HIS C 1 592  ? 130.914 130.350 76.926  1.00 196.16 ?  464  HIS C O     1 
ATOM   8120  C  CB    . HIS C 1 592  ? 131.438 129.184 74.142  1.00 203.48 ?  464  HIS C CB    1 
ATOM   8121  C  CG    . HIS C 1 592  ? 131.111 129.422 72.698  1.00 214.98 ?  464  HIS C CG    1 
ATOM   8122  N  ND1   . HIS C 1 592  ? 132.069 129.737 71.758  1.00 227.13 ?  464  HIS C ND1   1 
ATOM   8123  C  CD2   . HIS C 1 592  ? 129.931 129.389 72.035  1.00 217.72 ?  464  HIS C CD2   1 
ATOM   8124  C  CE1   . HIS C 1 592  ? 131.492 129.887 70.578  1.00 226.02 ?  464  HIS C CE1   1 
ATOM   8125  N  NE2   . HIS C 1 592  ? 130.195 129.684 70.720  1.00 224.14 ?  464  HIS C NE2   1 
ATOM   8126  N  N     . LYS C 1 593  ? 133.126 129.938 77.021  1.00 187.94 ?  465  LYS C N     1 
ATOM   8127  C  CA    . LYS C 1 593  ? 133.146 129.995 78.481  1.00 193.09 ?  465  LYS C CA    1 
ATOM   8128  C  C     . LYS C 1 593  ? 132.647 131.348 78.974  1.00 210.40 ?  465  LYS C C     1 
ATOM   8129  O  O     . LYS C 1 593  ? 131.781 131.428 79.853  1.00 217.82 ?  465  LYS C O     1 
ATOM   8130  C  CB    . LYS C 1 593  ? 134.555 129.726 79.011  1.00 30.00  ?  465  LYS C CB    1 
ATOM   8131  C  CG    . LYS C 1 593  ? 135.048 128.307 78.775  1.00 30.00  ?  465  LYS C CG    1 
ATOM   8132  C  CD    . LYS C 1 593  ? 136.460 128.117 79.303  1.00 30.00  ?  465  LYS C CD    1 
ATOM   8133  C  CE    . LYS C 1 593  ? 136.944 126.693 79.089  1.00 30.00  ?  465  LYS C CE    1 
ATOM   8134  N  NZ    . LYS C 1 593  ? 138.335 126.498 79.580  1.00 30.00  ?  465  LYS C NZ    1 
ATOM   8135  N  N     . GLN C 1 594  ? 133.189 132.427 78.404  1.00 208.27 ?  466  GLN C N     1 
ATOM   8136  C  CA    . GLN C 1 594  ? 132.805 133.774 78.812  1.00 203.06 ?  466  GLN C CA    1 
ATOM   8137  C  C     . GLN C 1 594  ? 131.356 134.080 78.458  1.00 177.65 ?  466  GLN C C     1 
ATOM   8138  O  O     . GLN C 1 594  ? 130.682 134.803 79.196  1.00 166.34 ?  466  GLN C O     1 
ATOM   8139  C  CB    . GLN C 1 594  ? 133.746 134.796 78.173  1.00 196.08 ?  466  GLN C CB    1 
ATOM   8140  C  CG    . GLN C 1 594  ? 135.220 134.432 78.310  1.00 210.44 ?  466  GLN C CG    1 
ATOM   8141  C  CD    . GLN C 1 594  ? 136.106 135.170 77.325  1.00 202.51 ?  466  GLN C CD    1 
ATOM   8142  O  OE1   . GLN C 1 594  ? 137.312 134.929 77.257  1.00 201.53 ?  466  GLN C OE1   1 
ATOM   8143  N  NE2   . GLN C 1 594  ? 135.513 136.077 76.558  1.00 196.78 ?  466  GLN C NE2   1 
ATOM   8144  N  N     . ALA C 1 595  ? 130.857 133.534 77.347  1.00 174.21 ?  467  ALA C N     1 
ATOM   8145  C  CA    . ALA C 1 595  ? 129.449 133.713 77.009  1.00 163.99 ?  467  ALA C CA    1 
ATOM   8146  C  C     . ALA C 1 595  ? 128.544 133.033 78.030  1.00 162.46 ?  467  ALA C C     1 
ATOM   8147  O  O     . ALA C 1 595  ? 127.519 133.598 78.433  1.00 165.07 ?  467  ALA C O     1 
ATOM   8148  C  CB    . ALA C 1 595  ? 129.178 133.177 75.604  1.00 172.70 ?  467  ALA C CB    1 
ATOM   8149  N  N     . ASP C 1 596  ? 128.906 131.819 78.457  1.00 176.40 ?  468  ASP C N     1 
ATOM   8150  C  CA    . ASP C 1 596  ? 128.137 131.137 79.495  1.00 180.89 ?  468  ASP C CA    1 
ATOM   8151  C  C     . ASP C 1 596  ? 128.177 131.900 80.813  1.00 168.31 ?  468  ASP C C     1 
ATOM   8152  O  O     . ASP C 1 596  ? 127.154 132.028 81.494  1.00 163.13 ?  468  ASP C O     1 
ATOM   8153  C  CB    . ASP C 1 596  ? 128.649 129.708 79.692  1.00 203.72 ?  468  ASP C CB    1 
ATOM   8154  C  CG    . ASP C 1 596  ? 128.789 128.944 78.386  1.00 230.77 ?  468  ASP C CG    1 
ATOM   8155  O  OD1   . ASP C 1 596  ? 128.319 129.450 77.345  1.00 214.55 ?  468  ASP C OD1   1 
ATOM   8156  O  OD2   . ASP C 1 596  ? 129.383 127.844 78.397  1.00 328.92 -1 468  ASP C OD2   1 
ATOM   8157  N  N     . GLU C 1 597  ? 129.354 132.404 81.197  1.00 183.11 ?  469  GLU C N     1 
ATOM   8158  C  CA    . GLU C 1 597  ? 129.450 133.210 82.414  1.00 180.70 ?  469  GLU C CA    1 
ATOM   8159  C  C     . GLU C 1 597  ? 128.597 134.468 82.313  1.00 155.78 ?  469  GLU C C     1 
ATOM   8160  O  O     . GLU C 1 597  ? 127.944 134.868 83.285  1.00 154.47 ?  469  GLU C O     1 
ATOM   8161  C  CB    . GLU C 1 597  ? 130.907 133.578 82.694  1.00 225.02 ?  469  GLU C CB    1 
ATOM   8162  C  CG    . GLU C 1 597  ? 131.868 132.400 82.742  1.00 275.63 ?  469  GLU C CG    1 
ATOM   8163  C  CD    . GLU C 1 597  ? 133.243 132.746 82.192  1.00 297.39 ?  469  GLU C CD    1 
ATOM   8164  O  OE1   . GLU C 1 597  ? 133.536 133.950 82.027  1.00 265.14 ?  469  GLU C OE1   1 
ATOM   8165  O  OE2   . GLU C 1 597  ? 134.028 131.813 81.918  1.00 425.86 -1 469  GLU C OE2   1 
ATOM   8166  N  N     . LEU C 1 598  ? 128.595 135.109 81.145  1.00 152.12 ?  470  LEU C N     1 
ATOM   8167  C  CA    . LEU C 1 598  ? 127.802 136.317 80.964  1.00 156.09 ?  470  LEU C CA    1 
ATOM   8168  C  C     . LEU C 1 598  ? 126.315 136.019 81.080  1.00 166.81 ?  470  LEU C C     1 
ATOM   8169  O  O     . LEU C 1 598  ? 125.576 136.745 81.755  1.00 176.05 ?  470  LEU C O     1 
ATOM   8170  C  CB    . LEU C 1 598  ? 128.120 136.954 79.615  1.00 161.01 ?  470  LEU C CB    1 
ATOM   8171  C  CG    . LEU C 1 598  ? 127.460 138.319 79.431  1.00 190.76 ?  470  LEU C CG    1 
ATOM   8172  C  CD1   . LEU C 1 598  ? 128.118 139.350 80.329  1.00 202.11 ?  470  LEU C CD1   1 
ATOM   8173  C  CD2   . LEU C 1 598  ? 127.506 138.754 77.976  1.00 209.55 ?  470  LEU C CD2   1 
ATOM   8174  N  N     . GLU C 1 599  ? 125.853 134.958 80.415  1.00 172.68 ?  471  GLU C N     1 
ATOM   8175  C  CA    . GLU C 1 599  ? 124.459 134.555 80.564  1.00 188.36 ?  471  GLU C CA    1 
ATOM   8176  C  C     . GLU C 1 599  ? 124.141 134.192 82.009  1.00 183.42 ?  471  GLU C C     1 
ATOM   8177  O  O     . GLU C 1 599  ? 123.027 134.443 82.483  1.00 192.16 ?  471  GLU C O     1 
ATOM   8178  C  CB    . GLU C 1 599  ? 124.140 133.387 79.628  1.00 206.07 ?  471  GLU C CB    1 
ATOM   8179  C  CG    . GLU C 1 599  ? 122.776 132.752 79.873  1.00 230.52 ?  471  GLU C CG    1 
ATOM   8180  C  CD    . GLU C 1 599  ? 121.957 132.592 78.606  1.00 277.09 ?  471  GLU C CD    1 
ATOM   8181  O  OE1   . GLU C 1 599  ? 122.463 132.945 77.519  1.00 250.01 ?  471  GLU C OE1   1 
ATOM   8182  O  OE2   . GLU C 1 599  ? 120.807 132.115 78.699  1.00 412.31 -1 471  GLU C OE2   1 
ATOM   8183  N  N     . ALA C 1 600  ? 125.108 133.622 82.729  1.00 169.22 ?  472  ALA C N     1 
ATOM   8184  C  CA    . ALA C 1 600  ? 124.932 133.369 84.151  1.00 167.13 ?  472  ALA C CA    1 
ATOM   8185  C  C     . ALA C 1 600  ? 124.866 134.661 84.954  1.00 185.77 ?  472  ALA C C     1 
ATOM   8186  O  O     . ALA C 1 600  ? 124.320 134.659 86.063  1.00 197.76 ?  472  ALA C O     1 
ATOM   8187  C  CB    . ALA C 1 600  ? 126.066 132.485 84.668  1.00 135.73 ?  472  ALA C CB    1 
ATOM   8188  N  N     . MET C 1 601  ? 125.412 135.761 84.423  1.00 174.05 ?  473  MET C N     1 
ATOM   8189  C  CA    . MET C 1 601  ? 125.332 137.041 85.121  1.00 182.84 ?  473  MET C CA    1 
ATOM   8190  C  C     . MET C 1 601  ? 123.947 137.667 84.992  1.00 184.77 ?  473  MET C C     1 
ATOM   8191  O  O     . MET C 1 601  ? 123.301 137.980 85.997  1.00 191.33 ?  473  MET C O     1 
ATOM   8192  C  CB    . MET C 1 601  ? 126.393 138.010 84.592  1.00 179.57 ?  473  MET C CB    1 
ATOM   8193  C  CG    . MET C 1 601  ? 126.905 138.988 85.644  1.00 195.59 ?  473  MET C CG    1 
ATOM   8194  S  SD    . MET C 1 601  ? 127.001 140.689 85.053  1.00 207.02 ?  473  MET C SD    1 
ATOM   8195  C  CE    . MET C 1 601  ? 125.259 141.046 84.859  1.00 165.30 ?  473  MET C CE    1 
ATOM   8196  N  N     . MET C 1 602  ? 123.478 137.872 83.763  1.00 186.46 ?  474  MET C N     1 
ATOM   8197  C  CA    . MET C 1 602  ? 122.162 138.454 83.532  1.00 191.16 ?  474  MET C CA    1 
ATOM   8198  C  C     . MET C 1 602  ? 121.086 137.424 83.850  1.00 203.51 ?  474  MET C C     1 
ATOM   8199  O  O     . MET C 1 602  ? 121.115 136.307 83.322  1.00 203.32 ?  474  MET C O     1 
ATOM   8200  C  CB    . MET C 1 602  ? 122.036 138.944 82.092  1.00 205.98 ?  474  MET C CB    1 
ATOM   8201  C  CG    . MET C 1 602  ? 123.041 140.014 81.699  1.00 201.34 ?  474  MET C CG    1 
ATOM   8202  S  SD    . MET C 1 602  ? 122.674 141.617 82.443  1.00 182.12 ?  474  MET C SD    1 
ATOM   8203  C  CE    . MET C 1 602  ? 121.091 141.993 81.690  1.00 170.04 ?  474  MET C CE    1 
ATOM   8204  N  N     . GLN C 1 603  ? 120.162 137.793 84.744  1.00 217.92 ?  475  GLN C N     1 
ATOM   8205  C  CA    . GLN C 1 603  ? 119.013 136.980 85.143  1.00 240.64 ?  475  GLN C CA    1 
ATOM   8206  C  C     . GLN C 1 603  ? 119.459 135.816 86.032  1.00 235.35 ?  475  GLN C C     1 
ATOM   8207  O  O     . GLN C 1 603  ? 118.627 135.127 86.634  1.00 240.85 ?  475  GLN C O     1 
ATOM   8208  C  CB    . GLN C 1 603  ? 118.249 136.487 83.901  1.00 257.82 ?  475  GLN C CB    1 
ATOM   8209  C  CG    . GLN C 1 603  ? 117.057 135.567 84.157  1.00 264.00 ?  475  GLN C CG    1 
ATOM   8210  C  CD    . GLN C 1 603  ? 116.146 136.075 85.256  1.00 269.06 ?  475  GLN C CD    1 
ATOM   8211  O  OE1   . GLN C 1 603  ? 115.839 137.268 85.321  1.00 274.17 ?  475  GLN C OE1   1 
ATOM   8212  N  NE2   . GLN C 1 603  ? 115.723 135.177 86.137  1.00 259.61 ?  475  GLN C NE2   1 
ATOM   8213  N  N     . GLY C 1 604  ? 120.765 135.615 86.161  1.00 218.36 ?  476  GLY C N     1 
ATOM   8214  C  CA    . GLY C 1 604  ? 121.314 134.656 87.090  1.00 205.76 ?  476  GLY C CA    1 
ATOM   8215  C  C     . GLY C 1 604  ? 121.625 135.302 88.421  1.00 209.00 ?  476  GLY C C     1 
ATOM   8216  O  O     . GLY C 1 604  ? 121.149 136.394 88.739  1.00 204.91 ?  476  GLY C O     1 
ATOM   8217  N  N     . ARG C 1 605  ? 122.448 134.616 89.209  1.00 207.92 ?  477  ARG C N     1 
ATOM   8218  C  CA    . ARG C 1 605  ? 122.945 135.195 90.458  1.00 201.15 ?  477  ARG C CA    1 
ATOM   8219  C  C     . ARG C 1 605  ? 124.207 136.026 90.201  1.00 208.00 ?  477  ARG C C     1 
ATOM   8220  O  O     . ARG C 1 605  ? 125.238 135.909 90.862  1.00 200.16 ?  477  ARG C O     1 
ATOM   8221  C  CB    . ARG C 1 605  ? 123.171 134.090 91.492  1.00 201.19 ?  477  ARG C CB    1 
ATOM   8222  C  CG    . ARG C 1 605  ? 124.441 133.216 91.386  1.00 208.27 ?  477  ARG C CG    1 
ATOM   8223  C  CD    . ARG C 1 605  ? 124.662 132.571 90.027  1.00 204.94 ?  477  ARG C CD    1 
ATOM   8224  N  NE    . ARG C 1 605  ? 126.044 132.112 89.896  1.00 162.52 ?  477  ARG C NE    1 
ATOM   8225  C  CZ    . ARG C 1 605  ? 126.551 131.546 88.806  1.00 108.85 ?  477  ARG C CZ    1 
ATOM   8226  N  NH1   . ARG C 1 605  ? 127.823 131.169 88.787  1.00 70.51  ?  477  ARG C NH1   1 
ATOM   8227  N  NH2   . ARG C 1 605  ? 125.789 131.364 87.735  1.00 118.35 ?  477  ARG C NH2   1 
ATOM   8228  N  N     . GLY C 1 606  ? 124.085 136.952 89.250  1.00 224.07 ?  478  GLY C N     1 
ATOM   8229  C  CA    . GLY C 1 606  ? 125.229 137.626 88.664  1.00 246.28 ?  478  GLY C CA    1 
ATOM   8230  C  C     . GLY C 1 606  ? 125.947 138.638 89.535  1.00 269.35 ?  478  GLY C C     1 
ATOM   8231  O  O     . GLY C 1 606  ? 126.675 139.495 89.021  1.00 271.75 ?  478  GLY C O     1 
ATOM   8232  N  N     . PHE C 1 607  ? 125.746 138.557 90.850  1.00 255.60 ?  479  PHE C N     1 
ATOM   8233  C  CA    . PHE C 1 607  ? 126.480 139.371 91.809  1.00 239.08 ?  479  PHE C CA    1 
ATOM   8234  C  C     . PHE C 1 607  ? 127.609 138.602 92.496  1.00 205.74 ?  479  PHE C C     1 
ATOM   8235  O  O     . PHE C 1 607  ? 128.246 139.144 93.406  1.00 168.91 ?  479  PHE C O     1 
ATOM   8236  C  CB    . PHE C 1 607  ? 125.518 139.958 92.856  1.00 216.42 ?  479  PHE C CB    1 
ATOM   8237  C  CG    . PHE C 1 607  ? 124.362 140.745 92.265  1.00 221.51 ?  479  PHE C CG    1 
ATOM   8238  C  CD1   . PHE C 1 607  ? 124.487 142.103 92.006  1.00 199.19 ?  479  PHE C CD1   1 
ATOM   8239  C  CD2   . PHE C 1 607  ? 123.160 140.125 91.959  1.00 226.49 ?  479  PHE C CD2   1 
ATOM   8240  C  CE1   . PHE C 1 607  ? 123.431 142.826 91.460  1.00 179.71 ?  479  PHE C CE1   1 
ATOM   8241  C  CE2   . PHE C 1 607  ? 122.102 140.848 91.416  1.00 209.75 ?  479  PHE C CE2   1 
ATOM   8242  C  CZ    . PHE C 1 607  ? 122.243 142.197 91.167  1.00 199.27 ?  479  PHE C CZ    1 
ATOM   8243  N  N     . GLY C 1 608  ? 127.868 137.360 92.085  1.00 180.78 ?  480  GLY C N     1 
ATOM   8244  C  CA    . GLY C 1 608  ? 129.038 136.623 92.531  1.00 113.88 ?  480  GLY C CA    1 
ATOM   8245  C  C     . GLY C 1 608  ? 128.757 135.462 93.464  1.00 69.14  ?  480  GLY C C     1 
ATOM   8246  O  O     . GLY C 1 608  ? 129.344 134.385 93.315  1.00 66.84  ?  480  GLY C O     1 
ATOM   8247  N  N     . LEU C 1 609  ? 127.840 135.659 94.411  1.00 73.08  ?  481  LEU C N     1 
ATOM   8248  C  CA    . LEU C 1 609  ? 127.612 134.688 95.473  1.00 54.35  ?  481  LEU C CA    1 
ATOM   8249  C  C     . LEU C 1 609  ? 126.249 134.942 96.106  1.00 55.25  ?  481  LEU C C     1 
ATOM   8250  O  O     . LEU C 1 609  ? 125.943 136.084 96.455  1.00 68.34  ?  481  LEU C O     1 
ATOM   8251  C  CB    . LEU C 1 609  ? 128.715 134.801 96.523  1.00 36.72  ?  481  LEU C CB    1 
ATOM   8252  C  CG    . LEU C 1 609  ? 128.562 133.880 97.717  1.00 30.04  ?  481  LEU C CG    1 
ATOM   8253  C  CD1   . LEU C 1 609  ? 129.278 132.590 97.430  1.00 33.89  ?  481  LEU C CD1   1 
ATOM   8254  C  CD2   . LEU C 1 609  ? 129.098 134.547 98.967  1.00 23.30  ?  481  LEU C CD2   1 
ATOM   8255  N  N     . HIS C 1 610  ? 125.440 133.891 96.267  1.00 43.50  ?  482  HIS C N     1 
ATOM   8256  C  CA    . HIS C 1 610  ? 124.077 134.047 96.787  1.00 52.84  ?  482  HIS C CA    1 
ATOM   8257  C  C     . HIS C 1 610  ? 124.115 134.582 98.223  1.00 49.24  ?  482  HIS C C     1 
ATOM   8258  O  O     . HIS C 1 610  ? 124.735 133.949 99.091  1.00 51.67  ?  482  HIS C O     1 
ATOM   8259  C  CB    . HIS C 1 610  ? 123.327 132.704 96.715  1.00 57.32  ?  482  HIS C CB    1 
ATOM   8260  C  CG    . HIS C 1 610  ? 121.836 132.822 96.841  1.00 82.95  ?  482  HIS C CG    1 
ATOM   8261  N  ND1   . HIS C 1 610  ? 121.224 133.815 97.576  1.00 78.57  ?  482  HIS C ND1   1 
ATOM   8262  C  CD2   . HIS C 1 610  ? 120.835 132.080 96.306  1.00 103.58 ?  482  HIS C CD2   1 
ATOM   8263  C  CE1   . HIS C 1 610  ? 119.912 133.674 97.501  1.00 99.80  ?  482  HIS C CE1   1 
ATOM   8264  N  NE2   . HIS C 1 610  ? 119.650 132.630 96.734  1.00 112.06 ?  482  HIS C NE2   1 
ATOM   8265  N  N     . PRO C 1 611  ? 123.472 135.757 98.520  1.00 43.76  ?  483  PRO C N     1 
ATOM   8266  C  CA    . PRO C 1 611  ? 123.558 136.353 99.869  1.00 28.23  ?  483  PRO C CA    1 
ATOM   8267  C  C     . PRO C 1 611  ? 123.152 135.423 101.000 1.00 35.92  ?  483  PRO C C     1 
ATOM   8268  O  O     . PRO C 1 611  ? 123.477 135.657 102.170 1.00 30.91  ?  483  PRO C O     1 
ATOM   8269  C  CB    . PRO C 1 611  ? 122.596 137.545 99.787  1.00 16.83  ?  483  PRO C CB    1 
ATOM   8270  C  CG    . PRO C 1 611  ? 122.587 137.911 98.373  1.00 23.58  ?  483  PRO C CG    1 
ATOM   8271  C  CD    . PRO C 1 611  ? 122.728 136.630 97.595  1.00 39.77  ?  483  PRO C CD    1 
ATOM   8272  N  N     . ALA C 1 612  ? 122.421 134.368 100.654 1.00 40.44  ?  484  ALA C N     1 
ATOM   8273  C  CA    . ALA C 1 612  ? 121.991 133.402 101.655 1.00 53.97  ?  484  ALA C CA    1 
ATOM   8274  C  C     . ALA C 1 612  ? 123.186 132.671 102.272 1.00 56.84  ?  484  ALA C C     1 
ATOM   8275  O  O     . ALA C 1 612  ? 123.321 132.597 103.501 1.00 57.75  ?  484  ALA C O     1 
ATOM   8276  C  CB    . ALA C 1 612  ? 121.005 132.420 101.022 1.00 55.50  ?  484  ALA C CB    1 
ATOM   8277  N  N     . VAL C 1 613  ? 124.067 132.118 101.431 1.00 49.32  ?  485  VAL C N     1 
ATOM   8278  C  CA    . VAL C 1 613  ? 125.263 131.450 101.943 1.00 47.14  ?  485  VAL C CA    1 
ATOM   8279  C  C     . VAL C 1 613  ? 126.185 132.455 102.625 1.00 37.71  ?  485  VAL C C     1 
ATOM   8280  O  O     . VAL C 1 613  ? 126.945 132.105 103.538 1.00 41.92  ?  485  VAL C O     1 
ATOM   8281  C  CB    . VAL C 1 613  ? 125.980 130.676 100.815 1.00 47.51  ?  485  VAL C CB    1 
ATOM   8282  C  CG1   . VAL C 1 613  ? 126.932 131.577 100.044 1.00 44.60  ?  485  VAL C CG1   1 
ATOM   8283  C  CG2   . VAL C 1 613  ? 126.727 129.479 101.385 1.00 50.78  ?  485  VAL C CG2   1 
ATOM   8284  N  N     . CYS C 1 614  ? 126.121 133.720 102.212 1.00 41.41  ?  486  CYS C N     1 
ATOM   8285  C  CA    . CYS C 1 614  ? 126.866 134.772 102.893 1.00 44.06  ?  486  CYS C CA    1 
ATOM   8286  C  C     . CYS C 1 614  ? 126.392 134.938 104.336 1.00 32.79  ?  486  CYS C C     1 
ATOM   8287  O  O     . CYS C 1 614  ? 127.206 135.030 105.267 1.00 37.81  ?  486  CYS C O     1 
ATOM   8288  C  CB    . CYS C 1 614  ? 126.722 136.073 102.102 1.00 59.33  ?  486  CYS C CB    1 
ATOM   8289  S  SG    . CYS C 1 614  ? 126.930 137.587 103.038 1.00 160.84 ?  486  CYS C SG    1 
ATOM   8290  N  N     . LEU C 1 615  ? 125.076 134.966 104.548 1.00 28.78  ?  487  LEU C N     1 
ATOM   8291  C  CA    . LEU C 1 615  ? 124.562 135.046 105.913 1.00 13.37  ?  487  LEU C CA    1 
ATOM   8292  C  C     . LEU C 1 615  ? 124.937 133.797 106.704 1.00 18.01  ?  487  LEU C C     1 
