data_6DBU
# 
_entry.id   6DBU 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.320 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   6DBU         
WWPDB D_1000234340 
EMDB  EMD-7850     
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.details 
_pdbx_database_related.db_id 
_pdbx_database_related.content_type 
EMDB . EMD-7843 'other EM volume'      
EMDB . EMD-7844 'other EM volume'      
EMDB . EMD-7845 'other EM volume'      
EMDB . EMD-7846 'other EM volume'      
EMDB . EMD-7847 'other EM volume'      
EMDB . EMD-7848 'other EM volume'      
EMDB . EMD-7849 'other EM volume'      
EMDB . EMD-7850 'associated EM volume' 
EMDB . EMD-7851 'other EM volume'      
EMDB . EMD-7852 'other EM volume'      
EMDB . EMD-7853 'other EM volume'      
PDB  . 6DBI     unspecified            
PDB  . 6DBJ     unspecified            
PDB  . 6DBL     unspecified            
PDB  . 6DBO     unspecified            
PDB  . 6DBQ     unspecified            
PDB  . 6DBR     unspecified            
PDB  . 6DBU     unspecified            
PDB  . 6DBV     unspecified            
PDB  . 6DBW     unspecified            
PDB  . 6DBX     unspecified            
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.entry_id                        6DBU 
_pdbx_database_status.recvd_initial_deposition_date   2018-05-03 
_pdbx_database_status.SG_entry                        N 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
_audit_author.identifier_ORCID 
'Wu, H.'   1 ? 
'Liao, M.' 2 ? 
'Ru, H.'   3 ? 
'Mi, W.'   4 ? 
# 
_citation.abstract                  ? 
_citation.abstract_id_CAS           ? 
_citation.book_id_ISBN              ? 
_citation.book_publisher            ? 
_citation.book_publisher_city       ? 
_citation.book_title                ? 
_citation.coordinate_linkage        ? 
_citation.country                   US 
_citation.database_id_Medline       ? 
_citation.details                   ? 
_citation.id                        primary 
_citation.journal_abbrev            'Nat. Struct. Mol. Biol.' 
_citation.journal_id_ASTM           ? 
_citation.journal_id_CSD            ? 
_citation.journal_id_ISSN           1545-9985 
_citation.journal_full              ? 
_citation.journal_issue             ? 
_citation.journal_volume            25 
_citation.language                  ? 
_citation.page_first                732 
_citation.page_last                 742 
_citation.title                     'DNA melting initiates the RAG catalytic pathway.' 
_citation.year                      2018 
_citation.database_id_CSD           ? 
_citation.pdbx_database_id_DOI      10.1038/s41594-018-0098-5 
_citation.pdbx_database_id_PubMed   30061602 
_citation.unpublished_flag          ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Ru, H.'       1 ?                   
primary 'Mi, W.'       2 ?                   
primary 'Zhang, P.'    3 ?                   
primary 'Alt, F.W.'    4 ?                   
primary 'Schatz, D.G.' 5 0000-0002-5669-1176 
primary 'Liao, M.'     6 ?                   
primary 'Wu, H.'       7 0000-0002-7281-8579 
# 
_cell.angle_alpha                  90.00 
_cell.angle_alpha_esd              ? 
_cell.angle_beta                   90.00 
_cell.angle_beta_esd               ? 
_cell.angle_gamma                  90.00 
_cell.angle_gamma_esd              ? 
_cell.entry_id                     6DBU 
_cell.details                      ? 
_cell.formula_units_Z              ? 
_cell.length_a                     1 
_cell.length_a_esd                 ? 
_cell.length_b                     1 
_cell.length_b_esd                 ? 
_cell.length_c                     1 
_cell.length_c_esd                 ? 
_cell.volume                       ? 
_cell.volume_esd                   ? 
_cell.Z_PDB                        1 
_cell.reciprocal_angle_alpha       ? 
_cell.reciprocal_angle_beta        ? 
_cell.reciprocal_angle_gamma       ? 
_cell.reciprocal_angle_alpha_esd   ? 
_cell.reciprocal_angle_beta_esd    ? 
_cell.reciprocal_angle_gamma_esd   ? 
_cell.reciprocal_length_a          ? 
_cell.reciprocal_length_b          ? 
_cell.reciprocal_length_c          ? 
_cell.reciprocal_length_a_esd      ? 
_cell.reciprocal_length_b_esd      ? 
_cell.reciprocal_length_c_esd      ? 
_cell.pdbx_unique_axis             ? 
# 
_symmetry.entry_id                         6DBU 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                1 
_symmetry.space_group_name_Hall            ? 
_symmetry.space_group_name_H-M             'P 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'Recombination activating gene 1 - MBP chimera' 131160.047 2 2.3.2.27 ? ? ? 
2 polymer     man 'Recombination activating gene 2'               59435.930  2 ?        ? ? ? 
3 polymer     syn 'Forward strand RSS substrate DNA'              10450.713  2 ?        ? ? ? 
4 polymer     syn 'Reverse strand RSS substrate DNA'              10468.741  2 ?        ? ? ? 
5 non-polymer syn 'ZINC ION'                                      65.409     2 ?        ? ? ? 
6 non-polymer syn 'CALCIUM ION'                                   40.078     4 ?        ? ? ? 
# 
loop_
_entity_name_com.entity_id 
_entity_name_com.name 
1 'MBP,MMBP,Maltodextrin-binding protein,RAG-1' 
2 'V(D)J recombination-activating protein 2'    
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)'        no no 
;MGSSHHHHHHGTKTEEGKLVIWINGDKGYNGLAEVGKKFEKDTGIKVTVEHPDKLEEKFPQVAATGDGPDIIFWAHDRFG
GYAQSGLLAEITPDKAFQDKLYPFTWDAVRYNGKLIAYPIAVEALSLIYNKDLLPNPPKTWEEIPALDKELKAKGKSALM
FNLQEPYFTWPLIAADGGYAFKYENGKYDIKDVGVDNAGAKAGLTFLVDLIKNKHMNADTDYSIAEAAFNKGETAMTING
PWAWSNIDTSKVNYGVTVLPTFKGQPSKPFVGVLSAGINAASPNKELAKEFLENYLLTDEGLEAVNKDKPLGAVALKSYE
EELAKDPRIAATMENAQKGEIMPNIPQMSAFWYAVRTAVINAASGRQTVDEALKDAQTGTDYDIPTTLEVLFQGPLGSRC
QRDHLSTKLIPTEVPADLIRAVTCQVCDHLLSDPVQSPCRHLFCRLCIIRYTHALGPNCPTCNQHLNPSHLIKPAKFFLA
TLSSLPLLCPSEECSDWVRLDSFREHCLNHYREKESQEEQTPSEQNLDGYLPVNKGGRPRQHLLSLTRRAQKHRLRDLKN
QVKTFAEKEEGGDVKSVCLTLFLLALRAGNEHKQADELEAMMQGRGFGLHPAVCLAIRVNTFLSCSQYHKMYRTVKATSG
RQIFQPLHTLRNAEKELLPGFHQFEWQPALKNVSTSWDVGIIDGLSGWTVSVDDVPADTISRRFRYDVALVSALKDLEED
IMEGLRERALDDSMCTSGFTVVVKESCDGMGDVSEKHGSGPAVPEKAVRFSFTIMSISIRLEGEDDGITIFQEQKPNSEL
SCRPLCLMFVDESDHETLTAILGPVVAERKAMMESRLIISVGGLLRSFRFFFRGTGYDEKMVREMEGLEASGSTYICTLC
DSTRAEASQNMVLHSITRSHDENLERYEIWRKNPFSESADELRDRVKGVSAKPFMETQPTLDALHCDIGNATEFYKIFQD
EIGEVYQKPNPSREERRRWRSTLDKQLRKKMKLKPVMRMNGNYARRLMTREAVEAVCELVPSEERREALLKLMDLYLQMK
PVWRSTCPSRDCPDQLCQYSYNSQQFADLLSSMFKYRYDGKITNYLHKTLAHVPEIVERDGSIGAWASEGNESGNKLFRR
FRKMNARQSKTFELEDILKHHWLYTSKYLQKFMEAHKNS
;
;MGSSHHHHHHGTKTEEGKLVIWINGDKGYNGLAEVGKKFEKDTGIKVTVEHPDKLEEKFPQVAATGDGPDIIFWAHDRFG
GYAQSGLLAEITPDKAFQDKLYPFTWDAVRYNGKLIAYPIAVEALSLIYNKDLLPNPPKTWEEIPALDKELKAKGKSALM
FNLQEPYFTWPLIAADGGYAFKYENGKYDIKDVGVDNAGAKAGLTFLVDLIKNKHMNADTDYSIAEAAFNKGETAMTING
PWAWSNIDTSKVNYGVTVLPTFKGQPSKPFVGVLSAGINAASPNKELAKEFLENYLLTDEGLEAVNKDKPLGAVALKSYE
EELAKDPRIAATMENAQKGEIMPNIPQMSAFWYAVRTAVINAASGRQTVDEALKDAQTGTDYDIPTTLEVLFQGPLGSRC
QRDHLSTKLIPTEVPADLIRAVTCQVCDHLLSDPVQSPCRHLFCRLCIIRYTHALGPNCPTCNQHLNPSHLIKPAKFFLA
TLSSLPLLCPSEECSDWVRLDSFREHCLNHYREKESQEEQTPSEQNLDGYLPVNKGGRPRQHLLSLTRRAQKHRLRDLKN
QVKTFAEKEEGGDVKSVCLTLFLLALRAGNEHKQADELEAMMQGRGFGLHPAVCLAIRVNTFLSCSQYHKMYRTVKATSG
RQIFQPLHTLRNAEKELLPGFHQFEWQPALKNVSTSWDVGIIDGLSGWTVSVDDVPADTISRRFRYDVALVSALKDLEED
IMEGLRERALDDSMCTSGFTVVVKESCDGMGDVSEKHGSGPAVPEKAVRFSFTIMSISIRLEGEDDGITIFQEQKPNSEL
SCRPLCLMFVDESDHETLTAILGPVVAERKAMMESRLIISVGGLLRSFRFFFRGTGYDEKMVREMEGLEASGSTYICTLC
DSTRAEASQNMVLHSITRSHDENLERYEIWRKNPFSESADELRDRVKGVSAKPFMETQPTLDALHCDIGNATEFYKIFQD
EIGEVYQKPNPSREERRRWRSTLDKQLRKKMKLKPVMRMNGNYARRLMTREAVEAVCELVPSEERREALLKLMDLYLQMK
PVWRSTCPSRDCPDQLCQYSYNSQQFADLLSSMFKYRYDGKITNYLHKTLAHVPEIVERDGSIGAWASEGNESGNKLFRR
FRKMNARQSKTFELEDILKHHWLYTSKYLQKFMEAHKNS
;
A,C ? 
2 'polypeptide(L)'        no no 
;GGSMSLQPLTAVNCGSLVQPGFSLLDLEGDVYLFGQKGWPKRSCPTGIFGVRIKKGELKLRAISFSNNSSYLPPLRCPAI
AHFEAQDGKPECYLIHGGRTPNNELSSSLYMLSVDSRGCNRKVTLRCEEKELVGDVPSARYGHTLSVINSRGKTACVLFG
GRSYMPPTERTTQNWNSVVDCPPQVYLIDLEFGCCTAHTLPELTDGQSFHVALARQDCVYFLGGHILSSDCRPSRLIRLH
VELLLGSPVLTCTILHEGLTITSAIASPIGYHEYIIFGGYQSETQKRMECTYVGLDDVGVHMESREPPQWTSEISHSRTW
FGGSLGKGTALVAIPSEGNPTPPEAYHFYQVSFQKEQDGEATAQGGSQESTDFEDSAPLEDSEELYFGREPHELEYSSDV
EGDTYNEEDEEDESQTGYWIKCCLSCQVDPNIWEPYYSTELTRPAMIFCSRGEGGHWVHAQCMELPESLLLQLSQDNSKY
FCLDHGGLPKQEMTPPKQMLPVKRVPMKMTHRKAPVSLKMTPAKKTFLRRLFD
;
;GGSMSLQPLTAVNCGSLVQPGFSLLDLEGDVYLFGQKGWPKRSCPTGIFGVRIKKGELKLRAISFSNNSSYLPPLRCPAI
AHFEAQDGKPECYLIHGGRTPNNELSSSLYMLSVDSRGCNRKVTLRCEEKELVGDVPSARYGHTLSVINSRGKTACVLFG
GRSYMPPTERTTQNWNSVVDCPPQVYLIDLEFGCCTAHTLPELTDGQSFHVALARQDCVYFLGGHILSSDCRPSRLIRLH
VELLLGSPVLTCTILHEGLTITSAIASPIGYHEYIIFGGYQSETQKRMECTYVGLDDVGVHMESREPPQWTSEISHSRTW
FGGSLGKGTALVAIPSEGNPTPPEAYHFYQVSFQKEQDGEATAQGGSQESTDFEDSAPLEDSEELYFGREPHELEYSSDV
EGDTYNEEDEEDESQTGYWIKCCLSCQVDPNIWEPYYSTELTRPAMIFCSRGEGGHWVHAQCMELPESLLLQLSQDNSKY
FCLDHGGLPKQEMTPPKQMLPVKRVPMKMTHRKAPVSLKMTPAKKTFLRRLFD
;
B,D ? 
3 polydeoxyribonucleotide no no 
;(DG)(DA)(DT)(DC)(DT)(DG)(DG)(DC)(DC)(DT)(DG)(DT)(DC)(DT)(DT)(DA)(DC)(DA)(DC)(DA)
(DG)(DT)(DG)(DC)(DT)(DA)(DC)(DA)(DG)(DA)(DC)(DT)(DG)(DG)
;
GATCTGGCCTGTCTTACACAGTGCTACAGACTGG E,G ? 
4 polydeoxyribonucleotide no no 
;(DC)(DC)(DA)(DG)(DT)(DC)(DT)(DG)(DT)(DA)(DG)(DC)(DA)(DC)(DT)(DG)(DT)(DG)(DT)(DA)
(DA)(DG)(DA)(DC)(DA)(DG)(DG)(DC)(DC)(DA)(DG)(DA)(DT)(DC)
;
CCAGTCTGTAGCACTGTGTAAGACAGGCCAGATC F,H ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1    MET n 
1 2    GLY n 
1 3    SER n 
1 4    SER n 
1 5    HIS n 
1 6    HIS n 
1 7    HIS n 
1 8    HIS n 
1 9    HIS n 
1 10   HIS n 
1 11   GLY n 
1 12   THR n 
1 13   LYS n 
1 14   THR n 
1 15   GLU n 
1 16   GLU n 
1 17   GLY n 
1 18   LYS n 
1 19   LEU n 
1 20   VAL n 
1 21   ILE n 
1 22   TRP n 
1 23   ILE n 
1 24   ASN n 
1 25   GLY n 
1 26   ASP n 
1 27   LYS n 
1 28   GLY n 
1 29   TYR n 
1 30   ASN n 
1 31   GLY n 
1 32   LEU n 
1 33   ALA n 
1 34   GLU n 
1 35   VAL n 
1 36   GLY n 
1 37   LYS n 
1 38   LYS n 
1 39   PHE n 
1 40   GLU n 
1 41   LYS n 
1 42   ASP n 
1 43   THR n 
1 44   GLY n 
1 45   ILE n 
1 46   LYS n 
1 47   VAL n 
1 48   THR n 
1 49   VAL n 
1 50   GLU n 
1 51   HIS n 
1 52   PRO n 
1 53   ASP n 
1 54   LYS n 
1 55   LEU n 
1 56   GLU n 
1 57   GLU n 
1 58   LYS n 
1 59   PHE n 
1 60   PRO n 
1 61   GLN n 
1 62   VAL n 
1 63   ALA n 
1 64   ALA n 
1 65   THR n 
1 66   GLY n 
1 67   ASP n 
1 68   GLY n 
1 69   PRO n 
1 70   ASP n 
1 71   ILE n 
1 72   ILE n 
1 73   PHE n 
1 74   TRP n 
1 75   ALA n 
1 76   HIS n 
1 77   ASP n 
1 78   ARG n 
1 79   PHE n 
1 80   GLY n 
1 81   GLY n 
1 82   TYR n 
1 83   ALA n 
1 84   GLN n 
1 85   SER n 
1 86   GLY n 
1 87   LEU n 
1 88   LEU n 
1 89   ALA n 
1 90   GLU n 
1 91   ILE n 
1 92   THR n 
1 93   PRO n 
1 94   ASP n 
1 95   LYS n 
1 96   ALA n 
1 97   PHE n 
1 98   GLN n 
1 99   ASP n 
1 100  LYS n 
1 101  LEU n 
1 102  TYR n 
1 103  PRO n 
1 104  PHE n 
1 105  THR n 
1 106  TRP n 
1 107  ASP n 
1 108  ALA n 
1 109  VAL n 
1 110  ARG n 
1 111  TYR n 
1 112  ASN n 
1 113  GLY n 
1 114  LYS n 
1 115  LEU n 
1 116  ILE n 
1 117  ALA n 
1 118  TYR n 
1 119  PRO n 
1 120  ILE n 
1 121  ALA n 
1 122  VAL n 
1 123  GLU n 
1 124  ALA n 
1 125  LEU n 
1 126  SER n 
1 127  LEU n 
1 128  ILE n 
1 129  TYR n 
1 130  ASN n 
1 131  LYS n 
1 132  ASP n 
1 133  LEU n 
1 134  LEU n 
1 135  PRO n 
1 136  ASN n 
1 137  PRO n 
1 138  PRO n 
1 139  LYS n 
1 140  THR n 
1 141  TRP n 
1 142  GLU n 
1 143  GLU n 
1 144  ILE n 
1 145  PRO n 
1 146  ALA n 
1 147  LEU n 
1 148  ASP n 
1 149  LYS n 
1 150  GLU n 
1 151  LEU n 
1 152  LYS n 
1 153  ALA n 
1 154  LYS n 
1 155  GLY n 
1 156  LYS n 
1 157  SER n 
1 158  ALA n 
1 159  LEU n 
1 160  MET n 
1 161  PHE n 
1 162  ASN n 
1 163  LEU n 
1 164  GLN n 
1 165  GLU n 
1 166  PRO n 
1 167  TYR n 
1 168  PHE n 
1 169  THR n 
1 170  TRP n 
1 171  PRO n 
1 172  LEU n 
1 173  ILE n 
1 174  ALA n 
1 175  ALA n 
1 176  ASP n 
1 177  GLY n 
1 178  GLY n 
1 179  TYR n 
1 180  ALA n 
1 181  PHE n 
1 182  LYS n 
1 183  TYR n 
1 184  GLU n 
1 185  ASN n 
1 186  GLY n 
1 187  LYS n 
1 188  TYR n 
1 189  ASP n 
1 190  ILE n 
1 191  LYS n 
1 192  ASP n 
1 193  VAL n 
1 194  GLY n 
1 195  VAL n 
1 196  ASP n 
1 197  ASN n 
1 198  ALA n 
1 199  GLY n 
1 200  ALA n 
1 201  LYS n 
1 202  ALA n 
1 203  GLY n 
1 204  LEU n 
1 205  THR n 
1 206  PHE n 
1 207  LEU n 
1 208  VAL n 
1 209  ASP n 
1 210  LEU n 
1 211  ILE n 
1 212  LYS n 
1 213  ASN n 
1 214  LYS n 
1 215  HIS n 
1 216  MET n 
1 217  ASN n 
1 218  ALA n 
1 219  ASP n 
1 220  THR n 
1 221  ASP n 
1 222  TYR n 
1 223  SER n 
1 224  ILE n 
1 225  ALA n 
1 226  GLU n 
1 227  ALA n 
1 228  ALA n 
1 229  PHE n 
1 230  ASN n 
1 231  LYS n 
1 232  GLY n 
1 233  GLU n 
1 234  THR n 
1 235  ALA n 
1 236  MET n 
1 237  THR n 
1 238  ILE n 
1 239  ASN n 
1 240  GLY n 
1 241  PRO n 
1 242  TRP n 
1 243  ALA n 
1 244  TRP n 
1 245  SER n 
1 246  ASN n 
1 247  ILE n 
1 248  ASP n 
1 249  THR n 
1 250  SER n 
1 251  LYS n 
1 252  VAL n 
1 253  ASN n 
1 254  TYR n 
1 255  GLY n 
1 256  VAL n 
1 257  THR n 
1 258  VAL n 
1 259  LEU n 
1 260  PRO n 
1 261  THR n 
1 262  PHE n 
1 263  LYS n 
1 264  GLY n 
1 265  GLN n 
1 266  PRO n 
1 267  SER n 
1 268  LYS n 
1 269  PRO n 
1 270  PHE n 
1 271  VAL n 
1 272  GLY n 
1 273  VAL n 
1 274  LEU n 
1 275  SER n 
1 276  ALA n 
1 277  GLY n 
1 278  ILE n 
1 279  ASN n 
1 280  ALA n 
1 281  ALA n 
1 282  SER n 
1 283  PRO n 
1 284  ASN n 
1 285  LYS n 
1 286  GLU n 
1 287  LEU n 
1 288  ALA n 
1 289  LYS n 
1 290  GLU n 
1 291  PHE n 
1 292  LEU n 
1 293  GLU n 
1 294  ASN n 
1 295  TYR n 
1 296  LEU n 
1 297  LEU n 
1 298  THR n 
1 299  ASP n 
1 300  GLU n 
1 301  GLY n 
1 302  LEU n 
1 303  GLU n 
1 304  ALA n 
1 305  VAL n 
1 306  ASN n 
1 307  LYS n 
1 308  ASP n 
1 309  LYS n 
1 310  PRO n 
1 311  LEU n 
1 312  GLY n 
1 313  ALA n 
1 314  VAL n 
1 315  ALA n 
1 316  LEU n 
1 317  LYS n 
1 318  SER n 
1 319  TYR n 
1 320  GLU n 
1 321  GLU n 
1 322  GLU n 
1 323  LEU n 
1 324  ALA n 
1 325  LYS n 
1 326  ASP n 
1 327  PRO n 
1 328  ARG n 
1 329  ILE n 
1 330  ALA n 
1 331  ALA n 
1 332  THR n 
1 333  MET n 
1 334  GLU n 
1 335  ASN n 
1 336  ALA n 
1 337  GLN n 
1 338  LYS n 
1 339  GLY n 
1 340  GLU n 
1 341  ILE n 
1 342  MET n 
1 343  PRO n 
1 344  ASN n 
1 345  ILE n 
1 346  PRO n 
1 347  GLN n 
1 348  MET n 
1 349  SER n 
1 350  ALA n 
1 351  PHE n 
1 352  TRP n 
1 353  TYR n 
1 354  ALA n 
1 355  VAL n 
1 356  ARG n 
1 357  THR n 
1 358  ALA n 
1 359  VAL n 
1 360  ILE n 
1 361  ASN n 
1 362  ALA n 
1 363  ALA n 
1 364  SER n 
1 365  GLY n 
1 366  ARG n 
1 367  GLN n 
1 368  THR n 
1 369  VAL n 
1 370  ASP n 
1 371  GLU n 
1 372  ALA n 
1 373  LEU n 
1 374  LYS n 
1 375  ASP n 
1 376  ALA n 
1 377  GLN n 
1 378  THR n 
1 379  GLY n 
1 380  THR n 
1 381  ASP n 
1 382  TYR n 
1 383  ASP n 
1 384  ILE n 
1 385  PRO n 
1 386  THR n 
1 387  THR n 
1 388  LEU n 
1 389  GLU n 
1 390  VAL n 
1 391  LEU n 
1 392  PHE n 
1 393  GLN n 
1 394  GLY n 
1 395  PRO n 
1 396  LEU n 
1 397  GLY n 
1 398  SER n 
1 399  ARG n 
1 400  CYS n 
1 401  GLN n 
1 402  ARG n 
1 403  ASP n 
1 404  HIS n 
1 405  LEU n 
1 406  SER n 
1 407  THR n 
1 408  LYS n 
1 409  LEU n 
1 410  ILE n 
1 411  PRO n 
1 412  THR n 
1 413  GLU n 
1 414  VAL n 
1 415  PRO n 
1 416  ALA n 
1 417  ASP n 
1 418  LEU n 
1 419  ILE n 
1 420  ARG n 
1 421  ALA n 
1 422  VAL n 
1 423  THR n 
1 424  CYS n 
1 425  GLN n 
1 426  VAL n 
1 427  CYS n 
1 428  ASP n 
1 429  HIS n 
1 430  LEU n 
1 431  LEU n 
1 432  SER n 
1 433  ASP n 
1 434  PRO n 
1 435  VAL n 
1 436  GLN n 
1 437  SER n 
1 438  PRO n 
1 439  CYS n 
1 440  ARG n 
1 441  HIS n 
1 442  LEU n 
1 443  PHE n 
1 444  CYS n 
1 445  ARG n 
1 446  LEU n 
1 447  CYS n 
1 448  ILE n 
1 449  ILE n 
1 450  ARG n 
1 451  TYR n 
1 452  THR n 
1 453  HIS n 
1 454  ALA n 
1 455  LEU n 
1 456  GLY n 
1 457  PRO n 
1 458  ASN n 
1 459  CYS n 
1 460  PRO n 
1 461  THR n 
1 462  CYS n 
1 463  ASN n 
1 464  GLN n 
1 465  HIS n 
1 466  LEU n 
1 467  ASN n 
1 468  PRO n 
1 469  SER n 
1 470  HIS n 
1 471  LEU n 
1 472  ILE n 
1 473  LYS n 
1 474  PRO n 
1 475  ALA n 
1 476  LYS n 
1 477  PHE n 
1 478  PHE n 
1 479  LEU n 
1 480  ALA n 
1 481  THR n 
1 482  LEU n 
1 483  SER n 
1 484  SER n 
1 485  LEU n 
1 486  PRO n 
1 487  LEU n 
1 488  LEU n 
1 489  CYS n 
1 490  PRO n 
1 491  SER n 
1 492  GLU n 
1 493  GLU n 
1 494  CYS n 
1 495  SER n 
1 496  ASP n 
1 497  TRP n 
1 498  VAL n 
1 499  ARG n 
1 500  LEU n 
1 501  ASP n 
1 502  SER n 
1 503  PHE n 
1 504  ARG n 
1 505  GLU n 
1 506  HIS n 
1 507  CYS n 
1 508  LEU n 
1 509  ASN n 
1 510  HIS n 
1 511  TYR n 
1 512  ARG n 
1 513  GLU n 
1 514  LYS n 
1 515  GLU n 
1 516  SER n 
1 517  GLN n 
1 518  GLU n 
1 519  GLU n 
1 520  GLN n 
1 521  THR n 
1 522  PRO n 
1 523  SER n 
1 524  GLU n 
1 525  GLN n 
1 526  ASN n 
1 527  LEU n 
1 528  ASP n 
1 529  GLY n 
1 530  TYR n 
1 531  LEU n 
1 532  PRO n 
1 533  VAL n 
1 534  ASN n 
1 535  LYS n 
1 536  GLY n 
1 537  GLY n 
1 538  ARG n 
1 539  PRO n 
1 540  ARG n 
1 541  GLN n 
1 542  HIS n 
1 543  LEU n 
1 544  LEU n 
1 545  SER n 
1 546  LEU n 
1 547  THR n 
1 548  ARG n 
1 549  ARG n 
1 550  ALA n 
1 551  GLN n 
1 552  LYS n 
1 553  HIS n 
1 554  ARG n 
1 555  LEU n 
1 556  ARG n 
1 557  ASP n 
1 558  LEU n 
1 559  LYS n 
1 560  ASN n 
1 561  GLN n 
1 562  VAL n 
1 563  LYS n 
1 564  THR n 
1 565  PHE n 
1 566  ALA n 
1 567  GLU n 
1 568  LYS n 
1 569  GLU n 
1 570  GLU n 
1 571  GLY n 
1 572  GLY n 
1 573  ASP n 
1 574  VAL n 
1 575  LYS n 
1 576  SER n 
1 577  VAL n 
1 578  CYS n 
1 579  LEU n 
1 580  THR n 
1 581  LEU n 
1 582  PHE n 
1 583  LEU n 
1 584  LEU n 
1 585  ALA n 
1 586  LEU n 
1 587  ARG n 
1 588  ALA n 
1 589  GLY n 
1 590  ASN n 
1 591  GLU n 
1 592  HIS n 
1 593  LYS n 
1 594  GLN n 
1 595  ALA n 
1 596  ASP n 
1 597  GLU n 
1 598  LEU n 
1 599  GLU n 
1 600  ALA n 
1 601  MET n 
1 602  MET n 
1 603  GLN n 
1 604  GLY n 
1 605  ARG n 
1 606  GLY n 
1 607  PHE n 
1 608  GLY n 
1 609  LEU n 
1 610  HIS n 
1 611  PRO n 
1 612  ALA n 
1 613  VAL n 
1 614  CYS n 
1 615  LEU n 
1 616  ALA n 
1 617  ILE n 
1 618  ARG n 
1 619  VAL n 
1 620  ASN n 
1 621  THR n 
1 622  PHE n 
1 623  LEU n 
1 624  SER n 
1 625  CYS n 
1 626  SER n 
1 627  GLN n 
1 628  TYR n 
1 629  HIS n 
1 630  LYS n 
1 631  MET n 
1 632  TYR n 
1 633  ARG n 
1 634  THR n 
1 635  VAL n 
1 636  LYS n 
1 637  ALA n 
1 638  THR n 
1 639  SER n 
1 640  GLY n 
1 641  ARG n 
1 642  GLN n 
1 643  ILE n 
1 644  PHE n 
1 645  GLN n 
1 646  PRO n 
1 647  LEU n 
1 648  HIS n 
1 649  THR n 
1 650  LEU n 
1 651  ARG n 
1 652  ASN n 
1 653  ALA n 
1 654  GLU n 
1 655  LYS n 
1 656  GLU n 
1 657  LEU n 
1 658  LEU n 
1 659  PRO n 
1 660  GLY n 
1 661  PHE n 
1 662  HIS n 
1 663  GLN n 
1 664  PHE n 
1 665  GLU n 
1 666  TRP n 
1 667  GLN n 
1 668  PRO n 
1 669  ALA n 
1 670  LEU n 
1 671  LYS n 
1 672  ASN n 
1 673  VAL n 
1 674  SER n 
1 675  THR n 
1 676  SER n 
1 677  TRP n 
1 678  ASP n 
1 679  VAL n 
1 680  GLY n 
1 681  ILE n 
1 682  ILE n 
1 683  ASP n 
1 684  GLY n 
1 685  LEU n 
1 686  SER n 
1 687  GLY n 
1 688  TRP n 
1 689  THR n 
1 690  VAL n 
1 691  SER n 
1 692  VAL n 
1 693  ASP n 
1 694  ASP n 
1 695  VAL n 
1 696  PRO n 
1 697  ALA n 
1 698  ASP n 
1 699  THR n 
1 700  ILE n 
1 701  SER n 
1 702  ARG n 
1 703  ARG n 
1 704  PHE n 
1 705  ARG n 
1 706  TYR n 
1 707  ASP n 
1 708  VAL n 
1 709  ALA n 
1 710  LEU n 
1 711  VAL n 
1 712  SER n 
1 713  ALA n 
1 714  LEU n 
1 715  LYS n 
1 716  ASP n 
1 717  LEU n 
1 718  GLU n 
1 719  GLU n 
1 720  ASP n 
1 721  ILE n 
1 722  MET n 
1 723  GLU n 
1 724  GLY n 
1 725  LEU n 
1 726  ARG n 
1 727  GLU n 
1 728  ARG n 
1 729  ALA n 
1 730  LEU n 
1 731  ASP n 
1 732  ASP n 
1 733  SER n 
1 734  MET n 
1 735  CYS n 
1 736  THR n 
1 737  SER n 
1 738  GLY n 
1 739  PHE n 
1 740  THR n 
1 741  VAL n 
1 742  VAL n 
1 743  VAL n 
1 744  LYS n 
1 745  GLU n 
1 746  SER n 
1 747  CYS n 
1 748  ASP n 
1 749  GLY n 
1 750  MET n 
1 751  GLY n 
1 752  ASP n 
1 753  VAL n 
1 754  SER n 
1 755  GLU n 
1 756  LYS n 
1 757  HIS n 
1 758  GLY n 
1 759  SER n 
1 760  GLY n 
1 761  PRO n 
1 762  ALA n 
1 763  VAL n 
1 764  PRO n 
1 765  GLU n 
1 766  LYS n 
1 767  ALA n 
1 768  VAL n 
1 769  ARG n 
1 770  PHE n 
1 771  SER n 
1 772  PHE n 
1 773  THR n 
1 774  ILE n 
1 775  MET n 
1 776  SER n 
1 777  ILE n 
1 778  SER n 
1 779  ILE n 
1 780  ARG n 
1 781  LEU n 
1 782  GLU n 
1 783  GLY n 
1 784  GLU n 
1 785  ASP n 
1 786  ASP n 
1 787  GLY n 
1 788  ILE n 
1 789  THR n 
1 790  ILE n 
1 791  PHE n 
1 792  GLN n 
1 793  GLU n 
1 794  GLN n 
1 795  LYS n 
1 796  PRO n 
1 797  ASN n 
1 798  SER n 
1 799  GLU n 
1 800  LEU n 
1 801  SER n 
1 802  CYS n 
1 803  ARG n 
1 804  PRO n 
1 805  LEU n 
1 806  CYS n 
1 807  LEU n 
1 808  MET n 
1 809  PHE n 
1 810  VAL n 
1 811  ASP n 
1 812  GLU n 
1 813  SER n 
1 814  ASP n 
1 815  HIS n 
1 816  GLU n 
1 817  THR n 
1 818  LEU n 
1 819  THR n 
1 820  ALA n 
1 821  ILE n 
1 822  LEU n 
1 823  GLY n 
1 824  PRO n 
1 825  VAL n 
1 826  VAL n 
1 827  ALA n 
1 828  GLU n 
1 829  ARG n 
1 830  LYS n 
1 831  ALA n 
1 832  MET n 
1 833  MET n 
1 834  GLU n 
1 835  SER n 
1 836  ARG n 
1 837  LEU n 
1 838  ILE n 
1 839  ILE n 
1 840  SER n 
1 841  VAL n 
1 842  GLY n 
1 843  GLY n 
1 844  LEU n 
1 845  LEU n 
1 846  ARG n 
1 847  SER n 
1 848  PHE n 
1 849  ARG n 
1 850  PHE n 
1 851  PHE n 
1 852  PHE n 
1 853  ARG n 
1 854  GLY n 
1 855  THR n 
1 856  GLY n 
1 857  TYR n 
1 858  ASP n 
1 859  GLU n 
1 860  LYS n 
1 861  MET n 
1 862  VAL n 
1 863  ARG n 
1 864  GLU n 
1 865  MET n 
1 866  GLU n 
1 867  GLY n 
1 868  LEU n 
1 869  GLU n 
1 870  ALA n 
1 871  SER n 
1 872  GLY n 
1 873  SER n 
1 874  THR n 
1 875  TYR n 
1 876  ILE n 
1 877  CYS n 
1 878  THR n 
1 879  LEU n 
1 880  CYS n 
1 881  ASP n 
1 882  SER n 
1 883  THR n 
1 884  ARG n 
1 885  ALA n 
1 886  GLU n 
1 887  ALA n 
1 888  SER n 
1 889  GLN n 
1 890  ASN n 
1 891  MET n 
1 892  VAL n 
1 893  LEU n 
1 894  HIS n 
1 895  SER n 
1 896  ILE n 
1 897  THR n 
1 898  ARG n 
1 899  SER n 
1 900  HIS n 
1 901  ASP n 
1 902  GLU n 
1 903  ASN n 
1 904  LEU n 
1 905  GLU n 
1 906  ARG n 
1 907  TYR n 
1 908  GLU n 
1 909  ILE n 
1 910  TRP n 
1 911  ARG n 
1 912  LYS n 
1 913  ASN n 
1 914  PRO n 
1 915  PHE n 
1 916  SER n 
1 917  GLU n 
1 918  SER n 
1 919  ALA n 
1 920  ASP n 
1 921  GLU n 
1 922  LEU n 
1 923  ARG n 
1 924  ASP n 
1 925  ARG n 
1 926  VAL n 
1 927  LYS n 
1 928  GLY n 
1 929  VAL n 
1 930  SER n 
1 931  ALA n 
1 932  LYS n 
1 933  PRO n 
1 934  PHE n 
1 935  MET n 
1 936  GLU n 
1 937  THR n 
1 938  GLN n 
1 939  PRO n 
1 940  THR n 
1 941  LEU n 
1 942  ASP n 
1 943  ALA n 
1 944  LEU n 
1 945  HIS n 
1 946  CYS n 
1 947  ASP n 
1 948  ILE n 
1 949  GLY n 
1 950  ASN n 
1 951  ALA n 
1 952  THR n 
1 953  GLU n 
1 954  PHE n 
1 955  TYR n 
1 956  LYS n 
1 957  ILE n 
1 958  PHE n 
1 959  GLN n 
1 960  ASP n 
1 961  GLU n 
1 962  ILE n 
1 963  GLY n 
1 964  GLU n 
1 965  VAL n 
1 966  TYR n 
1 967  GLN n 
1 968  LYS n 
1 969  PRO n 
1 970  ASN n 
1 971  PRO n 
1 972  SER n 
1 973  ARG n 
1 974  GLU n 
1 975  GLU n 
1 976  ARG n 
1 977  ARG n 
1 978  ARG n 
1 979  TRP n 
1 980  ARG n 
1 981  SER n 
1 982  THR n 
1 983  LEU n 
1 984  ASP n 
1 985  LYS n 
1 986  GLN n 
1 987  LEU n 
1 988  ARG n 
1 989  LYS n 
1 990  LYS n 
1 991  MET n 
1 992  LYS n 
1 993  LEU n 
1 994  LYS n 
1 995  PRO n 
1 996  VAL n 
1 997  MET n 
1 998  ARG n 
1 999  MET n 
1 1000 ASN n 
1 1001 GLY n 
1 1002 ASN n 
1 1003 TYR n 
1 1004 ALA n 
1 1005 ARG n 
1 1006 ARG n 
1 1007 LEU n 
1 1008 MET n 
1 1009 THR n 
1 1010 ARG n 
1 1011 GLU n 
1 1012 ALA n 
1 1013 VAL n 
1 1014 GLU n 
1 1015 ALA n 
1 1016 VAL n 
1 1017 CYS n 
1 1018 GLU n 
1 1019 LEU n 
1 1020 VAL n 
1 1021 PRO n 
1 1022 SER n 
1 1023 GLU n 
1 1024 GLU n 
1 1025 ARG n 
1 1026 ARG n 
1 1027 GLU n 
1 1028 ALA n 
1 1029 LEU n 
1 1030 LEU n 
1 1031 LYS n 
1 1032 LEU n 
1 1033 MET n 
1 1034 ASP n 
1 1035 LEU n 
1 1036 TYR n 
1 1037 LEU n 
1 1038 GLN n 
1 1039 MET n 
1 1040 LYS n 
1 1041 PRO n 
1 1042 VAL n 
1 1043 TRP n 
1 1044 ARG n 
1 1045 SER n 
1 1046 THR n 
1 1047 CYS n 
1 1048 PRO n 
1 1049 SER n 
1 1050 ARG n 
1 1051 ASP n 
1 1052 CYS n 
1 1053 PRO n 
1 1054 ASP n 
1 1055 GLN n 
1 1056 LEU n 
1 1057 CYS n 
1 1058 GLN n 
1 1059 TYR n 
1 1060 SER n 
1 1061 TYR n 
1 1062 ASN n 
1 1063 SER n 
1 1064 GLN n 
1 1065 GLN n 
1 1066 PHE n 
1 1067 ALA n 
1 1068 ASP n 
1 1069 LEU n 
1 1070 LEU n 
1 1071 SER n 
1 1072 SER n 
1 1073 MET n 
1 1074 PHE n 
1 1075 LYS n 
1 1076 TYR n 
1 1077 ARG n 
1 1078 TYR n 
1 1079 ASP n 
1 1080 GLY n 
1 1081 LYS n 
1 1082 ILE n 
1 1083 THR n 
1 1084 ASN n 
1 1085 TYR n 
1 1086 LEU n 
1 1087 HIS n 
1 1088 LYS n 
1 1089 THR n 
1 1090 LEU n 
1 1091 ALA n 
1 1092 HIS n 
1 1093 VAL n 
1 1094 PRO n 
1 1095 GLU n 
1 1096 ILE n 
1 1097 VAL n 
1 1098 GLU n 
1 1099 ARG n 
1 1100 ASP n 
1 1101 GLY n 
1 1102 SER n 
1 1103 ILE n 
1 1104 GLY n 
1 1105 ALA n 
1 1106 TRP n 
1 1107 ALA n 
1 1108 SER n 
1 1109 GLU n 
1 1110 GLY n 
1 1111 ASN n 
1 1112 GLU n 
1 1113 SER n 
1 1114 GLY n 
1 1115 ASN n 
1 1116 LYS n 
1 1117 LEU n 
1 1118 PHE n 
1 1119 ARG n 
1 1120 ARG n 
1 1121 PHE n 
1 1122 ARG n 
1 1123 LYS n 
1 1124 MET n 
1 1125 ASN n 
1 1126 ALA n 
1 1127 ARG n 
1 1128 GLN n 
1 1129 SER n 
1 1130 LYS n 
1 1131 THR n 
1 1132 PHE n 
1 1133 GLU n 
1 1134 LEU n 
1 1135 GLU n 
1 1136 ASP n 
1 1137 ILE n 
1 1138 LEU n 
1 1139 LYS n 
1 1140 HIS n 
1 1141 HIS n 
1 1142 TRP n 
1 1143 LEU n 
1 1144 TYR n 
1 1145 THR n 
1 1146 SER n 
1 1147 LYS n 
1 1148 TYR n 
1 1149 LEU n 
1 1150 GLN n 
1 1151 LYS n 
1 1152 PHE n 
1 1153 MET n 
1 1154 GLU n 
1 1155 ALA n 
1 1156 HIS n 
1 1157 LYS n 
1 1158 ASN n 
1 1159 SER n 
2 1    GLY n 
2 2    GLY n 
2 3    SER n 
2 4    MET n 
2 5    SER n 
2 6    LEU n 
2 7    GLN n 
2 8    PRO n 
2 9    LEU n 
2 10   THR n 
2 11   ALA n 
2 12   VAL n 
2 13   ASN n 
2 14   CYS n 
2 15   GLY n 
2 16   SER n 
2 17   LEU n 
2 18   VAL n 
2 19   GLN n 
2 20   PRO n 
2 21   GLY n 
2 22   PHE n 
2 23   SER n 
2 24   LEU n 
2 25   LEU n 
2 26   ASP n 
2 27   LEU n 
2 28   GLU n 
2 29   GLY n 
2 30   ASP n 
2 31   VAL n 
2 32   TYR n 
2 33   LEU n 
2 34   PHE n 
2 35   GLY n 
2 36   GLN n 
2 37   LYS n 
2 38   GLY n 
2 39   TRP n 
2 40   PRO n 
2 41   LYS n 
2 42   ARG n 
2 43   SER n 
2 44   CYS n 
2 45   PRO n 
2 46   THR n 
2 47   GLY n 
2 48   ILE n 
2 49   PHE n 
2 50   GLY n 
2 51   VAL n 
2 52   ARG n 
2 53   ILE n 
2 54   LYS n 
2 55   LYS n 
2 56   GLY n 
2 57   GLU n 
2 58   LEU n 
2 59   LYS n 
2 60   LEU n 
2 61   ARG n 
2 62   ALA n 
2 63   ILE n 
2 64   SER n 
2 65   PHE n 
2 66   SER n 
2 67   ASN n 
2 68   ASN n 
2 69   SER n 
2 70   SER n 
2 71   TYR n 
2 72   LEU n 
2 73   PRO n 
2 74   PRO n 
2 75   LEU n 
2 76   ARG n 
2 77   CYS n 
2 78   PRO n 
2 79   ALA n 
2 80   ILE n 
2 81   ALA n 
2 82   HIS n 
2 83   PHE n 
2 84   GLU n 
2 85   ALA n 
2 86   GLN n 
2 87   ASP n 
2 88   GLY n 
2 89   LYS n 
2 90   PRO n 
2 91   GLU n 
2 92   CYS n 
2 93   TYR n 
2 94   LEU n 
2 95   ILE n 
2 96   HIS n 
2 97   GLY n 
2 98   GLY n 
2 99   ARG n 
2 100  THR n 
2 101  PRO n 
2 102  ASN n 
2 103  ASN n 
2 104  GLU n 
2 105  LEU n 
2 106  SER n 
2 107  SER n 
2 108  SER n 
2 109  LEU n 
2 110  TYR n 
2 111  MET n 
2 112  LEU n 
2 113  SER n 
2 114  VAL n 
2 115  ASP n 
2 116  SER n 
2 117  ARG n 
2 118  GLY n 
2 119  CYS n 
2 120  ASN n 
2 121  ARG n 
2 122  LYS n 
2 123  VAL n 
2 124  THR n 
2 125  LEU n 
2 126  ARG n 
2 127  CYS n 
2 128  GLU n 
2 129  GLU n 
2 130  LYS n 
2 131  GLU n 
2 132  LEU n 
2 133  VAL n 
2 134  GLY n 
2 135  ASP n 
2 136  VAL n 
2 137  PRO n 
2 138  SER n 
2 139  ALA n 
2 140  ARG n 
2 141  TYR n 
2 142  GLY n 
2 143  HIS n 
2 144  THR n 
2 145  LEU n 
2 146  SER n 
2 147  VAL n 
2 148  ILE n 
2 149  ASN n 
2 150  SER n 
2 151  ARG n 
2 152  GLY n 
2 153  LYS n 
2 154  THR n 
2 155  ALA n 
2 156  CYS n 
2 157  VAL n 
2 158  LEU n 
2 159  PHE n 
2 160  GLY n 
2 161  GLY n 
2 162  ARG n 
2 163  SER n 
2 164  TYR n 
2 165  MET n 
2 166  PRO n 
2 167  PRO n 
2 168  THR n 
2 169  GLU n 
2 170  ARG n 
2 171  THR n 
2 172  THR n 
2 173  GLN n 
2 174  ASN n 
2 175  TRP n 
2 176  ASN n 
2 177  SER n 
2 178  VAL n 
2 179  VAL n 
2 180  ASP n 
2 181  CYS n 
2 182  PRO n 
2 183  PRO n 
2 184  GLN n 
2 185  VAL n 
2 186  TYR n 
2 187  LEU n 
2 188  ILE n 
2 189  ASP n 
2 190  LEU n 
2 191  GLU n 
2 192  PHE n 
2 193  GLY n 
2 194  CYS n 
2 195  CYS n 
2 196  THR n 
2 197  ALA n 
2 198  HIS n 
2 199  THR n 
2 200  LEU n 
2 201  PRO n 
2 202  GLU n 
2 203  LEU n 
2 204  THR n 
2 205  ASP n 
2 206  GLY n 
2 207  GLN n 
2 208  SER n 
2 209  PHE n 
2 210  HIS n 
2 211  VAL n 
2 212  ALA n 
2 213  LEU n 
2 214  ALA n 
2 215  ARG n 
2 216  GLN n 
2 217  ASP n 
2 218  CYS n 
2 219  VAL n 
2 220  TYR n 
2 221  PHE n 
2 222  LEU n 
2 223  GLY n 
2 224  GLY n 
2 225  HIS n 
2 226  ILE n 
2 227  LEU n 
2 228  SER n 
2 229  SER n 
2 230  ASP n 
2 231  CYS n 
2 232  ARG n 
2 233  PRO n 
2 234  SER n 
2 235  ARG n 
2 236  LEU n 
2 237  ILE n 
2 238  ARG n 
2 239  LEU n 
2 240  HIS n 
2 241  VAL n 
2 242  GLU n 
2 243  LEU n 
2 244  LEU n 
2 245  LEU n 
2 246  GLY n 
2 247  SER n 
2 248  PRO n 
2 249  VAL n 
2 250  LEU n 
2 251  THR n 
2 252  CYS n 
2 253  THR n 
2 254  ILE n 
2 255  LEU n 
2 256  HIS n 
2 257  GLU n 
2 258  GLY n 
2 259  LEU n 
2 260  THR n 
2 261  ILE n 
2 262  THR n 
2 263  SER n 
2 264  ALA n 
2 265  ILE n 
2 266  ALA n 
2 267  SER n 
2 268  PRO n 
2 269  ILE n 
2 270  GLY n 
2 271  TYR n 
2 272  HIS n 
2 273  GLU n 
2 274  TYR n 
2 275  ILE n 
2 276  ILE n 
2 277  PHE n 
2 278  GLY n 
2 279  GLY n 
2 280  TYR n 
2 281  GLN n 
2 282  SER n 
2 283  GLU n 
2 284  THR n 
2 285  GLN n 
2 286  LYS n 
2 287  ARG n 
2 288  MET n 
2 289  GLU n 
2 290  CYS n 
2 291  THR n 
2 292  TYR n 
2 293  VAL n 
2 294  GLY n 
2 295  LEU n 
2 296  ASP n 
2 297  ASP n 
2 298  VAL n 
2 299  GLY n 
2 300  VAL n 
2 301  HIS n 
2 302  MET n 
2 303  GLU n 
2 304  SER n 
2 305  ARG n 
2 306  GLU n 
2 307  PRO n 
2 308  PRO n 
2 309  GLN n 
2 310  TRP n 
2 311  THR n 
2 312  SER n 
2 313  GLU n 
2 314  ILE n 
2 315  SER n 
2 316  HIS n 
2 317  SER n 
2 318  ARG n 
2 319  THR n 
2 320  TRP n 
2 321  PHE n 
2 322  GLY n 
2 323  GLY n 
2 324  SER n 
2 325  LEU n 
2 326  GLY n 
2 327  LYS n 
2 328  GLY n 
2 329  THR n 
2 330  ALA n 
2 331  LEU n 
2 332  VAL n 
2 333  ALA n 
2 334  ILE n 
2 335  PRO n 
2 336  SER n 
2 337  GLU n 
2 338  GLY n 
2 339  ASN n 
2 340  PRO n 
2 341  THR n 
2 342  PRO n 
2 343  PRO n 
2 344  GLU n 
2 345  ALA n 
2 346  TYR n 
2 347  HIS n 
2 348  PHE n 
2 349  TYR n 
2 350  GLN n 
2 351  VAL n 
2 352  SER n 
2 353  PHE n 
2 354  GLN n 
2 355  LYS n 
2 356  GLU n 
2 357  GLN n 
2 358  ASP n 
2 359  GLY n 
2 360  GLU n 
2 361  ALA n 
2 362  THR n 
2 363  ALA n 
2 364  GLN n 
2 365  GLY n 
2 366  GLY n 
2 367  SER n 
2 368  GLN n 
2 369  GLU n 
2 370  SER n 
2 371  THR n 
2 372  ASP n 
2 373  PHE n 
2 374  GLU n 
2 375  ASP n 
2 376  SER n 
2 377  ALA n 
2 378  PRO n 
2 379  LEU n 
2 380  GLU n 
2 381  ASP n 
2 382  SER n 
2 383  GLU n 
2 384  GLU n 
2 385  LEU n 
2 386  TYR n 
2 387  PHE n 
2 388  GLY n 
2 389  ARG n 
2 390  GLU n 
2 391  PRO n 
2 392  HIS n 
2 393  GLU n 
2 394  LEU n 
2 395  GLU n 
2 396  TYR n 
2 397  SER n 
2 398  SER n 
2 399  ASP n 
2 400  VAL n 
2 401  GLU n 
2 402  GLY n 
2 403  ASP n 
2 404  THR n 
2 405  TYR n 
2 406  ASN n 
2 407  GLU n 
2 408  GLU n 
2 409  ASP n 
2 410  GLU n 
2 411  GLU n 
2 412  ASP n 
2 413  GLU n 
2 414  SER n 
2 415  GLN n 
2 416  THR n 
2 417  GLY n 
2 418  TYR n 
2 419  TRP n 
2 420  ILE n 
2 421  LYS n 
2 422  CYS n 
2 423  CYS n 
2 424  LEU n 
2 425  SER n 
2 426  CYS n 
2 427  GLN n 
2 428  VAL n 
2 429  ASP n 
2 430  PRO n 
2 431  ASN n 
2 432  ILE n 
2 433  TRP n 
2 434  GLU n 
2 435  PRO n 
2 436  TYR n 
2 437  TYR n 
2 438  SER n 
2 439  THR n 
2 440  GLU n 
2 441  LEU n 
2 442  THR n 
2 443  ARG n 
2 444  PRO n 
2 445  ALA n 
2 446  MET n 
2 447  ILE n 
2 448  PHE n 
2 449  CYS n 
2 450  SER n 
2 451  ARG n 
2 452  GLY n 
2 453  GLU n 
2 454  GLY n 
2 455  GLY n 
2 456  HIS n 
2 457  TRP n 
2 458  VAL n 
2 459  HIS n 
2 460  ALA n 
2 461  GLN n 
2 462  CYS n 
2 463  MET n 
2 464  GLU n 
2 465  LEU n 
2 466  PRO n 
2 467  GLU n 
2 468  SER n 
2 469  LEU n 
2 470  LEU n 
2 471  LEU n 
2 472  GLN n 
2 473  LEU n 
2 474  SER n 
2 475  GLN n 
2 476  ASP n 
2 477  ASN n 
2 478  SER n 
2 479  LYS n 
2 480  TYR n 
2 481  PHE n 
2 482  CYS n 
2 483  LEU n 
2 484  ASP n 
2 485  HIS n 
2 486  GLY n 
2 487  GLY n 
2 488  LEU n 
2 489  PRO n 
2 490  LYS n 
2 491  GLN n 
2 492  GLU n 
2 493  MET n 
2 494  THR n 
2 495  PRO n 
2 496  PRO n 
2 497  LYS n 
2 498  GLN n 
2 499  MET n 
2 500  LEU n 
2 501  PRO n 
2 502  VAL n 
2 503  LYS n 
2 504  ARG n 
2 505  VAL n 
2 506  PRO n 
2 507  MET n 
2 508  LYS n 
2 509  MET n 
2 510  THR n 
2 511  HIS n 
2 512  ARG n 
2 513  LYS n 
2 514  ALA n 
2 515  PRO n 
2 516  VAL n 
2 517  SER n 
2 518  LEU n 
2 519  LYS n 
2 520  MET n 
2 521  THR n 
2 522  PRO n 
2 523  ALA n 
2 524  LYS n 
2 525  LYS n 
2 526  THR n 
2 527  PHE n 
2 528  LEU n 
2 529  ARG n 
2 530  ARG n 
2 531  LEU n 
2 532  PHE n 
2 533  ASP n 
3 1    DG  n 
3 2    DA  n 
3 3    DT  n 
3 4    DC  n 
3 5    DT  n 
3 6    DG  n 
3 7    DG  n 
3 8    DC  n 
3 9    DC  n 
3 10   DT  n 
3 11   DG  n 
3 12   DT  n 
3 13   DC  n 
3 14   DT  n 
3 15   DT  n 
3 16   DA  n 
3 17   DC  n 
3 18   DA  n 
3 19   DC  n 
3 20   DA  n 
3 21   DG  n 
3 22   DT  n 
3 23   DG  n 
3 24   DC  n 
3 25   DT  n 
3 26   DA  n 
3 27   DC  n 
3 28   DA  n 
3 29   DG  n 
3 30   DA  n 
3 31   DC  n 
3 32   DT  n 
3 33   DG  n 
3 34   DG  n 
4 1    DC  n 
4 2    DC  n 
4 3    DA  n 
4 4    DG  n 
4 5    DT  n 
4 6    DC  n 
4 7    DT  n 
4 8    DG  n 
4 9    DT  n 
4 10   DA  n 
4 11   DG  n 
4 12   DC  n 
4 13   DA  n 
4 14   DC  n 
4 15   DT  n 
4 16   DG  n 
4 17   DT  n 
4 18   DG  n 
4 19   DT  n 
4 20   DA  n 
4 21   DA  n 
4 22   DG  n 
4 23   DA  n 
4 24   DC  n 
4 25   DA  n 
4 26   DG  n 
4 27   DG  n 
4 28   DC  n 
4 29   DC  n 
4 30   DA  n 
4 31   DG  n 
4 32   DA  n 
4 33   DT  n 
4 34   DC  n 
# 
loop_
_entity_src_gen.entity_id 
_entity_src_gen.pdbx_src_id 
_entity_src_gen.pdbx_alt_source_flag 
_entity_src_gen.pdbx_seq_type 
_entity_src_gen.pdbx_beg_seq_num 
_entity_src_gen.pdbx_end_seq_num 
_entity_src_gen.gene_src_common_name 
_entity_src_gen.gene_src_genus 
_entity_src_gen.pdbx_gene_src_gene 
_entity_src_gen.gene_src_species 
_entity_src_gen.gene_src_strain 
_entity_src_gen.gene_src_tissue 
_entity_src_gen.gene_src_tissue_fraction 
_entity_src_gen.gene_src_details 
_entity_src_gen.pdbx_gene_src_fragment 
_entity_src_gen.pdbx_gene_src_scientific_name 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 
_entity_src_gen.pdbx_gene_src_variant 
_entity_src_gen.pdbx_gene_src_cell_line 
_entity_src_gen.pdbx_gene_src_atcc 
_entity_src_gen.pdbx_gene_src_organ 
_entity_src_gen.pdbx_gene_src_organelle 
_entity_src_gen.pdbx_gene_src_cell 
_entity_src_gen.pdbx_gene_src_cellular_location 
_entity_src_gen.host_org_common_name 
_entity_src_gen.pdbx_host_org_scientific_name 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 
_entity_src_gen.host_org_genus 
_entity_src_gen.pdbx_host_org_gene 
_entity_src_gen.pdbx_host_org_organ 
_entity_src_gen.host_org_species 
_entity_src_gen.pdbx_host_org_tissue 
_entity_src_gen.pdbx_host_org_tissue_fraction 
_entity_src_gen.pdbx_host_org_strain 
_entity_src_gen.pdbx_host_org_variant 
_entity_src_gen.pdbx_host_org_cell_line 
_entity_src_gen.pdbx_host_org_atcc 
_entity_src_gen.pdbx_host_org_culture_collection 
_entity_src_gen.pdbx_host_org_cell 
_entity_src_gen.pdbx_host_org_organelle 
_entity_src_gen.pdbx_host_org_cellular_location 
_entity_src_gen.pdbx_host_org_vector_type 
_entity_src_gen.pdbx_host_org_vector 
_entity_src_gen.host_org_details 
_entity_src_gen.expression_system_id 
_entity_src_gen.plasmid_name 
_entity_src_gen.plasmid_details 
_entity_src_gen.pdbx_description 
1 1 sample 'Biological sequence' 1   398  ?         ? 'malE, b4034, JW3994' ? K12 ? ? ? ? 'Escherichia coli' 83333 ? ? ? ? ? ? ? ? 
'Spodoptera frugiperda' 7108 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
1 2 sample 'Biological sequence' 399 1159 Zebrafish ? rag1                  ? ?   ? ? ? ? 'Danio rerio'      7955  ? ? ? ? ? ? ? ? 
'Spodoptera frugiperda' 7108 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
2 1 sample 'Biological sequence' 1   533  Zebrafish ? rag2                  ? ?   ? ? ? ? 'Danio rerio'      7955  ? ? ? ? ? ? ? ? 
'Spodoptera frugiperda' 7108 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
# 
loop_
_pdbx_entity_src_syn.entity_id 
_pdbx_entity_src_syn.pdbx_src_id 
_pdbx_entity_src_syn.pdbx_alt_source_flag 
_pdbx_entity_src_syn.pdbx_beg_seq_num 
_pdbx_entity_src_syn.pdbx_end_seq_num 
_pdbx_entity_src_syn.organism_scientific 
_pdbx_entity_src_syn.organism_common_name 
_pdbx_entity_src_syn.ncbi_taxonomy_id 
_pdbx_entity_src_syn.details 
3 1 sample 1 34 'Danio rerio' ? 7955 ? 
4 1 sample 1 34 'Danio rerio' ? 7955 ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_db_isoform 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
1 UNP MALE_ECOLI   P0AEX9 ? 1 
;EEGKLVIWINGDKGYNGLAEVGKKFEKDTGIKVTVEHPDKLEEKFPQVAATGDGPDIIFWAHDRFGGYAQSGLLAEITPD
KAFQDKLYPFTWDAVRYNGKLIAYPIAVEALSLIYNKDLLPNPPKTWEEIPALDKELKAKGKSALMFNLQEPYFTWPLIA
ADGGYAFKYENGKYDIKDVGVDNAGAKAGLTFLVDLIKNKHMNADTDYSIAEAAFNKGETAMTINGPWAWSNIDTSKVNY
GVTVLPTFKGQPSKPFVGVLSAGINAASPNKELAKEFLENYLLTDEGLEAVNKDKPLGAVALKSYEEELAKDPRIAATME
NAQKGEIMPNIPQMSAFWYAVRTAVINAASGRQTVDEALKDAQT
;
29  
2 UNP RAG1_DANRE   O13033 ? 1 
;RCQRDHLSTKLIPTEVPADLIRAVTCQVCDHLLSDPVQSPCRHLFCRLCIIRYTHALGPNCPTCNQHLNPSHLIKPAKFF
LATLSSLPLLCPSEECSDWVRLDSFREHCLNHYREKESQEEQTPSEQNLDGYLPVNKGGRPRQHLLSLTRRAQKHRLRDL
KNQVKTFAEKEEGGDVKSVCLTLFLLALRAGNEHKQADELEAMMQGRGFGLHPAVCLAIRVNTFLSCSQYHKMYRTVKAT
SGRQIFQPLHTLRNAEKELLPGFHQFEWQPALKNVSTSWDVGIIDGLSGWTVSVDDVPADTISRRFRYDVALVSALKDLE
EDIMEGLRERALDDSMCTSGFTVVVKESCDGMGDVSEKHGSGPAVPEKAVRFSFTIMSISIRLEGEDDGITIFQEQKPNS
ELSCRPLCLMFVDESDHETLTAILGPVVAERKAMMESRLIISVGGLLRSFRFFFRGTGYDEKMVREMEGLEASGSTYICT
LCDSTRAEASQNMVLHSITRSHDENLERYEIWRKNPFSESADELRDRVKGVSAKPFMETQPTLDALHCDIGNATEFYKIF
QDEIGEVYQKPNPSREERRRWRSTLDKQLRKKMKLKPVMRMNGNYARRLMTREAVEAVCELVPSEERREALLKLMDLYLQ
MKPVWRSTCPSRDCPDQLCQYSYNSQQFADLLSSMFKYRYDGKITNYLHKTLAHVPEIVERDGSIGAWASEGNESGNKLF
RRFRKMNARQSKTFELEDILKHHWLYTSKYLQKFMEAHKNS
;
271 
3 UNP Q1RLW7_DANRE Q1RLW7 ? 2 
;MSLQPLTAVNCGSLVQPGFSLLDLEGDVYLFGQKGWPKRSCPTGIFGVRIKKGELKLRAISFSNNSSYLPPLRCPAIAHF
EAQDGKPECYLIHGGRTPNNELSSSLYMLSVDSRGCNRKVTLRCEEKELVGDVPSARYGHTLSVINSRGKTACVLFGGRS
YMPPTERTTQNWNSVVDCPPQVYLIDLEFGCCTAHTLPELTDGQSFHVALARQDCVYFLGGHILSSDCRPSRLIRLHVEL
LLGSPVLTCTILHEGLTITSAIASPIGYHEYIIFGGYQSETQKRMECTYVGLDDVGVHMESREPPQWTSEISHSRTWFGG
SLGKGTALVAIPSEGNPTPPEAYHFYQVSFQKEQDGEATAQGGSQESTDFEDSAPLEDSEELYFGREPHELEYSSDVEGD
TYNEEDEEDESQTGYWIKCCLSCQVDPNIWEPYYSTELTRPAMIFCSRGEGGHWVHAQCMELPESLLLQLSQDNSKYFCL
DHGGLPKQEMTPPKQMLPVKRVPMKMTHRKAPVSLKMTPAKKTFLRRLFD
;
1   
4 PDB 6DBU         6DBU   ? 3 ? 1   
5 PDB 6DBU         6DBU   ? 4 ? 1   
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1  1 6DBU A 15  ? 378  ? P0AEX9 29  ? 392  ? -113 250  
2  2 6DBU A 399 ? 1159 ? O13033 271 ? 1031 ? 271  1031 
3  3 6DBU B 4   ? 533  ? Q1RLW7 1   ? 530  ? 1    530  
4  1 6DBU C 15  ? 378  ? P0AEX9 29  ? 392  ? -113 250  
5  2 6DBU C 399 ? 1159 ? O13033 271 ? 1031 ? 271  1031 
6  3 6DBU D 4   ? 533  ? Q1RLW7 1   ? 530  ? 1    530  
7  4 6DBU E 1   ? 34   ? 6DBU   1   ? 34   ? 1    34   
8  5 6DBU F 1   ? 34   ? 6DBU   1   ? 34   ? 1    34   
9  4 6DBU G 1   ? 34   ? 6DBU   1   ? 34   ? 1    34   
10 5 6DBU H 1   ? 34   ? 6DBU   1   ? 34   ? 1    34   
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 6DBU MET A 1   ? UNP P0AEX9 ? ? 'initiating methionine' -127 1  
1 6DBU GLY A 2   ? UNP P0AEX9 ? ? 'expression tag'        -126 2  
1 6DBU SER A 3   ? UNP P0AEX9 ? ? 'expression tag'        -125 3  
1 6DBU SER A 4   ? UNP P0AEX9 ? ? 'expression tag'        -124 4  
1 6DBU HIS A 5   ? UNP P0AEX9 ? ? 'expression tag'        -123 5  
1 6DBU HIS A 6   ? UNP P0AEX9 ? ? 'expression tag'        -122 6  
1 6DBU HIS A 7   ? UNP P0AEX9 ? ? 'expression tag'        -121 7  
1 6DBU HIS A 8   ? UNP P0AEX9 ? ? 'expression tag'        -120 8  
1 6DBU HIS A 9   ? UNP P0AEX9 ? ? 'expression tag'        -119 9  
1 6DBU HIS A 10  ? UNP P0AEX9 ? ? 'expression tag'        -118 10 
1 6DBU GLY A 11  ? UNP P0AEX9 ? ? 'expression tag'        -117 11 
1 6DBU THR A 12  ? UNP P0AEX9 ? ? 'expression tag'        -116 12 
1 6DBU LYS A 13  ? UNP P0AEX9 ? ? 'expression tag'        -115 13 
1 6DBU THR A 14  ? UNP P0AEX9 ? ? 'expression tag'        -114 14 
1 6DBU GLY A 379 ? UNP P0AEX9 ? ? linker                  251  15 
1 6DBU THR A 380 ? UNP P0AEX9 ? ? linker                  252  16 
1 6DBU ASP A 381 ? UNP P0AEX9 ? ? linker                  253  17 
1 6DBU TYR A 382 ? UNP P0AEX9 ? ? linker                  254  18 
1 6DBU ASP A 383 ? UNP P0AEX9 ? ? linker                  255  19 
1 6DBU ILE A 384 ? UNP P0AEX9 ? ? linker                  256  20 
1 6DBU PRO A 385 ? UNP P0AEX9 ? ? linker                  257  21 
1 6DBU THR A 386 ? UNP P0AEX9 ? ? linker                  258  22 
1 6DBU THR A 387 ? UNP P0AEX9 ? ? linker                  259  23 
1 6DBU LEU A 388 ? UNP P0AEX9 ? ? linker                  260  24 
1 6DBU GLU A 389 ? UNP P0AEX9 ? ? linker                  261  25 
1 6DBU VAL A 390 ? UNP P0AEX9 ? ? linker                  262  26 
1 6DBU LEU A 391 ? UNP P0AEX9 ? ? linker                  263  27 
1 6DBU PHE A 392 ? UNP P0AEX9 ? ? linker                  264  28 
1 6DBU GLN A 393 ? UNP P0AEX9 ? ? linker                  265  29 
1 6DBU GLY A 394 ? UNP P0AEX9 ? ? linker                  266  30 
1 6DBU PRO A 395 ? UNP P0AEX9 ? ? linker                  267  31 
1 6DBU LEU A 396 ? UNP P0AEX9 ? ? linker                  268  32 
1 6DBU GLY A 397 ? UNP P0AEX9 ? ? linker                  269  33 
1 6DBU SER A 398 ? UNP P0AEX9 ? ? linker                  270  34 
3 6DBU GLY B 1   ? UNP Q1RLW7 ? ? 'expression tag'        -2   35 
3 6DBU GLY B 2   ? UNP Q1RLW7 ? ? 'expression tag'        -1   36 
3 6DBU SER B 3   ? UNP Q1RLW7 ? ? 'expression tag'        0    37 
4 6DBU MET C 1   ? UNP P0AEX9 ? ? 'initiating methionine' -127 38 
4 6DBU GLY C 2   ? UNP P0AEX9 ? ? 'expression tag'        -126 39 
4 6DBU SER C 3   ? UNP P0AEX9 ? ? 'expression tag'        -125 40 
4 6DBU SER C 4   ? UNP P0AEX9 ? ? 'expression tag'        -124 41 
4 6DBU HIS C 5   ? UNP P0AEX9 ? ? 'expression tag'        -123 42 
4 6DBU HIS C 6   ? UNP P0AEX9 ? ? 'expression tag'        -122 43 
4 6DBU HIS C 7   ? UNP P0AEX9 ? ? 'expression tag'        -121 44 
4 6DBU HIS C 8   ? UNP P0AEX9 ? ? 'expression tag'        -120 45 
4 6DBU HIS C 9   ? UNP P0AEX9 ? ? 'expression tag'        -119 46 
4 6DBU HIS C 10  ? UNP P0AEX9 ? ? 'expression tag'        -118 47 
4 6DBU GLY C 11  ? UNP P0AEX9 ? ? 'expression tag'        -117 48 
4 6DBU THR C 12  ? UNP P0AEX9 ? ? 'expression tag'        -116 49 
4 6DBU LYS C 13  ? UNP P0AEX9 ? ? 'expression tag'        -115 50 
4 6DBU THR C 14  ? UNP P0AEX9 ? ? 'expression tag'        -114 51 
4 6DBU GLY C 379 ? UNP P0AEX9 ? ? linker                  251  52 
4 6DBU THR C 380 ? UNP P0AEX9 ? ? linker                  252  53 
4 6DBU ASP C 381 ? UNP P0AEX9 ? ? linker                  253  54 
4 6DBU TYR C 382 ? UNP P0AEX9 ? ? linker                  254  55 
4 6DBU ASP C 383 ? UNP P0AEX9 ? ? linker                  255  56 
4 6DBU ILE C 384 ? UNP P0AEX9 ? ? linker                  256  57 
4 6DBU PRO C 385 ? UNP P0AEX9 ? ? linker                  257  58 
4 6DBU THR C 386 ? UNP P0AEX9 ? ? linker                  258  59 
4 6DBU THR C 387 ? UNP P0AEX9 ? ? linker                  259  60 
4 6DBU LEU C 388 ? UNP P0AEX9 ? ? linker                  260  61 
4 6DBU GLU C 389 ? UNP P0AEX9 ? ? linker                  261  62 
4 6DBU VAL C 390 ? UNP P0AEX9 ? ? linker                  262  63 
4 6DBU LEU C 391 ? UNP P0AEX9 ? ? linker                  263  64 
4 6DBU PHE C 392 ? UNP P0AEX9 ? ? linker                  264  65 
4 6DBU GLN C 393 ? UNP P0AEX9 ? ? linker                  265  66 
4 6DBU GLY C 394 ? UNP P0AEX9 ? ? linker                  266  67 
4 6DBU PRO C 395 ? UNP P0AEX9 ? ? linker                  267  68 
4 6DBU LEU C 396 ? UNP P0AEX9 ? ? linker                  268  69 
4 6DBU GLY C 397 ? UNP P0AEX9 ? ? linker                  269  70 
4 6DBU SER C 398 ? UNP P0AEX9 ? ? linker                  270  71 
6 6DBU GLY D 1   ? UNP Q1RLW7 ? ? 'expression tag'        -2   72 
6 6DBU GLY D 2   ? UNP Q1RLW7 ? ? 'expression tag'        -1   73 
6 6DBU SER D 3   ? UNP Q1RLW7 ? ? 'expression tag'        0    74 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                              ? 'C3 H7 N O2'      89.093  
ARG 'L-peptide linking' y ARGININE                             ? 'C6 H15 N4 O2 1'  175.209 
ASN 'L-peptide linking' y ASPARAGINE                           ? 'C4 H8 N2 O3'     132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                      ? 'C4 H7 N O4'      133.103 
CA  non-polymer         . 'CALCIUM ION'                        ? 'Ca 2'            40.078  
CYS 'L-peptide linking' y CYSTEINE                             ? 'C3 H7 N O2 S'    121.158 
DA  'DNA linking'       y "2'-DEOXYADENOSINE-5'-MONOPHOSPHATE" ? 'C10 H14 N5 O6 P' 331.222 
DC  'DNA linking'       y "2'-DEOXYCYTIDINE-5'-MONOPHOSPHATE"  ? 'C9 H14 N3 O7 P'  307.197 
DG  'DNA linking'       y "2'-DEOXYGUANOSINE-5'-MONOPHOSPHATE" ? 'C10 H14 N5 O7 P' 347.221 
DT  'DNA linking'       y "THYMIDINE-5'-MONOPHOSPHATE"         ? 'C10 H15 N2 O8 P' 322.208 
GLN 'L-peptide linking' y GLUTAMINE                            ? 'C5 H10 N2 O3'    146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                      ? 'C5 H9 N O4'      147.129 
GLY 'peptide linking'   y GLYCINE                              ? 'C2 H5 N O2'      75.067  
HIS 'L-peptide linking' y HISTIDINE                            ? 'C6 H10 N3 O2 1'  156.162 
ILE 'L-peptide linking' y ISOLEUCINE                           ? 'C6 H13 N O2'     131.173 
LEU 'L-peptide linking' y LEUCINE                              ? 'C6 H13 N O2'     131.173 
LYS 'L-peptide linking' y LYSINE                               ? 'C6 H15 N2 O2 1'  147.195 
MET 'L-peptide linking' y METHIONINE                           ? 'C5 H11 N O2 S'   149.211 
PHE 'L-peptide linking' y PHENYLALANINE                        ? 'C9 H11 N O2'     165.189 
PRO 'L-peptide linking' y PROLINE                              ? 'C5 H9 N O2'      115.130 
SER 'L-peptide linking' y SERINE                               ? 'C3 H7 N O3'      105.093 
THR 'L-peptide linking' y THREONINE                            ? 'C4 H9 N O3'      119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                           ? 'C11 H12 N2 O2'   204.225 
TYR 'L-peptide linking' y TYROSINE                             ? 'C9 H11 N O3'     181.189 
VAL 'L-peptide linking' y VALINE                               ? 'C5 H11 N O2'     117.146 
ZN  non-polymer         . 'ZINC ION'                           ? 'Zn 2'            65.409  
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.entry_id                   6DBU 
_exptl.crystals_number            ? 
_exptl.details                    ? 
_exptl.method                     'ELECTRON MICROSCOPY' 
_exptl.method_details             ? 
# 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.entry_id                                 6DBU 
_refine.pdbx_diffrn_id                           ? 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.ls_number_reflns_obs                     705179 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          0.06 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             271.360 
_refine.ls_d_res_high                            3.900 
_refine.ls_percent_reflns_obs                    99.92 
_refine.ls_R_factor_obs                          0.4515 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.4515 
_refine.ls_R_factor_R_free                       0.4514 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 0.28 
_refine.ls_number_reflns_R_free                  1992 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.B_iso_mean                               ? 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.solvent_model_details                    'FLAT BULK SOLVENT MODEL' 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             1.11 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             0.90 
_refine.pdbx_ls_cross_valid_method               ? 
_refine.details                                  ? 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_method_to_determine_struct          ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       MLHL 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            1.44 
_refine.pdbx_overall_phase_error                 61.94 
_refine.overall_SU_B                             ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
f_bond_d           0.007  ? ? 17658 'X-RAY DIFFRACTION' ? 
f_angle_d          1.197  ? ? 24448 'X-RAY DIFFRACTION' ? 
f_dihedral_angle_d 17.976 ? ? 10150 'X-RAY DIFFRACTION' ? 
f_chiral_restr     0.049  ? ? 2672  'X-RAY DIFFRACTION' ? 
f_plane_restr      0.011  ? ? 2682  'X-RAY DIFFRACTION' ? 
# 
_struct.entry_id                     6DBU 
_struct.title                        'Cryo-EM structure of RAG in complex with 12-RSS and 23-RSS substrate DNAs' 
_struct.pdbx_descriptor              
'Maltose-binding periplasmic protein,V(D)J recombination-activating protein 1, Recombination activating gene 2/DNA Complex' 
_struct.pdbx_model_details           ? 
_struct.pdbx_formula_weight          ? 
_struct.pdbx_formula_weight_method   ? 
_struct.pdbx_model_type_details      ? 
_struct.pdbx_CASP_flag               N 
# 
_struct_keywords.entry_id        6DBU 
_struct_keywords.text            
'V(D)J recombination, RAG complex, unmelted DNA substrates, Pre-cleavage complex, Recombination-DNA complex' 
_struct_keywords.pdbx_keywords   Recombination/DNA 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 1 ? 
D N N 2 ? 
E N N 3 ? 
F N N 4 ? 
G N N 3 ? 
H N N 4 ? 
I N N 5 ? 
J N N 6 ? 
K N N 6 ? 
L N N 5 ? 
M N N 6 ? 
N N N 6 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  AA1 HIS A 610  ? ASN A 620  ? HIS A 482  ASN A 492  1 ? 11 
HELX_P HELX_P2  AA2 CYS A 625  ? SER A 639  ? CYS A 497  SER A 511  1 ? 15 
HELX_P HELX_P3  AA3 PRO A 646  ? LYS A 655  ? PRO A 518  LYS A 527  1 ? 10 
HELX_P HELX_P4  AA4 ARG A 705  ? ARG A 728  ? ARG A 577  ARG A 600  1 ? 24 
HELX_P HELX_P5  AA5 SER A 798  ? CYS A 802  ? SER A 670  CYS A 674  5 ? 5  
HELX_P HELX_P6  AA6 ASP A 814  ? MET A 833  ? ASP A 686  MET A 705  1 ? 20 
HELX_P HELX_P7  AA7 ASP A 858  ? GLY A 867  ? ASP A 730  GLY A 739  1 ? 10 
HELX_P HELX_P8  AA8 THR A 883  ? ASN A 890  ? THR A 755  ASN A 762  1 ? 8  
HELX_P HELX_P9  AA9 SER A 899  ? ASN A 913  ? SER A 771  ASN A 785  1 ? 15 
HELX_P HELX_P10 AB1 SER A 918  ? VAL A 926  ? SER A 790  VAL A 798  1 ? 9  
HELX_P HELX_P11 AB2 ASP A 947  ? GLY A 963  ? ASP A 819  GLY A 835  1 ? 17 
HELX_P HELX_P12 AB3 GLU A 974  ? MET A 991  ? GLU A 846  MET A 863  1 ? 18 
HELX_P HELX_P13 AB4 ASN A 1000 ? MET A 1008 ? ASN A 872  MET A 880  1 ? 9  
HELX_P HELX_P14 AB5 THR A 1009 ? GLU A 1018 ? THR A 881  GLU A 890  1 ? 10 
HELX_P HELX_P15 AB6 GLU A 1023 ? SER A 1045 ? GLU A 895  SER A 917  1 ? 23 
HELX_P HELX_P16 AB7 CYS A 1052 ? MET A 1073 ? CYS A 924  MET A 945  1 ? 22 
HELX_P HELX_P17 AB8 THR A 1083 ? HIS A 1092 ? THR A 955  HIS A 964  1 ? 10 
HELX_P HELX_P18 AB9 HIS A 1092 ? GLY A 1101 ? HIS A 964  GLY A 973  1 ? 10 
HELX_P HELX_P19 AC1 ILE A 1103 ? ALA A 1107 ? ILE A 975  ALA A 979  5 ? 5  
HELX_P HELX_P20 AC2 SER A 1108 ? ASN A 1125 ? SER A 980  ASN A 997  1 ? 18 
HELX_P HELX_P21 AC3 SER A 1129 ? THR A 1145 ? SER A 1001 THR A 1017 1 ? 17 
HELX_P HELX_P22 AC4 LYS A 1147 ? PHE A 1152 ? LYS A 1019 PHE A 1024 1 ? 6  
HELX_P HELX_P23 AC5 THR B 311  ? HIS B 316  ? THR B 308  HIS B 313  1 ? 6  
HELX_P HELX_P24 AC6 HIS C 610  ? ASN C 620  ? HIS C 482  ASN C 492  1 ? 11 
HELX_P HELX_P25 AC7 CYS C 625  ? SER C 639  ? CYS C 497  SER C 511  1 ? 15 
HELX_P HELX_P26 AC8 PRO C 646  ? LYS C 655  ? PRO C 518  LYS C 527  1 ? 10 
HELX_P HELX_P27 AC9 ARG C 705  ? ARG C 728  ? ARG C 577  ARG C 600  1 ? 24 
HELX_P HELX_P28 AD1 SER C 798  ? CYS C 802  ? SER C 670  CYS C 674  5 ? 5  
HELX_P HELX_P29 AD2 ASP C 814  ? MET C 833  ? ASP C 686  MET C 705  1 ? 20 
HELX_P HELX_P30 AD3 ASP C 858  ? GLY C 867  ? ASP C 730  GLY C 739  1 ? 10 
HELX_P HELX_P31 AD4 THR C 883  ? ASN C 890  ? THR C 755  ASN C 762  1 ? 8  
HELX_P HELX_P32 AD5 SER C 899  ? ASN C 913  ? SER C 771  ASN C 785  1 ? 15 
HELX_P HELX_P33 AD6 SER C 918  ? VAL C 926  ? SER C 790  VAL C 798  1 ? 9  
HELX_P HELX_P34 AD7 ASP C 947  ? GLY C 963  ? ASP C 819  GLY C 835  1 ? 17 
HELX_P HELX_P35 AD8 GLU C 974  ? MET C 991  ? GLU C 846  MET C 863  1 ? 18 
HELX_P HELX_P36 AD9 ASN C 1000 ? MET C 1008 ? ASN C 872  MET C 880  1 ? 9  
HELX_P HELX_P37 AE1 THR C 1009 ? GLU C 1018 ? THR C 881  GLU C 890  1 ? 10 
HELX_P HELX_P38 AE2 GLU C 1023 ? SER C 1045 ? GLU C 895  SER C 917  1 ? 23 
HELX_P HELX_P39 AE3 CYS C 1052 ? MET C 1073 ? CYS C 924  MET C 945  1 ? 22 
HELX_P HELX_P40 AE4 THR C 1083 ? HIS C 1092 ? THR C 955  HIS C 964  1 ? 10 
HELX_P HELX_P41 AE5 HIS C 1092 ? GLY C 1101 ? HIS C 964  GLY C 973  1 ? 10 
HELX_P HELX_P42 AE6 ILE C 1103 ? ALA C 1107 ? ILE C 975  ALA C 979  5 ? 5  
HELX_P HELX_P43 AE7 SER C 1108 ? ASN C 1125 ? SER C 980  ASN C 997  1 ? 18 
HELX_P HELX_P44 AE8 SER C 1129 ? THR C 1145 ? SER C 1001 THR C 1017 1 ? 17 
HELX_P HELX_P45 AE9 LYS C 1147 ? PHE C 1152 ? LYS C 1019 PHE C 1024 1 ? 6  
HELX_P HELX_P46 AF1 THR D 311  ? HIS D 316  ? THR D 308  HIS D 313  1 ? 6  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
metalc1   metalc ? ? A ASP 748  OD1 ? ? ? 1_555 K CA .  CA ? ? A ASP 620 A CA 1103 1_555 ? ? ? ? ? ? ?                       3.135 
? 
metalc2   metalc ? ? A ASP 748  OD2 ? ? ? 1_555 J CA .  CA ? ? A ASP 620 A CA 1102 1_555 ? ? ? ? ? ? ?                       2.627 
? 
metalc3   metalc ? ? A GLU 812  OE2 ? ? ? 1_555 K CA .  CA ? ? A GLU 684 A CA 1103 1_555 ? ? ? ? ? ? ?                       2.855 
? 
metalc4   metalc ? ? A ASP 858  OD2 ? ? ? 1_555 K CA .  CA ? ? A ASP 730 A CA 1103 1_555 ? ? ? ? ? ? ?                       2.164 
? 
metalc5   metalc ? ? A CYS 877  SG  ? ? ? 1_555 I ZN .  ZN ? ? A CYS 749 A ZN 1101 1_555 ? ? ? ? ? ? ?                       2.281 
? 
metalc6   metalc ? ? A HIS 1087 NE2 ? ? ? 1_555 I ZN .  ZN ? ? A HIS 959 A ZN 1101 1_555 ? ? ? ? ? ? ?                       2.008 
? 
metalc7   metalc ? ? A HIS 1092 NE2 ? ? ? 1_555 I ZN .  ZN ? ? A HIS 964 A ZN 1101 1_555 ? ? ? ? ? ? ?                       2.130 
? 
metalc8   metalc ? ? A GLU 1112 OE2 ? ? ? 1_555 J CA .  CA ? ? A GLU 984 A CA 1102 1_555 ? ? ? ? ? ? ?                       2.932 
? 
metalc9   metalc ? ? C ASP 748  OD2 ? ? ? 1_555 M CA .  CA ? ? C ASP 620 C CA 1102 1_555 ? ? ? ? ? ? ?                       2.602 
? 
metalc10  metalc ? ? C ASP 858  OD2 ? ? ? 1_555 N CA .  CA ? ? C ASP 730 C CA 1103 1_555 ? ? ? ? ? ? ?                       2.304 
? 
metalc11  metalc ? ? C CYS 877  SG  ? ? ? 1_555 L ZN .  ZN ? ? C CYS 749 C ZN 1101 1_555 ? ? ? ? ? ? ?                       2.280 
? 
metalc12  metalc ? ? C HIS 1087 NE2 ? ? ? 1_555 L ZN .  ZN ? ? C HIS 959 C ZN 1101 1_555 ? ? ? ? ? ? ?                       2.003 
? 
metalc13  metalc ? ? C HIS 1092 NE2 ? ? ? 1_555 L ZN .  ZN ? ? C HIS 964 C ZN 1101 1_555 ? ? ? ? ? ? ?                       1.991 
? 
hydrog1   hydrog ? ? E DG  1    N1  ? ? ? 1_555 F DC 34 N3 ? ? E DG  1   F DC 34   1_555 ? ? ? ? ? ? WATSON-CRICK            ?     
? 
hydrog2   hydrog ? ? E DG  1    N2  ? ? ? 1_555 F DC 34 O2 ? ? E DG  1   F DC 34   1_555 ? ? ? ? ? ? WATSON-CRICK            ?     
? 
hydrog3   hydrog ? ? E DG  1    O6  ? ? ? 1_555 F DC 34 N4 ? ? E DG  1   F DC 34   1_555 ? ? ? ? ? ? WATSON-CRICK            ?     
? 
hydrog4   hydrog ? ? E DA  2    N1  ? ? ? 1_555 F DT 33 N3 ? ? E DA  2   F DT 33   1_555 ? ? ? ? ? ? WATSON-CRICK            ?     
? 
hydrog5   hydrog ? ? E DA  2    N6  ? ? ? 1_555 F DT 33 O4 ? ? E DA  2   F DT 33   1_555 ? ? ? ? ? ? WATSON-CRICK            ?     
? 
hydrog6   hydrog ? ? E DT  3    N3  ? ? ? 1_555 F DA 32 N1 ? ? E DT  3   F DA 32   1_555 ? ? ? ? ? ? WATSON-CRICK            ?     
? 
hydrog7   hydrog ? ? E DT  3    O4  ? ? ? 1_555 F DA 32 N6 ? ? E DT  3   F DA 32   1_555 ? ? ? ? ? ? WATSON-CRICK            ?     
? 
hydrog8   hydrog ? ? E DC  4    N3  ? ? ? 1_555 F DG 31 N1 ? ? E DC  4   F DG 31   1_555 ? ? ? ? ? ? WATSON-CRICK            ?     
? 
hydrog9   hydrog ? ? E DC  4    N4  ? ? ? 1_555 F DG 31 O6 ? ? E DC  4   F DG 31   1_555 ? ? ? ? ? ? WATSON-CRICK            ?     