ATOM   8293  O  O     . LEU C 1 615  ? 125.302 133.878 107.885 1.00 16.75  ?  487  LEU C O     1 
ATOM   8294  C  CB    . LEU C 1 615  ? 123.051 135.237 105.886 1.00 11.39  ?  487  LEU C CB    1 
ATOM   8295  C  CG    . LEU C 1 615  ? 122.384 135.043 107.240 1.00 12.29  ?  487  LEU C CG    1 
ATOM   8296  C  CD1   . LEU C 1 615  ? 122.774 136.163 108.184 1.00 7.14   ?  487  LEU C CD1   1 
ATOM   8297  C  CD2   . LEU C 1 615  ? 120.879 134.941 107.084 1.00 35.22  ?  487  LEU C CD2   1 
ATOM   8298  N  N     . ALA C 1 616  ? 124.835 132.624 106.067 1.00 27.04  ?  488  ALA C N     1 
ATOM   8299  C  CA    . ALA C 1 616  ? 125.220 131.382 106.735 1.00 16.83  ?  488  ALA C CA    1 
ATOM   8300  C  C     . ALA C 1 616  ? 126.660 131.448 107.228 1.00 16.87  ?  488  ALA C C     1 
ATOM   8301  O  O     . ALA C 1 616  ? 126.963 131.047 108.355 1.00 14.84  ?  488  ALA C O     1 
ATOM   8302  C  CB    . ALA C 1 616  ? 125.042 130.193 105.794 1.00 25.82  ?  488  ALA C CB    1 
ATOM   8303  N  N     . ILE C 1 617  ? 127.569 131.940 106.385 1.00 22.24  ?  489  ILE C N     1 
ATOM   8304  C  CA    . ILE C 1 617  ? 128.958 132.085 106.807 1.00 27.37  ?  489  ILE C CA    1 
ATOM   8305  C  C     . ILE C 1 617  ? 129.172 133.213 107.801 1.00 17.92  ?  489  ILE C C     1 
ATOM   8306  O  O     . ILE C 1 617  ? 130.205 133.237 108.471 1.00 23.56  ?  489  ILE C O     1 
ATOM   8307  C  CB    . ILE C 1 617  ? 129.882 132.211 105.585 1.00 14.23  ?  489  ILE C CB    1 
ATOM   8308  C  CG1   . ILE C 1 617  ? 131.192 131.486 105.887 1.00 27.30  ?  489  ILE C CG1   1 
ATOM   8309  C  CG2   . ILE C 1 617  ? 130.139 133.663 105.232 1.00 18.30  ?  489  ILE C CG2   1 
ATOM   8310  C  CD1   . ILE C 1 617  ? 131.000 130.028 106.098 1.00 29.45  ?  489  ILE C CD1   1 
ATOM   8311  N  N     . ARG C 1 618  ? 128.261 134.179 107.908 1.00 19.74  ?  490  ARG C N     1 
ATOM   8312  C  CA    . ARG C 1 618  ? 128.353 135.072 109.070 1.00 13.18  ?  490  ARG C CA    1 
ATOM   8313  C  C     . ARG C 1 618  ? 128.045 134.310 110.348 1.00 10.89  ?  490  ARG C C     1 
ATOM   8314  O  O     . ARG C 1 618  ? 128.760 134.425 111.347 1.00 16.26  ?  490  ARG C O     1 
ATOM   8315  C  CB    . ARG C 1 618  ? 127.406 136.258 108.961 1.00 13.92  ?  490  ARG C CB    1 
ATOM   8316  C  CG    . ARG C 1 618  ? 127.183 136.883 110.352 1.00 9.89   ?  490  ARG C CG    1 
ATOM   8317  C  CD    . ARG C 1 618  ? 126.702 138.311 110.317 1.00 14.03  ?  490  ARG C CD    1 
ATOM   8318  N  NE    . ARG C 1 618  ? 125.467 138.453 111.079 1.00 18.21  ?  490  ARG C NE    1 
ATOM   8319  C  CZ    . ARG C 1 618  ? 124.957 139.615 111.474 1.00 19.33  ?  490  ARG C CZ    1 
ATOM   8320  N  NH1   . ARG C 1 618  ? 123.823 139.649 112.171 1.00 28.35  ?  490  ARG C NH1   1 
ATOM   8321  N  NH2   . ARG C 1 618  ? 125.575 140.747 111.164 1.00 45.21  ?  490  ARG C NH2   1 
ATOM   8322  N  N     . VAL C 1 619  ? 126.950 133.556 110.341 1.00 12.83  ?  491  VAL C N     1 
ATOM   8323  C  CA    . VAL C 1 619  ? 126.489 132.918 111.565 1.00 9.09   ?  491  VAL C CA    1 
ATOM   8324  C  C     . VAL C 1 619  ? 127.209 131.598 111.798 1.00 12.70  ?  491  VAL C C     1 
ATOM   8325  O  O     . VAL C 1 619  ? 127.750 131.359 112.883 1.00 20.37  ?  491  VAL C O     1 
ATOM   8326  C  CB    . VAL C 1 619  ? 124.968 132.727 111.516 1.00 8.31   ?  491  VAL C CB    1 
ATOM   8327  C  CG1   . VAL C 1 619  ? 124.544 131.528 112.355 1.00 7.84   ?  491  VAL C CG1   1 
ATOM   8328  C  CG2   . VAL C 1 619  ? 124.276 133.991 111.980 1.00 28.13  ?  491  VAL C CG2   1 
ATOM   8329  N  N     . ASN C 1 620  ? 127.263 130.732 110.783 1.00 15.58  ?  492  ASN C N     1 
ATOM   8330  C  CA    . ASN C 1 620  ? 127.670 129.345 111.012 1.00 17.41  ?  492  ASN C CA    1 
ATOM   8331  C  C     . ASN C 1 620  ? 129.111 129.248 111.505 1.00 29.99  ?  492  ASN C C     1 
ATOM   8332  O  O     . ASN C 1 620  ? 129.585 128.164 111.858 1.00 26.98  ?  492  ASN C O     1 
ATOM   8333  C  CB    . ASN C 1 620  ? 127.489 128.493 109.757 1.00 14.44  ?  492  ASN C CB    1 
ATOM   8334  C  CG    . ASN C 1 620  ? 127.505 127.013 110.065 1.00 17.55  ?  492  ASN C CG    1 
ATOM   8335  O  OD1   . ASN C 1 620  ? 127.292 126.605 111.213 1.00 23.29  ?  492  ASN C OD1   1 
ATOM   8336  N  ND2   . ASN C 1 620  ? 127.741 126.198 109.051 1.00 36.13  ?  492  ASN C ND2   1 
ATOM   8337  N  N     . THR C 1 621  ? 129.820 130.374 111.532 1.00 22.26  ?  493  THR C N     1 
ATOM   8338  C  CA    . THR C 1 621  ? 131.130 130.435 112.164 1.00 13.27  ?  493  THR C CA    1 
ATOM   8339  C  C     . THR C 1 621  ? 131.208 131.602 113.142 1.00 12.95  ?  493  THR C C     1 
ATOM   8340  O  O     . THR C 1 621  ? 132.275 132.184 113.345 1.00 15.93  ?  493  THR C O     1 
ATOM   8341  C  CB    . THR C 1 621  ? 132.246 130.513 111.126 1.00 16.00  ?  493  THR C CB    1 
ATOM   8342  O  OG1   . THR C 1 621  ? 133.473 130.887 111.759 1.00 21.11  ?  493  THR C OG1   1 
ATOM   8343  C  CG2   . THR C 1 621  ? 131.922 131.519 110.083 1.00 16.95  ?  493  THR C CG2   1 
ATOM   8344  N  N     . PHE C 1 622  ? 130.077 131.972 113.736 1.00 19.48  ?  494  PHE C N     1 
ATOM   8345  C  CA    . PHE C 1 622  ? 130.020 132.833 114.912 1.00 19.21  ?  494  PHE C CA    1 
ATOM   8346  C  C     . PHE C 1 622  ? 130.669 134.194 114.688 1.00 19.26  ?  494  PHE C C     1 
ATOM   8347  O  O     . PHE C 1 622  ? 130.888 134.938 115.650 1.00 16.75  ?  494  PHE C O     1 
ATOM   8348  C  CB    . PHE C 1 622  ? 130.664 132.139 116.116 1.00 30.12  ?  494  PHE C CB    1 
ATOM   8349  C  CG    . PHE C 1 622  ? 130.089 130.782 116.412 1.00 44.47  ?  494  PHE C CG    1 
ATOM   8350  C  CD1   . PHE C 1 622  ? 130.477 129.667 115.686 1.00 77.13  ?  494  PHE C CD1   1 
ATOM   8351  C  CD2   . PHE C 1 622  ? 129.155 130.620 117.414 1.00 59.59  ?  494  PHE C CD2   1 
ATOM   8352  C  CE1   . PHE C 1 622  ? 129.942 128.420 115.953 1.00 109.92 ?  494  PHE C CE1   1 
ATOM   8353  C  CE2   . PHE C 1 622  ? 128.621 129.368 117.683 1.00 115.47 ?  494  PHE C CE2   1 
ATOM   8354  C  CZ    . PHE C 1 622  ? 129.015 128.275 116.953 1.00 134.33 ?  494  PHE C CZ    1 
ATOM   8355  N  N     . LEU C 1 623  ? 130.979 134.538 113.442 1.00 38.70  ?  495  LEU C N     1 
ATOM   8356  C  CA    . LEU C 1 623  ? 131.657 135.792 113.164 1.00 15.50  ?  495  LEU C CA    1 
ATOM   8357  C  C     . LEU C 1 623  ? 130.829 136.979 113.622 1.00 13.27  ?  495  LEU C C     1 
ATOM   8358  O  O     . LEU C 1 623  ? 129.602 136.993 113.502 1.00 12.38  ?  495  LEU C O     1 
ATOM   8359  C  CB    . LEU C 1 623  ? 131.948 135.922 111.676 1.00 21.13  ?  495  LEU C CB    1 
ATOM   8360  C  CG    . LEU C 1 623  ? 133.441 136.017 111.408 1.00 36.87  ?  495  LEU C CG    1 
ATOM   8361  C  CD1   . LEU C 1 623  ? 133.668 136.473 109.978 1.00 60.20  ?  495  LEU C CD1   1 
ATOM   8362  C  CD2   . LEU C 1 623  ? 134.108 136.944 112.418 1.00 38.42  ?  495  LEU C CD2   1 
ATOM   8363  N  N     . SER C 1 624  ? 131.519 137.994 114.120 1.00 25.64  ?  496  SER C N     1 
ATOM   8364  C  CA    . SER C 1 624  ? 130.869 139.203 114.597 1.00 37.27  ?  496  SER C CA    1 
ATOM   8365  C  C     . SER C 1 624  ? 130.431 140.050 113.402 1.00 27.33  ?  496  SER C C     1 
ATOM   8366  O  O     . SER C 1 624  ? 130.569 139.669 112.236 1.00 26.92  ?  496  SER C O     1 
ATOM   8367  C  CB    . SER C 1 624  ? 131.799 139.964 115.533 1.00 39.04  ?  496  SER C CB    1 
ATOM   8368  O  OG    . SER C 1 624  ? 131.607 141.363 115.419 1.00 28.96  ?  496  SER C OG    1 
ATOM   8369  N  N     . CYS C 1 625  ? 129.912 141.239 113.695 1.00 19.16  ?  497  CYS C N     1 
ATOM   8370  C  CA    . CYS C 1 625  ? 129.295 142.087 112.686 1.00 19.67  ?  497  CYS C CA    1 
ATOM   8371  C  C     . CYS C 1 625  ? 130.268 143.125 112.139 1.00 19.78  ?  497  CYS C C     1 
ATOM   8372  O  O     . CYS C 1 625  ? 130.511 143.165 110.931 1.00 17.24  ?  497  CYS C O     1 
ATOM   8373  C  CB    . CYS C 1 625  ? 128.049 142.766 113.262 1.00 41.09  ?  497  CYS C CB    1 
ATOM   8374  S  SG    . CYS C 1 625  ? 126.734 141.626 113.771 1.00 148.12 ?  497  CYS C SG    1 
ATOM   8375  N  N     . SER C 1 626  ? 130.828 143.972 112.998 1.00 11.41  ?  498  SER C N     1 
ATOM   8376  C  CA    . SER C 1 626  ? 131.863 144.878 112.518 1.00 12.49  ?  498  SER C CA    1 
ATOM   8377  C  C     . SER C 1 626  ? 133.003 144.078 111.893 1.00 18.73  ?  498  SER C C     1 
ATOM   8378  O  O     . SER C 1 626  ? 133.644 144.519 110.925 1.00 19.98  ?  498  SER C O     1 
ATOM   8379  C  CB    . SER C 1 626  ? 132.360 145.766 113.660 1.00 11.53  ?  498  SER C CB    1 
ATOM   8380  O  OG    . SER C 1 626  ? 133.413 146.612 113.235 1.00 11.86  ?  498  SER C OG    1 
ATOM   8381  N  N     . GLN C 1 627  ? 133.259 142.889 112.444 1.00 13.71  ?  499  GLN C N     1 
ATOM   8382  C  CA    . GLN C 1 627  ? 134.109 141.876 111.838 1.00 9.58   ?  499  GLN C CA    1 
ATOM   8383  C  C     . GLN C 1 627  ? 133.816 141.695 110.362 1.00 10.40  ?  499  GLN C C     1 
ATOM   8384  O  O     . GLN C 1 627  ? 134.701 141.788 109.501 1.00 10.66  ?  499  GLN C O     1 
ATOM   8385  C  CB    . GLN C 1 627  ? 133.868 140.560 112.575 1.00 10.50  ?  499  GLN C CB    1 
ATOM   8386  C  CG    . GLN C 1 627  ? 134.633 140.443 113.835 1.00 10.20  ?  499  GLN C CG    1 
ATOM   8387  C  CD    . GLN C 1 627  ? 136.029 140.023 113.562 1.00 29.33  ?  499  GLN C CD    1 
ATOM   8388  O  OE1   . GLN C 1 627  ? 136.387 139.756 112.416 1.00 39.91  ?  499  GLN C OE1   1 
ATOM   8389  N  NE2   . GLN C 1 627  ? 136.848 139.975 114.600 1.00 51.97  ?  499  GLN C NE2   1 
ATOM   8390  N  N     . TYR C 1 628  ? 132.547 141.396 110.089 1.00 9.95   ?  500  TYR C N     1 
ATOM   8391  C  CA    . TYR C 1 628  ? 132.096 141.140 108.733 1.00 16.92  ?  500  TYR C CA    1 
ATOM   8392  C  C     . TYR C 1 628  ? 132.372 142.331 107.823 1.00 12.61  ?  500  TYR C C     1 
ATOM   8393  O  O     . TYR C 1 628  ? 132.849 142.158 106.700 1.00 16.12  ?  500  TYR C O     1 
ATOM   8394  C  CB    . TYR C 1 628  ? 130.610 140.781 108.733 1.00 16.39  ?  500  TYR C CB    1 
ATOM   8395  C  CG    . TYR C 1 628  ? 130.210 140.082 107.467 1.00 8.24   ?  500  TYR C CG    1 
ATOM   8396  C  CD1   . TYR C 1 628  ? 130.556 138.766 107.244 1.00 11.00  ?  500  TYR C CD1   1 
ATOM   8397  C  CD2   . TYR C 1 628  ? 129.553 140.760 106.466 1.00 9.49   ?  500  TYR C CD2   1 
ATOM   8398  C  CE1   . TYR C 1 628  ? 130.218 138.134 106.067 1.00 17.70  ?  500  TYR C CE1   1 
ATOM   8399  C  CE2   . TYR C 1 628  ? 129.216 140.141 105.291 1.00 13.28  ?  500  TYR C CE2   1 
ATOM   8400  C  CZ    . TYR C 1 628  ? 129.550 138.828 105.092 1.00 25.43  ?  500  TYR C CZ    1 
ATOM   8401  O  OH    . TYR C 1 628  ? 129.215 138.199 103.916 1.00 36.58  ?  500  TYR C OH    1 
ATOM   8402  N  N     . HIS C 1 629  ? 132.067 143.551 108.283 1.00 19.10  ?  501  HIS C N     1 
ATOM   8403  C  CA    . HIS C 1 629  ? 132.241 144.726 107.425 1.00 18.70  ?  501  HIS C CA    1 
ATOM   8404  C  C     . HIS C 1 629  ? 133.706 144.976 107.122 1.00 12.42  ?  501  HIS C C     1 
ATOM   8405  O  O     . HIS C 1 629  ? 134.054 145.381 106.008 1.00 16.49  ?  501  HIS C O     1 
ATOM   8406  C  CB    . HIS C 1 629  ? 131.637 145.980 108.062 1.00 17.52  ?  501  HIS C CB    1 
ATOM   8407  C  CG    . HIS C 1 629  ? 132.129 147.269 107.463 1.00 12.88  ?  501  HIS C CG    1 
ATOM   8408  N  ND1   . HIS C 1 629  ? 132.289 147.452 106.104 1.00 15.22  ?  501  HIS C ND1   1 
ATOM   8409  C  CD2   . HIS C 1 629  ? 132.488 148.439 108.043 1.00 19.29  ?  501  HIS C CD2   1 
ATOM   8410  C  CE1   . HIS C 1 629  ? 132.725 148.677 105.875 1.00 32.65  ?  501  HIS C CE1   1 
ATOM   8411  N  NE2   . HIS C 1 629  ? 132.854 149.296 107.034 1.00 37.29  ?  501  HIS C NE2   1 
ATOM   8412  N  N     . LYS C 1 630  ? 134.575 144.786 108.109 1.00 14.63  ?  502  LYS C N     1 
ATOM   8413  C  CA    . LYS C 1 630  ? 135.998 144.942 107.847 1.00 7.09   ?  502  LYS C CA    1 
ATOM   8414  C  C     . LYS C 1 630  ? 136.464 143.926 106.817 1.00 10.84  ?  502  LYS C C     1 
ATOM   8415  O  O     . LYS C 1 630  ? 137.139 144.270 105.835 1.00 7.73   ?  502  LYS C O     1 
ATOM   8416  C  CB    . LYS C 1 630  ? 136.783 144.806 109.146 1.00 7.95   ?  502  LYS C CB    1 
ATOM   8417  C  CG    . LYS C 1 630  ? 138.223 145.219 109.015 1.00 9.61   ?  502  LYS C CG    1 
ATOM   8418  C  CD    . LYS C 1 630  ? 138.645 146.093 110.182 1.00 10.93  ?  502  LYS C CD    1 
ATOM   8419  C  CE    . LYS C 1 630  ? 138.585 145.337 111.500 1.00 13.44  ?  502  LYS C CE    1 
ATOM   8420  N  NZ    . LYS C 1 630  ? 138.770 146.252 112.661 1.00 12.33  ?  502  LYS C NZ    1 
ATOM   8421  N  N     . MET C 1 631  ? 136.101 142.664 107.032 1.00 21.64  ?  503  MET C N     1 
ATOM   8422  C  CA    . MET C 1 631  ? 136.417 141.619 106.068 1.00 6.75   ?  503  MET C CA    1 
ATOM   8423  C  C     . MET C 1 631  ? 135.910 141.972 104.676 1.00 6.68   ?  503  MET C C     1 
ATOM   8424  O  O     . MET C 1 631  ? 136.597 141.747 103.668 1.00 7.73   ?  503  MET C O     1 
ATOM   8425  C  CB    . MET C 1 631  ? 135.810 140.300 106.546 1.00 15.38  ?  503  MET C CB    1 
ATOM   8426  C  CG    . MET C 1 631  ? 136.477 139.096 105.944 1.00 17.66  ?  503  MET C CG    1 
ATOM   8427  S  SD    . MET C 1 631  ? 135.402 138.141 104.870 1.00 13.76  ?  503  MET C SD    1 
ATOM   8428  C  CE    . MET C 1 631  ? 134.526 137.147 106.071 1.00 16.82  ?  503  MET C CE    1 
ATOM   8429  N  N     . TYR C 1 632  ? 134.703 142.529 104.605 1.00 14.73  ?  504  TYR C N     1 
ATOM   8430  C  CA    . TYR C 1 632  ? 134.114 142.878 103.319 1.00 13.58  ?  504  TYR C CA    1 
ATOM   8431  C  C     . TYR C 1 632  ? 134.905 143.992 102.648 1.00 21.18  ?  504  TYR C C     1 
ATOM   8432  O  O     . TYR C 1 632  ? 135.204 143.916 101.452 1.00 25.30  ?  504  TYR C O     1 
ATOM   8433  C  CB    . TYR C 1 632  ? 132.641 143.270 103.510 1.00 12.96  ?  504  TYR C CB    1 
ATOM   8434  C  CG    . TYR C 1 632  ? 132.077 144.167 102.424 1.00 14.48  ?  504  TYR C CG    1 
ATOM   8435  C  CD1   . TYR C 1 632  ? 131.549 143.646 101.258 1.00 15.10  ?  504  TYR C CD1   1 
ATOM   8436  C  CD2   . TYR C 1 632  ? 132.099 145.545 102.567 1.00 24.71  ?  504  TYR C CD2   1 
ATOM   8437  C  CE1   . TYR C 1 632  ? 131.035 144.478 100.263 1.00 36.08  ?  504  TYR C CE1   1 
ATOM   8438  C  CE2   . TYR C 1 632  ? 131.603 146.374 101.585 1.00 50.38  ?  504  TYR C CE2   1 
ATOM   8439  C  CZ    . TYR C 1 632  ? 131.068 145.843 100.435 1.00 43.89  ?  504  TYR C CZ    1 
ATOM   8440  O  OH    . TYR C 1 632  ? 130.573 146.697 99.467  1.00 62.81  ?  504  TYR C OH    1 
ATOM   8441  N  N     . ARG C 1 633  ? 135.224 145.048 103.398 1.00 20.05  ?  505  ARG C N     1 
ATOM   8442  C  CA    . ARG C 1 633  ? 136.112 146.090 102.890 1.00 17.59  ?  505  ARG C CA    1 
ATOM   8443  C  C     . ARG C 1 633  ? 137.355 145.476 102.275 1.00 16.22  ?  505  ARG C C     1 
ATOM   8444  O  O     . ARG C 1 633  ? 137.780 145.843 101.169 1.00 21.29  ?  505  ARG C O     1 
ATOM   8445  C  CB    . ARG C 1 633  ? 136.514 147.045 104.011 1.00 14.85  ?  505  ARG C CB    1 
ATOM   8446  C  CG    . ARG C 1 633  ? 136.724 148.471 103.557 1.00 21.28  ?  505  ARG C CG    1 
ATOM   8447  C  CD    . ARG C 1 633  ? 136.733 149.407 104.736 1.00 47.53  ?  505  ARG C CD    1 
ATOM   8448  N  NE    . ARG C 1 633  ? 137.697 148.988 105.747 1.00 46.05  ?  505  ARG C NE    1 
ATOM   8449  C  CZ    . ARG C 1 633  ? 137.884 149.618 106.901 1.00 59.54  ?  505  ARG C CZ    1 
ATOM   8450  N  NH1   . ARG C 1 633  ? 138.779 149.167 107.771 1.00 26.91  ?  505  ARG C NH1   1 
ATOM   8451  N  NH2   . ARG C 1 633  ? 137.171 150.701 107.190 1.00 100.11 ?  505  ARG C NH2   1 
ATOM   8452  N  N     . THR C 1 634  ? 137.941 144.525 102.993 1.00 15.12  ?  506  THR C N     1 
ATOM   8453  C  CA    . THR C 1 634  ? 139.168 143.894 102.543 1.00 15.64  ?  506  THR C CA    1 
ATOM   8454  C  C     . THR C 1 634  ? 138.966 143.229 101.192 1.00 15.23  ?  506  THR C C     1 
ATOM   8455  O  O     . THR C 1 634  ? 139.644 143.557 100.212 1.00 19.54  ?  506  THR C O     1 
ATOM   8456  C  CB    . THR C 1 634  ? 139.619 142.876 103.577 1.00 27.74  ?  506  THR C CB    1 
ATOM   8457  O  OG1   . THR C 1 634  ? 140.134 143.564 104.722 1.00 39.97  ?  506  THR C OG1   1 
ATOM   8458  C  CG2   . THR C 1 634  ? 140.714 142.005 103.007 1.00 33.32  ?  506  THR C CG2   1 
ATOM   8459  N  N     . VAL C 1 635  ? 138.023 142.286 101.125 1.00 14.84  ?  507  VAL C N     1 
ATOM   8460  C  CA    . VAL C 1 635  ? 137.872 141.479 99.916  1.00 19.10  ?  507  VAL C CA    1 
ATOM   8461  C  C     . VAL C 1 635  ? 137.492 142.363 98.732  1.00 22.14  ?  507  VAL C C     1 
ATOM   8462  O  O     . VAL C 1 635  ? 137.952 142.148 97.603  1.00 24.55  ?  507  VAL C O     1 
ATOM   8463  C  CB    . VAL C 1 635  ? 136.863 140.333 100.144 1.00 23.24  ?  507  VAL C CB    1 
ATOM   8464  C  CG1   . VAL C 1 635  ? 135.597 140.820 100.816 1.00 26.89  ?  507  VAL C CG1   1 
ATOM   8465  C  CG2   . VAL C 1 635  ? 136.535 139.611 98.831  1.00 14.20  ?  507  VAL C CG2   1 
ATOM   8466  N  N     . LYS C 1 636  ? 136.689 143.401 98.975  1.00 26.99  ?  508  LYS C N     1 
ATOM   8467  C  CA    . LYS C 1 636  ? 136.298 144.306 97.895  1.00 27.40  ?  508  LYS C CA    1 
ATOM   8468  C  C     . LYS C 1 636  ? 137.509 145.041 97.339  1.00 20.22  ?  508  LYS C C     1 
ATOM   8469  O  O     . LYS C 1 636  ? 137.794 144.991 96.137  1.00 17.01  ?  508  LYS C O     1 
ATOM   8470  C  CB    . LYS C 1 636  ? 135.264 145.311 98.406  1.00 43.53  ?  508  LYS C CB    1 
ATOM   8471  C  CG    . LYS C 1 636  ? 135.097 146.518 97.505  1.00 57.16  ?  508  LYS C CG    1 
ATOM   8472  C  CD    . LYS C 1 636  ? 134.123 146.236 96.368  1.00 66.33  ?  508  LYS C CD    1 
ATOM   8473  C  CE    . LYS C 1 636  ? 132.793 145.706 96.890  1.00 64.27  ?  508  LYS C CE    1 
ATOM   8474  N  NZ    . LYS C 1 636  ? 132.271 146.560 97.993  1.00 62.75  ?  508  LYS C NZ    1 
ATOM   8475  N  N     . ALA C 1 637  ? 138.230 145.746 98.211  1.00 29.97  ?  509  ALA C N     1 
ATOM   8476  C  CA    . ALA C 1 637  ? 139.381 146.515 97.761  1.00 40.85  ?  509  ALA C CA    1 
ATOM   8477  C  C     . ALA C 1 637  ? 140.485 145.631 97.200  1.00 35.64  ?  509  ALA C C     1 
ATOM   8478  O  O     . ALA C 1 637  ? 141.309 146.114 96.418  1.00 41.96  ?  509  ALA C O     1 
ATOM   8479  C  CB    . ALA C 1 637  ? 139.929 147.354 98.920  1.00 49.10  ?  509  ALA C CB    1 
ATOM   8480  N  N     . THR C 1 638  ? 140.530 144.354 97.584  1.00 33.44  ?  510  THR C N     1 
ATOM   8481  C  CA    . THR C 1 638  ? 141.668 143.514 97.237  1.00 39.14  ?  510  THR C CA    1 
ATOM   8482  C  C     . THR C 1 638  ? 141.701 143.158 95.762  1.00 43.68  ?  510  THR C C     1 
ATOM   8483  O  O     . THR C 1 638  ? 142.592 143.612 95.038  1.00 58.92  ?  510  THR C O     1 
ATOM   8484  C  CB    . THR C 1 638  ? 141.666 142.216 98.045  1.00 56.34  ?  510  THR C CB    1 
ATOM   8485  O  OG1   . THR C 1 638  ? 141.584 142.516 99.443  1.00 57.45  ?  510  THR C OG1   1 
ATOM   8486  C  CG2   . THR C 1 638  ? 142.940 141.431 97.758  1.00 62.80  ?  510  THR C CG2   1 
ATOM   8487  N  N     . SER C 1 639  ? 140.740 142.362 95.294  1.00 36.48  ?  511  SER C N     1 
ATOM   8488  C  CA    . SER C 1 639  ? 140.772 141.880 93.918  1.00 51.10  ?  511  SER C CA    1 
ATOM   8489  C  C     . SER C 1 639  ? 139.445 142.197 93.236  1.00 45.44  ?  511  SER C C     1 
ATOM   8490  O  O     . SER C 1 639  ? 138.569 141.340 93.099  1.00 46.68  ?  511  SER C O     1 
ATOM   8491  C  CB    . SER C 1 639  ? 141.092 140.381 93.863  1.00 48.29  ?  511  SER C CB    1 
ATOM   8492  O  OG    . SER C 1 639  ? 139.923 139.593 93.980  1.00 40.48  ?  511  SER C OG    1 
ATOM   8493  N  N     . GLY C 1 640  ? 139.307 143.452 92.818  1.00 48.92  ?  512  GLY C N     1 
ATOM   8494  C  CA    . GLY C 1 640  ? 138.525 143.819 91.658  1.00 71.97  ?  512  GLY C CA    1 
ATOM   8495  C  C     . GLY C 1 640  ? 137.096 143.325 91.570  1.00 72.78  ?  512  GLY C C     1 
ATOM   8496  O  O     . GLY C 1 640  ? 136.420 143.616 90.581  1.00 105.94 ?  512  GLY C O     1 
ATOM   8497  N  N     . ARG C 1 641  ? 136.613 142.578 92.557  1.00 43.11  ?  513  ARG C N     1 
ATOM   8498  C  CA    . ARG C 1 641  ? 135.304 141.961 92.436  1.00 48.31  ?  513  ARG C CA    1 
ATOM   8499  C  C     . ARG C 1 641  ? 134.531 142.121 93.739  1.00 51.23  ?  513  ARG C C     1 
ATOM   8500  O  O     . ARG C 1 641  ? 135.106 142.287 94.819  1.00 40.91  ?  513  ARG C O     1 
ATOM   8501  C  CB    . ARG C 1 641  ? 135.419 140.472 92.043  1.00 58.39  ?  513  ARG C CB    1 
ATOM   8502  C  CG    . ARG C 1 641  ? 134.114 139.835 91.561  1.00 86.74  ?  513  ARG C CG    1 
ATOM   8503  C  CD    . ARG C 1 641  ? 134.271 139.065 90.241  1.00 99.53  ?  513  ARG C CD    1 
ATOM   8504  N  NE    . ARG C 1 641  ? 135.033 137.834 90.408  1.00 98.43  ?  513  ARG C NE    1 
ATOM   8505  C  CZ    . ARG C 1 641  ? 136.323 137.702 90.110  1.00 120.90 ?  513  ARG C CZ    1 
ATOM   8506  N  NH1   . ARG C 1 641  ? 137.007 138.730 89.623  1.00 116.21 ?  513  ARG C NH1   1 
ATOM   8507  N  NH2   . ARG C 1 641  ? 136.931 136.541 90.305  1.00 139.83 ?  513  ARG C NH2   1 
ATOM   8508  N  N     . GLN C 1 642  ? 133.205 142.090 93.602  1.00 63.86  ?  514  GLN C N     1 
ATOM   8509  C  CA    . GLN C 1 642  ? 132.255 142.113 94.717  1.00 63.67  ?  514  GLN C CA    1 
ATOM   8510  C  C     . GLN C 1 642  ? 131.829 140.674 94.982  1.00 67.52  ?  514  GLN C C     1 
ATOM   8511  O  O     . GLN C 1 642  ? 130.921 140.143 94.340  1.00 82.01  ?  514  GLN C O     1 
ATOM   8512  C  CB    . GLN C 1 642  ? 131.048 142.985 94.399  1.00 83.38  ?  514  GLN C CB    1 
ATOM   8513  C  CG    . GLN C 1 642  ? 130.094 143.172 95.576  1.00 77.10  ?  514  GLN C CG    1 
ATOM   8514  C  CD    . GLN C 1 642  ? 128.734 143.701 95.146  1.00 94.43  ?  514  GLN C CD    1 
ATOM   8515  O  OE1   . GLN C 1 642  ? 128.322 143.545 93.993  1.00 116.64 ?  514  GLN C OE1   1 
ATOM   8516  N  NE2   . GLN C 1 642  ? 128.033 144.340 96.075  1.00 80.90  ?  514  GLN C NE2   1 
ATOM   8517  N  N     . ILE C 1 643  ? 132.495 140.042 95.940  1.00 45.89  ?  515  ILE C N     1 
ATOM   8518  C  CA    . ILE C 1 643  ? 132.246 138.652 96.273  1.00 23.95  ?  515  ILE C CA    1 
ATOM   8519  C  C     . ILE C 1 643  ? 131.298 138.524 97.459  1.00 20.50  ?  515  ILE C C     1 
ATOM   8520  O  O     . ILE C 1 643  ? 130.415 137.665 97.467  1.00 22.85  ?  515  ILE C O     1 
ATOM   8521  C  CB    . ILE C 1 643  ? 133.595 137.949 96.541  1.00 15.21  ?  515  ILE C CB    1 
ATOM   8522  C  CG1   . ILE C 1 643  ? 134.406 137.824 95.242  1.00 27.69  ?  515  ILE C CG1   1 
ATOM   8523  C  CG2   . ILE C 1 643  ? 133.395 136.602 97.180  1.00 15.98  ?  515  ILE C CG2   1 
ATOM   8524  C  CD1   . ILE C 1 643  ? 133.648 137.235 94.072  1.00 33.84  ?  515  ILE C CD1   1 
ATOM   8525  N  N     . PHE C 1 644  ? 131.454 139.391 98.457  1.00 18.39  ?  516  PHE C N     1 
ATOM   8526  C  CA    . PHE C 1 644  ? 130.713 139.311 99.710  1.00 14.76  ?  516  PHE C CA    1 
ATOM   8527  C  C     . PHE C 1 644  ? 129.687 140.430 99.759  1.00 16.29  ?  516  PHE C C     1 
ATOM   8528  O  O     . PHE C 1 644  ? 130.047 141.610 99.730  1.00 21.14  ?  516  PHE C O     1 
ATOM   8529  C  CB    . PHE C 1 644  ? 131.661 139.383 100.901 1.00 14.36  ?  516  PHE C CB    1 
ATOM   8530  C  CG    . PHE C 1 644  ? 132.287 138.074 101.224 1.00 21.28  ?  516  PHE C CG    1 
ATOM   8531  C  CD1   . PHE C 1 644  ? 132.036 136.980 100.421 1.00 29.75  ?  516  PHE C CD1   1 
ATOM   8532  C  CD2   . PHE C 1 644  ? 133.111 137.919 102.315 1.00 20.53  ?  516  PHE C CD2   1 
ATOM   8533  C  CE1   . PHE C 1 644  ? 132.593 135.768 100.696 1.00 41.68  ?  516  PHE C CE1   1 
ATOM   8534  C  CE2   . PHE C 1 644  ? 133.670 136.688 102.590 1.00 16.34  ?  516  PHE C CE2   1 
ATOM   8535  C  CZ    . PHE C 1 644  ? 133.409 135.621 101.779 1.00 30.36  ?  516  PHE C CZ    1 
ATOM   8536  N  N     . GLN C 1 645  ? 128.420 140.058 99.839  1.00 17.57  ?  517  GLN C N     1 
ATOM   8537  C  CA    . GLN C 1 645  ? 127.351 141.039 99.817  1.00 21.85  ?  517  GLN C CA    1 
ATOM   8538  C  C     . GLN C 1 645  ? 127.450 141.954 101.035 1.00 14.78  ?  517  GLN C C     1 
ATOM   8539  O  O     . GLN C 1 645  ? 127.772 141.487 102.132 1.00 16.35  ?  517  GLN C O     1 
ATOM   8540  C  CB    . GLN C 1 645  ? 126.003 140.322 99.763  1.00 31.65  ?  517  GLN C CB    1 
ATOM   8541  C  CG    . GLN C 1 645  ? 126.042 139.050 98.914  1.00 33.47  ?  517  GLN C CG    1 
ATOM   8542  C  CD    . GLN C 1 645  ? 126.010 139.335 97.428  1.00 38.56  ?  517  GLN C CD    1 
ATOM   8543  O  OE1   . GLN C 1 645  ? 125.945 140.488 97.005  1.00 43.91  ?  517  GLN C OE1   1 
ATOM   8544  N  NE2   . GLN C 1 645  ? 126.064 138.281 96.623  1.00 62.14  ?  517  GLN C NE2   1 
ATOM   8545  N  N     . PRO C 1 646  ? 127.215 143.246 100.881 1.00 9.28   ?  518  PRO C N     1 
ATOM   8546  C  CA    . PRO C 1 646  ? 127.331 144.167 102.020 1.00 18.40  ?  518  PRO C CA    1 
ATOM   8547  C  C     . PRO C 1 646  ? 126.265 143.974 103.082 1.00 10.89  ?  518  PRO C C     1 
ATOM   8548  O  O     . PRO C 1 646  ? 125.443 143.057 103.015 1.00 12.43  ?  518  PRO C O     1 
ATOM   8549  C  CB    . PRO C 1 646  ? 127.221 145.553 101.369 1.00 16.45  ?  518  PRO C CB    1 
ATOM   8550  C  CG    . PRO C 1 646  ? 126.695 145.315 100.008 1.00 36.07  ?  518  PRO C CG    1 
ATOM   8551  C  CD    . PRO C 1 646  ? 127.151 143.959 99.601  1.00 15.83  ?  518  PRO C CD    1 
ATOM   8552  N  N     . LEU C 1 647  ? 126.284 144.864 104.068 1.00 22.34  ?  519  LEU C N     1 
ATOM   8553  C  CA    . LEU C 1 647  ? 125.584 144.619 105.320 1.00 15.28  ?  519  LEU C CA    1 
ATOM   8554  C  C     . LEU C 1 647  ? 124.082 144.764 105.164 1.00 24.84  ?  519  LEU C C     1 
ATOM   8555  O  O     . LEU C 1 647  ? 123.326 143.826 105.436 1.00 9.01   ?  519  LEU C O     1 
ATOM   8556  C  CB    . LEU C 1 647  ? 126.089 145.581 106.382 1.00 17.95  ?  519  LEU C CB    1 
ATOM   8557  C  CG    . LEU C 1 647  ? 127.116 144.961 107.300 1.00 17.35  ?  519  LEU C CG    1 
ATOM   8558  C  CD1   . LEU C 1 647  ? 126.385 144.082 108.270 1.00 17.06  ?  519  LEU C CD1   1 
ATOM   8559  C  CD2   . LEU C 1 647  ? 128.107 144.169 106.495 1.00 26.35  ?  519  LEU C CD2   1 
ATOM   8560  N  N     . HIS C 1 648  ? 123.626 145.951 104.766 1.00 26.85  ?  520  HIS C N     1 
ATOM   8561  C  CA    . HIS C 1 648  ? 122.204 146.248 104.870 1.00 37.83  ?  520  HIS C CA    1 
ATOM   8562  C  C     . HIS C 1 648  ? 121.384 145.330 103.977 1.00 37.09  ?  520  HIS C C     1 
ATOM   8563  O  O     . HIS C 1 648  ? 120.296 144.883 104.363 1.00 44.84  ?  520  HIS C O     1 
ATOM   8564  C  CB    . HIS C 1 648  ? 121.945 147.722 104.553 1.00 56.88  ?  520  HIS C CB    1 
ATOM   8565  C  CG    . HIS C 1 648  ? 122.157 148.097 103.117 1.00 63.05  ?  520  HIS C CG    1 
ATOM   8566  N  ND1   . HIS C 1 648  ? 123.184 147.588 102.351 1.00 55.37  ?  520  HIS C ND1   1 
ATOM   8567  C  CD2   . HIS C 1 648  ? 121.448 148.915 102.303 1.00 96.14  ?  520  HIS C CD2   1 
ATOM   8568  C  CE1   . HIS C 1 648  ? 123.110 148.094 101.133 1.00 79.54  ?  520  HIS C CE1   1 
ATOM   8569  N  NE2   . HIS C 1 648  ? 122.064 148.899 101.077 1.00 101.57 ?  520  HIS C NE2   1 
ATOM   8570  N  N     . THR C 1 649  ? 121.910 145.009 102.795 1.00 31.23  ?  521  THR C N     1 
ATOM   8571  C  CA    . THR C 1 649  ? 121.265 144.023 101.940 1.00 34.62  ?  521  THR C CA    1 
ATOM   8572  C  C     . THR C 1 649  ? 121.272 142.649 102.587 1.00 28.03  ?  521  THR C C     1 
ATOM   8573  O  O     . THR C 1 649  ? 120.318 141.883 102.434 1.00 34.64  ?  521  THR C O     1 
ATOM   8574  C  CB    . THR C 1 649  ? 121.960 143.964 100.581 1.00 27.94  ?  521  THR C CB    1 
ATOM   8575  O  OG1   . THR C 1 649  ? 121.535 142.790 99.879  1.00 20.33  ?  521  THR C OG1   1 
ATOM   8576  C  CG2   . THR C 1 649  ? 123.462 143.924 100.748 1.00 21.50  ?  521  THR C CG2   1 
ATOM   8577  N  N     . LEU C 1 650  ? 122.332 142.327 103.324 1.00 21.69  ?  522  LEU C N     1 
ATOM   8578  C  CA    . LEU C 1 650  ? 122.378 141.068 104.056 1.00 17.80  ?  522  LEU C CA    1 
ATOM   8579  C  C     . LEU C 1 650  ? 121.240 140.975 105.060 1.00 18.57  ?  522  LEU C C     1 
ATOM   8580  O  O     . LEU C 1 650  ? 120.497 139.988 105.088 1.00 20.60  ?  522  LEU C O     1 
ATOM   8581  C  CB    . LEU C 1 650  ? 123.722 140.939 104.757 1.00 13.59  ?  522  LEU C CB    1 
ATOM   8582  C  CG    . LEU C 1 650  ? 123.648 139.922 105.877 1.00 10.10  ?  522  LEU C CG    1 
ATOM   8583  C  CD1   . LEU C 1 650  ? 123.826 138.533 105.342 1.00 24.88  ?  522  LEU C CD1   1 
ATOM   8584  C  CD2   . LEU C 1 650  ? 124.691 140.258 106.905 1.00 15.63  ?  522  LEU C CD2   1 
ATOM   8585  N  N     . ARG C 1 651  ? 121.091 141.998 105.902 1.00 22.44  ?  523  ARG C N     1 
ATOM   8586  C  CA    . ARG C 1 651  ? 120.032 141.968 106.908 1.00 29.37  ?  523  ARG C CA    1 
ATOM   8587  C  C     . ARG C 1 651  ? 118.656 141.908 106.251 1.00 35.47  ?  523  ARG C C     1 
ATOM   8588  O  O     . ARG C 1 651  ? 117.790 141.130 106.667 1.00 32.98  ?  523  ARG C O     1 
ATOM   8589  C  CB    . ARG C 1 651  ? 120.117 143.184 107.829 1.00 40.27  ?  523  ARG C CB    1 
ATOM   8590  C  CG    . ARG C 1 651  ? 121.166 143.083 108.920 1.00 38.03  ?  523  ARG C CG    1 
ATOM   8591  C  CD    . ARG C 1 651  ? 121.193 144.355 109.761 1.00 60.38  ?  523  ARG C CD    1 
ATOM   8592  N  NE    . ARG C 1 651  ? 122.198 145.317 109.328 1.00 54.53  ?  523  ARG C NE    1 
ATOM   8593  C  CZ    . ARG C 1 651  ? 122.039 146.151 108.302 1.00 64.08  ?  523  ARG C CZ    1 
ATOM   8594  N  NH1   . ARG C 1 651  ? 120.899 146.149 107.620 1.00 65.28  ?  523  ARG C NH1   1 
ATOM   8595  N  NH2   . ARG C 1 651  ? 123.005 147.003 107.971 1.00 55.85  ?  523  ARG C NH2   1 
ATOM   8596  N  N     . ASN C 1 652  ? 118.425 142.758 105.242 1.00 40.94  ?  524  ASN C N     1 
ATOM   8597  C  CA    . ASN C 1 652  ? 117.119 142.811 104.594 1.00 39.93  ?  524  ASN C CA    1 
ATOM   8598  C  C     . ASN C 1 652  ? 116.792 141.490 103.902 1.00 57.94  ?  524  ASN C C     1 
ATOM   8599  O  O     . ASN C 1 652  ? 115.639 141.046 103.930 1.00 69.73  ?  524  ASN C O     1 
ATOM   8600  C  CB    . ASN C 1 652  ? 117.077 143.992 103.610 1.00 38.76  ?  524  ASN C CB    1 
ATOM   8601  C  CG    . ASN C 1 652  ? 116.071 143.804 102.471 1.00 60.44  ?  524  ASN C CG    1 
ATOM   8602  O  OD1   . ASN C 1 652  ? 114.915 143.425 102.689 1.00 78.05  ?  524  ASN C OD1   1 
ATOM   8603  N  ND2   . ASN C 1 652  ? 116.517 144.063 101.245 1.00 60.69  ?  524  ASN C ND2   1 
ATOM   8604  N  N     . ALA C 1 653  ? 117.793 140.824 103.316 1.00 58.32  ?  525  ALA C N     1 
ATOM   8605  C  CA    . ALA C 1 653  ? 117.572 139.524 102.692 1.00 58.68  ?  525  ALA C CA    1 
ATOM   8606  C  C     . ALA C 1 653  ? 117.320 138.454 103.741 1.00 49.43  ?  525  ALA C C     1 
ATOM   8607  O  O     . ALA C 1 653  ? 116.580 137.492 103.497 1.00 47.69  ?  525  ALA C O     1 
ATOM   8608  C  CB    . ALA C 1 653  ? 118.775 139.139 101.822 1.00 42.09  ?  525  ALA C CB    1 
ATOM   8609  N  N     . GLU C 1 654  ? 117.947 138.594 104.905 1.00 32.73  ?  526  GLU C N     1 
ATOM   8610  C  CA    . GLU C 1 654  ? 117.756 137.632 105.981 1.00 25.33  ?  526  GLU C CA    1 
ATOM   8611  C  C     . GLU C 1 654  ? 116.364 137.737 106.599 1.00 27.69  ?  526  GLU C C     1 
ATOM   8612  O  O     . GLU C 1 654  ? 115.756 136.718 106.951 1.00 19.75  ?  526  GLU C O     1 
ATOM   8613  C  CB    . GLU C 1 654  ? 118.840 137.850 107.036 1.00 29.71  ?  526  GLU C CB    1 
ATOM   8614  C  CG    . GLU C 1 654  ? 118.485 137.258 108.361 1.00 35.63  ?  526  GLU C CG    1 
ATOM   8615  C  CD    . GLU C 1 654  ? 117.838 138.263 109.267 1.00 76.62  ?  526  GLU C CD    1 
ATOM   8616  O  OE1   . GLU C 1 654  ? 117.851 139.471 108.932 1.00 42.37  ?  526  GLU C OE1   1 
ATOM   8617  O  OE2   . GLU C 1 654  ? 117.245 137.841 110.270 1.00 313.17 -1 526  GLU C OE2   1 
ATOM   8618  N  N     . LYS C 1 655  ? 115.846 138.964 106.730 1.00 39.70  ?  527  LYS C N     1 
ATOM   8619  C  CA    . LYS C 1 655  ? 114.635 139.244 107.510 1.00 30.56  ?  527  LYS C CA    1 
ATOM   8620  C  C     . LYS C 1 655  ? 113.463 138.349 107.142 1.00 18.46  ?  527  LYS C C     1 
ATOM   8621  O  O     . LYS C 1 655  ? 112.515 138.225 107.922 1.00 17.32  ?  527  LYS C O     1 
ATOM   8622  C  CB    . LYS C 1 655  ? 114.229 140.713 107.323 1.00 39.18  ?  527  LYS C CB    1 
ATOM   8623  C  CG    . LYS C 1 655  ? 113.092 141.206 108.219 1.00 31.64  ?  527  LYS C CG    1 
ATOM   8624  C  CD    . LYS C 1 655  ? 113.020 142.730 108.212 1.00 50.85  ?  527  LYS C CD    1 
ATOM   8625  C  CE    . LYS C 1 655  ? 114.335 143.326 108.692 1.00 43.72  ?  527  LYS C CE    1 
ATOM   8626  N  NZ    . LYS C 1 655  ? 114.317 144.805 108.850 1.00 41.42  ?  527  LYS C NZ    1 
ATOM   8627  N  N     . GLU C 1 656  ? 113.500 137.736 105.967 1.00 21.83  ?  528  GLU C N     1 
ATOM   8628  C  CA    . GLU C 1 656  ? 112.428 136.835 105.582 1.00 27.41  ?  528  GLU C CA    1 
ATOM   8629  C  C     . GLU C 1 656  ? 112.476 135.533 106.373 1.00 24.48  ?  528  GLU C C     1 
ATOM   8630  O  O     . GLU C 1 656  ? 111.435 134.917 106.614 1.00 37.62  ?  528  GLU C O     1 
ATOM   8631  C  CB    . GLU C 1 656  ? 112.512 136.566 104.083 1.00 40.25  ?  528  GLU C CB    1 
ATOM   8632  C  CG    . GLU C 1 656  ? 111.600 135.471 103.623 1.00 69.76  ?  528  GLU C CG    1 
ATOM   8633  C  CD    . GLU C 1 656  ? 111.799 135.111 102.173 1.00 157.14 ?  528  GLU C CD    1 
ATOM   8634  O  OE1   . GLU C 1 656  ? 112.846 135.476 101.597 1.00 157.88 ?  528  GLU C OE1   1 
ATOM   8635  O  OE2   . GLU C 1 656  ? 110.892 134.473 101.604 1.00 409.01 -1 528  GLU C OE2   1 
ATOM   8636  N  N     . LEU C 1 657  ? 113.661 135.117 106.817 1.00 9.89   ?  529  LEU C N     1 
ATOM   8637  C  CA    . LEU C 1 657  ? 113.815 133.782 107.389 1.00 19.14  ?  529  LEU C CA    1 
ATOM   8638  C  C     . LEU C 1 657  ? 113.316 133.672 108.828 1.00 12.51  ?  529  LEU C C     1 
ATOM   8639  O  O     . LEU C 1 657  ? 112.893 132.591 109.247 1.00 14.07  ?  529  LEU C O     1 
ATOM   8640  C  CB    . LEU C 1 657  ? 115.273 133.358 107.316 1.00 9.28   ?  529  LEU C CB    1 
ATOM   8641  C  CG    . LEU C 1 657  ? 115.527 132.735 105.956 1.00 8.12   ?  529  LEU C CG    1 