? 
hydrog10  hydrog ? ? E DC  4    O2  ? ? ? 1_555 F DG 31 N2 ? ? E DC  4   F DG 31   1_555 ? ? ? ? ? ? WATSON-CRICK            ?     
? 
hydrog11  hydrog ? ? E DT  5    N3  ? ? ? 1_555 F DA 30 N1 ? ? E DT  5   F DA 30   1_555 ? ? ? ? ? ? WATSON-CRICK            ?     
? 
hydrog12  hydrog ? ? E DT  5    O4  ? ? ? 1_555 F DA 30 N6 ? ? E DT  5   F DA 30   1_555 ? ? ? ? ? ? WATSON-CRICK            ?     
? 
hydrog13  hydrog ? ? E DG  6    N1  ? ? ? 1_555 F DC 29 N3 ? ? E DG  6   F DC 29   1_555 ? ? ? ? ? ? WATSON-CRICK            ?     
? 
hydrog14  hydrog ? ? E DG  6    N2  ? ? ? 1_555 F DC 29 O2 ? ? E DG  6   F DC 29   1_555 ? ? ? ? ? ? WATSON-CRICK            ?     
? 
hydrog15  hydrog ? ? E DG  6    O6  ? ? ? 1_555 F DC 29 N4 ? ? E DG  6   F DC 29   1_555 ? ? ? ? ? ? WATSON-CRICK            ?     
? 
hydrog16  hydrog ? ? E DG  7    N1  ? ? ? 1_555 F DC 28 N3 ? ? E DG  7   F DC 28   1_555 ? ? ? ? ? ? WATSON-CRICK            ?     
? 
hydrog17  hydrog ? ? E DG  7    N2  ? ? ? 1_555 F DC 28 O2 ? ? E DG  7   F DC 28   1_555 ? ? ? ? ? ? WATSON-CRICK            ?     
? 
hydrog18  hydrog ? ? E DG  7    O6  ? ? ? 1_555 F DC 28 N4 ? ? E DG  7   F DC 28   1_555 ? ? ? ? ? ? WATSON-CRICK            ?     
? 
hydrog19  hydrog ? ? E DC  8    N3  ? ? ? 1_555 F DG 27 N1 ? ? E DC  8   F DG 27   1_555 ? ? ? ? ? ? WATSON-CRICK            ?     
? 
hydrog20  hydrog ? ? E DC  8    N4  ? ? ? 1_555 F DG 27 O6 ? ? E DC  8   F DG 27   1_555 ? ? ? ? ? ? WATSON-CRICK            ?     
? 
hydrog21  hydrog ? ? E DC  8    O2  ? ? ? 1_555 F DG 27 N2 ? ? E DC  8   F DG 27   1_555 ? ? ? ? ? ? WATSON-CRICK            ?     
? 
hydrog22  hydrog ? ? E DC  9    N3  ? ? ? 1_555 F DG 26 N1 ? ? E DC  9   F DG 26   1_555 ? ? ? ? ? ? WATSON-CRICK            ?     
? 
hydrog23  hydrog ? ? E DC  9    N4  ? ? ? 1_555 F DG 26 O6 ? ? E DC  9   F DG 26   1_555 ? ? ? ? ? ? WATSON-CRICK            ?     
? 
hydrog24  hydrog ? ? E DC  9    O2  ? ? ? 1_555 F DG 26 N2 ? ? E DC  9   F DG 26   1_555 ? ? ? ? ? ? WATSON-CRICK            ?     
? 
hydrog25  hydrog ? ? E DT  10   N3  ? ? ? 1_555 F DA 25 N1 ? ? E DT  10  F DA 25   1_555 ? ? ? ? ? ? WATSON-CRICK            ?     
? 
hydrog26  hydrog ? ? E DT  10   O4  ? ? ? 1_555 F DA 25 N6 ? ? E DT  10  F DA 25   1_555 ? ? ? ? ? ? WATSON-CRICK            ?     
? 
hydrog27  hydrog ? ? E DG  11   N1  ? ? ? 1_555 F DC 24 N3 ? ? E DG  11  F DC 24   1_555 ? ? ? ? ? ? WATSON-CRICK            ?     
? 
hydrog28  hydrog ? ? E DG  11   N2  ? ? ? 1_555 F DC 24 O2 ? ? E DG  11  F DC 24   1_555 ? ? ? ? ? ? WATSON-CRICK            ?     
? 
hydrog29  hydrog ? ? E DG  11   O6  ? ? ? 1_555 F DC 24 N4 ? ? E DG  11  F DC 24   1_555 ? ? ? ? ? ? WATSON-CRICK            ?     
? 
hydrog30  hydrog ? ? E DT  12   N3  ? ? ? 1_555 F DA 23 N1 ? ? E DT  12  F DA 23   1_555 ? ? ? ? ? ? WATSON-CRICK            ?     
? 
hydrog31  hydrog ? ? E DT  12   O4  ? ? ? 1_555 F DA 23 N6 ? ? E DT  12  F DA 23   1_555 ? ? ? ? ? ? WATSON-CRICK            ?     
? 
hydrog32  hydrog ? ? E DC  13   N3  ? ? ? 1_555 F DG 22 N1 ? ? E DC  13  F DG 22   1_555 ? ? ? ? ? ? WATSON-CRICK            ?     
? 
hydrog33  hydrog ? ? E DC  13   N4  ? ? ? 1_555 F DG 22 O6 ? ? E DC  13  F DG 22   1_555 ? ? ? ? ? ? WATSON-CRICK            ?     
? 
hydrog34  hydrog ? ? E DC  13   O2  ? ? ? 1_555 F DG 22 N2 ? ? E DC  13  F DG 22   1_555 ? ? ? ? ? ? WATSON-CRICK            ?     
? 
hydrog35  hydrog ? ? E DT  14   N3  ? ? ? 1_555 F DA 21 N1 ? ? E DT  14  F DA 21   1_555 ? ? ? ? ? ? WATSON-CRICK            ?     
? 
hydrog36  hydrog ? ? E DT  14   O4  ? ? ? 1_555 F DA 21 N6 ? ? E DT  14  F DA 21   1_555 ? ? ? ? ? ? WATSON-CRICK            ?     
? 
hydrog37  hydrog ? ? E DT  15   N3  ? ? ? 1_555 F DA 20 N1 ? ? E DT  15  F DA 20   1_555 ? ? ? ? ? ? WATSON-CRICK            ?     
? 
hydrog38  hydrog ? ? E DT  15   O4  ? ? ? 1_555 F DA 20 N6 ? ? E DT  15  F DA 20   1_555 ? ? ? ? ? ? WATSON-CRICK            ?     
? 
hydrog39  hydrog ? ? E DA  16   N1  ? ? ? 1_555 F DT 19 N3 ? ? E DA  16  F DT 19   1_555 ? ? ? ? ? ? WATSON-CRICK            ?     
? 
hydrog40  hydrog ? ? E DA  16   N6  ? ? ? 1_555 F DT 19 O4 ? ? E DA  16  F DT 19   1_555 ? ? ? ? ? ? WATSON-CRICK            ?     
? 
hydrog41  hydrog ? ? E DC  17   N3  ? ? ? 1_555 F DG 18 N1 ? ? E DC  17  F DG 18   1_555 ? ? ? ? ? ? WATSON-CRICK            ?     
? 
hydrog42  hydrog ? ? E DC  17   N4  ? ? ? 1_555 F DG 18 O6 ? ? E DC  17  F DG 18   1_555 ? ? ? ? ? ? WATSON-CRICK            ?     
? 
hydrog43  hydrog ? ? E DC  17   O2  ? ? ? 1_555 F DG 18 N2 ? ? E DC  17  F DG 18   1_555 ? ? ? ? ? ? WATSON-CRICK            ?     
? 
hydrog44  hydrog ? ? E DA  18   N1  ? ? ? 1_555 F DT 17 N3 ? ? E DA  18  F DT 17   1_555 ? ? ? ? ? ? WATSON-CRICK            ?     
? 
hydrog45  hydrog ? ? E DA  18   N6  ? ? ? 1_555 F DT 17 O4 ? ? E DA  18  F DT 17   1_555 ? ? ? ? ? ? WATSON-CRICK            ?     
? 
hydrog46  hydrog ? ? E DA  18   N1  ? ? ? 1_555 F DG 18 N1 ? ? E DA  18  F DG 18   1_555 ? ? ? ? ? ? TYPE_8_PAIR             ?     
? 
hydrog47  hydrog ? ? E DA  18   N6  ? ? ? 1_555 F DG 18 O6 ? ? E DA  18  F DG 18   1_555 ? ? ? ? ? ? TYPE_8_PAIR             ?     
? 
hydrog48  hydrog ? ? E DC  19   N3  ? ? ? 1_555 F DG 16 N1 ? ? E DC  19  F DG 16   1_555 ? ? ? ? ? ? WATSON-CRICK            ?     
? 
hydrog49  hydrog ? ? E DC  19   N4  ? ? ? 1_555 F DG 16 O6 ? ? E DC  19  F DG 16   1_555 ? ? ? ? ? ? WATSON-CRICK            ?     
? 
hydrog50  hydrog ? ? E DC  19   O2  ? ? ? 1_555 F DG 16 N2 ? ? E DC  19  F DG 16   1_555 ? ? ? ? ? ? WATSON-CRICK            ?     
? 
hydrog51  hydrog ? ? E DA  20   N6  ? ? ? 1_555 F DC 14 N3 ? ? E DA  20  F DC 14   1_555 ? ? ? ? ? ? 'DA-DC MISPAIR'         ?     
? 
hydrog52  hydrog ? ? E DG  21   N1  ? ? ? 1_555 F DA 13 N1 ? ? E DG  21  F DA 13   1_555 ? ? ? ? ? ? TYPE_8_PAIR             ?     
? 
hydrog53  hydrog ? ? E DG  21   O6  ? ? ? 1_555 F DA 13 N6 ? ? E DG  21  F DA 13   1_555 ? ? ? ? ? ? TYPE_8_PAIR             ?     
? 
hydrog54  hydrog ? ? E DG  21   N1  ? ? ? 1_555 F DC 14 N3 ? ? E DG  21  F DC 14   1_555 ? ? ? ? ? ? WATSON-CRICK            ?     
? 
hydrog55  hydrog ? ? E DG  21   N2  ? ? ? 1_555 F DC 14 O2 ? ? E DG  21  F DC 14   1_555 ? ? ? ? ? ? WATSON-CRICK            ?     
? 
hydrog56  hydrog ? ? E DG  21   O6  ? ? ? 1_555 F DC 14 N4 ? ? E DG  21  F DC 14   1_555 ? ? ? ? ? ? WATSON-CRICK            ?     
? 
hydrog57  hydrog ? ? E DT  22   N3  ? ? ? 1_555 F DA 13 N1 ? ? E DT  22  F DA 13   1_555 ? ? ? ? ? ? WATSON-CRICK            ?     
? 
hydrog58  hydrog ? ? E DT  22   O4  ? ? ? 1_555 F DA 13 N6 ? ? E DT  22  F DA 13   1_555 ? ? ? ? ? ? WATSON-CRICK            ?     
? 
hydrog59  hydrog ? ? E DG  23   N1  ? ? ? 1_555 F DC 12 N3 ? ? E DG  23  F DC 12   1_555 ? ? ? ? ? ? WATSON-CRICK            ?     
? 
hydrog60  hydrog ? ? E DG  23   N2  ? ? ? 1_555 F DC 12 O2 ? ? E DG  23  F DC 12   1_555 ? ? ? ? ? ? WATSON-CRICK            ?     
? 
hydrog61  hydrog ? ? E DG  23   O6  ? ? ? 1_555 F DC 12 N4 ? ? E DG  23  F DC 12   1_555 ? ? ? ? ? ? WATSON-CRICK            ?     
? 
hydrog62  hydrog ? ? E DC  24   N3  ? ? ? 1_555 F DG 11 N1 ? ? E DC  24  F DG 11   1_555 ? ? ? ? ? ? WATSON-CRICK            ?     
? 
hydrog63  hydrog ? ? E DC  24   N4  ? ? ? 1_555 F DG 11 O6 ? ? E DC  24  F DG 11   1_555 ? ? ? ? ? ? WATSON-CRICK            ?     
? 
hydrog64  hydrog ? ? E DC  24   O2  ? ? ? 1_555 F DG 11 N2 ? ? E DC  24  F DG 11   1_555 ? ? ? ? ? ? WATSON-CRICK            ?     
? 
hydrog65  hydrog ? ? E DT  25   N3  ? ? ? 1_555 F DA 10 N1 ? ? E DT  25  F DA 10   1_555 ? ? ? ? ? ? WATSON-CRICK            ?     
? 
hydrog66  hydrog ? ? E DT  25   O4  ? ? ? 1_555 F DA 10 N6 ? ? E DT  25  F DA 10   1_555 ? ? ? ? ? ? WATSON-CRICK            ?     
? 
hydrog67  hydrog ? ? E DA  26   N1  ? ? ? 1_555 F DT 9  N3 ? ? E DA  26  F DT 9    1_555 ? ? ? ? ? ? WATSON-CRICK            ?     
? 
hydrog68  hydrog ? ? E DA  26   N6  ? ? ? 1_555 F DT 9  O4 ? ? E DA  26  F DT 9    1_555 ? ? ? ? ? ? WATSON-CRICK            ?     
? 
hydrog69  hydrog ? ? E DC  27   N3  ? ? ? 1_555 F DG 8  N1 ? ? E DC  27  F DG 8    1_555 ? ? ? ? ? ? WATSON-CRICK            ?     
? 
hydrog70  hydrog ? ? E DC  27   N4  ? ? ? 1_555 F DG 8  O6 ? ? E DC  27  F DG 8    1_555 ? ? ? ? ? ? WATSON-CRICK            ?     
? 
hydrog71  hydrog ? ? E DC  27   O2  ? ? ? 1_555 F DG 8  N2 ? ? E DC  27  F DG 8    1_555 ? ? ? ? ? ? WATSON-CRICK            ?     
? 
hydrog72  hydrog ? ? E DA  28   N1  ? ? ? 1_555 F DT 7  N3 ? ? E DA  28  F DT 7    1_555 ? ? ? ? ? ? WATSON-CRICK            ?     
? 
hydrog73  hydrog ? ? E DA  28   N6  ? ? ? 1_555 F DT 7  O4 ? ? E DA  28  F DT 7    1_555 ? ? ? ? ? ? WATSON-CRICK            ?     
? 
hydrog74  hydrog ? ? E DG  29   N1  ? ? ? 1_555 F DC 6  N3 ? ? E DG  29  F DC 6    1_555 ? ? ? ? ? ? WATSON-CRICK            ?     
? 
hydrog75  hydrog ? ? E DG  29   N2  ? ? ? 1_555 F DC 6  O2 ? ? E DG  29  F DC 6    1_555 ? ? ? ? ? ? WATSON-CRICK            ?     
? 
hydrog76  hydrog ? ? E DG  29   O6  ? ? ? 1_555 F DC 6  N4 ? ? E DG  29  F DC 6    1_555 ? ? ? ? ? ? WATSON-CRICK            ?     
? 
hydrog77  hydrog ? ? E DA  30   N1  ? ? ? 1_555 F DT 5  N3 ? ? E DA  30  F DT 5    1_555 ? ? ? ? ? ? WATSON-CRICK            ?     
? 
hydrog78  hydrog ? ? E DA  30   N6  ? ? ? 1_555 F DT 5  O4 ? ? E DA  30  F DT 5    1_555 ? ? ? ? ? ? WATSON-CRICK            ?     
? 
hydrog79  hydrog ? ? E DC  31   N3  ? ? ? 1_555 F DG 4  N1 ? ? E DC  31  F DG 4    1_555 ? ? ? ? ? ? WATSON-CRICK            ?     
? 
hydrog80  hydrog ? ? E DC  31   N4  ? ? ? 1_555 F DG 4  O6 ? ? E DC  31  F DG 4    1_555 ? ? ? ? ? ? WATSON-CRICK            ?     
? 
hydrog81  hydrog ? ? E DC  31   O2  ? ? ? 1_555 F DG 4  N2 ? ? E DC  31  F DG 4    1_555 ? ? ? ? ? ? WATSON-CRICK            ?     
? 
hydrog82  hydrog ? ? E DT  32   N3  ? ? ? 1_555 F DA 3  N1 ? ? E DT  32  F DA 3    1_555 ? ? ? ? ? ? WATSON-CRICK            ?     
? 
hydrog83  hydrog ? ? E DT  32   O4  ? ? ? 1_555 F DA 3  N6 ? ? E DT  32  F DA 3    1_555 ? ? ? ? ? ? WATSON-CRICK            ?     
? 
hydrog84  hydrog ? ? E DG  33   N1  ? ? ? 1_555 F DC 2  N3 ? ? E DG  33  F DC 2    1_555 ? ? ? ? ? ? WATSON-CRICK            ?     
? 
hydrog85  hydrog ? ? E DG  33   N2  ? ? ? 1_555 F DC 2  O2 ? ? E DG  33  F DC 2    1_555 ? ? ? ? ? ? WATSON-CRICK            ?     
? 
hydrog86  hydrog ? ? E DG  33   O6  ? ? ? 1_555 F DC 2  N4 ? ? E DG  33  F DC 2    1_555 ? ? ? ? ? ? WATSON-CRICK            ?     
? 
hydrog87  hydrog ? ? E DG  34   N1  ? ? ? 1_555 F DC 1  N3 ? ? E DG  34  F DC 1    1_555 ? ? ? ? ? ? WATSON-CRICK            ?     
? 
hydrog88  hydrog ? ? E DG  34   N2  ? ? ? 1_555 F DC 1  O2 ? ? E DG  34  F DC 1    1_555 ? ? ? ? ? ? WATSON-CRICK            ?     
? 
hydrog89  hydrog ? ? E DG  34   O6  ? ? ? 1_555 F DC 1  N4 ? ? E DG  34  F DC 1    1_555 ? ? ? ? ? ? WATSON-CRICK            ?     
? 
hydrog90  hydrog ? ? E DG  34   N1  ? ? ? 1_555 F DC 2  O2 ? ? E DG  34  F DC 2    1_555 ? ? ? ? ? ? 'REVERSED WATSON-CRICK' ?     
? 
hydrog91  hydrog ? ? E DG  34   N2  ? ? ? 1_555 F DC 2  N3 ? ? E DG  34  F DC 2    1_555 ? ? ? ? ? ? 'REVERSED WATSON-CRICK' ?     
? 
hydrog92  hydrog ? ? G DG  1    N1  ? ? ? 1_555 H DC 34 N3 ? ? G DG  1   H DC 34   1_555 ? ? ? ? ? ? WATSON-CRICK            ?     
? 
hydrog93  hydrog ? ? G DG  1    N2  ? ? ? 1_555 H DC 34 O2 ? ? G DG  1   H DC 34   1_555 ? ? ? ? ? ? WATSON-CRICK            ?     
? 
hydrog94  hydrog ? ? G DG  1    O6  ? ? ? 1_555 H DC 34 N4 ? ? G DG  1   H DC 34   1_555 ? ? ? ? ? ? WATSON-CRICK            ?     
? 
hydrog95  hydrog ? ? G DA  2    N1  ? ? ? 1_555 H DT 33 N3 ? ? G DA  2   H DT 33   1_555 ? ? ? ? ? ? WATSON-CRICK            ?     
? 
hydrog96  hydrog ? ? G DA  2    N6  ? ? ? 1_555 H DT 33 O4 ? ? G DA  2   H DT 33   1_555 ? ? ? ? ? ? WATSON-CRICK            ?     
? 
hydrog97  hydrog ? ? G DT  3    N3  ? ? ? 1_555 H DA 32 N1 ? ? G DT  3   H DA 32   1_555 ? ? ? ? ? ? WATSON-CRICK            ?     
? 
hydrog98  hydrog ? ? G DT  3    O4  ? ? ? 1_555 H DA 32 N6 ? ? G DT  3   H DA 32   1_555 ? ? ? ? ? ? WATSON-CRICK            ?     
? 
hydrog99  hydrog ? ? G DC  4    N3  ? ? ? 1_555 H DG 31 N1 ? ? G DC  4   H DG 31   1_555 ? ? ? ? ? ? WATSON-CRICK            ?     
? 
hydrog100 hydrog ? ? G DC  4    N4  ? ? ? 1_555 H DG 31 O6 ? ? G DC  4   H DG 31   1_555 ? ? ? ? ? ? WATSON-CRICK            ?     
? 
hydrog101 hydrog ? ? G DC  4    O2  ? ? ? 1_555 H DG 31 N2 ? ? G DC  4   H DG 31   1_555 ? ? ? ? ? ? WATSON-CRICK            ?     
? 
hydrog102 hydrog ? ? G DT  5    N3  ? ? ? 1_555 H DA 30 N1 ? ? G DT  5   H DA 30   1_555 ? ? ? ? ? ? WATSON-CRICK            ?     
? 
hydrog103 hydrog ? ? G DT  5    O4  ? ? ? 1_555 H DA 30 N6 ? ? G DT  5   H DA 30   1_555 ? ? ? ? ? ? WATSON-CRICK            ?     
? 
hydrog104 hydrog ? ? G DG  6    N1  ? ? ? 1_555 H DC 29 N3 ? ? G DG  6   H DC 29   1_555 ? ? ? ? ? ? WATSON-CRICK            ?     
? 
hydrog105 hydrog ? ? G DG  6    N2  ? ? ? 1_555 H DC 29 O2 ? ? G DG  6   H DC 29   1_555 ? ? ? ? ? ? WATSON-CRICK            ?     
? 
hydrog106 hydrog ? ? G DG  6    O6  ? ? ? 1_555 H DC 29 N4 ? ? G DG  6   H DC 29   1_555 ? ? ? ? ? ? WATSON-CRICK            ?     
? 
hydrog107 hydrog ? ? G DG  7    N1  ? ? ? 1_555 H DC 28 N3 ? ? G DG  7   H DC 28   1_555 ? ? ? ? ? ? WATSON-CRICK            ?     
? 
hydrog108 hydrog ? ? G DG  7    N2  ? ? ? 1_555 H DC 28 O2 ? ? G DG  7   H DC 28   1_555 ? ? ? ? ? ? WATSON-CRICK            ?     
? 
hydrog109 hydrog ? ? G DG  7    O6  ? ? ? 1_555 H DC 28 N4 ? ? G DG  7   H DC 28   1_555 ? ? ? ? ? ? WATSON-CRICK            ?     
? 
hydrog110 hydrog ? ? G DC  8    N3  ? ? ? 1_555 H DG 27 N1 ? ? G DC  8   H DG 27   1_555 ? ? ? ? ? ? WATSON-CRICK            ?     
? 
hydrog111 hydrog ? ? G DC  8    N4  ? ? ? 1_555 H DG 27 O6 ? ? G DC  8   H DG 27   1_555 ? ? ? ? ? ? WATSON-CRICK            ?     
? 
hydrog112 hydrog ? ? G DC  8    O2  ? ? ? 1_555 H DG 27 N2 ? ? G DC  8   H DG 27   1_555 ? ? ? ? ? ? WATSON-CRICK            ?     
? 
hydrog113 hydrog ? ? G DC  9    N3  ? ? ? 1_555 H DG 26 N1 ? ? G DC  9   H DG 26   1_555 ? ? ? ? ? ? WATSON-CRICK            ?     
? 
hydrog114 hydrog ? ? G DC  9    N4  ? ? ? 1_555 H DG 26 O6 ? ? G DC  9   H DG 26   1_555 ? ? ? ? ? ? WATSON-CRICK            ?     
? 
hydrog115 hydrog ? ? G DC  9    O2  ? ? ? 1_555 H DG 26 N2 ? ? G DC  9   H DG 26   1_555 ? ? ? ? ? ? WATSON-CRICK            ?     
? 
hydrog116 hydrog ? ? G DT  10   N3  ? ? ? 1_555 H DA 25 N1 ? ? G DT  10  H DA 25   1_555 ? ? ? ? ? ? WATSON-CRICK            ?     
? 
hydrog117 hydrog ? ? G DT  10   O4  ? ? ? 1_555 H DA 25 N6 ? ? G DT  10  H DA 25   1_555 ? ? ? ? ? ? WATSON-CRICK            ?     
? 
hydrog118 hydrog ? ? G DG  11   N1  ? ? ? 1_555 H DC 24 N3 ? ? G DG  11  H DC 24   1_555 ? ? ? ? ? ? WATSON-CRICK            ?     
? 
hydrog119 hydrog ? ? G DG  11   N2  ? ? ? 1_555 H DC 24 O2 ? ? G DG  11  H DC 24   1_555 ? ? ? ? ? ? WATSON-CRICK            ?     
? 
hydrog120 hydrog ? ? G DG  11   O6  ? ? ? 1_555 H DC 24 N4 ? ? G DG  11  H DC 24   1_555 ? ? ? ? ? ? WATSON-CRICK            ?     
? 
hydrog121 hydrog ? ? G DT  12   N3  ? ? ? 1_555 H DA 23 N1 ? ? G DT  12  H DA 23   1_555 ? ? ? ? ? ? WATSON-CRICK            ?     
? 
hydrog122 hydrog ? ? G DT  12   O4  ? ? ? 1_555 H DA 23 N6 ? ? G DT  12  H DA 23   1_555 ? ? ? ? ? ? WATSON-CRICK            ?     
? 
hydrog123 hydrog ? ? G DC  13   N3  ? ? ? 1_555 H DG 22 N1 ? ? G DC  13  H DG 22   1_555 ? ? ? ? ? ? WATSON-CRICK            ?     
? 
hydrog124 hydrog ? ? G DC  13   N4  ? ? ? 1_555 H DG 22 O6 ? ? G DC  13  H DG 22   1_555 ? ? ? ? ? ? WATSON-CRICK            ?     
? 
hydrog125 hydrog ? ? G DC  13   O2  ? ? ? 1_555 H DG 22 N2 ? ? G DC  13  H DG 22   1_555 ? ? ? ? ? ? WATSON-CRICK            ?     
? 
hydrog126 hydrog ? ? G DT  14   N3  ? ? ? 1_555 H DA 21 N1 ? ? G DT  14  H DA 21   1_555 ? ? ? ? ? ? WATSON-CRICK            ?     
? 
hydrog127 hydrog ? ? G DT  14   O4  ? ? ? 1_555 H DA 21 N6 ? ? G DT  14  H DA 21   1_555 ? ? ? ? ? ? WATSON-CRICK            ?     
? 
hydrog128 hydrog ? ? G DT  15   N3  ? ? ? 1_555 H DA 20 N1 ? ? G DT  15  H DA 20   1_555 ? ? ? ? ? ? WATSON-CRICK            ?     
? 
hydrog129 hydrog ? ? G DT  15   O4  ? ? ? 1_555 H DA 20 N6 ? ? G DT  15  H DA 20   1_555 ? ? ? ? ? ? WATSON-CRICK            ?     
? 
hydrog130 hydrog ? ? G DA  16   N1  ? ? ? 1_555 H DT 19 N3 ? ? G DA  16  H DT 19   1_555 ? ? ? ? ? ? WATSON-CRICK            ?     
? 
hydrog131 hydrog ? ? G DA  16   N6  ? ? ? 1_555 H DT 19 O4 ? ? G DA  16  H DT 19   1_555 ? ? ? ? ? ? WATSON-CRICK            ?     
? 
hydrog132 hydrog ? ? G DC  17   N3  ? ? ? 1_555 H DG 18 N1 ? ? G DC  17  H DG 18   1_555 ? ? ? ? ? ? WATSON-CRICK            ?     
? 
hydrog133 hydrog ? ? G DC  17   N4  ? ? ? 1_555 H DG 18 O6 ? ? G DC  17  H DG 18   1_555 ? ? ? ? ? ? WATSON-CRICK            ?     
? 
hydrog134 hydrog ? ? G DC  17   O2  ? ? ? 1_555 H DG 18 N2 ? ? G DC  17  H DG 18   1_555 ? ? ? ? ? ? WATSON-CRICK            ?     
? 
hydrog135 hydrog ? ? G DA  18   N1  ? ? ? 1_555 H DT 17 N3 ? ? G DA  18  H DT 17   1_555 ? ? ? ? ? ? WATSON-CRICK            ?     
? 
hydrog136 hydrog ? ? G DA  18   N6  ? ? ? 1_555 H DT 17 O4 ? ? G DA  18  H DT 17   1_555 ? ? ? ? ? ? WATSON-CRICK            ?     
? 
hydrog137 hydrog ? ? G DA  18   N1  ? ? ? 1_555 H DG 18 N1 ? ? G DA  18  H DG 18   1_555 ? ? ? ? ? ? TYPE_8_PAIR             ?     
? 
hydrog138 hydrog ? ? G DA  18   N6  ? ? ? 1_555 H DG 18 O6 ? ? G DA  18  H DG 18   1_555 ? ? ? ? ? ? TYPE_8_PAIR             ?     
? 
hydrog139 hydrog ? ? G DC  19   N3  ? ? ? 1_555 H DG 16 N1 ? ? G DC  19  H DG 16   1_555 ? ? ? ? ? ? WATSON-CRICK            ?     
? 
hydrog140 hydrog ? ? G DC  19   N4  ? ? ? 1_555 H DG 16 O6 ? ? G DC  19  H DG 16   1_555 ? ? ? ? ? ? WATSON-CRICK            ?     
? 
hydrog141 hydrog ? ? G DC  19   O2  ? ? ? 1_555 H DG 16 N2 ? ? G DC  19  H DG 16   1_555 ? ? ? ? ? ? WATSON-CRICK            ?     
? 
hydrog142 hydrog ? ? G DA  20   N1  ? ? ? 1_555 H DT 15 N3 ? ? G DA  20  H DT 15   1_555 ? ? ? ? ? ? WATSON-CRICK            ?     
? 
hydrog143 hydrog ? ? G DA  20   N6  ? ? ? 1_555 H DT 15 O4 ? ? G DA  20  H DT 15   1_555 ? ? ? ? ? ? WATSON-CRICK            ?     
? 
hydrog144 hydrog ? ? G DG  21   N1  ? ? ? 1_555 H DA 13 N1 ? ? G DG  21  H DA 13   1_555 ? ? ? ? ? ? TYPE_8_PAIR             ?     
? 
hydrog145 hydrog ? ? G DG  21   O6  ? ? ? 1_555 H DA 13 N6 ? ? G DG  21  H DA 13   1_555 ? ? ? ? ? ? TYPE_8_PAIR             ?     
? 
hydrog146 hydrog ? ? G DG  21   N1  ? ? ? 1_555 H DC 14 N3 ? ? G DG  21  H DC 14   1_555 ? ? ? ? ? ? WATSON-CRICK            ?     
? 
hydrog147 hydrog ? ? G DG  21   N2  ? ? ? 1_555 H DC 14 O2 ? ? G DG  21  H DC 14   1_555 ? ? ? ? ? ? WATSON-CRICK            ?     
? 
hydrog148 hydrog ? ? G DG  21   O6  ? ? ? 1_555 H DC 14 N4 ? ? G DG  21  H DC 14   1_555 ? ? ? ? ? ? WATSON-CRICK            ?     
? 
hydrog149 hydrog ? ? G DT  22   N3  ? ? ? 1_555 H DA 13 N1 ? ? G DT  22  H DA 13   1_555 ? ? ? ? ? ? WATSON-CRICK            ?     
? 
hydrog150 hydrog ? ? G DT  22   O4  ? ? ? 1_555 H DA 13 N6 ? ? G DT  22  H DA 13   1_555 ? ? ? ? ? ? WATSON-CRICK            ?     
? 
hydrog151 hydrog ? ? G DG  23   N1  ? ? ? 1_555 H DC 12 N3 ? ? G DG  23  H DC 12   1_555 ? ? ? ? ? ? WATSON-CRICK            ?     
? 
hydrog152 hydrog ? ? G DG  23   N2  ? ? ? 1_555 H DC 12 O2 ? ? G DG  23  H DC 12   1_555 ? ? ? ? ? ? WATSON-CRICK            ?     
? 
hydrog153 hydrog ? ? G DG  23   O6  ? ? ? 1_555 H DC 12 N4 ? ? G DG  23  H DC 12   1_555 ? ? ? ? ? ? WATSON-CRICK            ?     
? 
hydrog154 hydrog ? ? G DC  24   N3  ? ? ? 1_555 H DG 11 N1 ? ? G DC  24  H DG 11   1_555 ? ? ? ? ? ? WATSON-CRICK            ?     
? 
hydrog155 hydrog ? ? G DC  24   N4  ? ? ? 1_555 H DG 11 O6 ? ? G DC  24  H DG 11   1_555 ? ? ? ? ? ? WATSON-CRICK            ?     
? 
hydrog156 hydrog ? ? G DC  24   O2  ? ? ? 1_555 H DG 11 N2 ? ? G DC  24  H DG 11   1_555 ? ? ? ? ? ? WATSON-CRICK            ?     
? 
hydrog157 hydrog ? ? G DT  25   N3  ? ? ? 1_555 H DA 10 N1 ? ? G DT  25  H DA 10   1_555 ? ? ? ? ? ? WATSON-CRICK            ?     
? 
hydrog158 hydrog ? ? G DT  25   O4  ? ? ? 1_555 H DA 10 N6 ? ? G DT  25  H DA 10   1_555 ? ? ? ? ? ? WATSON-CRICK            ?     
? 
hydrog159 hydrog ? ? G DA  26   N1  ? ? ? 1_555 H DT 9  N3 ? ? G DA  26  H DT 9    1_555 ? ? ? ? ? ? WATSON-CRICK            ?     
? 
hydrog160 hydrog ? ? G DA  26   N6  ? ? ? 1_555 H DT 9  O4 ? ? G DA  26  H DT 9    1_555 ? ? ? ? ? ? WATSON-CRICK            ?     
? 
hydrog161 hydrog ? ? G DC  27   N3  ? ? ? 1_555 H DG 8  N1 ? ? G DC  27  H DG 8    1_555 ? ? ? ? ? ? WATSON-CRICK            ?     
? 
hydrog162 hydrog ? ? G DC  27   N4  ? ? ? 1_555 H DG 8  O6 ? ? G DC  27  H DG 8    1_555 ? ? ? ? ? ? WATSON-CRICK            ?     
? 
hydrog163 hydrog ? ? G DC  27   O2  ? ? ? 1_555 H DG 8  N2 ? ? G DC  27  H DG 8    1_555 ? ? ? ? ? ? WATSON-CRICK            ?     
? 
hydrog164 hydrog ? ? G DA  28   N1  ? ? ? 1_555 H DT 7  N3 ? ? G DA  28  H DT 7    1_555 ? ? ? ? ? ? WATSON-CRICK            ?     
? 
hydrog165 hydrog ? ? G DA  28   N6  ? ? ? 1_555 H DT 7  O4 ? ? G DA  28  H DT 7    1_555 ? ? ? ? ? ? WATSON-CRICK            ?     
? 
hydrog166 hydrog ? ? G DG  29   N1  ? ? ? 1_555 H DC 6  N3 ? ? G DG  29  H DC 6    1_555 ? ? ? ? ? ? WATSON-CRICK            ?     
? 
hydrog167 hydrog ? ? G DG  29   N2  ? ? ? 1_555 H DC 6  O2 ? ? G DG  29  H DC 6    1_555 ? ? ? ? ? ? WATSON-CRICK            ?     
? 
hydrog168 hydrog ? ? G DG  29   O6  ? ? ? 1_555 H DC 6  N4 ? ? G DG  29  H DC 6    1_555 ? ? ? ? ? ? WATSON-CRICK            ?     
? 
hydrog169 hydrog ? ? G DA  30   N1  ? ? ? 1_555 H DT 5  N3 ? ? G DA  30  H DT 5    1_555 ? ? ? ? ? ? WATSON-CRICK            ?     
? 
hydrog170 hydrog ? ? G DA  30   N6  ? ? ? 1_555 H DT 5  O4 ? ? G DA  30  H DT 5    1_555 ? ? ? ? ? ? WATSON-CRICK            ?     
? 
hydrog171 hydrog ? ? G DC  31   N3  ? ? ? 1_555 H DG 4  N1 ? ? G DC  31  H DG 4    1_555 ? ? ? ? ? ? WATSON-CRICK            ?     
? 
hydrog172 hydrog ? ? G DC  31   N4  ? ? ? 1_555 H DG 4  O6 ? ? G DC  31  H DG 4    1_555 ? ? ? ? ? ? WATSON-CRICK            ?     
? 
hydrog173 hydrog ? ? G DC  31   O2  ? ? ? 1_555 H DG 4  N2 ? ? G DC  31  H DG 4    1_555 ? ? ? ? ? ? WATSON-CRICK            ?     
? 
hydrog174 hydrog ? ? G DT  32   N3  ? ? ? 1_555 H DA 3  N1 ? ? G DT  32  H DA 3    1_555 ? ? ? ? ? ? WATSON-CRICK            ?     
? 
hydrog175 hydrog ? ? G DT  32   O4  ? ? ? 1_555 H DA 3  N6 ? ? G DT  32  H DA 3    1_555 ? ? ? ? ? ? WATSON-CRICK            ?     
? 
hydrog176 hydrog ? ? G DG  33   N1  ? ? ? 1_555 H DC 2  N3 ? ? G DG  33  H DC 2    1_555 ? ? ? ? ? ? WATSON-CRICK            ?     
? 
hydrog177 hydrog ? ? G DG  33   N2  ? ? ? 1_555 H DC 2  O2 ? ? G DG  33  H DC 2    1_555 ? ? ? ? ? ? WATSON-CRICK            ?     
? 
hydrog178 hydrog ? ? G DG  33   O6  ? ? ? 1_555 H DC 2  N4 ? ? G DG  33  H DC 2    1_555 ? ? ? ? ? ? WATSON-CRICK            ?     
? 
hydrog179 hydrog ? ? G DG  34   N1  ? ? ? 1_555 H DC 1  N3 ? ? G DG  34  H DC 1    1_555 ? ? ? ? ? ? WATSON-CRICK            ?     
? 
hydrog180 hydrog ? ? G DG  34   N2  ? ? ? 1_555 H DC 1  O2 ? ? G DG  34  H DC 1    1_555 ? ? ? ? ? ? WATSON-CRICK            ?     
? 
hydrog181 hydrog ? ? G DG  34   O6  ? ? ? 1_555 H DC 1  N4 ? ? G DG  34  H DC 1    1_555 ? ? ? ? ? ? WATSON-CRICK            ?     
? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
metalc ? ? 
hydrog ? ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1  GLN 667  A . ? GLN 539 A PRO 668  A ? PRO 540  A 1 -3.73  
2  LEU 781  A . ? LEU 653 A GLU 782  A ? GLU 654  A 1 -1.26  
3  ALA 870  A . ? ALA 742 A SER 871  A ? SER 743  A 1 0.89   
4  ARG 1127 A . ? ARG 999 A GLN 1128 A ? GLN 1000 A 1 2.58   
5  ASP 87   B . ? ASP 84  B GLY 88   B ? GLY 85   B 1 3.45   
6  PRO 90   B . ? PRO 87  B GLU 91   B ? GLU 88   B 1 -8.13  
7  HIS 96   B . ? HIS 93  B GLY 97   B ? GLY 94   B 1 -6.09  
8  ARG 117  B . ? ARG 114 B GLY 118  B ? GLY 115  B 1 -9.85  
9  GLY 118  B . ? GLY 115 B CYS 119  B ? CYS 116  B 1 -5.99  
10 GLY 134  B . ? GLY 131 B ASP 135  B ? ASP 132  B 1 -3.10  
11 ARG 151  B . ? ARG 148 B GLY 152  B ? GLY 149  B 1 -8.17  
12 GLU 191  B . ? GLU 188 B PHE 192  B ? PHE 189  B 1 -2.88  
13 LEU 245  B . ? LEU 242 B GLY 246  B ? GLY 243  B 1 2.22   
14 ASN 339  B . ? ASN 336 B PRO 340  B ? PRO 337  B 1 -2.17  
15 PRO 342  B . ? PRO 339 B PRO 343  B ? PRO 340  B 1 4.37   
16 GLN 667  C . ? GLN 539 C PRO 668  C ? PRO 540  C 1 -4.48  
17 LEU 781  C . ? LEU 653 C GLU 782  C ? GLU 654  C 1 -0.87  
18 ALA 870  C . ? ALA 742 C SER 871  C ? SER 743  C 1 1.14   
19 ARG 1127 C . ? ARG 999 C GLN 1128 C ? GLN 1000 C 1 2.51   
20 ASP 87   D . ? ASP 84  D GLY 88   D ? GLY 85   D 1 3.35   
21 PRO 90   D . ? PRO 87  D GLU 91   D ? GLU 88   D 1 -7.95  
22 HIS 96   D . ? HIS 93  D GLY 97   D ? GLY 94   D 1 -5.14  
23 ARG 117  D . ? ARG 114 D GLY 118  D ? GLY 115  D 1 -10.56 
24 GLY 118  D . ? GLY 115 D CYS 119  D ? CYS 116  D 1 -6.21  
25 GLY 134  D . ? GLY 131 D ASP 135  D ? ASP 132  D 1 -3.94  
26 ARG 151  D . ? ARG 148 D GLY 152  D ? GLY 149  D 1 -10.56 
27 GLU 191  D . ? GLU 188 D PHE 192  D ? PHE 189  D 1 -1.64  
28 LEU 245  D . ? LEU 242 D GLY 246  D ? GLY 243  D 1 2.36   
29 ASN 339  D . ? ASN 336 D PRO 340  D ? PRO 337  D 1 -2.63  
30 PRO 342  D . ? PRO 339 D PRO 343  D ? PRO 340  D 1 3.86   
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA1 ? 8 ? 
AA2 ? 6 ? 
AA3 ? 4 ? 
AA4 ? 5 ? 
AA5 ? 4 ? 
AA6 ? 4 ? 
AA7 ? 2 ? 
AA8 ? 4 ? 
AA9 ? 4 ? 
AB1 ? 8 ? 
AB2 ? 6 ? 
AB3 ? 4 ? 
AB4 ? 5 ? 
AB5 ? 4 ? 
AB6 ? 4 ? 
AB7 ? 2 ? 
AB8 ? 4 ? 
AB9 ? 4 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA1 1 2 ? anti-parallel 
AA1 2 3 ? anti-parallel 
AA1 3 4 ? parallel      
AA1 4 5 ? anti-parallel 
AA1 5 6 ? anti-parallel 
AA1 6 7 ? anti-parallel 
AA1 7 8 ? anti-parallel 
AA2 1 2 ? anti-parallel 
AA2 2 3 ? anti-parallel 
AA2 3 4 ? parallel      
AA2 4 5 ? anti-parallel 
AA2 5 6 ? anti-parallel 
AA3 1 2 ? anti-parallel 
AA3 2 3 ? anti-parallel 
AA3 3 4 ? anti-parallel 
AA4 1 2 ? parallel      
AA4 2 3 ? anti-parallel 
AA4 3 4 ? anti-parallel 
AA4 4 5 ? anti-parallel 
AA5 1 2 ? anti-parallel 
AA5 2 3 ? anti-parallel 
AA5 3 4 ? anti-parallel 
AA6 1 2 ? anti-parallel 
AA6 2 3 ? anti-parallel 
AA6 3 4 ? anti-parallel 
AA7 1 2 ? anti-parallel 
AA8 1 2 ? anti-parallel 
AA8 2 3 ? anti-parallel 
AA8 3 4 ? anti-parallel 
AA9 1 2 ? anti-parallel 
AA9 2 3 ? anti-parallel 
AA9 3 4 ? anti-parallel 
AB1 1 2 ? anti-parallel 
AB1 2 3 ? anti-parallel 
AB1 3 4 ? parallel      
AB1 4 5 ? anti-parallel 
AB1 5 6 ? anti-parallel 
AB1 6 7 ? anti-parallel 
AB1 7 8 ? anti-parallel 
AB2 1 2 ? anti-parallel 
AB2 2 3 ? anti-parallel 
AB2 3 4 ? parallel      
AB2 4 5 ? anti-parallel 
AB2 5 6 ? anti-parallel 
AB3 1 2 ? anti-parallel 
AB3 2 3 ? anti-parallel 
AB3 3 4 ? anti-parallel 
AB4 1 2 ? parallel      
AB4 2 3 ? anti-parallel 
AB4 3 4 ? anti-parallel 
AB4 4 5 ? anti-parallel 
AB5 1 2 ? anti-parallel 
AB5 2 3 ? anti-parallel 
AB5 3 4 ? anti-parallel 
AB6 1 2 ? anti-parallel 
AB6 2 3 ? anti-parallel 
AB6 3 4 ? anti-parallel 
AB7 1 2 ? anti-parallel 
AB8 1 2 ? anti-parallel 
AB8 2 3 ? anti-parallel 
AB8 3 4 ? anti-parallel 
AB9 1 2 ? anti-parallel 
AB9 2 3 ? anti-parallel 
AB9 3 4 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA1 1 GLU A 665 ? GLN A 667 ? GLU A 537 GLN A 539 
AA1 2 ARG A 836 ? VAL A 841 ? ARG A 708 VAL A 713 
AA1 3 LEU A 844 ? PHE A 852 ? LEU A 716 PHE A 724 
AA1 4 PHE A 739 ? MET A 750 ? PHE A 611 MET A 622 
AA1 5 ALA A 767 ? ILE A 779 ? ALA A 639 ILE A 651 
AA1 6 ARG A 803 ? MET A 808 ? ARG A 675 MET A 680 
AA1 7 SER A 701 ? ARG A 703 ? SER A 573 ARG A 575 
AA1 8 ILE A 682 ? ASP A 683 ? ILE A 554 ASP A 555 
AA2 1 GLU A 665 ? GLN A 667 ? GLU A 537 GLN A 539 
AA2 2 ARG A 836 ? VAL A 841 ? ARG A 708 VAL A 713 
AA2 3 LEU A 844 ? PHE A 852 ? LEU A 716 PHE A 724 
AA2 4 PHE A 739 ? MET A 750 ? PHE A 611 MET A 622 
AA2 5 ALA A 767 ? ILE A 779 ? ALA A 639 ILE A 651 
AA2 6 THR A 789 ? GLN A 792 ? THR A 661 GLN A 664 
AA3 1 SER B 5   ? PRO B 8   ? SER B 2   PRO B 5   
AA3 2 TYR B 346 ? SER B 352 ? TYR B 343 SER B 349 
AA3 3 THR B 329 ? PRO B 335 ? THR B 326 PRO B 332 
AA3 4 PHE B 321 ? GLY B 326 ? PHE B 318 GLY B 323 
AA4 1 THR B 10  ? ALA B 11  ? THR B 7   ALA B 8   
AA4 2 GLU B 57  ? ALA B 62  ? GLU B 54  ALA B 59  
AA4 3 PHE B 49  ? LYS B 54  ? PHE B 46  LYS B 51  
AA4 4 VAL B 31  ? PHE B 34  ? VAL B 28  PHE B 31  
AA4 5 SER B 23  ? ASP B 26  ? SER B 20  ASP B 23  
AA5 1 ALA B 79  ? PHE B 83  ? ALA B 76  PHE B 80  
AA5 2 CYS B 92  ? HIS B 96  ? CYS B 89  HIS B 93  
AA5 3 TYR B 110 ? ARG B 117 ? TYR B 107 ARG B 114 
AA5 4 VAL B 123 ? GLU B 129 ? VAL B 120 GLU B 126 
AA6 1 THR B 144 ? SER B 150 ? THR B 141 SER B 147 
AA6 2 LYS B 153 ? PHE B 159 ? LYS B 150 PHE B 156 
AA6 3 TYR B 186 ? ASP B 189 ? TYR B 183 ASP B 186 
AA6 4 THR B 196 ? ALA B 197 ? THR B 193 ALA B 194 
AA7 1 ARG B 162 ? TYR B 164 ? ARG B 159 TYR B 161 
AA7 2 VAL B 178 ? ASP B 180 ? VAL B 175 ASP B 177 
AA8 1 ALA B 212 ? ARG B 215 ? ALA B 209 ARG B 212 
AA8 2 CYS B 218 ? PHE B 221 ? CYS B 215 PHE B 218 
AA8 3 ILE B 237 ? LEU B 244 ? ILE B 234 LEU B 241 
AA8 4 SER B 247 ? ILE B 254 ? SER B 244 ILE B 251 
AA9 1 ALA B 266 ? PRO B 268 ? ALA B 263 PRO B 265 
AA9 2 GLU B 273 ? ILE B 276 ? GLU B 270 ILE B 273 
AA9 3 THR B 291 ? LEU B 295 ? THR B 288 LEU B 292 
AA9 4 VAL B 300 ? GLU B 303 ? VAL B 297 GLU B 300 
AB1 1 GLU C 665 ? GLN C 667 ? GLU C 537 GLN C 539 
AB1 2 ARG C 836 ? VAL C 841 ? ARG C 708 VAL C 713 
AB1 3 LEU C 844 ? PHE C 852 ? LEU C 716 PHE C 724 
AB1 4 PHE C 739 ? MET C 750 ? PHE C 611 MET C 622 
AB1 5 ALA C 767 ? ILE C 779 ? ALA C 639 ILE C 651 
AB1 6 ARG C 803 ? MET C 808 ? ARG C 675 MET C 680 
AB1 7 SER C 701 ? ARG C 703 ? SER C 573 ARG C 575 
AB1 8 ILE C 682 ? ASP C 683 ? ILE C 554 ASP C 555 
AB2 1 GLU C 665 ? GLN C 667 ? GLU C 537 GLN C 539 
AB2 2 ARG C 836 ? VAL C 841 ? ARG C 708 VAL C 713 
AB2 3 LEU C 844 ? PHE C 852 ? LEU C 716 PHE C 724 
AB2 4 PHE C 739 ? MET C 750 ? PHE C 611 MET C 622 
AB2 5 ALA C 767 ? ILE C 779 ? ALA C 639 ILE C 651 
AB2 6 THR C 789 ? GLN C 792 ? THR C 661 GLN C 664 
AB3 1 SER D 5   ? PRO D 8   ? SER D 2   PRO D 5   
AB3 2 TYR D 346 ? SER D 352 ? TYR D 343 SER D 349 
AB3 3 THR D 329 ? PRO D 335 ? THR D 326 PRO D 332 
AB3 4 PHE D 321 ? GLY D 326 ? PHE D 318 GLY D 323 
AB4 1 THR D 10  ? ALA D 11  ? THR D 7   ALA D 8   
AB4 2 GLU D 57  ? ALA D 62  ? GLU D 54  ALA D 59  
AB4 3 PHE D 49  ? LYS D 54  ? PHE D 46  LYS D 51  
AB4 4 VAL D 31  ? PHE D 34  ? VAL D 28  PHE D 31  
AB4 5 SER D 23  ? ASP D 26  ? SER D 20  ASP D 23  
AB5 1 ILE D 80  ? PHE D 83  ? ILE D 77  PHE D 80  
AB5 2 CYS D 92  ? ILE D 95  ? CYS D 89  ILE D 92  
AB5 3 TYR D 110 ? ARG D 117 ? TYR D 107 ARG D 114 
AB5 4 VAL D 123 ? GLU D 129 ? VAL D 120 GLU D 126 
AB6 1 THR D 144 ? SER D 150 ? THR D 141 SER D 147 
AB6 2 LYS D 153 ? PHE D 159 ? LYS D 150 PHE D 156 
AB6 3 TYR D 186 ? ILE D 188 ? TYR D 183 ILE D 185 
AB6 4 THR D 196 ? ALA D 197 ? THR D 193 ALA D 194 
AB7 1 ARG D 162 ? TYR D 164 ? ARG D 159 TYR D 161 
AB7 2 VAL D 178 ? ASP D 180 ? VAL D 175 ASP D 177 
AB8 1 ALA D 212 ? ARG D 215 ? ALA D 209 ARG D 212 
AB8 2 CYS D 218 ? PHE D 221 ? CYS D 215 PHE D 218 
AB8 3 ILE D 237 ? LEU D 244 ? ILE D 234 LEU D 241 
AB8 4 SER D 247 ? ILE D 254 ? SER D 244 ILE D 251 
AB9 1 ALA D 266 ? PRO D 268 ? ALA D 263 PRO D 265 
AB9 2 GLU D 273 ? ILE D 276 ? GLU D 270 ILE D 273 
AB9 3 THR D 291 ? LEU D 295 ? THR D 288 LEU D 292 
AB9 4 VAL D 300 ? GLU D 303 ? VAL D 297 GLU D 300 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA1 1 2 N GLU A 665 ? N GLU A 537 O ILE A 838 ? O ILE A 710 
AA1 2 3 N ILE A 839 ? N ILE A 711 O ARG A 846 ? O ARG A 718 
AA1 3 4 O PHE A 851 ? O PHE A 723 N VAL A 741 ? N VAL A 613 
AA1 4 5 N SER A 746 ? N SER A 618 O SER A 771 ? O SER A 643 
AA1 5 6 N PHE A 770 ? N PHE A 642 O LEU A 805 ? O LEU A 677 
AA1 6 7 O LEU A 807 ? O LEU A 679 N ARG A 702 ? N ARG A 574 
AA1 7 8 O ARG A 703 ? O ARG A 575 N ILE A 682 ? N ILE A 554 
AA2 1 2 N GLU A 665 ? N GLU A 537 O ILE A 838 ? O ILE A 710 
AA2 2 3 N ILE A 839 ? N ILE A 711 O ARG A 846 ? O ARG A 718 
AA2 3 4 O PHE A 851 ? O PHE A 723 N VAL A 741 ? N VAL A 613 
AA2 4 5 N SER A 746 ? N SER A 618 O SER A 771 ? O SER A 643 
AA2 5 6 N ILE A 777 ? N ILE A 649 O PHE A 791 ? O PHE A 663 
AA3 1 2 N GLN B 7   ? N GLN B 4   O GLN B 350 ? O GLN B 347 
AA3 2 3 O TYR B 349 ? O TYR B 346 N VAL B 332 ? N VAL B 329 
AA3 3 4 O ALA B 333 ? O ALA B 330 N PHE B 321 ? N PHE B 318 
AA4 1 2 N THR B 10  ? N THR B 7   O LEU B 58  ? O LEU B 55  
AA4 2 3 O ARG B 61  ? O ARG B 58  N GLY B 50  ? N GLY B 47  
AA4 3 4 O VAL B 51  ? O VAL B 48  N VAL B 31  ? N VAL B 28  
AA4 4 5 O TYR B 32  ? O TYR B 29  N LEU B 25  ? N LEU B 22  
AA5 1 2 N ALA B 81  ? N ALA B 78  O LEU B 94  ? O LEU B 91  
AA5 2 3 N TYR B 93  ? N TYR B 90  O LEU B 112 ? O LEU B 109 
AA5 3 4 N ASP B 115 ? N ASP B 112 O THR B 124 ? O THR B 121 
AA6 1 2 N SER B 146 ? N SER B 143 O VAL B 157 ? O VAL B 154 
AA6 2 3 N LEU B 158 ? N LEU B 155 O TYR B 186 ? O TYR B 183 
AA6 3 4 N LEU B 187 ? N LEU B 184 O THR B 196 ? O THR B 193 
AA7 1 2 N SER B 163 ? N SER B 160 O VAL B 179 ? O VAL B 176 
AA8 1 2 N ARG B 215 ? N ARG B 212 O CYS B 218 ? O CYS B 215 
AA8 2 3 N VAL B 219 ? N VAL B 216 O LEU B 239 ? O LEU B 236 
AA8 3 4 N ARG B 238 ? N ARG B 235 O THR B 253 ? O THR B 250 
AA9 1 2 N SER B 267 ? N SER B 264 O ILE B 275 ? O ILE B 272 
AA9 2 3 N TYR B 274 ? N TYR B 271 O VAL B 293 ? O VAL B 290 
AA9 3 4 N GLY B 294 ? N GLY B 291 O HIS B 301 ? O HIS B 298 
AB1 1 2 N GLU C 665 ? N GLU C 537 O ILE C 838 ? O ILE C 710 
AB1 2 3 N ILE C 839 ? N ILE C 711 O ARG C 846 ? O ARG C 718 
AB1 3 4 O PHE C 851 ? O PHE C 723 N VAL C 741 ? N VAL C 613 
AB1 4 5 N SER C 746 ? N SER C 618 O SER C 771 ? O SER C 643 
AB1 5 6 N PHE C 770 ? N PHE C 642 O LEU C 805 ? O LEU C 677 
AB1 6 7 O LEU C 807 ? O LEU C 679 N ARG C 702 ? N ARG C 574 
AB1 7 8 O ARG C 703 ? O ARG C 575 N ILE C 682 ? N ILE C 554 
AB2 1 2 N GLU C 665 ? N GLU C 537 O ILE C 838 ? O ILE C 710 
AB2 2 3 N ILE C 839 ? N ILE C 711 O ARG C 846 ? O ARG C 718 
AB2 3 4 O PHE C 851 ? O PHE C 723 N VAL C 741 ? N VAL C 613 
AB2 4 5 N SER C 746 ? N SER C 618 O SER C 771 ? O SER C 643 
AB2 5 6 N ILE C 777 ? N ILE C 649 O PHE C 791 ? O PHE C 663 
AB3 1 2 N GLN D 7   ? N GLN D 4   O GLN D 350 ? O GLN D 347 
AB3 2 3 O TYR D 349 ? O TYR D 346 N VAL D 332 ? N VAL D 329 
AB3 3 4 O ALA D 333 ? O ALA D 330 N PHE D 321 ? N PHE D 318 
AB4 1 2 N THR D 10  ? N THR D 7   O LEU D 58  ? O LEU D 55  
AB4 2 3 O ARG D 61  ? O ARG D 58  N GLY D 50  ? N GLY D 47  
AB4 3 4 O PHE D 49  ? O PHE D 46  N LEU D 33  ? N LEU D 30  
AB4 4 5 O TYR D 32  ? O TYR D 29  N LEU D 25  ? N LEU D 22  
AB5 1 2 N ALA D 81  ? N ALA D 78  O LEU D 94  ? O LEU D 91  
AB5 2 3 N TYR D 93  ? N TYR D 90  O LEU D 112 ? O LEU D 109 
AB5 3 4 N ASP D 115 ? N ASP D 112 O THR D 124 ? O THR D 121 
AB6 1 2 N SER D 146 ? N SER D 143 O VAL D 157 ? O VAL D 154 
AB6 2 3 N LEU D 158 ? N LEU D 155 O TYR D 186 ? O TYR D 183 
AB6 3 4 N LEU D 187 ? N LEU D 184 O THR D 196 ? O THR D 193 
AB7 1 2 N SER D 163 ? N SER D 160 O VAL D 179 ? O VAL D 176 
AB8 1 2 N ARG D 215 ? N ARG D 212 O CYS D 218 ? O CYS D 215 
AB8 2 3 N VAL D 219 ? N VAL D 216 O LEU D 239 ? O LEU D 236 
AB8 3 4 N HIS D 240 ? N HIS D 237 O THR D 251 ? O THR D 248 
AB9 1 2 N SER D 267 ? N SER D 264 O ILE D 275 ? O ILE D 272 
AB9 2 3 N TYR D 274 ? N TYR D 271 O VAL D 293 ? O VAL D 290 
AB9 3 4 N TYR D 292 ? N TYR D 289 O GLU D 303 ? O GLU D 300 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software A ZN 1101 ? 4 'binding site for residue ZN A 1101' 
AC2 Software A CA 1102 ? 2 'binding site for residue CA A 1102' 
AC3 Software A CA 1103 ? 3 'binding site for residue CA A 1103' 
AC4 Software C ZN 1101 ? 4 'binding site for residue ZN C 1101' 
AC5 Software C CA 1102 ? 3 'binding site for residue CA C 1102' 
AC6 Software C CA 1103 ? 2 'binding site for residue CA C 1103' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 4 CYS A 877  ? CYS A 749 . ? 1_555 ? 
2  AC1 4 CYS A 880  ? CYS A 752 . ? 1_555 ? 
3  AC1 4 HIS A 1087 ? HIS A 959 . ? 1_555 ? 
4  AC1 4 HIS A 1092 ? HIS A 964 . ? 1_555 ? 
5  AC2 2 ASP A 748  ? ASP A 620 . ? 1_555 ? 
6  AC2 2 GLU A 1112 ? GLU A 984 . ? 1_555 ? 
7  AC3 3 ASP A 748  ? ASP A 620 . ? 1_555 ? 
8  AC3 3 GLU A 812  ? GLU A 684 . ? 1_555 ? 
9  AC3 3 ASP A 858  ? ASP A 730 . ? 1_555 ? 
10 AC4 4 CYS C 877  ? CYS C 749 . ? 1_555 ? 
11 AC4 4 CYS C 880  ? CYS C 752 . ? 1_555 ? 
12 AC4 4 HIS C 1087 ? HIS C 959 . ? 1_555 ? 
13 AC4 4 HIS C 1092 ? HIS C 964 . ? 1_555 ? 
14 AC5 3 ASP C 748  ? ASP C 620 . ? 1_555 ? 
15 AC5 3 GLY C 749  ? GLY C 621 . ? 1_555 ? 
16 AC5 3 GLU C 1112 ? GLU C 984 . ? 1_555 ? 
17 AC6 2 ASP C 858  ? ASP C 730 . ? 1_555 ? 
18 AC6 2 DA  F 20   ? DA  F 20  . ? 1_555 ? 
# 
_atom_sites.entry_id                    6DBU 
_atom_sites.fract_transf_matrix[1][1]   1.000000 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   1.000000 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   1.000000 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
CA 
N  
O  
P  
S  
ZN 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1     N  N     . PHE A 1 607  ? 139.212 134.069 89.744  1.00 99.09  ?  479  PHE A N     1 
ATOM   2     C  CA    . PHE A 1 607  ? 140.504 134.700 89.968  1.00 103.58 ?  479  PHE A CA    1 
ATOM   3     C  C     . PHE A 1 607  ? 140.849 134.686 91.452  1.00 84.95  ?  479  PHE A C     1 
ATOM   4     O  O     . PHE A 1 607  ? 140.325 135.485 92.230  1.00 74.48  ?  479  PHE A O     1 
ATOM   5     C  CB    . PHE A 1 607  ? 140.504 136.130 89.423  1.00 118.97 ?  479  PHE A CB    1 
ATOM   6     C  CG    . PHE A 1 607  ? 140.577 136.201 87.922  1.00 138.48 ?  479  PHE A CG    1 
ATOM   7     C  CD1   . PHE A 1 607  ? 139.470 135.899 87.146  1.00 137.40 ?  479  PHE A CD1   1 
ATOM   8     C  CD2   . PHE A 1 607  ? 141.755 136.561 87.288  1.00 148.23 ?  479  PHE A CD2   1 
ATOM   9     C  CE1   . PHE A 1 607  ? 139.534 135.958 85.765  1.00 136.84 ?  479  PHE A CE1   1 
ATOM   10    C  CE2   . PHE A 1 607  ? 141.825 136.623 85.907  1.00 148.72 ?  479  PHE A CE2   1 
ATOM   11    C  CZ    . PHE A 1 607  ? 140.712 136.321 85.145  1.00 141.69 ?  479  PHE A CZ    1 
ATOM   12    N  N     . GLY A 1 608  ? 141.734 133.769 91.831  1.00 83.25  ?  480  GLY A N     1 
ATOM   13    C  CA    . GLY A 1 608  ? 142.115 133.610 93.221  1.00 69.13  ?  480  GLY A CA    1 
ATOM   14    C  C     . GLY A 1 608  ? 142.706 134.877 93.810  1.00 61.48  ?  480  GLY A C     1 
ATOM   15    O  O     . GLY A 1 608  ? 143.052 135.838 93.121  1.00 64.66  ?  480  GLY A O     1 
ATOM   16    N  N     . LEU A 1 609  ? 142.825 134.869 95.133  1.00 41.45  ?  481  LEU A N     1 
ATOM   17    C  CA    . LEU A 1 609  ? 143.282 136.029 95.879  1.00 30.72  ?  481  LEU A CA    1 
ATOM   18    C  C     . LEU A 1 609  ? 144.698 135.816 96.400  1.00 24.23  ?  481  LEU A C     1 
ATOM   19    O  O     . LEU A 1 609  ? 145.109 134.691 96.697  1.00 23.07  ?  481  LEU A O     1 
ATOM   20    C  CB    . LEU A 1 609  ? 142.339 136.337 97.042  1.00 23.95  ?  481  LEU A CB    1 
ATOM   21    C  CG    . LEU A 1 609  ? 142.397 137.788 97.511  1.00 22.67  ?  481  LEU A CG    1 
ATOM   22    C  CD1   . LEU A 1 609  ? 142.500 138.717 96.314  1.00 21.66  ?  481  LEU A CD1   1 
ATOM   23    C  CD2   . LEU A 1 609  ? 141.174 138.115 98.339  1.00 20.10  ?  481  LEU A CD2   1 
ATOM   24    N  N     . HIS A 1 610  ? 145.432 136.917 96.507  1.00 23.93  ?  482  HIS A N     1 
ATOM   25    C  CA    . HIS A 1 610  ? 146.819 136.911 96.950  1.00 24.55  ?  482  HIS A CA    1 
ATOM   26    C  C     . HIS A 1 610  ? 146.942 136.280 98.337  1.00 22.18  ?  482  HIS A C     1 
ATOM   27    O  O     . HIS A 1 610  ? 146.261 136.729 99.271  1.00 19.68  ?  482  HIS A O     1 
ATOM   28    C  CB    . HIS A 1 610  ? 147.333 138.350 96.957  1.00 22.91  ?  482  HIS A CB    1 
ATOM   29    C  CG    . HIS A 1 610  ? 148.774 138.487 96.578  1.00 30.57  ?  482  HIS A CG    1 
ATOM   30    N  ND1   . HIS A 1 610  ? 149.703 137.497 96.813  1.00 31.91  ?  482  HIS A ND1   1 
ATOM   31    C  CD2   . HIS A 1 610  ? 149.444 139.495 95.971  1.00 38.26  ?  482  HIS A CD2   1 
ATOM   32    C  CE1   . HIS A 1 610  ? 150.885 137.892 96.375  1.00 45.12  ?  482  HIS A CE1   1 
ATOM   33    N  NE2   . HIS A 1 610  ? 150.755 139.100 95.859  1.00 47.20  ?  482  HIS A NE2   1 
ATOM   34    N  N     . PRO A 1 611  ? 147.777 135.246 98.517  1.00 18.24  ?  483  PRO A N     1 
ATOM   35    C  CA    . PRO A 1 611  ? 147.861 134.592 99.838  1.00 12.13  ?  483  PRO A CA    1 
ATOM   36    C  C     . PRO A 1 611  ? 148.217 135.537 100.971 1.00 9.43   ?  483  PRO A C     1 
ATOM   37    O  O     . PRO A 1 611  ? 147.750 135.342 102.104 1.00 9.13   ?  483  PRO A O     1 
ATOM   38    C  CB    . PRO A 1 611  ? 148.952 133.531 99.630  1.00 11.26  ?  483  PRO A CB    1 
ATOM   39    C  CG    . PRO A 1 611  ? 148.921 133.246 98.174  1.00 12.31  ?  483  PRO A CG    1 
ATOM   40    C  CD    . PRO A 1 611  ? 148.596 134.553 97.507  1.00 14.31  ?  483  PRO A CD    1 
ATOM   41    N  N     . ALA A 1 612  ? 149.033 136.557 100.700 1.00 9.78   ?  484  ALA A N     1 
ATOM   42    C  CA    . ALA A 1 612  ? 149.346 137.542 101.728 1.00 11.65  ?  484  ALA A CA    1 
ATOM   43    C  C     . ALA A 1 612  ? 148.090 138.276 102.191 1.00 9.20   ?  484  ALA A C     1 
ATOM   44    O  O     . ALA A 1 612  ? 147.911 138.517 103.393 1.00 6.53   ?  484  ALA A O     1 
ATOM   45    C  CB    . ALA A 1 612  ? 150.392 138.523 101.202 1.00 13.19  ?  484  ALA A CB    1 
ATOM   46    N  N     . VAL A 1 613  ? 147.207 138.635 101.253 1.00 12.40  ?  485  VAL A N     1 
ATOM   47    C  CA    . VAL A 1 613  ? 145.947 139.282 101.615 1.00 8.71   ?  485  VAL A CA    1 
ATOM   48    C  C     . VAL A 1 613  ? 145.112 138.369 102.500 1.00 5.25   ?  485  VAL A C     1 
ATOM   49    O  O     . VAL A 1 613  ? 144.443 138.826 103.433 1.00 4.53   ?  485  VAL A O     1 
ATOM   50    C  CB    . VAL A 1 613  ? 145.172 139.704 100.351 1.00 10.61  ?  485  VAL A CB    1 
ATOM   51    C  CG1   . VAL A 1 613  ? 143.672 139.760 100.627 1.00 7.33   ?  485  VAL A CG1   1 
ATOM   52    C  CG2   . VAL A 1 613  ? 145.660 141.050 99.858  1.00 15.16  ?  485  VAL A CG2   1 
ATOM   53    N  N     . CYS A 1 614  ? 145.134 137.066 102.225 1.00 7.33   ?  486  CYS A N     1 
ATOM   54    C  CA    . CYS A 1 614  ? 144.350 136.142 103.035 1.00 6.94   ?  486  CYS A CA    1 
ATOM   55    C  C     . CYS A 1 614  ? 144.921 136.027 104.443 1.00 5.49   ?  486  CYS A C     1 
ATOM   56    O  O     . CYS A 1 614  ? 144.168 135.989 105.426 1.00 5.77   ?  486  CYS A O     1 
ATOM   57    C  CB    . CYS A 1 614  ? 144.291 134.774 102.360 1.00 12.82  ?  486  CYS A CB    1 
ATOM   58    S  SG    . CYS A 1 614  ? 142.832 133.805 102.793 1.00 15.76  ?  486  CYS A SG    1 
ATOM   59    N  N     . LEU A 1 615  ? 146.248 135.975 104.565 1.00 5.37   ?  487  LEU A N     1 
ATOM   60    C  CA    . LEU A 1 615  ? 146.836 136.008 105.899 1.00 4.46   ?  487  LEU A CA    1 
ATOM   61    C  C     . LEU A 1 615  ? 146.441 137.279 106.638 1.00 4.46   ?  487  LEU A C     1 
ATOM   62    O  O     . LEU A 1 615  ? 146.062 137.235 107.818 1.00 5.49   ?  487  LEU A O     1 
ATOM   63    C  CB    . LEU A 1 615  ? 148.354 135.893 105.816 1.00 6.77   ?  487  LEU A CB    1 
ATOM   64    C  CG    . LEU A 1 615  ? 149.028 136.101 107.171 1.00 7.48   ?  487  LEU A CG    1 
ATOM   65    C  CD1   . LEU A 1 615  ? 148.829 134.889 108.066 1.00 12.98  ?  487  LEU A CD1   1 
ATOM   66    C  CD2   . LEU A 1 615  ? 150.494 136.399 106.977 1.00 5.80   ?  487  LEU A CD2   1 
ATOM   67    N  N     . ALA A 1 616  ? 146.509 138.424 105.954 1.00 4.60   ?  488  ALA A N     1 
ATOM   68    C  CA    . ALA A 1 616  ? 146.145 139.680 106.599 1.00 4.55   ?  488  ALA A CA    1 
ATOM   69    C  C     . ALA A 1 616  ? 144.686 139.666 107.033 1.00 5.13   ?  488  ALA A C     1 
ATOM   70    O  O     . ALA A 1 616  ? 144.357 140.091 108.146 1.00 5.78   ?  488  ALA A O     1 
ATOM   71    C  CB    . ALA A 1 616  ? 146.420 140.856 105.664 1.00 6.83   ?  488  ALA A CB    1 
ATOM   72    N  N     . ILE A 1 617  ? 143.799 139.151 106.181 1.00 5.62   ?  489  ILE A N     1 
ATOM   73    C  CA    . ILE A 1 617  ? 142.386 139.089 106.525 1.00 7.70   ?  489  ILE A CA    1 
ATOM   74    C  C     . ILE A 1 617  ? 142.085 138.044 107.583 1.00 7.35   ?  489  ILE A C     1 
ATOM   75    O  O     . ILE A 1 617  ? 140.981 138.035 108.138 1.00 8.47   ?  489  ILE A O     1 
ATOM   76    C  CB    . ILE A 1 617  ? 141.526 138.839 105.270 1.00 3.45   ?  489  ILE A CB    1 
ATOM   77    C  CG1   . ILE A 1 617  ? 140.160 139.451 105.505 1.00 5.92   ?  489  ILE A CG1   1 
ATOM   78    C  CG2   . ILE A 1 617  ? 141.362 137.363 105.008 1.00 4.46   ?  489  ILE A CG2   1 
ATOM   79    C  CD1   . ILE A 1 617  ? 140.286 140.874 105.906 1.00 10.11  ?  489  ILE A CD1   1 
ATOM   80    N  N     . ARG A 1 618  ? 143.028 137.148 107.867 1.00 7.69   ?  490  ARG A N     1 
ATOM   81    C  CA    . ARG A 1 618  ? 142.862 136.302 109.042 1.00 7.92   ?  490  ARG A CA    1 
ATOM   82    C  C     . ARG A 1 618  ? 143.351 136.992 110.309 1.00 5.62   ?  490  ARG A C     1 
ATOM   83    O  O     . ARG A 1 618  ? 142.770 136.791 111.383 1.00 5.74   ?  490  ARG A O     1 
ATOM   84    C  CB    . ARG A 1 618  ? 143.597 134.974 108.874 1.00 6.74   ?  490  ARG A CB    1 
ATOM   85    C  CG    . ARG A 1 618  ? 143.229 133.977 109.959 1.00 4.54   ?  490  ARG A CG    1 
ATOM   86    C  CD    . ARG A 1 618  ? 144.172 132.804 110.015 1.00 2.69   ?  490  ARG A CD    1 
ATOM   87    N  NE    . ARG A 1 618  ? 145.224 133.026 110.999 1.00 3.19   ?  490  ARG A NE    1 
ATOM   88    C  CZ    . ARG A 1 618  ? 146.057 132.082 111.416 1.00 4.41   ?  490  ARG A CZ    1 
ATOM   89    N  NH1   . ARG A 1 618  ? 146.988 132.369 112.314 1.00 5.44   ?  490  ARG A NH1   1 
ATOM   90    N  NH2   . ARG A 1 618  ? 145.951 130.847 110.943 1.00 3.91   ?  490  ARG A NH2   1 
ATOM   91    N  N     . VAL A 1 619  ? 144.403 137.799 110.207 1.00 5.51   ?  491  VAL A N     1 
ATOM   92    C  CA    . VAL A 1 619  ? 144.972 138.430 111.395 1.00 4.07   ?  491  VAL A CA    1 
ATOM   93    C  C     . VAL A 1 619  ? 144.410 139.828 111.622 1.00 4.91   ?  491  VAL A C     1 
ATOM   94    O  O     . VAL A 1 619  ? 144.077 140.189 112.754 1.00 6.25   ?  491  VAL A O     1 
ATOM   95    C  CB    . VAL A 1 619  ? 146.509 138.451 111.289 1.00 2.48   ?  491  VAL A CB    1 
ATOM   96    C  CG1   . VAL A 1 619  ? 147.082 139.622 112.073 1.00 2.03   ?  491  VAL A CG1   1 
ATOM   97    C  CG2   . VAL A 1 619  ? 147.080 137.139 111.793 1.00 3.16   ?  491  VAL A CG2   1 
ATOM   98    N  N     . ASN A 1 620  ? 144.287 140.638 110.568 1.00 5.59   ?  492  ASN A N     1 
ATOM   99    C  CA    . ASN A 1 620  ? 143.891 142.029 110.758 1.00 6.14   ?  492  ASN A CA    1 
ATOM   100   C  C     . ASN A 1 620  ? 142.475 142.175 111.301 1.00 5.17   ?  492  ASN A C     1 
ATOM   101   O  O     . ASN A 1 620  ? 142.072 143.294 111.635 1.00 4.62   ?  492  ASN A O     1 
ATOM   102   C  CB    . ASN A 1 620  ? 144.039 142.799 109.444 1.00 9.12   ?  492  ASN A CB    1 
ATOM   103   C  CG    . ASN A 1 620  ? 144.192 144.293 109.654 1.00 9.10   ?  492  ASN A CG    1 
ATOM   104   O  OD1   . ASN A 1 620  ? 144.301 144.764 110.785 1.00 8.62   ?  492  ASN A OD1   1 
ATOM   105   N  ND2   . ASN A 1 620  ? 144.241 145.042 108.560 1.00 10.81  ?  492  ASN A ND2   1 
ATOM   106   N  N     . THR A 1 621  ? 141.718 141.082 111.415 1.00 5.34   ?  493  THR A N     1 
ATOM   107   C  CA    . THR A 1 621  ? 140.387 141.134 112.006 1.00 5.97   ?  493  THR A CA    1 
ATOM   108   C  C     . THR A 1 621  ? 140.173 139.998 112.999 1.00 6.34   ?  493  THR A C     1 
ATOM   109   O  O     . THR A 1 621  ? 139.058 139.485 113.132 1.00 6.28   ?  493  THR A O     1 
ATOM   110   C  CB    . THR A 1 621  ? 139.305 141.116 110.929 1.00 6.45   ?  493  THR A CB    1 
ATOM   111   O  OG1   . THR A 1 621  ? 138.035 140.846 111.534 1.00 5.20   ?  493  THR A OG1   1 
ATOM   112   C  CG2   . THR A 1 621  ? 139.597 140.053 109.906 1.00 5.72   ?  493  THR A CG2   1 
ATOM   113   N  N     . PHE A 1 622  ? 141.238 139.582 113.686 1.00 6.14   ?  494  PHE A N     1 
ATOM   114   C  CA    . PHE A 1 622  ? 141.145 138.688 114.842 1.00 6.31   ?  494  PHE A CA    1 
ATOM   115   C  C     . PHE A 1 622  ? 140.424 137.384 114.529 1.00 6.51   ?  494  PHE A C     1 
ATOM   116   O  O     . PHE A 1 622  ? 139.988 136.682 115.447 1.00 8.19   ?  494  PHE A O     1 
ATOM   117   C  CB    . PHE A 1 622  ? 140.454 139.381 116.018 1.00 6.12   ?  494  PHE A CB    1 
ATOM   118   C  CG    . PHE A 1 622  ? 141.175 140.587 116.508 1.00 6.04   ?  494  PHE A CG    1 
ATOM   119   C  CD1   . PHE A 1 622  ? 142.549 140.685 116.381 1.00 5.69   ?  494  PHE A CD1   1 
ATOM   120   C  CD2   . PHE A 1 622  ? 140.481 141.632 117.084 1.00 7.55   ?  494  PHE A CD2   1 
ATOM   121   C  CE1   . PHE A 1 622  ? 143.213 141.800 116.831 1.00 7.25   ?  494  PHE A CE1   1 
ATOM   122   C  CE2   . PHE A 1 622  ? 141.140 142.751 117.535 1.00 10.31  ?  494  PHE A CE2   1 
ATOM   123   C  CZ    . PHE A 1 622  ? 142.508 142.836 117.410 1.00 10.52  ?  494  PHE A CZ    1 
ATOM   124   N  N     . LEU A 1 623  ? 140.270 137.052 113.250 1.00 6.03   ?  495  LEU A N     1 
ATOM   125   C  CA    . LEU A 1 623  ? 139.627 135.799 112.889 1.00 5.94   ?  495  LEU A CA    1 
ATOM   126   C  C     . LEU A 1 623  ? 140.359 134.625 113.531 1.00 7.10   ?  495  LEU A C     1 
ATOM   127   O  O     . LEU A 1 623  ? 141.570 134.673 113.766 1.00 8.32   ?  495  LEU A O     1 
ATOM   128   C  CB    . LEU A 1 623  ? 139.596 135.640 111.370 1.00 6.76   ?  495  LEU A CB    1 
ATOM   129   C  CG    . LEU A 1 623  ? 138.187 135.698 110.785 1.00 6.57   ?  495  LEU A CG    1 
ATOM   130   C  CD1   . LEU A 1 623  ? 138.193 135.462 109.278 1.00 7.85   ?  495  LEU A CD1   1 
ATOM   131   C  CD2   . LEU A 1 623  ? 137.304 134.683 111.495 1.00 6.40   ?  495  LEU A CD2   1 
ATOM   132   N  N     . SER A 1 624  ? 139.611 133.563 113.820 1.00 6.81   ?  496  SER A N     1 
ATOM   133   C  CA    . SER A 1 624  ? 140.192 132.382 114.443 1.00 7.73   ?  496  SER A CA    1 
ATOM   134   C  C     . SER A 1 624  ? 140.947 131.590 113.380 1.00 9.04   ?  496  SER A C     1 
ATOM   135   O  O     . SER A 1 624  ? 141.216 132.077 112.279 1.00 8.13   ?  496  SER A O     1 
ATOM   136   C  CB    . SER A 1 624  ? 139.121 131.508 115.084 1.00 8.83   ?  496  SER A CB    1 
ATOM   137   O  OG    . SER A 1 624  ? 138.817 130.425 114.222 1.00 9.28   ?  496  SER A OG    1 
ATOM   138   N  N     . CYS A 1 625  ? 141.302 130.348 113.705 1.00 10.38  ?  497  CYS A N     1 
ATOM   139   C  CA    . CYS A 1 625  ? 141.902 129.435 112.740 1.00 13.21  ?  497  CYS A CA    1 
ATOM   140   C  C     . CYS A 1 625  ? 140.918 128.382 112.243 1.00 6.73   ?  497  CYS A C     1 
ATOM   141   O  O     . CYS A 1 625  ? 140.793 128.177 111.032 1.00 5.99   ?  497  CYS A O     1 
ATOM   142   C  CB    . CYS A 1 625  ? 143.141 128.761 113.342 1.00 20.02  ?  497  CYS A CB    1 
ATOM   143   S  SG    . CYS A 1 625  ? 144.551 129.878 113.586 1.00 28.72  ?  497  CYS A SG    1 
ATOM   144   N  N     . SER A 1 626  ? 140.213 127.707 113.153 1.00 4.73   ?  498  SER A N     1 
ATOM   145   C  CA    . SER A 1 626  ? 139.155 126.794 112.731 1.00 4.14   ?  498  SER A CA    1 
ATOM   146   C  C     . SER A 1 626  ? 138.082 127.530 111.934 1.00 5.22   ?  498  SER A C     1 
ATOM   147   O  O     . SER A 1 626  ? 137.652 127.064 110.870 1.00 5.98   ?  498  SER A O     1 
ATOM   148   C  CB    . SER A 1 626  ? 138.545 126.107 113.952 1.00 7.57   ?  498  SER A CB    1 
ATOM   149   O  OG    . SER A 1 626  ? 137.845 127.044 114.752 1.00 9.68   ?  498  SER A OG    1 
ATOM   150   N  N     . GLN A 1 627  ? 137.635 128.685 112.444 1.00 6.58   ?  499  GLN A N     1 
ATOM   151   C  CA    . GLN A 1 627  ? 136.603 129.468 111.763 1.00 7.16   ?  499  GLN A CA    1 
ATOM   152   C  C     . GLN A 1 627  ? 137.016 129.799 110.338 1.00 7.02   ?  499  GLN A C     1 
ATOM   153   O  O     . GLN A 1 627  ? 136.211 129.699 109.401 1.00 7.38   ?  499  GLN A O     1 
ATOM   154   C  CB    . GLN A 1 627  ? 136.329 130.764 112.526 1.00 6.28   ?  499  GLN A CB    1 
ATOM   155   C  CG    . GLN A 1 627  ? 135.715 130.606 113.899 1.00 6.73   ?  499  GLN A CG    1 
ATOM   156   C  CD    . GLN A 1 627  ? 135.651 131.928 114.641 1.00 11.73  ?  499  GLN A CD    1 
ATOM   157   O  OE1   . GLN A 1 627  ? 135.643 132.997 114.028 1.00 10.99  ?  499  GLN A OE1   1 
ATOM   158   N  NE2   . GLN A 1 627  ? 135.616 131.863 115.967 1.00 11.73  ?  499  GLN A NE2   1 
ATOM   159   N  N     . TYR A 1 628  ? 138.262 130.244 110.168 1.00 4.96   ?  500  TYR A N     1 
ATOM   160   C  CA    . TYR A 1 628  ? 138.764 130.567 108.840 1.00 4.94   ?  500  TYR A CA    1 
ATOM   161   C  C     . TYR A 1 628  ? 138.664 129.366 107.909 1.00 6.07   ?  500  TYR A C     1 
ATOM   162   O  O     . TYR A 1 628  ? 138.218 129.493 106.764 1.00 7.96   ?  500  TYR A O     1 
ATOM   163   C  CB    . TYR A 1 628  ? 140.203 131.066 108.937 1.00 5.03   ?  500  TYR A CB    1 
ATOM   164   C  CG    . TYR A 1 628  ? 140.860 131.227 107.597 1.00 2.96   ?  500  TYR A CG    1 
ATOM   165   C  CD1   . TYR A 1 628  ? 140.625 132.347 106.819 1.00 2.03   ?  500  TYR A CD1   1 
ATOM   166   C  CD2   . TYR A 1 628  ? 141.711 130.254 107.106 1.00 1.53   ?  500  TYR A CD2   1 
ATOM   167   C  CE1   . TYR A 1 628  ? 141.219 132.490 105.593 1.00 3.12   ?  500  TYR A CE1   1 
ATOM   168   C  CE2   . TYR A 1 628  ? 142.307 130.388 105.885 1.00 2.48   ?  500  TYR A CE2   1 
ATOM   169   C  CZ    . TYR A 1 628  ? 142.061 131.505 105.132 1.00 3.80   ?  500  TYR A CZ    1 
ATOM   170   O  OH    . TYR A 1 628  ? 142.666 131.629 103.908 1.00 7.71   ?  500  TYR A OH    1 
ATOM   171   N  N     . HIS A 1 629  ? 139.078 128.187 108.386 1.00 5.73   ?  501  HIS A N     1 
ATOM   172   C  CA    . HIS A 1 629  ? 139.002 126.990 107.552 1.00 6.69   ?  501  HIS A CA    1 
ATOM   173   C  C     . HIS A 1 629  ? 137.566 126.672 107.165 1.00 6.36   ?  501  HIS A C     1 
ATOM   174   O  O     . HIS A 1 629  ? 137.288 126.312 106.013 1.00 7.18   ?  501  HIS A O     1 
ATOM   175   C  CB    . HIS A 1 629  ? 139.616 125.791 108.271 1.00 6.25   ?  501  HIS A CB    1 
ATOM   176   C  CG    . HIS A 1 629  ? 139.377 124.488 107.568 1.00 4.59   ?  501  HIS A CG    1 
ATOM   177   N  ND1   . HIS A 1 629  ? 139.532 124.337 106.206 1.00 5.51   ?  501  HIS A ND1   1 
ATOM   178   C  CD2   . HIS A 1 629  ? 138.978 123.281 108.036 1.00 6.43   ?  501  HIS A CD2   1 
ATOM   179   C  CE1   . HIS A 1 629  ? 139.250 123.091 105.868 1.00 11.52  ?  501  HIS A CE1   1 
ATOM   180   N  NE2   . HIS A 1 629  ? 138.910 122.430 106.960 1.00 12.53  ?  501  HIS A NE2   1 
ATOM   181   N  N     . LYS A 1 630  ? 136.643 126.777 108.121 1.00 5.48   ?  502  LYS A N     1 
ATOM   182   C  CA    . LYS A 1 630  ? 135.254 126.446 107.827 1.00 6.57   ?  502  LYS A CA    1 
ATOM   183   C  C     . LYS A 1 630  ? 134.678 127.398 106.787 1.00 7.00   ?  502  LYS A C     1 
ATOM   184   O  O     . LYS A 1 630  ? 134.026 126.967 105.824 1.00 8.94   ?  502  LYS A O     1 
ATOM   185   C  CB    . LYS A 1 630  ? 134.429 126.476 109.111 1.00 5.44   ?  502  LYS A CB    1 
ATOM   186   C  CG    . LYS A 1 630  ? 133.277 125.498 109.109 1.00 5.85   ?  502  LYS A CG    1 
ATOM   187   C  CD    . LYS A 1 630  ? 133.001 124.950 110.492 1.00 4.35   ?  502  LYS A CD    1 
ATOM   188   C  CE    . LYS A 1 630  ? 132.809 126.070 111.494 1.00 2.33   ?  502  LYS A CE    1 
ATOM   189   N  NZ    . LYS A 1 630  ? 132.662 125.545 112.877 1.00 1.37   ?  502  LYS A NZ    1 
ATOM   190   N  N     . MET A 1 631  ? 134.940 128.697 106.945 1.00 7.49   ?  503  MET A N     1 
ATOM   191   C  CA    . MET A 1 631  ? 134.414 129.660 105.986 1.00 9.29   ?  503  MET A CA    1 
ATOM   192   C  C     . MET A 1 631  ? 135.074 129.504 104.621 1.00 9.07   ?  503  MET A C     1 
ATOM   193   O  O     . MET A 1 631  ? 134.417 129.696 103.585 1.00 9.83   ?  503  MET A O     1 
ATOM   194   C  CB    . MET A 1 631  ? 134.569 131.084 106.532 1.00 10.99  ?  503  MET A CB    1 
ATOM   195   C  CG    . MET A 1 631  ? 135.937 131.728 106.377 1.00 11.69  ?  503  MET A CG    1 
ATOM   196   S  SD    . MET A 1 631  ? 135.963 132.913 105.019 1.00 17.11  ?  503  MET A SD    1 
ATOM   197   C  CE    . MET A 1 631  ? 134.790 134.137 105.599 1.00 11.11  ?  503  MET A CE    1 
ATOM   198   N  N     . TYR A 1 632  ? 136.351 129.118 104.597 1.00 8.63   ?  504  TYR A N     1 
ATOM   199   C  CA    . TYR A 1 632  ? 137.030 128.878 103.331 1.00 8.79   ?  504  TYR A CA    1 
ATOM   200   C  C     . TYR A 1 632  ? 136.417 127.693 102.603 1.00 11.33  ?  504  TYR A C     1 
ATOM   201   O  O     . TYR A 1 632  ? 136.167 127.757 101.395 1.00 12.81  ?  504  TYR A O     1 
ATOM   202   C  CB    . TYR A 1 632  ? 138.520 128.641 103.569 1.00 8.93   ?  504  TYR A CB    1 
ATOM   203   C  CG    . TYR A 1 632  ? 139.121 127.669 102.583 1.00 11.14  ?  504  TYR A CG    1 
ATOM   204   C  CD1   . TYR A 1 632  ? 139.483 128.080 101.311 1.00 11.86  ?  504  TYR A CD1   1 
ATOM   205   C  CD2   . TYR A 1 632  ? 139.309 126.334 102.917 1.00 16.38  ?  504  TYR A CD2   1 
ATOM   206   C  CE1   . TYR A 1 632  ? 140.024 127.194 100.403 1.00 13.36  ?  504  TYR A CE1   1 
ATOM   207   C  CE2   . TYR A 1 632  ? 139.847 125.443 102.013 1.00 19.83  ?  504  TYR A CE2   1 
ATOM   208   C  CZ    . TYR A 1 632  ? 140.206 125.880 100.758 1.00 18.02  ?  504  TYR A CZ    1 
ATOM   209   O  OH    . TYR A 1 632  ? 140.747 125.002 99.849  1.00 25.97  ?  504  TYR A OH    1 
ATOM   210   N  N     . ARG A 1 633  ? 136.205 126.585 103.318 1.00 11.50  ?  505  ARG A N     1 
ATOM   211   C  CA    . ARG A 1 633  ? 135.551 125.434 102.706 1.00 12.78  ?  505  ARG A CA    1 
ATOM   212   C  C     . ARG A 1 633  ? 134.171 125.808 102.181 1.00 12.06  ?  505  ARG A C     1 
ATOM   213   O  O     . ARG A 1 633  ? 133.769 125.364 101.097 1.00 13.33  ?  505  ARG A O     1 
ATOM   214   C  CB    . ARG A 1 633  ? 135.451 124.286 103.707 1.00 16.43  ?  505  ARG A CB    1 
ATOM   215   C  CG    . ARG A 1 633  ? 134.756 123.060 103.149 1.00 23.30  ?  505  ARG A CG    1 
ATOM   216   C  CD    . ARG A 1 633  ? 134.766 121.925 104.145 1.00 33.92  ?  505  ARG A CD    1 
ATOM   217   N  NE    . ARG A 1 633  ? 134.011 122.263 105.345 1.00 31.15  ?  505  ARG A NE    1 
ATOM   218   C  CZ    . ARG A 1 633  ? 133.991 121.519 106.444 1.00 35.17  ?  505  ARG A CZ    1 
ATOM   219   N  NH1   . ARG A 1 633  ? 133.277 121.901 107.494 1.00 26.30  ?  505  ARG A NH1   1 
ATOM   220   N  NH2   . ARG A 1 633  ? 134.686 120.391 106.492 1.00 50.33  ?  505  ARG A NH2   1 
ATOM   221   N  N     . THR A 1 634  ? 133.438 126.636 102.931 1.00 10.47  ?  506  THR A N     1 
ATOM   222   C  CA    . THR A 1 634  ? 132.121 127.074 102.477 1.00 10.05  ?  506  THR A CA    1 
ATOM   223   C  C     . THR A 1 634  ? 132.214 127.810 101.144 1.00 10.94  ?  506  THR A C     1 
ATOM   224   O  O     . THR A 1 634  ? 131.553 127.439 100.164 1.00 12.49  ?  506  THR A O     1 
ATOM   225   C  CB    . THR A 1 634  ? 131.467 127.967 103.529 1.00 11.40  ?  506  THR A CB    1 
ATOM   226   O  OG1   . THR A 1 634  ? 130.971 127.159 104.599 1.00 12.00  ?  506  THR A OG1   1 
ATOM   227   C  CG2   . THR A 1 634  ? 130.309 128.751 102.918 1.00 13.65  ?  506  THR A CG2   1 
ATOM   228   N  N     . VAL A 1 635  ? 133.030 128.866 101.093 1.00 8.65   ?  507  VAL A N     1 
ATOM   229   C  CA    . VAL A 1 635  ? 133.074 129.683 99.882  1.00 9.16   ?  507  VAL A CA    1 
ATOM   230   C  C     . VAL A 1 635  ? 133.700 128.912 98.723  1.00 10.09  ?  507  VAL A C     1 
ATOM   231   O  O     . VAL A 1 635  ? 133.405 129.189 97.553  1.00 11.88  ?  507  VAL A O     1 
ATOM   232   C  CB    . VAL A 1 635  ? 133.809 131.009 100.152 1.00 10.24  ?  507  VAL A CB    1 
ATOM   233   C  CG1   . VAL A 1 635  ? 135.274 130.759 100.461 1.00 12.69  ?  507  VAL A CG1   1 
ATOM   234   C  CG2   . VAL A 1 635  ? 133.655 131.950 98.966  1.00 11.69  ?  507  VAL A CG2   1 
ATOM   235   N  N     . LYS A 1 636  ? 134.565 127.937 99.018  1.00 13.01  ?  508  LYS A N     1 
ATOM   236   C  CA    . LYS A 1 636  ? 135.065 127.042 97.980  1.00 17.48  ?  508  LYS A CA    1 
ATOM   237   C  C     . LYS A 1 636  ? 133.926 126.240 97.371  1.00 19.25  ?  508  LYS A C     1 
ATOM   238   O  O     . LYS A 1 636  ? 133.647 126.338 96.169  1.00 19.69  ?  508  LYS A O     1 
ATOM   239   C  CB    . LYS A 1 636  ? 136.125 126.102 98.564  1.00 18.56  ?  508  LYS A CB    1 
ATOM   240   C  CG    . LYS A 1 636  ? 136.270 124.774 97.817  1.00 17.23  ?  508  LYS A CG    1 
ATOM   241   C  CD    . LYS A 1 636  ? 137.164 124.905 96.599  1.00 17.80  ?  508  LYS A CD    1 
ATOM   242   C  CE    . LYS A 1 636  ? 138.602 124.587 96.957  1.00 19.82  ?  508  LYS A CE    1 
ATOM   243   N  NZ    . LYS A 1 636  ? 138.731 123.173 97.407  1.00 18.48  ?  508  LYS A NZ    1 
ATOM   244   N  N     . ALA A 1 637  ? 133.241 125.451 98.204  1.00 21.81  ?  509  ALA A N     1 
ATOM   245   C  CA    . ALA A 1 637  ? 132.243 124.519 97.697  1.00 25.09  ?  509  ALA A CA    1 
ATOM   246   C  C     . ALA A 1 637  ? 131.063 125.238 97.062  1.00 25.81  ?  509  ALA A C     1 
ATOM   247   O  O     . ALA A 1 637  ? 130.424 124.688 96.158  1.00 28.94  ?  509  ALA A O     1 
ATOM   248   C  CB    . ALA A 1 637  ? 131.760 123.602 98.821  1.00 32.34  ?  509  ALA A CB    1 
ATOM   249   N  N     . THR A 1 638  ? 130.754 126.456 97.509  1.00 21.78  ?  510  THR A N     1 
ATOM   250   C  CA    . THR A 1 638  ? 129.575 127.133 96.979  1.00 22.92  ?  510  THR A CA    1 
ATOM   251   C  C     . THR A 1 638  ? 129.791 127.578 95.537  1.00 22.22  ?  510  THR A C     1 
ATOM   252   O  O     . THR A 1 638  ? 129.083 127.130 94.627  1.00 26.79  ?  510  THR A O     1 
ATOM   253   C  CB    . THR A 1 638  ? 129.194 128.323 97.860  1.00 23.64  ?  510  THR A CB    1 
ATOM   254   O  OG1   . THR A 1 638  ? 128.639 127.843 99.091  1.00 23.41  ?  510  THR A OG1   1 
ATOM   255   C  CG2   . THR A 1 638  ? 128.158 129.188 97.154  1.00 25.10  ?  510  THR A CG2   1 
ATOM   256   N  N     . SER A 1 639  ? 130.768 128.451 95.298  1.00 22.56  ?  511  SER A N     1 
ATOM   257   C  CA    . SER A 1 639  ? 130.871 129.109 93.997  1.00 29.73  ?  511  SER A CA    1 
ATOM   258   C  C     . SER A 1 639  ? 132.224 128.834 93.349  1.00 34.29  ?  511  SER A C     1 
ATOM   259   O  O     . SER A 1 639  ? 133.151 129.641 93.443  1.00 36.54  ?  511  SER A O     1 
ATOM   260   C  CB    . SER A 1 639  ? 130.622 130.616 94.150  1.00 35.35  ?  511  SER A CB    1 
ATOM   261   O  OG    . SER A 1 639  ? 131.019 131.318 92.984  1.00 45.16  ?  511  SER A OG    1 
ATOM   262   N  N     . GLY A 1 640  ? 132.336 127.666 92.720  1.00 37.55  ?  512  GLY A N     1 
ATOM   263   C  CA    . GLY A 1 640  ? 133.164 127.468 91.544  1.00 46.08  ?  512  GLY A CA    1 
ATOM   264   C  C     . GLY A 1 640  ? 134.587 127.988 91.527  1.00 42.70  ?  512  GLY A C     1 
ATOM   265   O  O     . GLY A 1 640  ? 135.229 127.957 90.472  1.00 46.66  ?  512  GLY A O     1 
ATOM   266   N  N     . ARG A 1 641  ? 135.111 128.466 92.652  1.00 38.12  ?  513  ARG A N     1 
ATOM   267   C  CA    . ARG A 1 641  ? 136.424 129.088 92.599  1.00 38.34  ?  513  ARG A CA    1 
ATOM   268   C  C     . ARG A 1 641  ? 137.104 129.004 93.955  1.00 36.11  ?  513  ARG A C     1 
ATOM   269   O  O     . ARG A 1 641  ? 136.465 128.797 94.989  1.00 32.74  ?  513  ARG A O     1 
ATOM   270   C  CB    . ARG A 1 641  ? 136.332 130.545 92.129  1.00 42.16  ?  513  ARG A CB    1 
ATOM   271   C  CG    . ARG A 1 641  ? 137.389 130.909 91.105  1.00 55.99  ?  513  ARG A CG    1 
ATOM   272   C  CD    . ARG A 1 641  ? 136.833 131.815 90.020  1.00 65.69  ?  513  ARG A CD    1 
ATOM   273   N  NE    . ARG A 1 641  ? 136.549 133.160 90.511  1.00 67.12  ?  513  ARG A NE    1 
ATOM   274   C  CZ    . ARG A 1 641  ? 135.396 133.794 90.328  1.00 65.72  ?  513  ARG A CZ    1 
ATOM   275   N  NH1   . ARG A 1 641  ? 134.412 133.205 89.662  1.00 73.20  ?  513  ARG A NH1   1 
ATOM   276   N  NH2   . ARG A 1 641  ? 135.229 135.018 90.808  1.00 64.05  ?  513  ARG A NH2   1 
ATOM   277   N  N     . GLN A 1 642  ? 138.426 129.167 93.921  1.00 33.25  ?  514  GLN A N     1 
ATOM   278   C  CA    . GLN A 1 642  ? 139.274 129.105 95.108  1.00 29.45  ?  514  GLN A CA    1 
ATOM   279   C  C     . GLN A 1 642  ? 139.577 130.539 95.532  1.00 26.15  ?  514  GLN A C     1 
ATOM   280   O  O     . GLN A 1 642  ? 140.621 131.109 95.212  1.00 29.17  ?  514  GLN A O     1 
ATOM   281   C  CB    . GLN A 1 642  ? 140.543 128.316 94.800  1.00 30.34  ?  514  GLN A CB    1 
ATOM   282   C  CG    . GLN A 1 642  ? 141.196 127.636 95.985  1.00 27.18  ?  514  GLN A CG    1 
ATOM   283   C  CD    . GLN A 1 642  ? 142.415 126.833 95.573  1.00 31.62  ?  514  GLN A CD    1 
ATOM   284   O  OE1   . GLN A 1 642  ? 142.969 127.036 94.491  1.00 33.51  ?  514  GLN A OE1   1 
ATOM   285   N  NE2   . GLN A 1 642  ? 142.831 125.908 96.427  1.00 36.31  ?  514  GLN A NE2   1 
ATOM   286   N  N     . ILE A 1 643  ? 138.635 131.129 96.268  1.00 18.85  ?  515  ILE A N     1 
ATOM   287   C  CA    . ILE A 1 643  ? 138.733 132.551 96.581  1.00 15.49  ?  515  ILE A CA    1 
ATOM   288   C  C     . ILE A 1 643  ? 139.728 132.801 97.709  1.00 15.66  ?  515  ILE A C     1 
ATOM   289   O  O     . ILE A 1 643  ? 140.470 133.790 97.686  1.00 18.10  ?  515  ILE A O     1 
ATOM   290   C  CB    . ILE A 1 643  ? 137.335 133.110 96.899  1.00 9.36   ?  515  ILE A CB    1 
ATOM   291   C  CG1   . ILE A 1 643  ? 136.608 133.430 95.594  1.00 8.93   ?  515  ILE A CG1   1 
ATOM   292   C  CG2   . ILE A 1 643  ? 137.420 134.338 97.785  1.00 9.44   ?  515  ILE A CG2   1 
ATOM   293   C  CD1   . ILE A 1 643  ? 137.253 134.541 94.803  1.00 18.50  ?  515  ILE A CD1   1 
ATOM   294   N  N     . PHE A 1 644  ? 139.774 131.918 98.701  1.00 14.01  ?  516  PHE A N     1 
ATOM   295   C  CA    . PHE A 1 644  ? 140.742 132.006 99.787  1.00 12.42  ?  516  PHE A CA    1 
ATOM   296   C  C     . PHE A 1 644  ? 141.684 130.815 99.703  1.00 13.50  ?  516  PHE A C     1 
ATOM   297   O  O     . PHE A 1 644  ? 141.240 129.686 99.481  1.00 15.26  ?  516  PHE A O     1 
ATOM   298   C  CB    . PHE A 1 644  ? 140.048 132.039 101.151 1.00 11.38  ?  516  PHE A CB    1 
ATOM   299   C  CG    . PHE A 1 644  ? 139.292 133.307 101.413 1.00 9.87   ?  516  PHE A CG    1 
ATOM   300   C  CD1   . PHE A 1 644  ? 139.451 134.400 100.585 1.00 9.92   ?  516  PHE A CD1   1 
ATOM   301   C  CD2   . PHE A 1 644  ? 138.439 133.414 102.496 1.00 8.62   ?  516  PHE A CD2   1 
ATOM   302   C  CE1   . PHE A 1 644  ? 138.763 135.566 100.815 1.00 10.43  ?  516  PHE A CE1   1 
ATOM   303   C  CE2   . PHE A 1 644  ? 137.751 134.586 102.733 1.00 6.43   ?  516  PHE A CE2   1 
ATOM   304   C  CZ    . PHE A 1 644  ? 137.913 135.661 101.892 1.00 6.94   ?  516  PHE A CZ    1 
ATOM   305   N  N     . GLN A 1 645  ? 142.979 131.068 99.860  1.00 11.23  ?  517  GLN A N     1 
ATOM   306   C  CA    . GLN A 1 645  ? 143.933 129.975 99.838  1.00 11.01  ?  517  GLN A CA    1 
ATOM   307   C  C     . GLN A 1 645  ? 143.675 129.041 101.019 1.00 10.39  ?  517  GLN A C     1 
ATOM   308   O  O     . GLN A 1 645  ? 143.149 129.462 102.054 1.00 9.21   ?  517  GLN A O     1 
ATOM   309   C  CB    . GLN A 1 645  ? 145.364 130.507 99.886  1.00 11.64  ?  517  GLN A CB    1 
ATOM   310   C  CG    . GLN A 1 645  ? 145.586 131.776 99.075  1.00 13.37  ?  517  GLN A CG    1 
ATOM   311   C  CD    . GLN A 1 645  ? 145.594 131.536 97.575  1.00 12.69  ?  517  GLN A CD    1 
ATOM   312   O  OE1   . GLN A 1 645  ? 145.300 130.437 97.102  1.00 12.05  ?  517  GLN A OE1   1 
ATOM   313   N  NE2   . GLN A 1 645  ? 145.936 132.570 96.817  1.00 15.16  ?  517  GLN A NE2   1 
ATOM   314   N  N     . PRO A 1 646  ? 144.005 127.760 100.881 1.00 11.77  ?  518  PRO A N     1 
ATOM   315   C  CA    . PRO A 1 646  ? 143.845 126.835 102.009 1.00 10.27  ?  518  PRO A CA    1 
ATOM   316   C  C     . PRO A 1 646  ? 144.809 127.119 103.146 1.00 7.90   ?  518  PRO A C     1 
ATOM   317   O  O     . PRO A 1 646  ? 145.654 128.017 103.068 1.00 9.91   ?  518  PRO A O     1 
ATOM   318   C  CB    . PRO A 1 646  ? 144.106 125.459 101.381 1.00 15.25  ?  518  PRO A CB    1 
ATOM   319   C  CG    . PRO A 1 646  ? 144.847 125.741 100.129 1.00 19.78  ?  518  PRO A CG    1 
ATOM   320   C  CD    . PRO A 1 646  ? 144.329 127.052 99.633  1.00 15.66  ?  518  PRO A CD    1 
ATOM   321   N  N     . LEU A 1 647  ? 144.682 126.328 104.208 1.00 8.82   ?  519  LEU A N     1 
ATOM   322   C  CA    . LEU A 1 647  ? 145.342 126.644 105.469 1.00 5.27   ?  519  LEU A CA    1 
ATOM   323   C  C     . LEU A 1 647  ? 146.854 126.515 105.364 1.00 10.22  ?  519  LEU A C     1 
ATOM   324   O  O     . LEU A 1 647  ? 147.592 127.487 105.585 1.00 13.47  ?  519  LEU A O     1 
ATOM   325   C  CB    . LEU A 1 647  ? 144.814 125.726 106.569 1.00 5.04   ?  519  LEU A CB    1 
ATOM   326   C  CG    . LEU A 1 647  ? 143.736 126.322 107.465 1.00 4.09   ?  519  LEU A CG    1 
ATOM   327   C  CD1   . LEU A 1 647  ? 144.377 127.275 108.454 1.00 6.73   ?  519  LEU A CD1   1 
ATOM   328   C  CD2   . LEU A 1 647  ? 142.678 127.018 106.639 1.00 3.10   ?  519  LEU A CD2   1 
ATOM   329   N  N     . HIS A 1 648  ? 147.332 125.309 105.051 1.00 14.23  ?  520  HIS A N     1 
ATOM   330   C  CA    . HIS A 1 648  ? 148.761 125.039 105.146 1.00 18.44  ?  520  HIS A CA    1 
ATOM   331   C  C     . HIS A 1 648  ? 149.558 125.962 104.233 1.00 21.12  ?  520  HIS A C     1 
ATOM   332   O  O     . HIS A 1 648  ? 150.642 126.426 104.605 1.00 24.79  ?  520  HIS A O     1 
ATOM   333   C  CB    . HIS A 1 648  ? 149.041 123.569 104.829 1.00 20.92  ?  520  HIS A CB    1 
ATOM   334   C  CG    . HIS A 1 648  ? 148.886 123.223 103.382 1.00 28.67  ?  520  HIS A CG    1 
ATOM   335   N  ND1   . HIS A 1 648  ? 149.845 123.523 102.438 1.00 30.80  ?  520  HIS A ND1   1 
ATOM   336   C  CD2   . HIS A 1 648  ? 147.878 122.614 102.715 1.00 38.09  ?  520  HIS A CD2   1 
ATOM   337   C  CE1   . HIS A 1 648  ? 149.436 123.110 101.253 1.00 32.82  ?  520  HIS A CE1   1 
ATOM   338   N  NE2   . HIS A 1 648  ? 148.246 122.554 101.393 1.00 42.98  ?  520  HIS A NE2   1 
ATOM   339   N  N     . THR A 1 649  ? 149.021 126.276 103.048 1.00 19.59  ?  521  THR A N     1 
ATOM   340   C  CA    . THR A 1 649  ? 149.744 127.175 102.153 1.00 21.68  ?  521  THR A CA    1 
ATOM   341   C  C     . THR A 1 649  ? 149.710 128.614 102.653 1.00 19.80  ?  521  THR A C     1 
ATOM   342   O  O     . THR A 1 649  ? 150.654 129.368 102.405 1.00 20.05  ?  521  THR A O     1 
ATOM   343   C  CB    . THR A 1 649  ? 149.191 127.100 100.729 1.00 23.61  ?  521  THR A CB    1 
ATOM   344   O  OG1   . THR A 1 649  ? 149.962 127.959 99.878  1.00 19.95  ?  521  THR A OG1   1 
ATOM   345   C  CG2   . THR A 1 649  ? 147.755 127.552 100.692 1.00 21.54  ?  521  THR A CG2   1 
ATOM   346   N  N     . LEU A 1 650  ? 148.659 129.010 103.376 1.00 16.19  ?  522  LEU A N     1 
ATOM   347   C  CA    . LEU A 1 650  ? 148.650 130.338 103.986 1.00 15.43  ?  522  LEU A CA    1 
ATOM   348   C  C     . LEU A 1 650  ? 149.726 130.448 105.058 1.00 14.89  ?  522  LEU A C     1 
ATOM   349   O  O     . LEU A 1 650  ? 150.485 131.425 105.096 1.00 15.88  ?  522  LEU A O     1 
ATOM   350   C  CB    . LEU A 1 650  ? 147.277 130.644 104.583 1.00 10.20  ?  522  LEU A CB    1 
ATOM   351   C  CG    . LEU A 1 650  ? 147.166 131.969 105.348 1.00 8.10   ?  522  LEU A CG    1 
ATOM   352   C  CD1   . LEU A 1 650  ? 145.881 132.677 104.975 1.00 7.85   ?  522  LEU A CD1   1 
ATOM   353   C  CD2   . LEU A 1 650  ? 147.233 131.751 106.853 1.00 8.25   ?  522  LEU A CD2   1 
ATOM   354   N  N     . ARG A 1 651  ? 149.794 129.457 105.952 1.00 15.78  ?  523  ARG A N     1 
ATOM   355   C  CA    . ARG A 1 651  ? 150.838 129.477 106.971 1.00 19.30  ?  523  ARG A CA    1 
ATOM   356   C  C     . ARG A 1 651  ? 152.222 129.457 106.334 1.00 17.08  ?  523  ARG A C     1 
ATOM   357   O  O     . ARG A 1 651  ? 153.122 130.188 106.765 1.00 20.74  ?  523  ARG A O     1 
ATOM   358   C  CB    . ARG A 1 651  ? 150.670 128.303 107.934 1.00 18.40  ?  523  ARG A CB    1 
ATOM   359   C  CG    . ARG A 1 651  ? 149.874 128.651 109.181 1.00 19.79  ?  523  ARG A CG    1 
ATOM   360   C  CD    . ARG A 1 651  ? 150.026 127.603 110.273 1.00 27.21  ?  523  ARG A CD    1 
ATOM   361   N  NE    . ARG A 1 651  ? 149.284 126.382 109.975 1.00 29.45  ?  523  ARG A NE    1 
ATOM   362   C  CZ    . ARG A 1 651  ? 149.794 125.333 109.338 1.00 32.06  ?  523  ARG A CZ    1 
ATOM   363   N  NH1   . ARG A 1 651  ? 151.060 125.349 108.940 1.00 33.18  ?  523  ARG A NH1   1 
ATOM   364   N  NH2   . ARG A 1 651  ? 149.042 124.266 109.106 1.00 29.61  ?  523  ARG A NH2   1 
ATOM   365   N  N     . ASN A 1 652  ? 152.406 128.634 105.297 1.00 22.43  ?  524  ASN A N     1 
ATOM   366   C  CA    . ASN A 1 652  ? 153.678 128.610 104.581 1.00 27.09  ?  524  ASN A CA    1 
ATOM   367   C  C     . ASN A 1 652  ? 153.997 129.974 103.976 1.00 26.81  ?  524  ASN A C     1 
ATOM   368   O  O     . ASN A 1 652  ? 155.150 130.421 104.008 1.00 29.76  ?  524  ASN A O     1 
ATOM   369   C  CB    . ASN A 1 652  ? 153.642 127.528 103.500 1.00 33.53  ?  524  ASN A CB    1 
ATOM   370   C  CG    . ASN A 1 652  ? 155.013 127.236 102.910 1.00 37.53  ?  524  ASN A CG    1 
ATOM   371   O  OD1   . ASN A 1 652  ? 156.042 127.545 103.512 1.00 39.88  ?  524  ASN A OD1   1 
ATOM   372   N  ND2   . ASN A 1 652  ? 155.029 126.635 101.725 1.00 35.86  ?  524  ASN A ND2   1 
ATOM   373   N  N     . ALA A 1 653  ? 152.987 130.653 103.423 1.00 23.62  ?  525  ALA A N     1 
ATOM   374   C  CA    . ALA A 1 653  ? 153.183 131.988 102.873 1.00 20.09  ?  525  ALA A CA    1 
ATOM   375   C  C     . ALA A 1 653  ? 153.488 133.013 103.953 1.00 17.11  ?  525  ALA A C     1 
ATOM   376   O  O     . ALA A 1 653  ? 154.089 134.052 103.657 1.00 17.11  ?  525  ALA A O     1 
ATOM   377   C  CB    . ALA A 1 653  ? 151.944 132.421 102.088 1.00 21.40  ?  525  ALA A CB    1 
ATOM   378   N  N     . GLU A 1 654  ? 153.083 132.746 105.192 1.00 17.16  ?  526  GLU A N     1 
ATOM   379   C  CA    . GLU A 1 654  ? 153.371 133.665 106.283 1.00 16.37  ?  526  GLU A CA    1 
ATOM   380   C  C     . GLU A 1 654  ? 154.807 133.531 106.783 1.00 20.63  ?  526  GLU A C     1 
ATOM   381   O  O     . GLU A 1 654  ? 155.388 134.520 107.247 1.00 19.93  ?  526  GLU A O     1 
ATOM   382   C  CB    . GLU A 1 654  ? 152.362 133.433 107.416 1.00 17.23  ?  526  GLU A CB    1 
ATOM   383   C  CG    . GLU A 1 654  ? 152.759 133.963 108.791 1.00 28.42  ?  526  GLU A CG    1 
ATOM   384   C  CD    . GLU A 1 654  ? 153.619 132.989 109.583 1.00 48.63  ?  526  GLU A CD    1 
ATOM   385   O  OE1   . GLU A 1 654  ? 153.901 131.884 109.070 1.00 34.90  ?  526  GLU A OE1   1 
ATOM   386   O  OE2   . GLU A 1 654  ? 154.026 133.332 110.712 1.00 151.04 -1 526  GLU A OE2   1 
ATOM   387   N  N     . LYS A 1 655  ? 155.399 132.334 106.665 1.00 21.91  ?  527  LYS A N     1 
ATOM   388   C  CA    . LYS A 1 655  ? 156.662 132.009 107.331 1.00 21.34  ?  527  LYS A CA    1 
ATOM   389   C  C     . LYS A 1 655  ? 157.772 133.022 107.078 1.00 18.00  ?  527  LYS A C     1 
ATOM   390   O  O     . LYS A 1 655  ? 158.698 133.129 107.891 1.00 16.06  ?  527  LYS A O     1 
ATOM   391   C  CB    . LYS A 1 655  ? 157.141 130.625 106.891 1.00 20.48  ?  527  LYS A CB    1 
ATOM   392   C  CG    . LYS A 1 655  ? 158.314 130.087 107.694 1.00 19.99  ?  527  LYS A CG    1 
ATOM   393   C  CD    . LYS A 1 655  ? 158.106 128.628 108.035 1.00 27.73  ?  527  LYS A CD    1 
ATOM   394   C  CE    . LYS A 1 655  ? 156.778 128.427 108.745 1.00 30.03  ?  527  LYS A CE    1 
ATOM   395   N  NZ    . LYS A 1 655  ? 156.539 127.003 109.106 1.00 37.71  ?  527  LYS A NZ    1 
ATOM   396   N  N     . GLU A 1 656  ? 157.712 133.762 105.974 1.00 18.11  ?  528  GLU A N     1 
ATOM   397   C  CA    . GLU A 1 656  ? 158.737 134.752 105.683 1.00 19.57  ?  528  GLU A CA    1 
ATOM   398   C  C     . GLU A 1 656  ? 158.424 136.127 106.259 1.00 13.75  ?  528  GLU A C     1 
ATOM   399   O  O     . GLU A 1 656  ? 159.266 137.028 106.159 1.00 13.86  ?  528  GLU A O     1 
ATOM   400   C  CB    . GLU A 1 656  ? 158.940 134.867 104.173 1.00 23.60  ?  528  GLU A CB    1 
ATOM   401   C  CG    . GLU A 1 656  ? 157.974 135.812 103.497 1.00 29.14  ?  528  GLU A CG    1 
ATOM   402   C  CD    . GLU A 1 656  ? 158.126 135.802 101.995 1.00 59.41  ?  528  GLU A CD    1 
ATOM   403   O  OE1   . GLU A 1 656  ? 158.324 134.710 101.422 1.00 53.36  ?  528  GLU A OE1   1 
ATOM   404   O  OE2   . GLU A 1 656  ? 158.062 136.890 101.388 1.00 149.82 -1 528  GLU A OE2   1 
ATOM   405   N  N     . LEU A 1 657  ? 157.248 136.315 106.857 1.00 10.28  ?  529  LEU A N     1 
ATOM   406   C  CA    . LEU A 1 657  ? 156.939 137.603 107.466 1.00 9.47   ?  529  LEU A CA    1 
ATOM   407   C  C     . LEU A 1 657  ? 157.487 137.706 108.884 1.00 12.18  ?  529  LEU A C     1 
ATOM   408   O  O     . LEU A 1 657  ? 158.015 138.756 109.270 1.00 9.19   ?  529  LEU A O     1 
ATOM   409   C  CB    . LEU A 1 657  ? 155.435 137.838 107.458 1.00 7.38   ?  529  LEU A CB    1 
ATOM   410   C  CG    . LEU A 1 657  ? 154.958 138.512 106.178 1.00 2.21   ?  529  LEU A CG    1 
ATOM   411   C  CD1   . LEU A 1 657  ? 153.455 138.483 106.134 1.00 9.74   ?  529  LEU A CD1   1 
ATOM   412   C  CD2   . LEU A 1 657  ? 155.486 139.935 106.109 1.00 2.54   ?  529  LEU A CD2   1 
ATOM   413   N  N     . LEU A 1 658  ? 157.363 136.635 109.672 1.00 11.30  ?  530  LEU A N     1 
ATOM   414   C  CA    . LEU A 1 658  ? 157.946 136.557 111.007 1.00 8.14   ?  530  LEU A CA    1 
ATOM   415   C  C     . LEU A 1 658  ? 159.439 136.848 110.959 1.00 6.66   ?  530  LEU A C     1 
ATOM   416   O  O     . LEU A 1 658  ? 160.065 136.724 109.900 1.00 9.35   ?  530  LEU A O     1 
ATOM   417   C  CB    . LEU A 1 658  ? 157.717 135.173 111.620 1.00 7.52   ?  530  LEU A CB    1 
ATOM   418   C  CG    . LEU A 1 658  ? 156.334 134.808 112.141 1.00 7.19   ?  530  LEU A CG    1 
ATOM   419   C  CD1   . LEU A 1 658  ? 156.370 133.444 112.798 1.00 7.82   ?  530  LEU A CD1   1 
ATOM   420   C  CD2   . LEU A 1 658  ? 155.938 135.848 113.151 1.00 7.74   ?  530  LEU A CD2   1 
ATOM   421   N  N     . PRO A 1 659  ? 160.047 137.233 112.075 1.00 3.63   ?  531  PRO A N     1 
ATOM   422   C  CA    . PRO A 1 659  ? 161.506 137.339 112.103 1.00 3.57   ?  531  PRO A CA    1 
ATOM   423   C  C     . PRO A 1 659  ? 162.159 135.978 111.938 1.00 4.25   ?  531  PRO A C     1 
ATOM   424   O  O     . PRO A 1 659  ? 161.578 134.934 112.251 1.00 4.05   ?  531  PRO A O     1 
ATOM   425   C  CB    . PRO A 1 659  ? 161.792 137.934 113.486 1.00 5.39   ?  531  PRO A CB    1 
ATOM   426   C  CG    . PRO A 1 659  ? 160.590 137.588 114.292 1.00 4.86   ?  531  PRO A CG    1 
ATOM   427   C  CD    . PRO A 1 659  ? 159.441 137.670 113.343 1.00 4.03   ?  531  PRO A CD    1 
ATOM   428   N  N     . GLY A 1 660  ? 163.383 136.003 111.420 1.00 6.52   ?  532  GLY A N     1 
ATOM   429   C  CA    . GLY A 1 660  ? 164.175 134.799 111.285 1.00 10.13  ?  532  GLY A CA    1 
ATOM   430   C  C     . GLY A 1 660  ? 164.101 134.167 109.912 1.00 10.11  ?  532  GLY A C     1 
ATOM   431   O  O     . GLY A 1 660  ? 164.105 132.939 109.796 1.00 16.85  ?  532  GLY A O     1 
ATOM   432   N  N     . PHE A 1 661  ? 164.034 134.980 108.870 1.00 10.34  ?  533  PHE A N     1 
ATOM   433   C  CA    . PHE A 1 661  ? 163.944 134.426 107.524 1.00 15.05  ?  533  PHE A CA    1 
ATOM   434   C  C     . PHE A 1 661  ? 164.991 134.978 106.574 1.00 13.90  ?  533  PHE A C     1 
ATOM   435   O  O     . PHE A 1 661  ? 165.501 134.236 105.731 1.00 17.89  ?  533  PHE A O     1 
ATOM   436   C  CB    . PHE A 1 661  ? 162.552 134.683 106.938 1.00 15.36  ?  533  PHE A CB    1 
ATOM   437   C  CG    . PHE A 1 661  ? 162.328 134.014 105.621 1.00 16.05  ?  533  PHE A CG    1 
ATOM   438   C  CD1   . PHE A 1 661  ? 161.953 132.684 105.569 1.00 14.76  ?  533  PHE A CD1   1 
ATOM   439   C  CD2   . PHE A 1 661  ? 162.508 134.705 104.435 1.00 11.99  ?  533  PHE A CD2   1 
ATOM   440   C  CE1   . PHE A 1 661  ? 161.751 132.057 104.359 1.00 22.49  ?  533  PHE A CE1   1 
ATOM   441   C  CE2   . PHE A 1 661  ? 162.309 134.084 103.221 1.00 19.08  ?  533  PHE A CE2   1 
ATOM   442   C  CZ    . PHE A 1 661  ? 161.929 132.757 103.182 1.00 25.78  ?  533  PHE A CZ    1 
ATOM   443   N  N     . HIS A 1 662  ? 165.320 136.257 106.680 1.00 14.05  ?  534  HIS A N     1 
ATOM   444   C  CA    . HIS A 1 662  ? 166.201 136.901 105.719 1.00 15.84  ?  534  HIS A CA    1 
ATOM   445   C  C     . HIS A 1 662  ? 167.635 136.852 106.222 1.00 21.83  ?  534  HIS A C     1 
ATOM   446   O  O     . HIS A 1 662  ? 167.947 137.407 107.280 1.00 25.84  ?  534  HIS A O     1 
ATOM   447   C  CB    . HIS A 1 662  ? 165.765 138.340 105.483 1.00 17.04  ?  534  HIS A CB    1 
ATOM   448   C  CG    . HIS A 1 662  ? 164.359 138.458 104.997 1.00 9.14   ?  534  HIS A CG    1 
ATOM   449   N  ND1   . HIS A 1 662  ? 163.985 138.100 103.720 1.00 14.00  ?  534  HIS A ND1   1 
ATOM   450   C  CD2   . HIS A 1 662  ? 163.237 138.908 105.607 1.00 12.24  ?  534  HIS A CD2   1 
ATOM   451   C  CE1   . HIS A 1 662  ? 162.692 138.317 103.566 1.00 10.01  ?  534  HIS A CE1   1 
ATOM   452   N  NE2   . HIS A 1 662  ? 162.214 138.810 104.695 1.00 14.83  ?  534  HIS A NE2   1 
ATOM   453   N  N     . GLN A 1 663  ? 168.501 136.195 105.458 1.00 28.05  ?  535  GLN A N     1 
ATOM   454   C  CA    . GLN A 1 663  ? 169.913 136.157 105.802 1.00 31.79  ?  535  GLN A CA    1 
ATOM   455   C  C     . GLN A 1 663  ? 170.512 137.556 105.737 1.00 36.10  ?  535  GLN A C     1 
ATOM   456   O  O     . GLN A 1 663  ? 170.271 138.306 104.785 1.00 37.50  ?  535  GLN A O     1 
ATOM   457   C  CB    . GLN A 1 663  ? 170.652 135.215 104.858 1.00 33.19  ?  535  GLN A CB    1 
ATOM   458   C  CG    . GLN A 1 663  ? 172.136 135.124 105.116 1.00 38.84  ?  535  GLN A CG    1 
ATOM   459   C  CD    . GLN A 1 663  ? 172.901 134.742 103.871 1.00 54.00  ?  535  GLN A CD    1 
ATOM   460   O  OE1   . GLN A 1 663  ? 172.350 134.741 102.770 1.00 50.50  ?  535  GLN A OE1   1 
ATOM   461   N  NE2   . GLN A 1 663  ? 174.177 134.417 104.036 1.00 65.30  ?  535  GLN A NE2   1 
ATOM   462   N  N     . PHE A 1 664  ? 171.291 137.908 106.757 1.00 34.54  ?  536  PHE A N     1 
ATOM   463   C  CA    . PHE A 1 664  ? 171.876 139.235 106.863 1.00 37.33  ?  536  PHE A CA    1 
ATOM   464   C  C     . PHE A 1 664  ? 173.311 139.123 107.348 1.00 41.64  ?  536  PHE A C     1 
ATOM   465   O  O     . PHE A 1 664  ? 173.780 138.051 107.741 1.00 38.73  ?  536  PHE A O     1 
ATOM   466   C  CB    . PHE A 1 664  ? 171.070 140.136 107.806 1.00 33.47  ?  536  PHE A CB    1 
ATOM   467   C  CG    . PHE A 1 664  ? 170.779 139.522 109.142 1.00 29.81  ?  536  PHE A CG    1 
ATOM   468   C  CD1   . PHE A 1 664  ? 171.745 139.475 110.132 1.00 33.69  ?  536  PHE A CD1   1 
ATOM   469   C  CD2   . PHE A 1 664  ? 169.529 138.999 109.411 1.00 27.31  ?  536  PHE A CD2   1 
ATOM   470   C  CE1   . PHE A 1 664  ? 171.467 138.913 111.361 1.00 31.31  ?  536  PHE A CE1   1 
ATOM   471   C  CE2   . PHE A 1 664  ? 169.248 138.436 110.639 1.00 23.51  ?  536  PHE A CE2   1 
ATOM   472   C  CZ    . PHE A 1 664  ? 170.216 138.394 111.615 1.00 25.07  ?  536  PHE A CZ    1 
ATOM   473   N  N     . GLU A 1 665  ? 174.004 140.259 107.337 1.00 47.72  ?  537  GLU A N     1 
ATOM   474   C  CA    . GLU A 1 665  ? 175.386 140.307 107.779 1.00 49.06  ?  537  GLU A CA    1 
ATOM   475   C  C     . GLU A 1 665  ? 175.576 141.476 108.734 1.00 45.18  ?  537  GLU A C     1 
ATOM   476   O  O     . GLU A 1 665  ? 174.821 142.450 108.719 1.00 45.83  ?  537  GLU A O     1 
ATOM   477   C  CB    . GLU A 1 665  ? 176.339 140.422 106.587 1.00 60.19  ?  537  GLU A CB    1 
ATOM   478   C  CG    . GLU A 1 665  ? 177.733 139.913 106.864 1.00 83.78  ?  537  GLU A CG    1 
ATOM   479   C  CD    . GLU A 1 665  ? 178.502 139.641 105.594 1.00 127.47 ?  537  GLU A CD    1 
ATOM   480   O  OE1   . GLU A 1 665  ? 177.864 139.291 104.578 1.00 118.93 ?  537  GLU A OE1   1 
ATOM   481   O  OE2   . GLU A 1 665  ? 179.743 139.777 105.607 1.00 189.80 -1 537  GLU A OE2   1 
ATOM   482   N  N     . TRP A 1 666  ? 176.603 141.373 109.571 1.00 41.84  ?  538  TRP A N     1 
ATOM   483   C  CA    . TRP A 1 666  ? 176.886 142.391 110.572 1.00 42.56  ?  538  TRP A CA    1 
ATOM   484   C  C     . TRP A 1 666  ? 178.368 142.735 110.522 1.00 48.61  ?  538  TRP A C     1 
ATOM   485   O  O     . TRP A 1 666  ? 179.214 141.838 110.604 1.00 50.03  ?  538  TRP A O     1 
ATOM   486   C  CB    . TRP A 1 666  ? 176.478 141.904 111.968 1.00 38.38  ?  538  TRP A CB    1 
ATOM   487   C  CG    . TRP A 1 666  ? 175.791 142.956 112.770 1.00 36.92  ?  538  TRP A CG    1 
ATOM   488   C  CD1   . TRP A 1 666  ? 176.380 143.990 113.428 1.00 45.12  ?  538  TRP A CD1   1 
ATOM   489   C  CD2   . TRP A 1 666  ? 174.383 143.092 112.991 1.00 29.41  ?  538  TRP A CD2   1 
ATOM   490   N  NE1   . TRP A 1 666  ? 175.433 144.763 114.049 1.00 40.40  ?  538  TRP A NE1   1 
ATOM   491   C  CE2   . TRP A 1 666  ? 174.196 144.233 113.795 1.00 30.28  ?  538  TRP A CE2   1 
ATOM   492   C  CE3   . TRP A 1 666  ? 173.264 142.359 112.591 1.00 24.73  ?  538  TRP A CE3   1 
ATOM   493   C  CZ2   . TRP A 1 666  ? 172.940 144.657 114.207 1.00 19.57  ?  538  TRP A CZ2   1 
ATOM   494   C  CZ3   . TRP A 1 666  ? 172.019 142.784 112.999 1.00 23.76  ?  538  TRP A CZ3   1 
ATOM   495   C  CH2   . TRP A 1 666  ? 171.866 143.922 113.798 1.00 21.02  ?  538  TRP A CH2   1 
ATOM   496   N  N     . GLN A 1 667  ? 178.683 144.020 110.380 1.00 46.90  ?  539  GLN A N     1 
ATOM   497   C  CA    . GLN A 1 667  ? 180.071 144.464 110.234 1.00 45.04  ?  539  GLN A CA    1 
ATOM   498   C  C     . GLN A 1 667  ? 180.448 145.422 111.353 1.00 41.69  ?  539  GLN A C     1 
ATOM   499   O  O     . GLN A 1 667  ? 179.945 146.562 111.381 1.00 42.73  ?  539  GLN A O     1 
ATOM   500   C  CB    . GLN A 1 667  ? 180.286 145.135 108.879 1.00 50.22  ?  539  GLN A CB    1 
ATOM   501   C  CG    . GLN A 1 667  ? 180.645 144.184 107.754 1.00 53.47  ?  539  GLN A CG    1 
ATOM   502   C  CD    . GLN A 1 667  ? 180.917 144.911 106.452 1.00 51.70  ?  539  GLN A CD    1 
ATOM   503   O  OE1   . GLN A 1 667  ? 180.729 146.124 106.355 1.00 50.03  ?  539  GLN A OE1   1 
ATOM   504   N  NE2   . GLN A 1 667  ? 181.366 144.173 105.444 1.00 56.90  ?  539  GLN A NE2   1 
ATOM   505   N  N     . PRO A 1 668  ? 181.308 145.023 112.303 1.00 46.13  ?  540  PRO A N     1 
ATOM   506   C  CA    . PRO A 1 668  ? 181.879 143.677 112.406 1.00 49.87  ?  540  PRO A CA    1 
ATOM   507   C  C     . PRO A 1 668  ? 180.926 142.704 113.082 1.00 48.19  ?  540  PRO A C     1 
ATOM   508   O  O     . PRO A 1 668  ? 179.758 143.043 113.272 1.00 49.99  ?  540  PRO A O     1 
ATOM   509   C  CB    . PRO A 1 668  ? 183.117 143.897 113.270 1.00 56.50  ?  540  PRO A CB    1 
ATOM   510   C  CG    . PRO A 1 668  ? 182.715 145.011 114.173 1.00 50.78  ?  540  PRO A CG    1 
ATOM   511   C  CD    . PRO A 1 668  ? 181.868 145.928 113.324 1.00 47.45  ?  540  PRO A CD    1 
ATOM   512   N  N     . ALA A 1 669  ? 181.417 141.518 113.438 1.00 53.06  ?  541  ALA A N     1 
ATOM   513   C  CA    . ALA A 1 669  ? 180.621 140.603 114.242 1.00 55.76  ?  541  ALA A CA    1 
ATOM   514   C  C     . ALA A 1 669  ? 180.211 141.282 115.542 1.00 55.25  ?  541  ALA A C     1 
ATOM   515   O  O     . ALA A 1 669  ? 180.971 142.065 116.121 1.00 52.42  ?  541  ALA A O     1 
ATOM   516   C  CB    . ALA A 1 669  ? 181.404 139.323 114.534 1.00 55.06  ?  541  ALA A CB    1 
ATOM   517   N  N     . LEU A 1 670  ? 178.995 140.991 115.993 1.00 44.39  ?  542  LEU A N     1 
ATOM   518   C  CA    . LEU A 1 670  ? 178.453 141.688 117.146 1.00 37.20  ?  542  LEU A CA    1 
ATOM   519   C  C     . LEU A 1 670  ? 179.150 141.251 118.430 1.00 37.07  ?  542  LEU A C     1 
ATOM   520   O  O     . LEU A 1 670  ? 179.810 140.210 118.495 1.00 38.58  ?  542  LEU A O     1 
ATOM   521   C  CB    . LEU A 1 670  ? 176.949 141.458 117.257 1.00 33.74  ?  542  LEU A CB    1 
ATOM   522   C  CG    . LEU A 1 670  ? 176.163 142.688 116.810 1.00 31.21  ?  542  LEU A CG    1 
ATOM   523   C  CD1   . LEU A 1 670  ? 174.695 142.368 116.589 1.00 30.19  ?  542  LEU A CD1   1 
ATOM   524   C  CD2   . LEU A 1 670  ? 176.333 143.793 117.836 1.00 30.02  ?  542  LEU A CD2   1 
ATOM   525   N  N     . LYS A 1 671  ? 178.994 142.074 119.462 1.00 35.27  ?  543  LYS A N     1 
ATOM   526   C  CA    . LYS A 1 671  ? 179.615 141.812 120.754 1.00 38.64  ?  543  LYS A CA    1 
ATOM   527   C  C     . LYS A 1 671  ? 178.788 140.767 121.490 1.00 37.06  ?  543  LYS A C     1 
ATOM   528   O  O     . LYS A 1 671  ? 177.637 141.027 121.859 1.00 34.63  ?  543  LYS A O     1 
ATOM   529   C  CB    . LYS A 1 671  ? 179.730 143.101 121.562 1.00 41.45  ?  543  LYS A CB    1 
ATOM   530   C  CG    . LYS A 1 671  ? 181.111 143.340 122.147 1.00 46.76  ?  543  LYS A CG    1 
ATOM   531   C  CD    . LYS A 1 671  ? 182.172 143.316 121.058 1.00 50.33  ?  543  LYS A CD    1 
ATOM   532   C  CE    . LYS A 1 671  ? 183.563 143.499 121.635 1.00 54.07  ?  543  LYS A CE    1 
ATOM   533   N  NZ    . LYS A 1 671  ? 183.854 142.478 122.678 1.00 56.36  ?  543  LYS A NZ    1 
ATOM   534   N  N     . ASN A 1 672  ? 179.378 139.588 121.691 1.00 37.36  ?  544  ASN A N     1 
ATOM   535   C  CA    . ASN A 1 672  ? 178.788 138.471 122.436 1.00 33.96  ?  544  ASN A CA    1 
ATOM   536   C  C     . ASN A 1 672  ? 177.335 138.213 122.021 1.00 28.88  ?  544  ASN A C     1 
ATOM   537   O  O     . ASN A 1 672  ? 176.404 138.212 122.830 1.00 28.38  ?  544  ASN A O     1 
ATOM   538   C  CB    . ASN A 1 672  ? 178.917 138.691 123.949 1.00 33.55  ?  544  ASN A CB    1 
ATOM   539   C  CG    . ASN A 1 672  ? 178.118 139.876 124.450 1.00 33.99  ?  544  ASN A CG    1 
ATOM   540   O  OD1   . ASN A 1 672  ? 178.631 140.991 124.546 1.00 35.52  ?  544  ASN A OD1   1 
ATOM   541   N  ND2   . ASN A 1 672  ? 176.848 139.643 124.761 1.00 32.16  ?  544  ASN A ND2   1 
ATOM   542   N  N     . VAL A 1 673  ? 177.165 137.973 120.722 1.00 30.49  ?  545  VAL A N     1 
ATOM   543   C  CA    . VAL A 1 673  ? 175.870 137.673 120.123 1.00 28.29  ?  545  VAL A CA    1 
ATOM   544   C  C     . VAL A 1 673  ? 176.096 136.626 119.042 1.00 27.92  ?  545  VAL A C     1 
ATOM   545   O  O     . VAL A 1 673  ? 176.820 136.885 118.074 1.00 34.97  ?  545  VAL A O     1 
ATOM   546   C  CB    . VAL A 1 673  ? 175.207 138.920 119.515 1.00 29.78  ?  545  VAL A CB    1 
ATOM   547   C  CG1   . VAL A 1 673  ? 173.979 138.524 118.719 1.00 31.88  ?  545  VAL A CG1   1 
ATOM   548   C  CG2   . VAL A 1 673  ? 174.858 139.925 120.599 1.00 36.71  ?  545  VAL A CG2   1 
ATOM   549   N  N     . SER A 1 674  ? 175.484 135.453 119.198 1.00 28.89  ?  546  SER A N     1 
ATOM   550   C  CA    . SER A 1 674  ? 175.689 134.381 118.231 1.00 32.87  ?  546  SER A CA    1 
ATOM   551   C  C     . SER A 1 674  ? 175.188 134.805 116.856 1.00 34.77  ?  546  SER A C     1 
ATOM   552   O  O     . SER A 1 674  ? 174.132 135.431 116.725 1.00 34.12  ?  546  SER A O     1 
ATOM   553   C  CB    . SER A 1 674  ? 174.982 133.104 118.684 1.00 33.74  ?  546  SER A CB    1 
ATOM   554   O  OG    . SER A 1 674  ? 175.210 132.047 117.766 1.00 34.44  ?  546  SER A OG    1 
ATOM   555   N  N     . THR A 1 675  ? 175.959 134.455 115.825 1.00 39.97  ?  547  THR A N     1 
ATOM   556   C  CA    . THR A 1 675  ? 175.744 134.985 114.485 1.00 42.07  ?  547  THR A CA    1 
ATOM   557   C  C     . THR A 1 675  ? 174.565 134.347 113.763 1.00 34.24  ?  547  THR A C     1 
ATOM   558   O  O     . THR A 1 675  ? 174.141 134.879 112.730 1.00 32.85  ?  547  THR A O     1 
ATOM   559   C  CB    . THR A 1 675  ? 177.011 134.808 113.636 1.00 48.10  ?  547  THR A CB    1 
ATOM   560   O  OG1   . THR A 1 675  ? 177.494 133.463 113.761 1.00 43.74  ?  547  THR A OG1   1 
ATOM   561   C  CG2   . THR A 1 675  ? 178.101 135.780 114.080 1.00 48.14  ?  547  THR A CG2   1 
ATOM   562   N  N     . SER A 1 676  ? 174.034 133.236 114.274 1.00 31.40  ?  548  SER A N     1 
ATOM   563   C  CA    . SER A 1 676  ? 172.925 132.557 113.617 1.00 31.31  ?  548  SER A CA    1 
ATOM   564   C  C     . SER A 1 676  ? 171.777 133.527 113.372 1.00 27.78  ?  548  SER A C     1 
ATOM   565   O  O     . SER A 1 676  ? 171.460 134.368 114.218 1.00 27.80  ?  548  SER A O     1 
ATOM   566   C  CB    . SER A 1 676  ? 172.454 131.378 114.467 1.00 35.38  ?  548  SER A CB    1 
ATOM   567   O  OG    . SER A 1 676  ? 171.421 130.660 113.815 1.00 36.64  ?  548  SER A OG    1 
ATOM   568   N  N     . TRP A 1 677  ? 171.159 133.412 112.197 1.00 29.69  ?  549  TRP A N     1 
ATOM   569   C  CA    . TRP A 1 677  ? 170.188 134.398 111.741 1.00 24.50  ?  549  TRP A CA    1 
ATOM   570   C  C     . TRP A 1 677  ? 168.794 133.825 111.518 1.00 24.87  ?  549  TRP A C     1 
ATOM   571   O  O     . TRP A 1 677  ? 167.921 134.543 111.017 1.00 25.24  ?  549  TRP A O     1 
ATOM   572   C  CB    . TRP A 1 677  ? 170.678 135.068 110.451 1.00 29.79  ?  549  TRP A CB    1 
ATOM   573   C  CG    . TRP A 1 677  ? 170.961 134.111 109.317 1.00 37.61  ?  549  TRP A CG    1 
ATOM   574   C  CD1   . TRP A 1 677  ? 172.164 133.545 109.001 1.00 39.99  ?  549  TRP A CD1   1 
ATOM   575   C  CD2   . TRP A 1 677  ? 170.023 133.618 108.349 1.00 37.03  ?  549  TRP A CD2   1 
ATOM   576   N  NE1   . TRP A 1 677  ? 172.032 132.733 107.900 1.00 41.61  ?  549  TRP A NE1   1 
ATOM   577   C  CE2   . TRP A 1 677  ? 170.728 132.759 107.481 1.00 38.65  ?  549  TRP A CE2   1 
ATOM   578   C  CE3   . TRP A 1 677  ? 168.656 133.818 108.134 1.00 29.84  ?  549  TRP A CE3   1 
ATOM   579   C  CZ2   . TRP A 1 677  ? 170.112 132.103 106.418 1.00 36.15  ?  549  TRP A CZ2   1 
ATOM   580   C  CZ3   . TRP A 1 677  ? 168.048 133.166 107.078 1.00 26.73  ?  549  TRP A CZ3   1 
ATOM   581   C  CH2   . TRP A 1 677  ? 168.775 132.320 106.233 1.00 31.49  ?  549  TRP A CH2   1 
ATOM   582   N  N     . ASP A 1 678  ? 168.548 132.566 111.874 1.00 30.88  ?  550  ASP A N     1 
ATOM   583   C  CA    . ASP A 1 678  ? 167.270 131.936 111.569 1.00 31.16  ?  550  ASP A CA    1 
ATOM   584   C  C     . ASP A 1 678  ? 166.448 131.575 112.799 1.00 28.64  ?  550  ASP A C     1 
ATOM   585   O  O     . ASP A 1 678  ? 165.373 130.984 112.650 1.00 26.91  ?  550  ASP A O     1 
ATOM   586   C  CB    . ASP A 1 678  ? 167.489 130.681 110.719 1.00 37.62  ?  550  ASP A CB    1 
ATOM   587   C  CG    . ASP A 1 678  ? 167.758 129.450 111.559 1.00 64.06  ?  550  ASP A CG    1 
ATOM   588   O  OD1   . ASP A 1 678  ? 168.616 129.519 112.465 1.00 53.24  ?  550  ASP A OD1   1 
ATOM   589   O  OD2   . ASP A 1 678  ? 167.098 128.418 111.323 1.00 145.84 -1 550  ASP A OD2   1 
ATOM   590   N  N     . VAL A 1 679  ? 166.914 131.908 114.003 1.00 24.95  ?  551  VAL A N     1 
ATOM   591   C  CA    . VAL A 1 679  ? 166.175 131.553 115.208 1.00 21.38  ?  551  VAL A CA    1 
ATOM   592   C  C     . VAL A 1 679  ? 164.846 132.297 115.237 1.00 15.08  ?  551  VAL A C     1 
ATOM   593   O  O     . VAL A 1 679  ? 164.755 133.469 114.843 1.00 14.41  ?  551  VAL A O     1 
ATOM   594   C  CB    . VAL A 1 679  ? 167.013 131.848 116.464 1.00 20.44  ?  551  VAL A CB    1 
ATOM   595   C  CG1   . VAL A 1 679  ? 168.053 130.757 116.673 1.00 23.95  ?  551  VAL A CG1   1 
ATOM   596   C  CG2   . VAL A 1 679  ? 167.685 133.202 116.340 1.00 21.29  ?  551  VAL A CG2   1 
ATOM   597   N  N     . GLY A 1 680  ? 163.802 131.610 115.698 1.00 15.02  ?  552  GLY A N     1 
ATOM   598   C  CA    . GLY A 1 680  ? 162.474 132.188 115.747 1.00 9.95   ?  552  GLY A CA    1 
ATOM   599   C  C     . GLY A 1 680  ? 162.150 132.794 117.096 1.00 8.88   ?  552  GLY A C     1 
ATOM   600   O  O     . GLY A 1 680  ? 162.702 133.836 117.463 1.00 8.13   ?  552  GLY A O     1 
ATOM   601   N  N     . ILE A 1 681  ? 161.256 132.158 117.846 1.00 7.68   ?  553  ILE A N     1 
ATOM   602   C  CA    . ILE A 1 681  ? 160.842 132.661 119.149 1.00 7.12   ?  553  ILE A CA    1 
ATOM   603   C  C     . ILE A 1 681  ? 161.709 131.997 120.214 1.00 11.32  ?  553  ILE A C     1 
ATOM   604   O  O     . ILE A 1 681  ? 161.564 130.804 120.495 1.00 12.53  ?  553  ILE A O     1 
ATOM   605   C  CB    . ILE A 1 681  ? 159.351 132.411 119.399 1.00 5.70   ?  553  ILE A CB    1 
ATOM   606   C  CG1   . ILE A 1 681  ? 158.523 133.099 118.312 1.00 2.91   ?  553  ILE A CG1   1 
ATOM   607   C  CG2   . ILE A 1 681  ? 158.954 132.914 120.772 1.00 6.75   ?  553  ILE A CG2   1 
ATOM   608   C  CD1   . ILE A 1 681  ? 157.053 133.210 118.624 1.00 3.87   ?  553  ILE A CD1   1 
ATOM   609   N  N     . ILE A 1 682  ? 162.614 132.774 120.801 1.00 10.19  ?  554  ILE A N     1 
ATOM   610   C  CA    . ILE A 1 682  ? 163.511 132.286 121.841 1.00 11.02  ?  554  ILE A CA    1 
ATOM   611   C  C     . ILE A 1 682  ? 162.754 132.198 123.158 1.00 16.60  ?  554  ILE A C     1 
ATOM   612   O  O     . ILE A 1 682  ? 161.980 133.098 123.507 1.00 17.07  ?  554  ILE A O     1 
ATOM   613   C  CB    . ILE A 1 682  ? 164.737 133.211 121.960 1.00 15.95  ?  554  ILE A CB    1 
ATOM   614   C  CG1   . ILE A 1 682  ? 165.778 132.861 120.899 1.00 16.83  ?  554  ILE A CG1   1 
ATOM   615   C  CG2   . ILE A 1 682  ? 165.360 133.140 123.345 1.00 14.81  ?  554  ILE A CG2   1 
ATOM   616   C  CD1   . ILE A 1 682  ? 167.126 133.479 121.160 1.00 16.53  ?  554  ILE A CD1   1 
ATOM   617   N  N     . ASP A 1 683  ? 162.960 131.104 123.890 1.00 25.94  ?  555  ASP A N     1 
ATOM   618   C  CA    . ASP A 1 683  ? 162.480 131.035 125.264 1.00 31.94  ?  555  ASP A CA    1 
ATOM   619   C  C     . ASP A 1 683  ? 163.157 132.122 126.095 1.00 23.16  ?  555  ASP A C     1 
ATOM   620   O  O     . ASP A 1 683  ? 164.387 132.210 126.139 1.00 26.37  ?  555  ASP A O     1 
ATOM   621   C  CB    . ASP A 1 683  ? 162.750 129.649 125.851 1.00 47.17  ?  555  ASP A CB    1 
ATOM   622   C  CG    . ASP A 1 683  ? 164.132 129.120 125.495 1.00 86.33  ?  555  ASP A CG    1 
ATOM   623   O  OD1   . ASP A 1 683  ? 164.636 129.441 124.397 1.00 63.63  ?  555  ASP A OD1   1 
ATOM   624   O  OD2   . ASP A 1 683  ? 164.713 128.373 126.313 1.00 186.58 -1 555  ASP A OD2   1 
ATOM   625   N  N     . GLY A 1 684  ? 162.347 132.951 126.759 1.00 12.51  ?  556  GLY A N     1 
ATOM   626   C  CA    . GLY A 1 684  ? 162.853 134.212 127.277 1.00 10.93  ?  556  GLY A CA    1 
ATOM   627   C  C     . GLY A 1 684  ? 163.834 134.082 128.427 1.00 7.89   ?  556  GLY A C     1 
ATOM   628   O  O     . GLY A 1 684  ? 164.712 134.936 128.593 1.00 11.36  ?  556  GLY A O     1 
ATOM   629   N  N     . LEU A 1 685  ? 163.702 133.026 129.235 1.00 10.54  ?  557  LEU A N     1 
ATOM   630   C  CA    . LEU A 1 685  ? 164.556 132.860 130.409 1.00 11.13  ?  557  LEU A CA    1 
ATOM   631   C  C     . LEU A 1 685  ? 166.034 132.791 130.055 1.00 13.61  ?  557  LEU A C     1 
ATOM   632   O  O     . LEU A 1 685  ? 166.878 132.992 130.937 1.00 16.18  ?  557  LEU A O     1 
ATOM   633   C  CB    . LEU A 1 685  ? 164.172 131.594 131.179 1.00 10.83  ?  557  LEU A CB    1 
ATOM   634   C  CG    . LEU A 1 685  ? 162.700 131.332 131.514 1.00 20.20  ?  557  LEU A CG    1 
ATOM   635   C  CD1   . LEU A 1 685  ? 161.944 130.673 130.358 1.00 18.27  ?  557  LEU A CD1   1 
ATOM   636   C  CD2   . LEU A 1 685  ? 162.585 130.501 132.788 1.00 22.30  ?  557  LEU A CD2   1 
ATOM   637   N  N     . SER A 1 686  ? 166.359 132.508 128.794 1.00 14.29  ?  558  SER A N     1 
ATOM   638   C  CA    . SER A 1 686  ? 167.740 132.359 128.336 1.00 16.80  ?  558  SER A CA    1 
ATOM   639   C  C     . SER A 1 686  ? 168.501 131.349 129.194 1.00 16.50  ?  558  SER A C     1 
ATOM   640   O  O     . SER A 1 686  ? 169.615 131.598 129.660 1.00 17.13  ?  558  SER A O     1 
ATOM   641   C  CB    . SER A 1 686  ? 168.458 133.711 128.300 1.00 15.65  ?  558  SER A CB    1 
ATOM   642   O  OG    . SER A 1 686  ? 168.589 134.265 129.596 1.00 14.93  ?  558  SER A OG    1 
ATOM   643   N  N     . GLY A 1 687  ? 167.878 130.191 129.403 1.00 16.58  ?  559  GLY A N     1 
ATOM   644   C  CA    . GLY A 1 687  ? 168.530 129.090 130.083 1.00 17.17  ?  559  GLY A CA    1 
ATOM   645   C  C     . GLY A 1 687  ? 168.841 129.329 131.546 1.00 20.79  ?  559  GLY A C     1 
ATOM   646   O  O     . GLY A 1 687  ? 170.010 129.411 131.933 1.00 20.89  ?  559  GLY A O     1 
ATOM   647   N  N     . TRP A 1 688  ? 167.806 129.444 132.371 1.00 21.47  ?  560  TRP A N     1 
ATOM   648   C  CA    . TRP A 1 688  ? 167.991 129.504 133.813 1.00 22.74  ?  560  TRP A CA    1 
ATOM   649   C  C     . TRP A 1 688  ? 168.246 128.102 134.346 1.00 20.79  ?  560  TRP A C     1 
ATOM   650   O  O     . TRP A 1 688  ? 167.468 127.182 134.078 1.00 22.55  ?  560  TRP A O     1 
ATOM   651   C  CB    . TRP A 1 688  ? 166.756 130.099 134.481 1.00 24.06  ?  560  TRP A CB    1 
ATOM   652   C  CG    . TRP A 1 688  ? 167.069 131.033 135.583 1.00 21.57  ?  560  TRP A CG    1 
ATOM   653   C  CD1   . TRP A 1 688  ? 168.221 131.091 136.305 1.00 26.26  ?  560  TRP A CD1   1 
ATOM   654   C  CD2   . TRP A 1 688  ? 166.213 132.052 136.104 1.00 24.79  ?  560  TRP A CD2   1 
ATOM   655   N  NE1   . TRP A 1 688  ? 168.140 132.089 137.244 1.00 32.64  ?  560  TRP A NE1   1 
ATOM   656   C  CE2   . TRP A 1 688  ? 166.915 132.694 137.141 1.00 33.70  ?  560  TRP A CE2   1 
ATOM   657   C  CE3   . TRP A 1 688  ? 164.921 132.485 135.793 1.00 23.55  ?  560  TRP A CE3   1 
ATOM   658   C  CZ2   . TRP A 1 688  ? 166.369 133.747 137.869 1.00 32.71  ?  560  TRP A CZ2   1 
ATOM   659   C  CZ3   . TRP A 1 688  ? 164.381 133.530 136.517 1.00 25.67  ?  560  TRP A CZ3   1 
ATOM   660   C  CH2   . TRP A 1 688  ? 165.104 134.149 137.543 1.00 29.75  ?  560  TRP A CH2   1 
ATOM   661   N  N     . THR A 1 689  ? 169.336 127.932 135.091 1.00 12.59  ?  561  THR A N     1 
ATOM   662   C  CA    . THR A 1 689  ? 169.601 126.624 135.673 1.00 15.34  ?  561  THR A CA    1 
ATOM   663   C  C     . THR A 1 689  ? 168.478 126.279 136.640 1.00 18.42  ?  561  THR A C     1 
ATOM   664   O  O     . THR A 1 689  ? 168.353 126.888 137.708 1.00 24.65  ?  561  THR A O     1 
ATOM   665   C  CB    . THR A 1 689  ? 170.957 126.605 136.367 1.00 15.15  ?  561  THR A CB    1 
ATOM   666   O  OG1   . THR A 1 689  ? 170.888 127.379 137.571 1.00 15.90  ?  561  THR A OG1   1 
ATOM   667   C  CG2   . THR A 1 689  ? 171.992 127.209 135.450 1.00 12.03  ?  561  THR A CG2   1 
ATOM   668   N  N     . VAL A 1 690  ? 167.659 125.299 136.267 1.00 24.95  ?  562  VAL A N     1 
ATOM   669   C  CA    . VAL A 1 690  ? 166.385 125.037 136.929 1.00 27.31  ?  562  VAL A CA    1 
ATOM   670   C  C     . VAL A 1 690  ? 166.569 124.506 138.347 1.00 35.45  ?  562  VAL A C     1 
ATOM   671   O  O     . VAL A 1 690  ? 165.587 124.314 139.074 1.00 41.26  ?  562  VAL A O     1 
ATOM   672   C  CB    . VAL A 1 690  ? 165.541 124.062 136.087 1.00 31.22  ?  562  VAL A CB    1 
ATOM   673   C  CG1   . VAL A 1 690  ? 165.922 122.615 136.395 1.00 34.12  ?  562  VAL A CG1   1 
ATOM   674   C  CG2   . VAL A 1 690  ? 164.058 124.305 136.319 1.00 31.42  ?  562  VAL A CG2   1 
ATOM   675   N  N     . SER A 1 691  ? 167.819 124.265 138.746 1.00 44.46  ?  563  SER A N     1 
ATOM   676   C  CA    . SER A 1 691  ? 168.143 123.736 140.069 1.00 55.70  ?  563  SER A CA    1 
ATOM   677   C  C     . SER A 1 691  ? 167.414 124.498 141.176 1.00 55.15  ?  563  SER A C     1 
ATOM   678   O  O     . SER A 1 691  ? 167.565 125.717 141.309 1.00 53.87  ?  563  SER A O     1 
ATOM   679   C  CB    . SER A 1 691  ? 169.663 123.793 140.262 1.00 55.62  ?  563  SER A CB    1 
ATOM   680   O  OG    . SER A 1 691  ? 170.032 124.036 141.602 1.00 58.83  ?  563  SER A OG    1 
ATOM   681   N  N     . VAL A 1 692  ? 166.622 123.765 141.970 1.00 51.99  ?  564  VAL A N     1 
ATOM   682   C  CA    . VAL A 1 692  ? 165.632 124.377 142.861 1.00 51.18  ?  564  VAL A CA    1 
ATOM   683   C  C     . VAL A 1 692  ? 166.286 125.246 143.930 1.00 47.63  ?  564  VAL A C     1 
ATOM   684   O  O     . VAL A 1 692  ? 165.680 126.212 144.411 1.00 51.56  ?  564  VAL A O     1 
ATOM   685   C  CB    . VAL A 1 692  ? 164.744 123.286 143.497 1.00 56.59  ?  564  VAL A CB    1 
ATOM   686   C  CG1   . VAL A 1 692  ? 163.578 123.908 144.259 1.00 63.03  ?  564  VAL A CG1   1 
ATOM   687   C  CG2   . VAL A 1 692  ? 164.228 122.332 142.432 1.00 58.90  ?  564  VAL A CG2   1 
ATOM   688   N  N     . ASP A 1 693  ? 167.519 124.928 144.321 1.00 47.76  ?  565  ASP A N     1 
ATOM   689   C  CA    . ASP A 1 693  ? 168.168 125.659 145.405 1.00 49.41  ?  565  ASP A CA    1 
ATOM   690   C  C     . ASP A 1 693  ? 168.467 127.114 145.052 1.00 48.06  ?  565  ASP A C     1 
ATOM   691   O  O     . ASP A 1 693  ? 168.635 127.932 145.963 1.00 45.61  ?  565  ASP A O     1 
ATOM   692   C  CB    . ASP A 1 693  ? 169.456 124.944 145.790 1.00 56.91  ?  565  ASP A CB    1 
ATOM   693   C  CG    . ASP A 1 693  ? 170.221 124.488 144.581 1.00 74.66  ?  565  ASP A CG    1 
ATOM   694   O  OD1   . ASP A 1 693  ? 169.619 124.538 143.493 1.00 63.23  ?  565  ASP A OD1   1 
ATOM   695   O  OD2   . ASP A 1 693  ? 171.395 124.087 144.703 1.00 144.46 -1 565  ASP A OD2   1 
ATOM   696   N  N     . ASP A 1 694  ? 168.545 127.458 143.767 1.00 48.72  ?  566  ASP A N     1 
ATOM   697   C  CA    . ASP A 1 694  ? 168.797 128.831 143.356 1.00 45.25  ?  566  ASP A CA    1 
ATOM   698   C  C     . ASP A 1 694  ? 167.474 129.599 143.297 1.00 40.71  ?  566  ASP A C     1 
ATOM   699   O  O     . ASP A 1 694  ? 166.413 129.075 143.643 1.00 41.44  ?  566  ASP A O     1 
ATOM   700   C  CB    . ASP A 1 694  ? 169.534 128.851 142.015 1.00 45.97  ?  566  ASP A CB    1 
ATOM   701   C  CG    . ASP A 1 694  ? 170.256 130.165 141.757 1.00 52.10  ?  566  ASP A CG    1 
ATOM   702   O  OD1   . ASP A 1 694  ? 169.794 131.215 142.251 1.00 39.74  ?  566  ASP A OD1   1 
ATOM   703   O  OD2   . ASP A 1 694  ? 171.300 130.143 141.070 1.00 105.35 -1 566  ASP A OD2   1 
ATOM   704   N  N     . VAL A 1 695  ? 167.535 130.860 142.876 1.00 30.71  ?  567  VAL A N     1 
ATOM   705   C  CA    . VAL A 1 695  ? 166.293 131.616 142.672 1.00 23.27  ?  567  VAL A CA    1 
ATOM   706   C  C     . VAL A 1 695  ? 165.457 130.900 141.616 1.00 19.62  ?  567  VAL A C     1 
ATOM   707   O  O     . VAL A 1 695  ? 166.003 130.481 140.576 1.00 21.96  ?  567  VAL A O     1 
ATOM   708   C  CB    . VAL A 1 695  ? 166.596 133.073 142.262 1.00 22.28  ?  567  VAL A CB    1 
ATOM   709   C  CG1   . VAL A 1 695  ? 167.550 133.117 141.090 1.00 17.44  ?  567  VAL A CG1   1 
ATOM   710   C  CG2   . VAL A 1 695  ? 165.317 133.826 141.929 1.00 19.97  ?  567  VAL A CG2   1 
ATOM   711   N  N     . PRO A 1 696  ? 164.159 130.696 141.841 1.00 21.00  ?  568  PRO A N     1 
ATOM   712   C  CA    . PRO A 1 696  ? 163.395 129.776 140.987 1.00 26.90  ?  568  PRO A CA    1 
ATOM   713   C  C     . PRO A 1 696  ? 163.430 130.157 139.512 1.00 33.22  ?  568  PRO A C     1 
ATOM   714   O  O     . PRO A 1 696  ? 163.566 131.327 139.147 1.00 29.81  ?  568  PRO A O     1 
ATOM   715   C  CB    . PRO A 1 696  ? 161.974 129.877 141.554 1.00 30.08  ?  568  PRO A CB    1 
ATOM   716   C  CG    . PRO A 1 696  ? 162.180 130.255 142.986 1.00 24.21  ?  568  PRO A CG    1 
ATOM   717   C  CD    . PRO A 1 696  ? 163.370 131.167 142.994 1.00 20.28  ?  568  PRO A CD    1 
ATOM   718   N  N     . ALA A 1 697  ? 163.307 129.133 138.658 1.00 30.24  ?  569  ALA A N     1 
ATOM   719   C  CA    . ALA A 1 697  ? 163.225 129.292 137.210 1.00 25.40  ?  569  ALA A CA    1 
ATOM   720   C  C     . ALA A 1 697  ? 161.785 129.408 136.722 1.00 23.05  ?  569  ALA A C     1 
ATOM   721   O  O     . ALA A 1 697  ? 161.479 129.012 135.587 1.00 21.00  ?  569  ALA A O     1 
ATOM   722   C  CB    . ALA A 1 697  ? 163.932 128.129 136.511 1.00 23.58  ?  569  ALA A CB    1 
ATOM   723   N  N     . ASP A 1 698  ? 160.897 129.950 137.562 1.00 29.01  ?  570  ASP A N     1 
ATOM   724   C  CA    . ASP A 1 698  ? 159.462 129.949 137.285 1.00 30.82  ?  570  ASP A CA    1 
ATOM   725   C  C     . ASP A 1 698  ? 159.104 130.877 136.130 1.00 23.14  ?  570  ASP A C     1 
ATOM   726   O  O     . ASP A 1 698  ? 158.485 130.452 135.147 1.00 22.75  ?  570  ASP A O     1 
ATOM   727   C  CB    . ASP A 1 698  ? 158.694 130.356 138.547 1.00 56.03  ?  570  ASP A CB    1 
ATOM   728   C  CG    . ASP A 1 698  ? 157.228 129.955 138.499 1.00 98.69  ?  570  ASP A CG    1 
ATOM   729   O  OD1   . ASP A 1 698  ? 156.839 129.223 137.565 1.00 92.82  ?  570  ASP A OD1   1 
ATOM   730   O  OD2   . ASP A 1 698  ? 156.460 130.380 139.390 1.00 194.25 -1 570  ASP A OD2   1 
ATOM   731   N  N     . THR A 1 699  ? 159.472 132.154 136.250 1.00 17.62  ?  571  THR A N     1 
ATOM   732   C  CA    . THR A 1 699  ? 159.047 133.228 135.352 1.00 8.61   ?  571  THR A CA    1 
ATOM   733   C  C     . THR A 1 699  ? 158.997 132.803 133.888 1.00 6.68   ?  571  THR A C     1 
ATOM   734   O  O     . THR A 1 699  ? 159.974 132.281 133.347 1.00 8.76   ?  571  THR A O     1 
ATOM   735   C  CB    . THR A 1 699  ? 160.004 134.409 135.514 1.00 9.26   ?  571  THR A CB    1 
ATOM   736   O  OG1   . THR A 1 699  ? 159.941 134.900 136.860 1.00 12.53  ?  571  THR A OG1   1 
ATOM   737   C  CG2   . THR A 1 699  ? 159.661 135.504 134.540 1.00 6.93   ?  571  THR A CG2   1 
ATOM   738   N  N     . ILE A 1 700  ? 157.855 133.048 133.246 1.00 6.78   ?  572  ILE A N     1 
ATOM   739   C  CA    . ILE A 1 700  ? 157.608 132.627 131.869 1.00 4.66   ?  572  ILE A CA    1 
ATOM   740   C  C     . ILE A 1 700  ? 157.679 133.846 130.961 1.00 4.82   ?  572  ILE A C     1 
ATOM   741   O  O     . ILE A 1 700  ? 157.028 134.864 131.227 1.00 6.48   ?  572  ILE A O     1 
ATOM   742   C  CB    . ILE A 1 700  ? 156.247 131.922 131.734 1.00 1.56   ?  572  ILE A CB    1 
ATOM   743   C  CG1   . ILE A 1 700  ? 156.329 130.509 132.305 1.00 5.98   ?  572  ILE A CG1   1 
ATOM   744   C  CG2   . ILE A 1 700  ? 155.808 131.876 130.283 1.00 1.12   ?  572  ILE A CG2   1 
ATOM   745   C  CD1   . ILE A 1 700  ? 155.055 129.720 132.148 1.00 13.16  ?  572  ILE A CD1   1 
ATOM   746   N  N     . SER A 1 701  ? 158.459 133.741 129.885 1.00 4.01   ?  573  SER A N     1 
ATOM   747   C  CA    . SER A 1 701  ? 158.604 134.850 128.953 1.00 4.98   ?  573  SER A CA    1 
ATOM   748   C  C     . SER A 1 701  ? 159.016 134.318 127.588 1.00 5.55   ?  573  SER A C     1 
ATOM   749   O  O     . SER A 1 701  ? 159.628 133.252 127.479 1.00 8.39   ?  573  SER A O     1 
ATOM   750   C  CB    . SER A 1 701  ? 159.622 135.880 129.464 1.00 5.47   ?  573  SER A CB    1 
ATOM   751   O  OG    . SER A 1 701  ? 160.940 135.362 129.483 1.00 6.99   ?  573  SER A OG    1 
ATOM   752   N  N     . ARG A 1 702  ? 158.662 135.073 126.550 1.00 4.75   ?  574  ARG A N     1 
ATOM   753   C  CA    . ARG A 1 702  ? 159.014 134.722 125.181 1.00 3.15   ?  574  ARG A CA    1 
ATOM   754   C  C     . ARG A 1 702  ? 159.338 135.990 124.408 1.00 1.87   ?  574  ARG A C     1 
ATOM   755   O  O     . ARG A 1 702  ? 158.747 137.048 124.646 1.00 3.97   ?  574  ARG A O     1 
ATOM   756   C  CB    . ARG A 1 702  ? 157.887 133.961 124.477 1.00 3.91   ?  574  ARG A CB    1 
ATOM   757   C  CG    . ARG A 1 702  ? 157.560 132.620 125.095 1.00 6.29   ?  574  ARG A CG    1 
ATOM   758   C  CD    . ARG A 1 702  ? 158.586 131.578 124.706 1.00 10.01  ?  574  ARG A CD    1 
ATOM   759   N  NE    . ARG A 1 702  ? 158.114 130.233 125.012 1.00 10.66  ?  574  ARG A NE    1 
ATOM   760   C  CZ    . ARG A 1 702  ? 158.444 129.559 126.107 1.00 10.01  ?  574  ARG A CZ    1 
ATOM   761   N  NH1   . ARG A 1 702  ? 159.257 130.103 127.004 1.00 5.66   ?  574  ARG A NH1   1 
ATOM   762   N  NH2   . ARG A 1 702  ? 157.965 128.340 126.304 1.00 7.15   ?  574  ARG A NH2   1 
ATOM   763   N  N     . ARG A 1 703  ? 160.268 135.872 123.462 1.00 4.61   ?  575  ARG A N     1 
ATOM   764   C  CA    . ARG A 1 703  ? 160.722 137.051 122.741 1.00 3.49   ?  575  ARG A CA    1 
ATOM   765   C  C     . ARG A 1 703  ? 161.523 136.636 121.519 1.00 4.06   ?  575  ARG A C     1 
ATOM   766   O  O     . ARG A 1 703  ? 161.975 135.493 121.400 1.00 5.37   ?  575  ARG A O     1 
ATOM   767   C  CB    . ARG A 1 703  ? 161.578 137.955 123.629 1.00 3.35   ?  575  ARG A CB    1 
ATOM   768   C  CG    . ARG A 1 703  ? 162.960 137.413 123.893 1.00 3.28   ?  575  ARG A CG    1 
ATOM   769   C  CD    . ARG A 1 703  ? 163.744 138.327 124.804 1.00 2.02   ?  575  ARG A CD    1 
ATOM   770   N  NE    . ARG A 1 703  ? 165.000 137.696 125.186 1.00 3.45   ?  575  ARG A NE    1 
ATOM   771   C  CZ    . ARG A 1 703  ? 166.085 137.694 124.422 1.00 3.82   ?  575  ARG A CZ    1 
ATOM   772   N  NH1   . ARG A 1 703  ? 166.063 138.296 123.241 1.00 3.99   ?  575  ARG A NH1   1 
ATOM   773   N  NH2   . ARG A 1 703  ? 167.189 137.091 124.837 1.00 8.30   ?  575  ARG A NH2   1 
ATOM   774   N  N     . PHE A 1 704  ? 161.696 137.595 120.616 1.00 3.29   ?  576  PHE A N     1 
ATOM   775   C  CA    . PHE A 1 704  ? 162.630 137.475 119.514 1.00 2.06   ?  576  PHE A CA    1 
ATOM   776   C  C     . PHE A 1 704  ? 164.004 137.952 119.965 1.00 4.33   ?  576  PHE A C     1 
ATOM   777   O  O     . PHE A 1 704  ? 164.190 138.425 121.088 1.00 4.16   ?  576  PHE A O     1 
ATOM   778   C  CB    . PHE A 1 704  ? 162.154 138.295 118.319 1.00 2.71   ?  576  PHE A CB    1 
ATOM   779   C  CG    . PHE A 1 704  ? 160.802 137.912 117.833 1.00 3.18   ?  576  PHE A CG    1 
ATOM   780   C  CD1   . PHE A 1 704  ? 160.442 136.582 117.740 1.00 7.85   ?  576  PHE A CD1   1 
ATOM   781   C  CD2   . PHE A 1 704  ? 159.883 138.880 117.477 1.00 6.43   ?  576  PHE A CD2   1 
ATOM   782   C  CE1   . PHE A 1 704  ? 159.192 136.226 117.288 1.00 8.60   ?  576  PHE A CE1   1 
ATOM   783   C  CE2   . PHE A 1 704  ? 158.629 138.526 117.027 1.00 6.85   ?  576  PHE A CE2   1 
ATOM   784   C  CZ    . PHE A 1 704  ? 158.283 137.197 116.933 1.00 6.71   ?  576  PHE A CZ    1 
ATOM   785   N  N     . ARG A 1 705  ? 164.981 137.836 119.077 1.00 4.62   ?  577  ARG A N     1 
ATOM   786   C  CA    . ARG A 1 705  ? 166.253 138.507 119.273 1.00 6.33   ?  577  ARG A CA    1 
ATOM   787   C  C     . ARG A 1 705  ? 166.164 139.901 118.673 1.00 7.58   ?  577  ARG A C     1 
ATOM   788   O  O     . ARG A 1 705  ? 165.529 140.098 117.633 1.00 9.38   ?  577  ARG A O     1 
ATOM   789   C  CB    . ARG A 1 705  ? 167.396 137.726 118.631 1.00 12.16  ?  577  ARG A CB    1 
ATOM   790   C  CG    . ARG A 1 705  ? 167.370 136.239 118.910 1.00 14.46  ?  577  ARG A CG    1 
ATOM   791   C  CD    . ARG A 1 705  ? 168.740 135.649 118.668 1.00 13.27  ?  577  ARG A CD    1 
ATOM   792   N  NE    . ARG A 1 705  ? 169.558 136.558 117.876 1.00 12.92  ?  577  ARG A NE    1 
ATOM   793   C  CZ    . ARG A 1 705  ? 170.834 136.349 117.579 1.00 17.38  ?  577  ARG A CZ    1 
ATOM   794   N  NH1   . ARG A 1 705  ? 171.445 135.253 118.007 1.00 20.13  ?  577  ARG A NH1   1 
ATOM   795   N  NH2   . ARG A 1 705  ? 171.496 137.236 116.852 1.00 25.22  ?  577  ARG A NH2   1 
ATOM   796   N  N     . TYR A 1 706  ? 166.795 140.866 119.343 1.00 6.47   ?  578  TYR A N     1 
ATOM   797   C  CA    . TYR A 1 706  ? 166.672 142.262 118.932 1.00 7.08   ?  578  TYR A CA    1 
ATOM   798   C  C     . TYR A 1 706  ? 167.080 142.449 117.476 1.00 9.29   ?  578  TYR A C     1 
ATOM   799   O  O     . TYR A 1 706  ? 166.323 143.006 116.667 1.00 9.68   ?  578  TYR A O     1 
ATOM   800   C  CB    . TYR A 1 706  ? 167.525 143.145 119.843 1.00 12.24  ?  578  TYR A CB    1 
ATOM   801   C  CG    . TYR A 1 706  ? 166.941 144.515 120.085 1.00 10.36  ?  578  TYR A CG    1 
ATOM   802   C  CD1   . TYR A 1 706  ? 165.991 144.723 121.075 1.00 7.90   ?  578  TYR A CD1   1 
ATOM   803   C  CD2   . TYR A 1 706  ? 167.345 145.604 119.328 1.00 14.47  ?  578  TYR A CD2   1 
ATOM   804   C  CE1   . TYR A 1 706  ? 165.454 145.979 121.299 1.00 9.73   ?  578  TYR A CE1   1 
ATOM   805   C  CE2   . TYR A 1 706  ? 166.815 146.862 119.546 1.00 14.22  ?  578  TYR A CE2   1 
ATOM   806   C  CZ    . TYR A 1 706  ? 165.870 147.044 120.533 1.00 12.62  ?  578  TYR A CZ    1 
ATOM   807   O  OH    . TYR A 1 706  ? 165.342 148.296 120.752 1.00 13.31  ?  578  TYR A OH    1 
ATOM   808   N  N     . ASP A 1 707  ? 168.277 141.976 117.129 1.00 12.88  ?  579  ASP A N     1 
ATOM   809   C  CA    . ASP A 1 707  ? 168.810 142.144 115.782 1.00 14.73  ?  579  ASP A CA    1 
ATOM   810   C  C     . ASP A 1 707  ? 167.876 141.564 114.724 1.00 14.94  ?  579  ASP A C     1 
ATOM   811   O  O     . ASP A 1 707  ? 167.585 142.212 113.710 1.00 15.00  ?  579  ASP A O     1 
ATOM   812   C  CB    . ASP A 1 707  ? 170.188 141.488 115.702 1.00 23.11  ?  579  ASP A CB    1 
ATOM   813   C  CG    . ASP A 1 707  ? 170.156 140.022 116.108 1.00 28.49  ?  579  ASP A CG    1 
ATOM   814   O  OD1   . ASP A 1 707  ? 169.084 139.542 116.536 1.00 19.61  ?  579  ASP A OD1   1 
ATOM   815   O  OD2   . ASP A 1 707  ? 171.198 139.346 115.994 1.00 76.41  -1 579  ASP A OD2   1 
ATOM   816   N  N     . VAL A 1 708  ? 167.414 140.329 114.931 1.00 11.82  ?  580  VAL A N     1 
ATOM   817   C  CA    . VAL A 1 708  ? 166.627 139.657 113.903 1.00 9.19   ?  580  VAL A CA    1 
ATOM   818   C  C     . VAL A 1 708  ? 165.274 140.338 113.732 1.00 9.29   ?  580  VAL A C     1 
ATOM   819   O  O     . VAL A 1 708  ? 164.780 140.499 112.608 1.00 10.29  ?  580  VAL A O     1 
ATOM   820   C  CB    . VAL A 1 708  ? 166.482 138.163 114.241 1.00 7.47   ?  580  VAL A CB    1 
ATOM   821   C  CG1   . VAL A 1 708  ? 165.683 137.465 113.171 1.00 7.98   ?  580  VAL A CG1   1 
ATOM   822   C  CG2   . VAL A 1 708  ? 167.851 137.522 114.376 1.00 13.09  ?  580  VAL A CG2   1 
ATOM   823   N  N     . ALA A 1 709  ? 164.655 140.759 114.836 1.00 8.53   ?  581  ALA A N     1 
ATOM   824   C  CA    . ALA A 1 709  ? 163.396 141.490 114.733 1.00 8.09   ?  581  ALA A CA    1 
ATOM   825   C  C     . ALA A 1 709  ? 163.585 142.796 113.973 1.00 9.89   ?  581  ALA A C     1 
ATOM   826   O  O     . ALA A 1 709  ? 162.753 143.169 113.132 1.00 11.09  ?  581  ALA A O     1 
ATOM   827   C  CB    . ALA A 1 709  ? 162.830 141.758 116.127 1.00 6.52   ?  581  ALA A CB    1 
ATOM   828   N  N     . LEU A 1 710  ? 164.684 143.501 114.254 1.00 10.22  ?  582  LEU A N     1 