ATOM   8642  C  CD1   . LEU C 1 657  ? 116.995 132.517 105.801 1.00 25.02  ?  529  LEU C CD1   1 
ATOM   8643  C  CD2   . LEU C 1 657  ? 114.766 131.431 105.802 1.00 9.13   ?  529  LEU C CD2   1 
ATOM   8644  N  N     . LEU C 1 658  ? 113.364 134.758 109.598 1.00 16.70  ?  530  LEU C N     1 
ATOM   8645  C  CA    . LEU C 1 658  ? 112.843 134.790 110.961 1.00 15.07  ?  530  LEU C CA    1 
ATOM   8646  C  C     . LEU C 1 658  ? 111.353 134.471 111.012 1.00 15.19  ?  530  LEU C C     1 
ATOM   8647  O  O     . LEU C 1 658  ? 110.669 134.536 109.986 1.00 23.87  ?  530  LEU C O     1 
ATOM   8648  C  CB    . LEU C 1 658  ? 113.089 136.160 111.587 1.00 22.10  ?  530  LEU C CB    1 
ATOM   8649  C  CG    . LEU C 1 658  ? 114.423 136.308 112.301 1.00 36.16  ?  530  LEU C CG    1 
ATOM   8650  C  CD1   . LEU C 1 658  ? 114.346 137.421 113.329 1.00 62.03  ?  530  LEU C CD1   1 
ATOM   8651  C  CD2   . LEU C 1 658  ? 114.781 134.999 112.953 1.00 37.62  ?  530  LEU C CD2   1 
ATOM   8652  N  N     . PRO C 1 659  ? 110.811 134.139 112.185 1.00 8.56   ?  531  PRO C N     1 
ATOM   8653  C  CA    . PRO C 1 659  ? 109.360 133.983 112.297 1.00 36.41  ?  531  PRO C CA    1 
ATOM   8654  C  C     . PRO C 1 659  ? 108.622 135.304 112.124 1.00 18.47  ?  531  PRO C C     1 
ATOM   8655  O  O     . PRO C 1 659  ? 109.164 136.396 112.302 1.00 19.78  ?  531  PRO C O     1 
ATOM   8656  C  CB    . PRO C 1 659  ? 109.181 133.420 113.704 1.00 23.48  ?  531  PRO C CB    1 
ATOM   8657  C  CG    . PRO C 1 659  ? 110.309 134.013 114.456 1.00 15.42  ?  531  PRO C CG    1 
ATOM   8658  C  CD    . PRO C 1 659  ? 111.466 133.964 113.492 1.00 15.89  ?  531  PRO C CD    1 
ATOM   8659  N  N     . GLY C 1 660  ? 107.348 135.182 111.772 1.00 24.80  ?  532  GLY C N     1 
ATOM   8660  C  CA    . GLY C 1 660  ? 106.482 136.326 111.589 1.00 33.05  ?  532  GLY C CA    1 
ATOM   8661  C  C     . GLY C 1 660  ? 106.710 137.030 110.271 1.00 30.97  ?  532  GLY C C     1 
ATOM   8662  O  O     . GLY C 1 660  ? 106.949 138.241 110.244 1.00 35.54  ?  532  GLY C O     1 
ATOM   8663  N  N     . PHE C 1 661  ? 106.682 136.280 109.175 1.00 20.69  ?  533  PHE C N     1 
ATOM   8664  C  CA    . PHE C 1 661  ? 106.821 136.928 107.881 1.00 22.14  ?  533  PHE C CA    1 
ATOM   8665  C  C     . PHE C 1 661  ? 105.761 136.484 106.880 1.00 67.17  ?  533  PHE C C     1 
ATOM   8666  O  O     . PHE C 1 661  ? 105.330 137.294 106.053 1.00 51.49  ?  533  PHE C O     1 
ATOM   8667  C  CB    . PHE C 1 661  ? 108.216 136.666 107.305 1.00 28.08  ?  533  PHE C CB    1 
ATOM   8668  C  CG    . PHE C 1 661  ? 108.465 137.356 105.999 1.00 46.72  ?  533  PHE C CG    1 
ATOM   8669  C  CD1   . PHE C 1 661  ? 108.829 138.696 105.975 1.00 40.50  ?  533  PHE C CD1   1 
ATOM   8670  C  CD2   . PHE C 1 661  ? 108.275 136.701 104.798 1.00 58.18  ?  533  PHE C CD2   1 
ATOM   8671  C  CE1   . PHE C 1 661  ? 109.050 139.353 104.781 1.00 53.93  ?  533  PHE C CE1   1 
ATOM   8672  C  CE2   . PHE C 1 661  ? 108.485 137.360 103.599 1.00 85.90  ?  533  PHE C CE2   1 
ATOM   8673  C  CZ    . PHE C 1 661  ? 108.873 138.686 103.595 1.00 86.25  ?  533  PHE C CZ    1 
ATOM   8674  N  N     . HIS C 1 662  ? 105.330 135.220 106.922 1.00 35.35  ?  534  HIS C N     1 
ATOM   8675  C  CA    . HIS C 1 662  ? 104.541 134.635 105.843 1.00 37.31  ?  534  HIS C CA    1 
ATOM   8676  C  C     . HIS C 1 662  ? 103.086 134.510 106.254 1.00 51.27  ?  534  HIS C C     1 
ATOM   8677  O  O     . HIS C 1 662  ? 102.753 133.750 107.168 1.00 66.89  ?  534  HIS C O     1 
ATOM   8678  C  CB    . HIS C 1 662  ? 105.097 133.281 105.451 1.00 15.95  ?  534  HIS C CB    1 
ATOM   8679  C  CG    . HIS C 1 662  ? 106.536 133.349 105.095 1.00 57.02  ?  534  HIS C CG    1 
ATOM   8680  N  ND1   . HIS C 1 662  ? 106.985 133.366 103.793 1.00 25.21  ?  534  HIS C ND1   1 
ATOM   8681  C  CD2   . HIS C 1 662  ? 107.632 133.415 105.879 1.00 32.69  ?  534  HIS C CD2   1 
ATOM   8682  C  CE1   . HIS C 1 662  ? 108.303 133.437 103.795 1.00 44.54  ?  534  HIS C CE1   1 
ATOM   8683  N  NE2   . HIS C 1 662  ? 108.718 133.467 105.047 1.00 38.79  ?  534  HIS C NE2   1 
ATOM   8684  N  N     . GLN C 1 663  ? 102.223 135.238 105.558 1.00 65.72  ?  535  GLN C N     1 
ATOM   8685  C  CA    . GLN C 1 663  ? 100.793 135.166 105.799 1.00 51.14  ?  535  GLN C CA    1 
ATOM   8686  C  C     . GLN C 1 663  ? 100.289 133.739 105.642 1.00 42.39  ?  535  GLN C C     1 
ATOM   8687  O  O     . GLN C 1 663  ? 100.723 132.995 104.757 1.00 39.17  ?  535  GLN C O     1 
ATOM   8688  C  CB    . GLN C 1 663  ? 100.063 136.099 104.835 1.00 63.78  ?  535  GLN C CB    1 
ATOM   8689  C  CG    . GLN C 1 663  ? 98.744  135.567 104.332 1.00 83.08  ?  535  GLN C CG    1 
ATOM   8690  C  CD    . GLN C 1 663  ? 98.226  136.348 103.146 1.00 115.65 ?  535  GLN C CD    1 
ATOM   8691  O  OE1   . GLN C 1 663  ? 98.488  137.547 103.017 1.00 108.59 ?  535  GLN C OE1   1 
ATOM   8692  N  NE2   . GLN C 1 663  ? 97.494  135.674 102.267 1.00 121.05 ?  535  GLN C NE2   1 
ATOM   8693  N  N     . PHE C 1 664  ? 99.377  133.357 106.529 1.00 36.35  ?  536  PHE C N     1 
ATOM   8694  C  CA    . PHE C 1 664  ? 98.758  132.042 106.511 1.00 44.12  ?  536  PHE C CA    1 
ATOM   8695  C  C     . PHE C 1 664  ? 97.322  132.200 106.984 1.00 45.58  ?  536  PHE C C     1 
ATOM   8696  O  O     . PHE C 1 664  ? 96.854  133.314 107.241 1.00 37.60  ?  536  PHE C O     1 
ATOM   8697  C  CB    . PHE C 1 664  ? 99.507  131.069 107.412 1.00 45.21  ?  536  PHE C CB    1 
ATOM   8698  C  CG    . PHE C 1 664  ? 99.780  131.606 108.785 1.00 41.79  ?  536  PHE C CG    1 
ATOM   8699  C  CD1   . PHE C 1 664  ? 98.803  131.568 109.763 1.00 46.12  ?  536  PHE C CD1   1 
ATOM   8700  C  CD2   . PHE C 1 664  ? 101.007 132.152 109.102 1.00 44.72  ?  536  PHE C CD2   1 
ATOM   8701  C  CE1   . PHE C 1 664  ? 99.052  132.061 111.030 1.00 58.66  ?  536  PHE C CE1   1 
ATOM   8702  C  CE2   . PHE C 1 664  ? 101.254 132.645 110.372 1.00 38.87  ?  536  PHE C CE2   1 
ATOM   8703  C  CZ    . PHE C 1 664  ? 100.278 132.599 111.328 1.00 36.42  ?  536  PHE C CZ    1 
ATOM   8704  N  N     . GLU C 1 665  ? 96.623  131.079 107.129 1.00 45.71  ?  537  GLU C N     1 
ATOM   8705  C  CA    . GLU C 1 665  ? 95.276  131.141 107.677 1.00 52.47  ?  537  GLU C CA    1 
ATOM   8706  C  C     . GLU C 1 665  ? 95.017  129.914 108.540 1.00 52.94  ?  537  GLU C C     1 
ATOM   8707  O  O     . GLU C 1 665  ? 95.755  128.928 108.487 1.00 49.04  ?  537  GLU C O     1 
ATOM   8708  C  CB    . GLU C 1 665  ? 94.227  131.272 106.565 1.00 94.22  ?  537  GLU C CB    1 
ATOM   8709  C  CG    . GLU C 1 665  ? 93.111  132.255 106.902 1.00 138.84 ?  537  GLU C CG    1 
ATOM   8710  C  CD    . GLU C 1 665  ? 92.292  132.664 105.686 1.00 186.82 ?  537  GLU C CD    1 
ATOM   8711  O  OE1   . GLU C 1 665  ? 92.883  132.859 104.603 1.00 160.18 ?  537  GLU C OE1   1 
ATOM   8712  O  OE2   . GLU C 1 665  ? 91.054  132.783 105.813 1.00 319.05 -1 537  GLU C OE2   1 
ATOM   8713  N  N     . TRP C 1 666  ? 93.954  129.979 109.341 1.00 66.43  ?  538  TRP C N     1 
ATOM   8714  C  CA    . TRP C 1 666  ? 93.683  128.925 110.311 1.00 66.62  ?  538  TRP C CA    1 
ATOM   8715  C  C     . TRP C 1 666  ? 92.193  128.607 110.317 1.00 62.51  ?  538  TRP C C     1 
ATOM   8716  O  O     . TRP C 1 666  ? 91.371  129.498 110.556 1.00 50.60  ?  538  TRP C O     1 
ATOM   8717  C  CB    . TRP C 1 666  ? 94.164  129.341 111.707 1.00 65.44  ?  538  TRP C CB    1 
ATOM   8718  C  CG    . TRP C 1 666  ? 94.773  128.204 112.443 1.00 75.57  ?  538  TRP C CG    1 
ATOM   8719  C  CD1   . TRP C 1 666  ? 94.124  127.140 112.981 1.00 83.93  ?  538  TRP C CD1   1 
ATOM   8720  C  CD2   . TRP C 1 666  ? 96.168  127.985 112.678 1.00 58.21  ?  538  TRP C CD2   1 
ATOM   8721  N  NE1   . TRP C 1 666  ? 95.022  126.276 113.559 1.00 88.69  ?  538  TRP C NE1   1 
ATOM   8722  C  CE2   . TRP C 1 666  ? 96.286  126.774 113.387 1.00 74.10  ?  538  TRP C CE2   1 
ATOM   8723  C  CE3   . TRP C 1 666  ? 97.327  128.706 112.378 1.00 53.86  ?  538  TRP C CE3   1 
ATOM   8724  C  CZ2   . TRP C 1 666  ? 97.513  126.261 113.792 1.00 53.82  ?  538  TRP C CZ2   1 
ATOM   8725  C  CZ3   . TRP C 1 666  ? 98.544  128.194 112.777 1.00 37.93  ?  538  TRP C CZ3   1 
ATOM   8726  C  CH2   . TRP C 1 666  ? 98.628  126.983 113.480 1.00 36.77  ?  538  TRP C CH2   1 
ATOM   8727  N  N     . GLN C 1 667  ? 91.846  127.346 110.061 1.00 55.72  ?  539  GLN C N     1 
ATOM   8728  C  CA    . GLN C 1 667  ? 90.458  126.884 110.014 1.00 48.27  ?  539  GLN C CA    1 
ATOM   8729  C  C     . GLN C 1 667  ? 90.252  125.755 111.015 1.00 47.41  ?  539  GLN C C     1 
ATOM   8730  O  O     . GLN C 1 667  ? 90.826  124.662 110.841 1.00 50.37  ?  539  GLN C O     1 
ATOM   8731  C  CB    . GLN C 1 667  ? 90.081  126.403 108.612 1.00 43.06  ?  539  GLN C CB    1 
ATOM   8732  C  CG    . GLN C 1 667  ? 90.601  127.266 107.478 1.00 39.88  ?  539  GLN C CG    1 
ATOM   8733  C  CD    . GLN C 1 667  ? 90.776  126.482 106.190 1.00 52.20  ?  539  GLN C CD    1 
ATOM   8734  O  OE1   . GLN C 1 667  ? 90.872  125.253 106.202 1.00 48.62  ?  539  GLN C OE1   1 
ATOM   8735  N  NE2   . GLN C 1 667  ? 90.832  127.193 105.070 1.00 78.58  ?  539  GLN C NE2   1 
ATOM   8736  N  N     . PRO C 1 668  ? 89.469  125.961 112.082 1.00 44.42  ?  540  PRO C N     1 
ATOM   8737  C  CA    . PRO C 1 668  ? 88.914  127.271 112.439 1.00 56.53  ?  540  PRO C CA    1 
ATOM   8738  C  C     . PRO C 1 668  ? 89.956  128.217 113.035 1.00 53.67  ?  540  PRO C C     1 
ATOM   8739  O  O     . PRO C 1 668  ? 91.096  127.794 113.211 1.00 63.47  ?  540  PRO C O     1 
ATOM   8740  C  CB    . PRO C 1 668  ? 87.848  126.914 113.476 1.00 68.69  ?  540  PRO C CB    1 
ATOM   8741  C  CG    . PRO C 1 668  ? 88.341  125.625 114.070 1.00 49.02  ?  540  PRO C CG    1 
ATOM   8742  C  CD    . PRO C 1 668  ? 88.866  124.883 112.882 1.00 37.39  ?  540  PRO C CD    1 
ATOM   8743  N  N     . ALA C 1 669  ? 89.591  129.466 113.319 1.00 56.90  ?  541  ALA C N     1 
ATOM   8744  C  CA    . ALA C 1 669  ? 90.486  130.336 114.071 1.00 67.17  ?  541  ALA C CA    1 
ATOM   8745  C  C     . ALA C 1 669  ? 90.722  129.753 115.461 1.00 73.09  ?  541  ALA C C     1 
ATOM   8746  O  O     . ALA C 1 669  ? 89.857  129.081 116.026 1.00 71.16  ?  541  ALA C O     1 
ATOM   8747  C  CB    . ALA C 1 669  ? 89.905  131.745 114.179 1.00 66.29  ?  541  ALA C CB    1 
ATOM   8748  N  N     . LEU C 1 670  ? 91.902  130.022 116.019 1.00 77.57  ?  542  LEU C N     1 
ATOM   8749  C  CA    . LEU C 1 670  ? 92.287  129.396 117.275 1.00 71.28  ?  542  LEU C CA    1 
ATOM   8750  C  C     . LEU C 1 670  ? 91.532  130.007 118.450 1.00 78.02  ?  542  LEU C C     1 
ATOM   8751  O  O     . LEU C 1 670  ? 90.897  131.061 118.351 1.00 77.74  ?  542  LEU C O     1 
ATOM   8752  C  CB    . LEU C 1 670  ? 93.788  129.527 117.519 1.00 37.38  ?  542  LEU C CB    1 
ATOM   8753  C  CG    . LEU C 1 670  ? 94.627  128.707 116.551 1.00 33.15  ?  542  LEU C CG    1 
ATOM   8754  C  CD1   . LEU C 1 670  ? 95.543  129.630 115.772 1.00 30.18  ?  542  LEU C CD1   1 
ATOM   8755  C  CD2   . LEU C 1 670  ? 95.397  127.622 117.288 1.00 32.27  ?  542  LEU C CD2   1 
ATOM   8756  N  N     . LYS C 1 671  ? 91.630  129.327 119.589 1.00 75.19  ?  543  LYS C N     1 
ATOM   8757  C  CA    . LYS C 1 671  ? 90.949  129.759 120.802 1.00 76.58  ?  543  LYS C CA    1 
ATOM   8758  C  C     . LYS C 1 671  ? 91.811  130.780 121.538 1.00 70.33  ?  543  LYS C C     1 
ATOM   8759  O  O     . LYS C 1 671  ? 92.970  130.501 121.861 1.00 52.62  ?  543  LYS C O     1 
ATOM   8760  C  CB    . LYS C 1 671  ? 90.640  128.559 121.699 1.00 71.14  ?  543  LYS C CB    1 
ATOM   8761  C  CG    . LYS C 1 671  ? 89.153  128.318 121.879 1.00 61.32  ?  543  LYS C CG    1 
ATOM   8762  C  CD    . LYS C 1 671  ? 88.450  128.238 120.527 1.00 64.63  ?  543  LYS C CD    1 
ATOM   8763  C  CE    . LYS C 1 671  ? 86.957  128.026 120.682 1.00 72.36  ?  543  LYS C CE    1 
ATOM   8764  N  NZ    . LYS C 1 671  ? 86.376  129.056 121.588 1.00 76.20  ?  543  LYS C NZ    1 
ATOM   8765  N  N     . ASN C 1 672  ? 91.240  131.960 121.795 1.00 71.14  ?  544  ASN C N     1 
ATOM   8766  C  CA    . ASN C 1 672  ? 91.856  133.025 122.599 1.00 66.53  ?  544  ASN C CA    1 
ATOM   8767  C  C     . ASN C 1 672  ? 93.310  133.296 122.209 1.00 47.88  ?  544  ASN C C     1 
ATOM   8768  O  O     . ASN C 1 672  ? 94.175  133.521 123.058 1.00 30.60  ?  544  ASN C O     1 
ATOM   8769  C  CB    . ASN C 1 672  ? 91.734  132.725 124.096 1.00 64.83  ?  544  ASN C CB    1 
ATOM   8770  C  CG    . ASN C 1 672  ? 92.559  131.534 124.529 1.00 56.56  ?  544  ASN C CG    1 
ATOM   8771  O  OD1   . ASN C 1 672  ? 92.097  130.391 124.495 1.00 49.64  ?  544  ASN C OD1   1 
ATOM   8772  N  ND2   . ASN C 1 672  ? 93.798  131.794 124.934 1.00 45.87  ?  544  ASN C ND2   1 
ATOM   8773  N  N     . VAL C 1 673  ? 93.566  133.320 120.904 1.00 71.00  ?  545  VAL C N     1 
ATOM   8774  C  CA    . VAL C 1 673  ? 94.882  133.606 120.347 1.00 62.22  ?  545  VAL C CA    1 
ATOM   8775  C  C     . VAL C 1 673  ? 94.739  134.766 119.368 1.00 80.75  ?  545  VAL C C     1 
ATOM   8776  O  O     . VAL C 1 673  ? 93.733  134.878 118.661 1.00 107.86 ?  545  VAL C O     1 
ATOM   8777  C  CB    . VAL C 1 673  ? 95.478  132.358 119.653 1.00 60.59  ?  545  VAL C CB    1 
ATOM   8778  C  CG1   . VAL C 1 673  ? 96.743  132.704 118.897 1.00 73.46  ?  545  VAL C CG1   1 
ATOM   8779  C  CG2   . VAL C 1 673  ? 95.732  131.250 120.665 1.00 60.45  ?  545  VAL C CG2   1 
ATOM   8780  N  N     . SER C 1 674  ? 95.751  135.635 119.328 1.00 60.34  ?  546  SER C N     1 
ATOM   8781  C  CA    . SER C 1 674  ? 95.720  136.836 118.498 1.00 63.91  ?  546  SER C CA    1 
ATOM   8782  C  C     . SER C 1 674  ? 95.486  136.511 117.028 1.00 68.30  ?  546  SER C C     1 
ATOM   8783  O  O     . SER C 1 674  ? 95.713  135.381 116.583 1.00 61.99  ?  546  SER C O     1 
ATOM   8784  C  CB    . SER C 1 674  ? 97.025  137.630 118.653 1.00 70.59  ?  546  SER C CB    1 
ATOM   8785  O  OG    . SER C 1 674  ? 97.385  138.288 117.449 1.00 67.10  ?  546  SER C OG    1 
ATOM   8786  N  N     . THR C 1 675  ? 95.041  137.509 116.270 1.00 72.92  ?  547  THR C N     1 
ATOM   8787  C  CA    . THR C 1 675  ? 94.741  137.341 114.858 1.00 79.70  ?  547  THR C CA    1 
ATOM   8788  C  C     . THR C 1 675  ? 95.916  137.697 113.957 1.00 74.15  ?  547  THR C C     1 
ATOM   8789  O  O     . THR C 1 675  ? 95.921  137.308 112.782 1.00 72.39  ?  547  THR C O     1 
ATOM   8790  C  CB    . THR C 1 675  ? 93.518  138.191 114.480 1.00 94.21  ?  547  THR C CB    1 
ATOM   8791  O  OG1   . THR C 1 675  ? 93.819  139.579 114.670 1.00 82.67  ?  547  THR C OG1   1 
ATOM   8792  C  CG2   . THR C 1 675  ? 92.310  137.817 115.335 1.00 83.68  ?  547  THR C CG2   1 
ATOM   8793  N  N     . SER C 1 676  ? 96.912  138.407 114.480 1.00 53.76  ?  548  SER C N     1 
ATOM   8794  C  CA    . SER C 1 676  ? 98.037  138.840 113.667 1.00 42.02  ?  548  SER C CA    1 
ATOM   8795  C  C     . SER C 1 676  ? 98.925  137.655 113.285 1.00 24.76  ?  548  SER C C     1 
ATOM   8796  O  O     . SER C 1 676  ? 98.852  136.566 113.860 1.00 25.61  ?  548  SER C O     1 
ATOM   8797  C  CB    . SER C 1 676  ? 98.863  139.895 114.408 1.00 36.97  ?  548  SER C CB    1 
ATOM   8798  O  OG    . SER C 1 676  ? 98.110  141.074 114.638 1.00 46.43  ?  548  SER C OG    1 
ATOM   8799  N  N     . TRP C 1 677  ? 99.770  137.889 112.285 1.00 24.82  ?  549  TRP C N     1 
ATOM   8800  C  CA    . TRP C 1 677  ? 100.755 136.912 111.853 1.00 23.68  ?  549  TRP C CA    1 
ATOM   8801  C  C     . TRP C 1 677  ? 102.109 137.538 111.564 1.00 30.90  ?  549  TRP C C     1 
ATOM   8802  O  O     . TRP C 1 677  ? 103.021 136.822 111.141 1.00 39.15  ?  549  TRP C O     1 
ATOM   8803  C  CB    . TRP C 1 677  ? 100.274 136.155 110.599 1.00 36.42  ?  549  TRP C CB    1 
ATOM   8804  C  CG    . TRP C 1 677  ? 99.879  137.033 109.427 1.00 43.38  ?  549  TRP C CG    1 
ATOM   8805  C  CD1   . TRP C 1 677  ? 98.610  137.409 109.086 1.00 63.54  ?  549  TRP C CD1   1 
ATOM   8806  C  CD2   . TRP C 1 677  ? 100.748 137.649 108.458 1.00 40.01  ?  549  TRP C CD2   1 
ATOM   8807  N  NE1   . TRP C 1 677  ? 98.631  138.208 107.968 1.00 69.61  ?  549  TRP C NE1   1 
ATOM   8808  C  CE2   . TRP C 1 677  ? 99.929  138.373 107.565 1.00 59.32  ?  549  TRP C CE2   1 
ATOM   8809  C  CE3   . TRP C 1 677  ? 102.130 137.659 108.258 1.00 45.85  ?  549  TRP C CE3   1 
ATOM   8810  C  CZ2   . TRP C 1 677  ? 100.448 139.097 106.494 1.00 53.69  ?  549  TRP C CZ2   1 
ATOM   8811  C  CZ3   . TRP C 1 677  ? 102.640 138.376 107.195 1.00 50.00  ?  549  TRP C CZ3   1 
ATOM   8812  C  CH2   . TRP C 1 677  ? 101.803 139.084 106.325 1.00 46.99  ?  549  TRP C CH2   1 
ATOM   8813  N  N     . ASP C 1 678  ? 102.269 138.842 111.765 1.00 37.24  ?  550  ASP C N     1 
ATOM   8814  C  CA    . ASP C 1 678  ? 103.512 139.525 111.450 1.00 48.88  ?  550  ASP C CA    1 
ATOM   8815  C  C     . ASP C 1 678  ? 104.398 139.765 112.664 1.00 51.02  ?  550  ASP C C     1 