ATOM   829   C  CA    . LEU A 1 710  ? 164.963 144.750 113.557 1.00 9.75   ?  582  LEU A CA    1 
ATOM   830   C  C     . LEU A 1 710  ? 165.135 144.524 112.058 1.00 11.80  ?  582  LEU A C     1 
ATOM   831   O  O     . LEU A 1 710  ? 164.589 145.277 111.241 1.00 13.85  ?  582  LEU A O     1 
ATOM   832   C  CB    . LEU A 1 710  ? 166.205 145.410 114.151 1.00 7.78   ?  582  LEU A CB    1 
ATOM   833   C  CG    . LEU A 1 710  ? 165.957 146.789 114.758 1.00 7.13   ?  582  LEU A CG    1 
ATOM   834   C  CD1   . LEU A 1 710  ? 167.251 147.404 115.253 1.00 14.74  ?  582  LEU A CD1   1 
ATOM   835   C  CD2   . LEU A 1 710  ? 165.306 147.675 113.724 1.00 7.43   ?  582  LEU A CD2   1 
ATOM   836   N  N     . VAL A 1 711  ? 165.907 143.500 111.675 1.00 10.67  ?  583  VAL A N     1 
ATOM   837   C  CA    . VAL A 1 711  ? 166.112 143.263 110.246 1.00 10.15  ?  583  VAL A CA    1 
ATOM   838   C  C     . VAL A 1 711  ? 164.806 142.841 109.586 1.00 11.47  ?  583  VAL A C     1 
ATOM   839   O  O     . VAL A 1 711  ? 164.551 143.188 108.424 1.00 16.00  ?  583  VAL A O     1 
ATOM   840   C  CB    . VAL A 1 711  ? 167.229 142.230 109.983 1.00 11.59  ?  583  VAL A CB    1 
ATOM   841   C  CG1   . VAL A 1 711  ? 168.517 142.632 110.682 1.00 17.53  ?  583  VAL A CG1   1 
ATOM   842   C  CG2   . VAL A 1 711  ? 166.801 140.834 110.385 1.00 11.64  ?  583  VAL A CG2   1 
ATOM   843   N  N     . SER A 1 712  ? 163.951 142.112 110.308 1.00 10.22  ?  584  SER A N     1 
ATOM   844   C  CA    . SER A 1 712  ? 162.650 141.749 109.760 1.00 15.06  ?  584  SER A CA    1 
ATOM   845   C  C     . SER A 1 712  ? 161.819 142.994 109.467 1.00 19.30  ?  584  SER A C     1 
ATOM   846   O  O     . SER A 1 712  ? 161.258 143.140 108.372 1.00 18.02  ?  584  SER A O     1 
ATOM   847   C  CB    . SER A 1 712  ? 161.921 140.818 110.731 1.00 14.01  ?  584  SER A CB    1 
ATOM   848   O  OG    . SER A 1 712  ? 160.759 140.258 110.144 1.00 11.10  ?  584  SER A OG    1 
ATOM   849   N  N     . ALA A 1 713  ? 161.742 143.911 110.437 1.00 16.34  ?  585  ALA A N     1 
ATOM   850   C  CA    . ALA A 1 713  ? 160.972 145.137 110.234 1.00 14.80  ?  585  ALA A CA    1 
ATOM   851   C  C     . ALA A 1 713  ? 161.555 145.977 109.104 1.00 18.63  ?  585  ALA A C     1 
ATOM   852   O  O     . ALA A 1 713  ? 160.816 146.579 108.311 1.00 24.18  ?  585  ALA A O     1 
ATOM   853   C  CB    . ALA A 1 713  ? 160.924 145.949 111.526 1.00 12.51  ?  585  ALA A CB    1 
ATOM   854   N  N     . LEU A 1 714  ? 162.882 146.030 109.016 1.00 16.41  ?  586  LEU A N     1 
ATOM   855   C  CA    . LEU A 1 714  ? 163.521 146.799 107.956 1.00 18.82  ?  586  LEU A CA    1 
ATOM   856   C  C     . LEU A 1 714  ? 163.182 146.230 106.583 1.00 22.88  ?  586  LEU A C     1 
ATOM   857   O  O     . LEU A 1 714  ? 162.815 146.972 105.661 1.00 24.61  ?  586  LEU A O     1 
ATOM   858   C  CB    . LEU A 1 714  ? 165.030 146.824 108.181 1.00 15.20  ?  586  LEU A CB    1 
ATOM   859   C  CG    . LEU A 1 714  ? 165.681 148.150 107.804 1.00 22.87  ?  586  LEU A CG    1 
ATOM   860   C  CD1   . LEU A 1 714  ? 164.893 149.306 108.400 1.00 19.11  ?  586  LEU A CD1   1 
ATOM   861   C  CD2   . LEU A 1 714  ? 167.124 148.177 108.270 1.00 27.47  ?  586  LEU A CD2   1 
ATOM   862   N  N     . LYS A 1 715  ? 163.308 144.910 106.422 1.00 22.20  ?  587  LYS A N     1 
ATOM   863   C  CA    . LYS A 1 715  ? 162.968 144.308 105.138 1.00 24.63  ?  587  LYS A CA    1 
ATOM   864   C  C     . LYS A 1 715  ? 161.492 144.475 104.820 1.00 24.40  ?  587  LYS A C     1 
ATOM   865   O  O     . LYS A 1 715  ? 161.118 144.579 103.645 1.00 33.00  ?  587  LYS A O     1 
ATOM   866   C  CB    . LYS A 1 715  ? 163.342 142.831 105.115 1.00 19.98  ?  587  LYS A CB    1 
ATOM   867   C  CG    . LYS A 1 715  ? 163.331 142.264 103.711 1.00 20.26  ?  587  LYS A CG    1 
ATOM   868   C  CD    . LYS A 1 715  ? 164.448 141.279 103.507 1.00 18.68  ?  587  LYS A CD    1 
ATOM   869   C  CE    . LYS A 1 715  ? 165.796 141.910 103.758 1.00 19.39  ?  587  LYS A CE    1 
ATOM   870   N  NZ    . LYS A 1 715  ? 165.826 143.315 103.278 1.00 28.05  ?  587  LYS A NZ    1 
ATOM   871   N  N     . ASP A 1 716  ? 160.639 144.485 105.844 1.00 26.67  ?  588  ASP A N     1 
ATOM   872   C  CA    . ASP A 1 716  ? 159.258 144.902 105.643 1.00 36.16  ?  588  ASP A CA    1 
ATOM   873   C  C     . ASP A 1 716  ? 159.201 146.279 104.994 1.00 37.54  ?  588  ASP A C     1 
ATOM   874   O  O     . ASP A 1 716  ? 158.544 146.473 103.965 1.00 42.67  ?  588  ASP A O     1 
ATOM   875   C  CB    . ASP A 1 716  ? 158.518 144.903 106.981 1.00 42.01  ?  588  ASP A CB    1 
ATOM   876   C  CG    . ASP A 1 716  ? 157.040 145.219 106.837 1.00 53.85  ?  588  ASP A CG    1 
ATOM   877   O  OD1   . ASP A 1 716  ? 156.689 146.278 106.275 1.00 57.95  ?  588  ASP A OD1   1 
ATOM   878   O  OD2   . ASP A 1 716  ? 156.220 144.395 107.287 1.00 108.54 -1 588  ASP A OD2   1 
ATOM   879   N  N     . LEU A 1 717  ? 159.891 147.249 105.589 1.00 38.40  ?  589  LEU A N     1 
ATOM   880   C  CA    . LEU A 1 717  ? 159.816 148.633 105.132 1.00 35.93  ?  589  LEU A CA    1 
ATOM   881   C  C     . LEU A 1 717  ? 160.593 148.890 103.847 1.00 41.78  ?  589  LEU A C     1 
ATOM   882   O  O     . LEU A 1 717  ? 160.606 150.034 103.365 1.00 53.00  ?  589  LEU A O     1 
ATOM   883   C  CB    . LEU A 1 717  ? 160.318 149.564 106.229 1.00 35.10  ?  589  LEU A CB    1 
ATOM   884   C  CG    . LEU A 1 717  ? 159.401 150.754 106.487 1.00 42.68  ?  589  LEU A CG    1 
ATOM   885   C  CD1   . LEU A 1 717  ? 158.027 150.284 106.936 1.00 32.97  ?  589  LEU A CD1   1 
ATOM   886   C  CD2   . LEU A 1 717  ? 160.034 151.634 107.529 1.00 38.50  ?  589  LEU A CD2   1 
ATOM   887   N  N     . GLU A 1 718  ? 161.264 147.868 103.322 1.00 41.04  ?  590  GLU A N     1 
ATOM   888   C  CA    . GLU A 1 718  ? 161.950 147.950 102.037 1.00 47.54  ?  590  GLU A CA    1 
ATOM   889   C  C     . GLU A 1 718  ? 161.130 148.679 100.973 1.00 57.32  ?  590  GLU A C     1 
ATOM   890   O  O     . GLU A 1 718  ? 161.683 149.454 100.181 1.00 59.96  ?  590  GLU A O     1 
ATOM   891   C  CB    . GLU A 1 718  ? 162.308 146.542 101.555 1.00 48.75  ?  590  GLU A CB    1 
ATOM   892   C  CG    . GLU A 1 718  ? 162.144 146.315 100.063 1.00 63.41  ?  590  GLU A CG    1 
ATOM   893   C  CD    . GLU A 1 718  ? 162.149 144.845 99.702  1.00 85.71  ?  590  GLU A CD    1 
ATOM   894   O  OE1   . GLU A 1 718  ? 163.073 144.127 100.140 1.00 62.91  ?  590  GLU A OE1   1 
ATOM   895   O  OE2   . GLU A 1 718  ? 161.231 144.406 98.979  1.00 172.99 -1 590  GLU A OE2   1 
ATOM   896   N  N     . GLU A 1 719  ? 159.814 148.450 100.953 1.00 64.07  ?  591  GLU A N     1 
ATOM   897   C  CA    . GLU A 1 719  ? 158.956 149.108 99.971  1.00 75.60  ?  591  GLU A CA    1 
ATOM   898   C  C     . GLU A 1 719  ? 159.068 150.624 100.074 1.00 74.02  ?  591  GLU A C     1 
ATOM   899   O  O     . GLU A 1 719  ? 159.373 151.311 99.090  1.00 77.03  ?  591  GLU A O     1 
ATOM   900   C  CB    . GLU A 1 719  ? 157.505 148.658 100.163 1.00 84.07  ?  591  GLU A CB    1 
ATOM   901   C  CG    . GLU A 1 719  ? 156.662 148.677 98.892  1.00 102.01 ?  591  GLU A CG    1 
ATOM   902   C  CD    . GLU A 1 719  ? 156.273 150.078 98.452  1.00 115.76 ?  591  GLU A CD    1 
ATOM   903   O  OE1   . GLU A 1 719  ? 156.261 150.996 99.298  1.00 102.04 ?  591  GLU A OE1   1 
ATOM   904   O  OE2   . GLU A 1 719  ? 155.979 150.261 97.252  1.00 182.01 -1 591  GLU A OE2   1 
ATOM   905   N  N     . ASP A 1 720  ? 158.822 151.166 101.269 1.00 68.82  ?  592  ASP A N     1 
ATOM   906   C  CA    . ASP A 1 720  ? 158.840 152.614 101.430 1.00 66.09  ?  592  ASP A CA    1 
ATOM   907   C  C     . ASP A 1 720  ? 160.246 153.179 101.299 1.00 60.87  ?  592  ASP A C     1 
ATOM   908   O  O     . ASP A 1 720  ? 160.407 154.313 100.834 1.00 63.35  ?  592  ASP A O     1 
ATOM   909   C  CB    . ASP A 1 720  ? 158.228 153.005 102.775 1.00 71.98  ?  592  ASP A CB    1 
ATOM   910   C  CG    . ASP A 1 720  ? 156.766 152.616 102.882 1.00 93.24  ?  592  ASP A CG    1 
ATOM   911   O  OD1   . ASP A 1 720  ? 156.306 151.801 102.055 1.00 89.53  ?  592  ASP A OD1   1 
ATOM   912   O  OD2   . ASP A 1 720  ? 156.076 153.121 103.792 1.00 137.76 -1 592  ASP A OD2   1 
ATOM   913   N  N     . ILE A 1 721  ? 161.276 152.418 101.682 1.00 60.44  ?  593  ILE A N     1 
ATOM   914   C  CA    . ILE A 1 721  ? 162.627 152.951 101.514 1.00 66.38  ?  593  ILE A CA    1 
ATOM   915   C  C     . ILE A 1 721  ? 162.968 153.072 100.030 1.00 72.86  ?  593  ILE A C     1 
ATOM   916   O  O     . ILE A 1 721  ? 163.569 154.066 99.595  1.00 77.64  ?  593  ILE A O     1 
ATOM   917   C  CB    . ILE A 1 721  ? 163.674 152.120 102.288 1.00 62.58  ?  593  ILE A CB    1 
ATOM   918   C  CG1   . ILE A 1 721  ? 164.061 150.835 101.552 1.00 56.87  ?  593  ILE A CG1   1 
ATOM   919   C  CG2   . ILE A 1 721  ? 163.191 151.814 103.698 1.00 64.36  ?  593  ILE A CG2   1 
ATOM   920   C  CD1   . ILE A 1 721  ? 165.215 150.105 102.195 1.00 51.44  ?  593  ILE A CD1   1 
ATOM   921   N  N     . MET A 1 722  ? 162.545 152.098 99.216  1.00 67.43  ?  594  MET A N     1 
ATOM   922   C  CA    . MET A 1 722  ? 162.804 152.192 97.783  1.00 67.45  ?  594  MET A CA    1 
ATOM   923   C  C     . MET A 1 722  ? 161.952 153.282 97.145  1.00 71.36  ?  594  MET A C     1 
ATOM   924   O  O     . MET A 1 722  ? 162.410 153.987 96.234  1.00 81.95  ?  594  MET A O     1 
ATOM   925   C  CB    . MET A 1 722  ? 162.555 150.841 97.115  1.00 63.79  ?  594  MET A CB    1 
ATOM   926   C  CG    . MET A 1 722  ? 163.352 150.629 95.841  1.00 64.94  ?  594  MET A CG    1 
ATOM   927   S  SD    . MET A 1 722  ? 165.127 150.794 96.121  1.00 64.90  ?  594  MET A SD    1 
ATOM   928   C  CE    . MET A 1 722  ? 165.414 149.514 97.340  1.00 44.10  ?  594  MET A CE    1 
ATOM   929   N  N     . GLU A 1 723  ? 160.718 153.452 97.625  1.00 69.49  ?  595  GLU A N     1 
ATOM   930   C  CA    . GLU A 1 723  ? 159.888 154.549 97.139  1.00 77.04  ?  595  GLU A CA    1 
ATOM   931   C  C     . GLU A 1 723  ? 160.528 155.900 97.441  1.00 83.78  ?  595  GLU A C     1 
ATOM   932   O  O     . GLU A 1 723  ? 160.527 156.800 96.593  1.00 91.05  ?  595  GLU A O     1 
ATOM   933   C  CB    . GLU A 1 723  ? 158.489 154.466 97.751  1.00 85.42  ?  595  GLU A CB    1 
ATOM   934   C  CG    . GLU A 1 723  ? 157.870 155.818 98.088  1.00 96.26  ?  595  GLU A CG    1 
ATOM   935   C  CD    . GLU A 1 723  ? 157.413 156.582 96.858  1.00 117.24 ?  595  GLU A CD    1 
ATOM   936   O  OE1   . GLU A 1 723  ? 157.435 156.006 95.749  1.00 107.65 ?  595  GLU A OE1   1 
ATOM   937   O  OE2   . GLU A 1 723  ? 157.043 157.766 97.000  1.00 197.46 -1 595  GLU A OE2   1 
ATOM   938   N  N     . GLY A 1 724  ? 161.082 156.059 98.645  1.00 82.21  ?  596  GLY A N     1 
ATOM   939   C  CA    . GLY A 1 724  ? 161.728 157.311 98.995  1.00 82.61  ?  596  GLY A CA    1 
ATOM   940   C  C     . GLY A 1 724  ? 163.002 157.559 98.217  1.00 81.24  ?  596  GLY A C     1 
ATOM   941   O  O     . GLY A 1 724  ? 163.320 158.707 97.890  1.00 82.84  ?  596  GLY A O     1 
ATOM   942   N  N     . LEU A 1 725  ? 163.755 156.496 97.918  1.00 81.69  ?  597  LEU A N     1 
ATOM   943   C  CA    . LEU A 1 725  ? 164.905 156.653 97.033  1.00 83.77  ?  597  LEU A CA    1 
ATOM   944   C  C     . LEU A 1 725  ? 164.473 157.058 95.628  1.00 95.60  ?  597  LEU A C     1 
ATOM   945   O  O     . LEU A 1 725  ? 165.195 157.798 94.949  1.00 97.67  ?  597  LEU A O     1 
ATOM   946   C  CB    . LEU A 1 725  ? 165.721 155.361 96.992  1.00 80.13  ?  597  LEU A CB    1 
ATOM   947   C  CG    . LEU A 1 725  ? 166.450 154.975 98.282  1.00 69.14  ?  597  LEU A CG    1 
ATOM   948   C  CD1   . LEU A 1 725  ? 167.511 153.922 98.006  1.00 64.40  ?  597  LEU A CD1   1 
ATOM   949   C  CD2   . LEU A 1 725  ? 167.064 156.196 98.948  1.00 67.29  ?  597  LEU A CD2   1 
ATOM   950   N  N     . ARG A 1 726  ? 163.308 156.584 95.178  1.00 101.90 ?  598  ARG A N     1 
ATOM   951   C  CA    . ARG A 1 726  ? 162.764 157.046 93.903  1.00 103.96 ?  598  ARG A CA    1 
ATOM   952   C  C     . ARG A 1 726  ? 162.409 158.528 93.962  1.00 100.12 ?  598  ARG A C     1 
ATOM   953   O  O     . ARG A 1 726  ? 162.790 159.306 93.078  1.00 100.57 ?  598  ARG A O     1 
ATOM   954   C  CB    . ARG A 1 726  ? 161.534 156.221 93.521  1.00 103.26 ?  598  ARG A CB    1 
ATOM   955   C  CG    . ARG A 1 726  ? 161.853 154.817 93.065  1.00 105.61 ?  598  ARG A CG    1 
ATOM   956   C  CD    . ARG A 1 726  ? 162.782 154.847 91.869  1.00 117.96 ?  598  ARG A CD    1 
ATOM   957   N  NE    . ARG A 1 726  ? 163.792 153.800 91.959  1.00 132.42 ?  598  ARG A NE    1 
ATOM   958   C  CZ    . ARG A 1 726  ? 164.955 153.941 92.586  1.00 132.27 ?  598  ARG A CZ    1 
ATOM   959   N  NH1   . ARG A 1 726  ? 165.259 155.087 93.179  1.00 122.88 ?  598  ARG A NH1   1 
ATOM   960   N  NH2   . ARG A 1 726  ? 165.814 152.933 92.620  1.00 147.97 ?  598  ARG A NH2   1 
ATOM   961   N  N     . GLU A 1 727  ? 161.677 158.934 95.003  1.00 98.62  ?  599  GLU A N     1 
ATOM   962   C  CA    . GLU A 1 727  ? 161.184 160.307 95.088  1.00 96.37  ?  599  GLU A CA    1 
ATOM   963   C  C     . GLU A 1 727  ? 162.333 161.303 95.180  1.00 94.06  ?  599  GLU A C     1 
ATOM   964   O  O     . GLU A 1 727  ? 162.413 162.252 94.390  1.00 97.83  ?  599  GLU A O     1 
ATOM   965   C  CB    . GLU A 1 727  ? 160.248 160.452 96.289  1.00 97.39  ?  599  GLU A CB    1 
ATOM   966   C  CG    . GLU A 1 727  ? 159.478 161.769 96.340  1.00 107.28 ?  599  GLU A CG    1 
ATOM   967   C  CD    . GLU A 1 727  ? 160.329 162.941 96.802  1.00 115.17 ?  599  GLU A CD    1 
ATOM   968   O  OE1   . GLU A 1 727  ? 161.291 162.717 97.568  1.00 99.85  ?  599  GLU A OE1   1 
ATOM   969   O  OE2   . GLU A 1 727  ? 160.047 164.082 96.383  1.00 172.59 -1 599  GLU A OE2   1 
ATOM   970   N  N     . ARG A 1 728  ? 163.229 161.109 96.152  1.00 88.54  ?  600  ARG A N     1 
ATOM   971   C  CA    . ARG A 1 728  ? 164.356 162.015 96.343  1.00 82.77  ?  600  ARG A CA    1 
ATOM   972   C  C     . ARG A 1 728  ? 165.274 162.041 95.130  1.00 89.15  ?  600  ARG A C     1 
ATOM   973   O  O     . ARG A 1 728  ? 166.214 162.846 95.093  1.00 88.87  ?  600  ARG A O     1 
ATOM   974   C  CB    . ARG A 1 728  ? 165.128 161.610 97.602  1.00 77.72  ?  600  ARG A CB    1 
ATOM   975   C  CG    . ARG A 1 728  ? 166.091 162.663 98.126  1.00 73.02  ?  600  ARG A CG    1 
ATOM   976   C  CD    . ARG A 1 728  ? 165.365 163.968 98.417  1.00 70.20  ?  600  ARG A CD    1 
ATOM   977   N  NE    . ARG A 1 728  ? 164.283 163.795 99.382  1.00 69.27  ?  600  ARG A NE    1 
ATOM   978   C  CZ    . ARG A 1 728  ? 163.672 164.797 100.008 1.00 67.02  ?  600  ARG A CZ    1 
ATOM   979   N  NH1   . ARG A 1 728  ? 164.033 166.051 99.771  1.00 68.47  ?  600  ARG A NH1   1 
ATOM   980   N  NH2   . ARG A 1 728  ? 162.698 164.545 100.871 1.00 63.71  ?  600  ARG A NH2   1 
ATOM   981   N  N     . ALA A 1 729  ? 165.011 161.185 94.142  1.00 102.79 ?  601  ALA A N     1 
ATOM   982   C  CA    . ALA A 1 729  ? 165.754 161.108 92.892  1.00 114.89 ?  601  ALA A CA    1 
ATOM   983   C  C     . ALA A 1 729  ? 167.215 160.755 93.117  1.00 120.14 ?  601  ALA A C     1 
ATOM   984   O  O     . ALA A 1 729  ? 168.065 161.060 92.277  1.00 125.30 ?  601  ALA A O     1 
ATOM   985   C  CB    . ALA A 1 729  ? 165.635 162.409 92.090  1.00 119.32 ?  601  ALA A CB    1 
ATOM   986   N  N     . LEU A 1 730  ? 167.521 160.112 94.240  1.00 116.19 ?  602  LEU A N     1 
ATOM   987   C  CA    . LEU A 1 730  ? 168.889 159.699 94.503  1.00 126.82 ?  602  LEU A CA    1 
ATOM   988   C  C     . LEU A 1 730  ? 169.251 158.492 93.645  1.00 133.31 ?  602  LEU A C     1 
ATOM   989   O  O     . LEU A 1 730  ? 168.409 157.648 93.326  1.00 125.67 ?  602  LEU A O     1 
ATOM   990   C  CB    . LEU A 1 730  ? 169.077 159.372 95.985  1.00 121.87 ?  602  LEU A CB    1 
ATOM   991   C  CG    . LEU A 1 730  ? 170.490 158.961 96.414  1.00 127.74 ?  602  LEU A CG    1 
ATOM   992   C  CD1   . LEU A 1 730  ? 171.481 160.083 96.144  1.00 132.07 ?  602  LEU A CD1   1 
ATOM   993   C  CD2   . LEU A 1 730  ? 170.522 158.562 97.878  1.00 118.15 ?  602  LEU A CD2   1 
ATOM   994   N  N     . ASP A 1 731  ? 170.524 158.427 93.265  1.00 142.01 ?  603  ASP A N     1 
ATOM   995   C  CA    . ASP A 1 731  ? 171.040 157.297 92.515  1.00 143.80 ?  603  ASP A CA    1 
ATOM   996   C  C     . ASP A 1 731  ? 170.938 156.021 93.351  1.00 135.64 ?  603  ASP A C     1 
ATOM   997   O  O     . ASP A 1 731  ? 170.583 156.041 94.532  1.00 131.98 ?  603  ASP A O     1 
ATOM   998   C  CB    . ASP A 1 731  ? 172.490 157.550 92.111  1.00 156.19 ?  603  ASP A CB    1 
ATOM   999   C  CG    . ASP A 1 731  ? 172.748 159.000 91.751  1.00 176.06 ?  603  ASP A CG    1 
ATOM   1000  O  OD1   . ASP A 1 731  ? 171.901 159.604 91.060  1.00 170.46 ?  603  ASP A OD1   1 
ATOM   1001  O  OD2   . ASP A 1 731  ? 173.794 159.539 92.172  1.00 224.27 -1 603  ASP A OD2   1 
ATOM   1002  N  N     . ASP A 1 732  ? 171.254 154.896 92.718  1.00 132.02 ?  604  ASP A N     1 
ATOM   1003  C  CA    . ASP A 1 732  ? 171.220 153.599 93.382  1.00 129.27 ?  604  ASP A CA    1 
ATOM   1004  C  C     . ASP A 1 732  ? 172.597 152.996 93.600  1.00 123.78 ?  604  ASP A C     1 
ATOM   1005  O  O     . ASP A 1 732  ? 172.843 152.403 94.653  1.00 120.99 ?  604  ASP A O     1 
ATOM   1006  C  CB    . ASP A 1 732  ? 170.355 152.620 92.584  1.00 144.12 ?  604  ASP A CB    1 
ATOM   1007  C  CG    . ASP A 1 732  ? 168.896 153.026 92.559  1.00 158.85 ?  604  ASP A CG    1 
ATOM   1008  O  OD1   . ASP A 1 732  ? 168.564 154.095 93.114  1.00 143.14 ?  604  ASP A OD1   1 
ATOM   1009  O  OD2   . ASP A 1 732  ? 168.077 152.274 91.991  1.00 215.11 -1 604  ASP A OD2   1 
ATOM   1010  N  N     . SER A 1 733  ? 173.507 153.132 92.636  1.00 124.48 ?  605  SER A N     1 
ATOM   1011  C  CA    . SER A 1 733  ? 174.882 152.696 92.847  1.00 129.81 ?  605  SER A CA    1 
ATOM   1012  C  C     . SER A 1 733  ? 175.652 153.606 93.796  1.00 135.36 ?  605  SER A C     1 
ATOM   1013  O  O     . SER A 1 733  ? 176.836 153.349 94.041  1.00 133.76 ?  605  SER A O     1 
ATOM   1014  C  CB    . SER A 1 733  ? 175.616 152.608 91.507  1.00 127.58 ?  605  SER A CB    1 
ATOM   1015  O  OG    . SER A 1 733  ? 176.955 152.180 91.685  1.00 122.36 ?  605  SER A OG    1 
ATOM   1016  N  N     . MET A 1 734  ? 175.015 154.652 94.337  1.00 137.59 ?  606  MET A N     1 
ATOM   1017  C  CA    . MET A 1 734  ? 175.681 155.612 95.212  1.00 145.85 ?  606  MET A CA    1 
ATOM   1018  C  C     . MET A 1 734  ? 174.961 155.780 96.548  1.00 135.95 ?  606  MET A C     1 
ATOM   1019  O  O     . MET A 1 734  ? 175.192 156.772 97.246  1.00 132.03 ?  606  MET A O     1 
ATOM   1020  C  CB    . MET A 1 734  ? 175.815 156.969 94.515  1.00 153.18 ?  606  MET A CB    1 
ATOM   1021  C  CG    . MET A 1 734  ? 177.225 157.296 94.051  1.00 151.58 ?  606  MET A CG    1 
ATOM   1022  S  SD    . MET A 1 734  ? 178.369 157.520 95.426  1.00 147.70 ?  606  MET A SD    1 
ATOM   1023  C  CE    . MET A 1 734  ? 179.859 157.993 94.552  1.00 144.24 ?  606  MET A CE    1 
ATOM   1024  N  N     . CYS A 1 735  ? 174.098 154.837 96.922  1.00 125.32 ?  607  CYS A N     1 
ATOM   1025  C  CA    . CYS A 1 735  ? 173.369 154.881 98.188  1.00 111.43 ?  607  CYS A CA    1 
ATOM   1026  C  C     . CYS A 1 735  ? 173.443 153.531 98.890  1.00 98.30  ?  607  CYS A C     1 
ATOM   1027  O  O     . CYS A 1 735  ? 172.450 153.003 99.396  1.00 89.76  ?  607  CYS A O     1 
ATOM   1028  C  CB    . CYS A 1 735  ? 171.916 155.298 97.975  1.00 107.22 ?  607  CYS A CB    1 
ATOM   1029  S  SG    . CYS A 1 735  ? 170.939 154.173 96.951  1.00 112.57 ?  607  CYS A SG    1 
ATOM   1030  N  N     . THR A 1 736  ? 174.642 152.952 98.934  1.00 90.40  ?  608  THR A N     1 
ATOM   1031  C  CA    . THR A 1 736  ? 174.842 151.649 99.550  1.00 73.46  ?  608  THR A CA    1 
ATOM   1032  C  C     . THR A 1 736  ? 175.385 151.724 100.972 1.00 72.47  ?  608  THR A C     1 
ATOM   1033  O  O     . THR A 1 736  ? 175.402 150.699 101.661 1.00 69.37  ?  608  THR A O     1 
ATOM   1034  C  CB    . THR A 1 736  ? 175.792 150.794 98.696  1.00 67.09  ?  608  THR A CB    1 
ATOM   1035  O  OG1   . THR A 1 736  ? 177.121 151.327 98.773  1.00 69.59  ?  608  THR A OG1   1 
ATOM   1036  C  CG2   . THR A 1 736  ? 175.340 150.774 97.244  1.00 73.42  ?  608  THR A CG2   1 
ATOM   1037  N  N     . SER A 1 737  ? 175.830 152.893 101.431 1.00 74.66  ?  609  SER A N     1 
ATOM   1038  C  CA    . SER A 1 737  ? 176.470 152.995 102.737 1.00 69.18  ?  609  SER A CA    1 
ATOM   1039  C  C     . SER A 1 737  ? 175.739 153.910 103.707 1.00 65.66  ?  609  SER A C     1 
ATOM   1040  O  O     . SER A 1 737  ? 175.440 153.497 104.834 1.00 60.46  ?  609  SER A O     1 
ATOM   1041  C  CB    . SER A 1 737  ? 177.922 153.474 102.574 1.00 71.10  ?  609  SER A CB    1 
ATOM   1042  O  OG    . SER A 1 737  ? 178.554 153.611 103.835 1.00 69.35  ?  609  SER A OG    1 
ATOM   1043  N  N     . GLY A 1 738  ? 175.441 155.142 103.306 1.00 71.12  ?  610  GLY A N     1 
ATOM   1044  C  CA    . GLY A 1 738  ? 175.021 156.156 104.254 1.00 77.76  ?  610  GLY A CA    1 
ATOM   1045  C  C     . GLY A 1 738  ? 173.575 156.124 104.708 1.00 65.01  ?  610  GLY A C     1 
ATOM   1046  O  O     . GLY A 1 738  ? 172.796 157.008 104.345 1.00 64.20  ?  610  GLY A O     1 
ATOM   1047  N  N     . PHE A 1 739  ? 173.207 155.141 105.525 1.00 55.33  ?  611  PHE A N     1 
ATOM   1048  C  CA    . PHE A 1 739  ? 171.862 155.043 106.072 1.00 47.02  ?  611  PHE A CA    1 
ATOM   1049  C  C     . PHE A 1 739  ? 171.871 155.300 107.575 1.00 42.07  ?  611  PHE A C     1 
ATOM   1050  O  O     . PHE A 1 739  ? 172.853 155.011 108.266 1.00 41.18  ?  611  PHE A O     1 
ATOM   1051  C  CB    . PHE A 1 739  ? 171.247 153.671 105.779 1.00 47.42  ?  611  PHE A CB    1 
ATOM   1052  C  CG    . PHE A 1 739  ? 170.603 153.577 104.425 1.00 54.91  ?  611  PHE A CG    1 
ATOM   1053  C  CD1   . PHE A 1 739  ? 171.371 153.393 103.288 1.00 63.63  ?  611  PHE A CD1   1 
ATOM   1054  C  CD2   . PHE A 1 739  ? 169.230 153.693 104.288 1.00 57.91  ?  611  PHE A CD2   1 
ATOM   1055  C  CE1   . PHE A 1 739  ? 170.778 153.310 102.041 1.00 71.29  ?  611  PHE A CE1   1 
ATOM   1056  C  CE2   . PHE A 1 739  ? 168.633 153.614 103.044 1.00 63.98  ?  611  PHE A CE2   1 
ATOM   1057  C  CZ    . PHE A 1 739  ? 169.407 153.422 101.919 1.00 70.03  ?  611  PHE A CZ    1 
ATOM   1058  N  N     . THR A 1 740  ? 170.758 155.840 108.078 1.00 39.88  ?  612  THR A N     1 
ATOM   1059  C  CA    . THR A 1 740  ? 170.656 156.257 109.477 1.00 35.03  ?  612  THR A CA    1 
ATOM   1060  C  C     . THR A 1 740  ? 169.232 156.004 109.962 1.00 33.43  ?  612  THR A C     1 
ATOM   1061  O  O     . THR A 1 740  ? 168.308 156.723 109.566 1.00 34.48  ?  612  THR A O     1 
ATOM   1062  C  CB    . THR A 1 740  ? 171.034 157.733 109.629 1.00 40.16  ?  612  THR A CB    1 
ATOM   1063  O  OG1   . THR A 1 740  ? 172.447 157.891 109.442 1.00 46.18  ?  612  THR A OG1   1 
ATOM   1064  C  CG2   . THR A 1 740  ? 170.651 158.260 111.006 1.00 33.04  ?  612  THR A CG2   1 
ATOM   1065  N  N     . VAL A 1 741  ? 169.058 155.000 110.825 1.00 28.81  ?  613  VAL A N     1 
ATOM   1066  C  CA    . VAL A 1 741  ? 167.752 154.600 111.348 1.00 22.04  ?  613  VAL A CA    1 
ATOM   1067  C  C     . VAL A 1 741  ? 167.648 155.005 112.813 1.00 17.45  ?  613  VAL A C     1 
ATOM   1068  O  O     . VAL A 1 741  ? 168.512 154.649 113.626 1.00 16.21  ?  613  VAL A O     1 
ATOM   1069  C  CB    . VAL A 1 741  ? 167.517 153.085 111.209 1.00 21.10  ?  613  VAL A CB    1 
ATOM   1070  C  CG1   . VAL A 1 741  ? 166.450 152.636 112.193 1.00 21.75  ?  613  VAL A CG1   1 
ATOM   1071  C  CG2   . VAL A 1 741  ? 167.100 152.725 109.800 1.00 24.92  ?  613  VAL A CG2   1 
ATOM   1072  N  N     . VAL A 1 742  ? 166.571 155.712 113.155 1.00 17.49  ?  614  VAL A N     1 
ATOM   1073  C  CA    . VAL A 1 742  ? 166.251 156.053 114.537 1.00 13.89  ?  614  VAL A CA    1 
ATOM   1074  C  C     . VAL A 1 742  ? 165.202 155.069 115.042 1.00 11.33  ?  614  VAL A C     1 
ATOM   1075  O  O     . VAL A 1 742  ? 164.194 154.819 114.366 1.00 12.51  ?  614  VAL A O     1 
ATOM   1076  C  CB    . VAL A 1 742  ? 165.756 157.506 114.650 1.00 17.56  ?  614  VAL A CB    1 
ATOM   1077  C  CG1   . VAL A 1 742  ? 165.729 157.954 116.105 1.00 16.73  ?  614  VAL A CG1   1 
ATOM   1078  C  CG2   . VAL A 1 742  ? 166.638 158.431 113.822 1.00 18.13  ?  614  VAL A CG2   1 
ATOM   1079  N  N     . VAL A 1 743  ? 165.440 154.500 116.224 1.00 9.07   ?  615  VAL A N     1 
ATOM   1080  C  CA    . VAL A 1 743  ? 164.568 153.485 116.806 1.00 8.08   ?  615  VAL A CA    1 
ATOM   1081  C  C     . VAL A 1 743  ? 164.044 154.011 118.134 1.00 8.27   ?  615  VAL A C     1 
ATOM   1082  O  O     . VAL A 1 743  ? 164.832 154.313 119.039 1.00 8.35   ?  615  VAL A O     1 
ATOM   1083  C  CB    . VAL A 1 743  ? 165.304 152.152 117.011 1.00 11.09  ?  615  VAL A CB    1 
ATOM   1084  C  CG1   . VAL A 1 743  ? 164.463 151.205 117.855 1.00 12.53  ?  615  VAL A CG1   1 
ATOM   1085  C  CG2   . VAL A 1 743  ? 165.660 151.526 115.673 1.00 13.08  ?  615  VAL A CG2   1 
ATOM   1086  N  N     . LYS A 1 744  ? 162.723 154.113 118.256 1.00 8.52   ?  616  LYS A N     1 
ATOM   1087  C  CA    . LYS A 1 744  ? 162.089 154.519 119.502 1.00 7.21   ?  616  LYS A CA    1 
ATOM   1088  C  C     . LYS A 1 744  ? 161.574 153.275 120.204 1.00 6.44   ?  616  LYS A C     1 
ATOM   1089  O  O     . LYS A 1 744  ? 160.683 152.593 119.689 1.00 7.93   ?  616  LYS A O     1 
ATOM   1090  C  CB    . LYS A 1 744  ? 160.939 155.491 119.252 1.00 8.01   ?  616  LYS A CB    1 
ATOM   1091  C  CG    . LYS A 1 744  ? 160.000 155.625 120.439 1.00 13.10  ?  616  LYS A CG    1 
ATOM   1092  C  CD    . LYS A 1 744  ? 158.704 156.317 120.056 1.00 15.60  ?  616  LYS A CD    1 
ATOM   1093  C  CE    . LYS A 1 744  ? 157.823 155.405 119.219 1.00 16.71  ?  616  LYS A CE    1 
ATOM   1094  N  NZ    . LYS A 1 744  ? 156.528 156.047 118.865 1.00 19.03  ?  616  LYS A NZ    1 
ATOM   1095  N  N     . GLU A 1 745  ? 162.129 152.974 121.366 1.00 6.86   ?  617  GLU A N     1 
ATOM   1096  C  CA    . GLU A 1 745  ? 161.650 151.840 122.137 1.00 9.00   ?  617  GLU A CA    1 
ATOM   1097  C  C     . GLU A 1 745  ? 160.666 152.310 123.202 1.00 8.20   ?  617  GLU A C     1 
ATOM   1098  O  O     . GLU A 1 745  ? 160.523 153.506 123.471 1.00 8.98   ?  617  GLU A O     1 
ATOM   1099  C  CB    . GLU A 1 745  ? 162.818 151.085 122.770 1.00 12.49  ?  617  GLU A CB    1 
ATOM   1100  C  CG    . GLU A 1 745  ? 163.807 151.975 123.470 1.00 16.85  ?  617  GLU A CG    1 
ATOM   1101  C  CD    . GLU A 1 745  ? 165.100 151.259 123.772 1.00 32.92  ?  617  GLU A CD    1 
ATOM   1102  O  OE1   . GLU A 1 745  ? 165.277 150.115 123.300 1.00 23.85  ?  617  GLU A OE1   1 
ATOM   1103  O  OE2   . GLU A 1 745  ? 165.939 151.840 124.489 1.00 124.35 -1 617  GLU A OE2   1 
ATOM   1104  N  N     . SER A 1 746  ? 159.977 151.341 123.804 1.00 9.53   ?  618  SER A N     1 
ATOM   1105  C  CA    . SER A 1 746  ? 158.958 151.625 124.810 1.00 10.28  ?  618  SER A CA    1 
ATOM   1106  C  C     . SER A 1 746  ? 158.640 150.353 125.578 1.00 10.52  ?  618  SER A C     1 
ATOM   1107  O  O     . SER A 1 746  ? 158.219 149.356 124.985 1.00 9.47   ?  618  SER A O     1 
ATOM   1108  C  CB    . SER A 1 746  ? 157.694 152.180 124.158 1.00 10.14  ?  618  SER A CB    1 
ATOM   1109  O  OG    . SER A 1 746  ? 156.753 152.558 125.147 1.00 14.42  ?  618  SER A OG    1 
ATOM   1110  N  N     . CYS A 1 747  ? 158.815 150.391 126.892 1.00 12.77  ?  619  CYS A N     1 
ATOM   1111  C  CA    . CYS A 1 747  ? 158.433 149.286 127.752 1.00 11.96  ?  619  CYS A CA    1 
ATOM   1112  C  C     . CYS A 1 747  ? 157.389 149.770 128.742 1.00 16.05  ?  619  CYS A C     1 
ATOM   1113  O  O     . CYS A 1 747  ? 157.383 150.939 129.143 1.00 16.90  ?  619  CYS A O     1 
ATOM   1114  C  CB    . CYS A 1 747  ? 159.633 148.716 128.511 1.00 13.80  ?  619  CYS A CB    1 
ATOM   1115  S  SG    . CYS A 1 747  ? 159.196 147.770 129.990 1.00 25.08  ?  619  CYS A SG    1 
ATOM   1116  N  N     . ASP A 1 748  ? 156.503 148.865 129.135 1.00 16.68  ?  620  ASP A N     1 
ATOM   1117  C  CA    . ASP A 1 748  ? 155.515 149.210 130.142 1.00 23.16  ?  620  ASP A CA    1 
ATOM   1118  C  C     . ASP A 1 748  ? 154.972 147.930 130.755 1.00 17.64  ?  620  ASP A C     1 
ATOM   1119  O  O     . ASP A 1 748  ? 155.202 146.821 130.258 1.00 13.28  ?  620  ASP A O     1 
ATOM   1120  C  CB    . ASP A 1 748  ? 154.386 150.062 129.554 1.00 35.68  ?  620  ASP A CB    1 
ATOM   1121  C  CG    . ASP A 1 748  ? 153.511 150.682 130.623 1.00 54.96  ?  620  ASP A CG    1 
ATOM   1122  O  OD1   . ASP A 1 748  ? 154.003 151.566 131.355 1.00 50.33  ?  620  ASP A OD1   1 
ATOM   1123  O  OD2   . ASP A 1 748  ? 152.338 150.271 130.743 1.00 100.81 -1 620  ASP A OD2   1 
ATOM   1124  N  N     . GLY A 1 749  ? 154.267 148.109 131.865 1.00 21.52  ?  621  GLY A N     1 
ATOM   1125  C  CA    . GLY A 1 749  ? 153.525 147.040 132.498 1.00 20.30  ?  621  GLY A CA    1 
ATOM   1126  C  C     . GLY A 1 749  ? 152.052 147.145 132.144 1.00 18.12  ?  621  GLY A C     1 
ATOM   1127  O  O     . GLY A 1 749  ? 151.470 148.231 132.148 1.00 23.77  ?  621  GLY A O     1 
ATOM   1128  N  N     . MET A 1 750  ? 151.472 146.004 131.813 1.00 14.60  ?  622  MET A N     1 
ATOM   1129  C  CA    . MET A 1 750  ? 150.050 145.865 131.574 1.00 16.03  ?  622  MET A CA    1 
ATOM   1130  C  C     . MET A 1 750  ? 149.474 144.989 132.672 1.00 19.35  ?  622  MET A C     1 
ATOM   1131  O  O     . MET A 1 750  ? 149.991 143.897 132.941 1.00 19.66  ?  622  MET A O     1 
ATOM   1132  C  CB    . MET A 1 750  ? 149.799 145.254 130.201 1.00 19.11  ?  622  MET A CB    1 
ATOM   1133  C  CG    . MET A 1 750  ? 148.435 144.654 130.012 1.00 25.06  ?  622  MET A CG    1 
ATOM   1134  S  SD    . MET A 1 750  ? 148.050 144.665 128.256 1.00 43.89  ?  622  MET A SD    1 
ATOM   1135  C  CE    . MET A 1 750  ? 149.700 144.602 127.548 1.00 22.66  ?  622  MET A CE    1 
ATOM   1136  N  N     . GLY A 1 751  ? 148.419 145.474 133.310 1.00 31.74  ?  623  GLY A N     1 
ATOM   1137  C  CA    . GLY A 1 751  ? 147.875 144.832 134.485 1.00 49.65  ?  623  GLY A CA    1 
ATOM   1138  C  C     . GLY A 1 751  ? 146.698 143.929 134.174 1.00 58.51  ?  623  GLY A C     1 
ATOM   1139  O  O     . GLY A 1 751  ? 145.991 144.118 133.185 1.00 54.39  ?  623  GLY A O     1 
ATOM   1140  N  N     . ASP A 1 752  ? 146.526 142.924 135.031 1.00 71.40  ?  624  ASP A N     1 
ATOM   1141  C  CA    . ASP A 1 752  ? 145.301 142.133 135.141 1.00 90.08  ?  624  ASP A CA    1 
ATOM   1142  C  C     . ASP A 1 752  ? 144.785 141.669 133.776 1.00 87.55  ?  624  ASP A C     1 
ATOM   1143  O  O     . ASP A 1 752  ? 143.742 142.113 133.298 1.00 90.85  ?  624  ASP A O     1 
ATOM   1144  C  CB    . ASP A 1 752  ? 144.212 142.922 135.873 1.00 105.69 ?  624  ASP A CB    1 
ATOM   1145  C  CG    . ASP A 1 752  ? 144.380 142.896 137.376 1.00 123.54 ?  624  ASP A CG    1 
ATOM   1146  O  OD1   . ASP A 1 752  ? 145.122 143.747 137.909 1.00 108.81 ?  624  ASP A OD1   1 
ATOM   1147  O  OD2   . ASP A 1 752  ? 143.770 142.022 138.026 1.00 207.76 -1 624  ASP A OD2   1 
ATOM   1148  N  N     . VAL A 1 753  ? 145.554 140.783 133.142 1.00 81.10  ?  625  VAL A N     1 
ATOM   1149  C  CA    . VAL A 1 753  ? 145.033 140.066 131.981 1.00 85.15  ?  625  VAL A CA    1 
ATOM   1150  C  C     . VAL A 1 753  ? 143.696 139.452 132.383 1.00 88.26  ?  625  VAL A C     1 
ATOM   1151  O  O     . VAL A 1 753  ? 143.605 138.725 133.379 1.00 84.84  ?  625  VAL A O     1 
ATOM   1152  C  CB    . VAL A 1 753  ? 146.024 139.004 131.466 1.00 83.32  ?  625  VAL A CB    1 
ATOM   1153  C  CG1   . VAL A 1 753  ? 147.155 139.667 130.698 1.00 67.50  ?  625  VAL A CG1   1 
ATOM   1154  C  CG2   . VAL A 1 753  ? 146.588 138.190 132.620 1.00 78.93  ?  625  VAL A CG2   1 
ATOM   1155  N  N     . SER A 1 754  ? 142.642 139.777 131.638 1.00 79.08  ?  626  SER A N     1 
ATOM   1156  C  CA    . SER A 1 754  ? 141.274 139.443 132.030 1.00 80.92  ?  626  SER A CA    1 
ATOM   1157  C  C     . SER A 1 754  ? 140.931 138.052 131.511 1.00 100.60 ?  626  SER A C     1 
ATOM   1158  O  O     . SER A 1 754  ? 140.682 137.865 130.318 1.00 100.04 ?  626  SER A O     1 
ATOM   1159  C  CB    . SER A 1 754  ? 140.300 140.491 131.501 1.00 71.26  ?  626  SER A CB    1 
ATOM   1160  O  OG    . SER A 1 754  ? 140.333 140.545 130.084 1.00 68.60  ?  626  SER A OG    1 
ATOM   1161  N  N     . GLU A 1 755  ? 140.911 137.070 132.411 1.00 114.54 ?  627  GLU A N     1 
ATOM   1162  C  CA    . GLU A 1 755  ? 140.509 135.715 132.058 1.00 132.00 ?  627  GLU A CA    1 
ATOM   1163  C  C     . GLU A 1 755  ? 139.884 135.054 133.280 1.00 140.89 ?  627  GLU A C     1 
ATOM   1164  O  O     . GLU A 1 755  ? 139.852 135.624 134.375 1.00 137.36 ?  627  GLU A O     1 
ATOM   1165  C  CB    . GLU A 1 755  ? 141.694 134.897 131.528 1.00 135.29 ?  627  GLU A CB    1 
ATOM   1166  C  CG    . GLU A 1 755  ? 141.404 134.128 130.235 1.00 156.70 ?  627  GLU A CG    1 
ATOM   1167  C  CD    . GLU A 1 755  ? 140.619 132.844 130.458 1.00 166.81 ?  627  GLU A CD    1 
ATOM   1168  O  OE1   . GLU A 1 755  ? 140.631 132.325 131.593 1.00 149.89 ?  627  GLU A OE1   1 
ATOM   1169  O  OE2   . GLU A 1 755  ? 139.994 132.351 129.493 1.00 206.01 -1 627  GLU A OE2   1 
ATOM   1170  N  N     . LYS A 1 756  ? 139.384 133.839 133.078 1.00 142.30 ?  628  LYS A N     1 
ATOM   1171  C  CA    . LYS A 1 756  ? 138.745 133.063 134.133 1.00 133.24 ?  628  LYS A CA    1 
ATOM   1172  C  C     . LYS A 1 756  ? 139.730 132.725 135.247 1.00 128.31 ?  628  LYS A C     1 
ATOM   1173  O  O     . LYS A 1 756  ? 139.348 132.599 136.410 1.00 125.49 ?  628  LYS A O     1 
ATOM   1174  C  CB    . LYS A 1 756  ? 138.144 131.775 133.562 1.00 123.32 ?  628  LYS A CB    1 
ATOM   1175  C  CG    . LYS A 1 756  ? 136.813 131.941 132.829 1.00 127.57 ?  628  LYS A CG    1 
ATOM   1176  C  CD    . LYS A 1 756  ? 136.991 132.540 131.439 1.00 133.87 ?  628  LYS A CD    1 
ATOM   1177  C  CE    . LYS A 1 756  ? 135.655 132.749 130.739 1.00 117.05 ?  628  LYS A CE    1 
ATOM   1178  N  NZ    . LYS A 1 756  ? 134.770 133.689 131.479 1.00 112.52 ?  628  LYS A NZ    1 
ATOM   1179  N  N     . PRO A 1 764  ? 149.639 134.646 136.580 1.00 57.77  ?  636  PRO A N     1 
ATOM   1180  C  CA    . PRO A 1 764  ? 149.076 135.232 135.359 1.00 56.08  ?  636  PRO A CA    1 
ATOM   1181  C  C     . PRO A 1 764  ? 148.124 136.390 135.641 1.00 60.39  ?  636  PRO A C     1 
ATOM   1182  O  O     . PRO A 1 764  ? 146.964 136.346 135.233 1.00 60.48  ?  636  PRO A O     1 
ATOM   1183  C  CB    . PRO A 1 764  ? 148.330 134.055 134.724 1.00 57.04  ?  636  PRO A CB    1 
ATOM   1184  C  CG    . PRO A 1 764  ? 147.951 133.200 135.877 1.00 60.49  ?  636  PRO A CG    1 
ATOM   1185  C  CD    . PRO A 1 764  ? 149.114 133.292 136.828 1.00 65.34  ?  636  PRO A CD    1 
ATOM   1186  N  N     . GLU A 1 765  ? 148.612 137.409 136.347 1.00 57.42  ?  637  GLU A N     1 
ATOM   1187  C  CA    . GLU A 1 765  ? 147.849 138.632 136.564 1.00 56.70  ?  637  GLU A CA    1 
ATOM   1188  C  C     . GLU A 1 765  ? 148.518 139.828 135.901 1.00 43.48  ?  637  GLU A C     1 
ATOM   1189  O  O     . GLU A 1 765  ? 147.894 140.497 135.074 1.00 53.72  ?  637  GLU A O     1 
ATOM   1190  C  CB    . GLU A 1 765  ? 147.652 138.873 138.069 1.00 77.79  ?  637  GLU A CB    1 
ATOM   1191  C  CG    . GLU A 1 765  ? 146.318 139.514 138.430 1.00 93.77  ?  637  GLU A CG    1 
ATOM   1192  C  CD    . GLU A 1 765  ? 145.913 139.257 139.873 1.00 113.54 ?  637  GLU A CD    1 
ATOM   1193  O  OE1   . GLU A 1 765  ? 144.933 138.514 140.093 1.00 103.62 ?  637  GLU A OE1   1 
ATOM   1194  O  OE2   . GLU A 1 765  ? 146.573 139.795 140.787 1.00 146.17 -1 637  GLU A OE2   1 
ATOM   1195  N  N     . LYS A 1 766  ? 149.781 140.099 136.212 1.00 31.82  ?  638  LYS A N     1 
ATOM   1196  C  CA    . LYS A 1 766  ? 150.496 141.203 135.597 1.00 23.93  ?  638  LYS A CA    1 
ATOM   1197  C  C     . LYS A 1 766  ? 151.186 140.734 134.316 1.00 23.71  ?  638  LYS A C     1 
ATOM   1198  O  O     . LYS A 1 766  ? 151.171 139.550 133.968 1.00 20.10  ?  638  LYS A O     1 
ATOM   1199  C  CB    . LYS A 1 766  ? 151.501 141.791 136.585 1.00 26.18  ?  638  LYS A CB    1 
ATOM   1200  C  CG    . LYS A 1 766  ? 150.860 142.467 137.779 1.00 29.28  ?  638  LYS A CG    1 
ATOM   1201  C  CD    . LYS A 1 766  ? 149.999 143.641 137.351 1.00 31.65  ?  638  LYS A CD    1 
ATOM   1202  C  CE    . LYS A 1 766  ? 149.937 144.693 138.444 1.00 33.28  ?  638  LYS A CE    1 
ATOM   1203  N  NZ    . LYS A 1 766  ? 149.601 144.088 139.760 1.00 35.42  ?  638  LYS A NZ    1 
ATOM   1204  N  N     . ALA A 1 767  ? 151.796 141.679 133.600 1.00 18.69  ?  639  ALA A N     1 
ATOM   1205  C  CA    . ALA A 1 767  ? 152.574 141.378 132.403 1.00 9.70   ?  639  ALA A CA    1 
ATOM   1206  C  C     . ALA A 1 767  ? 153.380 142.615 132.037 1.00 7.44   ?  639  ALA A C     1 
ATOM   1207  O  O     . ALA A 1 767  ? 153.015 143.733 132.398 1.00 9.78   ?  639  ALA A O     1 
ATOM   1208  C  CB    . ALA A 1 767  ? 151.679 140.954 131.233 1.00 9.61   ?  639  ALA A CB    1 
ATOM   1209  N  N     . VAL A 1 768  ? 154.483 142.405 131.324 1.00 2.73   ?  640  VAL A N     1 
ATOM   1210  C  CA    . VAL A 1 768  ? 155.318 143.495 130.829 1.00 3.97   ?  640  VAL A CA    1 
ATOM   1211  C  C     . VAL A 1 768  ? 155.507 143.295 129.334 1.00 6.85   ?  640  VAL A C     1 
ATOM   1212  O  O     . VAL A 1 768  ? 155.643 142.157 128.872 1.00 8.58   ?  640  VAL A O     1 
ATOM   1213  C  CB    . VAL A 1 768  ? 156.682 143.543 131.549 1.00 4.75   ?  640  VAL A CB    1 
ATOM   1214  C  CG1   . VAL A 1 768  ? 157.544 144.655 130.984 1.00 5.12   ?  640  VAL A CG1   1 
ATOM   1215  C  CG2   . VAL A 1 768  ? 156.495 143.723 133.039 1.00 8.56   ?  640  VAL A CG2   1 
ATOM   1216  N  N     . ARG A 1 769  ? 155.513 144.392 128.570 1.00 5.81   ?  641  ARG A N     1 
ATOM   1217  C  CA    . ARG A 1 769  ? 155.589 144.275 127.114 1.00 4.65   ?  641  ARG A CA    1 
ATOM   1218  C  C     . ARG A 1 769  ? 156.575 145.293 126.548 1.00 3.33   ?  641  ARG A C     1 
ATOM   1219  O  O     . ARG A 1 769  ? 156.317 146.500 126.580 1.00 12.69  ?  641  ARG A O     1 
ATOM   1220  C  CB    . ARG A 1 769  ? 154.208 144.437 126.484 1.00 6.58   ?  641  ARG A CB    1 
ATOM   1221  C  CG    . ARG A 1 769  ? 154.222 144.398 124.976 1.00 10.13  ?  641  ARG A CG    1 
ATOM   1222  C  CD    . ARG A 1 769  ? 152.845 144.088 124.444 1.00 34.86  ?  641  ARG A CD    1 
ATOM   1223  N  NE    . ARG A 1 769  ? 151.854 144.952 125.067 1.00 15.54  ?  641  ARG A NE    1 
ATOM   1224  C  CZ    . ARG A 1 769  ? 151.640 146.209 124.701 1.00 14.80  ?  641  ARG A CZ    1 
ATOM   1225  N  NH1   . ARG A 1 769  ? 150.722 146.934 125.318 1.00 21.56  ?  641  ARG A NH1   1 
ATOM   1226  N  NH2   . ARG A 1 769  ? 152.354 146.741 123.718 1.00 12.35  ?  641  ARG A NH2   1 
ATOM   1227  N  N     . PHE A 1 770  ? 157.690 144.794 126.013 1.00 4.50   ?  642  PHE A N     1 
ATOM   1228  C  CA    . PHE A 1 770  ? 158.735 145.618 125.414 1.00 4.74   ?  642  PHE A CA    1 
ATOM   1229  C  C     . PHE A 1 770  ? 158.494 145.726 123.910 1.00 5.06   ?  642  PHE A C     1 
ATOM   1230  O  O     . PHE A 1 770  ? 158.443 144.703 123.219 1.00 5.91   ?  642  PHE A O     1 
ATOM   1231  C  CB    . PHE A 1 770  ? 160.105 145.001 125.692 1.00 3.62   ?  642  PHE A CB    1 
ATOM   1232  C  CG    . PHE A 1 770  ? 161.243 145.950 125.508 1.00 3.60   ?  642  PHE A CG    1 
ATOM   1233  C  CD1   . PHE A 1 770  ? 161.625 146.789 126.533 1.00 5.61   ?  642  PHE A CD1   1 
ATOM   1234  C  CD2   . PHE A 1 770  ? 161.932 146.004 124.310 1.00 5.19   ?  642  PHE A CD2   1 
ATOM   1235  C  CE1   . PHE A 1 770  ? 162.668 147.671 126.372 1.00 7.27   ?  642  PHE A CE1   1 
ATOM   1236  C  CE2   . PHE A 1 770  ? 162.979 146.885 124.142 1.00 7.86   ?  642  PHE A CE2   1 
ATOM   1237  C  CZ    . PHE A 1 770  ? 163.348 147.719 125.176 1.00 11.48  ?  642  PHE A CZ    1 
ATOM   1238  N  N     . SER A 1 771  ? 158.358 146.954 123.397 1.00 5.62   ?  643  SER A N     1 
ATOM   1239  C  CA    . SER A 1 771  ? 158.027 147.173 121.993 1.00 6.20   ?  643  SER A CA    1 
ATOM   1240  C  C     . SER A 1 771  ? 158.848 148.319 121.420 1.00 6.61   ?  643  SER A C     1 
ATOM   1241  O  O     . SER A 1 771  ? 158.957 149.377 122.039 1.00 7.99   ?  643  SER A O     1 
ATOM   1242  C  CB    . SER A 1 771  ? 156.539 147.499 121.815 1.00 8.18   ?  643  SER A CB    1 
ATOM   1243  O  OG    . SER A 1 771  ? 156.190 148.677 122.529 1.00 9.08   ?  643  SER A OG    1 
ATOM   1244  N  N     . PHE A 1 772  ? 159.380 148.127 120.215 1.00 6.07   ?  644  PHE A N     1 
ATOM   1245  C  CA    . PHE A 1 772  ? 160.126 149.180 119.540 1.00 6.51   ?  644  PHE A CA    1 
ATOM   1246  C  C     . PHE A 1 772  ? 159.422 149.570 118.245 1.00 5.48   ?  644  PHE A C     1 
ATOM   1247  O  O     . PHE A 1 772  ? 158.545 148.859 117.752 1.00 5.96   ?  644  PHE A O     1 
ATOM   1248  C  CB    . PHE A 1 772  ? 161.587 148.762 119.270 1.00 6.35   ?  644  PHE A CB    1 
ATOM   1249  C  CG    . PHE A 1 772  ? 161.776 147.900 118.051 1.00 2.08   ?  644  PHE A CG    1 
ATOM   1250  C  CD1   . PHE A 1 772  ? 161.976 148.467 116.804 1.00 3.69   ?  644  PHE A CD1   1 
ATOM   1251  C  CD2   . PHE A 1 772  ? 161.805 146.524 118.161 1.00 1.70   ?  644  PHE A CD2   1 
ATOM   1252  C  CE1   . PHE A 1 772  ? 162.163 147.678 115.692 1.00 2.72   ?  644  PHE A CE1   1 
ATOM   1253  C  CE2   . PHE A 1 772  ? 161.997 145.733 117.048 1.00 1.56   ?  644  PHE A CE2   1 
ATOM   1254  C  CZ    . PHE A 1 772  ? 162.176 146.312 115.814 1.00 1.20   ?  644  PHE A CZ    1 
ATOM   1255  N  N     . THR A 1 773  ? 159.820 150.719 117.699 1.00 7.73   ?  645  THR A N     1 
ATOM   1256  C  CA    . THR A 1 773  ? 159.199 151.259 116.497 1.00 9.60   ?  645  THR A CA    1 
ATOM   1257  C  C     . THR A 1 773  ? 160.237 152.039 115.701 1.00 10.49  ?  645  THR A C     1 
ATOM   1258  O  O     . THR A 1 773  ? 160.982 152.849 116.265 1.00 10.86  ?  645  THR A O     1 
ATOM   1259  C  CB    . THR A 1 773  ? 158.006 152.159 116.850 1.00 10.94  ?  645  THR A CB    1 
ATOM   1260  O  OG1   . THR A 1 773  ? 157.029 151.399 117.572 1.00 6.81   ?  645  THR A OG1   1 
ATOM   1261  C  CG2   . THR A 1 773  ? 157.368 152.733 115.595 1.00 11.68  ?  645  THR A CG2   1 
ATOM   1262  N  N     . ILE A 1 774  ? 160.288 151.782 114.395 1.00 8.23   ?  646  ILE A N     1 
ATOM   1263  C  CA    . ILE A 1 774  ? 161.159 152.545 113.509 1.00 8.67   ?  646  ILE A CA    1 
ATOM   1264  C  C     . ILE A 1 774  ? 160.589 153.950 113.382 1.00 8.43   ?  646  ILE A C     1 
ATOM   1265  O  O     . ILE A 1 774  ? 159.482 154.138 112.863 1.00 8.44   ?  646  ILE A O     1 
ATOM   1266  C  CB    . ILE A 1 774  ? 161.273 151.873 112.136 1.00 7.77   ?  646  ILE A CB    1 
ATOM   1267  C  CG1   . ILE A 1 774  ? 161.420 150.361 112.290 1.00 6.40   ?  646  ILE A CG1   1 
ATOM   1268  C  CG2   . ILE A 1 774  ? 162.464 152.421 111.378 1.00 8.05   ?  646  ILE A CG2   1 
ATOM   1269  C  CD1   . ILE A 1 774  ? 162.691 149.959 112.969 1.00 6.77   ?  646  ILE A CD1   1 
ATOM   1270  N  N     . MET A 1 775  ? 161.329 154.944 113.868 1.00 10.36  ?  647  MET A N     1 
ATOM   1271  C  CA    . MET A 1 775  ? 160.806 156.303 113.870 1.00 12.80  ?  647  MET A CA    1 
ATOM   1272  C  C     . MET A 1 775  ? 161.082 157.021 112.552 1.00 17.56  ?  647  MET A C     1 
ATOM   1273  O  O     . MET A 1 775  ? 160.150 157.471 111.876 1.00 23.70  ?  647  MET A O     1 
ATOM   1274  C  CB    . MET A 1 775  ? 161.388 157.088 115.047 1.00 19.06  ?  647  MET A CB    1 
ATOM   1275  C  CG    . MET A 1 775  ? 160.343 157.484 116.064 1.00 21.08  ?  647  MET A CG    1 
ATOM   1276  S  SD    . MET A 1 775  ? 159.122 158.595 115.343 1.00 37.72  ?  647  MET A SD    1 
ATOM   1277  C  CE    . MET A 1 775  ? 160.169 159.937 114.784 1.00 30.47  ?  647  MET A CE    1 
ATOM   1278  N  N     . SER A 1 776  ? 162.354 157.136 112.174 1.00 22.42  ?  648  SER A N     1 
ATOM   1279  C  CA    . SER A 1 776  ? 162.713 157.859 110.962 1.00 25.54  ?  648  SER A CA    1 
ATOM   1280  C  C     . SER A 1 776  ? 164.016 157.314 110.391 1.00 24.49  ?  648  SER A C     1 
ATOM   1281  O  O     . SER A 1 776  ? 164.968 157.057 111.134 1.00 23.72  ?  648  SER A O     1 
ATOM   1282  C  CB    . SER A 1 776  ? 162.827 159.366 111.236 1.00 27.51  ?  648  SER A CB    1 
ATOM   1283  O  OG    . SER A 1 776  ? 163.861 159.649 112.164 1.00 26.40  ?  648  SER A OG    1 
ATOM   1284  N  N     . ILE A 1 777  ? 164.041 157.137 109.068 1.00 26.73  ?  649  ILE A N     1 
ATOM   1285  C  CA    . ILE A 1 777  ? 165.223 156.694 108.330 1.00 29.64  ?  649  ILE A CA    1 
ATOM   1286  C  C     . ILE A 1 777  ? 165.640 157.786 107.352 1.00 35.56  ?  649  ILE A C     1 
ATOM   1287  O  O     . ILE A 1 777  ? 164.823 158.264 106.554 1.00 36.28  ?  649  ILE A O     1 
ATOM   1288  C  CB    . ILE A 1 777  ? 164.984 155.357 107.598 1.00 27.23  ?  649  ILE A CB    1 
ATOM   1289  C  CG1   . ILE A 1 777  ? 166.078 155.076 106.556 1.00 36.39  ?  649  ILE A CG1   1 
ATOM   1290  C  CG2   . ILE A 1 777  ? 163.638 155.326 106.941 1.00 23.32  ?  649  ILE A CG2   1 
ATOM   1291  C  CD1   . ILE A 1 777  ? 167.468 154.886 107.099 1.00 43.04  ?  649  ILE A CD1   1 
ATOM   1292  N  N     . SER A 1 778  ? 166.917 158.163 107.414 1.00 38.62  ?  650  SER A N     1 
ATOM   1293  C  CA    . SER A 1 778  ? 167.495 159.228 106.609 1.00 44.18  ?  650  SER A CA    1 
ATOM   1294  C  C     . SER A 1 778  ? 168.787 158.738 105.961 1.00 49.38  ?  650  SER A C     1 
ATOM   1295  O  O     . SER A 1 778  ? 169.305 157.666 106.288 1.00 47.54  ?  650  SER A O     1 
ATOM   1296  C  CB    . SER A 1 778  ? 167.755 160.480 107.460 1.00 51.56  ?  650  SER A CB    1 
ATOM   1297  O  OG    . SER A 1 778  ? 168.504 160.167 108.622 1.00 48.83  ?  650  SER A OG    1 
ATOM   1298  N  N     . ILE A 1 779  ? 169.313 159.539 105.036 1.00 54.91  ?  651  ILE A N     1 
ATOM   1299  C  CA    . ILE A 1 779  ? 170.483 159.154 104.257 1.00 59.78  ?  651  ILE A CA    1 
ATOM   1300  C  C     . ILE A 1 779  ? 171.676 160.008 104.669 1.00 77.72  ?  651  ILE A C     1 
ATOM   1301  O  O     . ILE A 1 779  ? 171.537 161.119 105.190 1.00 85.17  ?  651  ILE A O     1 
ATOM   1302  C  CB    . ILE A 1 779  ? 170.232 159.258 102.737 1.00 62.35  ?  651  ILE A CB    1 
ATOM   1303  C  CG1   . ILE A 1 779  ? 170.912 158.098 102.015 1.00 64.87  ?  651  ILE A CG1   1 
ATOM   1304  C  CG2   . ILE A 1 779  ? 170.754 160.572 102.185 1.00 65.11  ?  651  ILE A CG2   1 
ATOM   1305  C  CD1   . ILE A 1 779  ? 170.346 156.756 102.382 1.00 61.73  ?  651  ILE A CD1   1 
ATOM   1306  N  N     . ARG A 1 780  ? 172.871 159.471 104.415 1.00 92.24  ?  652  ARG A N     1 
ATOM   1307  C  CA    . ARG A 1 780  ? 174.123 160.092 104.825 1.00 117.86 ?  652  ARG A CA    1 
ATOM   1308  C  C     . ARG A 1 780  ? 175.083 160.373 103.676 1.00 131.92 ?  652  ARG A C     1 
ATOM   1309  O  O     . ARG A 1 780  ? 175.907 161.282 103.793 1.00 146.71 ?  652  ARG A O     1 
ATOM   1310  C  CB    . ARG A 1 780  ? 174.829 159.207 105.871 1.00 116.58 ?  652  ARG A CB    1 
ATOM   1311  C  CG    . ARG A 1 780  ? 176.102 159.784 106.480 1.00 124.10 ?  652  ARG A CG    1 
ATOM   1312  C  CD    . ARG A 1 780  ? 175.820 161.036 107.289 1.00 137.54 ?  652  ARG A CD    1 
ATOM   1313  N  NE    . ARG A 1 780  ? 177.028 161.565 107.915 1.00 138.71 ?  652  ARG A NE    1 
ATOM   1314  C  CZ    . ARG A 1 780  ? 177.915 162.332 107.291 1.00 143.00 ?  652  ARG A CZ    1 
ATOM   1315  N  NH1   . ARG A 1 780  ? 177.731 162.658 106.019 1.00 152.67 ?  652  ARG A NH1   1 
ATOM   1316  N  NH2   . ARG A 1 780  ? 178.987 162.772 107.935 1.00 138.75 ?  652  ARG A NH2   1 
ATOM   1317  N  N     . LEU A 1 781  ? 174.998 159.640 102.569 1.00 127.66 ?  653  LEU A N     1 
ATOM   1318  C  CA    . LEU A 1 781  ? 175.925 159.847 101.463 1.00 146.39 ?  653  LEU A CA    1 
ATOM   1319  C  C     . LEU A 1 781  ? 175.549 161.097 100.675 1.00 153.12 ?  653  LEU A C     1 
ATOM   1320  O  O     . LEU A 1 781  ? 174.395 161.258 100.265 1.00 144.49 ?  653  LEU A O     1 
ATOM   1321  C  CB    . LEU A 1 781  ? 175.947 158.625 100.544 1.00 137.36 ?  653  LEU A CB    1 
ATOM   1322  C  CG    . LEU A 1 781  ? 176.622 157.371 101.107 1.00 116.99 ?  653  LEU A CG    1 
ATOM   1323  C  CD1   . LEU A 1 781  ? 176.285 156.150 100.266 1.00 99.63  ?  653  LEU A CD1   1 
ATOM   1324  C  CD2   . LEU A 1 781  ? 178.130 157.560 101.197 1.00 118.59 ?  653  LEU A CD2   1 
ATOM   1325  N  N     . GLU A 1 782  ? 176.524 161.979 100.457 1.00 164.40 ?  654  GLU A N     1 
ATOM   1326  C  CA    . GLU A 1 782  ? 177.885 161.794 100.961 1.00 169.49 ?  654  GLU A CA    1 
ATOM   1327  C  C     . GLU A 1 782  ? 178.464 163.100 101.506 1.00 170.28 ?  654  GLU A C     1 
ATOM   1328  O  O     . GLU A 1 782  ? 179.611 163.143 101.953 1.00 168.36 ?  654  GLU A O     1 
ATOM   1329  C  CB    . GLU A 1 782  ? 178.796 161.238 99.861  1.00 175.63 ?  654  GLU A CB    1 
ATOM   1330  C  CG    . GLU A 1 782  ? 179.326 162.288 98.898  1.00 193.22 ?  654  GLU A CG    1 
ATOM   1331  C  CD    . GLU A 1 782  ? 178.227 162.944 98.087  1.00 209.32 ?  654  GLU A CD    1 
ATOM   1332  O  OE1   . GLU A 1 782  ? 177.463 162.215 97.420  1.00 202.16 ?  654  GLU A OE1   1 
ATOM   1333  O  OE2   . GLU A 1 782  ? 178.124 164.188 98.124  1.00 253.20 -1 654  GLU A OE2   1 
ATOM   1334  N  N     . GLY A 1 783  ? 177.666 164.165 101.460 1.00 170.25 ?  655  GLY A N     1 
ATOM   1335  C  CA    . GLY A 1 783  ? 178.113 165.461 101.933 1.00 173.30 ?  655  GLY A CA    1 
ATOM   1336  C  C     . GLY A 1 783  ? 177.965 165.631 103.431 1.00 177.03 ?  655  GLY A C     1 
ATOM   1337  O  O     . GLY A 1 783  ? 178.265 164.711 104.198 1.00 172.70 ?  655  GLY A O     1 
ATOM   1338  N  N     . GLU A 1 784  ? 177.503 166.807 103.861 1.00 184.26 ?  656  GLU A N     1 
ATOM   1339  C  CA    . GLU A 1 784  ? 177.275 167.042 105.283 1.00 186.69 ?  656  GLU A CA    1 
ATOM   1340  C  C     . GLU A 1 784  ? 175.969 166.401 105.741 1.00 179.67 ?  656  GLU A C     1 
ATOM   1341  O  O     . GLU A 1 784  ? 175.928 165.747 106.790 1.00 170.87 ?  656  GLU A O     1 
ATOM   1342  C  CB    . GLU A 1 784  ? 177.279 168.545 105.582 1.00 193.89 ?  656  GLU A CB    1 
ATOM   1343  C  CG    . GLU A 1 784  ? 176.379 169.390 104.682 1.00 196.73 ?  656  GLU A CG    1 
ATOM   1344  C  CD    . GLU A 1 784  ? 177.051 169.793 103.383 1.00 205.53 ?  656  GLU A CD    1 
ATOM   1345  O  OE1   . GLU A 1 784  ? 178.280 169.607 103.264 1.00 202.37 ?  656  GLU A OE1   1 
ATOM   1346  O  OE2   . GLU A 1 784  ? 176.348 170.294 102.480 1.00 230.66 -1 656  GLU A OE2   1 
ATOM   1347  N  N     . ASP A 1 785  ? 174.906 166.582 104.959 1.00 180.48 ?  657  ASP A N     1 
ATOM   1348  C  CA    . ASP A 1 785  ? 173.594 165.956 105.149 1.00 168.09 ?  657  ASP A CA    1 
ATOM   1349  C  C     . ASP A 1 785  ? 173.176 165.921 106.622 1.00 164.32 ?  657  ASP A C     1 
ATOM   1350  O  O     . ASP A 1 785  ? 172.987 164.866 107.230 1.00 158.29 ?  657  ASP A O     1 
ATOM   1351  C  CB    . ASP A 1 785  ? 173.552 164.559 104.520 1.00 159.91 ?  657  ASP A CB    1 
ATOM   1352  C  CG    . ASP A 1 785  ? 174.415 163.553 105.250 1.00 162.79 ?  657  ASP A CG    1 
ATOM   1353  O  OD1   . ASP A 1 785  ? 175.653 163.592 105.104 1.00 163.91 ?  657  ASP A OD1   1 
ATOM   1354  O  OD2   . ASP A 1 785  ? 173.840 162.731 105.994 1.00 190.00 -1 657  ASP A OD2   1 
ATOM   1355  N  N     . ASP A 1 786  ? 173.032 167.120 107.195 1.00 167.83 ?  658  ASP A N     1 
ATOM   1356  C  CA    . ASP A 1 786  ? 172.474 167.231 108.539 1.00 163.97 ?  658  ASP A CA    1 
ATOM   1357  C  C     . ASP A 1 786  ? 171.148 166.489 108.651 1.00 147.67 ?  658  ASP A C     1 
ATOM   1358  O  O     . ASP A 1 786  ? 170.803 165.986 109.727 1.00 140.17 ?  658  ASP A O     1 
ATOM   1359  C  CB    . ASP A 1 786  ? 172.301 168.704 108.916 1.00 174.23 ?  658  ASP A CB    1 
ATOM   1360  C  CG    . ASP A 1 786  ? 171.564 169.496 107.854 1.00 182.48 ?  658  ASP A CG    1 
ATOM   1361  O  OD1   . ASP A 1 786  ? 171.271 168.929 106.780 1.00 168.87 ?  658  ASP A OD1   1 
ATOM   1362  O  OD2   . ASP A 1 786  ? 171.283 170.690 108.091 1.00 221.41 -1 658  ASP A OD2   1 
ATOM   1363  N  N     . GLY A 1 787  ? 170.398 166.407 107.554 1.00 141.17 ?  659  GLY A N     1 
ATOM   1364  C  CA    . GLY A 1 787  ? 169.255 165.522 107.473 1.00 121.55 ?  659  GLY A CA    1 
ATOM   1365  C  C     . GLY A 1 787  ? 168.715 165.385 106.064 1.00 99.01  ?  659  GLY A C     1 
ATOM   1366  O  O     . GLY A 1 787  ? 168.450 166.386 105.392 1.00 96.48  ?  659  GLY A O     1 
ATOM   1367  N  N     . ILE A 1 788  ? 168.547 164.146 105.605 1.00 76.97  ?  660  ILE A N     1 
ATOM   1368  C  CA    . ILE A 1 788  ? 167.872 163.849 104.341 1.00 65.37  ?  660  ILE A CA    1 
ATOM   1369  C  C     . ILE A 1 788  ? 166.791 162.828 104.682 1.00 56.88  ?  660  ILE A C     1 
ATOM   1370  O  O     . ILE A 1 788  ? 167.029 161.617 104.652 1.00 54.86  ?  660  ILE A O     1 
ATOM   1371  C  CB    . ILE A 1 788  ? 168.823 163.311 103.267 1.00 63.63  ?  660  ILE A CB    1 
ATOM   1372  C  CG1   . ILE A 1 788  ? 169.984 164.277 103.032 1.00 74.69  ?  660  ILE A CG1   1 
ATOM   1373  C  CG2   . ILE A 1 788  ? 168.073 163.071 101.966 1.00 61.79  ?  660  ILE A CG2   1 
ATOM   1374  C  CD1   . ILE A 1 788  ? 169.562 165.606 102.450 1.00 81.84  ?  660  ILE A CD1   1 
ATOM   1375  N  N     . THR A 1 789  ? 165.593 163.309 105.001 1.00 53.65  ?  661  THR A N     1 
ATOM   1376  C  CA    . THR A 1 789  ? 164.530 162.433 105.482 1.00 45.54  ?  661  THR A CA    1 
ATOM   1377  C  C     . THR A 1 789  ? 164.056 161.525 104.352 1.00 41.41  ?  661  THR A C     1 
ATOM   1378  O  O     . THR A 1 789  ? 163.370 161.969 103.426 1.00 44.05  ?  661  THR A O     1 
ATOM   1379  C  CB    . THR A 1 789  ? 163.381 163.260 106.060 1.00 47.45  ?  661  THR A CB    1 
ATOM   1380  O  OG1   . THR A 1 789  ? 162.219 162.434 106.223 1.00 42.05  ?  661  THR A OG1   1 
ATOM   1381  C  CG2   . THR A 1 789  ? 163.051 164.466 105.176 1.00 52.63  ?  661  THR A CG2   1 
ATOM   1382  N  N     . ILE A 1 790  ? 164.431 160.248 104.415 1.00 39.20  ?  662  ILE A N     1 
ATOM   1383  C  CA    . ILE A 1 790  ? 163.939 159.297 103.424 1.00 38.34  ?  662  ILE A CA    1 
ATOM   1384  C  C     . ILE A 1 790  ? 162.533 158.841 103.784 1.00 33.61  ?  662  ILE A C     1 
ATOM   1385  O  O     . ILE A 1 790  ? 161.627 158.844 102.943 1.00 36.02  ?  662  ILE A O     1 
ATOM   1386  C  CB    . ILE A 1 790  ? 164.911 158.108 103.277 1.00 43.12  ?  662  ILE A CB    1 
ATOM   1387  C  CG1   . ILE A 1 790  ? 165.856 158.336 102.096 1.00 50.95  ?  662  ILE A CG1   1 
ATOM   1388  C  CG2   . ILE A 1 790  ? 164.156 156.802 103.065 1.00 43.83  ?  662  ILE A CG2   1 
ATOM   1389  C  CD1   . ILE A 1 790  ? 166.627 159.635 102.155 1.00 58.27  ?  662  ILE A CD1   1 
ATOM   1390  N  N     . PHE A 1 791  ? 162.320 158.468 105.044 1.00 30.71  ?  663  PHE A N     1 
ATOM   1391  C  CA    . PHE A 1 791  ? 160.997 158.050 105.491 1.00 26.66  ?  663  PHE A CA    1 
ATOM   1392  C  C     . PHE A 1 791  ? 160.808 158.503 106.927 1.00 26.26  ?  663  PHE A C     1 
ATOM   1393  O  O     . PHE A 1 791  ? 161.558 158.085 107.817 1.00 27.74  ?  663  PHE A O     1 
ATOM   1394  C  CB    . PHE A 1 791  ? 160.824 156.535 105.382 1.00 29.50  ?  663  PHE A CB    1 
ATOM   1395  C  CG    . PHE A 1 791  ? 159.866 155.965 106.388 1.00 27.95  ?  663  PHE A CG    1 
ATOM   1396  C  CD1   . PHE A 1 791  ? 158.510 156.210 106.291 1.00 34.28  ?  663  PHE A CD1   1 
ATOM   1397  C  CD2   . PHE A 1 791  ? 160.328 155.211 107.452 1.00 25.08  ?  663  PHE A CD2   1 
ATOM   1398  C  CE1   . PHE A 1 791  ? 157.633 155.691 107.222 1.00 34.54  ?  663  PHE A CE1   1 
ATOM   1399  C  CE2   . PHE A 1 791  ? 159.457 154.703 108.388 1.00 24.59  ?  663  PHE A CE2   1 
ATOM   1400  C  CZ    . PHE A 1 791  ? 158.108 154.935 108.271 1.00 27.38  ?  663  PHE A CZ    1 
ATOM   1401  N  N     . GLN A 1 792  ? 159.813 159.354 107.146 1.00 24.31  ?  664  GLN A N     1 
ATOM   1402  C  CA    . GLN A 1 792  ? 159.399 159.760 108.482 1.00 27.52  ?  664  GLN A CA    1 
ATOM   1403  C  C     . GLN A 1 792  ? 158.012 159.184 108.728 1.00 27.27  ?  664  GLN A C     1 
ATOM   1404  O  O     . GLN A 1 792  ? 157.037 159.611 108.097 1.00 29.13  ?  664  GLN A O     1 
ATOM   1405  C  CB    . GLN A 1 792  ? 159.399 161.278 108.633 1.00 30.42  ?  664  GLN A CB    1 
ATOM   1406  C  CG    . GLN A 1 792  ? 159.048 161.735 110.040 1.00 37.20  ?  664  GLN A CG    1 
ATOM   1407  C  CD    . GLN A 1 792  ? 159.115 163.239 110.205 1.00 41.67  ?  664  GLN A CD    1 
ATOM   1408  O  OE1   . GLN A 1 792  ? 159.223 163.979 109.228 1.00 40.74  ?  664  GLN A OE1   1 
ATOM   1409  N  NE2   . GLN A 1 792  ? 159.051 163.699 111.450 1.00 36.95  ?  664  GLN A NE2   1 
ATOM   1410  N  N     . GLU A 1 793  ? 157.936 158.201 109.624 1.00 32.62  ?  665  GLU A N     1 
ATOM   1411  C  CA    . GLU A 1 793  ? 156.658 157.630 110.023 1.00 35.76  ?  665  GLU A CA    1 
ATOM   1412  C  C     . GLU A 1 793  ? 155.679 158.736 110.400 1.00 37.91  ?  665  GLU A C     1 
ATOM   1413  O  O     . GLU A 1 793  ? 156.033 159.689 111.098 1.00 38.16  ?  665  GLU A O     1 
ATOM   1414  C  CB    . GLU A 1 793  ? 156.869 156.668 111.196 1.00 34.93  ?  665  GLU A CB    1 
ATOM   1415  C  CG    . GLU A 1 793  ? 155.647 156.469 112.063 1.00 40.35  ?  665  GLU A CG    1 
ATOM   1416  C  CD    . GLU A 1 793  ? 154.507 155.837 111.299 1.00 52.71  ?  665  GLU A CD    1 
ATOM   1417  O  OE1   . GLU A 1 793  ? 154.610 154.644 110.946 1.00 44.64  ?  665  GLU A OE1   1 
ATOM   1418  O  OE2   . GLU A 1 793  ? 153.520 156.551 111.024 1.00 103.61 -1 665  GLU A OE2   1 
ATOM   1419  N  N     . GLN A 1 794  ? 154.443 158.613 109.914 1.00 40.11  ?  666  GLN A N     1 
ATOM   1420  C  CA    . GLN A 1 794  ? 153.443 159.658 110.084 1.00 37.15  ?  666  GLN A CA    1 
ATOM   1421  C  C     . GLN A 1 794  ? 152.513 159.426 111.267 1.00 38.43  ?  666  GLN A C     1 
ATOM   1422  O  O     . GLN A 1 794  ? 151.788 160.350 111.653 1.00 39.83  ?  666  GLN A O     1 
ATOM   1423  C  CB    . GLN A 1 794  ? 152.609 159.802 108.806 1.00 37.27  ?  666  GLN A CB    1 
ATOM   1424  C  CG    . GLN A 1 794  ? 152.449 161.239 108.353 1.00 45.70  ?  666  GLN A CG    1 
ATOM   1425  C  CD    . GLN A 1 794  ? 153.728 161.802 107.766 1.00 47.26  ?  666  GLN A CD    1 
ATOM   1426  O  OE1   . GLN A 1 794  ? 154.654 161.058 107.441 1.00 41.45  ?  666  GLN A OE1   1 
ATOM   1427  N  NE2   . GLN A 1 794  ? 153.791 163.122 107.639 1.00 48.15  ?  666  GLN A NE2   1 
ATOM   1428  N  N     . LYS A 1 795  ? 152.513 158.229 111.847 1.00 40.25  ?  667  LYS A N     1 
ATOM   1429  C  CA    . LYS A 1 795  ? 151.677 157.904 113.004 1.00 36.15  ?  667  LYS A CA    1 
ATOM   1430  C  C     . LYS A 1 795  ? 152.534 157.267 114.093 1.00 32.67  ?  667  LYS A C     1 