ATOM   8816  O  O     . ASP C 1 678  ? 105.596 140.014 112.495 1.00 52.93  ?  550  ASP C O     1 
ATOM   8817  C  CB    . ASP C 1 678  ? 103.222 140.867 110.774 1.00 67.74  ?  550  ASP C CB    1 
ATOM   8818  C  CG    . ASP C 1 678  ? 102.918 141.965 111.768 1.00 123.80 ?  550  ASP C CG    1 
ATOM   8819  O  OD1   . ASP C 1 678  ? 102.036 141.771 112.631 1.00 92.61  ?  550  ASP C OD1   1 
ATOM   8820  O  OD2   . ASP C 1 678  ? 103.586 143.017 111.704 1.00 330.12 -1 550  ASP C OD2   1 
ATOM   8821  N  N     . VAL C 1 679  ? 103.836 139.689 113.872 1.00 49.84  ?  551  VAL C N     1 
ATOM   8822  C  CA    . VAL C 1 679  ? 104.583 140.019 115.079 1.00 47.12  ?  551  VAL C CA    1 
ATOM   8823  C  C     . VAL C 1 679  ? 105.772 139.079 115.233 1.00 31.42  ?  551  VAL C C     1 
ATOM   8824  O  O     . VAL C 1 679  ? 105.647 137.858 115.099 1.00 30.93  ?  551  VAL C O     1 
ATOM   8825  C  CB    . VAL C 1 679  ? 103.647 139.982 116.299 1.00 58.30  ?  551  VAL C CB    1 
ATOM   8826  C  CG1   . VAL C 1 679  ? 102.628 141.113 116.211 1.00 93.15  ?  551  VAL C CG1   1 
ATOM   8827  C  CG2   . VAL C 1 679  ? 102.933 138.642 116.401 1.00 50.62  ?  551  VAL C CG2   1 
ATOM   8828  N  N     . GLY C 1 680  ? 106.944 139.656 115.499 1.00 25.38  ?  552  GLY C N     1 
ATOM   8829  C  CA    . GLY C 1 680  ? 108.168 138.895 115.675 1.00 12.41  ?  552  GLY C CA    1 
ATOM   8830  C  C     . GLY C 1 680  ? 108.460 138.545 117.122 1.00 9.56   ?  552  GLY C C     1 
ATOM   8831  O  O     . GLY C 1 680  ? 107.664 137.858 117.761 1.00 11.86  ?  552  GLY C O     1 
ATOM   8832  N  N     . ILE C 1 681  ? 109.581 139.026 117.658 1.00 8.95   ?  553  ILE C N     1 
ATOM   8833  C  CA    . ILE C 1 681  ? 110.037 138.657 118.997 1.00 6.88   ?  553  ILE C CA    1 
ATOM   8834  C  C     . ILE C 1 681  ? 109.139 139.340 120.021 1.00 10.17  ?  553  ILE C C     1 
ATOM   8835  O  O     . ILE C 1 681  ? 109.217 140.557 120.206 1.00 14.60  ?  553  ILE C O     1 
ATOM   8836  C  CB    . ILE C 1 681  ? 111.500 139.046 119.215 1.00 10.41  ?  553  ILE C CB    1 
ATOM   8837  C  CG1   . ILE C 1 681  ? 112.389 138.364 118.180 1.00 6.47   ?  553  ILE C CG1   1 
ATOM   8838  C  CG2   . ILE C 1 681  ? 111.929 138.672 120.622 1.00 9.36   ?  553  ILE C CG2   1 
ATOM   8839  C  CD1   . ILE C 1 681  ? 113.863 138.614 118.362 1.00 17.90  ?  553  ILE C CD1   1 
ATOM   8840  N  N     . ILE C 1 682  ? 108.297 138.564 120.700 1.00 12.14  ?  554  ILE C N     1 
ATOM   8841  C  CA    . ILE C 1 682  ? 107.451 139.067 121.775 1.00 25.23  ?  554  ILE C CA    1 
ATOM   8842  C  C     . ILE C 1 682  ? 108.246 138.980 123.071 1.00 20.45  ?  554  ILE C C     1 
ATOM   8843  O  O     . ILE C 1 682  ? 108.889 137.963 123.350 1.00 21.12  ?  554  ILE C O     1 
ATOM   8844  C  CB    . ILE C 1 682  ? 106.128 138.273 121.845 1.00 33.85  ?  554  ILE C CB    1 
ATOM   8845  C  CG1   . ILE C 1 682  ? 105.154 138.769 120.768 1.00 41.87  ?  554  ILE C CG1   1 
ATOM   8846  C  CG2   . ILE C 1 682  ? 105.474 138.370 123.213 1.00 37.67  ?  554  ILE C CG2   1 
ATOM   8847  C  CD1   . ILE C 1 682  ? 103.754 138.176 120.862 1.00 32.73  ?  554  ILE C CD1   1 
ATOM   8848  N  N     . ASP C 1 683  ? 108.236 140.066 123.845 1.00 46.69  ?  555  ASP C N     1 
ATOM   8849  C  CA    . ASP C 1 683  ? 108.831 140.056 125.175 1.00 70.52  ?  555  ASP C CA    1 
ATOM   8850  C  C     . ASP C 1 683  ? 108.169 138.987 126.039 1.00 59.02  ?  555  ASP C C     1 
ATOM   8851  O  O     . ASP C 1 683  ? 106.945 138.947 126.168 1.00 66.54  ?  555  ASP C O     1 
ATOM   8852  C  CB    . ASP C 1 683  ? 108.697 141.438 125.831 1.00 81.45  ?  555  ASP C CB    1 
ATOM   8853  C  CG    . ASP C 1 683  ? 107.312 142.075 125.614 1.00 177.56 ?  555  ASP C CG    1 
ATOM   8854  O  OD1   . ASP C 1 683  ? 106.524 141.578 124.775 1.00 167.94 ?  555  ASP C OD1   1 
ATOM   8855  O  OD2   . ASP C 1 683  ? 107.006 143.084 126.290 1.00 355.75 -1 555  ASP C OD2   1 
ATOM   8856  N  N     . GLY C 1 684  ? 108.981 138.114 126.633 1.00 39.38  ?  556  GLY C N     1 
ATOM   8857  C  CA    . GLY C 1 684  ? 108.447 136.988 127.386 1.00 22.95  ?  556  GLY C CA    1 
ATOM   8858  C  C     . GLY C 1 684  ? 107.823 137.343 128.729 1.00 15.57  ?  556  GLY C C     1 
ATOM   8859  O  O     . GLY C 1 684  ? 107.240 136.463 129.371 1.00 14.42  ?  556  GLY C O     1 
ATOM   8860  N  N     . LEU C 1 685  ? 107.954 138.597 129.175 1.00 17.88  ?  557  LEU C N     1 
ATOM   8861  C  CA    . LEU C 1 685  ? 107.284 139.051 130.393 1.00 13.62  ?  557  LEU C CA    1 
ATOM   8862  C  C     . LEU C 1 685  ? 105.792 138.743 130.374 1.00 17.65  ?  557  LEU C C     1 
ATOM   8863  O  O     . LEU C 1 685  ? 105.182 138.552 131.432 1.00 15.71  ?  557  LEU C O     1 
ATOM   8864  C  CB    . LEU C 1 685  ? 107.483 140.562 130.568 1.00 18.39  ?  557  LEU C CB    1 
ATOM   8865  C  CG    . LEU C 1 685  ? 108.827 141.098 131.067 1.00 21.52  ?  557  LEU C CG    1 
ATOM   8866  C  CD1   . LEU C 1 685  ? 109.347 142.275 130.230 1.00 24.21  ?  557  LEU C CD1   1 
ATOM   8867  C  CD2   . LEU C 1 685  ? 108.705 141.490 132.537 1.00 19.96  ?  557  LEU C CD2   1 
ATOM   8868  N  N     . SER C 1 686  ? 105.190 138.728 129.181 1.00 21.54  ?  558  SER C N     1 
ATOM   8869  C  CA    . SER C 1 686  ? 103.765 138.460 128.978 1.00 13.96  ?  558  SER C CA    1 
ATOM   8870  C  C     . SER C 1 686  ? 102.895 139.490 129.693 1.00 16.83  ?  558  SER C C     1 
ATOM   8871  O  O     . SER C 1 686  ? 101.893 139.151 130.322 1.00 19.81  ?  558  SER C O     1 
ATOM   8872  C  CB    . SER C 1 686  ? 103.392 137.038 129.400 1.00 9.60   ?  558  SER C CB    1 
ATOM   8873  O  OG    . SER C 1 686  ? 102.037 136.986 129.805 1.00 13.46  ?  558  SER C OG    1 
ATOM   8874  N  N     . GLY C 1 687  ? 103.283 140.759 129.590 1.00 15.92  ?  559  GLY C N     1 
ATOM   8875  C  CA    . GLY C 1 687  ? 102.485 141.863 130.084 1.00 15.13  ?  559  GLY C CA    1 
ATOM   8876  C  C     . GLY C 1 687  ? 102.157 141.823 131.561 1.00 17.30  ?  559  GLY C C     1 
ATOM   8877  O  O     . GLY C 1 687  ? 100.988 141.710 131.940 1.00 19.40  ?  559  GLY C O     1 
ATOM   8878  N  N     . TRP C 1 688  ? 103.169 141.929 132.408 1.00 12.94  ?  560  TRP C N     1 
ATOM   8879  C  CA    . TRP C 1 688  ? 102.966 142.013 133.847 1.00 14.32  ?  560  TRP C CA    1 
ATOM   8880  C  C     . TRP C 1 688  ? 102.804 143.465 134.269 1.00 17.13  ?  560  TRP C C     1 
ATOM   8881  O  O     . TRP C 1 688  ? 103.601 144.324 133.881 1.00 17.04  ?  560  TRP C O     1 
ATOM   8882  C  CB    . TRP C 1 688  ? 104.129 141.386 134.609 1.00 20.79  ?  560  TRP C CB    1 
ATOM   8883  C  CG    . TRP C 1 688  ? 103.849 140.022 135.103 1.00 29.74  ?  560  TRP C CG    1 
ATOM   8884  C  CD1   . TRP C 1 688  ? 102.681 139.338 134.976 1.00 26.97  ?  560  TRP C CD1   1 
ATOM   8885  C  CD2   . TRP C 1 688  ? 104.732 139.181 135.850 1.00 37.11  ?  560  TRP C CD2   1 
ATOM   8886  N  NE1   . TRP C 1 688  ? 102.786 138.110 135.577 1.00 31.20  ?  560  TRP C NE1   1 
ATOM   8887  C  CE2   . TRP C 1 688  ? 104.037 137.991 136.124 1.00 39.06  ?  560  TRP C CE2   1 
ATOM   8888  C  CE3   . TRP C 1 688  ? 106.047 139.314 136.303 1.00 27.57  ?  560  TRP C CE3   1 
ATOM   8889  C  CZ2   . TRP C 1 688  ? 104.608 136.947 136.829 1.00 41.27  ?  560  TRP C CZ2   1 
ATOM   8890  C  CZ3   . TRP C 1 688  ? 106.610 138.282 137.001 1.00 18.51  ?  560  TRP C CZ3   1 
ATOM   8891  C  CH2   . TRP C 1 688  ? 105.893 137.110 137.260 1.00 27.87  ?  560  TRP C CH2   1 
ATOM   8892  N  N     . THR C 1 689  ? 101.786 143.730 135.082 1.00 20.66  ?  561  THR C N     1 
ATOM   8893  C  CA    . THR C 1 689  ? 101.625 145.059 135.659 1.00 22.33  ?  561  THR C CA    1 
ATOM   8894  C  C     . THR C 1 689  ? 102.791 145.275 136.612 1.00 20.51  ?  561  THR C C     1 
ATOM   8895  O  O     . THR C 1 689  ? 102.844 144.692 137.696 1.00 23.54  ?  561  THR C O     1 
ATOM   8896  C  CB    . THR C 1 689  ? 100.280 145.189 136.364 1.00 20.90  ?  561  THR C CB    1 
ATOM   8897  O  OG1   . THR C 1 689  ? 100.384 144.708 137.707 1.00 23.78  ?  561  THR C OG1   1 
ATOM   8898  C  CG2   . THR C 1 689  ? 99.213  144.383 135.630 1.00 13.09  ?  561  THR C CG2   1 
ATOM   8899  N  N     . VAL C 1 690  ? 103.743 146.116 136.201 1.00 24.71  ?  562  VAL C N     1 
ATOM   8900  C  CA    . VAL C 1 690  ? 105.017 146.267 136.894 1.00 35.41  ?  562  VAL C CA    1 
ATOM   8901  C  C     . VAL C 1 690  ? 104.847 146.698 138.345 1.00 45.26  ?  562  VAL C C     1 
ATOM   8902  O  O     . VAL C 1 690  ? 105.830 146.741 139.093 1.00 57.34  ?  562  VAL C O     1 
ATOM   8903  C  CB    . VAL C 1 690  ? 105.925 147.269 136.138 1.00 60.31  ?  562  VAL C CB    1 
ATOM   8904  C  CG1   . VAL C 1 690  ? 105.524 148.711 136.453 1.00 86.32  ?  562  VAL C CG1   1 
ATOM   8905  C  CG2   . VAL C 1 690  ? 107.408 147.018 136.433 1.00 49.57  ?  562  VAL C CG2   1 
ATOM   8906  N  N     . SER C 1 691  ? 103.624 147.022 138.758 1.00 40.92  ?  563  SER C N     1 
ATOM   8907  C  CA    . SER C 1 691  ? 103.311 147.442 140.117 1.00 67.81  ?  563  SER C CA    1 
ATOM   8908  C  C     . SER C 1 691  ? 104.002 146.572 141.166 1.00 38.67  ?  563  SER C C     1 
ATOM   8909  O  O     . SER C 1 691  ? 103.796 145.359 141.218 1.00 37.42  ?  563  SER C O     1 
ATOM   8910  C  CB    . SER C 1 691  ? 101.781 147.433 140.303 1.00 74.60  ?  563  SER C CB    1 
ATOM   8911  O  OG    . SER C 1 691  ? 101.218 146.152 140.068 1.00 39.96  ?  563  SER C OG    1 
ATOM   8912  N  N     . VAL C 1 692  ? 104.824 147.206 142.013 1.00 33.46  ?  564  VAL C N     1 
ATOM   8913  C  CA    . VAL C 1 692  ? 105.788 146.515 142.871 1.00 27.36  ?  564  VAL C CA    1 
ATOM   8914  C  C     . VAL C 1 692  ? 105.080 146.036 144.134 1.00 28.79  ?  564  VAL C C     1 
ATOM   8915  O  O     . VAL C 1 692  ? 105.719 145.533 145.064 1.00 41.57  ?  564  VAL C O     1 
ATOM   8916  C  CB    . VAL C 1 692  ? 106.998 147.422 143.216 1.00 37.04  ?  564  VAL C CB    1 
ATOM   8917  C  CG1   . VAL C 1 692  ? 108.212 146.587 143.668 1.00 39.67  ?  564  VAL C CG1   1 
ATOM   8918  C  CG2   . VAL C 1 692  ? 107.374 148.311 142.044 1.00 41.35  ?  564  VAL C CG2   1 
ATOM   8919  N  N     . ASP C 1 693  ? 103.756 146.200 144.180 1.00 33.95  ?  565  ASP C N     1 
ATOM   8920  C  CA    . ASP C 1 693  ? 102.973 145.682 145.297 1.00 58.37  ?  565  ASP C CA    1 
ATOM   8921  C  C     . ASP C 1 693  ? 102.830 144.163 145.220 1.00 64.00  ?  565  ASP C C     1 
ATOM   8922  O  O     . ASP C 1 693  ? 102.882 143.478 146.248 1.00 56.03  ?  565  ASP C O     1 
ATOM   8923  C  CB    . ASP C 1 693  ? 101.585 146.340 145.334 1.00 104.89 ?  565  ASP C CB    1 
ATOM   8924  C  CG    . ASP C 1 693  ? 100.842 146.241 144.006 1.00 102.91 ?  565  ASP C CG    1 
ATOM   8925  O  OD1   . ASP C 1 693  ? 101.502 146.056 142.966 1.00 72.02  ?  565  ASP C OD1   1 
ATOM   8926  O  OD2   . ASP C 1 693  ? 99.595  146.363 144.001 1.00 222.07 -1 565  ASP C OD2   1 
ATOM   8927  N  N     . ASP C 1 694  ? 102.644 143.628 144.013 1.00 64.75  ?  566  ASP C N     1 
ATOM   8928  C  CA    . ASP C 1 694  ? 102.496 142.195 143.773 1.00 59.82  ?  566  ASP C CA    1 
ATOM   8929  C  C     . ASP C 1 694  ? 103.890 141.557 143.714 1.00 51.14  ?  566  ASP C C     1 
ATOM   8930  O  O     . ASP C 1 694  ? 104.894 142.194 144.047 1.00 55.11  ?  566  ASP C O     1 
ATOM   8931  C  CB    . ASP C 1 694  ? 101.692 141.968 142.489 1.00 78.59  ?  566  ASP C CB    1 
ATOM   8932  C  CG    . ASP C 1 694  ? 101.150 140.552 142.365 1.00 77.81  ?  566  ASP C CG    1 
ATOM   8933  O  OD1   . ASP C 1 694  ? 101.666 139.647 143.052 1.00 59.91  ?  566  ASP C OD1   1 
ATOM   8934  O  OD2   . ASP C 1 694  ? 100.219 140.336 141.559 1.00 213.85 -1 566  ASP C OD2   1 
ATOM   8935  N  N     . VAL C 1 695  ? 103.973 140.291 143.302 1.00 41.22  ?  567  VAL C N     1 
ATOM   8936  C  CA    . VAL C 1 695  ? 105.289 139.722 142.976 1.00 21.57  ?  567  VAL C CA    1 
ATOM   8937  C  C     . VAL C 1 695  ? 105.879 140.516 141.825 1.00 22.76  ?  567  VAL C C     1 
ATOM   8938  O  O     . VAL C 1 695  ? 105.185 140.761 140.821 1.00 33.14  ?  567  VAL C O     1 
ATOM   8939  C  CB    . VAL C 1 695  ? 105.191 138.230 142.607 1.00 11.80  ?  567  VAL C CB    1 
ATOM   8940  C  CG1   . VAL C 1 695  ? 104.064 137.987 141.619 1.00 18.44  ?  567  VAL C CG1   1 
ATOM   8941  C  CG2   . VAL C 1 695  ? 106.516 137.744 142.016 1.00 7.93   ?  567  VAL C CG2   1 
ATOM   8942  N  N     . PRO C 1 696  ? 107.126 140.951 141.914 1.00 26.95  ?  568  PRO C N     1 
ATOM   8943  C  CA    . PRO C 1 696  ? 107.641 141.907 140.934 1.00 37.56  ?  568  PRO C CA    1 
ATOM   8944  C  C     . PRO C 1 696  ? 107.630 141.344 139.519 1.00 29.34  ?  568  PRO C C     1 
ATOM   8945  O  O     . PRO C 1 696  ? 107.490 140.144 139.273 1.00 27.80  ?  568  PRO C O     1 
ATOM   8946  C  CB    . PRO C 1 696  ? 109.064 142.181 141.424 1.00 46.22  ?  568  PRO C CB    1 
ATOM   8947  C  CG    . PRO C 1 696  ? 108.990 141.910 142.903 1.00 38.66  ?  568  PRO C CG    1 
ATOM   8948  C  CD    . PRO C 1 696  ? 108.044 140.759 143.049 1.00 24.74  ?  568  PRO C CD    1 
ATOM   8949  N  N     . ALA C 1 697  ? 107.787 142.264 138.567 1.00 33.76  ?  569  ALA C N     1 
ATOM   8950  C  CA    . ALA C 1 697  ? 107.949 141.949 137.154 1.00 31.13  ?  569  ALA C CA    1 
ATOM   8951  C  C     . ALA C 1 697  ? 109.416 141.800 136.774 1.00 49.24  ?  569  ALA C C     1 
ATOM   8952  O  O     . ALA C 1 697  ? 109.797 142.113 135.640 1.00 45.39  ?  569  ALA C O     1 
ATOM   8953  C  CB    . ALA C 1 697  ? 107.274 143.016 136.288 1.00 19.27  ?  569  ALA C CB    1 
ATOM   8954  N  N     . ASP C 1 698  ? 110.252 141.339 137.710 1.00 56.04  ?  570  ASP C N     1 
ATOM   8955  C  CA    . ASP C 1 698  ? 111.701 141.343 137.510 1.00 59.26  ?  570  ASP C CA    1 
ATOM   8956  C  C     . ASP C 1 698  ? 112.127 140.367 136.418 1.00 50.59  ?  570  ASP C C     1 
ATOM   8957  O  O     . ASP C 1 698  ? 112.970 140.696 135.577 1.00 56.73  ?  570  ASP C O     1 
ATOM   8958  C  CB    . ASP C 1 698  ? 112.420 141.009 138.821 1.00 97.84  ?  570  ASP C CB    1 
ATOM   8959  C  CG    . ASP C 1 698  ? 113.910 141.355 138.782 1.00 208.28 ?  570  ASP C CG    1 
ATOM   8960  O  OD1   . ASP C 1 698  ? 114.354 142.043 137.835 1.00 197.74 ?  570  ASP C OD1   1 
ATOM   8961  O  OD2   . ASP C 1 698  ? 114.652 140.907 139.681 1.00 392.41 -1 570  ASP C OD2   1 
ATOM   8962  N  N     . THR C 1 699  ? 111.591 139.151 136.443 1.00 35.28  ?  571  THR C N     1 
ATOM   8963  C  CA    . THR C 1 699  ? 112.041 138.078 135.559 1.00 19.75  ?  571  THR C CA    1 
ATOM   8964  C  C     . THR C 1 699  ? 112.089 138.518 134.097 1.00 16.22  ?  571  THR C C     1 
ATOM   8965  O  O     . THR C 1 699  ? 111.056 138.845 133.510 1.00 25.66  ?  571  THR C O     1 
ATOM   8966  C  CB    . THR C 1 699  ? 111.104 136.880 135.736 1.00 11.29  ?  571  THR C CB    1 
ATOM   8967  O  OG1   . THR C 1 699  ? 111.406 136.218 136.970 1.00 11.73  ?  571  THR C OG1   1 
ATOM   8968  C  CG2   . THR C 1 699  ? 111.242 135.905 134.595 1.00 17.77  ?  571  THR C CG2   1 
ATOM   8969  N  N     . ILE C 1 700  ? 113.301 138.525 133.508 1.00 9.33   ?  572  ILE C N     1 
ATOM   8970  C  CA    . ILE C 1 700  ? 113.511 138.931 132.117 1.00 7.96   ?  572  ILE C CA    1 
ATOM   8971  C  C     . ILE C 1 700  ? 113.552 137.695 131.233 1.00 8.07   ?  572  ILE C C     1 
ATOM   8972  O  O     . ILE C 1 700  ? 114.238 136.713 131.542 1.00 8.68   ?  572  ILE C O     1 
ATOM   8973  C  CB    . ILE C 1 700  ? 114.795 139.769 131.944 1.00 6.97   ?  572  ILE C CB    1 
ATOM   8974  C  CG1   . ILE C 1 700  ? 114.539 141.232 132.308 1.00 20.11  ?  572  ILE C CG1   1 
ATOM   8975  C  CG2   . ILE C 1 700  ? 115.299 139.710 130.519 1.00 9.61   ?  572  ILE C CG2   1 
ATOM   8976  C  CD1   . ILE C 1 700  ? 115.636 142.209 131.844 1.00 22.20  ?  572  ILE C CD1   1 
ATOM   8977  N  N     . SER C 1 701  ? 112.839 137.759 130.110 1.00 11.87  ?  573  SER C N     1 
ATOM   8978  C  CA    . SER C 1 701  ? 112.687 136.613 129.227 1.00 18.38  ?  573  SER C CA    1 
ATOM   8979  C  C     . SER C 1 701  ? 112.212 137.091 127.859 1.00 13.61  ?  573  SER C C     1 
ATOM   8980  O  O     . SER C 1 701  ? 111.623 138.165 127.720 1.00 15.48  ?  573  SER C O     1 
ATOM   8981  C  CB    . SER C 1 701  ? 111.724 135.580 129.835 1.00 34.24  ?  573  SER C CB    1 
ATOM   8982  O  OG    . SER C 1 701  ? 110.426 135.657 129.285 1.00 33.80  ?  573  SER C OG    1 
ATOM   8983  N  N     . ARG C 1 702  ? 112.498 136.279 126.847 1.00 11.05  ?  574  ARG C N     1 
ATOM   8984  C  CA    . ARG C 1 702  ? 112.119 136.585 125.477 1.00 19.90  ?  574  ARG C CA    1 
ATOM   8985  C  C     . ARG C 1 702  ? 111.745 135.292 124.775 1.00 20.43  ?  574  ARG C C     1 
ATOM   8986  O  O     . ARG C 1 702  ? 112.311 134.229 125.046 1.00 26.87  ?  574  ARG C O     1 
ATOM   8987  C  CB    . ARG C 1 702  ? 113.245 137.268 124.702 1.00 20.13  ?  574  ARG C CB    1 
ATOM   8988  C  CG    . ARG C 1 702  ? 113.626 138.615 125.245 1.00 22.00  ?  574  ARG C CG    1 
ATOM   8989  C  CD    . ARG C 1 702  ? 112.542 139.631 125.007 1.00 20.78  ?  574  ARG C CD    1 
ATOM   8990  N  NE    . ARG C 1 702  ? 113.112 140.946 124.760 1.00 21.33  ?  574  ARG C NE    1 
ATOM   8991  C  CZ    . ARG C 1 702  ? 113.003 141.961 125.605 1.00 20.70  ?  574  ARG C CZ    1 
ATOM   8992  N  NH1   . ARG C 1 702  ? 112.354 141.800 126.756 1.00 21.18  ?  574  ARG C NH1   1 
ATOM   8993  N  NH2   . ARG C 1 702  ? 113.552 143.135 125.316 1.00 26.02  ?  574  ARG C NH2   1 
ATOM   8994  N  N     . ARG C 1 703  ? 110.798 135.392 123.853 1.00 12.71  ?  575  ARG C N     1 
ATOM   8995  C  CA    . ARG C 1 703  ? 110.314 134.205 123.174 1.00 11.77  ?  575  ARG C CA    1 
ATOM   8996  C  C     . ARG C 1 703  ? 109.599 134.622 121.901 1.00 11.21  ?  575  ARG C C     1 
ATOM   8997  O  O     . ARG C 1 703  ? 109.425 135.808 121.615 1.00 15.71  ?  575  ARG C O     1 
ATOM   8998  C  CB    . ARG C 1 703  ? 109.391 133.385 124.082 1.00 13.73  ?  575  ARG C CB    1 
ATOM   8999  C  CG    . ARG C 1 703  ? 107.941 133.840 124.075 1.00 11.54  ?  575  ARG C CG    1 
ATOM   9000  C  CD    . ARG C 1 703  ? 107.095 132.961 124.973 1.00 8.91   ?  575  ARG C CD    1 
ATOM   9001  N  NE    . ARG C 1 703  ? 105.735 133.462 125.113 1.00 10.37  ?  575  ARG C NE    1 
ATOM   9002  C  CZ    . ARG C 1 703  ? 104.907 133.672 124.096 1.00 16.12  ?  575  ARG C CZ    1 
ATOM   9003  N  NH1   . ARG C 1 703  ? 105.285 133.398 122.856 1.00 24.62  ?  575  ARG C NH1   1 
ATOM   9004  N  NH2   . ARG C 1 703  ? 103.686 134.137 124.323 1.00 15.62  ?  575  ARG C NH2   1 
ATOM   9005  N  N     . PHE C 1 704  ? 109.201 133.615 121.135 1.00 7.37   ?  576  PHE C N     1 
ATOM   9006  C  CA    . PHE C 1 704  ? 108.433 133.789 119.920 1.00 6.52   ?  576  PHE C CA    1 
ATOM   9007  C  C     . PHE C 1 704  ? 106.965 133.478 120.205 1.00 9.85   ?  576  PHE C C     1 
ATOM   9008  O  O     . PHE C 1 704  ? 106.565 133.192 121.335 1.00 18.85  ?  576  PHE C O     1 
ATOM   9009  C  CB    . PHE C 1 704  ? 108.978 132.890 118.810 1.00 11.66  ?  576  PHE C CB    1 
ATOM   9010  C  CG    . PHE C 1 704  ? 110.263 133.380 118.176 1.00 17.81  ?  576  PHE C CG    1 
ATOM   9011  C  CD1   . PHE C 1 704  ? 110.587 134.723 118.157 1.00 21.45  ?  576  PHE C CD1   1 
ATOM   9012  C  CD2   . PHE C 1 704  ? 111.141 132.492 117.581 1.00 36.02  ?  576  PHE C CD2   1 
ATOM   9013  C  CE1   . PHE C 1 704  ? 111.760 135.154 117.555 1.00 13.42  ?  576  PHE C CE1   1 
ATOM   9014  C  CE2   . PHE C 1 704  ? 112.315 132.932 116.989 1.00 25.00  ?  576  PHE C CE2   1 
ATOM   9015  C  CZ    . PHE C 1 704  ? 112.616 134.259 116.983 1.00 21.70  ?  576  PHE C CZ    1 
ATOM   9016  N  N     . ARG C 1 705  ? 106.151 133.554 119.163 1.00 21.35  ?  577  ARG C N     1 
ATOM   9017  C  CA    . ARG C 1 705  ? 104.785 133.049 119.210 1.00 11.19  ?  577  ARG C CA    1 
ATOM   9018  C  C     . ARG C 1 705  ? 104.810 131.628 118.662 1.00 9.91   ?  577  ARG C C     1 
ATOM   9019  O  O     . ARG C 1 705  ? 105.155 131.416 117.496 1.00 16.82  ?  577  ARG C O     1 
ATOM   9020  C  CB    . ARG C 1 705  ? 103.843 133.945 118.411 1.00 17.12  ?  577  ARG C CB    1 
ATOM   9021  C  CG    . ARG C 1 705  ? 103.117 134.977 119.265 1.00 16.29  ?  577  ARG C CG    1 
ATOM   9022  C  CD    . ARG C 1 705  ? 102.003 135.658 118.492 1.00 12.56  ?  577  ARG C CD    1 
ATOM   9023  N  NE    . ARG C 1 705  ? 101.280 134.705 117.664 1.00 23.02  ?  577  ARG C NE    1 
ATOM   9024  C  CZ    . ARG C 1 705  ? 99.999  134.821 117.340 1.00 39.31  ?  577  ARG C CZ    1 
ATOM   9025  N  NH1   . ARG C 1 705  ? 99.288  135.849 117.781 1.00 32.02  ?  577  ARG C NH1   1 
ATOM   9026  N  NH2   . ARG C 1 705  ? 99.428  133.900 116.578 1.00 65.54  ?  577  ARG C NH2   1 
ATOM   9027  N  N     . TYR C 1 706  ? 104.453 130.661 119.512 1.00 10.69  ?  578  TYR C N     1 
ATOM   9028  C  CA    . TYR C 1 706  ? 104.602 129.238 119.222 1.00 12.39  ?  578  TYR C CA    1 
ATOM   9029  C  C     . TYR C 1 706  ? 104.148 128.869 117.807 1.00 13.85  ?  578  TYR C C     1 
ATOM   9030  O  O     . TYR C 1 706  ? 104.930 128.359 116.992 1.00 14.42  ?  578  TYR C O     1 
ATOM   9031  C  CB    . TYR C 1 706  ? 103.819 128.444 120.273 1.00 20.28  ?  578  TYR C CB    1 
ATOM   9032  C  CG    . TYR C 1 706  ? 104.093 126.955 120.264 1.00 39.58  ?  578  TYR C CG    1 
ATOM   9033  C  CD1   . TYR C 1 706  ? 103.363 126.101 119.456 1.00 62.17  ?  578  TYR C CD1   1 
ATOM   9034  C  CD2   . TYR C 1 706  ? 105.064 126.401 121.085 1.00 41.89  ?  578  TYR C CD2   1 
ATOM   9035  C  CE1   . TYR C 1 706  ? 103.605 124.741 119.447 1.00 66.64  ?  578  TYR C CE1   1 
ATOM   9036  C  CE2   . TYR C 1 706  ? 105.316 125.041 121.077 1.00 50.44  ?  578  TYR C CE2   1 
ATOM   9037  C  CZ    . TYR C 1 706  ? 104.580 124.216 120.257 1.00 64.50  ?  578  TYR C CZ    1 
ATOM   9038  O  OH    . TYR C 1 706  ? 104.826 122.862 120.252 1.00 75.10  ?  578  TYR C OH    1 
ATOM   9039  N  N     . ASP C 1 707  ? 102.870 129.125 117.517 1.00 19.67  ?  579  ASP C N     1 
ATOM   9040  C  CA    . ASP C 1 707  ? 102.307 128.863 116.201 1.00 20.28  ?  579  ASP C CA    1 
ATOM   9041  C  C     . ASP C 1 707  ? 103.130 129.491 115.084 1.00 21.60  ?  579  ASP C C     1 
ATOM   9042  O  O     . ASP C 1 707  ? 103.367 128.862 114.045 1.00 29.26  ?  579  ASP C O     1 
ATOM   9043  C  CB    . ASP C 1 707  ? 100.874 129.392 116.143 1.00 29.36  ?  579  ASP C CB    1 
ATOM   9044  C  CG    . ASP C 1 707  ? 100.770 130.838 116.606 1.00 54.35  ?  579  ASP C CG    1 
ATOM   9045  O  OD1   . ASP C 1 707  ? 101.805 131.421 117.001 1.00 33.58  ?  579  ASP C OD1   1 
ATOM   9046  O  OD2   . ASP C 1 707  ? 99.666  131.412 116.533 1.00 292.84 -1 579  ASP C OD2   1 
ATOM   9047  N  N     . VAL C 1 708  ? 103.546 130.741 115.270 1.00 20.24  ?  580  VAL C N     1 
ATOM   9048  C  CA    . VAL C 1 708  ? 104.228 131.461 114.203 1.00 23.99  ?  580  VAL C CA    1 
ATOM   9049  C  C     . VAL C 1 708  ? 105.572 130.808 113.894 1.00 21.98  ?  580  VAL C C     1 
ATOM   9050  O  O     . VAL C 1 708  ? 105.941 130.629 112.726 1.00 22.54  ?  580  VAL C O     1 
ATOM   9051  C  CB    . VAL C 1 708  ? 104.369 132.946 114.585 1.00 27.12  ?  580  VAL C CB    1 
ATOM   9052  C  CG1   . VAL C 1 708  ? 105.048 133.712 113.487 1.00 22.99  ?  580  VAL C CG1   1 
ATOM   9053  C  CG2   . VAL C 1 708  ? 102.995 133.559 114.864 1.00 24.91  ?  580  VAL C CG2   1 
ATOM   9054  N  N     . ALA C 1 709  ? 106.316 130.421 114.932 1.00 17.72  ?  581  ALA C N     1 
ATOM   9055  C  CA    . ALA C 1 709  ? 107.579 129.719 114.716 1.00 17.06  ?  581  ALA C CA    1 
ATOM   9056  C  C     . ALA C 1 709  ? 107.352 128.382 114.035 1.00 15.62  ?  581  ALA C C     1 
ATOM   9057  O  O     . ALA C 1 709  ? 108.157 127.951 113.196 1.00 21.34  ?  581  ALA C O     1 
ATOM   9058  C  CB    . ALA C 1 709  ? 108.307 129.525 116.046 1.00 36.35  ?  581  ALA C CB    1 
ATOM   9059  N  N     . LEU C 1 710  ? 106.271 127.700 114.405 1.00 13.93  ?  582  LEU C N     1 
ATOM   9060  C  CA    . LEU C 1 710  ? 105.969 126.421 113.779 1.00 18.99  ?  582  LEU C CA    1 
ATOM   9061  C  C     . LEU C 1 710  ? 105.741 126.599 112.278 1.00 21.99  ?  582  LEU C C     1 
ATOM   9062  O  O     . LEU C 1 710  ? 106.263 125.829 111.463 1.00 23.02  ?  582  LEU C O     1 
ATOM   9063  C  CB    . LEU C 1 710  ? 104.751 125.794 114.461 1.00 38.71  ?  582  LEU C CB    1 
ATOM   9064  C  CG    . LEU C 1 710  ? 104.695 124.267 114.539 1.00 33.44  ?  582  LEU C CG    1 
ATOM   9065  C  CD1   . LEU C 1 710  ? 103.670 123.800 115.579 1.00 49.62  ?  582  LEU C CD1   1 
ATOM   9066  C  CD2   . LEU C 1 710  ? 104.416 123.649 113.182 1.00 46.82  ?  582  LEU C CD2   1 
ATOM   9067  N  N     . VAL C 1 711  ? 104.953 127.614 111.895 1.00 29.49  ?  583  VAL C N     1 
ATOM   9068  C  CA    . VAL C 1 711  ? 104.709 127.849 110.467 1.00 31.82  ?  583  VAL C CA    1 
ATOM   9069  C  C     . VAL C 1 711  ? 105.994 128.278 109.777 1.00 31.79  ?  583  VAL C C     1 
ATOM   9070  O  O     . VAL C 1 711  ? 106.224 127.939 108.610 1.00 43.62  ?  583  VAL C O     1 
ATOM   9071  C  CB    . VAL C 1 711  ? 103.569 128.870 110.208 1.00 52.58  ?  583  VAL C CB    1 
ATOM   9072  C  CG1   . VAL C 1 711  ? 102.381 128.637 111.132 1.00 94.08  ?  583  VAL C CG1   1 
ATOM   9073  C  CG2   . VAL C 1 711  ? 104.052 130.328 110.254 1.00 32.80  ?  583  VAL C CG2   1 
ATOM   9074  N  N     . SER C 1 712  ? 106.855 129.010 110.483 1.00 21.65  ?  584  SER C N     1 
ATOM   9075  C  CA    . SER C 1 712  ? 108.145 129.382 109.921 1.00 22.12  ?  584  SER C CA    1 
ATOM   9076  C  C     . SER C 1 712  ? 108.945 128.134 109.551 1.00 37.57  ?  584  SER C C     1 
ATOM   9077  O  O     . SER C 1 712  ? 109.415 127.994 108.418 1.00 47.93  ?  584  SER C O     1 
ATOM   9078  C  CB    . SER C 1 712  ? 108.899 130.255 110.926 1.00 18.90  ?  584  SER C CB    1 
ATOM   9079  O  OG    . SER C 1 712  ? 109.889 131.055 110.304 1.00 22.23  ?  584  SER C OG    1 
ATOM   9080  N  N     . ALA C 1 713  ? 109.072 127.197 110.494 1.00 34.50  ?  585  ALA C N     1 
ATOM   9081  C  CA    . ALA C 1 713  ? 109.841 125.974 110.258 1.00 32.59  ?  585  ALA C CA    1 
ATOM   9082  C  C     . ALA C 1 713  ? 109.214 125.118 109.168 1.00 27.44  ?  585  ALA C C     1 
ATOM   9083  O  O     . ALA C 1 713  ? 109.913 124.547 108.314 1.00 27.80  ?  585  ALA C O     1 
ATOM   9084  C  CB    . ALA C 1 713  ? 109.938 125.164 111.547 1.00 36.05  ?  585  ALA C CB    1 
ATOM   9085  N  N     . LEU C 1 714  ? 107.893 124.988 109.202 1.00 20.17  ?  586  LEU C N     1 
ATOM   9086  C  CA    . LEU C 1 714  ? 107.232 124.139 108.228 1.00 21.71  ?  586  LEU C CA    1 
ATOM   9087  C  C     . LEU C 1 714  ? 107.427 124.699 106.823 1.00 41.43  ?  586  LEU C C     1 
ATOM   9088  O  O     . LEU C 1 714  ? 107.817 123.970 105.905 1.00 67.97  ?  586  LEU C O     1 
ATOM   9089  C  CB    . LEU C 1 714  ? 105.754 123.988 108.587 1.00 48.30  ?  586  LEU C CB    1 
ATOM   9090  C  CG    . LEU C 1 714  ? 105.090 122.713 108.057 1.00 68.98  ?  586  LEU C CG    1 
ATOM   9091  C  CD1   . LEU C 1 714  ? 105.986 121.506 108.304 1.00 44.40  ?  586  LEU C CD1   1 
ATOM   9092  C  CD2   . LEU C 1 714  ? 103.685 122.490 108.622 1.00 66.83  ?  586  LEU C CD2   1 
ATOM   9093  N  N     . LYS C 1 715  ? 107.192 126.005 106.636 1.00 45.03  ?  587  LYS C N     1 
ATOM   9094  C  CA    . LYS C 1 715  ? 107.440 126.599 105.325 1.00 55.20  ?  587  LYS C CA    1 
ATOM   9095  C  C     . LYS C 1 715  ? 108.913 126.525 104.950 1.00 61.29  ?  587  LYS C C     1 
ATOM   9096  O  O     . LYS C 1 715  ? 109.247 126.369 103.770 1.00 87.35  ?  587  LYS C O     1 
ATOM   9097  C  CB    . LYS C 1 715  ? 106.932 128.045 105.273 1.00 34.46  ?  587  LYS C CB    1 
ATOM   9098  C  CG    . LYS C 1 715  ? 107.696 128.942 104.306 1.00 29.99  ?  587  LYS C CG    1 
ATOM   9099  C  CD    . LYS C 1 715  ? 107.155 130.332 104.332 1.00 16.87  ?  587  LYS C CD    1 
ATOM   9100  C  CE    . LYS C 1 715  ? 105.738 130.355 103.780 1.00 20.90  ?  587  LYS C CE    1 
ATOM   9101  N  NZ    . LYS C 1 715  ? 105.611 129.552 102.534 1.00 32.52  ?  587  LYS C NZ    1 
ATOM   9102  N  N     . ASP C 1 716  ? 109.807 126.627 105.932 1.00 53.39  ?  588  ASP C N     1 
ATOM   9103  C  CA    . ASP C 1 716  ? 111.230 126.435 105.679 1.00 61.93  ?  588  ASP C CA    1 
ATOM   9104  C  C     . ASP C 1 716  ? 111.489 125.070 105.056 1.00 49.83  ?  588  ASP C C     1 
ATOM   9105  O  O     . ASP C 1 716  ? 112.361 124.917 104.196 1.00 64.60  ?  588  ASP C O     1 
ATOM   9106  C  CB    . ASP C 1 716  ? 111.984 126.610 106.998 1.00 70.93  ?  588  ASP C CB    1 
ATOM   9107  C  CG    . ASP C 1 716  ? 113.487 126.699 106.821 1.00 130.52 ?  588  ASP C CG    1 
ATOM   9108  O  OD1   . ASP C 1 716  ? 114.066 125.942 106.009 1.00 110.94 ?  588  ASP C OD1   1 
ATOM   9109  O  OD2   . ASP C 1 716  ? 114.095 127.554 107.492 1.00 357.20 -1 588  ASP C OD2   1 
ATOM   9110  N  N     . LEU C 1 717  ? 110.712 124.073 105.452 1.00 38.36  ?  589  LEU C N     1 
ATOM   9111  C  CA    . LEU C 1 717  ? 110.901 122.727 104.922 1.00 49.23  ?  589  LEU C CA    1 
ATOM   9112  C  C     . LEU C 1 717  ? 110.185 122.493 103.559 1.00 76.82  ?  589  LEU C C     1 
ATOM   9113  O  O     . LEU C 1 717  ? 109.870 121.334 103.222 1.00 83.14  ?  589  LEU C O     1 
ATOM   9114  C  CB    . LEU C 1 717  ? 110.432 121.707 105.957 1.00 39.30  ?  589  LEU C CB    1 
ATOM   9115  C  CG    . LEU C 1 717  ? 111.546 121.092 106.800 1.00 24.43  ?  589  LEU C CG    1 
ATOM   9116  C  CD1   . LEU C 1 717  ? 112.549 122.144 107.253 1.00 20.46  ?  589  LEU C CD1   1 
ATOM   9117  C  CD2   . LEU C 1 717  ? 110.929 120.383 107.982 1.00 44.34  ?  589  LEU C CD2   1 
ATOM   9118  N  N     . GLU C 1 718  ? 109.934 123.560 102.789 1.00 85.60  ?  590  GLU C N     1 
ATOM   9119  C  CA    . GLU C 1 718  ? 109.139 123.439 101.563 1.00 94.74  ?  590  GLU C CA    1 
ATOM   9120  C  C     . GLU C 1 718  ? 109.859 122.600 100.512 1.00 102.19 ?  590  GLU C C     1 
ATOM   9121  O  O     . GLU C 1 718  ? 109.232 121.799 99.805  1.00 97.64  ?  590  GLU C O     1 
ATOM   9122  C  CB    . GLU C 1 718  ? 108.804 124.827 101.004 1.00 101.45 ?  590  GLU C CB    1 
ATOM   9123  C  CG    . GLU C 1 718  ? 109.682 125.310 99.850  1.00 128.42 ?  590  GLU C CG    1 
ATOM   9124  C  CD    . GLU C 1 718  ? 109.597 126.807 99.622  1.00 166.94 ?  590  GLU C CD    1 
ATOM   9125  O  OE1   . GLU C 1 718  ? 110.587 127.516 99.903  1.00 144.52 ?  590  GLU C OE1   1 
ATOM   9126  O  OE2   . GLU C 1 718  ? 108.530 127.278 99.180  1.00 327.09 -1 590  GLU C OE2   1 
ATOM   9127  N  N     . GLU C 1 719  ? 111.177 122.772 100.392 1.00 122.79 ?  591  GLU C N     1 
ATOM   9128  C  CA    . GLU C 1 719  ? 111.929 122.007 99.409  1.00 148.91 ?  591  GLU C CA    1 
ATOM   9129  C  C     . GLU C 1 719  ? 111.874 120.521 99.727  1.00 137.33 ?  591  GLU C C     1 
ATOM   9130  O  O     . GLU C 1 719  ? 111.677 119.690 98.832  1.00 146.34 ?  591  GLU C O     1 
ATOM   9131  C  CB    . GLU C 1 719  ? 113.377 122.520 99.344  1.00 168.91 ?  591  GLU C CB    1 
ATOM   9132  C  CG    . GLU C 1 719  ? 114.382 121.562 98.717  1.00 194.97 ?  591  GLU C CG    1 
ATOM   9133  C  CD    . GLU C 1 719  ? 114.938 120.556 99.711  1.00 244.79 ?  591  GLU C CD    1 
ATOM   9134  O  OE1   . GLU C 1 719  ? 114.701 120.724 100.924 1.00 210.02 ?  591  GLU C OE1   1 
ATOM   9135  O  OE2   . GLU C 1 719  ? 115.580 119.578 99.272  1.00 440.94 -1 591  GLU C OE2   1 
ATOM   9136  N  N     . ASP C 1 720  ? 112.016 120.170 101.006 1.00 123.27 ?  592  ASP C N     1 
ATOM   9137  C  CA    . ASP C 1 720  ? 112.025 118.763 101.394 1.00 116.93 ?  592  ASP C CA    1 
ATOM   9138  C  C     . ASP C 1 720  ? 110.645 118.130 101.248 1.00 104.13 ?  592  ASP C C     1 
ATOM   9139  O  O     . ASP C 1 720  ? 110.540 116.961 100.865 1.00 105.29 ?  592  ASP C O     1 
ATOM   9140  C  CB    . ASP C 1 720  ? 112.547 118.618 102.821 1.00 146.34 ?  592  ASP C CB    1 
ATOM   9141  C  CG    . ASP C 1 720  ? 114.055 118.419 102.878 1.00 223.66 ?  592  ASP C CG    1 
ATOM   9142  O  OD1   . ASP C 1 720  ? 114.637 117.964 101.871 1.00 219.45 ?  592  ASP C OD1   1 
ATOM   9143  O  OD2   . ASP C 1 720  ? 114.662 118.739 103.920 1.00 339.09 -1 592  ASP C OD2   1 
ATOM   9144  N  N     . ILE C 1 721  ? 109.573 118.873 101.538 1.00 101.81 ?  593  ILE C N     1 
ATOM   9145  C  CA    . ILE C 1 721  ? 108.252 118.272 101.356 1.00 111.78 ?  593  ILE C CA    1 
ATOM   9146  C  C     . ILE C 1 721  ? 107.948 118.098 99.869  1.00 116.83 ?  593  ILE C C     1 
ATOM   9147  O  O     . ILE C 1 721  ? 107.382 117.077 99.451  1.00 113.98 ?  593  ILE C O     1 
ATOM   9148  C  CB    . ILE C 1 721  ? 107.151 119.083 102.067 1.00 119.57 ?  593  ILE C CB    1 
ATOM   9149  C  CG1   . ILE C 1 721  ? 107.163 120.545 101.627 1.00 92.59  ?  593  ILE C CG1   1 
ATOM   9150  C  CG2   . ILE C 1 721  ? 107.295 118.965 103.583 1.00 116.50 ?  593  ILE C CG2   1 
ATOM   9151  C  CD1   . ILE C 1 721  ? 105.946 121.349 102.061 1.00 81.29  ?  593  ILE C CD1   1 
ATOM   9152  N  N     . MET C 1 722  ? 108.326 119.081 99.042  1.00 112.53 ?  594  MET C N     1 
ATOM   9153  C  CA    . MET C 1 722  ? 108.107 118.945 97.606  1.00 108.00 ?  594  MET C CA    1 
ATOM   9154  C  C     . MET C 1 722  ? 108.934 117.789 97.042  1.00 125.36 ?  594  MET C C     1 
ATOM   9155  O  O     . MET C 1 722  ? 108.476 117.055 96.156  1.00 147.63 ?  594  MET C O     1 
ATOM   9156  C  CB    . MET C 1 722  ? 108.450 120.259 96.901  1.00 81.67  ?  594  MET C CB    1 
ATOM   9157  C  CG    . MET C 1 722  ? 107.524 120.636 95.752  1.00 71.93  ?  594  MET C CG    1 
ATOM   9158  S  SD    . MET C 1 722  ? 105.772 120.478 96.163  1.00 87.98  ?  594  MET C SD    1 
ATOM   9159  C  CE    . MET C 1 722  ? 105.637 121.655 97.510  1.00 55.59  ?  594  MET C CE    1 
ATOM   9160  N  N     . GLU C 1 723  ? 110.149 117.596 97.564  1.00 130.68 ?  595  GLU C N     1 
ATOM   9161  C  CA    . GLU C 1 723  ? 110.982 116.487 97.115  1.00 134.44 ?  595  GLU C CA    1 
ATOM   9162  C  C     . GLU C 1 723  ? 110.402 115.149 97.563  1.00 130.33 ?  595  GLU C C     1 
ATOM   9163  O  O     . GLU C 1 723  ? 110.462 114.164 96.822  1.00 144.64 ?  595  GLU C O     1 