ATOM   1431  O  O     . LYS A 1 795  ? 152.307 156.121 114.493 1.00 32.25  ?  667  LYS A O     1 
ATOM   1432  C  CB    . LYS A 1 795  ? 150.536 156.973 112.597 1.00 36.73  ?  667  LYS A CB    1 
ATOM   1433  C  CG    . LYS A 1 795  ? 149.759 157.420 111.365 1.00 36.76  ?  667  LYS A CG    1 
ATOM   1434  C  CD    . LYS A 1 795  ? 148.904 156.286 110.815 1.00 32.78  ?  667  LYS A CD    1 
ATOM   1435  C  CE    . LYS A 1 795  ? 147.863 155.835 111.824 1.00 26.40  ?  667  LYS A CE    1 
ATOM   1436  N  NZ    . LYS A 1 795  ? 147.074 154.671 111.333 1.00 22.71  ?  667  LYS A NZ    1 
ATOM   1437  N  N     . PRO A 1 796  ? 153.528 157.997 114.614 1.00 31.39  ?  668  PRO A N     1 
ATOM   1438  C  CA    . PRO A 1 796  ? 154.483 157.379 115.550 1.00 28.84  ?  668  PRO A CA    1 
ATOM   1439  C  C     . PRO A 1 796  ? 153.868 156.960 116.873 1.00 22.62  ?  668  PRO A C     1 
ATOM   1440  O  O     . PRO A 1 796  ? 154.560 156.323 117.679 1.00 23.06  ?  668  PRO A O     1 
ATOM   1441  C  CB    . PRO A 1 796  ? 155.532 158.477 115.752 1.00 35.10  ?  668  PRO A CB    1 
ATOM   1442  C  CG    . PRO A 1 796  ? 154.778 159.743 115.539 1.00 38.05  ?  668  PRO A CG    1 
ATOM   1443  C  CD    . PRO A 1 796  ? 153.737 159.452 114.492 1.00 35.41  ?  668  PRO A CD    1 
ATOM   1444  N  N     . ASN A 1 797  ? 152.603 157.297 117.124 1.00 22.87  ?  669  ASN A N     1 
ATOM   1445  C  CA    . ASN A 1 797  ? 151.899 156.861 118.321 1.00 27.48  ?  669  ASN A CA    1 
ATOM   1446  C  C     . ASN A 1 797  ? 150.836 155.812 118.052 1.00 27.12  ?  669  ASN A C     1 
ATOM   1447  O  O     . ASN A 1 797  ? 150.528 155.024 118.945 1.00 27.51  ?  669  ASN A O     1 
ATOM   1448  C  CB    . ASN A 1 797  ? 151.235 158.055 119.018 1.00 32.73  ?  669  ASN A CB    1 
ATOM   1449  C  CG    . ASN A 1 797  ? 152.063 159.316 118.929 1.00 31.89  ?  669  ASN A CG    1 
ATOM   1450  O  OD1   . ASN A 1 797  ? 152.409 159.768 117.838 1.00 32.15  ?  669  ASN A OD1   1 
ATOM   1451  N  ND2   . ASN A 1 797  ? 152.379 159.900 120.079 1.00 31.97  ?  669  ASN A ND2   1 
ATOM   1452  N  N     . SER A 1 798  ? 150.257 155.785 116.856 1.00 23.65  ?  670  SER A N     1 
ATOM   1453  C  CA    . SER A 1 798  ? 149.216 154.810 116.570 1.00 20.95  ?  670  SER A CA    1 
ATOM   1454  C  C     . SER A 1 798  ? 149.773 153.397 116.696 1.00 17.30  ?  670  SER A C     1 
ATOM   1455  O  O     . SER A 1 798  ? 150.805 153.067 116.103 1.00 17.10  ?  670  SER A O     1 
ATOM   1456  C  CB    . SER A 1 798  ? 148.647 155.042 115.174 1.00 27.10  ?  670  SER A CB    1 
ATOM   1457  O  OG    . SER A 1 798  ? 147.288 154.652 115.104 1.00 30.71  ?  670  SER A OG    1 
ATOM   1458  N  N     . GLU A 1 799  ? 149.083 152.566 117.483 1.00 23.04  ?  671  GLU A N     1 
ATOM   1459  C  CA    . GLU A 1 799  ? 149.551 151.216 117.783 1.00 21.26  ?  671  GLU A CA    1 
ATOM   1460  C  C     . GLU A 1 799  ? 149.762 150.371 116.535 1.00 15.42  ?  671  GLU A C     1 
ATOM   1461  O  O     . GLU A 1 799  ? 150.436 149.337 116.611 1.00 13.20  ?  671  GLU A O     1 
ATOM   1462  C  CB    . GLU A 1 799  ? 148.557 150.513 118.708 1.00 28.12  ?  671  GLU A CB    1 
ATOM   1463  C  CG    . GLU A 1 799  ? 147.182 150.274 118.086 1.00 37.71  ?  671  GLU A CG    1 
ATOM   1464  C  CD    . GLU A 1 799  ? 146.315 151.524 118.046 1.00 58.72  ?  671  GLU A CD    1 
ATOM   1465  O  OE1   . GLU A 1 799  ? 146.809 152.611 118.416 1.00 40.59  ?  671  GLU A OE1   1 
ATOM   1466  O  OE2   . GLU A 1 799  ? 145.135 151.418 117.651 1.00 141.85 -1 671  GLU A OE2   1 
ATOM   1467  N  N     . LEU A 1 800  ? 149.195 150.778 115.395 1.00 17.31  ?  672  LEU A N     1 
ATOM   1468  C  CA    . LEU A 1 800  ? 149.416 150.061 114.145 1.00 17.73  ?  672  LEU A CA    1 
ATOM   1469  C  C     . LEU A 1 800  ? 150.892 149.905 113.812 1.00 17.18  ?  672  LEU A C     1 
ATOM   1470  O  O     . LEU A 1 800  ? 151.257 148.979 113.079 1.00 14.42  ?  672  LEU A O     1 
ATOM   1471  C  CB    . LEU A 1 800  ? 148.702 150.772 112.995 1.00 22.50  ?  672  LEU A CB    1 
ATOM   1472  C  CG    . LEU A 1 800  ? 147.181 150.630 112.952 1.00 27.86  ?  672  LEU A CG    1 
ATOM   1473  C  CD1   . LEU A 1 800  ? 146.576 151.537 111.886 1.00 27.01  ?  672  LEU A CD1   1 
ATOM   1474  C  CD2   . LEU A 1 800  ? 146.804 149.176 112.707 1.00 21.10  ?  672  LEU A CD2   1 
ATOM   1475  N  N     . SER A 1 801  ? 151.752 150.789 114.326 1.00 14.66  ?  673  SER A N     1 
ATOM   1476  C  CA    . SER A 1 801  ? 153.200 150.642 114.186 1.00 10.83  ?  673  SER A CA    1 
ATOM   1477  C  C     . SER A 1 801  ? 153.805 150.757 115.584 1.00 9.31   ?  673  SER A C     1 
ATOM   1478  O  O     . SER A 1 801  ? 154.305 151.811 115.984 1.00 10.20  ?  673  SER A O     1 
ATOM   1479  C  CB    . SER A 1 801  ? 153.766 151.686 113.223 1.00 10.92  ?  673  SER A CB    1 
ATOM   1480  O  OG    . SER A 1 801  ? 155.181 151.727 113.285 1.00 15.22  ?  673  SER A OG    1 
ATOM   1481  N  N     . CYS A 1 802  ? 153.764 149.648 116.320 1.00 9.41   ?  674  CYS A N     1 
ATOM   1482  C  CA    . CYS A 1 802  ? 154.480 149.520 117.588 1.00 8.30   ?  674  CYS A CA    1 
ATOM   1483  C  C     . CYS A 1 802  ? 154.780 148.035 117.754 1.00 6.66   ?  674  CYS A C     1 
ATOM   1484  O  O     . CYS A 1 802  ? 153.945 147.279 118.260 1.00 5.33   ?  674  CYS A O     1 
ATOM   1485  C  CB    . CYS A 1 802  ? 153.677 150.067 118.759 1.00 11.38  ?  674  CYS A CB    1 
ATOM   1486  S  SG    . CYS A 1 802  ? 154.660 150.279 120.262 1.00 16.49  ?  674  CYS A SG    1 
ATOM   1487  N  N     . ARG A 1 803  ? 155.975 147.638 117.344 1.00 5.55   ?  675  ARG A N     1 
ATOM   1488  C  CA    . ARG A 1 803  ? 156.287 146.233 117.152 1.00 4.08   ?  675  ARG A CA    1 
ATOM   1489  C  C     . ARG A 1 803  ? 156.723 145.605 118.466 1.00 4.43   ?  675  ARG A C     1 
ATOM   1490  O  O     . ARG A 1 803  ? 157.733 146.035 119.040 1.00 4.44   ?  675  ARG A O     1 
ATOM   1491  C  CB    . ARG A 1 803  ? 157.379 146.077 116.113 1.00 4.28   ?  675  ARG A CB    1 
ATOM   1492  C  CG    . ARG A 1 803  ? 157.464 147.243 115.140 1.00 4.97   ?  675  ARG A CG    1 
ATOM   1493  C  CD    . ARG A 1 803  ? 156.326 147.198 114.143 1.00 4.91   ?  675  ARG A CD    1 
ATOM   1494  N  NE    . ARG A 1 803  ? 156.399 146.004 113.307 1.00 5.83   ?  675  ARG A NE    1 
ATOM   1495  C  CZ    . ARG A 1 803  ? 157.218 145.872 112.271 1.00 6.91   ?  675  ARG A CZ    1 
ATOM   1496  N  NH1   . ARG A 1 803  ? 158.027 146.868 111.933 1.00 6.03   ?  675  ARG A NH1   1 
ATOM   1497  N  NH2   . ARG A 1 803  ? 157.221 144.749 111.567 1.00 8.60   ?  675  ARG A NH2   1 
ATOM   1498  N  N     . PRO A 1 804  ? 156.006 144.607 118.973 1.00 0.58   ?  676  PRO A N     1 
ATOM   1499  C  CA    . PRO A 1 804  ? 156.460 143.918 120.179 1.00 6.64   ?  676  PRO A CA    1 
ATOM   1500  C  C     . PRO A 1 804  ? 157.696 143.091 119.887 1.00 0.58   ?  676  PRO A C     1 
ATOM   1501  O  O     . PRO A 1 804  ? 157.889 142.572 118.785 1.00 8.28   ?  676  PRO A O     1 
ATOM   1502  C  CB    . PRO A 1 804  ? 155.271 143.025 120.546 1.00 10.35  ?  676  PRO A CB    1 
ATOM   1503  C  CG    . PRO A 1 804  ? 154.595 142.793 119.248 1.00 7.34   ?  676  PRO A CG    1 
ATOM   1504  C  CD    . PRO A 1 804  ? 154.715 144.083 118.499 1.00 9.51   ?  676  PRO A CD    1 
ATOM   1505  N  N     . LEU A 1 805  ? 158.542 142.979 120.896 1.00 3.46   ?  677  LEU A N     1 
ATOM   1506  C  CA    . LEU A 1 805  ? 159.797 142.273 120.767 1.00 2.86   ?  677  LEU A CA    1 
ATOM   1507  C  C     . LEU A 1 805  ? 160.062 141.344 121.934 1.00 3.85   ?  677  LEU A C     1 
ATOM   1508  O  O     . LEU A 1 805  ? 160.832 140.387 121.779 1.00 4.58   ?  677  LEU A O     1 
ATOM   1509  C  CB    . LEU A 1 805  ? 160.936 143.288 120.626 1.00 1.21   ?  677  LEU A CB    1 
ATOM   1510  C  CG    . LEU A 1 805  ? 162.375 142.811 120.661 1.00 1.21   ?  677  LEU A CG    1 
ATOM   1511  C  CD1   . LEU A 1 805  ? 163.166 143.502 119.577 1.00 3.36   ?  677  LEU A CD1   1 
ATOM   1512  C  CD2   . LEU A 1 805  ? 162.929 143.130 122.025 1.00 6.46   ?  677  LEU A CD2   1 
ATOM   1513  N  N     . CYS A 1 806  ? 159.414 141.562 123.075 1.00 3.16   ?  678  CYS A N     1 
ATOM   1514  C  CA    . CYS A 1 806  ? 159.600 140.733 124.251 1.00 2.11   ?  678  CYS A CA    1 
ATOM   1515  C  C     . CYS A 1 806  ? 158.373 140.814 125.146 1.00 2.03   ?  678  CYS A C     1 
ATOM   1516  O  O     . CYS A 1 806  ? 157.832 141.901 125.369 1.00 3.33   ?  678  CYS A O     1 
ATOM   1517  C  CB    . CYS A 1 806  ? 160.838 141.167 125.029 1.00 1.64   ?  678  CYS A CB    1 
ATOM   1518  S  SG    . CYS A 1 806  ? 160.954 140.347 126.612 1.00 3.49   ?  678  CYS A SG    1 
ATOM   1519  N  N     . LEU A 1 807  ? 157.949 139.662 125.672 1.00 1.55   ?  679  LEU A N     1 
ATOM   1520  C  CA    . LEU A 1 807  ? 156.844 139.601 126.615 1.00 2.38   ?  679  LEU A CA    1 
ATOM   1521  C  C     . LEU A 1 807  ? 157.220 138.724 127.797 1.00 4.20   ?  679  LEU A C     1 
ATOM   1522  O  O     . LEU A 1 807  ? 157.837 137.668 127.628 1.00 9.35   ?  679  LEU A O     1 
ATOM   1523  C  CB    . LEU A 1 807  ? 155.574 139.073 125.960 1.00 2.43   ?  679  LEU A CB    1 
ATOM   1524  C  CG    . LEU A 1 807  ? 154.772 140.176 125.277 1.00 0.31   ?  679  LEU A CG    1 
ATOM   1525  C  CD1   . LEU A 1 807  ? 155.290 140.443 123.879 1.00 0.51   ?  679  LEU A CD1   1 
ATOM   1526  C  CD2   . LEU A 1 807  ? 153.310 139.823 125.252 1.00 2.16   ?  679  LEU A CD2   1 
ATOM   1527  N  N     . MET A 1 808  ? 156.839 139.175 128.994 1.00 4.78   ?  680  MET A N     1 
ATOM   1528  C  CA    . MET A 1 808  ? 157.243 138.551 130.248 1.00 3.92   ?  680  MET A CA    1 
ATOM   1529  C  C     . MET A 1 808  ? 156.087 138.597 131.234 1.00 3.13   ?  680  MET A C     1 
ATOM   1530  O  O     . MET A 1 808  ? 155.522 139.666 131.484 1.00 3.79   ?  680  MET A O     1 
ATOM   1531  C  CB    . MET A 1 808  ? 158.457 139.261 130.855 1.00 4.72   ?  680  MET A CB    1 
ATOM   1532  C  CG    . MET A 1 808  ? 159.640 139.407 129.922 1.00 5.73   ?  680  MET A CG    1 
ATOM   1533  S  SD    . MET A 1 808  ? 160.828 140.577 130.588 1.00 9.65   ?  680  MET A SD    1 
ATOM   1534  C  CE    . MET A 1 808  ? 159.727 141.840 131.189 1.00 6.28   ?  680  MET A CE    1 
ATOM   1535  N  N     . PHE A 1 809  ? 155.753 137.440 131.806 1.00 3.77   ?  681  PHE A N     1 
ATOM   1536  C  CA    . PHE A 1 809  ? 154.684 137.331 132.799 1.00 2.74   ?  681  PHE A CA    1 
ATOM   1537  C  C     . PHE A 1 809  ? 155.231 137.658 134.189 1.00 5.16   ?  681  PHE A C     1 
ATOM   1538  O  O     . PHE A 1 809  ? 155.313 136.814 135.083 1.00 6.20   ?  681  PHE A O     1 
ATOM   1539  C  CB    . PHE A 1 809  ? 154.081 135.937 132.777 1.00 3.02   ?  681  PHE A CB    1 
ATOM   1540  C  CG    . PHE A 1 809  ? 152.844 135.828 131.955 1.00 3.33   ?  681  PHE A CG    1 
ATOM   1541  C  CD1   . PHE A 1 809  ? 151.904 136.839 131.968 1.00 5.08   ?  681  PHE A CD1   1 
ATOM   1542  C  CD2   . PHE A 1 809  ? 152.610 134.707 131.181 1.00 3.79   ?  681  PHE A CD2   1 
ATOM   1543  C  CE1   . PHE A 1 809  ? 150.758 136.742 131.215 1.00 11.76  ?  681  PHE A CE1   1 
ATOM   1544  C  CE2   . PHE A 1 809  ? 151.464 134.604 130.424 1.00 9.12   ?  681  PHE A CE2   1 
ATOM   1545  C  CZ    . PHE A 1 809  ? 150.536 135.623 130.442 1.00 11.46  ?  681  PHE A CZ    1 
ATOM   1546  N  N     . VAL A 1 810  ? 155.621 138.916 134.366 1.00 5.67   ?  682  VAL A N     1 
ATOM   1547  C  CA    . VAL A 1 810  ? 156.145 139.381 135.639 1.00 7.90   ?  682  VAL A CA    1 
ATOM   1548  C  C     . VAL A 1 810  ? 155.346 140.617 136.040 1.00 15.35  ?  682  VAL A C     1 
ATOM   1549  O  O     . VAL A 1 810  ? 154.396 141.007 135.363 1.00 15.54  ?  682  VAL A O     1 
ATOM   1550  C  CB    . VAL A 1 810  ? 157.657 139.687 135.571 1.00 6.98   ?  682  VAL A CB    1 
ATOM   1551  C  CG1   . VAL A 1 810  ? 158.298 139.644 136.963 1.00 11.42  ?  682  VAL A CG1   1 
ATOM   1552  C  CG2   . VAL A 1 810  ? 158.348 138.736 134.622 1.00 5.96   ?  682  VAL A CG2   1 
ATOM   1553  N  N     . ASP A 1 811  ? 155.732 141.224 137.156 1.00 16.29  ?  683  ASP A N     1 
ATOM   1554  C  CA    . ASP A 1 811  ? 155.118 142.449 137.635 1.00 23.22  ?  683  ASP A CA    1 
ATOM   1555  C  C     . ASP A 1 811  ? 156.065 143.623 137.416 1.00 18.28  ?  683  ASP A C     1 
ATOM   1556  O  O     . ASP A 1 811  ? 157.289 143.479 137.481 1.00 19.37  ?  683  ASP A O     1 
ATOM   1557  C  CB    . ASP A 1 811  ? 154.745 142.330 139.114 1.00 29.34  ?  683  ASP A CB    1 
ATOM   1558  C  CG    . ASP A 1 811  ? 153.658 143.302 139.521 1.00 42.99  ?  683  ASP A CG    1 
ATOM   1559  O  OD1   . ASP A 1 811  ? 153.553 144.382 138.902 1.00 34.18  ?  683  ASP A OD1   1 
ATOM   1560  O  OD2   . ASP A 1 811  ? 152.890 142.972 140.448 1.00 158.99 -1 683  ASP A OD2   1 
ATOM   1561  N  N     . GLU A 1 812  ? 155.473 144.790 137.153 1.00 24.92  ?  684  GLU A N     1 
ATOM   1562  C  CA    . GLU A 1 812  ? 156.252 145.980 136.828 1.00 27.13  ?  684  GLU A CA    1 
ATOM   1563  C  C     . GLU A 1 812  ? 157.147 146.408 137.982 1.00 21.84  ?  684  GLU A C     1 
ATOM   1564  O  O     . GLU A 1 812  ? 158.205 147.009 137.759 1.00 24.49  ?  684  GLU A O     1 
ATOM   1565  C  CB    . GLU A 1 812  ? 155.301 147.117 136.447 1.00 40.41  ?  684  GLU A CB    1 
ATOM   1566  C  CG    . GLU A 1 812  ? 155.961 148.372 135.907 1.00 56.22  ?  684  GLU A CG    1 
ATOM   1567  C  CD    . GLU A 1 812  ? 154.975 149.520 135.748 1.00 79.92  ?  684  GLU A CD    1 
ATOM   1568  O  OE1   . GLU A 1 812  ? 154.243 149.818 136.717 1.00 69.95  ?  684  GLU A OE1   1 
ATOM   1569  O  OE2   . GLU A 1 812  ? 154.926 150.122 134.654 1.00 104.52 -1 684  GLU A OE2   1 
ATOM   1570  N  N     . SER A 1 813  ? 156.748 146.094 139.215 1.00 21.31  ?  685  SER A N     1 
ATOM   1571  C  CA    . SER A 1 813  ? 157.394 146.676 140.386 1.00 23.05  ?  685  SER A CA    1 
ATOM   1572  C  C     . SER A 1 813  ? 158.764 146.058 140.642 1.00 26.83  ?  685  SER A C     1 
ATOM   1573  O  O     . SER A 1 813  ? 159.788 146.752 140.598 1.00 27.94  ?  685  SER A O     1 
ATOM   1574  C  CB    . SER A 1 813  ? 156.492 146.507 141.610 1.00 25.65  ?  685  SER A CB    1 
ATOM   1575  O  OG    . SER A 1 813  ? 155.192 147.012 141.363 1.00 26.27  ?  685  SER A OG    1 
ATOM   1576  N  N     . ASP A 1 814  ? 158.804 144.749 140.913 1.00 25.11  ?  686  ASP A N     1 
ATOM   1577  C  CA    . ASP A 1 814  ? 160.016 144.114 141.423 1.00 20.56  ?  686  ASP A CA    1 
ATOM   1578  C  C     . ASP A 1 814  ? 161.177 144.256 140.448 1.00 14.21  ?  686  ASP A C     1 
ATOM   1579  O  O     . ASP A 1 814  ? 161.150 143.716 139.336 1.00 18.08  ?  686  ASP A O     1 
ATOM   1580  C  CB    . ASP A 1 814  ? 159.774 142.634 141.743 1.00 29.27  ?  686  ASP A CB    1 
ATOM   1581  C  CG    . ASP A 1 814  ? 159.445 141.812 140.513 1.00 38.67  ?  686  ASP A CG    1 
ATOM   1582  O  OD1   . ASP A 1 814  ? 158.666 142.293 139.663 1.00 29.99  ?  686  ASP A OD1   1 
ATOM   1583  O  OD2   . ASP A 1 814  ? 159.992 140.696 140.385 1.00 122.19 -1 686  ASP A OD2   1 
ATOM   1584  N  N     . HIS A 1 815  ? 162.207 144.992 140.866 1.00 11.33  ?  687  HIS A N     1 
ATOM   1585  C  CA    . HIS A 1 815  ? 163.341 145.236 139.986 1.00 8.28   ?  687  HIS A CA    1 
ATOM   1586  C  C     . HIS A 1 815  ? 164.058 143.943 139.613 1.00 12.46  ?  687  HIS A C     1 
ATOM   1587  O  O     . HIS A 1 815  ? 164.632 143.843 138.517 1.00 12.35  ?  687  HIS A O     1 
ATOM   1588  C  CB    . HIS A 1 815  ? 164.308 146.208 140.657 1.00 5.56   ?  687  HIS A CB    1 
ATOM   1589  C  CG    . HIS A 1 815  ? 165.133 146.995 139.690 1.00 5.32   ?  687  HIS A CG    1 
ATOM   1590  N  ND1   . HIS A 1 815  ? 166.420 147.398 139.969 1.00 5.25   ?  687  HIS A ND1   1 
ATOM   1591  C  CD2   . HIS A 1 815  ? 164.853 147.456 138.448 1.00 8.98   ?  687  HIS A CD2   1 
ATOM   1592  C  CE1   . HIS A 1 815  ? 166.900 148.071 138.938 1.00 6.32   ?  687  HIS A CE1   1 
ATOM   1593  N  NE2   . HIS A 1 815  ? 165.969 148.120 138.002 1.00 10.10  ?  687  HIS A NE2   1 
ATOM   1594  N  N     . GLU A 1 816  ? 164.011 142.937 140.489 1.00 13.78  ?  688  GLU A N     1 
ATOM   1595  C  CA    . GLU A 1 816  ? 164.837 141.745 140.332 1.00 16.93  ?  688  GLU A CA    1 
ATOM   1596  C  C     . GLU A 1 816  ? 164.541 140.989 139.042 1.00 16.71  ?  688  GLU A C     1 
ATOM   1597  O  O     . GLU A 1 816  ? 165.401 140.913 138.156 1.00 16.42  ?  688  GLU A O     1 
ATOM   1598  C  CB    . GLU A 1 816  ? 164.654 140.810 141.531 1.00 16.24  ?  688  GLU A CB    1 
ATOM   1599  C  CG    . GLU A 1 816  ? 165.904 140.015 141.886 1.00 23.89  ?  688  GLU A CG    1 
ATOM   1600  C  CD    . GLU A 1 816  ? 166.417 139.164 140.735 1.00 33.98  ?  688  GLU A CD    1 
ATOM   1601  O  OE1   . GLU A 1 816  ? 165.601 138.470 140.091 1.00 26.91  ?  688  GLU A OE1   1 
ATOM   1602  O  OE2   . GLU A 1 816  ? 167.636 139.200 140.465 1.00 134.22 -1 688  GLU A OE2   1 
ATOM   1603  N  N     . THR A 1 817  ? 163.339 140.419 138.928 1.00 16.08  ?  689  THR A N     1 
ATOM   1604  C  CA    . THR A 1 817  ? 163.037 139.585 137.769 1.00 12.53  ?  689  THR A CA    1 
ATOM   1605  C  C     . THR A 1 817  ? 162.996 140.405 136.488 1.00 10.01  ?  689  THR A C     1 
ATOM   1606  O  O     . THR A 1 817  ? 163.372 139.906 135.416 1.00 10.13  ?  689  THR A O     1 
ATOM   1607  C  CB    . THR A 1 817  ? 161.710 138.859 137.975 1.00 12.52  ?  689  THR A CB    1 
ATOM   1608  O  OG1   . THR A 1 817  ? 161.630 138.384 139.325 1.00 15.85  ?  689  THR A OG1   1 
ATOM   1609  C  CG2   . THR A 1 817  ? 161.596 137.682 137.020 1.00 10.78  ?  689  THR A CG2   1 
ATOM   1610  N  N     . LEU A 1 818  ? 162.552 141.659 136.582 1.00 11.45  ?  690  LEU A N     1 
ATOM   1611  C  CA    . LEU A 1 818  ? 162.526 142.529 135.414 1.00 10.55  ?  690  LEU A CA    1 
ATOM   1612  C  C     . LEU A 1 818  ? 163.921 142.685 134.821 1.00 11.93  ?  690  LEU A C     1 
ATOM   1613  O  O     . LEU A 1 818  ? 164.121 142.471 133.618 1.00 15.69  ?  690  LEU A O     1 
ATOM   1614  C  CB    . LEU A 1 818  ? 161.935 143.889 135.788 1.00 6.62   ?  690  LEU A CB    1 
ATOM   1615  C  CG    . LEU A 1 818  ? 161.734 144.864 134.626 1.00 5.58   ?  690  LEU A CG    1 
ATOM   1616  C  CD1   . LEU A 1 818  ? 160.871 144.215 133.573 1.00 10.20  ?  690  LEU A CD1   1 
ATOM   1617  C  CD2   . LEU A 1 818  ? 161.103 146.164 135.099 1.00 6.61   ?  690  LEU A CD2   1 
ATOM   1618  N  N     . THR A 1 819  ? 164.905 143.049 135.654 1.00 9.54   ?  691  THR A N     1 
ATOM   1619  C  CA    . THR A 1 819  ? 166.273 143.138 135.151 1.00 10.75  ?  691  THR A CA    1 
ATOM   1620  C  C     . THR A 1 819  ? 166.773 141.780 134.682 1.00 85.22  ?  691  THR A C     1 
ATOM   1621  O  O     . THR A 1 819  ? 167.421 141.677 133.633 1.00 22.62  ?  691  THR A O     1 
ATOM   1622  C  CB    . THR A 1 819  ? 167.211 143.696 136.219 1.00 13.85  ?  691  THR A CB    1 
ATOM   1623  O  OG1   . THR A 1 819  ? 166.647 144.886 136.781 1.00 7.64   ?  691  THR A OG1   1 
ATOM   1624  C  CG2   . THR A 1 819  ? 168.571 144.018 135.612 1.00 7.03   ?  691  THR A CG2   1 
ATOM   1625  N  N     . ALA A 1 820  ? 166.471 140.727 135.446 1.00 17.39  ?  692  ALA A N     1 
ATOM   1626  C  CA    . ALA A 1 820  ? 166.945 139.390 135.109 1.00 15.31  ?  692  ALA A CA    1 
ATOM   1627  C  C     . ALA A 1 820  ? 166.552 138.988 133.693 1.00 15.16  ?  692  ALA A C     1 
ATOM   1628  O  O     . ALA A 1 820  ? 167.359 138.404 132.960 1.00 14.87  ?  692  ALA A O     1 
ATOM   1629  C  CB    . ALA A 1 820  ? 166.400 138.379 136.118 1.00 17.23  ?  692  ALA A CB    1 
ATOM   1630  N  N     . ILE A 1 821  ? 165.319 139.288 133.288 1.00 11.49  ?  693  ILE A N     1 
ATOM   1631  C  CA    . ILE A 1 821  ? 164.873 138.883 131.954 1.00 10.19  ?  693  ILE A CA    1 
ATOM   1632  C  C     . ILE A 1 821  ? 165.259 139.911 130.895 1.00 8.13   ?  693  ILE A C     1 
ATOM   1633  O  O     . ILE A 1 821  ? 165.609 139.543 129.770 1.00 9.21   ?  693  ILE A O     1 
ATOM   1634  C  CB    . ILE A 1 821  ? 163.356 138.611 131.930 1.00 9.51   ?  693  ILE A CB    1 
ATOM   1635  C  CG1   . ILE A 1 821  ? 162.938 137.688 133.072 1.00 6.24   ?  693  ILE A CG1   1 
ATOM   1636  C  CG2   . ILE A 1 821  ? 162.972 137.945 130.616 1.00 8.09   ?  693  ILE A CG2   1 
ATOM   1637  C  CD1   . ILE A 1 821  ? 163.239 136.226 132.820 1.00 9.69   ?  693  ILE A CD1   1 
ATOM   1638  N  N     . LEU A 1 822  ? 165.207 141.208 131.217 1.00 12.00  ?  694  LEU A N     1 
ATOM   1639  C  CA    . LEU A 1 822  ? 165.492 142.220 130.207 1.00 10.89  ?  694  LEU A CA    1 
ATOM   1640  C  C     . LEU A 1 822  ? 166.972 142.303 129.860 1.00 12.33  ?  694  LEU A C     1 
ATOM   1641  O  O     . LEU A 1 822  ? 167.307 142.771 128.765 1.00 12.18  ?  694  LEU A O     1 
ATOM   1642  C  CB    . LEU A 1 822  ? 164.996 143.586 130.681 1.00 12.01  ?  694  LEU A CB    1 
ATOM   1643  C  CG    . LEU A 1 822  ? 163.791 144.173 129.940 1.00 4.74   ?  694  LEU A CG    1 
ATOM   1644  C  CD1   . LEU A 1 822  ? 162.618 143.216 130.003 1.00 9.46   ?  694  LEU A CD1   1 
ATOM   1645  C  CD2   . LEU A 1 822  ? 163.408 145.529 130.508 1.00 4.35   ?  694  LEU A CD2   1 
ATOM   1646  N  N     . GLY A 1 823  ? 167.854 141.856 130.759 1.00 14.43  ?  695  GLY A N     1 
ATOM   1647  C  CA    . GLY A 1 823  ? 169.286 141.952 130.583 1.00 14.39  ?  695  GLY A CA    1 
ATOM   1648  C  C     . GLY A 1 823  ? 169.814 141.666 129.190 1.00 12.82  ?  695  GLY A C     1 
ATOM   1649  O  O     . GLY A 1 823  ? 170.521 142.490 128.602 1.00 13.21  ?  695  GLY A O     1 
ATOM   1650  N  N     . PRO A 1 824  ? 169.510 140.483 128.647 1.00 11.74  ?  696  PRO A N     1 
ATOM   1651  C  CA    . PRO A 1 824  ? 169.974 140.164 127.284 1.00 12.35  ?  696  PRO A CA    1 
ATOM   1652  C  C     . PRO A 1 824  ? 169.605 141.206 126.240 1.00 13.04  ?  696  PRO A C     1 
ATOM   1653  O  O     . PRO A 1 824  ? 170.448 141.557 125.406 1.00 18.93  ?  696  PRO A O     1 
ATOM   1654  C  CB    . PRO A 1 824  ? 169.299 138.815 127.010 1.00 11.15  ?  696  PRO A CB    1 
ATOM   1655  C  CG    . PRO A 1 824  ? 169.203 138.192 128.359 1.00 11.61  ?  696  PRO A CG    1 
ATOM   1656  C  CD    . PRO A 1 824  ? 168.875 139.319 129.293 1.00 10.32  ?  696  PRO A CD    1 
ATOM   1657  N  N     . VAL A 1 825  ? 168.368 141.705 126.258 1.00 12.05  ?  697  VAL A N     1 
ATOM   1658  C  CA    . VAL A 1 825  ? 167.965 142.748 125.317 1.00 11.88  ?  697  VAL A CA    1 
ATOM   1659  C  C     . VAL A 1 825  ? 168.839 143.988 125.482 1.00 17.15  ?  697  VAL A C     1 
ATOM   1660  O  O     . VAL A 1 825  ? 169.271 144.605 124.495 1.00 17.94  ?  697  VAL A O     1 
ATOM   1661  C  CB    . VAL A 1 825  ? 166.472 143.072 125.508 1.00 7.63   ?  697  VAL A CB    1 
ATOM   1662  C  CG1   . VAL A 1 825  ? 166.050 144.211 124.603 1.00 6.69   ?  697  VAL A CG1   1 
ATOM   1663  C  CG2   . VAL A 1 825  ? 165.628 141.832 125.249 1.00 5.60   ?  697  VAL A CG2   1 
ATOM   1664  N  N     . VAL A 1 826  ? 169.113 144.372 126.731 1.00 15.13  ?  698  VAL A N     1 
ATOM   1665  C  CA    . VAL A 1 826  ? 169.931 145.555 126.990 1.00 12.88  ?  698  VAL A CA    1 
ATOM   1666  C  C     . VAL A 1 826  ? 171.344 145.350 126.461 1.00 14.40  ?  698  VAL A C     1 
ATOM   1667  O  O     . VAL A 1 826  ? 171.926 146.242 125.832 1.00 16.99  ?  698  VAL A O     1 
ATOM   1668  C  CB    . VAL A 1 826  ? 169.931 145.886 128.493 1.00 12.94  ?  698  VAL A CB    1 
ATOM   1669  C  CG1   . VAL A 1 826  ? 171.204 146.628 128.883 1.00 12.97  ?  698  VAL A CG1   1 
ATOM   1670  C  CG2   . VAL A 1 826  ? 168.703 146.704 128.846 1.00 15.26  ?  698  VAL A CG2   1 
ATOM   1671  N  N     . ALA A 1 827  ? 171.922 144.175 126.722 1.00 14.44  ?  699  ALA A N     1 
ATOM   1672  C  CA    . ALA A 1 827  ? 173.258 143.882 126.212 1.00 16.92  ?  699  ALA A CA    1 
ATOM   1673  C  C     . ALA A 1 827  ? 173.277 143.910 124.689 1.00 15.72  ?  699  ALA A C     1 
ATOM   1674  O  O     . ALA A 1 827  ? 174.234 144.403 124.079 1.00 16.47  ?  699  ALA A O     1 
ATOM   1675  C  CB    . ALA A 1 827  ? 173.735 142.527 126.734 1.00 18.24  ?  699  ALA A CB    1 
ATOM   1676  N  N     . GLU A 1 828  ? 172.216 143.398 124.061 1.00 20.31  ?  700  GLU A N     1 
ATOM   1677  C  CA    . GLU A 1 828  ? 172.103 143.459 122.607 1.00 23.09  ?  700  GLU A CA    1 
ATOM   1678  C  C     . GLU A 1 828  ? 172.158 144.896 122.117 1.00 20.92  ?  700  GLU A C     1 
ATOM   1679  O  O     . GLU A 1 828  ? 172.959 145.239 121.236 1.00 23.43  ?  700  GLU A O     1 
ATOM   1680  C  CB    . GLU A 1 828  ? 170.798 142.801 122.156 1.00 27.21  ?  700  GLU A CB    1 
ATOM   1681  C  CG    . GLU A 1 828  ? 170.806 141.291 122.223 1.00 46.21  ?  700  GLU A CG    1 
ATOM   1682  C  CD    . GLU A 1 828  ? 171.559 140.669 121.068 1.00 79.72  ?  700  GLU A CD    1 
ATOM   1683  O  OE1   . GLU A 1 828  ? 171.999 141.420 120.171 1.00 62.32  ?  700  GLU A OE1   1 
ATOM   1684  O  OE2   . GLU A 1 828  ? 171.725 139.431 121.061 1.00 186.70 -1 700  GLU A OE2   1 
ATOM   1685  N  N     . ARG A 1 829  ? 171.304 145.753 122.676 1.00 20.64  ?  701  ARG A N     1 
ATOM   1686  C  CA    . ARG A 1 829  ? 171.271 147.140 122.229 1.00 21.93  ?  701  ARG A CA    1 
ATOM   1687  C  C     . ARG A 1 829  ? 172.603 147.839 122.481 1.00 22.89  ?  701  ARG A C     1 
ATOM   1688  O  O     . ARG A 1 829  ? 173.082 148.599 121.631 1.00 24.51  ?  701  ARG A O     1 
ATOM   1689  C  CB    . ARG A 1 829  ? 170.138 147.892 122.917 1.00 19.69  ?  701  ARG A CB    1 
ATOM   1690  C  CG    . ARG A 1 829  ? 170.000 149.313 122.424 1.00 21.16  ?  701  ARG A CG    1 
ATOM   1691  C  CD    . ARG A 1 829  ? 170.502 150.284 123.465 1.00 19.51  ?  701  ARG A CD    1 
ATOM   1692  N  NE    . ARG A 1 829  ? 169.630 150.260 124.629 1.00 23.92  ?  701  ARG A NE    1 
ATOM   1693  C  CZ    . ARG A 1 829  ? 168.372 150.678 124.602 1.00 26.33  ?  701  ARG A CZ    1 
ATOM   1694  N  NH1   . ARG A 1 829  ? 167.860 151.144 123.471 1.00 26.46  ?  701  ARG A NH1   1 
ATOM   1695  N  NH2   . ARG A 1 829  ? 167.627 150.628 125.696 1.00 30.59  ?  701  ARG A NH2   1 
ATOM   1696  N  N     . LYS A 1 830  ? 173.215 147.595 123.645 1.00 24.25  ?  702  LYS A N     1 
ATOM   1697  C  CA    . LYS A 1 830  ? 174.484 148.240 123.966 1.00 27.65  ?  702  LYS A CA    1 
ATOM   1698  C  C     . LYS A 1 830  ? 175.603 147.752 123.056 1.00 26.08  ?  702  LYS A C     1 
ATOM   1699  O  O     . LYS A 1 830  ? 176.588 148.468 122.845 1.00 27.27  ?  702  LYS A O     1 
ATOM   1700  C  CB    . LYS A 1 830  ? 174.842 147.994 125.434 1.00 29.88  ?  702  LYS A CB    1 
ATOM   1701  C  CG    . LYS A 1 830  ? 175.945 148.897 125.984 1.00 31.46  ?  702  LYS A CG    1 
ATOM   1702  C  CD    . LYS A 1 830  ? 176.150 148.681 127.481 1.00 37.59  ?  702  LYS A CD    1 
ATOM   1703  C  CE    . LYS A 1 830  ? 174.836 148.763 128.251 1.00 34.38  ?  702  LYS A CE    1 
ATOM   1704  N  NZ    . LYS A 1 830  ? 174.126 150.058 128.044 1.00 31.33  ?  702  LYS A NZ    1 
ATOM   1705  N  N     . ALA A 1 831  ? 175.472 146.539 122.517 1.00 24.36  ?  703  ALA A N     1 
ATOM   1706  C  CA    . ALA A 1 831  ? 176.417 146.055 121.523 1.00 26.05  ?  703  ALA A CA    1 
ATOM   1707  C  C     . ALA A 1 831  ? 176.108 146.561 120.120 1.00 24.80  ?  703  ALA A C     1 
ATOM   1708  O  O     . ALA A 1 831  ? 177.010 146.595 119.276 1.00 27.47  ?  703  ALA A O     1 
ATOM   1709  C  CB    . ALA A 1 831  ? 176.432 144.524 121.518 1.00 26.91  ?  703  ALA A CB    1 
ATOM   1710  N  N     . MET A 1 832  ? 174.865 146.963 119.854 1.00 26.11  ?  704  MET A N     1 
ATOM   1711  C  CA    . MET A 1 832  ? 174.441 147.222 118.483 1.00 24.91  ?  704  MET A CA    1 
ATOM   1712  C  C     . MET A 1 832  ? 174.769 148.629 118.001 1.00 26.15  ?  704  MET A C     1 
ATOM   1713  O  O     . MET A 1 832  ? 174.984 148.827 116.798 1.00 28.05  ?  704  MET A O     1 
ATOM   1714  C  CB    . MET A 1 832  ? 172.939 146.968 118.350 1.00 20.07  ?  704  MET A CB    1 
ATOM   1715  C  CG    . MET A 1 832  ? 172.432 146.961 116.923 1.00 19.83  ?  704  MET A CG    1 
ATOM   1716  S  SD    . MET A 1 832  ? 170.848 146.118 116.786 1.00 19.84  ?  704  MET A SD    1 
ATOM   1717  C  CE    . MET A 1 832  ? 171.278 144.495 117.408 1.00 18.66  ?  704  MET A CE    1 
ATOM   1718  N  N     . MET A 1 833  ? 174.820 149.611 118.903 1.00 27.50  ?  705  MET A N     1 
ATOM   1719  C  CA    . MET A 1 833  ? 175.150 150.974 118.502 1.00 30.25  ?  705  MET A CA    1 
ATOM   1720  C  C     . MET A 1 833  ? 176.571 151.108 117.973 1.00 39.02  ?  705  MET A C     1 
ATOM   1721  O  O     . MET A 1 833  ? 176.914 152.165 117.431 1.00 41.63  ?  705  MET A O     1 
ATOM   1722  C  CB    . MET A 1 833  ? 174.959 151.922 119.683 1.00 29.21  ?  705  MET A CB    1 
ATOM   1723  C  CG    . MET A 1 833  ? 173.669 151.705 120.445 1.00 27.86  ?  705  MET A CG    1 
ATOM   1724  S  SD    . MET A 1 833  ? 173.519 152.821 121.852 1.00 38.15  ?  705  MET A SD    1 
ATOM   1725  C  CE    . MET A 1 833  ? 175.109 152.593 122.647 1.00 24.76  ?  705  MET A CE    1 
ATOM   1726  N  N     . GLU A 1 834  ? 177.401 150.077 118.118 1.00 41.78  ?  706  GLU A N     1 
ATOM   1727  C  CA    . GLU A 1 834  ? 178.799 150.151 117.710 1.00 50.14  ?  706  GLU A CA    1 
ATOM   1728  C  C     . GLU A 1 834  ? 178.969 149.793 116.237 1.00 46.32  ?  706  GLU A C     1 
ATOM   1729  O  O     . GLU A 1 834  ? 179.457 150.603 115.443 1.00 48.45  ?  706  GLU A O     1 
ATOM   1730  C  CB    . GLU A 1 834  ? 179.644 149.222 118.589 1.00 64.26  ?  706  GLU A CB    1 
ATOM   1731  C  CG    . GLU A 1 834  ? 180.883 149.874 119.175 1.00 93.03  ?  706  GLU A CG    1 
ATOM   1732  C  CD    . GLU A 1 834  ? 180.548 150.908 120.229 1.00 117.26 ?  706  GLU A CD    1 
ATOM   1733  O  OE1   . GLU A 1 834  ? 179.506 150.755 120.903 1.00 94.76  ?  706  GLU A OE1   1 
ATOM   1734  O  OE2   . GLU A 1 834  ? 181.323 151.874 120.384 1.00 225.65 -1 706  GLU A OE2   1 
ATOM   1735  N  N     . SER A 1 835  ? 178.553 148.589 115.864 1.00 50.22  ?  707  SER A N     1 
ATOM   1736  C  CA    . SER A 1 835  ? 178.757 148.080 114.517 1.00 52.87  ?  707  SER A CA    1 
ATOM   1737  C  C     . SER A 1 835  ? 177.734 148.685 113.558 1.00 52.89  ?  707  SER A C     1 
ATOM   1738  O  O     . SER A 1 835  ? 176.972 149.594 113.899 1.00 48.76  ?  707  SER A O     1 
ATOM   1739  C  CB    . SER A 1 835  ? 178.682 146.558 114.522 1.00 50.60  ?  707  SER A CB    1 
ATOM   1740  O  OG    . SER A 1 835  ? 178.425 146.070 113.221 1.00 47.01  ?  707  SER A OG    1 
ATOM   1741  N  N     . ARG A 1 836  ? 177.717 148.175 112.331 1.00 48.63  ?  708  ARG A N     1 
ATOM   1742  C  CA    . ARG A 1 836  ? 176.725 148.535 111.334 1.00 42.66  ?  708  ARG A CA    1 
ATOM   1743  C  C     . ARG A 1 836  ? 176.185 147.258 110.705 1.00 41.11  ?  708  ARG A C     1 
ATOM   1744  O  O     . ARG A 1 836  ? 176.736 146.165 110.883 1.00 42.21  ?  708  ARG A O     1 
ATOM   1745  C  CB    . ARG A 1 836  ? 177.313 149.478 110.274 1.00 45.24  ?  708  ARG A CB    1 
ATOM   1746  C  CG    . ARG A 1 836  ? 177.751 150.829 110.832 1.00 43.30  ?  708  ARG A CG    1 
ATOM   1747  C  CD    . ARG A 1 836  ? 178.499 151.659 109.798 1.00 44.22  ?  708  ARG A CD    1 
ATOM   1748  N  NE    . ARG A 1 836  ? 179.797 151.081 109.460 1.00 55.58  ?  708  ARG A NE    1 
ATOM   1749  C  CZ    . ARG A 1 836  ? 180.013 150.271 108.428 1.00 60.20  ?  708  ARG A CZ    1 
ATOM   1750  N  NH1   . ARG A 1 836  ? 179.014 149.938 107.621 1.00 55.67  ?  708  ARG A NH1   1 
ATOM   1751  N  NH2   . ARG A 1 836  ? 181.229 149.792 108.202 1.00 60.11  ?  708  ARG A NH2   1 
ATOM   1752  N  N     . LEU A 1 837  ? 175.090 147.404 109.966 1.00 42.90  ?  709  LEU A N     1 
ATOM   1753  C  CA    . LEU A 1 837  ? 174.305 146.274 109.490 1.00 44.41  ?  709  LEU A CA    1 
ATOM   1754  C  C     . LEU A 1 837  ? 174.346 146.203 107.968 1.00 44.35  ?  709  LEU A C     1 
ATOM   1755  O  O     . LEU A 1 837  ? 174.302 147.234 107.297 1.00 44.04  ?  709  LEU A O     1 
ATOM   1756  C  CB    . LEU A 1 837  ? 172.861 146.405 109.989 1.00 38.05  ?  709  LEU A CB    1 
ATOM   1757  C  CG    . LEU A 1 837  ? 171.789 145.451 109.472 1.00 37.87  ?  709  LEU A CG    1 
ATOM   1758  C  CD1   . LEU A 1 837  ? 172.175 144.017 109.756 1.00 40.64  ?  709  LEU A CD1   1 
ATOM   1759  C  CD2   . LEU A 1 837  ? 170.451 145.786 110.109 1.00 30.41  ?  709  LEU A CD2   1 
ATOM   1760  N  N     . ILE A 1 838  ? 174.427 144.991 107.417 1.00 42.22  ?  710  ILE A N     1 
ATOM   1761  C  CA    . ILE A 1 838  ? 174.474 144.774 105.973 1.00 41.12  ?  710  ILE A CA    1 
ATOM   1762  C  C     . ILE A 1 838  ? 173.253 143.941 105.600 1.00 39.43  ?  710  ILE A C     1 
ATOM   1763  O  O     . ILE A 1 838  ? 173.148 142.767 105.991 1.00 38.26  ?  710  ILE A O     1 
ATOM   1764  C  CB    . ILE A 1 838  ? 175.776 144.088 105.534 1.00 41.15  ?  710  ILE A CB    1 
ATOM   1765  C  CG1   . ILE A 1 838  ? 176.955 145.062 105.619 1.00 40.55  ?  710  ILE A CG1   1 
ATOM   1766  C  CG2   . ILE A 1 838  ? 175.658 143.554 104.115 1.00 41.99  ?  710  ILE A CG2   1 
ATOM   1767  C  CD1   . ILE A 1 838  ? 176.874 146.214 104.641 1.00 38.62  ?  710  ILE A CD1   1 
ATOM   1768  N  N     . ILE A 1 839  ? 172.326 144.552 104.854 1.00 40.68  ?  711  ILE A N     1 
ATOM   1769  C  CA    . ILE A 1 839  ? 171.077 143.914 104.443 1.00 35.15  ?  711  ILE A CA    1 
ATOM   1770  C  C     . ILE A 1 839  ? 170.859 144.130 102.950 1.00 40.59  ?  711  ILE A C     1 
ATOM   1771  O  O     . ILE A 1 839  ? 171.153 145.204 102.416 1.00 43.50  ?  711  ILE A O     1 
ATOM   1772  C  CB    . ILE A 1 839  ? 169.870 144.425 105.267 1.00 32.63  ?  711  ILE A CB    1 
ATOM   1773  C  CG1   . ILE A 1 839  ? 168.772 143.368 105.310 1.00 36.69  ?  711  ILE A CG1   1 
ATOM   1774  C  CG2   . ILE A 1 839  ? 169.300 145.719 104.713 1.00 30.71  ?  711  ILE A CG2   1 
ATOM   1775  C  CD1   . ILE A 1 839  ? 169.235 142.050 105.782 1.00 34.09  ?  711  ILE A CD1   1 
ATOM   1776  N  N     . SER A 1 840  ? 170.364 143.095 102.272 1.00 38.87  ?  712  SER A N     1 
ATOM   1777  C  CA    . SER A 1 840  ? 170.127 143.153 100.832 1.00 39.53  ?  712  SER A CA    1 
ATOM   1778  C  C     . SER A 1 840  ? 168.685 143.584 100.592 1.00 37.46  ?  712  SER A C     1 
ATOM   1779  O  O     . SER A 1 840  ? 167.746 142.830 100.871 1.00 35.86  ?  712  SER A O     1 
ATOM   1780  C  CB    . SER A 1 840  ? 170.422 141.807 100.173 1.00 35.75  ?  712  SER A CB    1 
ATOM   1781  O  OG    . SER A 1 840  ? 169.484 140.818 100.562 1.00 34.62  ?  712  SER A OG    1 
ATOM   1782  N  N     . VAL A 1 841  ? 168.512 144.798 100.080 1.00 39.99  ?  713  VAL A N     1 
ATOM   1783  C  CA    . VAL A 1 841  ? 167.204 145.358 99.777  1.00 40.09  ?  713  VAL A CA    1 
ATOM   1784  C  C     . VAL A 1 841  ? 167.239 145.923 98.363  1.00 48.65  ?  713  VAL A C     1 
ATOM   1785  O  O     . VAL A 1 841  ? 168.253 146.489 97.936  1.00 49.90  ?  713  VAL A O     1 
ATOM   1786  C  CB    . VAL A 1 841  ? 166.805 146.435 100.808 1.00 35.02  ?  713  VAL A CB    1 
ATOM   1787  C  CG1   . VAL A 1 841  ? 167.908 147.463 100.955 1.00 39.45  ?  713  VAL A CG1   1 
ATOM   1788  C  CG2   . VAL A 1 841  ? 165.533 147.110 100.389 1.00 40.03  ?  713  VAL A CG2   1 
ATOM   1789  N  N     . GLY A 1 842  ? 166.143 145.743 97.631  1.00 48.39  ?  714  GLY A N     1 
ATOM   1790  C  CA    . GLY A 1 842  ? 166.089 146.204 96.248  1.00 44.27  ?  714  GLY A CA    1 
ATOM   1791  C  C     . GLY A 1 842  ? 167.243 145.718 95.402  1.00 49.10  ?  714  GLY A C     1 
ATOM   1792  O  O     . GLY A 1 842  ? 167.770 146.470 94.571  1.00 48.91  ?  714  GLY A O     1 
ATOM   1793  N  N     . GLY A 1 843  ? 167.664 144.468 95.607  1.00 53.12  ?  715  GLY A N     1 
ATOM   1794  C  CA    . GLY A 1 843  ? 168.777 143.896 94.882  1.00 54.36  ?  715  GLY A CA    1 
ATOM   1795  C  C     . GLY A 1 843  ? 170.148 144.341 95.341  1.00 57.10  ?  715  GLY A C     1 
ATOM   1796  O  O     . GLY A 1 843  ? 171.129 143.632 95.084  1.00 54.99  ?  715  GLY A O     1 
ATOM   1797  N  N     . LEU A 1 844  ? 170.254 145.482 96.018  1.00 55.90  ?  716  LEU A N     1 
ATOM   1798  C  CA    . LEU A 1 844  ? 171.537 146.016 96.456  1.00 52.99  ?  716  LEU A CA    1 
ATOM   1799  C  C     . LEU A 1 844  ? 171.722 145.744 97.942  1.00 49.28  ?  716  LEU A C     1 
ATOM   1800  O  O     . LEU A 1 844  ? 170.803 145.962 98.737  1.00 49.51  ?  716  LEU A O     1 
ATOM   1801  C  CB    . LEU A 1 844  ? 171.625 147.518 96.180  1.00 50.36  ?  716  LEU A CB    1 
ATOM   1802  C  CG    . LEU A 1 844  ? 171.409 147.961 94.731  1.00 51.25  ?  716  LEU A CG    1 
ATOM   1803  C  CD1   . LEU A 1 844  ? 171.387 149.477 94.624  1.00 65.17  ?  716  LEU A CD1   1 
ATOM   1804  C  CD2   . LEU A 1 844  ? 172.484 147.380 93.830  1.00 56.38  ?  716  LEU A CD2   1 
ATOM   1805  N  N     . LEU A 1 845  ? 172.899 145.249 98.313  1.00 38.45  ?  717  LEU A N     1 
ATOM   1806  C  CA    . LEU A 1 845  ? 173.222 145.118 99.725  1.00 35.96  ?  717  LEU A CA    1 
ATOM   1807  C  C     . LEU A 1 845  ? 173.740 146.456 100.231 1.00 35.74  ?  717  LEU A C     1 
ATOM   1808  O  O     . LEU A 1 845  ? 174.577 147.095 99.584  1.00 37.68  ?  717  LEU A O     1 
ATOM   1809  C  CB    . LEU A 1 845  ? 174.242 144.003 99.960  1.00 34.93  ?  717  LEU A CB    1 
ATOM   1810  C  CG    . LEU A 1 845  ? 175.561 143.991 99.188  1.00 34.09  ?  717  LEU A CG    1 
ATOM   1811  C  CD1   . LEU A 1 845  ? 176.657 144.680 99.988  1.00 37.29  ?  717  LEU A CD1   1 
ATOM   1812  C  CD2   . LEU A 1 845  ? 175.960 142.563 98.845  1.00 31.26  ?  717  LEU A CD2   1 
ATOM   1813  N  N     . ARG A 1 846  ? 173.218 146.892 101.373 1.00 39.33  ?  718  ARG A N     1 
ATOM   1814  C  CA    . ARG A 1 846  ? 173.467 148.233 101.871 1.00 46.74  ?  718  ARG A CA    1 
ATOM   1815  C  C     . ARG A 1 846  ? 173.708 148.187 103.372 1.00 46.00  ?  718  ARG A C     1 
ATOM   1816  O  O     . ARG A 1 846  ? 173.269 147.268 104.075 1.00 41.82  ?  718  ARG A O     1 
ATOM   1817  C  CB    . ARG A 1 846  ? 172.303 149.175 101.535 1.00 46.83  ?  718  ARG A CB    1 
ATOM   1818  C  CG    . ARG A 1 846  ? 172.048 149.307 100.043 1.00 48.71  ?  718  ARG A CG    1 
ATOM   1819  C  CD    . ARG A 1 846  ? 170.764 150.051 99.750  1.00 49.64  ?  718  ARG A CD    1 
ATOM   1820  N  NE    . ARG A 1 846  ? 170.277 149.756 98.407  1.00 47.71  ?  718  ARG A NE    1 
ATOM   1821  C  CZ    . ARG A 1 846  ? 169.118 150.187 97.923  1.00 46.62  ?  718  ARG A CZ    1 
ATOM   1822  N  NH1   . ARG A 1 846  ? 168.323 150.937 98.674  1.00 50.77  ?  718  ARG A NH1   1 
ATOM   1823  N  NH2   . ARG A 1 846  ? 168.753 149.869 96.689  1.00 46.15  ?  718  ARG A NH2   1 
ATOM   1824  N  N     . SER A 1 847  ? 174.422 149.206 103.847 1.00 49.72  ?  719  SER A N     1 
ATOM   1825  C  CA    . SER A 1 847  ? 174.834 149.315 105.236 1.00 48.19  ?  719  SER A CA    1 
ATOM   1826  C  C     . SER A 1 847  ? 173.958 150.325 105.964 1.00 46.64  ?  719  SER A C     1 
ATOM   1827  O  O     . SER A 1 847  ? 173.635 151.391 105.431 1.00 48.54  ?  719  SER A O     1 
ATOM   1828  C  CB    . SER A 1 847  ? 176.304 149.729 105.342 1.00 49.59  ?  719  SER A CB    1 
ATOM   1829  O  OG    . SER A 1 847  ? 176.447 151.138 105.293 1.00 50.33  ?  719  SER A OG    1 
ATOM   1830  N  N     . PHE A 1 848  ? 173.574 149.970 107.182 1.00 44.69  ?  720  PHE A N     1 
ATOM   1831  C  CA    . PHE A 1 848  ? 172.759 150.803 108.047 1.00 39.18  ?  720  PHE A CA    1 
ATOM   1832  C  C     . PHE A 1 848  ? 173.504 151.083 109.343 1.00 37.70  ?  720  PHE A C     1 
ATOM   1833  O  O     . PHE A 1 848  ? 174.254 150.236 109.845 1.00 36.74  ?  720  PHE A O     1 
ATOM   1834  C  CB    . PHE A 1 848  ? 171.418 150.139 108.388 1.00 39.93  ?  720  PHE A CB    1 
ATOM   1835  C  CG    . PHE A 1 848  ? 170.443 150.099 107.249 1.00 38.18  ?  720  PHE A CG    1 
ATOM   1836  C  CD1   . PHE A 1 848  ? 170.627 149.227 106.191 1.00 37.77  ?  720  PHE A CD1   1 
ATOM   1837  C  CD2   . PHE A 1 848  ? 169.329 150.921 107.249 1.00 34.11  ?  720  PHE A CD2   1 
ATOM   1838  C  CE1   . PHE A 1 848  ? 169.724 149.186 105.149 1.00 38.09  ?  720  PHE A CE1   1 
ATOM   1839  C  CE2   . PHE A 1 848  ? 168.423 150.883 106.211 1.00 34.27  ?  720  PHE A CE2   1 
ATOM   1840  C  CZ    . PHE A 1 848  ? 168.621 150.015 105.160 1.00 37.84  ?  720  PHE A CZ    1 
ATOM   1841  N  N     . ARG A 1 849  ? 173.280 152.282 109.870 1.00 37.18  ?  721  ARG A N     1 
ATOM   1842  C  CA    . ARG A 1 849  ? 173.643 152.649 111.225 1.00 36.05  ?  721  ARG A CA    1 
ATOM   1843  C  C     . ARG A 1 849  ? 172.376 152.654 112.077 1.00 27.27  ?  721  ARG A C     1 
ATOM   1844  O  O     . ARG A 1 849  ? 171.277 152.364 111.598 1.00 26.27  ?  721  ARG A O     1 
ATOM   1845  C  CB    . ARG A 1 849  ? 174.339 154.010 111.246 1.00 39.55  ?  721  ARG A CB    1 
ATOM   1846  C  CG    . ARG A 1 849  ? 175.696 154.023 110.565 1.00 43.11  ?  721  ARG A CG    1 
ATOM   1847  C  CD    . ARG A 1 849  ? 176.411 155.335 110.819 1.00 42.83  ?  721  ARG A CD    1 
ATOM   1848  N  NE    . ARG A 1 849  ? 176.494 155.615 112.248 1.00 38.36  ?  721  ARG A NE    1 
ATOM   1849  C  CZ    . ARG A 1 849  ? 177.305 154.974 113.080 1.00 37.49  ?  721  ARG A CZ    1 
ATOM   1850  N  NH1   . ARG A 1 849  ? 178.102 154.017 112.622 1.00 35.83  ?  721  ARG A NH1   1 
ATOM   1851  N  NH2   . ARG A 1 849  ? 177.318 155.286 114.368 1.00 35.85  ?  721  ARG A NH2   1 
ATOM   1852  N  N     . PHE A 1 850  ? 172.525 152.996 113.354 1.00 23.16  ?  722  PHE A N     1 
ATOM   1853  C  CA    . PHE A 1 850  ? 171.383 152.945 114.257 1.00 18.37  ?  722  PHE A CA    1 
ATOM   1854  C  C     . PHE A 1 850  ? 171.592 153.912 115.408 1.00 14.79  ?  722  PHE A C     1 
ATOM   1855  O  O     . PHE A 1 850  ? 172.679 153.960 115.992 1.00 16.86  ?  722  PHE A O     1 
ATOM   1856  C  CB    . PHE A 1 850  ? 171.177 151.530 114.806 1.00 15.66  ?  722  PHE A CB    1 
ATOM   1857  C  CG    . PHE A 1 850  ? 170.417 150.623 113.887 1.00 14.25  ?  722  PHE A CG    1 
ATOM   1858  C  CD1   . PHE A 1 850  ? 169.045 150.741 113.752 1.00 14.58  ?  722  PHE A CD1   1 
ATOM   1859  C  CD2   . PHE A 1 850  ? 171.075 149.643 113.166 1.00 16.91  ?  722  PHE A CD2   1 
ATOM   1860  C  CE1   . PHE A 1 850  ? 168.348 149.898 112.911 1.00 14.95  ?  722  PHE A CE1   1 
ATOM   1861  C  CE2   . PHE A 1 850  ? 170.381 148.802 112.324 1.00 16.57  ?  722  PHE A CE2   1 
ATOM   1862  C  CZ    . PHE A 1 850  ? 169.016 148.929 112.196 1.00 15.27  ?  722  PHE A CZ    1 
ATOM   1863  N  N     . PHE A 1 851  ? 170.547 154.667 115.731 1.00 16.00  ?  723  PHE A N     1 
ATOM   1864  C  CA    . PHE A 1 851  ? 170.465 155.406 116.980 1.00 16.45  ?  723  PHE A CA    1 
ATOM   1865  C  C     . PHE A 1 851  ? 169.244 154.920 117.746 1.00 12.65  ?  723  PHE A C     1 
ATOM   1866  O  O     . PHE A 1 851  ? 168.225 154.549 117.150 1.00 13.85  ?  723  PHE A O     1 
ATOM   1867  C  CB    . PHE A 1 851  ? 170.373 156.919 116.743 1.00 18.90  ?  723  PHE A CB    1 
ATOM   1868  C  CG    . PHE A 1 851  ? 171.553 157.489 116.009 1.00 24.97  ?  723  PHE A CG    1 
ATOM   1869  C  CD1   . PHE A 1 851  ? 172.817 156.947 116.171 1.00 28.65  ?  723  PHE A CD1   1 
ATOM   1870  C  CD2   . PHE A 1 851  ? 171.395 158.563 115.150 1.00 28.62  ?  723  PHE A CD2   1 
ATOM   1871  C  CE1   . PHE A 1 851  ? 173.902 157.464 115.492 1.00 33.68  ?  723  PHE A CE1   1 
ATOM   1872  C  CE2   . PHE A 1 851  ? 172.478 159.087 114.469 1.00 36.01  ?  723  PHE A CE2   1 
ATOM   1873  C  CZ    . PHE A 1 851  ? 173.733 158.536 114.640 1.00 39.19  ?  723  PHE A CZ    1 
ATOM   1874  N  N     . PHE A 1 852  ? 169.355 154.912 119.071 1.00 10.63  ?  724  PHE A N     1 
ATOM   1875  C  CA    . PHE A 1 852  ? 168.311 154.385 119.947 1.00 9.48   ?  724  PHE A CA    1 
ATOM   1876  C  C     . PHE A 1 852  ? 167.909 155.477 120.931 1.00 10.75  ?  724  PHE A C     1 
ATOM   1877  O  O     . PHE A 1 852  ? 168.503 155.621 122.002 1.00 11.73  ?  724  PHE A O     1 
ATOM   1878  C  CB    . PHE A 1 852  ? 168.784 153.121 120.658 1.00 9.03   ?  724  PHE A CB    1 
ATOM   1879  C  CG    . PHE A 1 852  ? 168.816 151.913 119.770 1.00 13.57  ?  724  PHE A CG    1 
ATOM   1880  C  CD1   . PHE A 1 852  ? 167.686 151.129 119.608 1.00 16.34  ?  724  PHE A CD1   1 
ATOM   1881  C  CD2   . PHE A 1 852  ? 169.968 151.568 119.088 1.00 17.39  ?  724  PHE A CD2   1 
ATOM   1882  C  CE1   . PHE A 1 852  ? 167.707 150.022 118.785 1.00 10.24  ?  724  PHE A CE1   1 
ATOM   1883  C  CE2   . PHE A 1 852  ? 169.993 150.459 118.265 1.00 15.05  ?  724  PHE A CE2   1 
ATOM   1884  C  CZ    . PHE A 1 852  ? 168.860 149.686 118.114 1.00 10.86  ?  724  PHE A CZ    1 
ATOM   1885  N  N     . ARG A 1 853  ? 166.890 156.249 120.554 1.00 10.88  ?  725  ARG A N     1 
ATOM   1886  C  CA    . ARG A 1 853  ? 166.356 157.305 121.410 1.00 11.03  ?  725  ARG A CA    1 
ATOM   1887  C  C     . ARG A 1 853  ? 165.250 156.697 122.266 1.00 10.19  ?  725  ARG A C     1 
ATOM   1888  O  O     . ARG A 1 853  ? 164.055 156.850 122.004 1.00 11.39  ?  725  ARG A O     1 
ATOM   1889  C  CB    . ARG A 1 853  ? 165.844 158.469 120.574 1.00 14.95  ?  725  ARG A CB    1 
ATOM   1890  C  CG    . ARG A 1 853  ? 166.856 159.048 119.611 1.00 20.63  ?  725  ARG A CG    1 
ATOM   1891  C  CD    . ARG A 1 853  ? 167.800 160.001 120.315 1.00 34.14  ?  725  ARG A CD    1 
ATOM   1892  N  NE    . ARG A 1 853  ? 168.772 160.581 119.393 1.00 46.54  ?  725  ARG A NE    1 
ATOM   1893  C  CZ    . ARG A 1 853  ? 168.543 161.655 118.643 1.00 49.24  ?  725  ARG A CZ    1 
ATOM   1894  N  NH1   . ARG A 1 853  ? 167.372 162.275 118.705 1.00 41.28  ?  725  ARG A NH1   1 
ATOM   1895  N  NH2   . ARG A 1 853  ? 169.488 162.110 117.832 1.00 47.67  ?  725  ARG A NH2   1 
ATOM   1896  N  N     . GLY A 1 854  ? 165.669 155.977 123.304 1.00 9.47   ?  726  GLY A N     1 
ATOM   1897  C  CA    . GLY A 1 854  ? 164.723 155.354 124.208 1.00 10.51  ?  726  GLY A CA    1 
ATOM   1898  C  C     . GLY A 1 854  ? 163.927 156.405 124.954 1.00 10.35  ?  726  GLY A C     1 
ATOM   1899  O  O     . GLY A 1 854  ? 164.505 157.238 125.673 1.00 15.69  ?  726  GLY A O     1 
ATOM   1900  N  N     . THR A 1 855  ? 162.607 156.393 124.790 1.00 9.21   ?  727  THR A N     1 
ATOM   1901  C  CA    . THR A 1 855  ? 161.743 157.380 125.425 1.00 8.87   ?  727  THR A CA    1 
ATOM   1902  C  C     . THR A 1 855  ? 160.542 156.735 126.092 1.00 8.69   ?  727  THR A C     1 
ATOM   1903  O  O     . THR A 1 855  ? 159.983 157.280 127.050 1.00 9.44   ?  727  THR A O     1 
ATOM   1904  C  CB    . THR A 1 855  ? 161.246 158.392 124.399 1.00 10.28  ?  727  THR A CB    1 
ATOM   1905  O  OG1   . THR A 1 855  ? 160.158 159.132 124.965 1.00 11.91  ?  727  THR A OG1   1 
ATOM   1906  C  CG2   . THR A 1 855  ? 160.753 157.676 123.168 1.00 13.92  ?  727  THR A CG2   1 
ATOM   1907  N  N     . GLY A 1 856  ? 160.141 155.572 125.587 1.00 9.97   ?  728  GLY A N     1 
ATOM   1908  C  CA    . GLY A 1 856  ? 158.847 155.020 125.918 1.00 11.42  ?  728  GLY A CA    1 
ATOM   1909  C  C     . GLY A 1 856  ? 158.779 154.502 127.333 1.00 9.31   ?  728  GLY A C     1 
ATOM   1910  O  O     . GLY A 1 856  ? 158.656 153.297 127.570 1.00 9.24   ?  728  GLY A O     1 
ATOM   1911  N  N     . TYR A 1 857  ? 158.860 155.417 128.287 1.00 9.68   ?  729  TYR A N     1 
ATOM   1912  C  CA    . TYR A 1 857  ? 158.745 155.065 129.688 1.00 12.01  ?  729  TYR A CA    1 
ATOM   1913  C  C     . TYR A 1 857  ? 157.945 156.141 130.399 1.00 16.49  ?  729  TYR A C     1 
ATOM   1914  O  O     . TYR A 1 857  ? 158.104 157.333 130.119 1.00 16.14  ?  729  TYR A O     1 
ATOM   1915  C  CB    . TYR A 1 857  ? 160.117 154.924 130.351 1.00 10.75  ?  729  TYR A CB    1 
ATOM   1916  C  CG    . TYR A 1 857  ? 161.101 154.048 129.612 1.00 7.83   ?  729  TYR A CG    1 
ATOM   1917  C  CD1   . TYR A 1 857  ? 161.942 154.579 128.643 1.00 7.49   ?  729  TYR A CD1   1 
ATOM   1918  C  CD2   . TYR A 1 857  ? 161.211 152.697 129.904 1.00 8.56   ?  729  TYR A CD2   1 
ATOM   1919  C  CE1   . TYR A 1 857  ? 162.853 153.785 127.978 1.00 7.51   ?  729  TYR A CE1   1 
ATOM   1920  C  CE2   . TYR A 1 857  ? 162.119 151.896 129.243 1.00 9.19   ?  729  TYR A CE2   1 
ATOM   1921  C  CZ    . TYR A 1 857  ? 162.938 152.445 128.283 1.00 9.67   ?  729  TYR A CZ    1 
ATOM   1922  O  OH    . TYR A 1 857  ? 163.845 151.649 127.623 1.00 11.71  ?  729  TYR A OH    1 
ATOM   1923  N  N     . ASP A 1 858  ? 157.078 155.711 131.307 1.00 28.06  ?  730  ASP A N     1 
ATOM   1924  C  CA    . ASP A 1 858  ? 156.481 156.641 132.245 1.00 33.49  ?  730  ASP A CA    1 
ATOM   1925  C  C     . ASP A 1 858  ? 157.497 156.991 133.328 1.00 30.56  ?  730  ASP A C     1 
ATOM   1926  O  O     . ASP A 1 858  ? 158.508 156.307 133.511 1.00 28.67  ?  730  ASP A O     1 
ATOM   1927  C  CB    . ASP A 1 858  ? 155.212 156.051 132.860 1.00 48.81  ?  730  ASP A CB    1 
ATOM   1928  C  CG    . ASP A 1 858  ? 155.363 154.582 133.208 1.00 66.47  ?  730  ASP A CG    1 
ATOM   1929  O  OD1   . ASP A 1 858  ? 156.441 154.011 132.936 1.00 51.58  ?  730  ASP A OD1   1 
ATOM   1930  O  OD2   . ASP A 1 858  ? 154.400 153.998 133.749 1.00 128.83 -1 730  ASP A OD2   1 
ATOM   1931  N  N     . GLU A 1 859  ? 157.209 158.077 134.049 1.00 34.48  ?  731  GLU A N     1 
ATOM   1932  C  CA    . GLU A 1 859  ? 158.160 158.638 135.006 1.00 31.12  ?  731  GLU A CA    1 
ATOM   1933  C  C     . GLU A 1 859  ? 158.682 157.584 135.978 1.00 26.06  ?  731  GLU A C     1 
ATOM   1934  O  O     . GLU A 1 859  ? 159.887 157.513 136.249 1.00 25.87  ?  731  GLU A O     1 
ATOM   1935  C  CB    . GLU A 1 859  ? 157.499 159.784 135.774 1.00 44.64  ?  731  GLU A CB    1 
ATOM   1936  C  CG    . GLU A 1 859  ? 156.575 160.656 134.934 1.00 70.67  ?  731  GLU A CG    1 
ATOM   1937  C  CD    . GLU A 1 859  ? 155.164 160.091 134.833 1.00 96.01  ?  731  GLU A CD    1 
ATOM   1938  O  OE1   . GLU A 1 859  ? 154.946 158.948 135.287 1.00 77.93  ?  731  GLU A OE1   1 
ATOM   1939  O  OE2   . GLU A 1 859  ? 154.274 160.786 134.298 1.00 171.10 -1 731  GLU A OE2   1 
ATOM   1940  N  N     . LYS A 1 860  ? 157.781 156.759 136.515 1.00 25.97  ?  732  LYS A N     1 
ATOM   1941  C  CA    . LYS A 1 860  ? 158.168 155.769 137.518 1.00 16.42  ?  732  LYS A CA    1 
ATOM   1942  C  C     . LYS A 1 860  ? 159.226 154.814 136.979 1.00 16.47  ?  732  LYS A C     1 
ATOM   1943  O  O     . LYS A 1 860  ? 160.252 154.566 137.628 1.00 18.10  ?  732  LYS A O     1 
ATOM   1944  C  CB    . LYS A 1 860  ? 156.931 155.001 137.977 1.00 13.47  ?  732  LYS A CB    1 
ATOM   1945  C  CG    . LYS A 1 860  ? 157.215 153.830 138.889 1.00 7.88   ?  732  LYS A CG    1 
ATOM   1946  C  CD    . LYS A 1 860  ? 155.910 153.199 139.330 1.00 11.60  ?  732  LYS A CD    1 
ATOM   1947  C  CE    . LYS A 1 860  ? 156.135 151.924 140.111 1.00 9.74   ?  732  LYS A CE    1 
ATOM   1948  N  NZ    . LYS A 1 860  ? 154.835 151.323 140.510 1.00 7.76   ?  732  LYS A NZ    1 
ATOM   1949  N  N     . MET A 1 861  ? 158.989 154.259 135.789 1.00 16.66  ?  733  MET A N     1 
ATOM   1950  C  CA    . MET A 1 861  ? 159.978 153.366 135.203 1.00 16.79  ?  733  MET A CA    1 
ATOM   1951  C  C     . MET A 1 861  ? 161.240 154.118 134.811 1.00 16.43  ?  733  MET A C     1 
ATOM   1952  O  O     . MET A 1 861  ? 162.341 153.564 134.903 1.00 18.66  ?  733  MET A O     1 
ATOM   1953  C  CB    . MET A 1 861  ? 159.388 152.644 133.996 1.00 17.01  ?  733  MET A CB    1 
ATOM   1954  C  CG    . MET A 1 861  ? 160.347 151.670 133.347 1.00 19.26  ?  733  MET A CG    1 
ATOM   1955  S  SD    . MET A 1 861  ? 159.560 150.099 132.965 1.00 24.79  ?  733  MET A SD    1 
ATOM   1956  C  CE    . MET A 1 861  ? 159.117 149.553 134.611 1.00 26.11  ?  733  MET A CE    1 
ATOM   1957  N  N     . VAL A 1 862  ? 161.101 155.372 134.372 1.00 16.49  ?  734  VAL A N     1 
ATOM   1958  C  CA    . VAL A 1 862  ? 162.273 156.200 134.100 1.00 19.52  ?  734  VAL A CA    1 
ATOM   1959  C  C     . VAL A 1 862  ? 163.172 156.251 135.324 1.00 20.18  ?  734  VAL A C     1 
ATOM   1960  O  O     . VAL A 1 862  ? 164.396 156.112 135.223 1.00 21.35  ?  734  VAL A O     1 
ATOM   1961  C  CB    . VAL A 1 862  ? 161.846 157.612 133.654 1.00 21.66  ?  734  VAL A CB    1 
ATOM   1962  C  CG1   . VAL A 1 862  ? 162.907 158.635 134.030 1.00 21.78  ?  734  VAL A CG1   1 
ATOM   1963  C  CG2   . VAL A 1 862  ? 161.602 157.642 132.162 1.00 22.52  ?  734  VAL A CG2   1 
ATOM   1964  N  N     . ARG A 1 863  ? 162.577 156.433 136.504 1.00 24.52  ?  735  ARG A N     1 
ATOM   1965  C  CA    . ARG A 1 863  ? 163.371 156.480 137.727 1.00 29.83  ?  735  ARG A CA    1 
ATOM   1966  C  C     . ARG A 1 863  ? 163.966 155.116 138.044 1.00 25.71  ?  735  ARG A C     1 
ATOM   1967  O  O     . ARG A 1 863  ? 165.164 155.003 138.329 1.00 27.07  ?  735  ARG A O     1 
ATOM   1968  C  CB    . ARG A 1 863  ? 162.516 156.970 138.895 1.00 38.41  ?  735  ARG A CB    1 
ATOM   1969  C  CG    . ARG A 1 863  ? 162.042 158.403 138.766 1.00 43.66  ?  735  ARG A CG    1 
ATOM   1970  C  CD    . ARG A 1 863  ? 163.071 159.398 139.268 1.00 38.89  ?  735  ARG A CD    1 
ATOM   1971  N  NE    . ARG A 1 863  ? 162.564 160.762 139.160 1.00 44.50  ?  735  ARG A NE    1 
ATOM   1972  C  CZ    . ARG A 1 863  ? 161.537 161.233 139.861 1.00 49.02  ?  735  ARG A CZ    1 
ATOM   1973  N  NH1   . ARG A 1 863  ? 160.910 160.452 140.731 1.00 51.71  ?  735  ARG A NH1   1 
ATOM   1974  N  NH2   . ARG A 1 863  ? 161.139 162.486 139.694 1.00 51.79  ?  735  ARG A NH2   1 
ATOM   1975  N  N     . GLU A 1 864  ? 163.140 154.066 138.003 1.00 22.73  ?  736  GLU A N     1 
ATOM   1976  C  CA    . GLU A 1 864  ? 163.623 152.736 138.369 1.00 20.03  ?  736  GLU A CA    1 
ATOM   1977  C  C     . GLU A 1 864  ? 164.795 152.308 137.499 1.00 19.87  ?  736  GLU A C     1 
ATOM   1978  O  O     . GLU A 1 864  ? 165.742 151.676 137.984 1.00 20.21  ?  736  GLU A O     1 
ATOM   1979  C  CB    . GLU A 1 864  ? 162.499 151.711 138.272 1.00 22.84  ?  736  GLU A CB    1 
ATOM   1980  C  CG    . GLU A 1 864  ? 161.787 151.469 139.579 1.00 32.60  ?  736  GLU A CG    1 
ATOM   1981  C  CD    . GLU A 1 864  ? 160.900 150.249 139.521 1.00 55.53  ?  736  GLU A CD    1 
ATOM   1982  O  OE1   . GLU A 1 864  ? 160.995 149.498 138.528 1.00 44.73  ?  736  GLU A OE1   1 
ATOM   1983  O  OE2   . GLU A 1 864  ? 160.111 150.040 140.464 1.00 143.71 -1 736  GLU A OE2   1 
ATOM   1984  N  N     . MET A 1 865  ? 164.749 152.634 136.209 1.00 21.48  ?  737  MET A N     1 
ATOM   1985  C  CA    . MET A 1 865  ? 165.871 152.323 135.335 1.00 21.98  ?  737  MET A CA    1 
ATOM   1986  C  C     . MET A 1 865  ? 167.019 153.299 135.531 1.00 23.55  ?  737  MET A C     1 
ATOM   1987  O  O     . MET A 1 865  ? 168.186 152.915 135.397 1.00 23.04  ?  737  MET A O     1 
ATOM   1988  C  CB    . MET A 1 865  ? 165.417 152.335 133.876 1.00 25.88  ?  737  MET A CB    1 
ATOM   1989  C  CG    . MET A 1 865  ? 164.263 151.393 133.583 1.00 31.32  ?  737  MET A CG    1 
ATOM   1990  S  SD    . MET A 1 865  ? 164.657 149.676 133.964 1.00 43.90  ?  737  MET A SD    1 
ATOM   1991  C  CE    . MET A 1 865  ? 163.105 148.861 133.596 1.00 29.59  ?  737  MET A CE    1 
ATOM   1992  N  N     . GLU A 1 866  ? 166.706 154.551 135.863 1.00 22.09  ?  738  GLU A N     1 
ATOM   1993  C  CA    . GLU A 1 866  ? 167.716 155.588 135.992 1.00 24.09  ?  738  GLU A CA    1 
ATOM   1994  C  C     . GLU A 1 866  ? 168.412 155.558 137.343 1.00 25.97  ?  738  GLU A C     1 
ATOM   1995  O  O     . GLU A 1 866  ? 169.526 156.081 137.466 1.00 29.93  ?  738  GLU A O     1 
ATOM   1996  C  CB    . GLU A 1 866  ? 167.079 156.959 135.764 1.00 26.20  ?  738  GLU A CB    1 
ATOM   1997  C  CG    . GLU A 1 866  ? 168.092 158.053 135.549 1.00 42.87  ?  738  GLU A CG    1 
ATOM   1998  C  CD    . GLU A 1 866  ? 169.250 157.576 134.698 1.00 59.21  ?  738  GLU A CD    1 
ATOM   1999  O  OE1   . GLU A 1 866  ? 169.076 157.456 133.468 1.00 47.49  ?  738  GLU A OE1   1 
ATOM   2000  O  OE2   . GLU A 1 866  ? 170.330 157.300 135.263 1.00 196.60 -1 738  GLU A OE2   1 
ATOM   2001  N  N     . GLY A 1 867  ? 167.782 154.967 138.359 1.00 28.63  ?  739  GLY A N     1 
ATOM   2002  C  CA    . GLY A 1 867  ? 168.384 154.765 139.658 1.00 28.22  ?  739  GLY A CA    1 
ATOM   2003  C  C     . GLY A 1 867  ? 167.843 155.683 140.733 1.00 27.65  ?  739  GLY A C     1 
ATOM   2004  O  O     . GLY A 1 867  ? 167.844 155.309 141.914 1.00 26.58  ?  739  GLY A O     1 
ATOM   2005  N  N     . LEU A 1 868  ? 167.384 156.872 140.353 1.00 28.78  ?  740  LEU A N     1 
ATOM   2006  C  CA    . LEU A 1 868  ? 166.844 157.810 141.323 1.00 32.68  ?  740  LEU A CA    1 
ATOM   2007  C  C     . LEU A 1 868  ? 165.663 157.194 142.062 1.00 34.71  ?  740  LEU A C     1 
ATOM   2008  O  O     . LEU A 1 868  ? 164.959 156.320 141.547 1.00 31.38  ?  740  LEU A O     1 
ATOM   2009  C  CB    . LEU A 1 868  ? 166.414 159.100 140.627 1.00 33.05  ?  740  LEU A CB    1 
ATOM   2010  C  CG    . LEU A 1 868  ? 167.486 159.760 139.758 1.00 32.13  ?  740  LEU A CG    1 
ATOM   2011  C  CD1   . LEU A 1 868  ? 166.983 161.073 139.184 1.00 30.19  ?  740  LEU A CD1   1 
ATOM   2012  C  CD2   . LEU A 1 868  ? 168.759 159.972 140.561 1.00 33.44  ?  740  LEU A CD2   1 
ATOM   2013  N  N     . GLU A 1 869  ? 165.457 157.658 143.291 1.00 41.13  ?  741  GLU A N     1 
ATOM   2014  C  CA    . GLU A 1 869  ? 164.327 157.217 144.087 1.00 45.64  ?  741  GLU A CA    1 
ATOM   2015  C  C     . GLU A 1 869  ? 163.016 157.599 143.400 1.00 47.22  ?  741  GLU A C     1 
ATOM   2016  O  O     . GLU A 1 869  ? 162.982 158.367 142.434 1.00 47.56  ?  741  GLU A O     1 
ATOM   2017  C  CB    . GLU A 1 869  ? 164.399 157.822 145.489 1.00 56.18  ?  741  GLU A CB    1 
ATOM   2018  C  CG    . GLU A 1 869  ? 164.404 159.351 145.530 1.00 65.63  ?  741  GLU A CG    1 
ATOM   2019  C  CD    . GLU A 1 869  ? 165.759 159.971 145.218 1.00 75.78  ?  741  GLU A CD    1 
ATOM   2020  O  OE1   . GLU A 1 869  ? 166.437 159.499 144.282 1.00 58.86  ?  741  GLU A OE1   1 
ATOM   2021  O  OE2   . GLU A 1 869  ? 166.144 160.943 145.905 1.00 152.46 -1 741  GLU A OE2   1 
ATOM   2022  N  N     . ALA A 1 870  ? 161.923 157.050 143.917 1.00 50.40  ?  742  ALA A N     1 
ATOM   2023  C  CA    . ALA A 1 870  ? 160.620 157.226 143.297 1.00 54.84  ?  742  ALA A CA    1 
ATOM   2024  C  C     . ALA A 1 870  ? 159.551 157.057 144.365 1.00 65.71  ?  742  ALA A C     1 
ATOM   2025  O  O     . ALA A 1 870  ? 159.710 156.240 145.275 1.00 71.91  ?  742  ALA A O     1 
ATOM   2026  C  CB    . ALA A 1 870  ? 160.414 156.221 142.156 1.00 51.99  ?  742  ALA A CB    1 
ATOM   2027  N  N     . SER A 1 871  ? 158.469 157.825 144.254 1.00 66.84  ?  743  SER A N     1 
ATOM   2028  C  CA    . SER A 1 871  ? 158.280 158.777 143.162 1.00 68.12  ?  743  SER A CA    1 
ATOM   2029  C  C     . SER A 1 871  ? 158.187 160.211 143.675 1.00 67.92  ?  743  SER A C     1 
ATOM   2030  O  O     . SER A 1 871  ? 158.778 161.124 143.096 1.00 61.58  ?  743  SER A O     1 
ATOM   2031  C  CB    . SER A 1 871  ? 157.027 158.420 142.361 1.00 78.05  ?  743  SER A CB    1 
ATOM   2032  O  OG    . SER A 1 871  ? 156.787 159.367 141.336 1.00 83.24  ?  743  SER A OG    1 
ATOM   2033  N  N     . GLY A 1 872  ? 157.450 160.402 144.769 1.00 68.04  ?  744  GLY A N     1 