ATOM   9164  C  CB    . GLU C 1 723  ? 112.415 116.660 97.627  1.00 150.64 ?  595  GLU C CB    1 
ATOM   9165  C  CG    . GLU C 1 723  ? 113.205 115.358 97.751  1.00 167.02 ?  595  GLU C CG    1 
ATOM   9166  C  CD    . GLU C 1 723  ? 113.342 114.618 96.427  1.00 213.65 ?  595  GLU C CD    1 
ATOM   9167  O  OE1   . GLU C 1 723  ? 113.372 115.279 95.366  1.00 213.16 ?  595  GLU C OE1   1 
ATOM   9168  O  OE2   . GLU C 1 723  ? 113.364 113.369 96.442  1.00 261.79 -1 595  GLU C OE2   1 
ATOM   9169  N  N     . GLY C 1 724  ? 109.853 115.089 98.778  1.00 111.97 ?  596  GLY C N     1 
ATOM   9170  C  CA    . GLY C 1 724  ? 109.165 113.888 99.205  1.00 98.96  ?  596  GLY C CA    1 
ATOM   9171  C  C     . GLY C 1 724  ? 107.971 113.552 98.337  1.00 98.09  ?  596  GLY C C     1 
ATOM   9172  O  O     . GLY C 1 724  ? 107.689 112.376 98.091  1.00 101.76 ?  596  GLY C O     1 
ATOM   9173  N  N     . LEU C 1 725  ? 107.255 114.573 97.861  1.00 94.94  ?  597  LEU C N     1 
ATOM   9174  C  CA    . LEU C 1 725  ? 106.150 114.323 96.933  1.00 93.41  ?  597  LEU C CA    1 
ATOM   9175  C  C     . LEU C 1 725  ? 106.653 113.831 95.579  1.00 119.88 ?  597  LEU C C     1 
ATOM   9176  O  O     . LEU C 1 725  ? 106.021 112.972 94.952  1.00 114.03 ?  597  LEU C O     1 
ATOM   9177  C  CB    . LEU C 1 725  ? 105.313 115.588 96.750  1.00 97.35  ?  597  LEU C CB    1 
ATOM   9178  C  CG    . LEU C 1 725  ? 104.558 116.150 97.951  1.00 81.14  ?  597  LEU C CG    1 
ATOM   9179  C  CD1   . LEU C 1 725  ? 103.279 116.811 97.485  1.00 65.64  ?  597  LEU C CD1   1 
ATOM   9180  C  CD2   . LEU C 1 725  ? 104.252 115.056 98.960  1.00 68.24  ?  597  LEU C CD2   1 
ATOM   9181  N  N     . ARG C 1 726  ? 107.773 114.379 95.101  1.00 150.27 ?  598  ARG C N     1 
ATOM   9182  C  CA    . ARG C 1 726  ? 108.311 113.960 93.804  1.00 150.25 ?  598  ARG C CA    1 
ATOM   9183  C  C     . ARG C 1 726  ? 108.861 112.537 93.851  1.00 134.53 ?  598  ARG C C     1 
ATOM   9184  O  O     . ARG C 1 726  ? 108.601 111.734 92.949  1.00 132.94 ?  598  ARG C O     1 
ATOM   9185  C  CB    . ARG C 1 726  ? 109.386 114.943 93.336  1.00 155.27 ?  598  ARG C CB    1 
ATOM   9186  C  CG    . ARG C 1 726  ? 108.842 116.310 93.024  1.00 158.19 ?  598  ARG C CG    1 
ATOM   9187  C  CD    . ARG C 1 726  ? 107.792 116.212 91.937  1.00 154.65 ?  598  ARG C CD    1 
ATOM   9188  N  NE    . ARG C 1 726  ? 106.670 117.099 92.197  1.00 187.49 ?  598  ARG C NE    1 
ATOM   9189  C  CZ    . ARG C 1 726  ? 105.599 116.743 92.901  1.00 203.96 ?  598  ARG C CZ    1 
ATOM   9190  N  NH1   . ARG C 1 726  ? 105.509 115.514 93.401  1.00 164.82 ?  598  ARG C NH1   1 
ATOM   9191  N  NH2   . ARG C 1 726  ? 104.613 117.610 93.099  1.00 254.34 ?  598  ARG C NH2   1 
ATOM   9192  N  N     . GLU C 1 727  ? 109.644 112.219 94.882  1.00 134.35 ?  599  GLU C N     1 
ATOM   9193  C  CA    . GLU C 1 727  ? 110.220 110.884 95.003  1.00 119.35 ?  599  GLU C CA    1 
ATOM   9194  C  C     . GLU C 1 727  ? 109.130 109.822 95.084  1.00 118.66 ?  599  GLU C C     1 
ATOM   9195  O  O     . GLU C 1 727  ? 109.168 108.817 94.364  1.00 117.18 ?  599  GLU C O     1 
ATOM   9196  C  CB    . GLU C 1 727  ? 111.143 110.826 96.225  1.00 120.25 ?  599  GLU C CB    1 
ATOM   9197  C  CG    . GLU C 1 727  ? 111.848 109.492 96.433  1.00 141.10 ?  599  GLU C CG    1 
ATOM   9198  C  CD    . GLU C 1 727  ? 111.019 108.507 97.234  1.00 160.40 ?  599  GLU C CD    1 
ATOM   9199  O  OE1   . GLU C 1 727  ? 109.988 108.917 97.806  1.00 138.36 ?  599  GLU C OE1   1 
ATOM   9200  O  OE2   . GLU C 1 727  ? 111.392 107.316 97.278  1.00 277.26 -1 599  GLU C OE2   1 
ATOM   9201  N  N     . ARG C 1 728  ? 108.147 110.025 95.963  1.00 119.05 ?  600  ARG C N     1 
ATOM   9202  C  CA    . ARG C 1 728  ? 106.999 109.129 96.021  1.00 107.45 ?  600  ARG C CA    1 
ATOM   9203  C  C     . ARG C 1 728  ? 106.155 109.199 94.757  1.00 106.45 ?  600  ARG C C     1 
ATOM   9204  O  O     . ARG C 1 728  ? 105.319 108.314 94.540  1.00 100.22 ?  600  ARG C O     1 
ATOM   9205  C  CB    . ARG C 1 728  ? 106.142 109.458 97.250  1.00 86.58  ?  600  ARG C CB    1 
ATOM   9206  C  CG    . ARG C 1 728  ? 105.135 108.378 97.607  1.00 76.22  ?  600  ARG C CG    1 
ATOM   9207  C  CD    . ARG C 1 728  ? 105.847 107.047 97.804  1.00 85.45  ?  600  ARG C CD    1 
ATOM   9208  N  NE    . ARG C 1 728  ? 106.973 107.151 98.731  1.00 91.11  ?  600  ARG C NE    1 
ATOM   9209  C  CZ    . ARG C 1 728  ? 107.415 106.156 99.495  1.00 93.62  ?  600  ARG C CZ    1 
ATOM   9210  N  NH1   . ARG C 1 728  ? 106.846 104.960 99.433  1.00 97.36  ?  600  ARG C NH1   1 
ATOM   9211  N  NH2   . ARG C 1 728  ? 108.445 106.352 100.309 1.00 88.99  ?  600  ARG C NH2   1 
ATOM   9212  N  N     . ALA C 1 729  ? 106.365 110.220 93.921  1.00 122.21 ?  601  ALA C N     1 
ATOM   9213  C  CA    . ALA C 1 729  ? 105.636 110.397 92.666  1.00 128.07 ?  601  ALA C CA    1 
ATOM   9214  C  C     . ALA C 1 729  ? 104.135 110.465 92.913  1.00 113.58 ?  601  ALA C C     1 
ATOM   9215  O  O     . ALA C 1 729  ? 103.327 109.973 92.122  1.00 117.97 ?  601  ALA C O     1 
ATOM   9216  C  CB    . ALA C 1 729  ? 105.978 109.296 91.661  1.00 142.95 ?  601  ALA C CB    1 
ATOM   9217  N  N     . LEU C 1 730  ? 103.762 111.079 94.027  1.00 103.92 ?  602  LEU C N     1 
ATOM   9218  C  CA    . LEU C 1 730  ? 102.362 111.200 94.366  1.00 105.41 ?  602  LEU C CA    1 
ATOM   9219  C  C     . LEU C 1 730  ? 101.719 112.311 93.538  1.00 101.95 ?  602  LEU C C     1 
ATOM   9220  O  O     . LEU C 1 730  ? 102.380 113.028 92.782  1.00 91.62  ?  602  LEU C O     1 
ATOM   9221  C  CB    . LEU C 1 730  ? 102.203 111.468 95.859  1.00 94.17  ?  602  LEU C CB    1 
ATOM   9222  C  CG    . LEU C 1 730  ? 101.063 110.679 96.496  1.00 108.16 ?  602  LEU C CG    1 
ATOM   9223  C  CD1   . LEU C 1 730  ? 101.329 109.179 96.413  1.00 83.81  ?  602  LEU C CD1   1 
ATOM   9224  C  CD2   . LEU C 1 730  ? 100.825 111.120 97.930  1.00 127.32 ?  602  LEU C CD2   1 
ATOM   9225  N  N     . ASP C 1 731  ? 100.404 112.438 93.682  1.00 124.63 ?  603  ASP C N     1 
ATOM   9226  C  CA    . ASP C 1 731  ? 99.659  113.448 92.949  1.00 136.14 ?  603  ASP C CA    1 
ATOM   9227  C  C     . ASP C 1 731  ? 100.070 114.852 93.398  1.00 120.03 ?  603  ASP C C     1 
ATOM   9228  O  O     . ASP C 1 731  ? 100.811 115.041 94.368  1.00 123.97 ?  603  ASP C O     1 
ATOM   9229  C  CB    . ASP C 1 731  ? 98.156  113.247 93.138  1.00 181.16 ?  603  ASP C CB    1 
ATOM   9230  C  CG    . ASP C 1 731  ? 97.725  111.797 92.953  1.00 228.02 ?  603  ASP C CG    1 
ATOM   9231  O  OD1   . ASP C 1 731  ? 98.564  110.953 92.576  1.00 208.37 ?  603  ASP C OD1   1 
ATOM   9232  O  OD2   . ASP C 1 731  ? 96.537  111.502 93.196  1.00 369.43 -1 603  ASP C OD2   1 
ATOM   9233  N  N     . ASP C 1 732  ? 99.570  115.849 92.669  1.00 128.50 ?  604  ASP C N     1 
ATOM   9234  C  CA    . ASP C 1 732  ? 99.894  117.250 92.903  1.00 129.05 ?  604  ASP C CA    1 
ATOM   9235  C  C     . ASP C 1 732  ? 98.699  118.067 93.371  1.00 120.98 ?  604  ASP C C     1 
ATOM   9236  O  O     . ASP C 1 732  ? 98.799  118.801 94.357  1.00 117.80 ?  604  ASP C O     1 
ATOM   9237  C  CB    . ASP C 1 732  ? 100.476 117.868 91.627  1.00 154.99 ?  604  ASP C CB    1 
ATOM   9238  C  CG    . ASP C 1 732  ? 101.580 117.026 91.024  1.00 208.29 ?  604  ASP C CG    1 
ATOM   9239  O  OD1   . ASP C 1 732  ? 102.156 116.177 91.739  1.00 164.30 ?  604  ASP C OD1   1 
ATOM   9240  O  OD2   . ASP C 1 732  ? 101.863 117.208 89.823  1.00 415.12 -1 604  ASP C OD2   1 
ATOM   9241  N  N     . SER C 1 733  ? 97.572  117.987 92.666  1.00 126.80 ?  605  SER C N     1 
ATOM   9242  C  CA    . SER C 1 733  ? 96.341  118.608 93.140  1.00 127.12 ?  605  SER C CA    1 
ATOM   9243  C  C     . SER C 1 733  ? 95.628  117.780 94.202  1.00 158.18 ?  605  SER C C     1 
ATOM   9244  O  O     . SER C 1 733  ? 94.598  118.227 94.718  1.00 152.72 ?  605  SER C O     1 
ATOM   9245  C  CB    . SER C 1 733  ? 95.384  118.864 91.971  1.00 127.31 ?  605  SER C CB    1 
ATOM   9246  O  OG    . SER C 1 733  ? 94.216  119.543 92.405  1.00 111.85 ?  605  SER C OG    1 
ATOM   9247  N  N     . MET C 1 734  ? 96.142  116.593 94.536  1.00 178.82 ?  606  MET C N     1 
ATOM   9248  C  CA    . MET C 1 734  ? 95.545  115.706 95.531  1.00 210.10 ?  606  MET C CA    1 
ATOM   9249  C  C     . MET C 1 734  ? 96.398  115.601 96.793  1.00 184.72 ?  606  MET C C     1 
ATOM   9250  O  O     . MET C 1 734  ? 96.386  114.573 97.476  1.00 170.59 ?  606  MET C O     1 
ATOM   9251  C  CB    . MET C 1 734  ? 95.304  114.317 94.939  1.00 231.79 ?  606  MET C CB    1 
ATOM   9252  C  CG    . MET C 1 734  ? 93.925  114.105 94.320  1.00 238.87 ?  606  MET C CG    1 
ATOM   9253  S  SD    . MET C 1 734  ? 92.676  113.544 95.502  1.00 214.21 ?  606  MET C SD    1 
ATOM   9254  C  CE    . MET C 1 734  ? 91.488  112.773 94.404  1.00 128.51 ?  606  MET C CE    1 
ATOM   9255  N  N     . CYS C 1 735  ? 97.164  116.650 97.096  1.00 166.32 ?  607  CYS C N     1 
ATOM   9256  C  CA    . CYS C 1 735  ? 97.897  116.747 98.353  1.00 147.06 ?  607  CYS C CA    1 
ATOM   9257  C  C     . CYS C 1 735  ? 97.549  118.052 99.064  1.00 131.30 ?  607  CYS C C     1 
ATOM   9258  O  O     . CYS C 1 735  ? 98.442  118.776 99.515  1.00 118.15 ?  607  CYS C O     1 
ATOM   9259  C  CB    . CYS C 1 735  ? 99.407  116.644 98.113  1.00 139.97 ?  607  CYS C CB    1 
ATOM   9260  S  SG    . CYS C 1 735  ? 100.071 117.797 96.892  1.00 150.30 ?  607  CYS C SG    1 
ATOM   9261  N  N     . THR C 1 736  ? 96.254  118.371 99.150  1.00 130.75 ?  608  THR C N     1 
ATOM   9262  C  CA    . THR C 1 736  ? 95.806  119.638 99.717  1.00 107.69 ?  608  THR C CA    1 
ATOM   9263  C  C     . THR C 1 736  ? 95.223  119.521 101.123 1.00 104.39 ?  608  THR C C     1 
ATOM   9264  O  O     . THR C 1 736  ? 95.113  120.543 101.811 1.00 97.96  ?  608  THR C O     1 
ATOM   9265  C  CB    . THR C 1 736  ? 94.757  120.299 98.805  1.00 97.36  ?  608  THR C CB    1 
ATOM   9266  O  OG1   . THR C 1 736  ? 93.485  119.667 98.991  1.00 108.80 ?  608  THR C OG1   1 
ATOM   9267  C  CG2   . THR C 1 736  ? 95.159  120.200 97.338  1.00 107.85 ?  608  THR C CG2   1 
ATOM   9268  N  N     . SER C 1 737  ? 94.850  118.318 101.572 1.00 107.65 ?  609  SER C N     1 
ATOM   9269  C  CA    . SER C 1 737  ? 94.164  118.134 102.850 1.00 99.59  ?  609  SER C CA    1 
ATOM   9270  C  C     . SER C 1 737  ? 94.986  117.357 103.872 1.00 85.79  ?  609  SER C C     1 
ATOM   9271  O  O     . SER C 1 737  ? 95.185  117.830 104.995 1.00 79.63  ?  609  SER C O     1 
ATOM   9272  C  CB    . SER C 1 737  ? 92.816  117.431 102.617 1.00 106.23 ?  609  SER C CB    1 
ATOM   9273  O  OG    . SER C 1 737  ? 92.477  116.582 103.704 1.00 84.14  ?  609  SER C OG    1 
ATOM   9274  N  N     . GLY C 1 738  ? 95.463  116.166 103.519 1.00 94.42  ?  610  GLY C N     1 
ATOM   9275  C  CA    . GLY C 1 738  ? 96.000  115.233 104.493 1.00 93.46  ?  610  GLY C CA    1 
ATOM   9276  C  C     . GLY C 1 738  ? 97.482  115.311 104.804 1.00 77.78  ?  610  GLY C C     1 
ATOM   9277  O  O     . GLY C 1 738  ? 98.258  114.452 104.370 1.00 72.52  ?  610  GLY C O     1 
ATOM   9278  N  N     . PHE C 1 739  ? 97.890  116.324 105.562 1.00 54.73  ?  611  PHE C N     1 
ATOM   9279  C  CA    . PHE C 1 739  ? 99.255  116.425 106.059 1.00 39.96  ?  611  PHE C CA    1 
ATOM   9280  C  C     . PHE C 1 739  ? 99.261  116.414 107.581 1.00 38.20  ?  611  PHE C C     1 
ATOM   9281  O  O     . PHE C 1 739  ? 98.462  117.104 108.221 1.00 40.23  ?  611  PHE C O     1 
ATOM   9282  C  CB    . PHE C 1 739  ? 99.944  117.684 105.537 1.00 42.59  ?  611  PHE C CB    1 
ATOM   9283  C  CG    . PHE C 1 739  ? 100.352 117.583 104.103 1.00 48.36  ?  611  PHE C CG    1 
ATOM   9284  C  CD1   . PHE C 1 739  ? 99.400  117.475 103.106 1.00 65.64  ?  611  PHE C CD1   1 
ATOM   9285  C  CD2   . PHE C 1 739  ? 101.687 117.539 103.752 1.00 57.47  ?  611  PHE C CD2   1 
ATOM   9286  C  CE1   . PHE C 1 739  ? 99.772  117.363 101.791 1.00 95.72  ?  611  PHE C CE1   1 
ATOM   9287  C  CE2   . PHE C 1 739  ? 102.062 117.424 102.432 1.00 93.43  ?  611  PHE C CE2   1 
ATOM   9288  C  CZ    . PHE C 1 739  ? 101.102 117.338 101.453 1.00 109.21 ?  611  PHE C CZ    1 
ATOM   9289  N  N     . THR C 1 740  ? 100.170 115.631 108.155 1.00 43.58  ?  612  THR C N     1 
ATOM   9290  C  CA    . THR C 1 740  ? 100.237 115.439 109.600 1.00 55.82  ?  612  THR C CA    1 
ATOM   9291  C  C     . THR C 1 740  ? 101.701 115.482 110.015 1.00 43.68  ?  612  THR C C     1 
ATOM   9292  O  O     . THR C 1 740  ? 102.459 114.555 109.718 1.00 43.97  ?  612  THR C O     1 
ATOM   9293  C  CB    . THR C 1 740  ? 99.593  114.113 110.003 1.00 69.51  ?  612  THR C CB    1 
ATOM   9294  O  OG1   . THR C 1 740  ? 98.307  113.995 109.381 1.00 72.89  ?  612  THR C OG1   1 
ATOM   9295  C  CG2   . THR C 1 740  ? 99.418  114.033 111.506 1.00 70.06  ?  612  THR C CG2   1 
ATOM   9296  N  N     . VAL C 1 741  ? 102.097 116.562 110.683 1.00 43.00  ?  613  VAL C N     1 
ATOM   9297  C  CA    . VAL C 1 741  ? 103.453 116.739 111.188 1.00 36.25  ?  613  VAL C CA    1 
ATOM   9298  C  C     . VAL C 1 741  ? 103.470 116.364 112.666 1.00 35.55  ?  613  VAL C C     1 
ATOM   9299  O  O     . VAL C 1 741  ? 102.643 116.852 113.445 1.00 38.78  ?  613  VAL C O     1 
ATOM   9300  C  CB    . VAL C 1 741  ? 103.932 118.186 110.976 1.00 41.26  ?  613  VAL C CB    1 
ATOM   9301  C  CG1   . VAL C 1 741  ? 105.007 118.561 111.984 1.00 44.17  ?  613  VAL C CG1   1 
ATOM   9302  C  CG2   . VAL C 1 741  ? 104.445 118.382 109.555 1.00 37.00  ?  613  VAL C CG2   1 
ATOM   9303  N  N     . VAL C 1 742  ? 104.399 115.477 113.052 1.00 32.87  ?  614  VAL C N     1 
ATOM   9304  C  CA    . VAL C 1 742  ? 104.624 115.119 114.450 1.00 20.16  ?  614  VAL C CA    1 
ATOM   9305  C  C     . VAL C 1 742  ? 105.750 115.997 114.985 1.00 29.61  ?  614  VAL C C     1 
ATOM   9306  O  O     . VAL C 1 742  ? 106.747 116.246 114.291 1.00 33.36  ?  614  VAL C O     1 
ATOM   9307  C  CB    . VAL C 1 742  ? 104.952 113.619 114.597 1.00 12.61  ?  614  VAL C CB    1 
ATOM   9308  C  CG1   . VAL C 1 742  ? 104.998 113.216 116.057 1.00 13.47  ?  614  VAL C CG1   1 
ATOM   9309  C  CG2   . VAL C 1 742  ? 103.927 112.776 113.857 1.00 13.96  ?  614  VAL C CG2   1 
ATOM   9310  N  N     . VAL C 1 743  ? 105.604 116.463 116.226 1.00 24.69  ?  615  VAL C N     1 
ATOM   9311  C  CA    . VAL C 1 743  ? 106.503 117.455 116.808 1.00 17.01  ?  615  VAL C CA    1 
ATOM   9312  C  C     . VAL C 1 743  ? 107.006 116.944 118.155 1.00 20.09  ?  615  VAL C C     1 
ATOM   9313  O  O     . VAL C 1 743  ? 106.216 116.449 118.967 1.00 20.38  ?  615  VAL C O     1 
ATOM   9314  C  CB    . VAL C 1 743  ? 105.802 118.816 116.962 1.00 13.10  ?  615  VAL C CB    1 
ATOM   9315  C  CG1   . VAL C 1 743  ? 106.429 119.626 118.076 1.00 29.10  ?  615  VAL C CG1   1 
ATOM   9316  C  CG2   . VAL C 1 743  ? 105.830 119.572 115.644 1.00 20.66  ?  615  VAL C CG2   1 
ATOM   9317  N  N     . LYS C 1 744  ? 108.318 117.070 118.393 1.00 20.37  ?  616  LYS C N     1 
ATOM   9318  C  CA    . LYS C 1 744  ? 108.958 116.662 119.640 1.00 18.39  ?  616  LYS C CA    1 
ATOM   9319  C  C     . LYS C 1 744  ? 109.336 117.887 120.461 1.00 18.64  ?  616  LYS C C     1 
ATOM   9320  O  O     . LYS C 1 744  ? 109.847 118.871 119.918 1.00 19.08  ?  616  LYS C O     1 
ATOM   9321  C  CB    . LYS C 1 744  ? 110.220 115.825 119.369 1.00 22.91  ?  616  LYS C CB    1 
ATOM   9322  C  CG    . LYS C 1 744  ? 111.035 115.469 120.612 1.00 26.47  ?  616  LYS C CG    1 
ATOM   9323  C  CD    . LYS C 1 744  ? 112.516 115.201 120.298 1.00 34.58  ?  616  LYS C CD    1 
ATOM   9324  C  CE    . LYS C 1 744  ? 113.231 116.450 119.813 1.00 33.08  ?  616  LYS C CE    1 
ATOM   9325  N  NZ    . LYS C 1 744  ? 114.713 116.288 119.727 1.00 28.13  ?  616  LYS C NZ    1 
ATOM   9326  N  N     . GLU C 1 745  ? 109.107 117.809 121.769 1.00 19.80  ?  617  GLU C N     1 
ATOM   9327  C  CA    . GLU C 1 745  ? 109.379 118.879 122.717 1.00 16.38  ?  617  GLU C CA    1 
ATOM   9328  C  C     . GLU C 1 745  ? 110.692 118.630 123.446 1.00 17.23  ?  617  GLU C C     1 
ATOM   9329  O  O     . GLU C 1 745  ? 111.212 117.513 123.473 1.00 24.27  ?  617  GLU C O     1 
ATOM   9330  C  CB    . GLU C 1 745  ? 108.250 118.978 123.745 1.00 18.91  ?  617  GLU C CB    1 
ATOM   9331  C  CG    . GLU C 1 745  ? 106.871 118.911 123.139 1.00 36.17  ?  617  GLU C CG    1 
ATOM   9332  C  CD    . GLU C 1 745  ? 106.387 120.245 122.627 1.00 107.69 ?  617  GLU C CD    1 
ATOM   9333  O  OE1   . GLU C 1 745  ? 107.222 121.136 122.358 1.00 79.30  ?  617  GLU C OE1   1 
ATOM   9334  O  OE2   . GLU C 1 745  ? 105.159 120.396 122.465 1.00 296.17 -1 617  GLU C OE2   1 
ATOM   9335  N  N     . SER C 1 746  ? 111.213 119.689 124.061 1.00 14.40  ?  618  SER C N     1 
ATOM   9336  C  CA    . SER C 1 746  ? 112.312 119.562 125.005 1.00 9.79   ?  618  SER C CA    1 
ATOM   9337  C  C     . SER C 1 746  ? 112.436 120.825 125.832 1.00 10.70  ?  618  SER C C     1 
ATOM   9338  O  O     . SER C 1 746  ? 112.627 121.918 125.289 1.00 14.09  ?  618  SER C O     1 
ATOM   9339  C  CB    . SER C 1 746  ? 113.643 119.311 124.300 1.00 13.36  ?  618  SER C CB    1 
ATOM   9340  O  OG    . SER C 1 746  ? 114.714 119.718 125.138 1.00 14.01  ?  618  SER C OG    1 
ATOM   9341  N  N     . CYS C 1 747  ? 112.354 120.700 127.143 1.00 11.21  ?  619  CYS C N     1 
ATOM   9342  C  CA    . CYS C 1 747  ? 112.599 121.829 128.016 1.00 13.13  ?  619  CYS C CA    1 
ATOM   9343  C  C     . CYS C 1 747  ? 113.629 121.396 129.045 1.00 17.05  ?  619  CYS C C     1 
ATOM   9344  O  O     . CYS C 1 747  ? 113.429 120.395 129.738 1.00 41.85  ?  619  CYS C O     1 
ATOM   9345  C  CB    . CYS C 1 747  ? 111.296 122.284 128.663 1.00 17.30  ?  619  CYS C CB    1 
ATOM   9346  S  SG    . CYS C 1 747  ? 111.524 123.116 130.206 1.00 24.36  ?  619  CYS C SG    1 
ATOM   9347  N  N     . ASP C 1 748  ? 114.734 122.131 129.132 1.00 20.80  ?  620  ASP C N     1 
ATOM   9348  C  CA    . ASP C 1 748  ? 115.833 121.753 130.007 1.00 41.03  ?  620  ASP C CA    1 
ATOM   9349  C  C     . ASP C 1 748  ? 116.406 122.985 130.690 1.00 60.55  ?  620  ASP C C     1 
ATOM   9350  O  O     . ASP C 1 748  ? 116.401 124.091 130.130 1.00 66.75  ?  620  ASP C O     1 
ATOM   9351  C  CB    . ASP C 1 748  ? 116.961 121.030 129.246 1.00 70.54  ?  620  ASP C CB    1 
ATOM   9352  C  CG    . ASP C 1 748  ? 118.189 120.768 130.123 1.00 140.87 ?  620  ASP C CG    1 
ATOM   9353  O  OD1   . ASP C 1 748  ? 118.050 120.667 131.364 1.00 129.06 ?  620  ASP C OD1   1 
ATOM   9354  O  OD2   . ASP C 1 748  ? 119.306 120.687 129.571 1.00 329.64 -1 620  ASP C OD2   1 
ATOM   9355  N  N     . GLY C 1 749  ? 116.926 122.770 131.898 1.00 69.95  ?  621  GLY C N     1 
ATOM   9356  C  CA    . GLY C 1 749  ? 117.634 123.809 132.625 1.00 63.51  ?  621  GLY C CA    1 
ATOM   9357  C  C     . GLY C 1 749  ? 119.127 123.766 132.366 1.00 45.00  ?  621  GLY C C     1 
ATOM   9358  O  O     . GLY C 1 749  ? 119.767 122.721 132.520 1.00 46.82  ?  621  GLY C O     1 
ATOM   9359  N  N     . MET C 1 750  ? 119.675 124.913 131.975 1.00 23.88  ?  622  MET C N     1 
ATOM   9360  C  CA    . MET C 1 750  ? 121.101 125.109 131.769 1.00 20.14  ?  622  MET C CA    1 
ATOM   9361  C  C     . MET C 1 750  ? 121.520 126.244 132.685 1.00 29.76  ?  622  MET C C     1 
ATOM   9362  O  O     . MET C 1 750  ? 120.994 127.358 132.578 1.00 32.77  ?  622  MET C O     1 
ATOM   9363  C  CB    . MET C 1 750  ? 121.399 125.445 130.307 1.00 28.75  ?  622  MET C CB    1 
ATOM   9364  C  CG    . MET C 1 750  ? 122.639 126.313 130.086 1.00 31.98  ?  622  MET C CG    1 
ATOM   9365  S  SD    . MET C 1 750  ? 123.128 126.338 128.347 1.00 81.15  ?  622  MET C SD    1 
ATOM   9366  C  CE    . MET C 1 750  ? 121.536 126.163 127.530 1.00 41.46  ?  622  MET C CE    1 
ATOM   9367  N  N     . GLY C 1 751  ? 122.434 125.963 133.593 1.00 33.62  ?  623  GLY C N     1 
ATOM   9368  C  CA    . GLY C 1 751  ? 122.743 126.880 134.661 1.00 56.58  ?  623  GLY C CA    1 
ATOM   9369  C  C     . GLY C 1 751  ? 124.068 127.595 134.508 1.00 65.37  ?  623  GLY C C     1 
ATOM   9370  O  O     . GLY C 1 751  ? 124.958 127.163 133.780 1.00 57.53  ?  623  GLY C O     1 
ATOM   9371  N  N     . ASP C 1 752  ? 124.159 128.721 135.212 1.00 101.85 ?  624  ASP C N     1 
ATOM   9372  C  CA    . ASP C 1 752  ? 125.415 129.373 135.568 1.00 131.52 ?  624  ASP C CA    1 
ATOM   9373  C  C     . ASP C 1 752  ? 126.261 129.695 134.332 1.00 128.88 ?  624  ASP C C     1 
ATOM   9374  O  O     . ASP C 1 752  ? 127.332 129.134 134.108 1.00 152.28 ?  624  ASP C O     1 
ATOM   9375  C  CB    . ASP C 1 752  ? 126.188 128.512 136.574 1.00 192.74 ?  624  ASP C CB    1 
ATOM   9376  C  CG    . ASP C 1 752  ? 125.752 128.760 138.016 1.00 240.37 ?  624  ASP C CG    1 
ATOM   9377  O  OD1   . ASP C 1 752  ? 124.717 128.201 138.436 1.00 208.63 ?  624  ASP C OD1   1 
ATOM   9378  O  OD2   . ASP C 1 752  ? 126.433 129.531 138.728 1.00 436.02 -1 624  ASP C OD2   1 
ATOM   9379  N  N     . VAL C 1 753  ? 125.723 130.593 133.508 1.00 87.14  ?  625  VAL C N     1 
ATOM   9380  C  CA    . VAL C 1 753  ? 126.532 131.220 132.469 1.00 81.98  ?  625  VAL C CA    1 
ATOM   9381  C  C     . VAL C 1 753  ? 127.726 131.894 133.137 1.00 87.92  ?  625  VAL C C     1 
ATOM   9382  O  O     . VAL C 1 753  ? 127.567 132.817 133.940 1.00 85.41  ?  625  VAL C O     1 
ATOM   9383  C  CB    . VAL C 1 753  ? 125.715 132.218 131.629 1.00 69.11  ?  625  VAL C CB    1 
ATOM   9384  C  CG1   . VAL C 1 753  ? 124.935 131.486 130.557 1.00 64.91  ?  625  VAL C CG1   1 
ATOM   9385  C  CG2   . VAL C 1 753  ? 124.775 133.025 132.508 1.00 63.09  ?  625  VAL C CG2   1 
ATOM   9386  N  N     . SER C 1 754  ? 128.931 131.432 132.806 1.00 94.80  ?  626  SER C N     1 
ATOM   9387  C  CA    . SER C 1 754  ? 130.149 131.880 133.468 1.00 96.71  ?  626  SER C CA    1 
ATOM   9388  C  C     . SER C 1 754  ? 130.612 133.190 132.849 1.00 124.92 ?  626  SER C C     1 
ATOM   9389  O  O     . SER C 1 754  ? 130.793 133.276 131.630 1.00 133.91 ?  626  SER C O     1 
ATOM   9390  C  CB    . SER C 1 754  ? 131.252 130.826 133.367 1.00 113.41 ?  626  SER C CB    1 
ATOM   9391  O  OG    . SER C 1 754  ? 131.215 130.147 132.124 1.00 99.13  ?  626  SER C OG    1 
ATOM   9392  N  N     . GLU C 1 755  ? 130.815 134.196 133.689 1.00 156.28 ?  627  GLU C N     1 
ATOM   9393  C  CA    . GLU C 1 755  ? 131.219 135.511 133.211 1.00 196.76 ?  627  GLU C CA    1 
ATOM   9394  C  C     . GLU C 1 755  ? 132.086 136.138 134.300 1.00 220.01 ?  627  GLU C C     1 
ATOM   9395  O  O     . GLU C 1 755  ? 132.549 135.448 135.215 1.00 206.71 ?  627  GLU C O     1 
ATOM   9396  C  CB    . GLU C 1 755  ? 129.971 136.335 132.848 1.00 200.40 ?  627  GLU C CB    1 
ATOM   9397  C  CG    . GLU C 1 755  ? 130.198 137.490 131.876 1.00 203.03 ?  627  GLU C CG    1 
ATOM   9398  C  CD    . GLU C 1 755  ? 131.396 137.287 130.965 1.00 201.98 ?  627  GLU C CD    1 
ATOM   9399  O  OE1   . GLU C 1 755  ? 131.419 136.299 130.202 1.00 180.47 ?  627  GLU C OE1   1 
ATOM   9400  O  OE2   . GLU C 1 755  ? 132.318 138.125 131.011 1.00 259.30 -1 627  GLU C OE2   1 
ATOM   9401  N  N     . LYS C 1 756  ? 132.311 137.444 134.205 1.00 222.24 ?  628  LYS C N     1 
ATOM   9402  C  CA    . LYS C 1 756  ? 133.171 138.149 135.147 1.00 199.97 ?  628  LYS C CA    1 
ATOM   9403  C  C     . LYS C 1 756  ? 132.493 138.315 136.505 1.00 142.52 ?  628  LYS C C     1 
ATOM   9404  O  O     . LYS C 1 756  ? 133.127 138.722 137.482 1.00 129.40 ?  628  LYS C O     1 
ATOM   9405  C  CB    . LYS C 1 756  ? 133.561 139.515 134.581 1.00 188.46 ?  628  LYS C CB    1 
ATOM   9406  C  CG    . LYS C 1 756  ? 135.018 139.624 134.139 1.00 222.16 ?  628  LYS C CG    1 
ATOM   9407  C  CD    . LYS C 1 756  ? 135.278 138.849 132.855 1.00 252.87 ?  628  LYS C CD    1 
ATOM   9408  C  CE    . LYS C 1 756  ? 136.774 138.679 132.604 1.00 234.03 ?  628  LYS C CE    1 
ATOM   9409  N  NZ    . LYS C 1 756  ? 137.441 137.902 133.686 1.00 230.15 ?  628  LYS C NZ    1 
ATOM   9410  N  N     . PRO C 1 764  ? 122.805 136.863 137.011 1.00 129.72 ?  636  PRO C N     1 
ATOM   9411  C  CA    . PRO C 1 764  ? 122.610 136.122 135.761 1.00 92.28  ?  636  PRO C CA    1 
ATOM   9412  C  C     . PRO C 1 764  ? 123.343 134.787 135.745 1.00 65.13  ?  636  PRO C C     1 
ATOM   9413  O  O     . PRO C 1 764  ? 124.414 134.695 135.147 1.00 58.64  ?  636  PRO C O     1 
ATOM   9414  C  CB    . PRO C 1 764  ? 123.180 137.073 134.698 1.00 74.93  ?  636  PRO C CB    1 
ATOM   9415  C  CG    . PRO C 1 764  ? 124.078 137.997 135.454 1.00 74.56  ?  636  PRO C CG    1 
ATOM   9416  C  CD    . PRO C 1 764  ? 123.396 138.187 136.767 1.00 122.04 ?  636  PRO C CD    1 
ATOM   9417  N  N     . GLU C 1 765  ? 122.787 133.773 136.406 1.00 63.01  ?  637  GLU C N     1 
ATOM   9418  C  CA    . GLU C 1 765  ? 123.385 132.443 136.392 1.00 71.32  ?  637  GLU C CA    1 
ATOM   9419  C  C     . GLU C 1 765  ? 122.495 131.423 135.694 1.00 60.53  ?  637  GLU C C     1 
ATOM   9420  O  O     . GLU C 1 765  ? 122.912 130.833 134.692 1.00 68.13  ?  637  GLU C O     1 
ATOM   9421  C  CB    . GLU C 1 765  ? 123.701 132.002 137.830 1.00 114.47 ?  637  GLU C CB    1 
ATOM   9422  C  CG    . GLU C 1 765  ? 125.012 132.570 138.389 1.00 153.88 ?  637  GLU C CG    1 
ATOM   9423  C  CD    . GLU C 1 765  ? 125.201 132.310 139.879 1.00 197.66 ?  637  GLU C CD    1 
ATOM   9424  O  OE1   . GLU C 1 765  ? 125.237 133.285 140.659 1.00 159.82 ?  637  GLU C OE1   1 
ATOM   9425  O  OE2   . GLU C 1 765  ? 125.316 131.130 140.273 1.00 314.14 -1 637  GLU C OE2   1 
ATOM   9426  N  N     . LYS C 1 766  ? 121.262 131.236 136.151 1.00 40.97  ?  638  LYS C N     1 
ATOM   9427  C  CA    . LYS C 1 766  ? 120.463 130.131 135.650 1.00 29.54  ?  638  LYS C CA    1 
ATOM   9428  C  C     . LYS C 1 766  ? 119.735 130.517 134.363 1.00 35.73  ?  638  LYS C C     1 
ATOM   9429  O  O     . LYS C 1 766  ? 119.586 131.692 134.025 1.00 36.53  ?  638  LYS C O     1 
ATOM   9430  C  CB    . LYS C 1 766  ? 119.462 129.664 136.708 1.00 48.31  ?  638  LYS C CB    1 
ATOM   9431  C  CG    . LYS C 1 766  ? 120.032 129.609 138.109 1.00 57.71  ?  638  LYS C CG    1 
ATOM   9432  C  CD    . LYS C 1 766  ? 121.226 128.659 138.186 1.00 76.34  ?  638  LYS C CD    1 
ATOM   9433  C  CE    . LYS C 1 766  ? 120.860 127.212 137.857 1.00 71.66  ?  638  LYS C CE    1 
ATOM   9434  N  NZ    . LYS C 1 766  ? 119.935 126.612 138.857 1.00 115.71 ?  638  LYS C NZ    1 
ATOM   9435  N  N     . ALA C 1 767  ? 119.289 129.495 133.638 1.00 27.81  ?  639  ALA C N     1 
ATOM   9436  C  CA    . ALA C 1 767  ? 118.498 129.700 132.434 1.00 20.66  ?  639  ALA C CA    1 
ATOM   9437  C  C     . ALA C 1 767  ? 117.742 128.420 132.121 1.00 16.10  ?  639  ALA C C     1 
ATOM   9438  O  O     . ALA C 1 767  ? 118.146 127.325 132.516 1.00 22.97  ?  639  ALA C O     1 
ATOM   9439  C  CB    . ALA C 1 767  ? 119.375 130.103 131.243 1.00 19.76  ?  639  ALA C CB    1 
ATOM   9440  N  N     . VAL C 1 768  ? 116.640 128.569 131.401 1.00 8.55   ?  640  VAL C N     1 
ATOM   9441  C  CA    . VAL C 1 768  ? 115.908 127.423 130.892 1.00 9.63   ?  640  VAL C CA    1 
ATOM   9442  C  C     . VAL C 1 768  ? 115.704 127.647 129.402 1.00 9.88   ?  640  VAL C C     1 
ATOM   9443  O  O     . VAL C 1 768  ? 115.602 128.787 128.939 1.00 15.24  ?  640  VAL C O     1 
ATOM   9444  C  CB    . VAL C 1 768  ? 114.570 127.226 131.633 1.00 15.10  ?  640  VAL C CB    1 
ATOM   9445  C  CG1   . VAL C 1 768  ? 113.891 125.949 131.177 1.00 20.34  ?  640  VAL C CG1   1 
ATOM   9446  C  CG2   . VAL C 1 768  ? 114.795 127.212 133.136 1.00 14.48  ?  640  VAL C CG2   1 
ATOM   9447  N  N     . ARG C 1 769  ? 115.683 126.558 128.641 1.00 8.51   ?  641  ARG C N     1 
ATOM   9448  C  CA    . ARG C 1 769  ? 115.550 126.638 127.190 1.00 15.14  ?  641  ARG C CA    1 
ATOM   9449  C  C     . ARG C 1 769  ? 114.473 125.666 126.740 1.00 18.15  ?  641  ARG C C     1 
ATOM   9450  O  O     . ARG C 1 769  ? 114.590 124.459 126.968 1.00 20.12  ?  641  ARG C O     1 
ATOM   9451  C  CB    . ARG C 1 769  ? 116.873 126.346 126.491 1.00 16.98  ?  641  ARG C CB    1 
ATOM   9452  C  CG    . ARG C 1 769  ? 116.712 126.095 125.012 1.00 18.29  ?  641  ARG C CG    1 
ATOM   9453  C  CD    . ARG C 1 769  ? 117.890 126.646 124.256 1.00 20.21  ?  641  ARG C CD    1 
ATOM   9454  N  NE    . ARG C 1 769  ? 119.133 126.156 124.823 1.00 21.36  ?  641  ARG C NE    1 
ATOM   9455  C  CZ    . ARG C 1 769  ? 119.583 124.926 124.640 1.00 17.76  ?  641  ARG C CZ    1 
ATOM   9456  N  NH1   . ARG C 1 769  ? 120.722 124.539 125.194 1.00 36.36  ?  641  ARG C NH1   1 
ATOM   9457  N  NH2   . ARG C 1 769  ? 118.885 124.081 123.899 1.00 14.44  ?  641  ARG C NH2   1 
ATOM   9458  N  N     . PHE C 1 770  ? 113.419 126.199 126.129 1.00 25.24  ?  642  PHE C N     1 
ATOM   9459  C  CA    . PHE C 1 770  ? 112.326 125.406 125.586 1.00 12.71  ?  642  PHE C CA    1 
ATOM   9460  C  C     . PHE C 1 770  ? 112.466 125.378 124.067 1.00 16.51  ?  642  PHE C C     1 
ATOM   9461  O  O     . PHE C 1 770  ? 112.469 126.434 123.427 1.00 20.50  ?  642  PHE C O     1 
ATOM   9462  C  CB    . PHE C 1 770  ? 110.981 126.002 125.998 1.00 12.60  ?  642  PHE C CB    1 
ATOM   9463  C  CG    . PHE C 1 770  ? 109.817 125.141 125.654 1.00 12.61  ?  642  PHE C CG    1 
ATOM   9464  C  CD1   . PHE C 1 770  ? 109.267 125.158 124.392 1.00 15.47  ?  642  PHE C CD1   1 
ATOM   9465  C  CD2   . PHE C 1 770  ? 109.283 124.288 126.595 1.00 12.53  ?  642  PHE C CD2   1 
ATOM   9466  C  CE1   . PHE C 1 770  ? 108.205 124.352 124.084 1.00 26.97  ?  642  PHE C CE1   1 
ATOM   9467  C  CE2   . PHE C 1 770  ? 108.225 123.482 126.281 1.00 15.53  ?  642  PHE C CE2   1 
ATOM   9468  C  CZ    . PHE C 1 770  ? 107.690 123.518 125.028 1.00 36.61  ?  642  PHE C CZ    1 
ATOM   9469  N  N     . SER C 1 771  ? 112.571 124.178 123.494 1.00 10.77  ?  643  SER C N     1 
ATOM   9470  C  CA    . SER C 1 771  ? 112.844 124.020 122.070 1.00 13.40  ?  643  SER C CA    1 
ATOM   9471  C  C     . SER C 1 771  ? 112.131 122.789 121.529 1.00 12.33  ?  643  SER C C     1 
ATOM   9472  O  O     . SER C 1 771  ? 111.995 121.781 122.226 1.00 18.65  ?  643  SER C O     1 
ATOM   9473  C  CB    . SER C 1 771  ? 114.351 123.891 121.793 1.00 32.19  ?  643  SER C CB    1 
ATOM   9474  O  OG    . SER C 1 771  ? 114.595 123.292 120.527 1.00 30.50  ?  643  SER C OG    1 
ATOM   9475  N  N     . PHE C 1 772  ? 111.722 122.861 120.263 1.00 11.43  ?  644  PHE C N     1 
ATOM   9476  C  CA    . PHE C 1 772  ? 111.030 121.751 119.619 1.00 10.67  ?  644  PHE C CA    1 
ATOM   9477  C  C     . PHE C 1 772  ? 111.763 121.352 118.345 1.00 10.75  ?  644  PHE C C     1 
ATOM   9478  O  O     . PHE C 1 772  ? 112.690 122.027 117.892 1.00 13.38  ?  644  PHE C O     1 
ATOM   9479  C  CB    . PHE C 1 772  ? 109.562 122.099 119.304 1.00 12.24  ?  644  PHE C CB    1 
ATOM   9480  C  CG    . PHE C 1 772  ? 109.380 123.179 118.263 1.00 11.13  ?  644  PHE C CG    1 
ATOM   9481  C  CD1   . PHE C 1 772  ? 109.352 124.509 118.619 1.00 17.59  ?  644  PHE C CD1   1 
ATOM   9482  C  CD2   . PHE C 1 772  ? 109.180 122.854 116.931 1.00 15.57  ?  644  PHE C CD2   1 
ATOM   9483  C  CE1   . PHE C 1 772  ? 109.156 125.495 117.663 1.00 16.01  ?  644  PHE C CE1   1 
ATOM   9484  C  CE2   . PHE C 1 772  ? 108.985 123.843 115.981 1.00 9.33   ?  644  PHE C CE2   1 
ATOM   9485  C  CZ    . PHE C 1 772  ? 108.974 125.155 116.352 1.00 10.17  ?  644  PHE C CZ    1 
ATOM   9486  N  N     . THR C 1 773  ? 111.343 120.228 117.777 1.00 11.52  ?  645  THR C N     1 
ATOM   9487  C  CA    . THR C 1 773  ? 111.915 119.751 116.527 1.00 11.90  ?  645  THR C CA    1 
ATOM   9488  C  C     . THR C 1 773  ? 110.862 118.975 115.750 1.00 11.80  ?  645  THR C C     1 
ATOM   9489  O  O     . THR C 1 773  ? 110.081 118.212 116.328 1.00 12.55  ?  645  THR C O     1 
ATOM   9490  C  CB    . THR C 1 773  ? 113.154 118.886 116.774 1.00 14.58  ?  645  THR C CB    1 
ATOM   9491  O  OG1   . THR C 1 773  ? 114.094 119.615 117.574 1.00 12.11  ?  645  THR C OG1   1 
ATOM   9492  C  CG2   . THR C 1 773  ? 113.810 118.510 115.461 1.00 22.49  ?  645  THR C CG2   1 
ATOM   9493  N  N     . ILE C 1 774  ? 110.849 119.188 114.438 1.00 9.51   ?  646  ILE C N     1 
ATOM   9494  C  CA    . ILE C 1 774  ? 109.890 118.544 113.552 1.00 12.53  ?  646  ILE C CA    1 
ATOM   9495  C  C     . ILE C 1 774  ? 110.382 117.120 113.325 1.00 13.22  ?  646  ILE C C     1 
ATOM   9496  O  O     . ILE C 1 774  ? 111.406 116.905 112.673 1.00 15.03  ?  646  ILE C O     1 
ATOM   9497  C  CB    . ILE C 1 774  ? 109.758 119.299 112.226 1.00 27.07  ?  646  ILE C CB    1 
ATOM   9498  C  CG1   . ILE C 1 774  ? 109.440 120.779 112.462 1.00 30.48  ?  646  ILE C CG1   1 
ATOM   9499  C  CG2   . ILE C 1 774  ? 108.723 118.642 111.333 1.00 58.17  ?  646  ILE C CG2   1 
ATOM   9500  C  CD1   . ILE C 1 774  ? 108.137 121.048 113.174 1.00 25.08  ?  646  ILE C CD1   1 
ATOM   9501  N  N     . MET C 1 775  ? 109.668 116.138 113.871 1.00 11.93  ?  647  MET C N     1 
ATOM   9502  C  CA    . MET C 1 775  ? 110.159 114.772 113.785 1.00 12.49  ?  647  MET C CA    1 
ATOM   9503  C  C     . MET C 1 775  ? 109.875 114.167 112.421 1.00 17.78  ?  647  MET C C     1 
ATOM   9504  O  O     . MET C 1 775  ? 110.795 113.702 111.739 1.00 31.79  ?  647  MET C O     1 
ATOM   9505  C  CB    . MET C 1 775  ? 109.541 113.934 114.900 1.00 20.25  ?  647  MET C CB    1 
ATOM   9506  C  CG    . MET C 1 775  ? 110.336 113.988 116.183 1.00 38.07  ?  647  MET C CG    1 
ATOM   9507  S  SD    . MET C 1 775  ? 112.067 113.593 115.910 1.00 73.17  ?  647  MET C SD    1 
ATOM   9508  C  CE    . MET C 1 775  ? 111.897 111.923 115.258 1.00 83.85  ?  647  MET C CE    1 
ATOM   9509  N  N     . SER C 1 776  ? 108.615 114.178 111.997 1.00 18.50  ?  648  SER C N     1 
ATOM   9510  C  CA    . SER C 1 776  ? 108.244 113.512 110.755 1.00 27.82  ?  648  SER C CA    1 
ATOM   9511  C  C     . SER C 1 776  ? 106.967 114.134 110.192 1.00 30.78  ?  648  SER C C     1 
ATOM   9512  O  O     . SER C 1 776  ? 106.107 114.603 110.943 1.00 35.4