ATOM   2034  C  CA    . GLY A 1 872  ? 157.265 161.721 145.345 1.00 63.62  ?  744  GLY A CA    1 
ATOM   2035  C  C     . GLY A 1 872  ? 158.501 162.212 146.069 1.00 54.14  ?  744  GLY A C     1 
ATOM   2036  O  O     . GLY A 1 872  ? 158.434 162.656 147.220 1.00 56.10  ?  744  GLY A O     1 
ATOM   2037  N  N     . SER A 1 873  ? 159.638 162.143 145.384 1.00 49.56  ?  745  SER A N     1 
ATOM   2038  C  CA    . SER A 1 873  ? 160.919 162.473 145.978 1.00 45.63  ?  745  SER A CA    1 
ATOM   2039  C  C     . SER A 1 873  ? 161.032 163.980 146.187 1.00 42.74  ?  745  SER A C     1 
ATOM   2040  O  O     . SER A 1 873  ? 160.107 164.752 145.916 1.00 47.64  ?  745  SER A O     1 
ATOM   2041  C  CB    . SER A 1 873  ? 162.049 161.967 145.087 1.00 52.98  ?  745  SER A CB    1 
ATOM   2042  O  OG    . SER A 1 873  ? 161.721 160.709 144.523 1.00 54.54  ?  745  SER A OG    1 
ATOM   2043  N  N     . THR A 1 874  ? 162.191 164.398 146.685 1.00 44.73  ?  746  THR A N     1 
ATOM   2044  C  CA    . THR A 1 874  ? 162.517 165.810 146.791 1.00 49.50  ?  746  THR A CA    1 
ATOM   2045  C  C     . THR A 1 874  ? 163.439 166.270 145.669 1.00 53.89  ?  746  THR A C     1 
ATOM   2046  O  O     . THR A 1 874  ? 163.716 167.469 145.560 1.00 58.15  ?  746  THR A O     1 
ATOM   2047  C  CB    . THR A 1 874  ? 163.152 166.096 148.158 1.00 54.47  ?  746  THR A CB    1 
ATOM   2048  O  OG1   . THR A 1 874  ? 162.492 165.303 149.153 1.00 55.97  ?  746  THR A OG1   1 
ATOM   2049  C  CG2   . THR A 1 874  ? 162.993 167.562 148.532 1.00 57.90  ?  746  THR A CG2   1 
ATOM   2050  N  N     . TYR A 1 875  ? 163.907 165.344 144.830 1.00 52.51  ?  747  TYR A N     1 
ATOM   2051  C  CA    . TYR A 1 875  ? 164.663 165.677 143.625 1.00 54.53  ?  747  TYR A CA    1 
ATOM   2052  C  C     . TYR A 1 875  ? 163.731 165.497 142.433 1.00 56.47  ?  747  TYR A C     1 
ATOM   2053  O  O     . TYR A 1 875  ? 163.702 164.458 141.774 1.00 55.76  ?  747  TYR A O     1 
ATOM   2054  C  CB    . TYR A 1 875  ? 165.911 164.815 143.520 1.00 49.77  ?  747  TYR A CB    1 
ATOM   2055  C  CG    . TYR A 1 875  ? 166.977 165.297 144.453 1.00 52.55  ?  747  TYR A CG    1 
ATOM   2056  C  CD1   . TYR A 1 875  ? 166.936 164.976 145.801 1.00 57.34  ?  747  TYR A CD1   1 
ATOM   2057  C  CD2   . TYR A 1 875  ? 167.993 166.122 144.003 1.00 56.30  ?  747  TYR A CD2   1 
ATOM   2058  C  CE1   . TYR A 1 875  ? 167.898 165.434 146.668 1.00 67.15  ?  747  TYR A CE1   1 
ATOM   2059  C  CE2   . TYR A 1 875  ? 168.956 166.591 144.862 1.00 60.77  ?  747  TYR A CE2   1 
ATOM   2060  C  CZ    . TYR A 1 875  ? 168.908 166.241 146.193 1.00 70.01  ?  747  TYR A CZ    1 
ATOM   2061  O  OH    . TYR A 1 875  ? 169.871 166.706 147.053 1.00 78.47  ?  747  TYR A OH    1 
ATOM   2062  N  N     . ILE A 1 876  ? 162.964 166.552 142.155 1.00 57.18  ?  748  ILE A N     1 
ATOM   2063  C  CA    . ILE A 1 876  ? 161.854 166.449 141.213 1.00 55.10  ?  748  ILE A CA    1 
ATOM   2064  C  C     . ILE A 1 876  ? 162.364 166.198 139.800 1.00 49.72  ?  748  ILE A C     1 
ATOM   2065  O  O     . ILE A 1 876  ? 162.023 165.190 139.169 1.00 50.34  ?  748  ILE A O     1 
ATOM   2066  C  CB    . ILE A 1 876  ? 160.977 167.712 141.277 1.00 60.90  ?  748  ILE A CB    1 
ATOM   2067  C  CG1   . ILE A 1 876  ? 161.843 168.960 141.479 1.00 63.95  ?  748  ILE A CG1   1 
ATOM   2068  C  CG2   . ILE A 1 876  ? 159.938 167.577 142.375 1.00 59.60  ?  748  ILE A CG2   1 
ATOM   2069  C  CD1   . ILE A 1 876  ? 161.072 170.264 141.415 1.00 71.48  ?  748  ILE A CD1   1 
ATOM   2070  N  N     . CYS A 1 877  ? 163.189 167.107 139.288 1.00 45.04  ?  749  CYS A N     1 
ATOM   2071  C  CA    . CYS A 1 877  ? 163.540 167.081 137.877 1.00 44.57  ?  749  CYS A CA    1 
ATOM   2072  C  C     . CYS A 1 877  ? 164.281 165.802 137.512 1.00 45.49  ?  749  CYS A C     1 
ATOM   2073  O  O     . CYS A 1 877  ? 165.002 165.215 138.323 1.00 45.12  ?  749  CYS A O     1 
ATOM   2074  C  CB    . CYS A 1 877  ? 164.405 168.283 137.521 1.00 45.39  ?  749  CYS A CB    1 
ATOM   2075  S  SG    . CYS A 1 877  ? 164.744 168.395 135.757 1.00 43.54  ?  749  CYS A SG    1 
ATOM   2076  N  N     . THR A 1 878  ? 164.087 165.372 136.268 1.00 43.80  ?  750  THR A N     1 
ATOM   2077  C  CA    . THR A 1 878  ? 164.845 164.278 135.684 1.00 40.10  ?  750  THR A CA    1 
ATOM   2078  C  C     . THR A 1 878  ? 165.963 164.779 134.776 1.00 40.55  ?  750  THR A C     1 
ATOM   2079  O  O     . THR A 1 878  ? 166.752 163.971 134.279 1.00 38.26  ?  750  THR A O     1 
ATOM   2080  C  CB    . THR A 1 878  ? 163.907 163.344 134.904 1.00 34.25  ?  750  THR A CB    1 
ATOM   2081  O  OG1   . THR A 1 878  ? 162.633 163.289 135.558 1.00 31.33  ?  750  THR A OG1   1 
ATOM   2082  C  CG2   . THR A 1 878  ? 164.476 161.937 134.847 1.00 34.01  ?  750  THR A CG2   1 
ATOM   2083  N  N     . LEU A 1 879  ? 166.052 166.092 134.561 1.00 45.69  ?  751  LEU A N     1 
ATOM   2084  C  CA    . LEU A 1 879  ? 167.053 166.706 133.695 1.00 49.79  ?  751  LEU A CA    1 
ATOM   2085  C  C     . LEU A 1 879  ? 168.043 167.573 134.455 1.00 54.65  ?  751  LEU A C     1 
ATOM   2086  O  O     . LEU A 1 879  ? 169.257 167.423 134.287 1.00 57.50  ?  751  LEU A O     1 
ATOM   2087  C  CB    . LEU A 1 879  ? 166.369 167.557 132.618 1.00 48.32  ?  751  LEU A CB    1 
ATOM   2088  C  CG    . LEU A 1 879  ? 165.088 166.957 132.060 1.00 45.78  ?  751  LEU A CG    1 
ATOM   2089  C  CD1   . LEU A 1 879  ? 164.251 167.978 131.321 1.00 51.94  ?  751  LEU A CD1   1 
ATOM   2090  C  CD2   . LEU A 1 879  ? 165.497 165.865 131.146 1.00 48.89  ?  751  LEU A CD2   1 
ATOM   2091  N  N     . CYS A 1 880  ? 167.551 168.502 135.266 1.00 55.62  ?  752  CYS A N     1 
ATOM   2092  C  CA    . CYS A 1 880  ? 168.405 169.363 136.066 1.00 59.08  ?  752  CYS A CA    1 
ATOM   2093  C  C     . CYS A 1 880  ? 168.755 168.646 137.367 1.00 55.75  ?  752  CYS A C     1 
ATOM   2094  O  O     . CYS A 1 880  ? 168.530 167.443 137.523 1.00 57.33  ?  752  CYS A O     1 
ATOM   2095  C  CB    . CYS A 1 880  ? 167.723 170.707 136.320 1.00 66.25  ?  752  CYS A CB    1 
ATOM   2096  S  SG    . CYS A 1 880  ? 168.713 171.879 137.286 1.00 64.26  ?  752  CYS A SG    1 
ATOM   2097  N  N     . ASP A 1 881  ? 169.326 169.382 138.317 1.00 52.98  ?  753  ASP A N     1 
ATOM   2098  C  CA    . ASP A 1 881  ? 169.608 168.847 139.641 1.00 53.56  ?  753  ASP A CA    1 
ATOM   2099  C  C     . ASP A 1 881  ? 168.802 169.557 140.719 1.00 52.00  ?  753  ASP A C     1 
ATOM   2100  O  O     . ASP A 1 881  ? 169.086 169.383 141.910 1.00 56.90  ?  753  ASP A O     1 
ATOM   2101  C  CB    . ASP A 1 881  ? 171.106 168.939 139.944 1.00 65.35  ?  753  ASP A CB    1 
ATOM   2102  C  CG    . ASP A 1 881  ? 171.957 168.267 138.879 1.00 76.87  ?  753  ASP A CG    1 
ATOM   2103  O  OD1   . ASP A 1 881  ? 171.807 168.617 137.690 1.00 69.73  ?  753  ASP A OD1   1 
ATOM   2104  O  OD2   . ASP A 1 881  ? 172.770 167.383 139.227 1.00 120.80 -1 753  ASP A OD2   1 
ATOM   2105  N  N     . SER A 1 882  ? 167.800 170.339 140.331 1.00 55.19  ?  754  SER A N     1 
ATOM   2106  C  CA    . SER A 1 882  ? 167.062 171.146 141.287 1.00 69.30  ?  754  SER A CA    1 
ATOM   2107  C  C     . SER A 1 882  ? 166.169 170.285 142.172 1.00 64.98  ?  754  SER A C     1 
ATOM   2108  O  O     . SER A 1 882  ? 165.624 169.262 141.748 1.00 58.91  ?  754  SER A O     1 
ATOM   2109  C  CB    . SER A 1 882  ? 166.219 172.194 140.561 1.00 77.38  ?  754  SER A CB    1 
ATOM   2110  O  OG    . SER A 1 882  ? 167.021 172.971 139.692 1.00 76.63  ?  754  SER A OG    1 
ATOM   2111  N  N     . THR A 1 883  ? 166.036 170.715 143.422 1.00 70.98  ?  755  THR A N     1 
ATOM   2112  C  CA    . THR A 1 883  ? 165.092 170.144 144.368 1.00 66.05  ?  755  THR A CA    1 
ATOM   2113  C  C     . THR A 1 883  ? 163.771 170.902 144.259 1.00 66.02  ?  755  THR A C     1 
ATOM   2114  O  O     . THR A 1 883  ? 163.531 171.643 143.302 1.00 72.32  ?  755  THR A O     1 
ATOM   2115  C  CB    . THR A 1 883  ? 165.648 170.201 145.790 1.00 68.88  ?  755  THR A CB    1 
ATOM   2116  O  OG1   . THR A 1 883  ? 165.611 171.554 146.263 1.00 71.91  ?  755  THR A OG1   1 
ATOM   2117  C  CG2   . THR A 1 883  ? 167.081 169.694 145.827 1.00 76.51  ?  755  THR A CG2   1 
ATOM   2118  N  N     . ARG A 1 884  ? 162.892 170.711 145.241 1.00 57.33  ?  756  ARG A N     1 
ATOM   2119  C  CA    . ARG A 1 884  ? 161.627 171.437 145.254 1.00 53.99  ?  756  ARG A CA    1 
ATOM   2120  C  C     . ARG A 1 884  ? 161.858 172.942 145.332 1.00 65.77  ?  756  ARG A C     1 
ATOM   2121  O  O     . ARG A 1 884  ? 161.329 173.710 144.518 1.00 72.38  ?  756  ARG A O     1 
ATOM   2122  C  CB    . ARG A 1 884  ? 160.774 170.962 146.428 1.00 46.05  ?  756  ARG A CB    1 
ATOM   2123  C  CG    . ARG A 1 884  ? 159.310 170.816 146.098 1.00 43.43  ?  756  ARG A CG    1 
ATOM   2124  C  CD    . ARG A 1 884  ? 159.108 169.715 145.084 1.00 42.55  ?  756  ARG A CD    1 
ATOM   2125  N  NE    . ARG A 1 884  ? 157.753 169.180 145.128 1.00 41.29  ?  756  ARG A NE    1 
ATOM   2126  C  CZ    . ARG A 1 884  ? 157.338 168.286 146.019 1.00 40.36  ?  756  ARG A CZ    1 
ATOM   2127  N  NH1   . ARG A 1 884  ? 156.087 167.850 145.990 1.00 40.19  ?  756  ARG A NH1   1 
ATOM   2128  N  NH2   . ARG A 1 884  ? 158.175 167.827 146.939 1.00 39.91  ?  756  ARG A NH2   1 
ATOM   2129  N  N     . ALA A 1 885  ? 162.673 173.379 146.293 1.00 67.91  ?  757  ALA A N     1 
ATOM   2130  C  CA    . ALA A 1 885  ? 162.790 174.804 146.589 1.00 76.58  ?  757  ALA A CA    1 
ATOM   2131  C  C     . ALA A 1 885  ? 163.511 175.555 145.474 1.00 77.67  ?  757  ALA A C     1 
ATOM   2132  O  O     . ALA A 1 885  ? 162.940 176.455 144.845 1.00 85.01  ?  757  ALA A O     1 
ATOM   2133  C  CB    . ALA A 1 885  ? 163.512 174.995 147.924 1.00 79.25  ?  757  ALA A CB    1 
ATOM   2134  N  N     . GLU A 1 886  ? 164.770 175.191 145.209 1.00 71.52  ?  758  GLU A N     1 
ATOM   2135  C  CA    . GLU A 1 886  ? 165.608 175.947 144.280 1.00 70.89  ?  758  GLU A CA    1 
ATOM   2136  C  C     . GLU A 1 886  ? 164.970 176.111 142.908 1.00 69.91  ?  758  GLU A C     1 
ATOM   2137  O  O     . GLU A 1 886  ? 165.307 177.058 142.188 1.00 75.20  ?  758  GLU A O     1 
ATOM   2138  C  CB    . GLU A 1 886  ? 166.964 175.265 144.136 1.00 78.66  ?  758  GLU A CB    1 
ATOM   2139  C  CG    . GLU A 1 886  ? 166.847 173.776 143.898 1.00 87.47  ?  758  GLU A CG    1 
ATOM   2140  C  CD    . GLU A 1 886  ? 168.181 173.063 143.958 1.00 106.73 ?  758  GLU A CD    1 
ATOM   2141  O  OE1   . GLU A 1 886  ? 169.223 173.750 143.986 1.00 105.95 ?  758  GLU A OE1   1 
ATOM   2142  O  OE2   . GLU A 1 886  ? 168.187 171.814 143.975 1.00 166.61 -1 758  GLU A OE2   1 
ATOM   2143  N  N     . ALA A 1 887  ? 164.075 175.205 142.523 1.00 71.62  ?  759  ALA A N     1 
ATOM   2144  C  CA    . ALA A 1 887  ? 163.263 175.407 141.336 1.00 77.73  ?  759  ALA A CA    1 
ATOM   2145  C  C     . ALA A 1 887  ? 161.969 176.145 141.638 1.00 88.57  ?  759  ALA A C     1 
ATOM   2146  O  O     . ALA A 1 887  ? 161.393 176.744 140.722 1.00 90.73  ?  759  ALA A O     1 
ATOM   2147  C  CB    . ALA A 1 887  ? 162.946 174.066 140.669 1.00 74.15  ?  759  ALA A CB    1 
ATOM   2148  N  N     . SER A 1 888  ? 161.514 176.138 142.900 1.00 90.93  ?  760  SER A N     1 
ATOM   2149  C  CA    . SER A 1 888  ? 160.278 176.838 143.239 1.00 98.95  ?  760  SER A CA    1 
ATOM   2150  C  C     . SER A 1 888  ? 160.469 178.343 143.247 1.00 102.75 ?  760  SER A C     1 
ATOM   2151  O  O     . SER A 1 888  ? 159.608 179.088 142.759 1.00 98.03  ?  760  SER A O     1 
ATOM   2152  C  CB    . SER A 1 888  ? 159.721 176.345 144.572 1.00 96.85  ?  760  SER A CB    1 
ATOM   2153  O  OG    . SER A 1 888  ? 158.417 176.866 144.791 1.00 99.17  ?  760  SER A OG    1 
ATOM   2154  N  N     . GLN A 1 889  ? 161.591 178.802 143.791 1.00 103.84 ?  761  GLN A N     1 
ATOM   2155  C  CA    . GLN A 1 889  ? 161.876 180.229 143.827 1.00 109.25 ?  761  GLN A CA    1 
ATOM   2156  C  C     . GLN A 1 889  ? 161.984 180.791 142.415 1.00 107.54 ?  761  GLN A C     1 
ATOM   2157  O  O     . GLN A 1 889  ? 161.178 181.631 142.001 1.00 104.91 ?  761  GLN A O     1 
ATOM   2158  C  CB    . GLN A 1 889  ? 163.158 180.470 144.619 1.00 111.08 ?  761  GLN A CB    1 
ATOM   2159  C  CG    . GLN A 1 889  ? 163.112 179.928 146.037 1.00 111.71 ?  761  GLN A CG    1 
ATOM   2160  C  CD    . GLN A 1 889  ? 162.109 180.658 146.906 1.00 112.42 ?  761  GLN A CD    1 
ATOM   2161  O  OE1   . GLN A 1 889  ? 161.890 181.859 146.747 1.00 116.55 ?  761  GLN A OE1   1 
ATOM   2162  N  NE2   . GLN A 1 889  ? 161.490 179.934 147.831 1.00 107.18 ?  761  GLN A NE2   1 
ATOM   2163  N  N     . ASN A 1 890  ? 162.973 180.324 141.656 1.00 104.13 ?  762  ASN A N     1 
ATOM   2164  C  CA    . ASN A 1 890  ? 163.134 180.675 140.250 1.00 102.50 ?  762  ASN A CA    1 
ATOM   2165  C  C     . ASN A 1 890  ? 162.795 179.451 139.411 1.00 93.10  ?  762  ASN A C     1 
ATOM   2166  O  O     . ASN A 1 890  ? 163.387 178.383 139.598 1.00 91.67  ?  762  ASN A O     1 
ATOM   2167  C  CB    . ASN A 1 890  ? 164.555 181.156 139.956 1.00 103.72 ?  762  ASN A CB    1 
ATOM   2168  C  CG    . ASN A 1 890  ? 164.679 181.818 138.593 1.00 98.21  ?  762  ASN A CG    1 
ATOM   2169  O  OD1   . ASN A 1 890  ? 164.158 181.320 137.593 1.00 92.17  ?  762  ASN A OD1   1 
ATOM   2170  N  ND2   . ASN A 1 890  ? 165.373 182.948 138.549 1.00 98.73  ?  762  ASN A ND2   1 
ATOM   2171  N  N     . MET A 1 891  ? 161.860 179.612 138.477 1.00 79.53  ?  763  MET A N     1 
ATOM   2172  C  CA    . MET A 1 891  ? 161.319 178.467 137.753 1.00 74.02  ?  763  MET A CA    1 
ATOM   2173  C  C     . MET A 1 891  ? 162.049 178.203 136.437 1.00 73.87  ?  763  MET A C     1 
ATOM   2174  O  O     . MET A 1 891  ? 162.610 177.121 136.239 1.00 74.52  ?  763  MET A O     1 
ATOM   2175  C  CB    . MET A 1 891  ? 159.820 178.675 137.509 1.00 69.12  ?  763  MET A CB    1 
ATOM   2176  C  CG    . MET A 1 891  ? 159.022 178.868 138.790 1.00 72.91  ?  763  MET A CG    1 
ATOM   2177  S  SD    . MET A 1 891  ? 157.239 178.779 138.548 1.00 72.00  ?  763  MET A SD    1 
ATOM   2178  C  CE    . MET A 1 891  ? 156.669 178.939 140.238 1.00 78.59  ?  763  MET A CE    1 
ATOM   2179  N  N     . VAL A 1 892  ? 162.065 179.187 135.538 1.00 71.74  ?  764  VAL A N     1 
ATOM   2180  C  CA    . VAL A 1 892  ? 162.345 178.938 134.128 1.00 71.10  ?  764  VAL A CA    1 
ATOM   2181  C  C     . VAL A 1 892  ? 163.816 179.135 133.779 1.00 70.63  ?  764  VAL A C     1 
ATOM   2182  O  O     . VAL A 1 892  ? 164.161 179.197 132.595 1.00 64.98  ?  764  VAL A O     1 
ATOM   2183  C  CB    . VAL A 1 892  ? 161.459 179.818 133.238 1.00 74.91  ?  764  VAL A CB    1 
ATOM   2184  C  CG1   . VAL A 1 892  ? 160.000 179.453 133.433 1.00 71.96  ?  764  VAL A CG1   1 
ATOM   2185  C  CG2   . VAL A 1 892  ? 161.696 181.268 133.562 1.00 87.46  ?  764  VAL A CG2   1 
ATOM   2186  N  N     . LEU A 1 893  ? 164.691 179.230 134.771 1.00 77.68  ?  765  LEU A N     1 
ATOM   2187  C  CA    . LEU A 1 893  ? 166.118 179.412 134.527 1.00 86.05  ?  765  LEU A CA    1 
ATOM   2188  C  C     . LEU A 1 893  ? 166.848 178.153 134.988 1.00 86.34  ?  765  LEU A C     1 
ATOM   2189  O  O     . LEU A 1 893  ? 167.285 178.057 136.136 1.00 86.93  ?  765  LEU A O     1 
ATOM   2190  C  CB    . LEU A 1 893  ? 166.642 180.658 135.235 1.00 95.25  ?  765  LEU A CB    1 
ATOM   2191  C  CG    . LEU A 1 893  ? 168.066 181.059 134.846 1.00 97.64  ?  765  LEU A CG    1 
ATOM   2192  C  CD1   . LEU A 1 893  ? 168.221 181.071 133.331 1.00 91.84  ?  765  LEU A CD1   1 
ATOM   2193  C  CD2   . LEU A 1 893  ? 168.438 182.410 135.439 1.00 90.98  ?  765  LEU A CD2   1 
ATOM   2194  N  N     . HIS A 1 894  ? 166.971 177.185 134.080 1.00 73.23  ?  766  HIS A N     1 
ATOM   2195  C  CA    . HIS A 1 894  ? 167.740 175.974 134.332 1.00 60.46  ?  766  HIS A CA    1 
ATOM   2196  C  C     . HIS A 1 894  ? 168.243 175.424 133.005 1.00 58.06  ?  766  HIS A C     1 
ATOM   2197  O  O     . HIS A 1 894  ? 167.744 175.780 131.935 1.00 59.09  ?  766  HIS A O     1 
ATOM   2198  C  CB    . HIS A 1 894  ? 166.918 174.911 135.073 1.00 59.55  ?  766  HIS A CB    1 
ATOM   2199  C  CG    . HIS A 1 894  ? 166.554 175.295 136.473 1.00 66.19  ?  766  HIS A CG    1 
ATOM   2200  N  ND1   . HIS A 1 894  ? 165.456 176.074 136.772 1.00 67.37  ?  766  HIS A ND1   1 
ATOM   2201  C  CD2   . HIS A 1 894  ? 167.166 175.042 137.653 1.00 68.97  ?  766  HIS A CD2   1 
ATOM   2202  C  CE1   . HIS A 1 894  ? 165.394 176.262 138.078 1.00 66.94  ?  766  HIS A CE1   1 
ATOM   2203  N  NE2   . HIS A 1 894  ? 166.421 175.646 138.636 1.00 67.53  ?  766  HIS A NE2   1 
ATOM   2204  N  N     . SER A 1 895  ? 169.242 174.548 133.090 1.00 64.67  ?  767  SER A N     1 
ATOM   2205  C  CA    . SER A 1 895  ? 169.821 173.899 131.922 1.00 72.31  ?  767  SER A CA    1 
ATOM   2206  C  C     . SER A 1 895  ? 169.774 172.391 132.110 1.00 73.21  ?  767  SER A C     1 
ATOM   2207  O  O     . SER A 1 895  ? 169.928 171.893 133.229 1.00 71.73  ?  767  SER A O     1 
ATOM   2208  C  CB    . SER A 1 895  ? 171.268 174.357 131.688 1.00 75.57  ?  767  SER A CB    1 
ATOM   2209  O  OG    . SER A 1 895  ? 172.117 173.936 132.742 1.00 75.35  ?  767  SER A OG    1 
ATOM   2210  N  N     . ILE A 1 896  ? 169.558 171.666 131.013 1.00 69.57  ?  768  ILE A N     1 
ATOM   2211  C  CA    . ILE A 1 896  ? 169.529 170.208 131.075 1.00 68.37  ?  768  ILE A CA    1 
ATOM   2212  C  C     . ILE A 1 896  ? 170.919 169.700 131.426 1.00 74.57  ?  768  ILE A C     1 
ATOM   2213  O  O     . ILE A 1 896  ? 171.907 170.031 130.760 1.00 75.56  ?  768  ILE A O     1 
ATOM   2214  C  CB    . ILE A 1 896  ? 169.030 169.603 129.756 1.00 60.36  ?  768  ILE A CB    1 
ATOM   2215  C  CG1   . ILE A 1 896  ? 167.502 169.619 129.710 1.00 57.16  ?  768  ILE A CG1   1 
ATOM   2216  C  CG2   . ILE A 1 896  ? 169.547 168.178 129.586 1.00 54.33  ?  768  ILE A CG2   1 
ATOM   2217  C  CD1   . ILE A 1 896  ? 166.921 168.741 128.624 1.00 59.88  ?  768  ILE A CD1   1 
ATOM   2218  N  N     . THR A 1 897  ? 171.001 168.906 132.490 1.00 71.64  ?  769  THR A N     1 
ATOM   2219  C  CA    . THR A 1 897  ? 172.259 168.333 132.948 1.00 70.02  ?  769  THR A CA    1 
ATOM   2220  C  C     . THR A 1 897  ? 172.253 166.814 132.913 1.00 71.70  ?  769  THR A C     1 
ATOM   2221  O  O     . THR A 1 897  ? 173.158 166.217 132.318 1.00 76.22  ?  769  THR A O     1 
ATOM   2222  C  CB    . THR A 1 897  ? 172.573 168.825 134.371 1.00 70.27  ?  769  THR A CB    1 
ATOM   2223  O  OG1   . THR A 1 897  ? 171.462 168.540 135.231 1.00 66.14  ?  769  THR A OG1   1 
ATOM   2224  C  CG2   . THR A 1 897  ? 172.836 170.325 134.373 1.00 70.80  ?  769  THR A CG2   1 
ATOM   2225  N  N     . ARG A 1 898  ? 171.235 166.181 133.503 1.00 67.23  ?  770  ARG A N     1 
ATOM   2226  C  CA    . ARG A 1 898  ? 171.234 164.741 133.755 1.00 61.48  ?  770  ARG A CA    1 
ATOM   2227  C  C     . ARG A 1 898  ? 171.583 163.934 132.511 1.00 62.18  ?  770  ARG A C     1 
ATOM   2228  O  O     . ARG A 1 898  ? 171.054 164.178 131.422 1.00 63.81  ?  770  ARG A O     1 
ATOM   2229  C  CB    . ARG A 1 898  ? 169.865 164.306 134.280 1.00 49.43  ?  770  ARG A CB    1 
ATOM   2230  C  CG    . ARG A 1 898  ? 169.636 164.609 135.746 1.00 45.52  ?  770  ARG A CG    1 
ATOM   2231  C  CD    . ARG A 1 898  ? 170.409 163.644 136.625 1.00 46.45  ?  770  ARG A CD    1 
ATOM   2232  N  NE    . ARG A 1 898  ? 170.364 164.030 138.032 1.00 52.24  ?  770  ARG A NE    1 
ATOM   2233  C  CZ    . ARG A 1 898  ? 169.253 164.064 138.760 1.00 53.06  ?  770  ARG A CZ    1 
ATOM   2234  N  NH1   . ARG A 1 898  ? 168.090 163.739 138.212 1.00 47.52  ?  770  ARG A NH1   1 
ATOM   2235  N  NH2   . ARG A 1 898  ? 169.303 164.425 140.035 1.00 53.17  ?  770  ARG A NH2   1 
ATOM   2236  N  N     . SER A 1 899  ? 172.487 162.973 132.685 1.00 62.46  ?  771  SER A N     1 
ATOM   2237  C  CA    . SER A 1 899  ? 172.845 162.028 131.640 1.00 59.39  ?  771  SER A CA    1 
ATOM   2238  C  C     . SER A 1 899  ? 173.014 160.651 132.259 1.00 54.89  ?  771  SER A C     1 
ATOM   2239  O  O     . SER A 1 899  ? 173.160 160.505 133.475 1.00 59.81  ?  771  SER A O     1 
ATOM   2240  C  CB    . SER A 1 899  ? 174.131 162.428 130.908 1.00 65.45  ?  771  SER A CB    1 
ATOM   2241  O  OG    . SER A 1 899  ? 174.856 161.279 130.502 1.00 59.52  ?  771  SER A OG    1 
ATOM   2242  N  N     . HIS A 1 900  ? 173.003 159.636 131.397 1.00 49.46  ?  772  HIS A N     1 
ATOM   2243  C  CA    . HIS A 1 900  ? 173.140 158.264 131.869 1.00 51.44  ?  772  HIS A CA    1 
ATOM   2244  C  C     . HIS A 1 900  ? 174.539 158.004 132.415 1.00 55.03  ?  772  HIS A C     1 
ATOM   2245  O  O     . HIS A 1 900  ? 174.699 157.471 133.521 1.00 59.31  ?  772  HIS A O     1 
ATOM   2246  C  CB    . HIS A 1 900  ? 172.813 157.295 130.734 1.00 46.81  ?  772  HIS A CB    1 
ATOM   2247  C  CG    . HIS A 1 900  ? 173.181 155.875 131.029 1.00 46.85  ?  772  HIS A CG    1 
ATOM   2248  N  ND1   . HIS A 1 900  ? 172.314 154.991 131.635 1.00 38.55  ?  772  HIS A ND1   1 
ATOM   2249  C  CD2   . HIS A 1 900  ? 174.325 155.186 130.803 1.00 52.73  ?  772  HIS A CD2   1 
ATOM   2250  C  CE1   . HIS A 1 900  ? 172.906 153.817 131.765 1.00 36.63  ?  772  HIS A CE1   1 
ATOM   2251  N  NE2   . HIS A 1 900  ? 174.128 153.909 131.270 1.00 47.01  ?  772  HIS A NE2   1 
ATOM   2252  N  N     . ASP A 1 901  ? 175.569 158.374 131.650 1.00 58.27  ?  773  ASP A N     1 
ATOM   2253  C  CA    . ASP A 1 901  ? 176.934 158.066 132.061 1.00 70.53  ?  773  ASP A CA    1 
ATOM   2254  C  C     . ASP A 1 901  ? 177.310 158.806 133.340 1.00 73.49  ?  773  ASP A C     1 
ATOM   2255  O  O     . ASP A 1 901  ? 177.918 158.224 134.250 1.00 71.42  ?  773  ASP A O     1 
ATOM   2256  C  CB    . ASP A 1 901  ? 177.903 158.404 130.931 1.00 88.91  ?  773  ASP A CB    1 
ATOM   2257  C  CG    . ASP A 1 901  ? 179.328 158.023 131.259 1.00 127.98 ?  773  ASP A CG    1 
ATOM   2258  O  OD1   . ASP A 1 901  ? 179.598 156.816 131.432 1.00 118.92 ?  773  ASP A OD1   1 
ATOM   2259  O  OD2   . ASP A 1 901  ? 180.177 158.933 131.348 1.00 202.68 -1 773  ASP A OD2   1 
ATOM   2260  N  N     . GLU A 1 902  ? 176.950 160.086 133.439 1.00 75.20  ?  774  GLU A N     1 
ATOM   2261  C  CA    . GLU A 1 902  ? 177.209 160.811 134.675 1.00 74.94  ?  774  GLU A CA    1 
ATOM   2262  C  C     . GLU A 1 902  ? 176.351 160.302 135.823 1.00 66.20  ?  774  GLU A C     1 
ATOM   2263  O  O     . GLU A 1 902  ? 176.733 160.471 136.983 1.00 62.82  ?  774  GLU A O     1 
ATOM   2264  C  CB    . GLU A 1 902  ? 176.974 162.304 134.477 1.00 81.34  ?  774  GLU A CB    1 
ATOM   2265  C  CG    . GLU A 1 902  ? 175.521 162.641 134.286 1.00 91.66  ?  774  GLU A CG    1 
ATOM   2266  C  CD    . GLU A 1 902  ? 175.313 164.026 133.740 1.00 110.03 ?  774  GLU A CD    1 
ATOM   2267  O  OE1   . GLU A 1 902  ? 176.276 164.821 133.726 1.00 107.93 ?  774  GLU A OE1   1 
ATOM   2268  O  OE2   . GLU A 1 902  ? 174.180 164.311 133.312 1.00 154.36 -1 774  GLU A OE2   1 
ATOM   2269  N  N     . ASN A 1 903  ? 175.210 159.670 135.533 1.00 58.33  ?  775  ASN A N     1 
ATOM   2270  C  CA    . ASN A 1 903  ? 174.438 159.039 136.599 1.00 51.04  ?  775  ASN A CA    1 
ATOM   2271  C  C     . ASN A 1 903  ? 175.145 157.794 137.117 1.00 43.61  ?  775  ASN A C     1 
ATOM   2272  O  O     . ASN A 1 903  ? 175.146 157.532 138.326 1.00 42.95  ?  775  ASN A O     1 
ATOM   2273  C  CB    . ASN A 1 903  ? 173.032 158.702 136.111 1.00 49.56  ?  775  ASN A CB    1 
ATOM   2274  C  CG    . ASN A 1 903  ? 172.035 159.798 136.420 1.00 52.42  ?  775  ASN A CG    1 
ATOM   2275  O  OD1   . ASN A 1 903  ? 172.166 160.505 137.420 1.00 49.23  ?  775  ASN A OD1   1 
ATOM   2276  N  ND2   . ASN A 1 903  ? 171.039 159.955 135.558 1.00 57.27  ?  775  ASN A ND2   1 
ATOM   2277  N  N     . LEU A 1 904  ? 175.754 157.019 136.218 1.00 44.38  ?  776  LEU A N     1 
ATOM   2278  C  CA    . LEU A 1 904  ? 176.652 155.953 136.656 1.00 41.66  ?  776  LEU A CA    1 
ATOM   2279  C  C     . LEU A 1 904  ? 177.753 156.515 137.548 1.00 48.53  ?  776  LEU A C     1 
ATOM   2280  O  O     . LEU A 1 904  ? 178.032 155.979 138.630 1.00 45.67  ?  776  LEU A O     1 
ATOM   2281  C  CB    . LEU A 1 904  ? 177.247 155.240 135.439 1.00 41.62  ?  776  LEU A CB    1 
ATOM   2282  C  CG    . LEU A 1 904  ? 177.796 153.817 135.594 1.00 41.54  ?  776  LEU A CG    1 
ATOM   2283  C  CD1   . LEU A 1 904  ? 179.055 153.703 136.459 1.00 47.77  ?  776  LEU A CD1   1 
ATOM   2284  C  CD2   . LEU A 1 904  ? 176.687 152.964 136.171 1.00 35.35  ?  776  LEU A CD2   1 
ATOM   2285  N  N     . GLU A 1 905  ? 178.390 157.600 137.102 1.00 62.77  ?  777  GLU A N     1 
ATOM   2286  C  CA    . GLU A 1 905  ? 179.461 158.213 137.884 1.00 68.27  ?  777  GLU A CA    1 
ATOM   2287  C  C     . GLU A 1 905  ? 178.975 158.618 139.273 1.00 56.38  ?  777  GLU A C     1 
ATOM   2288  O  O     . GLU A 1 905  ? 179.633 158.342 140.285 1.00 55.48  ?  777  GLU A O     1 
ATOM   2289  C  CB    . GLU A 1 905  ? 180.024 159.424 137.141 1.00 83.37  ?  777  GLU A CB    1 
ATOM   2290  C  CG    . GLU A 1 905  ? 181.340 159.909 137.708 1.00 102.70 ?  777  GLU A CG    1 
ATOM   2291  C  CD    . GLU A 1 905  ? 182.281 158.760 138.006 1.00 120.94 ?  777  GLU A CD    1 
ATOM   2292  O  OE1   . GLU A 1 905  ? 182.515 158.477 139.200 1.00 103.70 ?  777  GLU A OE1   1 
ATOM   2293  O  OE2   . GLU A 1 905  ? 182.775 158.130 137.047 1.00 176.52 -1 777  GLU A OE2   1 
ATOM   2294  N  N     . ARG A 1 906  ? 177.824 159.290 139.335 1.00 51.72  ?  778  ARG A N     1 
ATOM   2295  C  CA    . ARG A 1 906  ? 177.264 159.711 140.615 1.00 46.63  ?  778  ARG A CA    1 
ATOM   2296  C  C     . ARG A 1 906  ? 176.945 158.515 141.503 1.00 39.34  ?  778  ARG A C     1 
ATOM   2297  O  O     . ARG A 1 906  ? 177.150 158.567 142.721 1.00 38.32  ?  778  ARG A O     1 
ATOM   2298  C  CB    . ARG A 1 906  ? 176.010 160.555 140.387 1.00 49.50  ?  778  ARG A CB    1 
ATOM   2299  C  CG    . ARG A 1 906  ? 176.264 162.034 140.127 1.00 45.72  ?  778  ARG A CG    1 
ATOM   2300  C  CD    . ARG A 1 906  ? 174.947 162.773 139.934 1.00 41.78  ?  778  ARG A CD    1 
ATOM   2301  N  NE    . ARG A 1 906  ? 175.135 164.207 139.745 1.00 42.11  ?  778  ARG A NE    1 
ATOM   2302  C  CZ    . ARG A 1 906  ? 175.468 164.767 138.587 1.00 46.72  ?  778  ARG A CZ    1 
ATOM   2303  N  NH1   . ARG A 1 906  ? 175.656 164.010 137.515 1.00 54.53  ?  778  ARG A NH1   1 
ATOM   2304  N  NH2   . ARG A 1 906  ? 175.617 166.081 138.501 1.00 48.23  ?  778  ARG A NH2   1 
ATOM   2305  N  N     . TYR A 1 907  ? 176.425 157.432 140.924 1.00 33.00  ?  779  TYR A N     1 
ATOM   2306  C  CA    . TYR A 1 907  ? 176.182 156.244 141.734 1.00 25.44  ?  779  TYR A CA    1 
ATOM   2307  C  C     . TYR A 1 907  ? 177.481 155.706 142.309 1.00 32.63  ?  779  TYR A C     1 
ATOM   2308  O  O     . TYR A 1 907  ? 177.514 155.220 143.446 1.00 36.63  ?  779  TYR A O     1 
ATOM   2309  C  CB    . TYR A 1 907  ? 175.486 155.159 140.921 1.00 22.48  ?  779  TYR A CB    1 
ATOM   2310  C  CG    . TYR A 1 907  ? 175.415 153.845 141.664 1.00 18.21  ?  779  TYR A CG    1 
ATOM   2311  C  CD1   . TYR A 1 907  ? 174.422 153.614 142.604 1.00 13.10  ?  779  TYR A CD1   1 
ATOM   2312  C  CD2   . TYR A 1 907  ? 176.348 152.840 141.435 1.00 23.38  ?  779  TYR A CD2   1 
ATOM   2313  C  CE1   . TYR A 1 907  ? 174.354 152.421 143.286 1.00 13.80  ?  779  TYR A CE1   1 
ATOM   2314  C  CE2   . TYR A 1 907  ? 176.288 151.646 142.115 1.00 20.76  ?  779  TYR A CE2   1 
ATOM   2315  C  CZ    . TYR A 1 907  ? 175.288 151.440 143.036 1.00 16.76  ?  779  TYR A CZ    1 
ATOM   2316  O  OH    . TYR A 1 907  ? 175.226 150.247 143.712 1.00 14.99  ?  779  TYR A OH    1 
ATOM   2317  N  N     . GLU A 1 908  ? 178.556 155.753 141.524 1.00 38.48  ?  780  GLU A N     1 
ATOM   2318  C  CA    . GLU A 1 908  ? 179.857 155.359 142.055 1.00 46.56  ?  780  GLU A CA    1 
ATOM   2319  C  C     . GLU A 1 908  ? 180.256 156.248 143.226 1.00 46.93  ?  780  GLU A C     1 
ATOM   2320  O  O     . GLU A 1 908  ? 180.741 155.759 144.259 1.00 48.83  ?  780  GLU A O     1 
ATOM   2321  C  CB    . GLU A 1 908  ? 180.913 155.408 140.952 1.00 55.16  ?  780  GLU A CB    1 
ATOM   2322  C  CG    . GLU A 1 908  ? 181.175 154.055 140.338 1.00 67.73  ?  780  GLU A CG    1 
ATOM   2323  C  CD    . GLU A 1 908  ? 181.634 153.049 141.374 1.00 90.72  ?  780  GLU A CD    1 
ATOM   2324  O  OE1   . GLU A 1 908  ? 182.418 153.430 142.270 1.00 75.28  ?  780  GLU A OE1   1 
ATOM   2325  O  OE2   . GLU A 1 908  ? 181.193 151.883 141.307 1.00 162.63 -1 780  GLU A OE2   1 
ATOM   2326  N  N     . ILE A 1 909  ? 180.037 157.557 143.084 1.00 45.31  ?  781  ILE A N     1 
ATOM   2327  C  CA    . ILE A 1 909  ? 180.378 158.509 144.140 1.00 46.46  ?  781  ILE A CA    1 
ATOM   2328  C  C     . ILE A 1 909  ? 179.535 158.265 145.390 1.00 45.59  ?  781  ILE A C     1 
ATOM   2329  O  O     . ILE A 1 909  ? 179.987 158.514 146.516 1.00 47.15  ?  781  ILE A O     1 
ATOM   2330  C  CB    . ILE A 1 909  ? 180.233 159.949 143.598 1.00 49.31  ?  781  ILE A CB    1 
ATOM   2331  C  CG1   . ILE A 1 909  ? 181.494 160.343 142.822 1.00 54.25  ?  781  ILE A CG1   1 
ATOM   2332  C  CG2   . ILE A 1 909  ? 179.942 160.946 144.714 1.00 49.10  ?  781  ILE A CG2   1 
ATOM   2333  C  CD1   . ILE A 1 909  ? 181.612 161.827 142.539 1.00 58.57  ?  781  ILE A CD1   1 
ATOM   2334  N  N     . TRP A 1 910  ? 178.311 157.761 145.220 1.00 37.40  ?  782  TRP A N     1 
ATOM   2335  C  CA    . TRP A 1 910  ? 177.496 157.386 146.375 1.00 34.59  ?  782  TRP A CA    1 
ATOM   2336  C  C     . TRP A 1 910  ? 178.034 156.125 147.038 1.00 35.66  ?  782  TRP A C     1 
ATOM   2337  O  O     . TRP A 1 910  ? 178.248 156.092 148.257 1.00 40.12  ?  782  TRP A O     1 
ATOM   2338  C  CB    . TRP A 1 910  ? 176.035 157.180 145.963 1.00 34.12  ?  782  TRP A CB    1 
ATOM   2339  C  CG    . TRP A 1 910  ? 175.261 156.241 146.879 1.00 28.37  ?  782  TRP A CG    1 
ATOM   2340  C  CD1   . TRP A 1 910  ? 175.223 154.873 146.819 1.00 23.57  ?  782  TRP A CD1   1 
ATOM   2341  C  CD2   . TRP A 1 910  ? 174.421 156.612 147.979 1.00 23.15  ?  782  TRP A CD2   1 
ATOM   2342  N  NE1   . TRP A 1 910  ? 174.418 154.376 147.814 1.00 23.90  ?  782  TRP A NE1   1 
ATOM   2343  C  CE2   . TRP A 1 910  ? 173.912 155.422 148.539 1.00 18.02  ?  782  TRP A CE2   1 
ATOM   2344  C  CE3   . TRP A 1 910  ? 174.050 157.835 148.545 1.00 23.08  ?  782  TRP A CE3   1 
ATOM   2345  C  CZ2   . TRP A 1 910  ? 173.054 155.420 149.633 1.00 20.13  ?  782  TRP A CZ2   1 
ATOM   2346  C  CZ3   . TRP A 1 910  ? 173.198 157.829 149.631 1.00 25.48  ?  782  TRP A CZ3   1 
ATOM   2347  C  CH2   . TRP A 1 910  ? 172.710 156.631 150.164 1.00 19.82  ?  782  TRP A CH2   1 
ATOM   2348  N  N     . ARG A 1 911  ? 178.246 155.070 146.244 1.00 38.28  ?  783  ARG A N     1 
ATOM   2349  C  CA    . ARG A 1 911  ? 178.617 153.771 146.798 1.00 36.24  ?  783  ARG A CA    1 
ATOM   2350  C  C     . ARG A 1 911  ? 179.938 153.848 147.549 1.00 42.80  ?  783  ARG A C     1 
ATOM   2351  O  O     . ARG A 1 911  ? 180.038 153.406 148.700 1.00 43.33  ?  783  ARG A O     1 
ATOM   2352  C  CB    . ARG A 1 911  ? 178.701 152.725 145.685 1.00 40.90  ?  783  ARG A CB    1 
ATOM   2353  C  CG    . ARG A 1 911  ? 179.063 151.329 146.179 1.00 37.52  ?  783  ARG A CG    1 
ATOM   2354  C  CD    . ARG A 1 911  ? 179.336 150.378 145.024 1.00 35.69  ?  783  ARG A CD    1 
ATOM   2355  N  NE    . ARG A 1 911  ? 180.710 150.509 144.550 1.00 41.23  ?  783  ARG A NE    1 
ATOM   2356  C  CZ    . ARG A 1 911  ? 181.739 149.839 145.059 1.00 44.49  ?  783  ARG A CZ    1 
ATOM   2357  N  NH1   . ARG A 1 911  ? 181.547 148.986 146.056 1.00 39.35  ?  783  ARG A NH1   1 
ATOM   2358  N  NH2   . ARG A 1 911  ? 182.958 150.023 144.573 1.00 53.32  ?  783  ARG A NH2   1 
ATOM   2359  N  N     . LYS A 1 912  ? 180.972 154.403 146.911 1.00 47.42  ?  784  LYS A N     1 
ATOM   2360  C  CA    . LYS A 1 912  ? 182.259 154.476 147.592 1.00 51.49  ?  784  LYS A CA    1 
ATOM   2361  C  C     . LYS A 1 912  ? 182.258 155.527 148.698 1.00 54.17  ?  784  LYS A C     1 
ATOM   2362  O  O     . LYS A 1 912  ? 183.030 155.405 149.658 1.00 53.92  ?  784  LYS A O     1 
ATOM   2363  C  CB    . LYS A 1 912  ? 183.375 154.757 146.590 1.00 54.10  ?  784  LYS A CB    1 
ATOM   2364  C  CG    . LYS A 1 912  ? 184.744 154.284 147.045 1.00 54.09  ?  784  LYS A CG    1 
ATOM   2365  C  CD    . LYS A 1 912  ? 185.397 153.437 145.973 1.00 61.62  ?  784  LYS A CD    1 
ATOM   2366  C  CE    . LYS A 1 912  ? 185.419 154.175 144.646 1.00 62.76  ?  784  LYS A CE    1 
ATOM   2367  N  NZ    . LYS A 1 912  ? 185.908 153.314 143.537 1.00 64.53  ?  784  LYS A NZ    1 
ATOM   2368  N  N     . ASN A 1 913  ? 181.398 156.540 148.591 1.00 52.30  ?  785  ASN A N     1 
ATOM   2369  C  CA    . ASN A 1 913  ? 181.361 157.663 149.522 1.00 48.16  ?  785  ASN A CA    1 
ATOM   2370  C  C     . ASN A 1 913  ? 182.774 158.191 149.784 1.00 53.49  ?  785  ASN A C     1 
ATOM   2371  O  O     . ASN A 1 913  ? 183.256 158.156 150.920 1.00 56.80  ?  785  ASN A O     1 
ATOM   2372  C  CB    . ASN A 1 913  ? 180.681 157.273 150.828 1.00 42.49  ?  785  ASN A CB    1 
ATOM   2373  C  CG    . ASN A 1 913  ? 180.272 158.481 151.665 1.00 47.87  ?  785  ASN A CG    1 
ATOM   2374  O  OD1   . ASN A 1 913  ? 180.935 159.518 151.656 1.00 53.26  ?  785  ASN A OD1   1 
ATOM   2375  N  ND2   . ASN A 1 913  ? 179.178 158.341 152.402 1.00 46.74  ?  785  ASN A ND2   1 
ATOM   2376  N  N     . PRO A 1 914  ? 183.466 158.682 148.755 1.00 60.21  ?  786  PRO A N     1 
ATOM   2377  C  CA    . PRO A 1 914  ? 184.889 158.995 148.904 1.00 70.24  ?  786  PRO A CA    1 
ATOM   2378  C  C     . PRO A 1 914  ? 185.165 160.257 149.704 1.00 77.04  ?  786  PRO A C     1 
ATOM   2379  O  O     . PRO A 1 914  ? 186.307 160.725 149.718 1.00 82.09  ?  786  PRO A O     1 
ATOM   2380  C  CB    . PRO A 1 914  ? 185.351 159.148 147.446 1.00 71.71  ?  786  PRO A CB    1 
ATOM   2381  C  CG    . PRO A 1 914  ? 184.157 159.663 146.739 1.00 66.17  ?  786  PRO A CG    1 
ATOM   2382  C  CD    . PRO A 1 914  ? 182.949 159.079 147.431 1.00 59.65  ?  786  PRO A CD    1 
ATOM   2383  N  N     . PHE A 1 915  ? 184.148 160.802 150.371 1.00 69.11  ?  787  PHE A N     1 
ATOM   2384  C  CA    . PHE A 1 915  ? 184.313 161.991 151.189 1.00 73.44  ?  787  PHE A CA    1 
ATOM   2385  C  C     . PHE A 1 915  ? 183.738 161.818 152.590 1.00 70.59  ?  787  PHE A C     1 
ATOM   2386  O  O     . PHE A 1 915  ? 183.640 162.805 153.328 1.00 71.97  ?  787  PHE A O     1 
ATOM   2387  C  CB    . PHE A 1 915  ? 183.685 163.202 150.492 1.00 79.55  ?  787  PHE A CB    1 
ATOM   2388  C  CG    . PHE A 1 915  ? 184.358 163.565 149.195 1.00 80.97  ?  787  PHE A CG    1 
ATOM   2389  C  CD1   . PHE A 1 915  ? 184.076 162.871 148.029 1.00 77.24  ?  787  PHE A CD1   1 
ATOM   2390  C  CD2   . PHE A 1 915  ? 185.287 164.592 149.147 1.00 81.79  ?  787  PHE A CD2   1 
ATOM   2391  C  CE1   . PHE A 1 915  ? 184.699 163.199 146.840 1.00 75.80  ?  787  PHE A CE1   1 
ATOM   2392  C  CE2   . PHE A 1 915  ? 185.913 164.925 147.959 1.00 76.76  ?  787  PHE A CE2   1 
ATOM   2393  C  CZ    . PHE A 1 915  ? 185.619 164.226 146.805 1.00 76.79  ?  787  PHE A CZ    1 
ATOM   2394  N  N     . SER A 1 916  ? 183.355 160.593 152.968 1.00 69.32  ?  788  SER A N     1 
ATOM   2395  C  CA    . SER A 1 916  ? 182.970 160.245 154.343 1.00 70.17  ?  788  SER A CA    1 
ATOM   2396  C  C     . SER A 1 916  ? 181.856 161.141 154.881 1.00 64.13  ?  788  SER A C     1 
ATOM   2397  O  O     . SER A 1 916  ? 181.734 161.343 156.092 1.00 63.59  ?  788  SER A O     1 
ATOM   2398  C  CB    . SER A 1 916  ? 184.173 160.284 155.287 1.00 70.85  ?  788  SER A CB    1 
ATOM   2399  O  OG    . SER A 1 916  ? 184.684 161.600 155.409 1.00 77.25  ?  788  SER A OG    1 
ATOM   2400  N  N     . GLU A 1 917  ? 181.035 161.676 153.986 1.00 59.55  ?  789  GLU A N     1 
ATOM   2401  C  CA    . GLU A 1 917  ? 179.924 162.522 154.384 1.00 56.41  ?  789  GLU A CA    1 
ATOM   2402  C  C     . GLU A 1 917  ? 178.802 161.682 154.996 1.00 52.94  ?  789  GLU A C     1 
ATOM   2403  O  O     . GLU A 1 917  ? 178.766 160.455 154.865 1.00 54.40  ?  789  GLU A O     1 
ATOM   2404  C  CB    . GLU A 1 917  ? 179.432 163.320 153.179 1.00 73.46  ?  789  GLU A CB    1 
ATOM   2405  C  CG    . GLU A 1 917  ? 180.574 164.017 152.439 1.00 88.76  ?  789  GLU A CG    1 
ATOM   2406  C  CD    . GLU A 1 917  ? 180.184 164.522 151.066 1.00 108.17 ?  789  GLU A CD    1 
ATOM   2407  O  OE1   . GLU A 1 917  ? 178.971 164.639 150.798 1.00 98.87  ?  789  GLU A OE1   1 
ATOM   2408  O  OE2   . GLU A 1 917  ? 181.094 164.850 150.274 1.00 145.82 -1 789  GLU A OE2   1 
ATOM   2409  N  N     . SER A 1 918  ? 177.886 162.359 155.688 1.00 58.35  ?  790  SER A N     1 
ATOM   2410  C  CA    . SER A 1 918  ? 176.790 161.667 156.352 1.00 55.12  ?  790  SER A CA    1 
ATOM   2411  C  C     . SER A 1 918  ? 175.813 161.109 155.318 1.00 49.44  ?  790  SER A C     1 
ATOM   2412  O  O     . SER A 1 918  ? 175.981 161.271 154.105 1.00 51.48  ?  790  SER A O     1 
ATOM   2413  C  CB    . SER A 1 918  ? 176.071 162.605 157.320 1.00 60.08  ?  790  SER A CB    1 
ATOM   2414  O  OG    . SER A 1 918  ? 175.018 163.302 156.675 1.00 59.97  ?  790  SER A OG    1 
ATOM   2415  N  N     . ALA A 1 919  ? 174.771 160.439 155.817 1.00 47.20  ?  791  ALA A N     1 
ATOM   2416  C  CA    . ALA A 1 919  ? 173.759 159.866 154.936 1.00 50.40  ?  791  ALA A CA    1 
ATOM   2417  C  C     . ALA A 1 919  ? 173.067 160.951 154.121 1.00 54.23  ?  791  ALA A C     1 
ATOM   2418  O  O     . ALA A 1 919  ? 173.180 160.993 152.889 1.00 57.76  ?  791  ALA A O     1 
ATOM   2419  C  CB    . ALA A 1 919  ? 172.738 159.076 155.755 1.00 45.96  ?  791  ALA A CB    1 
ATOM   2420  N  N     . ASP A 1 920  ? 172.346 161.847 154.800 1.00 58.22  ?  792  ASP A N     1 
ATOM   2421  C  CA    . ASP A 1 920  ? 171.644 162.909 154.090 1.00 63.06  ?  792  ASP A CA    1 
ATOM   2422  C  C     . ASP A 1 920  ? 172.617 163.842 153.391 1.00 63.05  ?  792  ASP A C     1 
ATOM   2423  O  O     . ASP A 1 920  ? 172.299 164.395 152.331 1.00 66.05  ?  792  ASP A O     1 
ATOM   2424  C  CB    . ASP A 1 920  ? 170.753 163.690 155.055 1.00 78.50  ?  792  ASP A CB    1 
ATOM   2425  C  CG    . ASP A 1 920  ? 169.546 162.891 155.502 1.00 103.89 ?  792  ASP A CG    1 
ATOM   2426  O  OD1   . ASP A 1 920  ? 169.462 161.700 155.136 1.00 90.53  ?  792  ASP A OD1   1 
ATOM   2427  O  OD2   . ASP A 1 920  ? 168.679 163.449 156.207 1.00 175.75 -1 792  ASP A OD2   1 
ATOM   2428  N  N     . GLU A 1 921  ? 173.819 164.002 153.942 1.00 61.54  ?  793  GLU A N     1 
ATOM   2429  C  CA    . GLU A 1 921  ? 174.766 164.925 153.332 1.00 69.04  ?  793  GLU A CA    1 
ATOM   2430  C  C     . GLU A 1 921  ? 175.227 164.404 151.972 1.00 70.28  ?  793  GLU A C     1 
ATOM   2431  O  O     . GLU A 1 921  ? 175.260 165.159 150.994 1.00 74.32  ?  793  GLU A O     1 
ATOM   2432  C  CB    . GLU A 1 921  ? 175.933 165.172 154.295 1.00 74.29  ?  793  GLU A CB    1 
ATOM   2433  C  CG    . GLU A 1 921  ? 176.526 166.570 154.187 1.00 89.08  ?  793  GLU A CG    1 
ATOM   2434  C  CD    . GLU A 1 921  ? 177.395 166.746 152.964 1.00 109.64 ?  793  GLU A CD    1 
ATOM   2435  O  OE1   . GLU A 1 921  ? 178.574 166.345 153.011 1.00 104.89 ?  793  GLU A OE1   1 
ATOM   2436  O  OE2   . GLU A 1 921  ? 176.885 167.234 151.935 1.00 159.26 -1 793  GLU A OE2   1 
ATOM   2437  N  N     . LEU A 1 922  ? 175.517 163.102 151.870 1.00 66.76  ?  794  LEU A N     1 
ATOM   2438  C  CA    . LEU A 1 922  ? 175.855 162.529 150.568 1.00 61.79  ?  794  LEU A CA    1 
ATOM   2439  C  C     . LEU A 1 922  ? 174.637 162.466 149.654 1.00 57.05  ?  794  LEU A C     1 
ATOM   2440  O  O     . LEU A 1 922  ? 174.737 162.767 148.457 1.00 56.58  ?  794  LEU A O     1 
ATOM   2441  C  CB    . LEU A 1 922  ? 176.460 161.136 150.739 1.00 62.01  ?  794  LEU A CB    1 
ATOM   2442  C  CG    . LEU A 1 922  ? 176.835 160.444 149.423 1.00 57.70  ?  794  LEU A CG    1 
ATOM   2443  C  CD1   . LEU A 1 922  ? 177.722 161.344 148.575 1.00 64.52  ?  794  LEU A CD1   1 
ATOM   2444  C  CD2   . LEU A 1 922  ? 177.510 159.107 149.672 1.00 49.04  ?  794  LEU A CD2   1 
ATOM   2445  N  N     . ARG A 1 923  ? 173.485 162.060 150.198 1.00 56.30  ?  795  ARG A N     1 
ATOM   2446  C  CA    . ARG A 1 923  ? 172.241 162.064 149.433 1.00 54.96  ?  795  ARG A CA    1 
ATOM   2447  C  C     . ARG A 1 923  ? 172.009 163.408 148.755 1.00 56.81  ?  795  ARG A C     1 
ATOM   2448  O  O     . ARG A 1 923  ? 171.472 163.470 147.642 1.00 55.19  ?  795  ARG A O     1 
ATOM   2449  C  CB    . ARG A 1 923  ? 171.073 161.726 150.357 1.00 54.32  ?  795  ARG A CB    1 
ATOM   2450  C  CG    . ARG A 1 923  ? 169.725 161.665 149.683 1.00 43.16  ?  795  ARG A CG    1 
ATOM   2451  C  CD    . ARG A 1 923  ? 168.729 161.005 150.607 1.00 44.30  ?  795  ARG A CD    1 
ATOM   2452  N  NE    . ARG A 1 923  ? 167.449 160.787 149.950 1.00 50.69  ?  795  ARG A NE    1 
ATOM   2453  C  CZ    . ARG A 1 923  ? 166.455 161.665 149.970 1.00 59.43  ?  795  ARG A CZ    1 
ATOM   2454  N  NH1   . ARG A 1 923  ? 165.315 161.393 149.352 1.00 66.30  ?  795  ARG A NH1   1 
ATOM   2455  N  NH2   . ARG A 1 923  ? 166.603 162.818 150.609 1.00 55.91  ?  795  ARG A NH2   1 
ATOM   2456  N  N     . ASP A 1 924  ? 172.404 164.496 149.417 1.00 66.33  ?  796  ASP A N     1 
ATOM   2457  C  CA    . ASP A 1 924  ? 172.320 165.810 148.792 1.00 78.42  ?  796  ASP A CA    1 
ATOM   2458  C  C     . ASP A 1 924  ? 173.471 166.043 147.818 1.00 71.25  ?  796  ASP A C     1 
ATOM   2459  O  O     . ASP A 1 924  ? 173.270 166.634 146.750 1.00 74.09  ?  796  ASP A O     1 
ATOM   2460  C  CB    . ASP A 1 924  ? 172.300 166.903 149.861 1.00 94.54  ?  796  ASP A CB    1 
ATOM   2461  C  CG    . ASP A 1 924  ? 172.423 168.298 149.272 1.00 123.79 ?  796  ASP A CG    1 
ATOM   2462  O  OD1   . ASP A 1 924  ? 171.438 168.784 148.677 1.00 117.32 ?  796  ASP A OD1   1 
ATOM   2463  O  OD2   . ASP A 1 924  ? 173.505 168.908 149.401 1.00 185.82 -1 796  ASP A OD2   1 
ATOM   2464  N  N     . ARG A 1 925  ? 174.678 165.588 148.165 1.00 62.20  ?  797  ARG A N     1 
ATOM   2465  C  CA    . ARG A 1 925  ? 175.828 165.840 147.302 1.00 54.33  ?  797  ARG A CA    1 
ATOM   2466  C  C     . ARG A 1 925  ? 175.690 165.147 145.954 1.00 48.10  ?  797  ARG A C     1 
ATOM   2467  O  O     . ARG A 1 925  ? 176.184 165.651 144.938 1.00 48.14  ?  797  ARG A O     1 
ATOM   2468  C  CB    . ARG A 1 925  ? 177.114 165.386 147.984 1.00 52.36  ?  797  ARG A CB    1 
ATOM   2469  C  CG    . ARG A 1 925  ? 178.308 165.437 147.061 1.00 51.31  ?  797  ARG A CG    1 
ATOM   2470  C  CD    . ARG A 1 925  ? 179.554 164.977 147.746 1.00 65.64  ?  797  ARG A CD    1 
ATOM   2471  N  NE    . ARG A 1 925  ? 180.741 165.435 147.039 1.00 72.49  ?  797  ARG A NE    1 
ATOM   2472  C  CZ    . ARG A 1 925  ? 181.943 165.517 147.592 1.00 83.04  ?  797  ARG A CZ    1 
ATOM   2473  N  NH1   . ARG A 1 925  ? 182.109 165.177 148.862 1.00 93.34  ?  797  ARG A NH1   1 
ATOM   2474  N  NH2   . ARG A 1 925  ? 182.974 165.947 146.881 1.00 81.22  ?  797  ARG A NH2   1 
ATOM   2475  N  N     . VAL A 1 926  ? 175.016 163.996 145.921 1.00 54.77  ?  798  VAL A N     1 
ATOM   2476  C  CA    . VAL A 1 926  ? 174.924 163.190 144.713 1.00 55.73  ?  798  VAL A CA    1 
ATOM   2477  C  C     . VAL A 1 926  ? 173.611 163.394 143.974 1.00 52.34  ?  798  VAL A C     1 
ATOM   2478  O  O     . VAL A 1 926  ? 173.426 162.830 142.885 1.00 46.28  ?  798  VAL A O     1 
ATOM   2479  C  CB    . VAL A 1 926  ? 175.127 161.701 145.054 1.00 58.78  ?  798  VAL A CB    1 
ATOM   2480  C  CG1   . VAL A 1 926  ? 173.812 161.066 145.488 1.00 56.51  ?  798  VAL A CG1   1 
ATOM   2481  C  CG2   . VAL A 1 926  ? 175.729 160.975 143.881 1.00 56.04  ?  798  VAL A CG2   1 
ATOM   2482  N  N     . LYS A 1 927  ? 172.698 164.189 144.529 1.00 52.84  ?  799  LYS A N     1 
ATOM   2483  C  CA    . LYS A 1 927  ? 171.391 164.443 143.929 1.00 47.37  ?  799  LYS A CA    1 
ATOM   2484  C  C     . LYS A 1 927  ? 170.583 163.150 143.793 1.00 38.79  ?  799  LYS A C     1 
ATOM   2485  O  O     . LYS A 1 927  ? 170.209 162.730 142.696 1.00 38.25  ?  799  LYS A O     1 
ATOM   2486  C  CB    . LYS A 1 927  ? 171.529 165.149 142.573 1.00 52.84  ?  799  LYS A CB    1 
ATOM   2487  C  CG    . LYS A 1 927  ? 171.773 166.648 142.657 1.00 68.51  ?  799  LYS A CG    1 
ATOM   2488  C  CD    . LYS A 1 927  ? 173.196 166.979 143.099 1.00 71.10  ?  799  LYS A CD    1 
ATOM   2489  C  CE    . LYS A 1 927  ? 173.435 168.485 143.158 1.00 66.91  ?  799  LYS A CE    1 
ATOM   2490  N  NZ    . LYS A 1 927  ? 172.549 169.165 144.144 1.00 58.73  ?  799  LYS A NZ    1 
ATOM   2491  N  N     . GLY A 1 928  ? 170.332 162.512 144.937 1.00 42.64  ?  800  GLY A N     1 
ATOM   2492  C  CA    . GLY A 1 928  ? 169.413 161.392 145.016 1.00 45.59  ?  800  GLY A CA    1 
ATOM   2493  C  C     . GLY A 1 928  ? 169.836 160.123 144.308 1.00 39.25  ?  800  GLY A C     1 
ATOM   2494  O  O     . GLY A 1 928  ? 169.106 159.127 144.377 1.00 37.77  ?  800  GLY A O     1 
ATOM   2495  N  N     . VAL A 1 929  ? 170.977 160.117 143.624 1.00 34.13  ?  801  VAL A N     1 
ATOM   2496  C  CA    . VAL A 1 929  ? 171.433 158.901 142.964 1.00 26.67  ?  801  VAL A CA    1 
ATOM   2497  C  C     . VAL A 1 929  ? 171.731 157.853 144.026 1.00 21.00  ?  801  VAL A C     1 
ATOM   2498  O  O     . VAL A 1 929  ? 172.588 158.056 144.895 1.00 27.40  ?  801  VAL A O     1 
ATOM   2499  C  CB    . VAL A 1 929  ? 172.660 159.187 142.098 1.00 37.34  ?  801  VAL A CB    1 
ATOM   2500  C  CG1   . VAL A 1 929  ? 173.060 157.941 141.344 1.00 31.49  ?  801  VAL A CG1   1 
ATOM   2501  C  CG2   . VAL A 1 929  ? 172.378 160.339 141.144 1.00 42.96  ?  801  VAL A CG2   1 
ATOM   2502  N  N     . SER A 1 930  ? 171.015 156.729 143.970 1.00 19.36  ?  802  SER A N     1 
ATOM   2503  C  CA    . SER A 1 930  ? 171.170 155.685 144.982 1.00 24.54  ?  802  SER A CA    1 
ATOM   2504  C  C     . SER A 1 930  ? 171.262 154.272 144.432 1.00 19.15  ?  802  SER A C     1 
ATOM   2505  O  O     . SER A 1 930  ? 171.670 153.375 145.177 1.00 18.40  ?  802  SER A O     1 
ATOM   2506  C  CB    . SER A 1 930  ? 170.013 155.740 145.987 1.00 24.21  ?  802  SER A CB    1 
ATOM   2507  O  OG    . SER A 1 930  ? 170.087 154.666 146.910 1.00 15.64  ?  802  SER A OG    1 
ATOM   2508  N  N     . ALA A 1 931  ? 170.903 154.026 143.178 1.00 18.65  ?  803  ALA A N     1 
ATOM   2509  C  CA    . ALA A 1 931  ? 170.897 152.682 142.624 1.00 11.20  ?  803  ALA A CA    1 
ATOM   2510  C  C     . ALA A 1 931  ? 171.542 152.706 141.250 1.00 10.81  ?  803  ALA A C     1 
ATOM   2511  O  O     . ALA A 1 931  ? 171.302 153.623 140.460 1.00 15.07  ?  803  ALA A O     1 
ATOM   2512  C  CB    . ALA A 1 931  ? 169.478 152.130 142.526 1.00 8.97   ?  803  ALA A CB    1 
ATOM   2513  N  N     . LYS A 1 932  ? 172.355 151.696 140.972 1.00 8.72   ?  804  LYS A N     1 
ATOM   2514  C  CA    . LYS A 1 932  ? 173.100 151.643 139.724 1.00 11.27  ?  804  LYS A CA    1 
ATOM   2515  C  C     . LYS A 1 932  ? 172.145 151.580 138.539 1.00 10.94  ?  804  LYS A C     1 
ATOM   2516  O  O     . LYS A 1 932  ? 171.481 150.556 138.330 1.00 12.07  ?  804  LYS A O     1 
ATOM   2517  C  CB    . LYS A 1 932  ? 174.040 150.438 139.723 1.00 13.33  ?  804  LYS A CB    1 
ATOM   2518  C  CG    . LYS A 1 932  ? 174.700 150.153 138.388 1.00 16.39  ?  804  LYS A CG    1 
ATOM   2519  C  CD    . LYS A 1 932  ? 175.539 148.893 138.471 1.00 19.90  ?  804  LYS A CD    1 
ATOM   2520  C  CE    . LYS A 1 932  ? 176.380 148.704 137.223 1.00 24.67  ?  804  LYS A CE    1 
ATOM   2521  N  NZ    . LYS A 1 932  ? 177.375 147.613 137.408 1.00 38.52  ?  804  LYS A NZ    1 
ATOM   2522  N  N     . PRO A 1 933  ? 172.042 152.644 137.746 1.00 12.10  ?  805  PRO A N     1 
ATOM   2523  C  CA    . PRO A 1 933  ? 171.191 152.579 136.558 1.00 12.20  ?  805  PRO A CA    1 
ATOM   2524  C  C     . PRO A 1 933  ? 171.769 151.581 135.577 1.00 10.51  ?  805  PRO A C     1 
ATOM   2525  O  O     . PRO A 1 933  ? 172.976 151.330 135.554 1.00 9.65   ?  805  PRO A O     1 
ATOM   2526  C  CB    . PRO A 1 933  ? 171.246 154.001 135.994 1.00 20.17  ?  805  PRO A CB    1 
ATOM   2527  C  CG    . PRO A 1 933  ? 172.527 154.555 136.488 1.00 19.21  ?  805  PRO A CG    1 
ATOM   2528  C  CD    . PRO A 1 933  ? 172.881 153.856 137.769 1.00 15.98  ?  805  PRO A CD    1 
ATOM   2529  N  N     . PHE A 1 934  ? 170.896 150.995 134.766 1.00 12.35  ?  806  PHE A N     1 
ATOM   2530  C  CA    . PHE A 1 934  ? 171.368 149.996 133.823 1.00 15.94  ?  806  PHE A CA    1 
ATOM   2531  C  C     . PHE A 1 934  ? 170.759 150.084 132.431 1.00 18.52  ?  806  PHE A C     1 
ATOM   2532  O  O     . PHE A 1 934  ? 171.159 149.301 131.563 1.00 20.95  ?  806  PHE A O     1 
ATOM   2533  C  CB    . PHE A 1 934  ? 171.137 148.588 134.390 1.00 15.72  ?  806  PHE A CB    1 
ATOM   2534  C  CG    . PHE A 1 934  ? 169.751 148.076 134.179 1.00 12.74  ?  806  PHE A CG    1 
ATOM   2535  C  CD1   . PHE A 1 934  ? 168.701 148.554 134.940 1.00 11.74  ?  806  PHE A CD1   1 
ATOM   2536  C  CD2   . PHE A 1 934  ? 169.497 147.114 133.219 1.00 12.86  ?  806  PHE A CD2   1 
ATOM   2537  C  CE1   . PHE A 1 934  ? 167.430 148.078 134.749 1.00 13.20  ?  806  PHE A CE1   1 
ATOM   2538  C  CE2   . PHE A 1 934  ? 168.223 146.639 133.022 1.00 12.01  ?  806  PHE A CE2   1 
ATOM   2539  C  CZ    . PHE A 1 934  ? 167.187 147.122 133.786 1.00 12.45  ?  806  PHE A CZ    1 
ATOM   2540  N  N     . MET A 1 935  ? 169.823 150.996 132.176 1.00 19.63  ?  807  MET A N     1 
ATOM   2541  C  CA    . MET A 1 935  ? 169.243 151.156 130.842 1.00 20.12  ?  807  MET A CA    1 
ATOM   2542  C  C     . MET A 1 935  ? 169.275 152.633 130.465 1.00 23.56  ?  807  MET A C     1 
ATOM   2543  O  O     . MET A 1 935  ? 168.431 153.413 130.920 1.00 26.18  ?  807  MET A O     1 
ATOM   2544  C  CB    . MET A 1 935  ? 167.822 150.602 130.773 1.00 18.66  ?  807  MET A CB    1 
ATOM   2545  C  CG    . MET A 1 935  ? 167.159 150.817 129.416 1.00 19.72  ?  807  MET A CG    1 
ATOM   2546  S  SD    . MET A 1 935  ? 165.841 149.646 129.038 1.00 12.92  ?  807  MET A SD    1 
ATOM   2547  C  CE    . MET A 1 935  ? 164.732 149.923 130.409 1.00 12.85  ?  807  MET A CE    1 
ATOM   2548  N  N     . GLU A 1 936  ? 170.250 153.002 129.636 1.00 25.48  ?  808  GLU A N     1 
ATOM   2549  C  CA    . GLU A 1 936  ? 170.338 154.354 129.104 1.00 25.30  ?  808  GLU A CA    1 
ATOM   2550  C  C     . GLU A 1 936  ? 168.993 154.799 128.556 1.00 18.97  ?  808  GLU A C     1 
ATOM   2551  O  O     . GLU A 1 936  ? 168.448 154.182 127.635 1.00 19.65  ?  808  GLU A O     1 
ATOM   2552  C  CB    . GLU A 1 936  ? 171.403 154.407 128.009 1.00 35.23  ?  808  GLU A CB    1 
ATOM   2553  C  CG    . GLU A 1 936  ? 171.219 155.547 127.024 1.00 48.09  ?  808  GLU A CG    1 
ATOM   2554  C  CD    . GLU A 1 936  ? 172.219 155.501 125.887 1.00 78.54  ?  808  GLU A CD    1 
ATOM   2555  O  OE1   . GLU A 1 936  ? 172.972 154.508 125.791 1.00 59.38  ?  808  GLU A OE1   1 
ATOM   2556  O  OE2   . GLU A 1 936  ? 172.245 156.456 125.081 1.00 163.89 -1 808  GLU A OE2   1 
ATOM   2557  N  N     . THR A 1 937  ? 168.447 155.857 129.142 1.00 16.05  ?  809  THR A N     1 
ATOM   2558  C  CA    . THR A 1 937  ? 167.155 156.383 128.737 1.00 15.19  ?  809  THR A CA    1 
ATOM   2559  C  C     . THR A 1 937  ? 167.290 157.862 128.431 1.00 18.79  ?  809  THR A C     1 
ATOM   2560  O  O     . THR A 1 937  ? 167.863 158.615 129.226 1.00 20.26  ?  809  THR A O     1 
ATOM   2561  C  CB    . THR A 1 937  ? 166.092 156.163 129.821 1.00 15.20  ?  809  THR A CB    1 
ATOM   2562  O  OG1   . THR A 1 937  ? 164.945 156.973 129.534 1.00 16.11  ?  809  THR A OG1   1 
ATOM   2563  C  CG2   . THR A 1 937  ? 166.637 156.515 131.198 1.00 16.72  ?  809  THR A CG2   1 
ATOM   2564  N  N     . GLN A 1 938  ? 166.782 158.271 127.278 1.00 22.65  ?  810  GLN A N     1 
ATOM   2565  C  CA    . GLN A 1 938  ? 166.694 159.690 127.004 1.00 25.66  ?  810  GLN A CA    1 
ATOM   2566  C  C     . GLN A 1 938  ? 165.725 160.307 127.998 1.00 26.70  ?  810  GLN A C     1 
ATOM   2567  O  O     . GLN A 1 938  ? 164.574 159.854 128.100 1.00 20.39  ?  810  GLN A O     1 
ATOM   2568  C  CB    . GLN A 1 938  ? 166.236 159.978 125.582 1.00 28.88  ?  810  GLN A CB    1 
ATOM   2569  C  CG    . GLN A 1 938  ? 165.926 161.450 125.359 1.00 32.68  ?  810  GLN A CG    1 
ATOM   2570  C  CD    . GLN A 1 938  ? 165.969 161.841 123.901 1.00 37.35  ?  810  GLN A CD    1 
ATOM   2571  O  OE1   . GLN A 1 938  ? 166.482 161.099 123.064 1.00 35.43  ?  810  GLN A OE1   1 
ATOM   2572  N  NE2   . GLN A 1 938  ? 165.440 163.018 123.588 1.00 43.50  ?  810  GLN A NE2   1 
ATOM   2573  N  N     . PRO A 1 939  ? 166.139 161.291 128.749 1.00 45.21  ?  811  PRO A N     1 
ATOM   2574  C  CA    . PRO A 1 939  ? 165.237 161.913 129.717 1.00 47.42  ?  811  PRO A CA    1 
ATOM   2575  C  C     . PRO A 1 939  ? 164.318 162.904 129.025 1.00 45.48  ?  811  PRO A C     1 
ATOM   2576  O  O     . PRO A 1 939  ? 164.651 164.083 128.886 1.00 47.74  ?  811  PRO A O     1 
ATOM   2577  C  CB    . PRO A 1 939  ? 166.200 162.587 130.697 1.00 60.86  ?  811  PRO A CB    1 
ATOM   2578  C  CG    . PRO A 1 939  ? 167.396 162.924 129.854 1.00 65.46  ?  811  PRO A CG    1 
ATOM   2579  C  CD    . PRO A 1 939  ? 167.499 161.857 128.797 1.00 53.49  ?  811  PRO A CD    1 
ATOM   2580  N  N     . THR A 1 940  ? 163.189 162.429 128.522 1.00 34.22  ?  812  THR A N     1 
ATOM   2581  C  CA    . THR A 1 940  ? 162.293 163.268 127.747 1.00 30.08  ?  812  THR A CA    1 
ATOM   2582  C  C     . THR A 1 940  ? 160.951 163.404 128.450 1.00 26.07  ?  812  THR A C     1 
ATOM   2583  O  O     . THR A 1 940  ? 160.448 162.447 129.050 1.00 25.80  ?  812  THR A O     1 
ATOM   2584  C  CB    . THR A 1 940  ? 162.094 162.700 126.351 1.00 29.35  ?  812  THR A CB    1 
ATOM   2585  O  OG1   . THR A 1 940  ? 160.979 163.347 125.725 1.00 29.87  ?  812  THR A OG1   1 
ATOM   2586  C  CG2   . THR A 1 940  ? 161.840 161.219 126.442 1.00 27.77  ?  812  THR A CG2   1 
ATOM   2587  N  N     . LEU A 1 941  ? 160.394 164.610 128.382 1.00 30.98  ?  813  LEU A N     1 
ATOM   2588  C  CA    . LEU A 1 941  ? 159.049 164.854 128.876 1.00 35.31  ?  813  LEU A CA    1 
ATOM   2589  C  C     . LEU A 1 941  ? 158.056 163.957 128.150 1.00 41.14  ?  813  LEU A C     1 
ATOM   2590  O  O     . LEU A 1 941  ? 158.215 163.644 126.967 1.00 42.74  ?  813  LEU A O     1 
ATOM   2591  C  CB    . LEU A 1 941  ? 158.680 166.326 128.674 1.00 36.29  ?  813  LEU A CB    1 
ATOM   2592  C  CG    . LEU A 1 941  ? 157.209 166.714 128.483 1.00 40.27  ?  813  LEU A CG    1 
ATOM   2593  C  CD1   . LEU A 1 941  ? 156.431 166.580 129.783 1.00 47.13  ?  813  LEU A CD1   1 
ATOM   2594  C  CD2   . LEU A 1 941  ? 157.085 168.122 127.920 1.00 37.90  ?  813  LEU A CD2   1 
ATOM   2595  N  N     . ASP A 1 942  ? 157.031 163.522 128.874 1.00 51.97  ?  814  ASP A N     1 
ATOM   2596  C  CA    . ASP A 1 942  ? 155.931 162.778 128.282 1.00 64.75  ?  814  ASP A CA    1 
ATOM   2597  C  C     . ASP A 1 942  ? 154.788 163.745 128.010 1.00 68.01  ?  814  ASP A C     1 
ATOM   2598  O  O     . ASP A 1 942  ? 154.214 164.314 128.945 1.00 70.43  ?  814  ASP A O     1 
ATOM   2599  C  CB    . ASP A 1 942  ? 155.466 161.647 129.193 1.00 87.63  ?  814  ASP A CB    1 
ATOM   2600  C  CG    . ASP A 1 942  ? 154.104 161.118 128.800 1.00 103.75 ?  814  ASP A CG    1 
ATOM   2601  O  OD1   . ASP A 1 942  ? 153.951 160.685 127.638 1.00 89.20  ?  814  ASP A OD1   1 
ATOM   2602  O  OD2   . ASP A 1 942  ? 153.183 161.153 129.642 1.00 145.79 -1 814  ASP A OD2   1 
ATOM   2603  N  N     . ALA A 1 943  ? 154.464 163.933 126.732 1.00 74.61  ?  815  ALA A N     1 
ATOM   2604  C  CA    . ALA A 1 943  ? 153.389 164.837 126.356 1.00 85.64  ?  815  ALA A CA    1 
ATOM   2605  C  C     . ALA A 1 943  ? 152.007 164.262 126.622 1.00 94.96  ?  815  ALA A C     1 
ATOM   2606  O  O     . ALA A 1 943  ? 151.022 165.003 126.528 1.00 93.44  ?  815  ALA A O     1 
ATOM   2607  C  CB    . ALA A 1 943  ? 153.504 165.207 124.877 1.00 87.13  ?  815  ALA A CB    1 
ATOM   2608  N  N     . LEU A 1 944  ? 151.905 162.973 126.945 1.00 98.67  ?  816  LEU A N     1 
ATOM   2609  C  CA    . LEU A 1 944  ? 150.599 162.341 127.082 1.00 104.44 ?  816  LEU A CA    1 
ATOM   2610  C  C     . LEU A 1 944  ? 149.782 163.004 128.181 1.00 104.13 ?  816  LEU A C     1 
ATOM   2611  O  O     . LEU A 1 944  ? 148.743 163.612 127.900 1.00 101.06 ?  816  LEU A O     1 
ATOM   2612  C  CB    . LEU A 1 944  ? 150.745 160.846 127.365 1.00 110.48 ?  816  LEU A CB    1 
ATOM   2613  C  CG    . LEU A 1 944  ? 149.400 160.137 127.539 1.00 109.63 ?  816  LEU A CG    1 
ATOM   2614  C  CD1   . LEU A 1 944  ? 148.535 160.347 126.304 1.00 102.66 ?  816  LEU A CD1   1 
ATOM   2615  C  CD2   . LEU A 1 944  ? 149.580 158.654 127.835 1.00 103.16 ?  816  LEU A CD2   1 
ATOM   2616  N  N     . HIS A 1 945  ? 150.235 162.910 129.431 1.00 106.78 ?  817  HIS A N     1 
ATOM   2617  C  CA    . HIS A 1 945  ? 149.510 163.608 130.490 1.00 104.06 ?  817  HIS A CA    1 
ATOM   2618  C  C     . HIS A 1 945  ? 149.861 165.091 130.460 1.00 96.62  ?  817  HIS A C     1 
ATOM   2619  O  O     . HIS A 1 945  ? 149.040 165.926 130.069 1.00 99.32  ?  817  HIS A O     1 
ATOM   2620  C  CB    . HIS A 1 945  ? 149.849 162.988 131.850 1.00 104.60 ?  817  HIS A CB    1 
ATOM   2621  C  CG    . HIS A 1 945  ? 150.249 161.547 131.774 1.00 118.43 ?  817  HIS A CG    1 
ATOM   2622  N  ND1   . HIS A 1 945  ? 151.551 161.126 131.940 1.00 118.12 ?  817  HIS A ND1   1 
ATOM   2623  C  CD2   . HIS A 1 945  ? 149.520 160.429 131.544 1.00 122.39 ?  817  HIS A CD2   1 
ATOM   2624  C  CE1   . HIS A 1 945  ? 151.606 159.811 131.818 1.00 118.16 ?  817  HIS A CE1   1 
ATOM   2625  N  NE2   . HIS A 1 945  ? 150.387 159.364 131.577 1.00 117.61 ?  817  HIS A NE2   1 
ATOM   2626  N  N     . CYS A 1 946  ? 151.084 165.430 130.877 1.00 95.99  ?  818  CYS A N     1 
ATOM   2627  C  CA    . CYS A 1 946  ? 151.759 166.699 130.609 1.00 98.02  ?  818  CYS A CA    1 
ATOM   2628  C  C     . CYS A 1 946  ? 150.934 167.925 130.994 1.00 97.81  ?  818  CYS A C     1 
ATOM   2629  O  O     . CYS A 1 946  ? 151.438 169.053 130.967 1.00 95.97  ?  818  CYS A O     1 
ATOM   2630  C  CB    . CYS A 1 946  ? 152.142 166.787 129.130 1.00 95.46  ?  818  CYS A CB    1 
ATOM   2631  S  SG    . CYS A 1 946  ? 150.931 167.633 128.092 1.00 105.51 ?  818  CYS A SG    1 
ATOM   2632  N  N     . ASP A 1 947  ? 149.676 167.708 131.372 1.00 95.84  ?  819  ASP A N     1 
ATOM   2633  C  CA    . ASP A 1 947  ? 148.746 168.784 131.692 1.00 96.44  ?  819  ASP A CA    1 
ATOM   2634  C  C     . ASP A 1 947  ? 147.862 168.496 132.888 1.00 87.62  ?  819  ASP A C     1 
ATOM   2635  O  O     . ASP A 1 947  ? 147.343 169.449 133.479 1.00 91.18  ?  819  ASP A O     1 
ATOM   2636  C  CB    . ASP A 1 947  ? 147.857 169.103 130.485 1.00 108.01 ?  819  ASP A CB    1 
ATOM   2637  C  CG    . ASP A 1 947  ? 148.580 169.913 129.431 1.00 120.95 ?  819  ASP A CG    1 
ATOM   2638  O  OD1   . ASP A 1 947  ? 149.263 170.888 129.806 1.00 112.23 ?  819  ASP A OD1   1 
ATOM   2639  O  OD2   . ASP A 1 947  ? 148.464 169.582 128.232 1.00 167.74 -1 819  ASP A OD2   1 
ATOM   2640  N  N     . ILE A 1 948  ? 147.648 167.228 133.252 1.00 83.31  ?  820  ILE A N     1 
ATOM   2641  C  CA    . ILE A 1 948  ? 146.851 166.903 134.432 1.00 83.90  ?  820  ILE A CA    1 
ATOM   2642  C  C     . ILE A 1 948  ? 147.377 167.664 135.638 1.00 91.13  ?  820  ILE A C     1 
ATOM   2643  O  O     . ILE A 1 948  ? 146.605 168.203 136.442 1.00 92.33  ?  820  ILE A O     1 
ATOM   2644  C  CB    . ILE A 1 948  ? 146.858 165.381 134.669 1.00 88.01  ?  820  ILE A CB    1 
ATOM   2645  C  CG1   . ILE A 1 948  ? 146.406 164.649 133.402 1.00 90.41  ?  820  ILE A CG1   1 
ATOM   2646  C  CG2   . ILE A 1 948  ? 145.987 165.021 135.862 1.00 88.90  ?  820  ILE A CG2   1 
ATOM   2647  C  CD1   . ILE A 1 948  ? 146.488 163.141 133.498 1.00 98.01  ?  820  ILE A CD1   1 
ATOM   2648  N  N     . GLY A 1 949  ? 148.703 167.749 135.761 1.00 95.93  ?  821  GLY A N     1 
ATOM   2649  C  CA    . GLY A 1 949  ? 149.288 168.604 136.779 1.00 96.88  ?  821  GLY A CA    1 
ATOM   2650  C  C     . GLY A 1 949  ? 148.973 170.068 136.548 1.00 94.53  ?  821  GLY A C     1 
ATOM   2651  O  O     . GLY A 1 949  ? 148.501 170.762 137.449 1.00 94.41  ?  821  GLY A O     1 
ATOM   2652  N  N     . ASN A 1 950  ? 149.225 170.557 135.328 1.00 89.11  ?  822  ASN A N     1 
ATOM   2653  C  CA    . ASN A 1 950  ? 148.899 171.941 134.995 1.00 84.90  ?  822  ASN A CA    1 
ATOM   2654  C  C     . ASN A 1 950  ? 147.406 172.213 135.160 1.00 86.85  ?  822  ASN A C     1 
ATOM   2655  O  O     . ASN A 1 950  ? 147.007 173.273 135.665 1.00 89.09  ?  822  ASN A O     1 
ATOM   2656  C  CB    . ASN A 1 950  ? 149.344 172.251 133.562 1.00 88.00  ?  822  ASN A CB    1 
ATOM   2657  C  CG    . ASN A 1 950  ? 150.783 171.832 133.287 1.00 80.67  ?  822  ASN A CG    1 
ATOM   2658  O  OD1   . ASN A 1 950  ? 151.449 171.246 134.141 1.00 76.26  ?  822  ASN A OD1   1 
ATOM   2659  N  ND2   . ASN A 1 950  ? 151.264 172.126 132.083 1.00 75.50  ?  822  ASN A ND2   1 
ATOM   2660  N  N     . ALA A 1 951  ? 146.567 171.260 134.747 1.00 95.15  ?  823  ALA A N     1 
ATOM   2661  C  CA    . ALA A 1 951  ? 145.121 171.423 134.861 1.00 100.82 ?  823  ALA A CA    1 
ATOM   2662  C  C     . ALA A 1 951  ? 144.696 171.551 136.318 1.00 100.82 ?  823  ALA A C     1 
ATOM   2663  O  O     . ALA A 1 951  ? 144.077 172.546 136.712 1.00 100.81 ?  823  ALA A O     1 
ATOM   2664  C  CB    . ALA A 1 951  ? 144.404 170.249 134.193 1.00 104.58 ?  823  ALA A CB    1 
ATOM   2665  N  N     . THR A 1 952  ? 145.011 170.540 137.136 1.00 99.00  ?  824  THR A N     1 
ATOM   2666  C  CA    . THR A 1 952  ? 144.659 170.599 138.551 1.00 100.83 ?  824  THR A CA    1 
ATOM   2667  C  C     . THR A 1 952  ? 145.339 171.764 139.259 1.00 102.08 ?  824  THR A C     1 
ATOM   2668  O  O     . THR A 1 952  ? 144.835 172.233 140.285 1.00 103.06 ?  824  THR A O     1 
ATOM   2669  C  CB    . THR A 1 952  ? 145.008 169.276 139.244 1.00 95.59  ?  824  THR A CB    1 
ATOM   2670  O  OG1   . THR A 1 952  ? 144.325 169.197 140.502 1.00 96.21  ?  824  THR A OG1   1 
ATOM   2671  C  CG2   . THR A 1 952  ? 146.503 169.164 139.486 1.00 100.67 ?  824  THR A CG2   1 
ATOM   2672  N  N     . GLU A 1 953  ? 146.435 172.285 138.705 1.00 98.80  ?  825  GLU A N     1 
ATOM   2673  C  CA    . GLU A 1 953  ? 147.094 173.426 139.322 1.00 102.23 ?  825  GLU A CA    1 
ATOM   2674  C  C     . GLU A 1 953  ? 146.331 174.718 139.062 1.00 106.06 ?  825  GLU A C     1 
ATOM   2675  O  O     . GLU A 1 953  ? 146.159 175.532 139.975 1.00 110.88 ?  825  GLU A O     1 
ATOM   2676  C  CB    . GLU A 1 953  ? 148.532 173.531 138.815 1.00 104.17 ?  825  GLU A CB    1 
ATOM   2677  C  CG    . GLU A 1 953  ? 149.356 174.558 139.556 1.00 122.00 ?  825  GLU A CG    1 
ATOM   2678  C  CD    . GLU A 1 953  ? 149.498 174.233 141.033 1.00 134.67 ?  825  GLU A CD    1 
ATOM   2679  O  OE1   . GLU A 1 953  ? 149.422 173.040 141.397 1.00 122.19 ?  825  GLU A OE1   1 
ATOM   2680  O  OE2   . GLU A 1 953  ? 149.670 175.175 141.835 1.00 166.93 -1 825  GLU A OE2   1 
ATOM   2681  N  N     . PHE A 1 954  ? 145.863 174.925 137.828 1.00 97.48  ?  826  PHE A N     1 
ATOM   2682  C  CA    . PHE A 1 954  ? 144.950 176.039 137.581 1.00 93.95  ?  826  PHE A CA    1 
ATOM   2683  C  C     . PHE A 1 954  ? 143.647 175.860 138.352 1.00 102.29 ?  826  PHE A C     1 
ATOM   2684  O  O     . PHE A 1 954  ? 143.029 176.845 138.778 1.00 107.21 ?  826  PHE A O     1 
ATOM   2685  C  CB    . PHE A 1 954  ? 144.668 176.178 136.085 1.00 84.59  ?  826  PHE A CB    1 
ATOM   2686  C  CG    . PHE A 1 954  ? 145.854 176.627 135.284 1.00 81.58  ?  826  PHE A CG    1 
ATOM   2687  C  CD1   . PHE A 1 954  ? 146.888 177.324 135.885 1.00 84.92  ?  826  PHE A CD1   1 
ATOM   2688  C  CD2   . PHE A 1 954  ? 145.937 176.351 133.930 1.00 81.32  ?  826  PHE A CD2   1 
ATOM   2689  C  CE1   . PHE A 1 954  ? 147.981 177.737 135.151 1.00 82.28  ?  826  PHE A CE1   1 
ATOM   2690  C  CE2   . PHE A 1 954  ? 147.028 176.761 133.191 1.00 82.72  ?  826  PHE A CE2   1 
ATOM   2691  C  CZ    . PHE A 1 954  ? 148.051 177.455 133.802 1.00 80.32  ?  826  PHE A CZ    1 
ATOM   2692  N  N     . TYR A 1 955  ? 143.229 174.608 138.550 1.00 100.18 ?  827  TYR A N     1 
ATOM   2693  C  CA    . TYR A 1 955  ? 142.052 174.313 139.361 1.00 100.30 ?  827  TYR A CA    1 
ATOM   2694  C  C     . TYR A 1 955  ? 142.246 174.788 140.797 1.00 106.45 ?  827  TYR A C     1 
ATOM   2695  O  O     . TYR A 1 955  ? 141.348 175.396 141.388 1.00 108.70 ?  827  TYR A O     1 
ATOM   2696  C  CB    . TYR A 1 955  ? 141.771 172.809 139.316 1.00 91.94  ?  827  TYR A CB    1 
ATOM   2697  C  CG    . TYR A 1 955  ? 140.441 172.362 139.884 1.00 80.04  ?  827  TYR A CG    1 
ATOM   2698  C  CD1   . TYR A 1 955  ? 140.301 172.070 141.236 1.00 79.31  ?  827  TYR A CD1   1 
ATOM   2699  C  CD2   . TYR A 1 955  ? 139.336 172.194 139.061 1.00 75.23  ?  827  TYR A CD2   1 
ATOM   2700  C  CE1   . TYR A 1 955  ? 139.090 171.644 141.753 1.00 78.75  ?  827  TYR A CE1   1 
ATOM   2701  C  CE2   . TYR A 1 955  ? 138.124 171.770 139.568 1.00 71.83  ?  827  TYR A CE2   1 
ATOM   2702  C  CZ    . TYR A 1 955  ? 138.006 171.497 140.912 1.00 74.41  ?  827  TYR A CZ    1 
ATOM   2703  O  OH    . TYR A 1 955  ? 136.796 171.073 141.409 1.00 79.68  ?  827  TYR A OH    1 
ATOM   2704  N  N     . LYS A 1 956  ? 143.416 174.506 141.377 1.00 107.66 ?  828  LYS A N     1 
ATOM   2705  C  CA    . LYS A 1 956  ? 143.727 175.006 142.713 1.00 110.57 ?  828  LYS A CA    1 
ATOM   2706  C  C     . LYS A 1 956  ? 143.844 176.525 142.725 1.00 116.31 ?  828  LYS A C     1 
ATOM   2707  O  O     . LYS A 1 956  ? 143.404 177.180 143.677 1.00 123.22 ?  828  LYS A O     1 
ATOM   2708  C  CB    . LYS A 1 956  ? 145.016 174.373 143.231 1.00 100.15 ?  828  LYS A CB    1 
ATOM   2709  C  CG    . LYS A 1 956  ? 144.837 172.980 143.792 1.00 77.98  ?  828  LYS A CG    1 
ATOM   2710  C  CD    . LYS A 1 956  ? 145.913 172.667 144.809 1.00 66.65  ?  828  LYS A CD    1 
ATOM   2711  C  CE    . LYS A 1 956  ? 145.551 171.436 145.612 1.00 67.00  ?  828  LYS A CE    1 
ATOM   2712  N  NZ    . LYS A 1 956  ? 146.381 171.317 146.839 1.00 76.03  ?  828  LYS A NZ    1 
ATOM   2713  N  N     . ILE A 1 957  ? 144.451 177.099 141.683 1.00 108.93 ?  829  ILE A N     1 
ATOM   2714  C  CA    . ILE A 1 957  ? 144.515 178.554 141.560 1.00 106.73 ?  829  ILE A CA    1 
ATOM   2715  C  C     . ILE A 1 957  ? 143.118 179.149 141.673 1.00 115.26 ?  829  ILE A C     1 
ATOM   2716  O  O     . ILE A 1 957  ? 142.886 180.098 142.425 1.00 122.05 ?  829  ILE A O     1 
ATOM   2717  C  CB    . ILE A 1 957  ? 145.198 178.954 140.239 1.00 103.96 ?  829  ILE A CB    1 
ATOM   2718  C  CG1   . ILE A 1 957  ? 146.719 178.858 140.374 1.00 108.69 ?  829  ILE A CG1   1 
ATOM   2719  C  CG2   . ILE A 1 957  ? 144.785 180.355 139.818 1.00 107.60 ?  829  ILE A CG2   1 
ATOM   2720  C  CD1   . ILE A 1 957  ? 147.474 179.317 139.144 1.00 106.71 ?  829  ILE A CD1   1 
ATOM   2721  N  N     . PHE A 1 958  ? 142.155 178.566 140.963 1.00 119.25 ?  830  PHE A N     1 
ATOM   2722  C  CA    . PHE A 1 958  ? 140.805 179.126 140.964 1.00 128.35 ?  830  PHE A CA    1 
ATOM   2723  C  C     . PHE A 1 958  ? 140.059 178.827 142.264 1.00 133.77 ?  830  PHE A C     1 
ATOM   2724  O  O     . PHE A 1 958  ? 139.327 179.686 142.776 1.00 141.23 ?  830  PHE A O     1 
ATOM   2725  C  CB    . PHE A 1 958  ? 140.032 178.609 139.753 1.00 130.77 ?  830  PHE A CB    1 
ATOM   2726  C  CG    . PHE A 1 958  ? 140.543 179.144 138.445 1.00 137.75 ?  830  PHE A CG    1 
ATOM   2727  C  CD1   . PHE A 1 958  ? 141.361 180.262 138.418 1.00 139.55 ?  830  PHE A CD1   1 
ATOM   2728  C  CD2   . PHE A 1 958  ? 140.215 178.532 137.247 1.00 148.79 ?  830  PHE A CD2   1 
ATOM   2729  C  CE1   . PHE A 1 958  ? 141.840 180.761 137.224 1.00 144.90 ?  830  PHE A CE1   1 
ATOM   2730  C  CE2   . PHE A 1 958  ? 140.692 179.029 136.047 1.00 147.39 ?  830  PHE A CE2   1 
ATOM   2731  C  CZ    . PHE A 1 958  ? 141.506 180.145 136.037 1.00 147.12 ?  830  PHE A CZ    1 
ATOM   2732  N  N     . GLN A 1 959  ? 140.230 177.618 142.810 1.00 130.94 ?  831  GLN A N     1 
ATOM   2733  C  CA    . GLN A 1 959  ? 139.652 177.274 144.104 1.00 137.44 ?  831  GLN A CA    1 
ATOM   2734  C  C     . GLN A 1 959  ? 140.220 178.129 145.230 1.00 146.60 ?  831  GLN A C     1 
ATOM   2735  O  O     . GLN A 1 959  ? 139.616 178.205 146.306 1.00 148.14 ?  831  GLN A O     1 
ATOM   2736  C  CB    . GLN A 1 959  ? 139.885 175.787 144.390 1.00 132.85 ?  831  GLN A CB    1 
ATOM   2737  C  CG    . GLN A 1 959  ? 139.111 175.230 145.573 1.00 134.41 ?  831  GLN A CG    1 
ATOM   2738  C  CD    . GLN A 1 959  ? 139.374 173.752 145.793 1.00 129.12 ?  831  GLN A CD    1 
ATOM   2739  O  OE1   . GLN A 1 959  ? 139.558 172.994 144.841 1.00 121.64 ?  831  GLN A OE1   1 
ATOM   2740  N  NE2   . GLN A 1 959  ? 139.388 173.335 147.054 1.00 128.76 ?  831  GLN A NE2   1 
ATOM   2741  N  N     . ASP A 1 960  ? 141.373 178.758 145.012 1.00 145.70 ?  832  ASP A N     1 
ATOM   2742  C  CA    . ASP A 1 960  ? 141.924 179.730 145.946 1.00 154.26 ?  832  ASP A CA    1 
ATOM   2743  C  C     . ASP A 1 960  ? 141.722 181.171 145.492 1.00 150.24 ?  832  ASP A C     1 
ATOM   2744  O  O     . ASP A 1 960  ? 142.127 182.090 146.207 1.00 153.74 ?  832  ASP A O     1 
ATOM   2745  C  CB    . ASP A 1 960  ? 143.416 179.465 146.169 1.00 161.06 ?  832  ASP A CB    1 
ATOM   2746  C  CG    . ASP A 1 960  ? 143.683 178.086 146.738 1.00 171.18 ?  832  ASP A CG    1 
ATOM   2747  O  OD1   . ASP A 1 960  ? 142.824 177.573 147.487 1.00 160.69 ?  832  ASP A OD1   1 
ATOM   2748  O  OD2   . ASP A 1 960  ? 144.751 177.514 146.436 1.00 202.17 -1 832  ASP A OD2   1 
ATOM   2749  N  N     . GLU A 1 961  ? 141.166 181.387 144.301 1.00 137.29 ?  833  GLU A N     1 
ATOM   2750  C  CA    . GLU A 1 961  ? 140.734 182.721 143.902 1.00 128.63 ?  833  GLU A CA    1 
ATOM   2751  C  C     . GLU A 1 961  ? 139.303 183.022 144.317 1.00 130.38 ?  833  GLU A C     1 
ATOM   2752  O  O     . GLU A 1 961  ? 138.985 184.183 144.601 1.00 136.29 ?  833  GLU A O     1 
ATOM   2753  C  CB    . GLU A 1 961  ? 140.860 182.917 142.387 1.00 130.15 ?  833  GLU A CB    1 
ATOM   2754  C  CG    . GLU A 1 961  ? 142.284 182.971 141.883 1.00 138.19 ?  833  GLU A CG    1 
ATOM   2755  C  CD    . GLU A 1 961  ? 143.253 183.393 142.963 1.00 148.33 ?  833  GLU A CD    1 
ATOM   2756  O  OE1   . GLU A 1 961  ? 143.917 182.507 143.545 1.00 140.90 ?  833  GLU A OE1   1 
ATOM   2757  O  OE2   . GLU A 1 961  ? 143.344 184.606 143.240 1.00 181.02 -1 833  GLU A OE2   1 
ATOM   2758  N  N     . ILE A 1 962  ? 138.430 182.012 144.350 1.00 138.37 ?  834  ILE A N     1 
ATOM   2759  C  CA    . ILE A 1 962  ? 137.067 182.242 144.825 1.00 144.15 ?  834  ILE A CA    1 
ATOM   2760  C  C     . ILE A 1 962  ? 137.091 182.745 146.261 1.00 145.81 ?  834  ILE A C     1 
ATOM   2761  O  O     . ILE A 1 962  ? 136.452 183.749 146.598 1.00 155.26 ?  834  ILE A O     1 
ATOM   2762  C  CB    . ILE A 1 962  ? 136.214 180.971 144.679 1.00 145.51 ?  834  ILE A CB    1 
ATOM   2763  C  CG1   . ILE A 1 962  ? 135.744 180.841 143.235 1.00 146.37 ?  834  ILE A CG1   1 
ATOM   2764  C  CG2   . ILE A 1 962  ? 135.007 181.017 145.616 1.00 136.50 ?  834  ILE A CG2   1 
ATOM   2765  C  CD1   . ILE A 1 962  ? 134.637 179.866 143.062 1.00 139.59 ?  834  ILE A CD1   1 
ATOM   2766  N  N     . GLY A 1 963  ? 137.822 182.056 147.127 1.00 141.83 ?  835  GLY A N     1 
ATOM   2767  C  CA    . GLY A 1 963  ? 138.239 182.668 148.362 1.00 143.25 ?  835  GLY A CA    1 
ATOM   2768  C  C     . GLY A 1 963  ? 139.431 183.573 148.137 1.00 148.82 ?  835  GLY A C     1 
ATOM   2769  O  O     . GLY A 1 963  ? 140.150 183.457 147.151 1.00 147.14 ?  835  GLY A O     1 
ATOM   2770  N  N     . GLU A 1 964  ? 139.635 184.514 149.048 1.00 156.91 ?  836  GLU A N     1 
ATOM   2771  C  CA    . GLU A 1 964  ? 140.810 185.376 148.984 1.00 160.43 ?  836  GLU A CA    1 
ATOM   2772  C  C     . GLU A 1 964  ? 141.916 184.711 149.792 1.00 163.07 ?  836  GLU A C     1 
ATOM   2773  O  O     . GLU A 1 964  ? 141.881 184.711 151.026 1.00 165.69 ?  836  GLU A O     1 
ATOM   2774  C  CB    . GLU A 1 964  ? 140.488 186.779 149.488 1.00 165.70 ?  836  GLU A CB    1 
ATOM   2775  C  CG    . GLU A 1 964  ? 139.674 187.591 148.489 1.00 179.76 ?  836  GLU A CG    1 
ATOM   2776  C  CD    . GLU A 1 964  ? 140.254 187.537 147.083 1.00 184.30 ?  836  GLU A CD    1 
ATOM   2777  O  OE1   . GLU A 1 964  ? 141.478 187.737 146.932 1.00 178.76 ?  836  GLU A OE1   1 
ATOM   2778  O  OE2   . GLU A 1 964  ? 139.489 187.283 146.128 1.00 198.69 -1 836  GLU A OE2   1 
ATOM   2779  N  N     . VAL A 1 965  ? 142.890 184.133 149.092 1.00 164.31 ?  837  VAL A N     1 
ATOM   2780  C  CA    . VAL A 1 965  ? 143.851 183.249 149.740 1.00 169.41 ?  837  VAL A CA    1 
ATOM   2781  C  C     . VAL A 1 965  ? 145.048 184.006 150.316 1.00 177.67 ?  837  VAL A C     1 
ATOM   2782  O  O     . VAL A 1 965  ? 145.569 183.621 151.369 1.00 177.29 ?  837  VAL A O     1 
ATOM   2783  C  CB    . VAL A 1 965  ? 144.298 182.150 148.759 1.00 162.88 ?  837  VAL A CB    1 
ATOM   2784  C  CG1   . VAL A 1 965  ? 145.030 182.746 147.563 1.00 161.96 ?  837  VAL A CG1   1 
ATOM   2785  C  CG2   . VAL A 1 965  ? 145.154 181.109 149.469 1.00 162.68 ?  837  VAL A CG2   1 
ATOM   2786  N  N     . TYR A 1 966  ? 145.499 185.080 149.665 1.00 177.18 ?  838  TYR A N     1 
ATOM   2787  C  CA    . TYR A 1 966  ? 146.586 185.873 150.225 1.00 177.57 ?  838  TYR A CA    1 
ATOM   2788  C  C     . TYR A 1 966  ? 146.123 186.779 151.360 1.00 178.72 ?  838  TYR A C     1 
ATOM   2789  O  O     . TYR A 1 966  ? 146.964 187.399 152.019 1.00 175.98 ?  838  TYR A O     1 
ATOM   2790  C  CB    . TYR A 1 966  ? 147.262 186.707 149.131 1.00 172.80 ?  838  TYR A CB    1 
ATOM   2791  C  CG    . TYR A 1 966  ? 146.301 187.421 148.211 1.00 171.66 ?  838  TYR A CG    1 
ATOM   2792  C  CD1   . TYR A 1 966  ? 145.785 188.664 148.548 1.00 172.53 ?  838  TYR A CD1   1 
ATOM   2793  C  CD2   . TYR A 1 966  ? 145.914 186.855 147.004 1.00 171.99 ?  838  TYR A CD2   1 
ATOM   2794  C  CE1   . TYR A 1 966  ? 144.906 189.322 147.712 1.00 175.14 ?  838  TYR A CE1   1 
ATOM   2795  C  CE2   . TYR A 1 966  ? 145.034 187.507 146.160 1.00 175.78 ?  838  TYR A CE2   1 
ATOM   2796  C  CZ    . TYR A 1 966  ? 144.534 188.741 146.520 1.00 175.88 ?  838  TYR A CZ    1 
ATOM   2797  O  OH    . TYR A 1 966  ? 143.659 189.398 145.687 1.00 176.29 ?  838  TYR A OH    1 
ATOM   2798  N  N     . GLN A 1 967  ? 144.813 186.869 151.597 1.00 178.55 ?  839  GLN A N     1 
ATOM   2799  C  CA    . GLN A 1 967  ? 144.264 187.538 152.767 1.00 172.13 ?  839  GLN A CA    1 
ATOM   2800  C  C     . GLN A 1 967  ? 143.701 186.562 153.790 1.00 169.88 ?  839  GLN A C     1 
ATOM   2801  O  O     . GLN A 1 967  ? 143.405 186.971 154.918 1.00 162.77 ?  839  GLN A O     1 
ATOM   2802  C  CB    . GLN A 1 967  ? 143.164 188.527 152.351 1.00 165.60 ?  839  GLN A CB    1 
ATOM   2803  C  CG    . GLN A 1 967  ? 143.633 189.612 151.396 1.00 165.08 ?  839  GLN A CG    1 
ATOM   2804  C  CD    . GLN A 1 967  ? 142.482 190.371 150.765 1.00 159.55 ?  839  GLN A CD    1 
ATOM   2805  O  OE1   . GLN A 1 967  ? 141.526 189.773 150.271 1.00 162.38 ?  839  GLN A OE1   1 
ATOM   2806  N  NE2   . GLN A 1 967  ? 142.570 191.696 150.774 1.00 152.19 ?  839  GLN A NE2   1 
ATOM   2807  N  N     . LYS A 1 968  ? 143.545 185.292 153.421 1.00 172.46 ?  840  LYS A N     1 
ATOM   2808  C  CA    . LYS A 1 968  ? 143.063 184.243 154.321 1.00 169.05 ?  840  LYS A CA    1 
ATOM   2809  C  C     . LYS A 1 968  ? 143.904 182.997 154.068 1.00 165.59 ?  840  LYS A C     1 
ATOM   2810  O  O     . LYS A 1 968  ? 143.429 182.005 153.502 1.00 158.43 ?  840  LYS A O     1 
ATOM   2811  C  CB    . LYS A 1 968  ? 141.572 183.985 154.090 1.00 162.38 ?  840  LYS A CB    1 
ATOM   2812  C  CG    . LYS A 1 968  ? 140.931 182.928 154.968 1.00 150.68 ?  840  LYS A CG    1 
ATOM   2813  C  CD    . LYS A 1 968  ? 139.538 182.613 154.456 1.00 151.21 ?  840  LYS A CD    1 
ATOM   2814  C  CE    . LYS A 1 968  ? 139.030 181.301 155.007 1.00 150.81 ?  840  LYS A CE    1 
ATOM   2815  N  NZ    . LYS A 1 968  ? 137.708 180.939 154.424 1.00 150.14 ?  840  LYS A NZ    1 
ATOM   2816  N  N     . PRO A 1 969  ? 145.180 183.021 154.463 1.00 162.52 ?  841  PRO A N     1 
ATOM   2817  C  CA    . PRO A 1 969  ? 146.088 181.925 154.103 1.00 152.48 ?  841  PRO A CA    1 
ATOM   2818  C  C     . PRO A 1 969  ? 145.862 180.652 154.899 1.00 149.29 ?  841  PRO A C     1 
ATOM   2819  O  O     . PRO A 1 969  ? 146.615 179.687 154.721 1.00 148.79 ?  841  PRO A O     1 
ATOM   2820  C  CB    . PRO A 1 969  ? 147.473 182.520 154.396 1.00 140.53 ?  841  PRO A CB    1 
ATOM   2821  C  CG    . PRO A 1 969  ? 147.230 183.470 155.508 1.00 146.65 ?  841  PRO A CG    1 
ATOM   2822  C  CD    . PRO A 1 969  ? 145.854 184.048 155.280 1.00 159.74 ?  841  PRO A CD    1 
ATOM   2823  N  N     . ASN A 1 970  ? 144.848 180.623 155.759 1.00 149.16 ?  842  ASN A N     1 
ATOM   2824  C  CA    . ASN A 1 970  ? 144.529 179.459 156.581 1.00 145.99 ?  842  ASN A CA    1 
ATOM   2825  C  C     . ASN A 1 970  ? 143.051 179.131 156.425 1.00 138.57 ?  842  ASN A C     1 
ATOM   2826  O  O     . ASN A 1 970  ? 142.230 179.471 157.288 1.00 137.32 ?  842  ASN A O     1 
ATOM   2827  C  CB    . ASN A 1 970  ? 144.889 179.707 158.045 1.00 149.19 ?  842  ASN A CB    1 
ATOM   2828  C  CG    . ASN A 1 970  ? 146.335 179.375 158.352 1.00 149.09 ?  842  ASN A CG    1 
ATOM   2829  O  OD1   . ASN A 1 970  ? 147.167 179.278 157.450 1.00 146.25 ?  842  ASN A OD1   1 
ATOM   2830  N  ND2   . ASN A 1 970  ? 146.640 179.190 159.630 1.00 149.32 ?  842  ASN A ND2   1 
ATOM   2831  N  N     . PRO A 1 971  ? 142.676 178.474 155.332 1.00 136.38 ?  843  PRO A N     1 
ATOM   2832  C  CA    . PRO A 1 971  ? 141.300 177.988 155.207 1.00 136.01 ?  843  PRO A CA    1 
ATOM   2833  C  C     . PRO A 1 971  ? 141.051 176.810 156.136 1.00 125.41 ?  843  PRO A C     1 
ATOM   2834  O  O     . PRO A 1 971  ? 141.975 176.183 156.659 1.00 124.00 ?  843  PRO A O     1 
ATOM   2835  C  CB    . PRO A 1 971  ? 141.207 177.569 153.737 1.00 142.67 ?  843  PRO A CB    1 
ATOM   2836  C  CG    . PRO A 1 971  ? 142.607 177.200 153.380 1.00 139.97 ?  843  PRO A CG    1 
ATOM   2837  C  CD    . PRO A 1 971  ? 143.483 178.158 154.141 1.00 140.98 ?  843  PRO A CD    1 
ATOM   2838  N  N     . SER A 1 972  ? 139.772 176.519 156.345 1.00 123.07 ?  844  SER A N     1 
ATOM   2839  C  CA    . SER A 1 972  ? 139.384 175.390 157.171 1.00 117.63 ?  844  SER A CA    1 
ATOM   2840  C  C     . SER A 1 972  ? 139.335 174.120 156.326 1.00 116.25 ?  844  SER A C     1 
ATOM   2841  O  O     . SER A 1 972  ? 139.625 174.122 155.127 1.00 120.35 ?  844  SER A O     1 
ATOM   2842  C  CB    . SER A 1 972  ? 138.035 175.650 157.839 1.00 121.78 ?  844  SER A CB    1 
ATOM   2843  O  OG    . SER A 1 972  ? 138.013 176.915 158.476 1.00 127.81 ?  844  SER A OG    1 
ATOM   2844  N  N     . ARG A 1 973  ? 138.963 173.011 156.968 1.00 120.62 ?  845  ARG A N     1 
ATOM   2845  C  CA    . ARG A 1 973  ? 138.668 171.788 156.233 1.00 122.77 ?  845  ARG A CA    1 
ATOM   2846  C  C     . ARG A 1 973  ? 137.479 171.963 155.298 1.00 132.39 ?  845  ARG A C     1 
ATOM   2847  O  O     . ARG A 1 973  ? 137.301 171.158 154.377 1.00 133.67 ?  845  ARG A O     1 
ATOM   2848  C  CB    . ARG A 1 973  ? 138.395 170.648 157.217 1.00 121.41 ?  845  ARG A CB    1 
ATOM   2849  C  CG    . ARG A 1 973  ? 138.403 169.260 156.603 1.00 119.00 ?  845  ARG A CG    1 
ATOM   2850  C  CD    . ARG A 1 973  ? 139.449 168.381 157.261 1.00 122.39 ?  845  ARG A CD    1 
ATOM   2851  N  NE    . ARG A 1 973  ? 140.789 168.943 157.127 1.00 126.77 ?  845  ARG A NE    1 
ATOM   2852  C  CZ    . ARG A 1 973  ? 141.907 168.290 157.428 1.00 125.75 ?  845  ARG A CZ    1 
ATOM   2853  N  NH1   . ARG A 1 973  ? 141.850 167.046 157.883 1.00 126.62 ?  845  ARG A NH1   1 
ATOM   2854  N  NH2   . ARG A 1 973  ? 143.084 168.882 157.274 1.00 117.46 ?  845  ARG A NH2   1 
ATOM   2855  N  N     . GLU A 1 974  ? 136.678 173.007 155.503 1.00 135.54 ?  846  GLU A N     1 
ATOM   2856  C  CA    . GLU A 1 974  ? 135.406 173.181 154.819 1.00 145.14 ?  846  GLU A CA    1 
ATOM   2857  C  C     . GLU A 1 974  ? 135.350 174.393 153.901 1.00 139.26 ?  846  GLU A C     1 
ATOM   2858  O  O     . GLU A 1 974  ? 134.668 174.335 152.877 1.00 136.72 ?  846  GLU A O     1 
ATOM   2859  C  CB    . GLU A 1 974  ? 134.272 173.295 155.848 1.00 155.07 ?  846  GLU A CB    1 
ATOM   2860  C  CG    . GLU A 1 974  ? 134.279 172.195 156.897 1.00 159.16 ?  846  GLU A CG    1 
ATOM   2861  C  CD    . GLU A 1 974  ? 133.223 172.406 157.961 1.00 187.03 ?  846  GLU A CD    1 
ATOM   2862  O  OE1   . GLU A 1 974  ? 132.383 173.314 157.792 1.00 178.86 ?  846  GLU A OE1   1 
ATOM   2863  O  OE2   . GLU A 1 974  ? 133.234 171.667 158.967 1.00 253.93 -1 846  GLU A OE2   1 
ATOM   2864  N  N     . GLU A 1 975  ? 136.032 175.489 154.241 1.00 131.98 ?  847  GLU A N     1 
ATOM   2865  C  CA    . GLU A 1 975  ? 135.957 176.687 153.410 1.00 128.68 ?  847  GLU A CA    1 
ATOM   2866  C  C     . GLU A 1 975  ? 136.464 176.416 151.997 1.00 128.28 ?  847  GLU A C     1 
ATOM   2867  O  O     . GLU A 1 975  ? 135.915 176.941 151.020 1.00 128.51 ?  847  GLU A O     1 
ATOM   2868  C  CB    . GLU A 1 975  ? 136.736 177.825 154.066 1.00 129.55 ?  847  GLU A CB    1 
ATOM   2869  C  CG    . GLU A 1 975  ? 136.108 178.304 155.362 1.00 133.20 ?  847  GLU A CG    1 
ATOM   2870  C  CD    . GLU A 1 975  ? 137.126 178.862 156.329 1.00 145.40 ?  847  GLU A CD    1 
ATOM   2871  O  OE1   . GLU A 1 975  ? 138.291 178.418 156.289 1.00 138.40 ?  847  GLU A OE1   1 
ATOM   2872  O  OE2   . GLU A 1 975  ? 136.762 179.746 157.131 1.00 189.51 -1 847  GLU A OE2   1 
ATOM   2873  N  N     . ARG A 1 976  ? 137.501 175.584 151.867 1.00 131.39 ?  848  ARG A N     1 
ATOM   2874  C  CA    . ARG A 1 976  ? 137.938 175.164 150.539 1.00 131.07 ?  848  ARG A CA    1 
ATOM   2875  C  C     . ARG A 1 976  ? 136.890 174.282 149.870 1.00 131.87 ?  848  ARG A C     1 
ATOM   2876  O  O     . ARG A 1 976  ? 136.707 174.349 148.649 1.00 133.00 ?  848  ARG A O     1 
ATOM   2877  C  CB    . ARG A 1 976  ? 139.277 174.433 150.625 1.00 126.58 ?  848  ARG A CB    1 
ATOM   2878  C  CG    . ARG A 1 976  ? 140.474 175.338 150.861 1.00 121.01 ?  848  ARG A CG    1 
ATOM   2879  C  CD    . ARG A 1 976  ? 141.720 174.511 151.114 1.00 117.72 ?  848  ARG A CD    1 
ATOM   2880  N  NE    . ARG A 1 976  ? 141.522 173.584 152.224 1.00 120.95 ?  848  ARG A NE    1 
ATOM   2881  C  CZ    . ARG A 1 976  ? 142.495 172.884 152.796 1.00 117.22 ?  848  ARG A CZ    1 
ATOM   2882  N  NH1   . ARG A 1 976  ? 143.743 173.005 152.366 1.00 117.00 ?  848  ARG A NH1   1 
ATOM   2883  N  NH2   . ARG A 1 976  ? 142.219 172.064 153.801 1.00 114.45 ?  848  ARG A NH2   1 
ATOM   2884  N  N     . ARG A 1 977  ? 136.198 173.446 150.649 1.00 128.11 ?  849  ARG A N     1 
ATOM   2885  C  CA    . ARG A 1 977  ? 135.083 172.681 150.098 1.00 124.13 ?  849  ARG A CA    1 
ATOM   2886  C  C     . ARG A 1 977  ? 134.003 173.611 149.563 1.00 125.87 ?  849  ARG A C     1 
ATOM   2887  O  O     . ARG A 1 977  ? 133.478 173.400 148.464 1.00 126.99 ?  849  ARG A O     1 
ATOM   2888  C  CB    . ARG A 1 977  ? 134.508 171.742 151.159 1.00 119.33 ?  849  ARG A CB    1 
ATOM   2889  C  CG    . ARG A 1 977  ? 135.429 170.600 151.535 1.00 123.15 ?  849  ARG A CG    1 
ATOM   2890  C  CD    . ARG A 1 977  ? 135.676 169.704 150.337 1.00 127.78 ?  849  ARG A CD    1 
ATOM   2891  N  NE    . ARG A 1 977  ? 136.624 168.634 150.628 1.00 130.41 ?  849  ARG A NE    1 
ATOM   2892  C  CZ    . ARG A 1 977  ? 137.051 167.755 149.728 1.00 129.87 ?  849  ARG A CZ    1 
ATOM   2893  N  NH1   . ARG A 1 977  ? 136.614 167.821 148.478 1.00 125.64 ?  849  ARG A NH1   1 
ATOM   2894  N  NH2   . ARG A 1 977  ? 137.916 166.813 150.076 1.00 124.24 ?  849  ARG A NH2   1 
ATOM   2895  N  N     . ARG A 1 978  ? 133.674 174.656 150.326 1.00 130.70 ?  850  ARG A N     1 
ATOM   2896  C  CA    . ARG A 1 978  ? 132.714 175.658 149.871 1.00 135.90 ?  850  ARG A CA    1 
ATOM   2897  C  C     . ARG A 1 978  ? 133.160 176.297 148.562 1.00 135.52 ?  850  ARG A C     1 
ATOM   2898  O  O     . ARG A 1 978  ? 132.371 176.423 147.617 1.00 135.98 ?  850  ARG A O     1 
ATOM   2899  C  CB    . ARG A 1 978  ? 132.537 176.726 150.950 1.00 140.27 ?  850  ARG A CB    1 
ATOM   2900  C  CG    . ARG A 1 978  ? 132.012 178.059 150.435 1.00 143.50 ?  850  ARG A CG    1 
ATOM   2901  C  CD    . ARG A 1 978  ? 132.184 179.176 151.461 1.00 142.90 ?  850  ARG A CD    1 
ATOM   2902  N  NE    . ARG A 1 978  ? 131.455 178.920 152.701 1.00 144.17 ?  850  ARG A NE    1 
ATOM   2903  C  CZ    . ARG A 1 978  ? 131.982 178.337 153.773 1.00 139.95 ?  850  ARG A CZ    1 
ATOM   2904  N  NH1   . ARG A 1 978  ? 133.248 177.946 153.761 1.00 135.53 ?  850  ARG A NH1   1 
ATOM   2905  N  NH2   . ARG A 1 978  ? 131.242 178.142 154.856 1.00 138.63 ?  850  ARG A NH2   1 
ATOM   2906  N  N     . TRP A 1 979  ? 134.424 176.723 148.497 1.00 132.70 ?  851  TRP A N     1 
ATOM   2907  C  CA    . TRP A 1 979  ? 134.901 177.442 147.320 1.00 129.89 ?  851  TRP A CA    1 
ATOM   2908  C  C     . TRP A 1 979  ? 134.929 176.538 146.093 1.00 126.45 ?  851  TRP A C     1 
ATOM   2909  O  O     . TRP A 1 979  ? 134.516 176.949 145.001 1.00 125.38 ?  851  TRP A O     1 
ATOM   2910  C  CB    . TRP A 1 979  ? 136.281 178.036 147.596 1.00 133.29 ?  851  TRP A CB    1 
ATOM   2911  C  CG    . TRP A 1 979  ? 136.292 178.972 148.769 1.00 133.04 ?  851  TRP A CG    1 
ATOM   2912  C  CD1   . TRP A 1 979  ? 135.207 179.533 149.378 1.00 131.35 ?  851  TRP A CD1   1 
ATOM   2913  C  CD2   . TRP A 1 979  ? 137.440 179.441 149.487 1.00 131.87 ?  851  TRP A CD2   1 
ATOM   2914  N  NE1   . TRP A 1 979  ? 135.607 180.328 150.424 1.00 129.58 ?  851  TRP A NE1   1 
ATOM   2915  C  CE2   . TRP A 1 979  ? 136.974 180.288 150.513 1.00 128.55 ?  851  TRP A CE2   1 
ATOM   2916  C  CE3   . TRP A 1 979  ? 138.817 179.231 149.359 1.00 132.83 ?  851  TRP A CE3   1 
ATOM   2917  C  CZ2   . TRP A 1 979  ? 137.834 180.924 151.404 1.00 130.90 ?  851  TRP A CZ2   1 
ATOM   2918  C  CZ3   . TRP A 1 979  ? 139.669 179.864 150.246 1.00 132.89 ?  851  TRP A CZ3   1 
ATOM   2919  C  CH2   . TRP A 1 979  ? 139.174 180.700 151.255 1.00 135.11 ?  851  TRP A CH2   1 
ATOM   2920  N  N     . ARG A 1 980  ? 135.390 175.296 146.253 1.00 126.61 ?  852  ARG A N     1 
ATOM   2921  C  CA    . ARG A 1 980  ? 135.388 174.369 145.128 1.00 122.06 ?  852  ARG A CA    1 
ATOM   2922  C  C     . ARG A 1 980  ? 133.970 174.034 144.686 1.00 130.71 ?  852  ARG A C     1 
ATOM   2923  O  O     . ARG A 1 980  ? 133.709 173.907 143.487 1.00 132.69 ?  852  ARG A O     1 
ATOM   2924  C  CB    . ARG A 1 980  ? 136.140 173.090 145.480 1.00 116.88 ?  852  ARG A CB    1 
ATOM   2925  C  CG    . ARG A 1 980  ? 136.383 172.203 144.274 1.00 104.71 ?  852  ARG A CG    1 
ATOM   2926  C  CD    . ARG A 1 980  ? 136.551 170.753 144.668 1.00 98.64  ?  852  ARG A CD    1 
ATOM   2927  N  NE    . ARG A 1 980  ? 137.684 170.565 145.567 1.00 101.48 ?  852  ARG A NE    1 
ATOM   2928  C  CZ    . ARG A 1 980  ? 137.936 169.435 146.216 1.00 108.16 ?  852  ARG A CZ    1 
ATOM   2929  N  NH1   . ARG A 1 980  ? 137.132 168.391 146.068 1.00 110.65 ?  852  ARG A NH1   1 
ATOM   2930  N  NH2   . ARG A 1 980  ? 138.990 169.349 147.015 1.00 109.93 ?  852  ARG A NH2   1 
ATOM   2931  N  N     . SER A 1 981  ? 133.037 173.889 145.632 1.00 135.74 ?  853  SER A N     1 
ATOM   2932  C  CA    . SER A 1 981  ? 131.672 173.533 145.259 1.00 137.92 ?  853  SER A CA    1 
ATOM   2933  C  C     . SER A 1 981  ? 130.979 174.678 144.528 1.00 142.57 ?  853  SER A C     1 
ATOM   2934  O  O     . SER A 1 981  ? 130.259 174.449 143.543 1.00 140.65 ?  853  SER A O     1 
ATOM   2935  C  CB    . SER A 1 981  ? 130.879 173.122 146.500 1.00 132.14 ?  853  SER A CB    1 
ATOM   2936  O  OG    . SER A 1 981  ? 129.588 172.656 146.149 1.00 126.21 ?  853  SER A OG    1 
ATOM   2937  N  N     . THR A 1 982  ? 131.179 175.918 144.988 1.00 143.62 ?  854  THR A N     1 
ATOM   2938  C  CA    . THR A 1 982  ? 130.589 177.039 144.264 1.00 146.07 ?  854  THR A CA    1 
ATOM   2939  C  C     . THR A 1 982  ? 131.265 177.234 142.912 1.00 141.01 ?  854  THR A C     1 
ATOM   2940  O  O     . THR A 1 982  ? 130.593 177.588 141.938 1.00 137.44 ?  854  THR A O     1 
ATOM   2941  C  CB    . THR A 1 982  ? 130.635 178.329 145.096 1.00 144.70 ?  854  THR A CB    1 
ATOM   2942  O  OG1   . THR A 1 982  ? 130.042 179.400 144.351 1.00 141.89 ?  854  THR A OG1   1 
ATOM   2943  C  CG2   . THR A 1 982  ? 132.053 178.718 145.455 1.00 137.36 ?  854  THR A CG2   1 
ATOM   2944  N  N     . LEU A 1 983  ? 132.570 176.955 142.812 1.00 134.72 ?  855  LEU A N     1 
ATOM   2945  C  CA    . LEU A 1 983  ? 133.233 176.972 141.511 1.00 130.27 ?  855  LEU A CA    1 
ATOM   2946  C  C     . LEU A 1 983  ? 132.666 175.900 140.590 1.00 133.84 ?  855  LEU A C     1 
ATOM   2947  O  O     . LEU A 1 983  ? 132.544 176.107 139.376 1.00 132.68 ?  855  LEU A O     1 
ATOM   2948  C  CB    . LEU A 1 983  ? 134.737 176.773 141.692 1.00 120.88 ?  855  LEU A CB    1 
ATOM   2949  C  CG    . LEU A 1 983  ? 135.598 176.767 140.431 1.00 122.11 ?  855  LEU A CG    1 
ATOM   2950  C  CD1   . LEU A 1 983  ? 135.258 177.957 139.552 1.00 128.49 ?  855  LEU A CD1   1 
ATOM   2951  C  CD2   . LEU A 1 983  ? 137.067 176.782 140.809 1.00 119.67 ?  855  LEU A CD2   1 
ATOM   2952  N  N     . ASP A 1 984  ? 132.318 174.744 141.153 1.00 139.35 ?  856  ASP A N     1 
ATOM   2953  C  CA    . ASP A 1 984  ? 131.798 173.646 140.350 1.00 144.45 ?  856  ASP A CA    1 
ATOM   2954  C  C     . ASP A 1 984  ? 130.414 173.974 139.810 1.00 137.90 ?  856  ASP A C     1 
ATOM   2955  O  O     . ASP A 1 984  ? 130.134 173.763 138.625 1.00 133.27 ?  856  ASP A O     1 
ATOM   2956  C  CB    . ASP A 1 984  ? 131.770 172.365 141.182 1.00 155.54 ?  856  ASP A CB    1 
ATOM   2957  C  CG    . ASP A 1 984  ? 131.872 171.120 140.332 1.00 165.39 ?  856  ASP A CG    1 
ATOM   2958  O  OD1   . ASP A 1 984  ? 131.144 171.027 139.322 1.00 153.05 ?  856  ASP A OD1   1 
ATOM   2959  O  OD2   . ASP A 1 984  ? 132.690 170.238 140.669 1.00 194.58 -1 856  ASP A OD2   1 
ATOM   2960  N  N     . LYS A 1 985  ? 129.533 174.497 140.667 1.00 135.01 ?  857  LYS A N     1 
ATOM   2961  C  CA    . LYS A 1 985  ? 128.228 174.942 140.183 1.00 128.08 ?  857  LYS A CA    1 
ATOM   2962  C  C     . LYS A 1 985  ? 128.377 176.086 139.185 1.00 125.72 ?  857  LYS A C     1 
ATOM   2963  O  O     . LYS A 1 985  ? 127.628 176.167 138.201 1.00 123.86 ?  857  LYS A O     1 
ATOM   2964  C  CB    . LYS A 1 985  ? 127.339 175.356 141.355 1.00 121.57 ?  857  LYS A CB    1 
ATOM   2965  C  CG    . LYS A 1 985  ? 126.240 174.355 141.677 1.00 112.75 ?  857  LYS A CG    1 
ATOM   2966  C  CD    . LYS A 1 985  ? 126.338 173.876 143.113 1.00 107.00 ?  857  LYS A CD    1 
ATOM   2967  C  CE    . LYS A 1 985  ? 125.943 174.975 144.081 1.00 103.23 ?  857  LYS A CE    1 
ATOM   2968  N  NZ    . LYS A 1 985  ? 125.871 174.475 145.480 1.00 101.03 ?  857  LYS A NZ    1 
ATOM   2969  N  N     . GLN A 1 986  ? 129.354 176.966 139.413 1.00 126.79 ?  858  GLN A N     1 
ATOM   2970  C  CA    . GLN A 1 986  ? 129.653 178.044 138.478 1.00 124.02 ?  858  GLN A CA    1 
ATOM   2971  C  C     . GLN A 1 986  ? 129.958 177.500 137.088 1.00 124.07 ?  858  GLN A C     1 
ATOM   2972  O  O     . GLN A 1 986  ? 129.269 177.818 136.114 1.00 123.34 ?  858  GLN A O     1 
ATOM   2973  C  CB    . GLN A 1 986  ? 130.831 178.860 139.015 1.00 119.63 ?  858  GLN A CB    1 
ATOM   2974  C  CG    . GLN A 1 986  ? 131.150 180.111 138.234 1.00 115.65 ?  858  GLN A CG    1 
ATOM   2975  C  CD    . GLN A 1 986  ? 130.067 181.157 138.353 1.00 123.46 ?  858  GLN A CD    1 
ATOM   2976  O  OE1   . GLN A 1 986  ? 129.914 182.003 137.478 1.00 132.69 ?  858  GLN A OE1   1 
ATOM   2977  N  NE2   . GLN A 1 986  ? 129.310 181.110 139.443 1.00 123.17 ?  858  GLN A NE2   1 
ATOM   2978  N  N     . LEU A 1 987  ? 130.989 176.660 136.982 1.00 125.13 ?  859  LEU A N     1 
ATOM   2979  C  CA    . LEU A 1 987  ? 131.390 176.143 135.678 1.00 119.51 ?  859  LEU A CA    1 
ATOM   2980  C  C     . LEU A 1 987  ? 130.385 175.150 135.107 1.00 119.11 ?  859  LEU A C     1 
ATOM   2981  O  O     . LEU A 1 987  ? 130.422 174.878 133.902 1.00 116.98 ?  859  LEU A O     1 
ATOM   2982  C  CB    . LEU A 1 987  ? 132.780 175.516 135.769 1.00 113.78 ?  859  LEU A CB    1 
ATOM   2983  C  CG    . LEU A 1 987  ? 133.884 176.574 135.820 1.00 107.88 ?  859  LEU A CG    1 
ATOM   2984  C  CD1   . LEU A 1 987  ? 135.203 175.980 136.277 1.00 101.20 ?  859  LEU A CD1   1 
ATOM   2985  C  CD2   . LEU A 1 987  ? 134.033 177.251 134.464 1.00 106.51 ?  859  LEU A CD2   1 
ATOM   2986  N  N     . ARG A 1 988  ? 129.492 174.605 135.937 1.00 122.34 ?  860  ARG A N     1 
ATOM   2987  C  CA    . ARG A 1 988  ? 128.333 173.900 135.403 1.00 122.84 ?  860  ARG A CA    1 
ATOM   2988  C  C     . ARG A 1 988  ? 127.364 174.871 134.740 1.00 123.03 ?  860  ARG A C     1 
ATOM   2989  O  O     . ARG A 1 988  ? 126.736 174.539 133.727 1.00 119.61 ?  860  ARG A O     1 
ATOM   2990  C  CB    . ARG A 1 988  ? 127.635 173.117 136.518 1.00 122.71 ?  860  ARG A CB    1 
ATOM   2991  C  CG    . ARG A 1 988  ? 126.180 172.780 136.226 1.00 121.38 ?  860  ARG A CG    1 
ATOM   2992  C  CD    . ARG A 1 988  ? 125.597 171.861 137.282 1.00 115.69 ?  860  ARG A CD    1 
ATOM   2993  N  NE    . ARG A 1 988  ? 126.238 170.550 137.261 1.00 124.34 ?  860  ARG A NE    1 
ATOM   2994  C  CZ    . ARG A 1 988  ? 126.030 169.636 136.319 1.00 129.36 ?  860  ARG A CZ    1 
ATOM   2995  N  NH1   . ARG A 1 988  ? 125.199 169.888 135.317 1.00 129.16 ?  860  ARG A NH1   1 
ATOM   2996  N  NH2   . ARG A 1 988  ? 126.655 168.470 136.378 1.00 125.62 ?  860  ARG A NH2   1 
ATOM   2997  N  N     . LYS A 1 989  ? 127.239 176.081 135.292 1.00 125.24 ?  861  LYS A N     1 
ATOM   2998  C  CA    . LYS A 1 989  ? 126.320 177.066 134.727 1.00 127.24 ?  861  LYS A CA    1 
ATOM   2999  C  C     . LYS A 1 989  ? 126.750 177.491 133.326 1.00 126.05 ?  861  LYS A C     1 
ATOM   3000  O  O     . LYS A 1 989  ? 125.929 177.545 132.403 1.00 127.52 ?  861  LYS A O     1 
ATOM   3001  C  CB    . LYS A 1 989  ? 126.218 178.281 135.655 1.00 136.08 ?  861  LYS A CB    1 
ATOM   3002  C  CG    . LYS A 1 989  ? 125.915 179.597 134.947 1.00 140.70 ?  861  LYS A CG    1 
ATOM   3003  C  CD    . LYS A 1 989  ? 125.603 180.714 135.938 1.00 142.97 ?  861  LYS A CD    1 
ATOM   3004  C  CE    . LYS A 1 989  ? 126.794 181.030 136.833 1.00 144.18 ?  861  LYS A CE    1 
ATOM   3005  N  NZ    . LYS A 1 989  ? 127.895 181.707 136.093 1.00 141.50 ?  861  LYS A NZ    1 
ATOM   3006  N  N     . LYS A 1 990  ? 128.036 177.794 133.144 1.00 121.64 ?  862  LYS A N     1 
ATOM   3007  C  CA    . LYS A 1 990  ? 128.525 178.354 131.888 1.00 118.28 ?  862  LYS A CA    1 
ATOM   3008  C  C     . LYS A 1 990  ? 129.145 177.314 130.960 1.00 115.26 ?  862  LYS A C     1 
ATOM   3009  O  O     . LYS A 1 990  ? 128.741 177.209 129.799 1.00 112.59 ?  862  LYS A O     1 
ATOM   3010  C  CB    . LYS A 1 990  ? 129.534 179.473 132.172 1.00 118.00 ?  862  LYS A CB    1 
ATOM   3011  C  CG    . LYS A 1 990  ? 128.911 180.709 132.800 1.00 121.24 ?  862  LYS A CG    1 
ATOM   3012  C  CD    . LYS A 1 990  ? 129.882 181.394 133.737 1.00 129.69 ?  862  LYS A CD    1 
ATOM   3013  C  CE    . LYS A 1 990  ? 130.369 180.427 134.794 1.00 129.10 ?  862  LYS A CE    1 
ATOM   3014  N  NZ    . LYS A 1 990  ? 129.243 179.763 135.503 1.00 127.90 ?  862  LYS A NZ    1 
ATOM   3015  N  N     . MET A 1 991  ? 130.121 176.546 131.438 1.00 115.07 ?  863  MET A N     1 
ATOM   3016  C  CA    . MET A 1 991  ? 130.828 175.602 130.581 1.00 110.48 ?  863  MET A CA    1 
ATOM   3017  C  C     . MET A 1 991  ? 130.254 174.191 130.626 1.00 115.17 ?  863  MET A C     1 
ATOM   3018  O  O     . MET A 1 991  ? 130.729 173.327 129.880 1.00 111.44 ?  863  MET A O     1 
ATOM   3019  C  CB    . MET A 1 991  ? 132.316 175.568 130.945 1.00 107.19 ?  863  MET A CB    1 
ATOM   3020  C  CG    . MET A 1 991  ? 133.124 176.722 130.363 1.00 105.25 ?  863  MET A CG    1 
ATOM   3021  S  SD    . MET A 1 991  ? 133.299 176.652 128.566 1.00 91.57  ?  863  MET A SD    1 
ATOM   3022  C  CE    . MET A 1 991  ? 131.985 177.750 128.035 1.00 94.44  ?  863  MET A CE    1 
ATOM   3023  N  N     . LYS A 1 992  ? 129.250 173.941 131.469 1.00 117.95 ?  864  LYS A N     1 
ATOM   3024  C  CA    . LYS A 1 992  ? 128.559 172.651 131.533 1.00 118.98 ?  864  LYS A CA    1 
ATOM   3025  C  C     . LYS A 1 992  ? 129.547 171.509 131.782 1.00 119.05 ?  864  LYS A C     1 
ATOM   3026  O  O     . LYS A 1 992  ? 129.740 170.616 130.953 1.00 113.54 ?  864  LYS A O     1 
ATOM   3027  C  CB    . LYS A 1 992  ? 127.737 172.410 130.263 1.00 115.84 ?  864  LYS A CB    1 
ATOM   3028  C  CG    . LYS A 1 992  ? 126.459 173.227 130.195 1.00 107.08 ?  864  LYS A CG    1 
ATOM   3029  C  CD    . LYS A 1 992  ? 125.457 172.768 131.238 1.00 101.51 ?  864  LYS A CD    1 
ATOM   3030  C  CE    . LYS A 1 992  ? 124.145 173.512 131.091 1.00 98.02  ?  864  LYS A CE    1 
ATOM   3031  N  NZ    . LYS A 1 992  ? 123.589 173.357 129.719 1.00 99.85  ?  864  LYS A NZ    1 
ATOM   3032  N  N     . LEU A 1 993  ? 130.180 171.561 132.951 1.00 118.39 ?  865  LEU A N     1 
ATOM   3033  C  CA    . LEU A 1 993  ? 131.190 170.587 133.347 1.00 112.24 ?  865  LEU A CA    1 
ATOM   3034  C  C     . LEU A 1 993  ? 130.796 169.982 134.686 1.00 112.29 ?  865  LEU A C     1 
ATOM   3035  O  O     . LEU A 1 993  ? 130.916 170.635 135.729 1.00 114.73 ?  865  LEU A O     1 
ATOM   3036  C  CB    . LEU A 1 993  ? 132.574 171.231 133.411 1.00 111.36 ?  865  LEU A CB    1 
ATOM   3037  C  CG    . LEU A 1 993  ? 133.123 171.543 132.019 1.00 109.48 ?  865  LEU A CG    1 
ATOM   3038  C  CD1   . LEU A 1 993  ? 134.525 172.126 132.088 1.00 103.38 ?  865  LEU A CD1   1 
ATOM   3039  C  CD2   . LEU A 1 993  ? 133.100 170.276 131.183 1.00 108.59 ?  865  LEU A CD2   1 
ATOM   3040  N  N     . LYS A 1 994  ? 130.319 168.740 134.646 1.00 114.16 ?  866  LYS A N     1 
ATOM   3041  C  CA    . LYS A 1 994  ? 129.959 168.020 135.855 1.00 119.87 ?  866  LYS A CA    1 
ATOM   3042  C  C     . LYS A 1 994  ? 131.171 167.916 136.780 1.00 123.43 ?  866  LYS A C     1 
ATOM   3043  O  O     . LYS A 1 994  ? 132.314 167.877 136.314 1.00 120.92 ?  866  LYS A O     1 
ATOM   3044  C  CB    . LYS A 1 994  ? 129.445 166.625 135.492 1.00 124.89 ?  866  LYS A CB    1 
ATOM   3045  C  CG    . LYS A 1 994  ? 128.599 165.940 136.555 1.00 127.46 ?  866  LYS A CG    1 
ATOM   3046  C  CD    . LYS A 1 994  ? 128.080 164.595 136.076 1.00 128.29 ?  866  LYS A CD    1 
ATOM   3047  C  CE    . LYS A 1 994  ? 129.197 163.568 136.001 1.00 133.36 ?  866  LYS A CE    1 
ATOM   3048  N  NZ    . LYS A 1 994  ? 129.789 163.300 137.341 1.00 129.80 ?  866  LYS A NZ    1 
ATOM   3049  N  N     . PRO A 1 995  ? 130.956 167.902 138.096 1.00 128.05 ?  867  PRO A N     1 
ATOM   3050  C  CA    . PRO A 1 995  ? 132.072 167.657 139.017 1.00 132.94 ?  867  PRO A CA    1 
ATOM   3051  C  C     . PRO A 1 995  ? 132.733 166.313 138.741 1.00 134.90 ?  867  PRO A C     1 
ATOM   3052  O  O     . PRO A 1 995  ? 132.060 165.313 138.480 1.00 133.56 ?  867  PRO A O     1 
ATOM   3053  C  CB    . PRO A 1 995  ? 131.406 167.686 140.399 1.00 140.28 ?  867  PRO A CB    1 
ATOM   3054  C  CG    . PRO A 1 995  ? 129.927 167.567 140.135 1.00 132.54 ?  867  PRO A CG    1 
ATOM   3055  C  CD    . PRO A 1 995  ? 129.715 168.230 138.817 1.00 129.50 ?  867  PRO A CD    1 
ATOM   3056  N  N     . VAL A 1 996  ? 134.066 166.299 138.791 1.00 128.73 ?  868  VAL A N     1 
ATOM   3057  C  CA    . VAL A 1 996  ? 134.865 165.107 138.535 1.00 115.28 ?  868  VAL A CA    1 
ATOM   3058  C  C     . VAL A 1 996  ? 135.770 164.856 139.740 1.00 105.22 ?  868  VAL A C     1 
ATOM   3059  O  O     . VAL A 1 996  ? 135.813 165.650 140.680 1.00 107.22 ?  868  VAL A O     1 
ATOM   3060  C  CB    . VAL A 1 996  ? 135.700 165.227 137.243 1.00 107.19 ?  868  VAL A CB    1 
ATOM   3061  C  CG1   . VAL A 1 996  ? 134.833 165.697 136.086 1.00 107.67 ?  868  VAL A CG1   1 
ATOM   3062  C  CG2   . VAL A 1 996  ? 136.873 166.168 137.461 1.00 105.01 ?  868  VAL A CG2   1 
ATOM   3063  N  N     . MET A 1 997  ? 136.499 163.732 139.709 1.00 97.11  ?  869  MET A N     1 
ATOM   3064  C  CA    . MET A 1 997  ? 137.429 163.436 140.785 1.00 97.71  ?  869  MET A CA    1 
ATOM   3065  C  C     . MET A 1 997  ? 138.888 163.497 140.348 1.00 99.71  ?  869  MET A C     1 
ATOM   3066  O  O     . MET A 1 997  ? 139.759 163.682 141.202 1.00 106.17 ?  869  MET A O     1 
ATOM   3067  C  CB    . MET A 1 997  ? 137.113 162.063 141.410 1.00 100.77 ?  869  MET A CB    1 
ATOM   3068  C  CG    . MET A 1 997  ? 137.783 160.820 140.800 1.00 104.81 ?  869  MET A CG    1 
ATOM   3069  S  SD    . MET A 1 997  ? 139.449 160.564 141.441 1.00 97.71  ?  869  MET A SD    1 
ATOM   3070  C  CE    . MET A 1 997  ? 140.071 159.180 140.498 1.00 101.40 ?  869  MET A CE    1 
ATOM   3071  N  N     . ARG A 1 998  ? 139.171 163.412 139.046 1.00 100.12 ?  870  ARG A N     1 
ATOM   3072  C  CA    . ARG A 1 998  ? 140.529 163.558 138.542 1.00 101.44 ?  870  ARG A CA    1 
ATOM   3073  C  C     . ARG A 1 998  ? 140.513 164.256 137.191 1.00 87.56  ?  870  ARG A C     1 
ATOM   3074  O  O     . ARG A 1 998  ? 139.570 164.116 136.406 1.00 88.24  ?  870  ARG A O     1 
ATOM   3075  C  CB    . ARG A 1 998  ? 141.251 162.213 138.424 1.00 117.93 ?  870  ARG A CB    1 
ATOM   3076  C  CG    . ARG A 1 998  ? 140.508 161.123 137.665 1.00 124.96 ?  870  ARG A CG    1 
ATOM   3077  C  CD    . ARG A 1 998  ? 141.364 159.853 137.633 1.00 124.52 ?  870  ARG A CD    1 
ATOM   3078  N  NE    . ARG A 1 998  ? 140.652 158.692 137.108 1.00 116.77 ?  870  ARG A NE    1 
ATOM   3079  C  CZ    . ARG A 1 998  ? 140.834 158.137 135.915 1.00 107.61 ?  870  ARG A CZ    1 
ATOM   3080  N  NH1   . ARG A 1 998  ? 140.103 157.086 135.579 1.00 102.31 ?  870  ARG A NH1   1 
ATOM   3081  N  NH2   . ARG A 1 998  ? 141.752 158.596 135.071 1.00 107.74 ?  870  ARG A NH2   1 
ATOM   3082  N  N     . MET A 1 999  ? 141.585 165.004 136.933 1.00 79.86  ?  871  MET A N     1 
ATOM   3083  C  CA    . MET A 1 999  ? 141.726 165.800 135.719 1.00 77.50  ?  871  MET A CA    1 
ATOM   3084  C  C     . MET A 1 999  ? 142.154 164.873 134.586 1.00 76.50  ?  871  MET A C     1 
ATOM   3085  O  O     . MET A 1 999  ? 143.326 164.781 134.213 1.00 76.81  ?  871  MET A O     1 
ATOM   3086  C  CB    . MET A 1 999  ? 142.722 166.930 135.942 1.00 78.13  ?  871  MET A CB    1 
ATOM   3087  C  CG    . MET A 1 999  ? 142.086 168.196 136.487 1.00 80.64  ?  871  MET A CG    1 
ATOM   3088  S  SD    . MET A 1 999  ? 140.836 167.856 137.746 1.00 92.23  ?  871  MET A SD    1 
ATOM   3089  C  CE    . MET A 1 999  ? 141.855 167.389 139.144 1.00 89.45  ?  871  MET A CE    1 
ATOM   3090  N  N     . ASN A 1 1000 ? 141.174 164.175 134.029 1.00 79.72  ?  872  ASN A N     1 
ATOM   3091  C  CA    . ASN A 1 1000 ? 141.411 163.314 132.879 1.00 83.78  ?  872  ASN A CA    1 
ATOM   3092  C  C     . ASN A 1 1000 ? 141.691 164.183 131.653 1.00 83.50  ?  872  ASN A C     1 
ATOM   3093  O  O     . ASN A 1 1000 ? 141.820 165.408 131.735 1.00 84.84  ?  872  ASN A O     1 
ATOM   3094  C  CB    . ASN A 1 1000 ? 140.228 162.379 132.659 1.00 96.56  ?  872  ASN A CB    1 
ATOM   3095  C  CG    . ASN A 1 1000 ? 138.914 163.125 132.532 1.00 101.95 ?  872  ASN A CG    1 
ATOM   3096  O  OD1   . ASN A 1 1000 ? 138.805 164.114 131.805 1.00 97.91  ?  872  ASN A OD1   1 
ATOM   3097  N  ND2   . ASN A 1 1000 ? 137.908 162.658 133.253 1.00 107.84 ?  872  ASN A ND2   1 
ATOM   3098  N  N     . GLY A 1 1001 ? 141.800 163.538 130.491 1.00 85.68  ?  873  GLY A N     1 
ATOM   3099  C  CA    . GLY A 1 1001 ? 142.154 164.265 129.282 1.00 85.74  ?  873  GLY A CA    1 
ATOM   3100  C  C     . GLY A 1 1001 ? 141.083 165.246 128.837 1.00 89.33  ?  873  GLY A C     1 
ATOM   3101  O  O     . GLY A 1 1001 ? 141.378 166.408 128.543 1.00 92.98  ?  873  GLY A O     1 
ATOM   3102  N  N     . ASN A 1 1002 ? 139.829 164.790 128.768 1.00 92.39  ?  874  ASN A N     1 
ATOM   3103  C  CA    . ASN A 1 1002 ? 138.756 165.627 128.232 1.00 95.36  ?  874  ASN A CA    1 
ATOM   3104  C  C     . ASN A 1 1002 ? 138.535 166.868 129.091 1.00 92.79  ?  874  ASN A C     1 
ATOM   3105  O  O     . ASN A 1 1002 ? 138.502 167.997 128.581 1.00 94.61  ?  874  ASN A O     1 
ATOM   3106  C  CB    . ASN A 1 1002 ? 137.465 164.813 128.123 1.00 102.92 ?  874  ASN A CB    1 
ATOM   3107  C  CG    . ASN A 1 1002 ? 136.271 165.661 127.723 1.00 106.67 ?  874  ASN A CG    1 
ATOM   3108  O  OD1   . ASN A 1 1002 ? 136.395 166.598 126.935 1.00 104.93 ?  874  ASN A OD1   1 
ATOM   3109  N  ND2   . ASN A 1 1002 ? 135.105 165.335 128.270 1.00 103.87 ?  874  ASN A ND2   1 
ATOM   3110  N  N     . TYR A 1 1003 ? 138.355 166.669 130.400 1.00 87.14  ?  875  TYR A N     1 
ATOM   3111  C  CA    . TYR A 1 1003 ? 138.164 167.796 131.307 1.00 81.18  ?  875  TYR A CA    1 
ATOM   3112  C  C     . TYR A 1 1003 ? 139.339 168.761 131.240 1.00 78.63  ?  875  TYR A C     1 
ATOM   3113  O  O     . TYR A 1 1003 ? 139.153 169.982 131.302 1.00 82.84  ?  875  TYR A O     1 
ATOM   3114  C  CB    . TYR A 1 1003 ? 137.961 167.284 132.734 1.00 85.97  ?  875  TYR A CB    1 
ATOM   3115  C  CG    . TYR A 1 1003 ? 137.663 168.362 133.754 1.00 95.75  ?  875  TYR A CG    1 
ATOM   3116  C  CD1   . TYR A 1 1003 ? 138.692 169.032 134.405 1.00 99.38  ?  875  TYR A CD1   1 
ATOM   3117  C  CD2   . TYR A 1 1003 ? 136.355 168.704 134.074 1.00 99.20  ?  875  TYR A CD2   1 
ATOM   3118  C  CE1   . TYR A 1 1003 ? 138.428 170.013 135.340 1.00 96.79  ?  875  TYR A CE1   1 
ATOM   3119  C  CE2   . TYR A 1 1003 ? 136.082 169.688 135.010 1.00 102.81 ?  875  TYR A CE2   1 
ATOM   3120  C  CZ    . TYR A 1 1003 ? 137.123 170.339 135.639 1.00 95.66  ?  875  TYR A CZ    1 
ATOM   3121  O  OH    . TYR A 1 1003 ? 136.862 171.319 136.571 1.00 84.21  ?  875  TYR A OH    1 
ATOM   3122  N  N     . ALA A 1 1004 ? 140.559 168.232 131.111 1.00 80.77  ?  876  ALA A N     1 
ATOM   3123  C  CA    . ALA A 1 1004 ? 141.732 169.095 131.020 1.00 83.30  ?  876  ALA A CA    1 
ATOM   3124  C  C     . ALA A 1 1004 ? 141.687 169.958 129.767 1.00 86.58  ?  876  ALA A C     1 
ATOM   3125  O  O     . ALA A 1 1004 ? 142.006 171.152 129.815 1.00 92.24  ?  876  ALA A O     1 
ATOM   3126  C  CB    . ALA A 1 1004 ? 143.008 168.255 131.043 1.00 88.05  ?  876  ALA A CB    1 
ATOM   3127  N  N     . ARG A 1 1005 ? 141.299 169.372 128.632 1.00 89.55  ?  877  ARG A N     1 
ATOM   3128  C  CA    . ARG A 1 1005 ? 141.165 170.154 127.408 1.00 92.75  ?  877  ARG A CA    1 
ATOM   3129  C  C     . ARG A 1 1005 ? 140.113 171.243 127.566 1.00 97.25  ?  877  ARG A C     1 
ATOM   3130  O  O     . ARG A 1 1005 ? 140.392 172.427 127.341 1.00 99.51  ?  877  ARG A O     1 
ATOM   3131  C  CB    . ARG A 1 1005 ? 140.812 169.245 126.230 1.00 97.87  ?  877  ARG A CB    1 
ATOM   3132  C  CG    . ARG A 1 1005 ? 141.866 168.215 125.892 1.00 100.04 ?  877  ARG A CG    1 
ATOM   3133  C  CD    . ARG A 1 1005 ? 141.402 167.308 124.765 1.00 105.11 ?  877  ARG A CD    1 
ATOM   3134  N  NE    . ARG A 1 1005 ? 142.268 166.142 124.635 1.00 110.15 ?  877  ARG A NE    1 
ATOM   3135  C  CZ    . ARG A 1 1005 ? 142.072 164.994 125.274 1.00 108.42 ?  877  ARG A CZ    1 
ATOM   3136  N  NH1   . ARG A 1 1005 ? 141.030 164.856 126.081 1.00 103.18 ?  877  ARG A NH1   1 
ATOM   3137  N  NH2   . ARG A 1 1005 ? 142.913 163.984 125.102 1.00 105.49 ?  877  ARG A NH2   1 
ATOM   3138  N  N     . ARG A 1 1006 ? 138.896 170.864 127.966 1.00 97.02  ?  878  ARG A N     1 
ATOM   3139  C  CA    . ARG A 1 1006 ? 137.798 171.827 127.935 1.00 101.37 ?  878  ARG A CA    1 
ATOM   3140  C  C     . ARG A 1 1006 ? 137.957 172.909 128.999 1.00 100.38 ?  878  ARG A C     1 
ATOM   3141  O  O     . ARG A 1 1006 ? 137.593 174.068 128.765 1.00 102.93 ?  878  ARG A O     1 
ATOM   3142  C  CB    . ARG A 1 1006 ? 136.453 171.122 128.099 1.00 99.46  ?  878  ARG A CB    1 
ATOM   3143  C  CG    . ARG A 1 1006 ? 135.276 171.992 127.670 1.00 99.06  ?  878  ARG A CG    1 
ATOM   3144  C  CD    . ARG A 1 1006 ? 133.943 171.339 127.971 1.00 94.15  ?  878  ARG A CD    1 
ATOM   3145  N  NE    . ARG A 1 1006 ? 133.827 170.014 127.372 1.00 98.67  ?  878  ARG A NE    1 
ATOM   3146  C  CZ    . ARG A 1 1006 ? 132.825 169.175 127.609 1.00 101.51 ?  878  ARG A CZ    1 
ATOM   3147  N  NH1   . ARG A 1 1006 ? 131.849 169.523 128.437 1.00 101.44 ?  878  ARG A NH1   1 
ATOM   3148  N  NH2   . ARG A 1 1006 ? 132.798 167.988 127.020 1.00 99.54  ?  878  ARG A NH2   1 
ATOM   3149  N  N     . LEU A 1 1007 ? 138.488 172.559 130.173 1.00 93.80  ?  879  LEU A N     1 
ATOM   3150  C  CA    . LEU A 1 1007 ? 138.574 173.541 131.250 1.00 91.97  ?  879  LEU A CA    1 
ATOM   3151  C  C     . LEU A 1 1007 ? 139.650 174.582 130.971 1.00 94.08  ?  879  LEU A C     1 
ATOM   3152  O  O     . LEU A 1 1007 ? 139.425 175.783 131.165 1.00 99.77  ?  879  LEU A O     1 
ATOM   3153  C  CB    . LEU A 1 1007 ? 138.845 172.852 132.586 1.00 89.07  ?  879  LEU A CB    1 
ATOM   3154  C  CG    . LEU A 1 1007 ? 138.704 173.810 133.773 1.00 88.49  ?  879  LEU A CG    1 
ATOM   3155  C  CD1   . LEU A 1 1007 ? 137.237 174.109 134.021 1.00 92.59  ?  879  LEU A CD1   1 
ATOM   3156  C  CD2   . LEU A 1 1007 ? 139.377 173.283 135.033 1.00 81.35  ?  879  LEU A CD2   1 
ATOM   3157  N  N     . MET A 1 1008 ? 140.820 174.145 130.508 1.00 98.35  ?  880  MET A N     1 
ATOM   3158  C  CA    . MET A 1 1008 ? 141.933 175.060 130.293 1.00 105.47 ?  880  MET A CA    1 
ATOM   3159  C  C     . MET A 1 1008 ? 141.668 175.929 129.072 1.00 102.91 ?  880  MET A C     1 
ATOM   3160  O  O     . MET A 1 1008 ? 142.351 175.813 128.051 1.00 103.06 ?  880  MET A O     1 
ATOM   3161  C  CB    . MET A 1 1008 ? 143.241 174.286 130.134 1.00 109.65 ?  880  MET A CB    1 
ATOM   3162  C  CG    . MET A 1 1008 ? 143.645 173.510 131.376 1.00 108.46 ?  880  MET A CG    1 
ATOM   3163  S  SD    . MET A 1 1008 ? 145.343 172.917 131.307 1.00 98.55  ?  880  MET A SD    1 
ATOM   3164  C  CE    . MET A 1 1008 ? 145.329 172.069 129.730 1.00 103.89 ?  880  MET A CE    1 
ATOM   3165  N  N     . THR A 1 1009 ? 140.671 176.803 129.180 1.00 103.92 ?  881  THR A N     1 
ATOM   3166  C  CA    . THR A 1 1009 ? 140.225 177.640 128.080 1.00 111.46 ?  881  THR A CA    1 
ATOM   3167  C  C     . THR A 1 1009 ? 139.954 179.041 128.607 1.00 120.94 ?  881  THR A C     1 
ATOM   3168  O  O     . THR A 1 1009 ? 139.527 179.215 129.752 1.00 124.64 ?  881  THR A O     1 
ATOM   3169  C  CB    . THR A 1 1009 ? 138.961 177.068 127.418 1.00 119.07 ?  881  THR A CB    1 
ATOM   3170  O  OG1   . THR A 1 1009 ? 137.989 176.760 128.426 1.00 116.56 ?  881  THR A OG1   1 
ATOM   3171  C  CG2   . THR A 1 1009 ? 139.289 175.806 126.633 1.00 113.44 ?  881  THR A CG2   1 
ATOM   3172  N  N     . ARG A 1 1010 ? 140.211 180.040 127.758 1.00 118.87 ?  882  ARG A N     1 
ATOM   3173  C  CA    . ARG A 1 1010 ? 139.971 181.426 128.147 1.00 117.20 ?  882  ARG A CA    1 
ATOM   3174  C  C     . ARG A 1 1010 ? 138.509 181.666 128.505 1.00 124.66 ?  882  ARG A C     1 
ATOM   3175  O  O     . ARG A 1 1010 ? 138.202 182.557 129.308 1.00 127.18 ?  882  ARG A O     1 
ATOM   3176  C  CB    . ARG A 1 1010 ? 140.406 182.359 127.019 1.00 111.80 ?  882  ARG A CB    1 
ATOM   3177  C  CG    . ARG A 1 1010 ? 140.729 183.768 127.459 1.00 115.10 ?  882  ARG A CG    1 
ATOM   3178  C  CD    . ARG A 1 1010 ? 141.370 184.542 126.326 1.00 116.57 ?  882  ARG A CD    1 
ATOM   3179  N  NE    . ARG A 1 1010 ? 142.013 185.764 126.793 1.00 113.45 ?  882  ARG A NE    1 
ATOM   3180  C  CZ    . ARG A 1 1010 ? 142.670 186.605 126.003 1.00 112.76 ?  882  ARG A CZ    1 
ATOM   3181  N  NH1   . ARG A 1 1010 ? 142.770 186.354 124.705 1.00 111.73 ?  882  ARG A NH1   1 
ATOM   3182  N  NH2   . ARG A 1 1010 ? 143.226 187.697 126.509 1.00 115.80 ?  882  ARG A NH2   1 
ATOM   3183  N  N     . GLU A 1 1011 ? 137.599 180.881 127.923 1.00 134.04 ?  883  GLU A N     1 
ATOM   3184  C  CA    . GLU A 1 1011 ? 136.183 180.996 128.256 1.00 137.42 ?  883  GLU A CA    1 
ATOM   3185  C  C     . GLU A 1 1011 ? 135.939 180.651 129.720 1.00 134.73 ?  883  GLU A C     1 
ATOM   3186  O  O     . GLU A 1 1011 ? 135.315 181.422 130.457 1.00 135.91 ?  883  GLU A O     1 
ATOM   3187  C  CB    . GLU A 1 1011 ? 135.353 180.085 127.349 1.00 144.17 ?  883  GLU A CB    1 
ATOM   3188  C  CG    . GLU A 1 1011 ? 135.618 180.230 125.853 1.00 165.07 ?  883  GLU A CG    1 
ATOM   3189  C  CD    . GLU A 1 1011 ? 136.843 179.462 125.389 1.00 174.23 ?  883  GLU A CD    1 
ATOM   3190  O  OE1   . GLU A 1 1011 ? 137.940 179.700 125.935 1.00 153.93 ?  883  GLU A OE1   1 
ATOM   3191  O  OE2   . GLU A 1 1011 ? 136.706 178.609 124.486 1.00 268.97 -1 883  GLU A OE2   1 
ATOM   3192  N  N     . ALA A 1 1012 ? 136.429 179.489 130.159 1.00 136.20 ?  884  ALA A N     1 
ATOM   3193  C  CA    . ALA A 1 1012 ? 136.309 179.115 131.563 1.00 136.68 ?  884  ALA A CA    1 
ATOM   3194  C  C     . ALA A 1 1012 ? 137.074 180.067 132.467 1.00 140.56 ?  884  ALA A C     1 
ATOM   3195  O  O     . ALA A 1 1012 ? 136.740 180.194 133.647 1.00 141.21 ?  884  ALA A O     1 
ATOM   3196  C  CB    . ALA A 1 1012 ? 136.799 177.681 131.772 1.00 131.49 ?  884  ALA A CB    1 
ATOM   3197  N  N     . VAL A 1 1013 ? 138.073 180.763 131.933 1.00 141.78 ?  885  VAL A N     1 
ATOM   3198  C  CA    . VAL A 1 1013 ? 138.831 181.706 132.744 1.00 142.74 ?  885  VAL A CA    1 
ATOM   3199  C  C     . VAL A 1 1013 ? 138.013 182.970 132.990 1.00 149.72 ?  885  VAL A C     1 
ATOM   3200  O  O     . VAL A 1 1013 ? 137.923 183.462 134.122 1.00 151.98 ?  885  VAL A O     1 
ATOM   3201  C  CB    . VAL A 1 1013 ? 140.180 181.996 132.069 1.00 137.53 ?  885  VAL A CB    1 
ATOM   3202  C  CG1   . VAL A 1 1013 ? 140.727 183.349 132.447 1.00 140.05 ?  885  VAL A CG1   1 
ATOM   3203  C  CG2   . VAL A 1 1013 ? 141.142 180.904 132.400 1.00 132.09 ?  885  VAL A CG2   1 
ATOM   3204  N  N     . GLU A 1 1014 ? 137.362 183.490 131.947 1.00 150.68 ?  886  GLU A N     1 
ATOM   3205  C  CA    . GLU A 1 1014 ? 136.418 184.577 132.177 1.00 153.90 ?  886  GLU A CA    1 
ATOM   3206  C  C     . GLU A 1 1014 ? 135.189 184.107 132.947 1.00 151.14 ?  886  GLU A C     1 
ATOM   3207  O  O     . GLU A 1 1014 ? 134.484 184.932 133.541 1.00 154.21 ?  886  GLU A O     1 
ATOM   3208  C  CB    . GLU A 1 1014 ? 135.999 185.216 130.852 1.00 158.32 ?  886  GLU A CB    1 
ATOM   3209  C  CG    . GLU A 1 1014 ? 137.115 185.996 130.180 1.00 165.41 ?  886  GLU A CG    1 
ATOM   3210  C  CD    . GLU A 1 1014 ? 136.608 186.953 129.123 1.00 175.49 ?  886  GLU A CD    1 
ATOM   3211  O  OE1   . GLU A 1 1014 ? 135.389 187.226 129.101 1.00 172.51 ?  886  GLU A OE1   1 
ATOM   3212  O  OE2   . GLU A 1 1014 ? 137.428 187.430 128.312 1.00 198.11 -1 886  GLU A OE2   1 
ATOM   3213  N  N     . ALA A 1 1015 ? 134.926 182.800 132.951 1.00 150.16 ?  887  ALA A N     1 
ATOM   3214  C  CA    . ALA A 1 1015 ? 133.838 182.255 133.754 1.00 156.51 ?  887  ALA A CA    1 
ATOM   3215  C  C     . ALA A 1 1015 ? 134.201 182.234 135.234 1.00 160.23 ?  887  ALA A C     1 
ATOM   3216  O  O     . ALA A 1 1015 ? 133.351 182.498 136.092 1.00 160.51 ?  887  ALA A O     1 
ATOM   3217  C  CB    . ALA A 1 1015 ? 133.488 180.851 133.263 1.00 150.50 ?  887  ALA A CB    1 
ATOM   3218  N  N     . VAL A 1 1016 ? 135.454 181.902 135.553 1.00 158.89 ?  888  VAL A N     1 
ATOM   3219  C  CA    . VAL A 1 1016 ? 135.911 181.972 136.938 1.00 164.02 ?  888  VAL A CA    1 
ATOM   3220  C  C     . VAL A 1 1016 ? 136.141 183.415 137.363 1.00 159.54 ?  888  VAL A C     1 
ATOM   3221  O  O     . VAL A 1 1016 ? 136.202 183.700 138.566 1.00 157.37 ?  888  VAL A O     1 
ATOM   3222  C  CB    . VAL A 1 1016 ? 137.184 181.135 137.157 1.00 161.91 ?  888  VAL A CB    1 
ATOM   3223  C  CG1   . VAL A 1 1016 ? 138.418 181.874 136.668 1.00 155.18 ?  888  VAL A CG1   1 
ATOM   3224  C  CG2   . VAL A 1 1016 ? 137.333 180.764 138.625 1.00 161.91 ?  888  VAL A CG2   1 
ATOM   3225  N  N     . CYS A 1 1017 ? 136.269 184.336 136.403 1.00 157.44 ?  889  CYS A N     1 
ATOM   3226  C  CA    . CYS A 1 1017 ? 136.227 185.754 136.739 1.00 158.47 ?  889  CYS A CA    1 
ATOM   3227  C  C     . CYS A 1 1017 ? 134.914 186.131 137.416 1.00 160.82 ?  889  CYS A C     1 
ATOM   3228  O  O     . CYS A 1 1017 ? 134.886 187.039 138.253 1.00 162.02 ?  889  CYS A O     1 
ATOM   3229  C  CB    . CYS A 1 1017 ? 136.428 186.601 135.483 1.00 162.77 ?  889  CYS A CB    1 
ATOM   3230  S  SG    . CYS A 1 1017 ? 138.082 186.522 134.767 1.00 169.98 ?  889  CYS A SG    1 
ATOM   3231  N  N     . GLU A 1 1018 ? 133.825 185.432 137.082 1.00 160.91 ?  890  GLU A N     1 
ATOM   3232  C  CA    . GLU A 1 1018 ? 132.494 185.852 137.511 1.00 163.97 ?  890  GLU A CA    1 
ATOM   3233  C  C     . GLU A 1 1018 ? 132.359 185.890 139.030 1.00 156.50 ?  890  GLU A C     1 
ATOM   3234  O  O     . GLU A 1 1018 ? 131.647 186.748 139.565 1.00 155.88 ?  890  GLU A O     1 
ATOM   3235  C  CB    . GLU A 1 1018 ? 131.444 184.923 136.898 1.00 166.50 ?  890  GLU A CB    1 
ATOM   3236  C  CG    . GLU A 1 1018 ? 129.999 185.329 137.131 1.00 171.61 ?  890  GLU A CG    1 
ATOM   3237  C  CD    . GLU A 1 1018 ? 129.027 184.494 136.316 1.00 170.43 ?  890  GLU A CD    1 
ATOM   3238  O  OE1   . GLU A 1 1018 ? 129.217 184.388 135.086 1.00 158.33 ?  890  GLU A OE1   1 
ATOM   3239  O  OE2   . GLU A 1 1018 ? 128.085 183.925 136.907 1.00 222.65 -1 890  GLU A OE2   1 
ATOM   3240  N  N     . LEU A 1 1019 ? 133.041 184.992 139.742 1.00 150.06 ?  891  LEU A N     1 
ATOM   3241  C  CA    . LEU A 1 1019 ? 132.895 184.920 141.190 1.00 141.46 ?  891  LEU A CA    1 
ATOM   3242  C  C     . LEU A 1 1019 ? 134.028 185.581 141.969 1.00 151.04 ?  891  LEU A C     1 
ATOM   3243  O  O     . LEU A 1 1019 ? 133.858 185.832 143.166 1.00 149.08 ?  891  LEU A O     1 
ATOM   3244  C  CB    . LEU A 1 1019 ? 132.762 183.460 141.643 1.00 131.13 ?  891  LEU A CB    1 
ATOM   3245  C  CG    . LEU A 1 1019 ? 131.360 182.865 141.494 1.00 120.66 ?  891  LEU A CG    1 
ATOM   3246  C  CD1   . LEU A 1 1019 ? 131.307 181.448 142.045 1.00 123.33 ?  891  LEU A CD1   1 
ATOM   3247  C  CD2   . LEU A 1 1019 ? 130.331 183.751 142.178 1.00 114.08 ?  891  LEU A CD2   1 
ATOM   3248  N  N     . VAL A 1 1020 ? 135.164 185.870 141.347 1.00 159.72 ?  892  VAL A N     1 
ATOM   3249  C  CA    . VAL A 1 1020 ? 136.256 186.525 142.074 1.00 165.86 ?  892  VAL A CA    1 
ATOM   3250  C  C     . VAL A 1 1020 ? 135.935 188.012 142.213 1.00 172.74 ?  892  VAL A C     1 
ATOM   3251  O  O     . VAL A 1 1020 ? 135.600 188.662 141.210 1.00 173.18 ?  892  VAL A O     1 
ATOM   3252  C  CB    . VAL A 1 1020 ? 137.597 186.301 141.370 1.00 157.17 ?  892  VAL A CB    1 
ATOM   3253  C  CG1   . VAL A 1 1020 ? 137.497 186.583 139.892 1.00 149.21 ?  892  VAL A CG1   1 
ATOM   3254  C  CG2   . VAL A 1 1020 ? 138.686 187.161 141.997 1.00 161.49 ?  892  VAL A CG2   1 
ATOM   3255  N  N     . PRO A 1 1021 ? 136.003 188.579 143.430 1.00 172.86 ?  893  PRO A N     1 
ATOM   3256  C  CA    . PRO A 1 1021 ? 135.564 189.970 143.629 1.00 172.26 ?  893  PRO A CA    1 
ATOM   3257  C  C     . PRO A 1 1021 ? 136.435 191.007 142.933 1.00 179.57 ?  893  PRO A C     1 
ATOM   3258  O  O     . PRO A 1 1021 ? 135.916 191.868 142.216 1.00 182.47 ?  893  PRO A O     1 
ATOM   3259  C  CB    . PRO A 1 1021 ? 135.617 190.137 145.154 1.00 169.31 ?  893  PRO A CB    1 
ATOM   3260  C  CG    . PRO A 1 1021 ? 136.598 189.114 145.616 1.00 168.33 ?  893  PRO A CG    1 
ATOM   3261  C  CD    . PRO A 1 1021 ? 136.422 187.945 144.692 1.00 168.60 ?  893  PRO A CD    1 
ATOM   3262  N  N     . SER A 1 1022 ? 137.749 190.942 143.134 1.00 184.05 ?  894  SER A N     1 
ATOM   3263  C  CA    . SER A 1 1022 ? 138.642 191.945 142.573 1.00 189.58 ?  894  SER A CA    1 
ATOM   3264  C  C     . SER A 1 1022 ? 138.730 191.808 141.055 1.00 195.89 ?  894  SER A C     1 
ATOM   3265  O  O     . SER A 1 1022 ? 138.467 190.748 140.480 1.00 192.73 ?  894  SER A O     1 
ATOM   3266  C  CB    . SER A 1 1022 ? 140.036 191.830 143.191 1.00 189.09 ?  894  SER A CB    1 
ATOM   3267  O  OG    . SER A 1 1022 ? 140.921 192.787 142.633 1.00 187.01 ?  894  SER A OG    1 
ATOM   3268  N  N     . GLU A 1 1023 ? 139.109 192.908 140.403 1.00 200.88 ?  895  GLU A N     1 
ATOM   3269  C  CA    . GLU A 1 1023 ? 139.208 192.961 138.951 1.00 203.76 ?  895  GLU A CA    1 
ATOM   3270  C  C     . GLU A 1 1023 ? 140.643 192.984 138.444 1.00 199.66 ?  895  GLU A C     1 
ATOM   3271  O  O     . GLU A 1 1023 ? 140.853 193.041 137.227 1.00 195.13 ?  895  GLU A O     1 
ATOM   3272  C  CB    . GLU A 1 1023 ? 138.449 194.180 138.408 1.00 207.32 ?  895  GLU A CB    1 
ATOM   3273  C  CG    . GLU A 1 1023 ? 136.956 193.946 138.199 1.00 206.29 ?  895  GLU A CG    1 
ATOM   3274  C  CD    . GLU A 1 1023 ? 136.251 193.484 139.460 1.00 214.70 ?  895  GLU A CD    1 
ATOM   3275  O  OE1   . GLU A 1 1023 ? 136.581 194.000 140.548 1.00 209.81 ?  895  GLU A OE1   1 
ATOM   3276  O  OE2   . GLU A 1 1023 ? 135.373 192.600 139.364 1.00 253.07 -1 895  GLU A OE2   1 
ATOM   3277  N  N     . GLU A 1 1024 ? 141.635 192.946 139.333 1.00 199.09 ?  896  GLU A N     1 
ATOM   3278  C  CA    . GLU A 1 1024 ? 143.022 192.808 138.906 1.00 199.57 ?  896  GLU A CA    1 
ATOM   3279  C  C     . GLU A 1 1024 ? 143.447 191.346 138.836 1.00 194.91 ?  896  GLU A C     1 
ATOM   3280  O  O     . GLU A 1 1024 ? 144.172 190.950 137.913 1.00 191.22 ?  896  GLU A O     1 
ATOM   3281  C  CB    . GLU A 1 1024 ? 143.947 193.582 139.849 1.00 199.00 ?  896  GLU A CB    1 
ATOM   3282  C  CG    . GLU A 1 1024 ? 145.400 193.613 139.401 1.00 212.89 ?  896  GLU A CG    1 
ATOM   3283  C  CD    . GLU A 1 1024 ? 145.590 194.308 138.063 1.00 224.10 ?  896  GLU A CD    1 
ATOM   3284  O  OE1   . GLU A 1 1024 ? 144.735 195.140 137.689 1.00 214.80 ?  896  GLU A OE1   1 
ATOM   3285  O  OE2   . GLU A 1 1024 ? 146.595 194.018 137.382 1.00 259.58 -1 896  GLU A OE2   1 
ATOM   3286  N  N     . ARG A 1 1025 ? 143.001 190.538 139.801 1.00 188.86 ?  897  ARG A N     1 
ATOM   3287  C  CA    . ARG A 1 1025 ? 143.231 189.100 139.733 1.00 182.15 ?  897  ARG A CA    1 
ATOM   3288  C  C     . ARG A 1 1025 ? 142.619 188.505 138.472 1.00 179.63 ?  897  ARG A C     1 
ATOM   3289  O  O     . ARG A 1 1025 ? 143.180 187.566 137.894 1.00 170.41 ?  897  ARG A O     1 
ATOM   3290  C  CB    . ARG A 1 1025 ? 142.657 188.418 140.976 1.00 180.31 ?  897  ARG A CB    1 
ATOM   3291  C  CG    . ARG A 1 1025 ? 142.894 189.176 142.276 1.00 171.38 ?  897  ARG A CG    1 
ATOM   3292  C  CD    . ARG A 1 1025 ? 144.375 189.313 142.581 1.00 166.95 ?  897  ARG A CD    1 
ATOM   3293  N  NE    . ARG A 1 1025 ? 145.034 188.015 142.691 1.00 174.20 ?  897  ARG A NE    1 
ATOM   3294  C  CZ    . ARG A 1 1025 ? 146.300 187.848 143.062 1.00 172.43 ?  897  ARG A CZ    1 
ATOM   3295  N  NH1   . ARG A 1 1025 ? 147.049 188.900 143.361 1.00 167.28 ?  897  ARG A NH1   1 
ATOM   3296  N  NH2   . ARG A 1 1025 ? 146.817 186.629 143.134 1.00 167.28 ?  897  ARG A NH2   1 
ATOM   3297  N  N     . ARG A 1 1026 ? 141.475 189.041 138.035 1.00 188.69 ?  898  ARG A N     1 
ATOM   3298  C  CA    . ARG A 1 1026 ? 140.856 188.596 136.791 1.00 182.00 ?  898  ARG A CA    1 
ATOM   3299  C  C     . ARG A 1 1026 ? 141.807 188.767 135.613 1.00 177.83 ?  898  ARG A C     1 
ATOM   3300  O  O     . ARG A 1 1026 ? 142.028 187.831 134.838 1.00 170.32 ?  898  ARG A O     1 
ATOM   3301  C  CB    . ARG A 1 1026 ? 139.564 189.375 136.539 1.00 180.65 ?  898  ARG A CB    1 
ATOM   3302  C  CG    . ARG A 1 1026 ? 138.372 188.955 137.378 1.00 174.46 ?  898  ARG A CG    1 
ATOM   3303  C  CD    . ARG A 1 1026 ? 137.149 189.774 136.986 1.00 185.44 ?  898  ARG A CD    1 
ATOM   3304  N  NE    . ARG A 1 1026 ? 135.904 189.224 137.513 1.00 183.10 ?  898  ARG A NE    1 
ATOM   3305  C  CZ    . ARG A 1 1026 ? 134.699 189.725 137.253 1.00 185.64 ?  898  ARG A CZ    1 
ATOM   3306  N  NH1   . ARG A 1 1026 ? 134.574 190.786 136.468 1.00 185.09 ?  898  ARG A NH1   1 
ATOM   3307  N  NH2   . ARG A 1 1026 ? 133.619 189.160 137.776 1.00 180.45 ?  898  ARG A NH2   1 
ATOM   3308  N  N     . GLU A 1 1027 ? 142.373 189.966 135.460 1.00 182.06 ?  899  GLU A N     1 
ATOM   3309  C  CA    . GLU A 1 1027 ? 143.285 190.222 134.350 1.00 179.70 ?  899  GLU A CA    1 
ATOM   3310  C  C     . GLU A 1 1027 ? 144.554 189.388 134.477 1.00 171.13 ?  899  GLU A C     1 
ATOM   3311  O  O     . GLU A 1 1027 ? 145.104 188.921 133.469 1.00 163.52 ?  899  GLU A O     1 
ATOM   3312  C  CB    . GLU A 1 1027 ? 143.618 191.714 134.286 1.00 186.21 ?  899  GLU A CB    1 
ATOM   3313  C  CG    . GLU A 1 1027 ? 143.592 192.301 132.885 1.00 191.04 ?  899  GLU A CG    1 
ATOM   3314  C  CD    . GLU A 1 1027 ? 144.742 191.819 132.026 1.00 202.04 ?  899  GLU A CD    1 
ATOM   3315  O  OE1   . GLU A 1 1027 ? 145.811 191.494 132.585 1.00 191.33 ?  899  GLU A OE1   1 
ATOM   3316  O  OE2   . GLU A 1 1027 ? 144.576 191.760 130.790 1.00 235.73 -1 899  GLU A OE2   1 
ATOM   3317  N  N     . ALA A 1 1028 ? 145.029 189.185 135.709 1.00 168.61 ?  900  ALA A N     1 
ATOM   3318  C  CA    . ALA A 1 1028 ? 146.204 188.345 135.923 1.00 154.44 ?  900  ALA A CA    1 
ATOM   3319  C  C     . ALA A 1 1028 ? 145.965 186.925 135.420 1.00 148.00 ?  900  ALA A C     1 
ATOM   3320  O  O     . ALA A 1 1028 ? 146.741 186.402 134.610 1.00 145.75 ?  900  ALA A O     1 
ATOM   3321  C  CB    . ALA A 1 1028 ? 146.577 188.337 137.405 1.00 151.84 ?  900  ALA A CB    1 
ATOM   3322  N  N     . LEU A 1 1029 ? 144.891 186.283 135.892 1.00 147.79 ?  901  LEU A N     1 
ATOM   3323  C  CA    . LEU A 1 1029 ? 144.594 184.923 135.449 1.00 139.28 ?  901  LEU A CA    1 
ATOM   3324  C  C     . LEU A 1 1029 ? 144.255 184.870 133.962 1.00 140.37 ?  901  LEU A C     1 
ATOM   3325  O  O     . LEU A 1 1029 ? 144.530 183.859 133.302 1.00 137.07 ?  901  LEU A O     1 
ATOM   3326  C  CB    . LEU A 1 1029 ? 143.469 184.320 136.300 1.00 137.09 ?  901  LEU A CB    1 
ATOM   3327  C  CG    . LEU A 1 1029 ? 142.137 185.049 136.515 1.00 138.75 ?  901  LEU A CG    1 
ATOM   3328  C  CD1   . LEU A 1 1029 ? 141.152 184.786 135.418 1.00 138.05 ?  901  LEU A CD1   1 
ATOM   3329  C  CD2   . LEU A 1 1029 ? 141.527 184.662 137.852 1.00 137.97 ?  901  LEU A CD2   1 
ATOM   3330  N  N     . LEU A 1 1030 ? 143.695 185.952 133.411 1.00 147.38 ?  902  LEU A N     1 
ATOM   3331  C  CA    . LEU A 1 1030 ? 143.450 186.012 131.973 1.00 148.25 ?  902  LEU A CA    1 
ATOM   3332  C  C     . LEU A 1 1030 ? 144.756 185.933 131.192 1.00 145.36 ?  902  LEU A C     1 
ATOM   3333  O  O     . LEU A 1 1030 ? 144.898 185.110 130.279 1.00 141.35 ?  902  LEU A O     1 
ATOM   3334  C  CB    . LEU A 1 1030 ? 142.693 187.294 131.624 1.00 154.56 ?  902  LEU A CB    1 
ATOM   3335  C  CG    . LEU A 1 1030 ? 141.213 187.165 131.257 1.00 149.77 ?  902  LEU A CG    1 
ATOM   3336  C  CD1   . LEU A 1 1030 ? 140.575 188.541 131.137 1.00 152.14 ?  902  LEU A CD1   1 
ATOM   3337  C  CD2   . LEU A 1 1030 ? 141.050 186.383 129.967 1.00 141.43 ?  902  LEU A CD2   1 
ATOM   3338  N  N     . LYS A 1 1031 ? 145.721 186.794 131.533 1.00 144.69 ?  903  LYS A N     1 
ATOM   3339  C  CA    . LYS A 1 1031 ? 147.020 186.748 130.865 1.00 141.54 ?  903  LYS A CA    1 
ATOM   3340  C  C     . LYS A 1 1031 ? 147.703 185.403 131.080 1.00 131.20 ?  903  LYS A C     1 
ATOM   3341  O  O     . LYS A 1 1031 ? 148.351 184.873 130.169 1.00 123.07 ?  903  LYS A O     1 
ATOM   3342  C  CB    . LYS A 1 1031 ? 147.916 187.883 131.361 1.00 138.96 ?  903  LYS A CB    1 
ATOM   3343  C  CG    . LYS A 1 1031 ? 149.331 187.831 130.797 1.00 126.35 ?  903  LYS A CG    1 
ATOM   3344  C  CD    . LYS A 1 1031 ? 150.315 188.608 131.656 1.00 119.22 ?  903  LYS A CD    1 
ATOM   3345  C  CE    . LYS A 1 1031 ? 151.726 188.506 131.098 1.00 111.96 ?  903  LYS A CE    1 
ATOM   3346  N  NZ    . LYS A 1 1031 ? 152.736 189.082 132.026 1.00 114.81 ?  903  LYS A NZ    1 
ATOM   3347  N  N     . LEU A 1 1032 ? 147.571 184.838 132.283 1.00 130.79 ?  904  LEU A N     1 
ATOM   3348  C  CA    . LEU A 1 1032 ? 148.175 183.542 132.573 1.00 120.77 ?  904  LEU A CA    1 
ATOM   3349  C  C     . LEU A 1 1032 ? 147.652 182.470 131.623 1.00 113.49 ?  904  LEU A C     1 
ATOM   3350  O  O     . LEU A 1 1032 ? 148.428 181.805 130.925 1.00 110.80 ?  904  LEU A O     1 
ATOM   3351  C  CB    . LEU A 1 1032 ? 147.901 183.157 134.027 1.00 129.47 ?  904  LEU A CB    1 
ATOM   3352  C  CG    . LEU A 1 1032 ? 148.848 182.139 134.664 1.00 124.60 ?  904  LEU A CG    1 
ATOM   3353  C  CD1   . LEU A 1 1032 ? 150.272 182.671 134.684 1.00 119.42 ?  904  LEU A CD1   1 
ATOM   3354  C  CD2   . LEU A 1 1032 ? 148.389 181.771 136.068 1.00 125.88 ?  904  LEU A CD2   1 
ATOM   3355  N  N     . MET A 1 1033 ? 146.328 182.289 131.593 1.00 117.45 ?  905  MET A N     1 
ATOM   3356  C  CA    . MET A 1 1033 ? 145.723 181.314 130.690 1.00 115.18 ?  905  MET A CA    1 
ATOM   3357  C  C     . MET A 1 1033 ? 146.043 181.615 129.232 1.00 119.74 ?  905  MET A C     1 
ATOM   3358  O  O     . MET A 1 1033 ? 146.211 180.688 128.430 1.00 116.33 ?  905  MET A O     1 
ATOM   3359  C  CB    . MET A 1 1033 ? 144.212 181.279 130.905 1.00 111.96 ?  905  MET A CB    1 
ATOM   3360  C  CG    . MET A 1 1033 ? 143.423 180.554 129.820 1.00 111.50 ?  905  MET A CG    1 
ATOM   3361  S  SD    . MET A 1 1033 ? 143.703 178.773 129.793 1.00 99.29  ?  905  MET A SD    1 
ATOM   3362  C  CE    . MET A 1 1033 ? 143.076 178.279 131.395 1.00 102.98 ?  905  MET A CE    1 
ATOM   3363  N  N     . ASP A 1 1034 ? 146.137 182.897 128.867 1.00 129.73 ?  906  ASP A N     1 
ATOM   3364  C  CA    . ASP A 1 1034 ? 146.454 183.247 127.487 1.00 137.70 ?  906  ASP A CA    1 
ATOM   3365  C  C     . ASP A 1 1034 ? 147.843 182.754 127.104 1.00 124.07 ?  906  ASP A C     1 
ATOM   3366  O  O     . ASP A 1 1034 ? 148.023 182.116 126.062 1.00 119.73 ?  906  ASP A O     1 
ATOM   3367  C  CB    . ASP A 1 1034 ? 146.349 184.759 127.292 1.00 152.30 ?  906  ASP A CB    1 
ATOM   3368  C  CG    . ASP A 1 1034 ? 147.107 185.239 126.071 1.00 167.46 ?  906  ASP A CG    1 
ATOM   3369  O  OD1   . ASP A 1 1034 ? 146.835 184.731 124.963 1.00 163.54 ?  906  ASP A OD1   1 
ATOM   3370  O  OD2   . ASP A 1 1034 ? 147.980 186.119 126.221 1.00 205.90 -1 906  ASP A OD2   1 
ATOM   3371  N  N     . LEU A 1 1035 ? 148.839 183.043 127.943 1.00 117.35 ?  907  LEU A N     1 
ATOM   3372  C  CA    . LEU A 1 1035 ? 150.189 182.553 127.682 1.00 113.91 ?  907  LEU A CA    1 
ATOM   3373  C  C     . LEU A 1 1035 ? 150.236 181.029 127.701 1.00 108.75 ?  907  LEU A C     1 
ATOM   3374  O  O     . LEU A 1 1035 ? 150.962 180.408 126.913 1.00 105.86 ?  907  LEU A O     1 
ATOM   3375  C  CB    . LEU A 1 1035 ? 151.159 183.135 128.709 1.00 115.23 ?  907  LEU A CB    1 
ATOM   3376  C  CG    . LEU A 1 1035 ? 151.134 184.658 128.837 1.00 119.95 ?  907  LEU A CG    1 
ATOM   3377  C  CD1   . LEU A 1 1035 ? 152.074 185.113 129.938 1.00 119.75 ?  907  LEU A CD1   1 
ATOM   3378  C  CD2   . LEU A 1 1035 ? 151.477 185.324 127.513 1.00 123.05 ?  907  LEU A CD2   1 
ATOM   3379  N  N     . TYR A 1 1036 ? 149.457 180.406 128.588 1.00 109.36 ?  908  TYR A N     1 
ATOM   3380  C  CA    . TYR A 1 1036 ? 149.458 178.949 128.674 1.00 104.19 ?  908  TYR A CA    1 
ATOM   3381  C  C     . TYR A 1 1036 ? 148.913 178.315 127.400 1.00 98.63  ?  908  TYR A C     1 
ATOM   3382  O  O     . TYR A 1 1036 ? 149.442 177.302 126.927 1.00 91.01  ?  908  TYR A O     1 
ATOM   3383  C  CB    . TYR A 1 1036 ? 148.648 178.495 129.887 1.00 104.28 ?  908  TYR A CB    1 
ATOM   3384  C  CG    . TYR A 1 1036 ? 148.580 176.995 130.034 1.00 97.57  ?  908  TYR A CG    1 
ATOM   3385  C  CD1   . TYR A 1 1036 ? 149.555 176.305 130.739 1.00 95.52  ?  908  TYR A CD1   1 
ATOM   3386  C  CD2   . TYR A 1 1036 ? 147.545 176.268 129.462 1.00 99.32  ?  908  TYR A CD2   1 
ATOM   3387  C  CE1   . TYR A 1 1036 ? 149.500 174.935 130.872 1.00 101.26 ?  908  TYR A CE1   1 
ATOM   3388  C  CE2   . TYR A 1 1036 ? 147.483 174.901 129.587 1.00 99.63  ?  908  TYR A CE2   1 
ATOM   3389  C  CZ    . TYR A 1 1036 ? 148.462 174.238 130.296 1.00 102.54 ?  908  TYR A CZ    1 
ATOM   3390  O  OH    . TYR A 1 1036 ? 148.405 172.871 130.428 1.00 106.02 ?  908  TYR A OH    1 
ATOM   3391  N  N     . LEU A 1 1037 ? 147.837 178.876 126.846 1.00 104.10 ?  909  LEU A N     1 
ATOM   3392  C  CA    . LEU A 1 1037 ? 147.344 178.391 125.561 1.00 99.13  ?  909  LEU A CA    1 
ATOM   3393  C  C     . LEU A 1 1037 ? 148.305 178.735 124.434 1.00 96.93  ?  909  LEU A C     1 
ATOM   3394  O  O     . LEU A 1 1037 ? 148.424 177.975 123.467 1.00 93.55  ?  909  LEU A O     1 
ATOM   3395  C  CB    . LEU A 1 1037 ? 145.958 178.960 125.270 1.00 102.16 ?  909  LEU A CB    1 
ATOM   3396  C  CG    . LEU A 1 1037 ? 144.842 177.920 125.349 1.00 100.81 ?  909  LEU A CG    1 
ATOM   3397  C  CD1   . LEU A 1 1037 ? 144.776 177.347 126.749 1.00 96.79  ?  909  LEU A CD1   1 
ATOM   3398  C  CD2   . LEU A 1 1037 ? 143.503 178.515 124.942 1.00 105.76 ?  909  LEU A CD2   1 
ATOM   3399  N  N     . GLN A 1 1038 ? 148.994 179.873 124.539 1.00 100.39 ?  910  GLN A N     1 
ATOM   3400  C  CA    . GLN A 1 1038 ? 150.025 180.209 123.566 1.00 99.46  ?  910  GLN A CA    1 
ATOM   3401  C  C     . GLN A 1 1038 ? 151.153 179.186 123.574 1.00 95.76  ?  910  GLN A C     1 
ATOM   3402  O  O     . GLN A 1 1038 ? 151.831 178.998 122.558 1.00 94.78  ?  910  GLN A O     1 
ATOM   3403  C  CB    . GLN A 1 1038 ? 150.574 181.606 123.857 1.00 99.68  ?  910  GLN A CB    1 
ATOM   3404  C  CG    . GLN A 1 1038 ? 150.550 182.542 122.669 1.00 96.65  ?  910  GLN A CG    1 
ATOM   3405  C  CD    . GLN A 1 1038 ? 151.490 182.096 121.571 1.00 99.15  ?  910  GLN A CD    1 
ATOM   3406  O  OE1   . GLN A 1 1038 ? 152.604 181.644 121.837 1.00 101.05 ?  910  GLN A OE1   1 
ATOM   3407  N  NE2   . GLN A 1 1038 ? 151.043 182.213 120.327 1.00 100.79 ?  910  GLN A NE2   1 
ATOM   3408  N  N     . MET A 1 1039 ? 151.370 178.524 124.709 1.00 91.56  ?  911  MET A N     1 
ATOM   3409  C  CA    . MET A 1 1039 ? 152.506 177.626 124.862 1.00 86.33  ?  911  MET A CA    1 
ATOM   3410  C  C     . MET A 1 1039 ? 152.158 176.139 124.818 1.00 89.15  ?  911  MET A C     1 
ATOM   3411  O  O     . MET A 1 1039 ? 153.070 175.318 124.668 1.00 86.35  ?  911  MET A O     1 
ATOM   3412  C  CB    . MET A 1 1039 ? 153.232 177.939 126.177 1.00 79.68  ?  911  MET A CB    1 
ATOM   3413  C  CG    . MET A 1 1039 ? 152.574 177.361 127.406 1.00 80.89  ?  911  MET A CG    1 
ATOM   3414  S  SD    . MET A 1 1039 ? 153.183 178.156 128.899 1.00 83.65  ?  911  MET A SD    1 
ATOM   3415  C  CE    . MET A 1 1039 ? 154.944 178.141 128.583 1.00 79.62  ?  911  MET A CE    1 
ATOM   3416  N  N     . LYS A 1 1040 ? 150.877 175.766 124.946 1.00 89.48  ?  912  LYS A N     1 
ATOM   3417  C  CA    . LYS A 1 1040 ? 150.527 174.344 124.973 1.00 87.48  ?  912  LYS A CA    1 
ATOM   3418  C  C     . LYS A 1 1040 ? 150.770 173.637 123.641 1.00 80.61  ?  912  LYS A C     1 
ATOM   3419  O  O     . LYS A 1 1040 ? 151.467 172.602 123.629 1.00 77.93  ?  912  LYS A O     1 
ATOM   3420  C  CB    . LYS A 1 1040 ? 149.076 174.176 125.441 1.00 86.46  ?  912  LYS A CB    1 
ATOM   3421  C  CG    . LYS A 1 1040 ? 148.501 172.795 125.162 1.00 81.89  ?  912  LYS A CG    1 
ATOM   3422  C  CD    . LYS A 1 1040 ? 147.012 172.722 125.458 1.00 77.43  ?  912  LYS A CD    1 
ATOM   3423  C  CE    . LYS A 1 1040 ? 146.487 171.316 125.218 1.00 73.78  ?  912  LYS A CE    1 
ATOM   3424  N  NZ    . LYS A 1 1040 ? 146.799 170.843 123.840 1.00 72.48  ?  912  LYS A NZ    1 
ATOM   3425  N  N     . PRO A 1 1041 ? 150.229 174.096 122.504 1.00 82.62  ?  913  PRO A N     1 
ATOM   3426  C  CA    . PRO A 1 1041 ? 150.481 173.377 121.247 1.00 79.31  ?  913  PRO A CA    1 
ATOM   3427  C  C     . PRO A 1 1041 ? 151.929 173.427 120.810 1.00 72.82  ?  913  PRO A C     1 
ATOM   3428  O  O     . PRO A 1 1041 ? 152.312 172.662 119.915 1.00 75.33  ?  913  PRO A O     1 
ATOM   3429  C  CB    . PRO A 1 1041 ? 149.572 174.093 120.244 1.00 92.55  ?  913  PRO A CB    1 
ATOM   3430  C  CG    . PRO A 1 1041 ? 149.483 175.472 120.768 1.00 97.36  ?  913  PRO A CG    1 
ATOM   3431  C  CD    . PRO A 1 1041 ? 149.448 175.325 122.263 1.00 92.64  ?  913  PRO A CD    1 
ATOM   3432  N  N     . VAL A 1 1042 ? 152.743 174.300 121.409 1.00 68.72  ?  914  VAL A N     1 
ATOM   3433  C  CA    . VAL A 1 1042 ? 154.175 174.280 121.140 1.00 64.04  ?  914  VAL A CA    1 
ATOM   3434  C  C     . VAL A 1 1042 ? 154.756 172.916 121.468 1.00 63.99  ?  914  VAL A C     1 
ATOM   3435  O  O     . VAL A 1 1042 ? 155.681 172.448 120.792 1.00 69.29  ?  914  VAL A O     1 
ATOM   3436  C  CB    . VAL A 1 1042 ? 154.888 175.391 121.930 1.00 73.48  ?  914  VAL A CB    1 
ATOM   3437  C  CG1   . VAL A 1 1042 ? 156.310 175.561 121.428 1.00 72.26  ?  914  VAL A CG1   1 
ATOM   3438  C  CG2   . VAL A 1 1042 ? 154.121 176.684 121.826 1.00 81.68  ?  914  VAL A CG2   1 
ATOM   3439  N  N     . TRP A 1 1043 ? 154.235 172.253 122.502 1.00 68.30  ?  915  TRP A N     1 
ATOM   3440  C  CA    . TRP A 1 1043 ? 154.702 170.913 122.828 1.00 72.76  ?  915  TRP A CA    1 
ATOM   3441  C  C     . TRP A 1 1043 ? 153.749 169.814 122.379 1.00 73.69  ?  915  TRP A C     1 
ATOM   3442  O  O     . TRP A 1 1043 ? 154.215 168.726 122.026 1.00 67.46  ?  915  TRP A O     1 
ATOM   3443  C  CB    . TRP A 1 1043 ? 154.981 170.775 124.336 1.00 70.30  ?  915  TRP A CB    1 
ATOM   3444  C  CG    . TRP A 1 1043 ? 153.788 170.580 125.247 1.00 74.37  ?  915  TRP A CG    1 
ATOM   3445  C  CD1   . TRP A 1 1043 ? 152.965 169.489 125.309 1.00 78.31  ?  915  TRP A CD1   1 
ATOM   3446  C  CD2   . TRP A 1 1043 ? 153.334 171.478 126.267 1.00 76.08  ?  915  TRP A CD2   1 
ATOM   3447  N  NE1   . TRP A 1 1043 ? 152.008 169.670 126.275 1.00 85.53  ?  915  TRP A NE1   1 
ATOM   3448  C  CE2   . TRP A 1 1043 ? 152.215 170.881 126.882 1.00 83.96  ?  915  TRP A CE2   1 
ATOM   3449  C  CE3   . TRP A 1 1043 ? 153.755 172.735 126.711 1.00 74.88  ?  915  TRP A CE3   1 
ATOM   3450  C  CZ2   . TRP A 1 1043 ? 151.514 171.497 127.913 1.00 84.80  ?  915  TRP A CZ2   1 
ATOM   3451  C  CZ3   . TRP A 1 1043 ? 153.055 173.345 127.737 1.00 78.01  ?  915  TRP A CZ3   1 
ATOM   3452  C  CH2   . TRP A 1 1043 ? 151.948 172.725 128.326 1.00 79.39  ?  915  TRP A CH2   1 
ATOM   3453  N  N     . ARG A 1 1044 ? 152.433 170.051 122.367 1.00 78.73  ?  916  ARG A N     1 
ATOM   3454  C  CA    . ARG A 1 1044 ? 151.554 168.956 121.961 1.00 77.70  ?  916  ARG A CA    1 
ATOM   3455  C  C     . ARG A 1 1044 ? 151.517 168.741 120.449 1.00 76.97  ?  916  ARG A C     1 
ATOM   3456  O  O     . ARG A 1 1044 ? 150.858 167.800 119.991 1.00 73.45  ?  916  ARG A O     1 
ATOM   3457  C  CB    . ARG A 1 1044 ? 150.130 169.170 122.480 1.00 75.87  ?  916  ARG A CB    1 
ATOM   3458  C  CG    . ARG A 1 1044 ? 149.369 167.855 122.631 1.00 74.58  ?  916  ARG A CG    1 
ATOM   3459  C  CD    . ARG A 1 1044 ? 147.866 168.032 122.600 1.00 84.66  ?  916  ARG A CD    1 
ATOM   3460  N  NE    . ARG A 1 1044 ? 147.189 166.747 122.450 1.00 94.57  ?  916  ARG A NE    1 
ATOM   3461  C  CZ    . ARG A 1 1044 ? 146.877 165.942 123.461 1.00 97.12  ?  916  ARG A CZ    1 
ATOM   3462  N  NH1   . ARG A 1 1044 ? 147.186 166.284 124.704 1.00 96.34  ?  916  ARG A NH1   1 
ATOM   3463  N  NH2   . ARG A 1 1044 ? 146.261 164.790 123.230 1.00 97.94  ?  916  ARG A NH2   1 
ATOM   3464  N  N     . SER A 1 1045 ? 152.212 169.565 119.669 1.00 78.52  ?  917  SER A N     1 
ATOM   3465  C  CA    . SER A 1 1045 ? 152.208 169.413 118.221 1.00 71.55  ?  917  SER A CA    1 
ATOM   3466  C  C     . SER A 1 1045 ? 152.859 168.095 117.808 1.00 62.60  ?  917  SER A C     1 
ATOM   3467  O  O     . SER A 1 1045 ? 153.635 167.489 118.552 1.00 64.95  ?  917  SER A O     1 
ATOM   3468  C  CB    . SER A 1 1045 ? 152.944 170.576 117.556 1.00 78.73  ?  917  SER A CB    1 
ATOM   3469  O  OG    . SER A 1 1045 ? 152.116 171.721 117.462 1.00 93.96  ?  917  SER A OG    1 
ATOM   3470  N  N     . THR A 1 1046 ? 152.525 167.651 116.593 1.00 55.62  ?  918  THR A N     1 
ATOM   3471  C  CA    . THR A 1 1046 ? 153.199 166.487 116.027 1.00 54.91  ?  918  THR A CA    1 
ATOM   3472  C  C     . THR A 1 1046 ? 154.610 166.843 115.575 1.00 60.58  ?  918  THR A C     1 
ATOM   3473  O  O     . THR A 1 1046 ? 155.533 166.028 115.695 1.00 54.99  ?  918  THR A O     1 
ATOM   3474  C  CB    . THR A 1 1046 ? 152.387 165.920 114.862 1.00 52.01  ?  918  THR A CB    1 
ATOM   3475  O  OG1   . THR A 1 1046 ? 151.059 165.616 115.307 1.00 48.00  ?  918  THR A OG1   1 
ATOM   3476  C  CG2   . THR A 1 1046 ? 153.036 164.654 114.325 1.00 53.64  ?  918  THR A CG2   1 
ATOM   3477  N  N     . CYS A 1 1047 ? 154.792 168.055 115.053 1.00 68.83  ?  919  CYS A N     1 
ATOM   3478  C  CA    . CYS A 1 1047 ? 156.104 168.588 114.709 1.00 75.94  ?  919  CYS A CA    1 
ATOM   3479  C  C     . CYS A 1 1047 ? 156.042 170.112 114.710 1.00 84.00  ?  919  CYS A C     1 
ATOM   3480  O  O     . CYS A 1 1047 ? 155.672 170.718 113.696 1.00 96.68  ?  919  CYS A O     1 
ATOM   3481  C  CB    . CYS A 1 1047 ? 156.570 168.067 113.348 1.00 81.57  ?  919  CYS A CB    1 
ATOM   3482  S  SG    . CYS A 1 1047 ? 158.226 168.617 112.863 1.00 87.84  ?  919  CYS A SG    1 
ATOM   3483  N  N     . PRO A 1 1048 ? 156.393 170.766 115.822 1.00 81.16  ?  920  PRO A N     1 
ATOM   3484  C  CA    . PRO A 1 1048 ? 156.300 172.233 115.867 1.00 89.06  ?  920  PRO A CA    1 
ATOM   3485  C  C     . PRO A 1 1048 ? 157.247 172.927 114.910 1.00 95.30  ?  920  PRO A C     1 
ATOM   3486  O  O     . PRO A 1 1048 ? 157.016 174.097 114.579 1.00 102.81 ?  920  PRO A O     1 
ATOM   3487  C  CB    . PRO A 1 1048 ? 156.640 172.560 117.326 1.00 88.05  ?  920  PRO A CB    1 
ATOM   3488  C  CG    . PRO A 1 1048 ? 157.536 171.445 117.741 1.00 87.48  ?  920  PRO A CG    1 
ATOM   3489  C  CD    . PRO A 1 1048 ? 157.010 170.216 117.041 1.00 80.53  ?  920  PRO A CD    1 
ATOM   3490  N  N     . SER A 1 1049 ? 158.304 172.248 114.458 1.00 90.08  ?  921  SER A N     1 
ATOM   3491  C  CA    . SER A 1 1049 ? 159.159 172.803 113.416 1.00 92.65  ?  921  SER A CA    1 
ATOM   3492  C  C     . SER A 1 1049 ? 158.385 173.082 112.134 1.00 102.85 ?  921  SER A C     1 
ATOM   3493  O  O     . SER A 1 1049 ? 158.838 173.887 111.312 1.00 104.09 ?  921  SER A O     1 
ATOM   3494  C  CB    . SER A 1 1049 ? 160.318 171.847 113.128 1.00 89.26  ?  921  SER A CB    1 
ATOM   3495  O  OG    . SER A 1 1049 ? 160.809 171.263 114.322 1.00 84.23  ?  921  SER A OG    1 
ATOM   3496  N  N     . ARG A 1 1050 ? 157.235 172.439 111.952 1.00 108.44 ?  922  ARG A N     1 
ATOM   3497  C  CA    . ARG A 1 1050 ? 156.383 172.608 110.781 1.00 117.39 ?  922  ARG A CA    1 
ATOM   3498  C  C     . ARG A 1 1050 ? 154.986 173.105 111.119 1.00 117.33 ?  922  ARG A C     1 
ATOM   3499  O  O     . ARG A 1 1050 ? 154.458 173.966 110.408 1.00 119.25 ?  922  ARG A O     1 
ATOM   3500  C  CB    . ARG A 1 1050 ? 156.285 171.276 110.014 1.00 119.62 ?  922  ARG A CB    1 
ATOM   3501  C  CG    . ARG A 1 1050 ? 154.899 170.949 109.473 1.00 125.81 ?  922  ARG A CG    1 
ATOM   3502  C  CD    . ARG A 1 1050 ? 154.748 169.465 109.173 1.00 122.10 ?  922  ARG A CD    1 
ATOM   3503  N  NE    . ARG A 1 1050 ? 153.347 169.053 109.176 1.00 114.46 ?  922  ARG A NE    1 
ATOM   3504  C  CZ    . ARG A 1 1050 ? 152.669 168.717 110.270 1.00 101.92 ?  922  ARG A CZ    1 
ATOM   3505  N  NH1   . ARG A 1 1050 ? 153.264 168.740 111.454 1.00 98.66  ?  922  ARG A NH1   1 
ATOM   3506  N  NH2   . ARG A 1 1050 ? 151.396 168.357 110.179 1.00 95.78  ?  922  ARG A NH2   1 
ATOM   3507  N  N     . ASP A 1 1051 ? 154.372 172.596 112.191 1.00 116.92 ?  923  ASP A N     1 
ATOM   3508  C  CA    . ASP A 1 1051 ? 152.981 172.935 112.478 1.00 123.74 ?  923  ASP A CA    1 
ATOM   3509  C  C     . ASP A 1 1051 ? 152.845 174.391 112.908 1.00 124.41 ?  923  ASP A C     1 
ATOM   3510  O  O     . ASP A 1 1051 ? 152.071 175.154 112.317 1.00 129.72 ?  923  ASP A O     1 
ATOM   3511  C  CB    . ASP A 1 1051 ? 152.419 172.001 113.552 1.00 126.28 ?  923  ASP A CB    1 
ATOM   3512  C  CG    . ASP A 1 1051 ? 150.974 172.321 113.906 1.00 140.35 ?  923  ASP A CG    1 
ATOM   3513  O  OD1   . ASP A 1 1051 ? 150.064 171.831 113.205 1.00 136.25 ?  923  ASP A OD1   1 
ATOM   3514  O  OD2   . ASP A 1 1051 ? 150.748 173.063 114.885 1.00 180.62 -1 923  ASP A OD2   1 
ATOM   3515  N  N     . CYS A 1 1052 ? 153.588 174.796 113.935 1.00 118.28 ?  924  CYS A N     1 
ATOM   3516  C  CA    . CYS A 1 1052 ? 153.508 176.160 114.461 1.00 118.88 ?  924  CYS A CA    1 
ATOM   3517  C  C     . CYS A 1 1052 ? 154.818 176.524 115.141 1.00 121.05 ?  924  CYS A C     1 
ATOM   3518  O  O     . CYS A 1 1052 ? 154.926 176.522 116.374 1.00 121.79 ?  924  CYS A O     1 
ATOM   3519  C  CB    . CYS A 1 1052 ? 152.334 176.311 115.430 1.00 121.38 ?  924  CYS A CB    1 
ATOM   3520  S  SG    . CYS A 1 1052 ? 152.222 175.008 116.679 1.00 121.47 ?  924  CYS A SG    1 
ATOM   3521  N  N     . PRO A 1 1053 ? 155.850 176.858 114.359 1.00 125.97 ?  925  PRO A N     1 
ATOM   3522  C  CA    . PRO A 1 1053 ? 157.107 177.328 114.963 1.00 133.56 ?  925  PRO A CA    1 
ATOM   3523  C  C     . PRO A 1 1053 ? 157.029 178.750 115.498 1.00 136.65 ?  925  PRO A C     1 
ATOM   3524  O  O     . PRO A 1 1053 ? 157.942 179.172 116.226 1.00 134.61 ?  925  PRO A O     1 
ATOM   3525  C  CB    . PRO A 1 1053 ? 158.108 177.222 113.807 1.00 127.92 ?  925  PRO A CB    1 
ATOM   3526  C  CG    . PRO A 1 1053 ? 157.271 177.415 112.585 1.00 125.30 ?  925  PRO A CG    1 
ATOM   3527  C  CD    . PRO A 1 1053 ? 155.927 176.801 112.888 1.00 120.88 ?  925  PRO A CD    1 
ATOM   3528  N  N     . ASP A 1 1054 ? 155.973 179.494 115.156 1.00 135.24 ?  926  ASP A N     1 
ATOM   3529  C  CA    . ASP A 1 1054 ? 155.814 180.859 115.647 1.00 136.39 ?  926  ASP A CA    1 
ATOM   3530  C  C     . ASP A 1 1054 ? 155.818 180.896 117.170 1.00 127.62 ?  926  ASP A C     1 
ATOM   3531  O  O     . ASP A 1 1054 ? 156.643 181.579 117.787 1.00 121.38 ?  926  ASP A O     1 
ATOM   3532  C  CB    . ASP A 1 1054 ? 154.520 181.462 115.094 1.00 145.11 ?  926  ASP A CB    1 
ATOM   3533  C  CG    . ASP A 1 1054 ? 153.369 180.473 115.097 1.00 148.09 ?  926  ASP A CG    1 
ATOM   3534  O  OD1   . ASP A 1 1054 ? 153.598 179.295 114.757 1.00 133.31 ?  926  ASP A OD1   1 
ATOM   3535  O  OD2   . ASP A 1 1054 ? 152.237 180.869 115.445 1.00 207.99 -1 926  ASP A OD2   1 
ATOM   3536  N  N     . GLN A 1 1055 ? 154.901 180.154 117.795 1.00 124.52 ?  927  GLN A N     1 
ATOM   3537  C  CA    . GLN A 1 1055 ? 154.860 180.093 119.250 1.00 112.54 ?  927  GLN A CA    1 
ATOM   3538  C  C     . GLN A 1 1055 ? 156.109 179.442 119.832 1.00 108.15 ?  927  GLN A C     1 
ATOM   3539  O  O     . GLN A 1 1055 ? 156.436 179.693 120.998 1.00 108.35 ?  927  GLN A O     1 
ATOM   3540  C  CB    . GLN A 1 1055 ? 153.617 179.332 119.710 1.00 108.24 ?  927  GLN A CB    1 
ATOM   3541  C  CG    . GLN A 1 1055 ? 152.386 179.535 118.848 1.00 115.59 ?  927  GLN A CG    1 
ATOM   3542  C  CD    . GLN A 1 1055 ? 151.235 178.636 119.265 1.00 109.70 ?  927  GLN A CD    1 
ATOM   3543  O  OE1   . GLN A 1 1055 ? 150.656 177.927 118.442 1.00 111.92 ?  927  GLN A OE1   1 
ATOM   3544  N  NE2   . GLN A 1 1055 ? 150.900 178.661 120.548 1.00 99.53  ?  927  GLN A NE2   1 
ATOM   3545  N  N     . LEU A 1 1056 ? 156.809 178.612 119.053 1.00 108.34 ?  928  LEU A N     1 
ATOM   3546  C  CA    . LEU A 1 1056 ? 158.063 178.032 119.526 1.00 105.31 ?  928  LEU A CA    1 
ATOM   3547  C  C     . LEU A 1 1056 ? 159.122 179.108 119.716 1.00 109.36 ?  928  LEU A C     1 
ATOM   3548  O  O     . LEU A 1 1056 ? 159.819 179.134 120.738 1.00 108.38 ?  928  LEU A O     1 
ATOM   3549  C  CB    . LEU A 1 1056 ? 158.560 176.963 118.551 1.00 106.49 ?  928  LEU A CB    1 
ATOM   3550  C  CG    . LEU A 1 1056 ? 160.079 176.736 118.553 1.00 93.05  ?  928  LEU A CG    1 
ATOM   3551  C  CD1   . LEU A 1 1056 ? 160.534 176.005 119.811 1.00 77.44  ?  928  LEU A CD1   1 
ATOM   3552  C  CD2   . LEU A 1 1056 ? 160.542 175.999 117.303 1.00 95.60  ?  928  LEU A CD2   1 
ATOM   3553  N  N     . CYS A 1 1057 ? 159.268 180.000 118.734 1.00 116.97 ?  929  CYS A N     1 
ATOM   3554  C  CA    . CYS A 1 1057 ? 160.245 181.074 118.880 1.00 118.02 ?  929  CYS A CA    1 
ATOM   3555  C  C     . CYS A 1 1057 ? 159.860 182.031 120.001 1.00 116.79 ?  929  CYS A C     1 
ATOM   3556  O  O     . CYS A 1 1057 ? 160.736 182.661 120.605 1.00 117.70 ?  929  CYS A O     1 
ATOM   3557  C  CB    . CYS A 1 1057 ? 160.405 181.832 117.563 1.00 121.34 ?  929  CYS A CB    1 
ATOM   3558  S  SG    . CYS A 1 1057 ? 162.015 182.634 117.364 1.00 125.32 ?  929  CYS A SG    1 
ATOM   3559  N  N     . GLN A 1 1058 ? 158.567 182.148 120.298 1.00 114.17 ?  930  GLN A N     1 
ATOM   3560  C  CA    . GLN A 1 1058 ? 158.094 182.970 121.403 1.00 113.54 ?  930  GLN A CA    1 
ATOM   3561  C  C     . GLN A 1 1058 ? 158.050 182.220 122.727 1.00 112.23 ?  930  GLN A C     1 
ATOM   3562  O  O     . GLN A 1 1058 ? 157.812 182.848 123.765 1.00 111.31 ?  930  GLN A O     1 
ATOM   3563  C  CB    . GLN A 1 1058 ? 156.692 183.514 121.099 1.00 113.74 ?  930  GLN A CB    1 
ATOM   3564  C  CG    . GLN A 1 1058 ? 156.510 184.046 119.688 1.00 113.06 ?  930  GLN A CG    1 
ATOM   3565  C  CD    . GLN A 1 1058 ? 157.441 185.196 119.365 1.00 114.12 ?  930  GLN A CD    1 
ATOM   3566  O  OE1   . GLN A 1 1058 ? 157.885 185.922 120.255 1.00 113.90 ?  930  GLN A OE1   1 
ATOM   3567  N  NE2   . GLN A 1 1058 ? 157.746 185.364 118.085 1.00 112.56 ?  930  GLN A NE2   1 
ATOM   3568  N  N     . TYR A 1 1059 ? 158.285 180.903 122.717 1.00 111.42 ?  931  TYR A N     1 
ATOM   3569  C  CA    . TYR A 1 1059 ? 158.016 180.090 123.901 1.00 109.62 ?  931  TYR A CA    1 
ATOM   3570  C  C     . TYR A 1 1059 ? 158.897 180.492 125.075 1.00 99.81  ?  931  TYR A C     1 
ATOM   3571  O  O     . TYR A 1 1059 ? 158.449 180.465 126.225 1.00 99.08  ?  931  TYR A O     1 
ATOM   3572  C  CB    . TYR A 1 1059 ? 158.208 178.606 123.590 1.00 113.44 ?  931  TYR A CB    1 
ATOM   3573  C  CG    . TYR A 1 1059 ? 157.758 177.691 124.713 1.00 99.23  ?  931  TYR A CG    1 
ATOM   3574  C  CD1   . TYR A 1 1059 ? 158.613 177.368 125.761 1.00 87.95  ?  931  TYR A CD1   1 
ATOM   3575  C  CD2   . TYR A 1 1059 ? 156.482 177.145 124.721 1.00 89.63  ?  931  TYR A CD2   1 
ATOM   3576  C  CE1   . TYR A 1 1059 ? 158.205 176.539 126.786 1.00 85.17  ?  931  TYR A CE1   1 
ATOM   3577  C  CE2   . TYR A 1 1059 ? 156.073 176.307 125.737 1.00 83.37  ?  931  TYR A CE2   1 
ATOM   3578  C  CZ    . TYR A 1 1059 ? 156.934 176.011 126.768 1.00 79.91  ?  931  TYR A CZ    1 
ATOM   3579  O  OH    . TYR A 1 1059 ? 156.520 175.179 127.782 1.00 77.64  ?  931  TYR A OH    1 
ATOM   3580  N  N     . SER A 1 1060 ? 160.160 180.834 124.817 1.00 96.67  ?  932  SER A N     1 
ATOM   3581  C  CA    . SER A 1 1060 ? 161.025 181.285 125.902 1.00 94.04  ?  932  SER A CA    1 
ATOM   3582  C  C     . SER A 1 1060 ? 160.439 182.517 126.586 1.00 96.77  ?  932  SER A C     1 
ATOM   3583  O  O     . SER A 1 1060 ? 160.287 182.555 127.817 1.00 99.29  ?  932  SER A O     1 
ATOM   3584  C  CB    . SER A 1 1060 ? 162.430 181.572 125.369 1.00 91.75  ?  932  SER A CB    1 
ATOM   3585  O  OG    . SER A 1 1060 ? 163.075 180.379 124.958 1.00 78.00  ?  932  SER A OG    1 
ATOM   3586  N  N     . TYR A 1 1061 ? 160.061 183.522 125.793 1.00 103.61 ?  933  TYR A N     1 
ATOM   3587  C  CA    . TYR A 1 1061 ? 159.511 184.750 126.361 1.00 116.49 ?  933  TYR A CA    1 
ATOM   3588  C  C     . TYR A 1 1061 ? 158.131 184.519 126.969 1.00 115.28 ?  933  TYR A C     1 
ATOM   3589  O  O     . TYR A 1 1061 ? 157.809 185.081 128.024 1.00 117.69 ?  933  TYR A O     1 
ATOM   3590  C  CB    . TYR A 1 1061 ? 159.453 185.834 125.286 1.00 131.57 ?  933  TYR A CB    1 
ATOM   3591  C  CG    . TYR A 1 1061 ? 158.599 187.027 125.650 1.00 141.86 ?  933  TYR A CG    1 
ATOM   3592  C  CD1   . TYR A 1 1061 ? 159.047 187.972 126.563 1.00 140.45 ?  933  TYR A CD1   1 
ATOM   3593  C  CD2   . TYR A 1 1061 ? 157.349 187.214 125.073 1.00 141.51 ?  933  TYR A CD2   1 
ATOM   3594  C  CE1   . TYR A 1 1061 ? 158.273 189.066 126.896 1.00 136.26 ?  933  TYR A CE1   1 
ATOM   3595  C  CE2   . TYR A 1 1061 ? 156.568 188.305 125.400 1.00 136.22 ?  933  TYR A CE2   1 
ATOM   3596  C  CZ    . TYR A 1 1061 ? 157.036 189.228 126.310 1.00 134.77 ?  933  TYR A CZ    1 
ATOM   3597  O  OH    . TYR A 1 1061 ? 156.262 190.317 126.640 1.00 137.36 ?  933  TYR A OH    1 
ATOM   3598  N  N     . ASN A 1 1062 ? 157.300 183.707 126.310 1.00 109.81 ?  934  ASN A N     1 
ATOM   3599  C  CA    . ASN A 1 1062 ? 155.976 183.398 126.845 1.00 109.10 ?  934  ASN A CA    1 
ATOM   3600  C  C     . ASN A 1 1062 ? 156.088 182.715 128.202 1.00 108.71 ?  934  ASN A C     1 
ATOM   3601  O  O     . ASN A 1 1062 ? 155.418 183.099 129.171 1.00 112.37 ?  934  ASN A O     1 
ATOM   3602  C  CB    . ASN A 1 1062 ? 155.216 182.522 125.845 1.00 106.10 ?  934  ASN A CB    1 
ATOM   3603  C  CG    . ASN A 1 1062 ? 153.742 182.406 126.168 1.00 108.37 ?  934  ASN A CG    1 
ATOM   3604  O  OD1   . ASN A 1 1062 ? 152.913 183.131 125.617 1.00 105.61 ?  934  ASN A OD1   1 
ATOM   3605  N  ND2   . ASN A 1 1062 ? 153.404 181.475 127.051 1.00 110.10 ?  934  ASN A ND2   1 
ATOM   3606  N  N     . SER A 1 1063 ? 156.961 181.712 128.291 1.00 106.91 ?  935  SER A N     1 
ATOM   3607  C  CA    . SER A 1 1063 ? 157.199 181.029 129.556 1.00 109.07 ?  935  SER A CA    1 
ATOM   3608  C  C     . SER A 1 1063 ? 157.773 181.960 130.629 1.00 106.52 ?  935  SER A C     1 
ATOM   3609  O  O     . SER A 1 1063 ? 157.488 181.796 131.804 1.00 105.10 ?  935  SER A O     1 
ATOM   3610  C  CB    . SER A 1 1063 ? 158.105 179.816 129.332 1.00 110.08 ?  935  SER A CB    1 
ATOM   3611  O  OG    . SER A 1 1063 ? 159.247 180.182 128.587 1.00 109.18 ?  935  SER A OG    1 
ATOM   3612  N  N     . GLN A 1 1064 ? 158.581 182.936 130.261 1.00 103.15 ?  936  GLN A N     1 
ATOM   3613  C  CA    . GLN A 1 1064 ? 159.156 183.830 131.297 1.00 103.65 ?  936  GLN A CA    1 
ATOM   3614  C  C     . GLN A 1 1064 ? 158.119 184.770 131.810 1.00 109.21 ?  936  GLN A C     1 
ATOM   3615  O  O     . GLN A 1 1064 ? 158.069 185.065 133.012 1.00 113.67 ?  936  GLN A O     1 
ATOM   3616  C  CB    . GLN A 1 1064 ? 160.382 184.428 130.675 1.00 102.31 ?  936  GLN A CB    1 
ATOM   3617  C  CG    . GLN A 1 1064 ? 161.576 185.118 130.921 1.00 101.86 ?  936  GLN A CG    1 
ATOM   3618  C  CD    . GLN A 1 1064 ? 162.429 184.084 131.623 1.00 93.28  ?  936  GLN A CD    1 
ATOM   3619  O  OE1   . GLN A 1 1064 ? 163.473 184.316 131.941 1.00 95.44  ?  936  GLN A OE1   1 
ATOM   3620  N  NE2   . GLN A 1 1064 ? 161.600 183.781 132.764 1.00 97.54  ?  936  GLN A NE2   1 
ATOM   3621  N  N     . GLN A 1 1065 ? 157.289 185.289 130.922 1.00 114.81 ?  937  GLN A N     1 
ATOM   3622  C  CA    . GLN A 1 1065 ? 156.172 186.067 131.410 1.00 122.09 ?  937  GLN A CA    1 
ATOM   3623  C  C     . GLN A 1 1065 ? 155.294 185.221 132.317 1.00 120.67 ?  937  GLN A C     1 
ATOM   3624  O  O     . GLN A 1 1065 ? 154.818 185.707 133.344 1.00 123.28 ?  937  GLN A O     1 
ATOM   3625  C  CB    . GLN A 1 1065 ? 155.375 186.641 130.254 1.00 123.42 ?  937  GLN A CB    1 
ATOM   3626  C  CG    . GLN A 1 1065 ? 155.990 187.876 129.636 1.00 121.06 ?  937  GLN A CG    1 
ATOM   3627  C  CD    . GLN A 1 1065 ? 154.999 188.621 128.766 1.00 120.09 ?  937  GLN A CD    1 
ATOM   3628  O  OE1   . GLN A 1 1065 ? 155.138 189.823 128.542 1.00 124.96 ?  937  GLN A OE1   1 
ATOM   3629  N  NE2   . GLN A 1 1065 ? 153.988 187.914 128.277 1.00 119.27 ?  937  GLN A NE2   1 
ATOM   3630  N  N     . PHE A 1 1066 ? 155.065 183.953 131.955 1.00 111.30 ?  938  PHE A N     1 
ATOM   3631  C  CA    . PHE A 1 1066 ? 154.264 183.075 132.807 1.00 105.11 ?  938  PHE A CA    1 
ATOM   3632  C  C     . PHE A 1 1066 ? 154.903 182.919 134.184 1.00 110.59 ?  938  PHE A C     1 
ATOM   3633  O  O     . PHE A 1 1066 ? 154.225 183.010 135.216 1.00 114.59 ?  938  PHE A O     1 
ATOM   3634  C  CB    . PHE A 1 1066 ? 154.095 181.713 132.134 1.00 94.40  ?  938  PHE A CB    1 
ATOM   3635  C  CG    . PHE A 1 1066 ? 152.951 180.904 132.672 1.00 86.61  ?  938  PHE A CG    1 
ATOM   3636  C  CD1   . PHE A 1 1066 ? 153.057 180.248 133.886 1.00 86.33  ?  938  PHE A CD1   1 
ATOM   3637  C  CD2   . PHE A 1 1066 ? 151.772 180.789 131.955 1.00 92.69  ?  938  PHE A CD2   1 
ATOM   3638  C  CE1   . PHE A 1 1066 ? 152.007 179.501 134.378 1.00 88.31  ?  938  PHE A CE1   1 
ATOM   3639  C  CE2   . PHE A 1 1066 ? 150.720 180.039 132.443 1.00 92.19  ?  938  PHE A CE2   1 
ATOM   3640  C  CZ    . PHE A 1 1066 ? 150.839 179.395 133.656 1.00 88.37  ?  938  PHE A CZ    1 
ATOM   3641  N  N     . ALA A 1 1067 ? 156.214 182.676 134.210 1.00 111.36 ?  939  ALA A N     1 
ATOM   3642  C  CA    . ALA A 1 1067 ? 156.928 182.516 135.472 1.00 117.62 ?  939  ALA A CA    1 
ATOM   3643  C  C     . ALA A 1 1067 ? 156.890 183.796 136.293 1.00 121.81 ?  939  ALA A C     1 
ATOM   3644  O  O     . ALA A 1 1067 ? 156.682 183.757 137.511 1.00 125.03 ?  939  ALA A O     1 
ATOM   3645  C  CB    . ALA A 1 1067 ? 158.373 182.101 135.205 1.00 113.08 ?  939  ALA A CB    1 
ATOM   3646  N  N     . ASP A 1 1068 ? 157.098 184.942 135.645 1.00 121.67 ?  940  ASP A N     1 
ATOM   3647  C  CA    . ASP A 1 1068 ? 157.046 186.216 136.350 1.00 130.53 ?  940  ASP A CA    1 
ATOM   3648  C  C     . ASP A 1 1068 ? 155.660 186.460 136.929 1.00 134.36 ?  940  ASP A C     1 
ATOM   3649  O  O     . ASP A 1 1068 ? 155.527 186.967 138.049 1.00 135.54 ?  940  ASP A O     1 
ATOM   3650  C  CB    . ASP A 1 1068 ? 157.449 187.351 135.408 1.00 143.06 ?  940  ASP A CB    1 
ATOM   3651  C  CG    . ASP A 1 1068 ? 158.898 187.257 134.967 1.00 157.40 ?  940  ASP A CG    1 
ATOM   3652  O  OD1   . ASP A 1 1068 ? 159.722 186.713 135.732 1.00 150.38 ?  940  ASP A OD1   1 
ATOM   3653  O  OD2   . ASP A 1 1068 ? 159.211 187.723 133.851 1.00 226.29 -1 940  ASP A OD2   1 
ATOM   3654  N  N     . LEU A 1 1069 ? 154.614 186.084 136.190 1.00 136.57 ?  941  LEU A N     1 
ATOM   3655  C  CA    . LEU A 1 1069 ? 153.255 186.282 136.679 1.00 142.20 ?  941  LEU A CA    1 
ATOM   3656  C  C     . LEU A 1 1069 ? 152.954 185.365 137.857 1.00 135.26 ?  941  LEU A C     1 
ATOM   3657  O  O     . LEU A 1 1069 ? 152.283 185.774 138.811 1.00 139.17 ?  941  LEU A O     1 
ATOM   3658  C  CB    . LEU A 1 1069 ? 152.251 186.059 135.549 1.00 145.43 ?  941  LEU A CB    1 
ATOM   3659  C  CG    . LEU A 1 1069 ? 150.778 186.255 135.910 1.00 152.72 ?  941  LEU A CG    1 
ATOM   3660  C  CD1   . LEU A 1 1069 ? 150.574 187.573 136.639 1.00 158.18 ?  941  LEU A CD1   1 
ATOM   3661  C  CD2   . LEU A 1 1069 ? 149.924 186.211 134.658 1.00 151.76 ?  941  LEU A CD2   1 
ATOM   3662  N  N     . LEU A 1 1070 ? 153.443 184.125 137.814 1.00 124.13 ?  942  LEU A N     1 
ATOM   3663  C  CA    . LEU A 1 1070 ? 153.239 183.231 138.949 1.00 121.33 ?  942  LEU A CA    1 
ATOM   3664  C  C     . LEU A 1 1070 ? 154.008 183.707 140.176 1.00 125.63 ?  942  LEU A C     1 
ATOM   3665  O  O     . LEU A 1 1070 ? 153.511 183.607 141.304 1.00 128.61 ?  942  LEU A O     1 
ATOM   3666  C  CB    . LEU A 1 1070 ? 153.642 181.804 138.584 1.00 120.88 ?  942  LEU A CB    1 
ATOM   3667  C  CG    . LEU A 1 1070 ? 152.537 180.969 137.938 1.00 120.63 ?  942  LEU A CG    1 
ATOM   3668  C  CD1   . LEU A 1 1070 ? 152.989 179.528 137.748 1.00 109.59 ?  942  LEU A CD1   1 
ATOM   3669  C  CD2   . LEU A 1 1070 ? 151.262 181.041 138.767 1.00 120.55 ?  942  LEU A CD2   1 
ATOM   3670  N  N     . SER A 1 1071 ? 155.219 184.233 139.978 1.00 129.18 ?  943  SER A N     1 
ATOM   3671  C  CA    . SER A 1 1071 ? 156.035 184.678 141.101 1.00 134.66 ?  943  SER A CA    1 
ATOM   3672  C  C     . SER A 1 1071 ? 155.588 186.020 141.668 1.00 141.63 ?  943  SER A C     1 
ATOM   3673  O  O     . SER A 1 1071 ? 155.877 186.309 142.834 1.00 143.53 ?  943  SER A O     1 
ATOM   3674  C  CB    . SER A 1 1071 ? 157.506 184.760 140.684 1.00 134.70 ?  943  SER A CB    1 
ATOM   3675  O  OG    . SER A 1 1071 ? 158.046 183.469 140.454 1.00 127.29 ?  943  SER A OG    1 
ATOM   3676  N  N     . SER A 1 1072 ? 154.900 186.847 140.879 1.00 144.45 ?  944  SER A N     1 
ATOM   3677  C  CA    . SER A 1 1072 ? 154.407 188.124 141.381 1.00 148.69 ?  944  SER A CA    1 
ATOM   3678  C  C     . SER A 1 1072 ? 152.978 188.048 141.901 1.00 152.01 ?  944  SER A C     1 
ATOM   3679  O  O     . SER A 1 1072 ? 152.627 188.783 142.831 1.00 151.84 ?  944  SER A O     1 
ATOM   3680  C  CB    . SER A 1 1072 ? 154.494 189.192 140.286 1.00 144.66 ?  944  SER A CB    1 
ATOM   3681  O  OG    . SER A 1 1072 ? 153.682 188.856 139.174 1.00 146.27 ?  944  SER A OG    1 
ATOM   3682  N  N     . MET A 1 1073 ? 152.146 187.176 141.330 1.00 147.83 ?  945  MET A N     1 
ATOM   3683  C  CA    . MET A 1 1073 ? 150.733 187.089 141.685 1.00 146.96 ?  945  MET A CA    1 
ATOM   3684  C  C     . MET A 1 1073 ? 150.447 185.937 142.643 1.00 141.41 ?  945  MET A C     1 
ATOM   3685  O  O     . MET A 1 1073 ? 149.895 186.147 143.727 1.00 140.25 ?  945  MET A O     1 
ATOM   3686  C  CB    . MET A 1 1073 ? 149.886 186.944 140.412 1.00 145.41 ?  945  MET A CB    1 
ATOM   3687  C  CG    . MET A 1 1073 ? 148.568 187.697 140.451 1.00 150.64 ?  945  MET A CG    1 
ATOM   3688  S  SD    . MET A 1 1073 ? 148.812 189.449 140.802 1.00 164.64 ?  945  MET A SD    1 
ATOM   3689  C  CE    . MET A 1 1073 ? 147.174 190.104 140.499 1.00 160.57 ?  945  MET A CE    1 
ATOM   3690  N  N     . PHE A 1 1074 ? 150.824 184.714 142.262 1.00 136.63 ?  946  PHE A N     1 
ATOM   3691  C  CA    . PHE A 1 1074 ? 150.415 183.513 142.977 1.00 135.52 ?  946  PHE A CA    1 
ATOM   3692  C  C     . PHE A 1 1074 ? 151.544 182.875 143.780 1.00 133.98 ?  946  PHE A C     1 
ATOM   3693  O  O     . PHE A 1 1074 ? 151.440 181.703 144.154 1.00 130.18 ?  946  PHE A O     1 
ATOM   3694  C  CB    . PHE A 1 1074 ? 149.836 182.488 142.002 1.00 132.71 ?  946  PHE A CB    1 
ATOM   3695  C  CG    . PHE A 1 1074 ? 148.543 182.912 141.379 1.00 129.80 ?  946  PHE A CG    1 
ATOM   3696  C  CD1   . PHE A 1 1074 ? 147.343 182.688 142.028 1.00 128.13 ?  946  PHE A CD1   1 
ATOM   3697  C  CD2   . PHE A 1 1074 ? 148.527 183.543 140.148 1.00 128.23 ?  946  PHE A CD2   1 
ATOM   3698  C  CE1   . PHE A 1 1074 ? 146.154 183.080 141.462 1.00 130.21 ?  946  PHE A CE1   1 
ATOM   3699  C  CE2   . PHE A 1 1074 ? 147.337 183.936 139.574 1.00 133.29 ?  946  PHE A CE2   1 
ATOM   3700  C  CZ    . PHE A 1 1074 ? 146.148 183.704 140.233 1.00 136.99 ?  946  PHE A CZ    1 
ATOM   3701  N  N     . LYS A 1 1075 ? 152.616 183.616 144.069 1.00 136.61 ?  947  LYS A N     1 
ATOM   3702  C  CA    . LYS A 1 1075 ? 153.703 183.015 144.836 1.00 133.65 ?  947  LYS A CA    1 
ATOM   3703  C  C     . LYS A 1 1075 ? 153.317 182.718 146.281 1.00 128.40 ?  947  LYS A C     1 
ATOM   3704  O  O     . LYS A 1 1075 ? 154.141 182.169 147.022 1.00 126.81 ?  947  LYS A O     1 
ATOM   3705  C  CB    . LYS A 1 1075 ? 154.944 183.910 144.803 1.00 138.42 ?  947  LYS A CB    1 
ATOM   3706  C  CG    . LYS A 1 1075 ? 156.250 183.141 144.984 1.00 131.78 ?  947  LYS A CG    1 
ATOM   3707  C  CD    . LYS A 1 1075 ? 157.463 184.049 144.928 1.00 138.50 ?  947  LYS A CD    1 
ATOM   3708  C  CE    . LYS A 1 1075 ? 158.744 183.255 145.124 1.00 129.41 ?  947  LYS A CE    1 
ATOM   3709  N  NZ    . LYS A 1 1075 ? 159.946 184.132 145.099 1.00 128.39 ?  947  LYS A NZ    1 
ATOM   3710  N  N     . TYR A 1 1076 ? 152.089 183.051 146.694 1.00 125.80 ?  948  TYR A N     1 
ATOM   3711  C  CA    . TYR A 1 1076 ? 151.587 182.644 148.002 1.00 125.77 ?  948  TYR A CA    1 
ATOM   3712  C  C     . TYR A 1 1076 ? 151.679 181.138 148.212 1.00 124.50 ?  948  TYR A C     1 
ATOM   3713  O  O     . TYR A 1 1076 ? 151.645 180.676 149.358 1.00 125.70 ?  948  TYR A O     1 
ATOM   3714  C  CB    . TYR A 1 1076 ? 150.129 183.087 148.162 1.00 124.72 ?  948  TYR A CB    1 
ATOM   3715  C  CG    . TYR A 1 1076 ? 149.177 182.267 147.321 1.00 126.13 ?  948  TYR A CG    1 
ATOM   3716  C  CD1   . TYR A 1 1076 ? 148.954 182.583 145.989 1.00 127.24 ?  948  TYR A CD1   1 
ATOM   3717  C  CD2   . TYR A 1 1076 ? 148.520 181.164 147.851 1.00 127.63 ?  948  TYR A CD2   1 
ATOM   3718  C  CE1   . TYR A 1 1076 ? 148.097 181.831 145.212 1.00 132.00 ?  948  TYR A CE1   1 
ATOM   3719  C  CE2   . TYR A 1 1076 ? 147.664 180.405 147.080 1.00 130.94 ?  948  TYR A CE2   1 
ATOM   3720  C  CZ    . TYR A 1 1076 ? 147.453 180.744 145.761 1.00 136.40 ?  948  TYR A CZ    1 
ATOM   3721  O  OH    . TYR A 1 1076 ? 146.598 179.993 144.988 1.00 134.48 ?  948  TYR A OH    1 
ATOM   3722  N  N     . ARG A 1 1077 ? 151.773 180.366 147.131 1.00 120.98 ?  949  ARG A N     1 
ATOM   3723  C  CA    . ARG A 1 1077 ? 151.838 178.914 147.187 1.00 117.22 ?  949  ARG A CA    1 
ATOM   3724  C  C     . ARG A 1 1077 ? 153.160 178.344 146.693 1.00 111.48 ?  949  ARG A C     1 
ATOM   3725  O  O     . ARG A 1 1077 ? 153.551 177.259 147.133 1.00 105.41 ?  949  ARG A O     1 
ATOM   3726  C  CB    . ARG A 1 1077 ? 150.684 178.308 146.363 1.00 115.38 ?  949  ARG A CB    1 
ATOM   3727  C  CG    . ARG A 1 1077 ? 150.711 176.792 146.222 1.00 108.28 ?  949  ARG A CG    1 
ATOM   3728  C  CD    . ARG A 1 1077 ? 149.713 176.302 145.185 1.00 107.40 ?  949  ARG A CD    1 
ATOM   3729  N  NE    . ARG A 1 1077 ? 148.483 175.814 145.795 1.00 107.55 ?  949  ARG A NE    1 
ATOM   3730  C  CZ    . ARG A 1 1077 ? 147.421 176.575 146.032 1.00 121.80 ?  949  ARG A CZ    1 
ATOM   3731  N  NH1   . ARG A 1 1077 ? 147.443 177.859 145.705 1.00 127.09 ?  949  ARG A NH1   1 
ATOM   3732  N  NH2   . ARG A 1 1077 ? 146.339 176.055 146.592 1.00 130.36 ?  949  ARG A NH2   1 
ATOM   3733  N  N     . TYR A 1 1078 ? 153.875 179.055 145.818 1.00 115.46 ?  950  TYR A N     1 
ATOM   3734  C  CA    . TYR A 1 1078 ? 155.074 178.537 145.171 1.00 112.38 ?  950  TYR A CA    1 
ATOM   3735  C  C     . TYR A 1 1078 ? 156.353 179.033 145.835 1.00 109.68 ?  950  TYR A C     1 
ATOM   3736  O  O     . TYR A 1 1078 ? 157.358 179.262 145.151 1.00 109.69 ?  950  TYR A O     1 
ATOM   3737  C  CB    . TYR A 1 1078 ? 155.080 178.904 143.688 1.00 117.23 ?  950  TYR A CB    1 
ATOM   3738  C  CG    . TYR A 1 1078 ? 153.869 178.425 142.922 1.00 116.82 ?  950  TYR A CG    1 
ATOM   3739  C  CD1   . TYR A 1 1078 ? 153.095 177.370 143.388 1.00 119.22 ?  950  TYR A CD1   1 
ATOM   3740  C  CD2   . TYR A 1 1078 ? 153.492 179.039 141.739 1.00 114.23 ?  950  TYR A CD2   1 
ATOM   3741  C  CE1   . TYR A 1 1078 ? 151.987 176.940 142.691 1.00 125.15 ?  950  TYR A CE1   1 
ATOM   3742  C  CE2   . TYR A 1 1078 ? 152.388 178.616 141.037 1.00 114.10 ?  950  TYR A CE2   1 
ATOM   3743  C  CZ    . TYR A 1 1078 ? 151.639 177.568 141.516 1.00 123.16 ?  950  TYR A CZ    1 
ATOM   3744  O  OH    . TYR A 1 1078 ? 150.535 177.149 140.814 1.00 125.25 ?  950  TYR A OH    1 
ATOM   3745  N  N     . ASP A 1 1079 ? 156.330 179.219 147.155 1.00 112.04 ?  951  ASP A N     1 
ATOM   3746  C  CA    . ASP A 1 1079 ? 157.552 179.558 147.875 1.00 115.50 ?  951  ASP A CA    1 
ATOM   3747  C  C     . ASP A 1 1079 ? 158.594 178.460 147.703 1.00 107.98 ?  951  ASP A C     1 
ATOM   3748  O  O     . ASP A 1 1079 ? 159.677 178.688 147.152 1.00 104.45 ?  951  ASP A O     1 
ATOM   3749  C  CB    . ASP A 1 1079 ? 157.238 179.785 149.356 1.00 139.20 ?  951  ASP A CB    1 
ATOM   3750  C  CG    . ASP A 1 1079 ? 156.319 178.720 149.928 1.00 152.84 ?  951  ASP A CG    1 
ATOM   3751  O  OD1   . ASP A 1 1079 ? 155.869 177.844 149.158 1.00 129.60 ?  951  ASP A OD1   1 
ATOM   3752  O  OD2   . ASP A 1 1079 ? 156.049 178.756 151.147 1.00 231.83 -1 951  ASP A OD2   1 
ATOM   3753  N  N     . GLY A 1 1080 ? 158.270 177.252 148.155 1.00 103.41 ?  952  GLY A N     1 
ATOM   3754  C  CA    . GLY A 1 1080 ? 159.151 176.111 148.023 1.00 90.98  ?  952  GLY A CA    1 
ATOM   3755  C  C     . GLY A 1 1080 ? 158.464 174.929 147.366 1.00 82.31  ?  952  GLY A C     1 
ATOM   3756  O  O     . GLY A 1 1080 ? 159.067 173.866 147.204 1.00 77.10  ?  952  GLY A O     1 
ATOM   3757  N  N     . LYS A 1 1081 ? 157.206 175.105 146.972 1.00 81.25  ?  953  LYS A N     1 
ATOM   3758  C  CA    . LYS A 1 1081 ? 156.400 174.052 146.373 1.00 73.83  ?  953  LYS A CA    1 
ATOM   3759  C  C     . LYS A 1 1081 ? 156.236 174.291 144.883 1.00 74.39  ?  953  LYS A C     1 
ATOM   3760  O  O     . LYS A 1 1081 ? 155.920 175.413 144.461 1.00 82.11  ?  953  LYS A O     1 
ATOM   3761  C  CB    . LYS A 1 1081 ? 155.026 173.982 147.041 1.00 67.13  ?  953  LYS A CB    1 
ATOM   3762  C  CG    . LYS A 1 1081 ? 154.125 172.897 146.487 1.00 54.71  ?  953  LYS A CG    1 
ATOM   3763  C  CD    . LYS A 1 1081 ? 152.914 172.682 147.371 1.00 51.02  ?  953  LYS A CD    1 
ATOM   3764  C  CE    . LYS A 1 1081 ? 152.043 171.557 146.846 1.00 42.17  ?  953  LYS A CE    1 
ATOM   3765  N  NZ    . LYS A 1 1081 ? 150.887 171.310 147.748 1.00 48.46  ?  953  LYS A NZ    1 
ATOM   3766  N  N     . ILE A 1 1082 ? 156.438 173.231 144.097 1.00 68.76  ?  954  ILE A N     1 
ATOM   3767  C  CA    . ILE A 1 1082 ? 156.191 173.274 142.656 1.00 65.27  ?  954  ILE A CA    1 
ATOM   3768  C  C     . ILE A 1 1082 ? 155.798 171.863 142.227 1.00 65.33  ?  954  ILE A C     1 
ATOM   3769  O  O     . ILE A 1 1082 ? 156.493 170.896 142.562 1.00 64.19  ?  954  ILE A O     1 
ATOM   3770  C  CB    . ILE A 1 1082 ? 157.436 173.709 141.865 1.00 61.83  ?  954  ILE A CB    1 
ATOM   3771  C  CG1   . ILE A 1 1082 ? 157.603 175.212 141.948 1.00 66.37  ?  954  ILE A CG1   1 
ATOM   3772  C  CG2   . ILE A 1 1082 ? 157.243 173.373 140.377 1.00 59.99  ?  954  ILE A CG2   1 
ATOM   3773  C  CD1   . ILE A 1 1082 ? 158.606 175.687 140.981 1.00 71.61  ?  954  ILE A CD1   1 
ATOM   3774  N  N     . THR A 1 1083 ? 154.690 171.730 141.497 1.00 64.58  ?  955  THR A N     1 
ATOM   3775  C  CA    . THR A 1 1083 ? 154.281 170.428 140.976 1.00 63.80  ?  955  THR A CA    1 
ATOM   3776  C  C     . THR A 1 1083 ? 155.283 169.943 139.931 1.00 62.81  ?  955  THR A C     1 
ATOM   3777  O  O     . THR A 1 1083 ? 155.793 170.728 139.126 1.00 56.95  ?  955  THR A O     1 
ATOM   3778  C  CB    . THR A 1 1083 ? 152.874 170.522 140.383 1.00 61.65  ?  955  THR A CB    1 
ATOM   3779  O  OG1   . THR A 1 1083 ? 151.939 170.802 141.432 1.00 66.40  ?  955  THR A OG1   1 
ATOM   3780  C  CG2   . THR A 1 1083 ? 152.473 169.222 139.705 1.00 61.24  ?  955  THR A CG2   1 
ATOM   3781  N  N     . ASN A 1 1084 ? 155.563 168.636 139.962 1.00 66.16  ?  956  ASN A N     1 
ATOM   3782  C  CA    . ASN A 1 1084 ? 156.637 168.044 139.168 1.00 61.52  ?  956  ASN A CA    1 
ATOM   3783  C  C     . ASN A 1 1084 ? 156.546 168.444 137.698 1.00 56.08  ?  956  ASN A C     1 
ATOM   3784  O  O     . ASN A 1 1084 ? 157.475 169.045 137.145 1.00 53.64  ?  956  ASN A O     1 
ATOM   3785  C  CB    . ASN A 1 1084 ? 156.591 166.522 139.321 1.00 62.33  ?  956  ASN A CB    1 
ATOM   3786  C  CG    . ASN A 1 1084 ? 157.949 165.921 139.622 1.00 58.05  ?  956  ASN A CG    1 
ATOM   3787  O  OD1   . ASN A 1 1084 ? 158.972 166.397 139.134 1.00 60.55  ?  956  ASN A OD1   1 
ATOM   3788  N  ND2   . ASN A 1 1084 ? 157.964 164.868 140.432 1.00 52.63  ?  956  ASN A ND2   1 
ATOM   3789  N  N     . TYR A 1 1085 ? 155.418 168.114 137.056 1.00 54.95  ?  957  TYR A N     1 
ATOM   3790  C  CA    . TYR A 1 1085 ? 155.204 168.417 135.640 1.00 54.81  ?  957  TYR A CA    1 
ATOM   3791  C  C     . TYR A 1 1085 ? 155.556 169.858 135.298 1.00 55.56  ?  957  TYR A C     1 
ATOM   3792  O  O     . TYR A 1 1085 ? 156.102 170.138 134.222 1.00 55.09  ?  957  TYR A O     1 
ATOM   3793  C  CB    . TYR A 1 1085 ? 153.745 168.150 135.271 1.00 60.44  ?  957  TYR A CB    1 
ATOM   3794  C  CG    . TYR A 1 1085 ? 153.451 166.725 134.886 1.00 76.27  ?  957  TYR A CG    1 
ATOM   3795  C  CD1   . TYR A 1 1085 ? 154.437 165.753 134.950 1.00 79.24  ?  957  TYR A CD1   1 
ATOM   3796  C  CD2   . TYR A 1 1085 ? 152.189 166.353 134.443 1.00 87.80  ?  957  TYR A CD2   1 
ATOM   3797  C  CE1   . TYR A 1 1085 ? 154.174 164.446 134.591 1.00 91.79  ?  957  TYR A CE1   1 
ATOM   3798  C  CE2   . TYR A 1 1085 ? 151.915 165.049 134.082 1.00 94.38  ?  957  TYR A CE2   1 
ATOM   3799  C  CZ    . TYR A 1 1085 ? 152.911 164.100 134.158 1.00 95.29  ?  957  TYR A CZ    1 
ATOM   3800  O  OH    . TYR A 1 1085 ? 152.640 162.800 133.799 1.00 99.80  ?  957  TYR A OH    1 
ATOM   3801  N  N     . LEU A 1 1086 ? 155.234 170.785 136.202 1.00 56.65  ?  958  LEU A N     1 
ATOM   3802  C  CA    . LEU A 1 1086 ? 155.379 172.205 135.906 1.00 56.19  ?  958  LEU A CA    1 
ATOM   3803  C  C     . LEU A 1 1086 ? 156.838 172.592 135.700 1.00 51.70  ?  958  LEU A C     1 
ATOM   3804  O  O     . LEU A 1 1086 ? 157.143 173.446 134.860 1.00 51.50  ?  958  LEU A O     1 
ATOM   3805  C  CB    . LEU A 1 1086 ? 154.758 173.039 137.026 1.00 60.05  ?  958  LEU A CB    1 
ATOM   3806  C  CG    . LEU A 1 1086 ? 154.512 174.510 136.689 1.00 54.15  ?  958  LEU A CG    1 
ATOM   3807  C  CD1   . LEU A 1 1086 ? 153.570 174.630 135.505 1.00 49.81  ?  958  LEU A CD1   1 
ATOM   3808  C  CD2   . LEU A 1 1086 ? 153.969 175.267 137.894 1.00 59.04  ?  958  LEU A CD2   1 
ATOM   3809  N  N     . HIS A 1 1087 ? 157.755 171.984 136.452 1.00 45.41  ?  959  HIS A N     1 
ATOM   3810  C  CA    . HIS A 1 1087 ? 159.161 172.337 136.296 1.00 42.83  ?  959  HIS A CA    1 
ATOM   3811  C  C     . HIS A 1 1087 ? 159.656 171.995 134.896 1.00 48.37  ?  959  HIS A C     1 
ATOM   3812  O  O     . HIS A 1 1087 ? 160.275 172.827 134.219 1.00 48.98  ?  959  HIS A O     1 
ATOM   3813  C  CB    . HIS A 1 1087 ? 160.011 171.629 137.346 1.00 37.54  ?  959  HIS A CB    1 
ATOM   3814  C  CG    . HIS A 1 1087 ? 161.467 171.618 137.012 1.00 39.38  ?  959  HIS A CG    1 
ATOM   3815  N  ND1   . HIS A 1 1087 ? 162.241 172.760 137.019 1.00 39.96  ?  959  HIS A ND1   1 
ATOM   3816  C  CD2   . HIS A 1 1087 ? 162.280 170.615 136.610 1.00 42.07  ?  959  HIS A CD2   1 
ATOM   3817  C  CE1   . HIS A 1 1087 ? 163.476 172.453 136.664 1.00 44.09  ?  959  HIS A CE1   1 
ATOM   3818  N  NE2   . HIS A 1 1087 ? 163.526 171.157 136.412 1.00 42.32  ?  959  HIS A NE2   1 
ATOM   3819  N  N     . LYS A 1 1088 ? 159.388 170.768 134.444 1.00 54.41  ?  960  LYS A N     1 
ATOM   3820  C  CA    . LYS A 1 1088 ? 159.792 170.368 133.103 1.00 52.62  ?  960  LYS A CA    1 
ATOM   3821  C  C     . LYS A 1 1088 ? 159.053 171.162 132.033 1.00 51.17  ?  960  LYS A C     1 
ATOM   3822  O  O     . LYS A 1 1088 ? 159.616 171.423 130.963 1.00 50.41  ?  960  LYS A O     1 
ATOM   3823  C  CB    . LYS A 1 1088 ? 159.557 168.868 132.914 1.00 53.54  ?  960  LYS A CB    1 
ATOM   3824  C  CG    . LYS A 1 1088 ? 160.188 168.004 134.000 1.00 53.34  ?  960  LYS A CG    1 
ATOM   3825  C  CD    . LYS A 1 1088 ? 159.889 166.522 133.795 1.00 55.74  ?  960  LYS A CD    1 
ATOM   3826  C  CE    . LYS A 1 1088 ? 160.410 165.685 134.960 1.00 51.41  ?  960  LYS A CE    1 
ATOM   3827  N  NZ    . LYS A 1 1088 ? 160.193 164.221 134.767 1.00 42.00  ?  960  LYS A NZ    1 
ATOM   3828  N  N     . THR A 1 1089 ? 157.803 171.561 132.297 1.00 56.34  ?  961  THR A N     1 
ATOM   3829  C  CA    . THR A 1 1089 ? 157.051 172.301 131.289 1.00 61.34  ?  961  THR A CA    1 
ATOM   3830  C  C     . THR A 1 1089 ? 157.478 173.761 131.199 1.00 58.06  ?  961  THR A C     1 
ATOM   3831  O  O     . THR A 1 1089 ? 157.272 174.388 130.155 1.00 64.81  ?  961  THR A O     1 
ATOM   3832  C  CB    . THR A 1 1089 ? 155.540 172.208 131.557 1.00 66.15  ?  961  THR A CB    1 
ATOM   3833  O  OG1   . THR A 1 1089 ? 154.822 172.407 130.333 1.00 72.26  ?  961  THR A OG1   1 
ATOM   3834  C  CG2   . THR A 1 1089 ? 155.087 173.267 132.539 1.00 55.85  ?  961  THR A CG2   1 
ATOM   3835  N  N     . LEU A 1 1090 ? 158.081 174.310 132.252 1.00 46.98  ?  962  LEU A N     1 
ATOM   3836  C  CA    . LEU A 1 1090 ? 158.504 175.703 132.232 1.00 43.37  ?  962  LEU A CA    1 
ATOM   3837  C  C     . LEU A 1 1090 ? 159.986 175.893 131.945 1.00 46.91  ?  962  LEU A C     1 
ATOM   3838  O  O     . LEU A 1 1090 ? 160.370 176.951 131.436 1.00 51.08  ?  962  LEU A O     1 
ATOM   3839  C  CB    . LEU A 1 1090 ? 158.170 176.379 133.565 1.00 36.76  ?  962  LEU A CB    1 
ATOM   3840  C  CG    . LEU A 1 1090 ? 156.686 176.440 133.918 1.00 35.23  ?  962  LEU A CG    1 
ATOM   3841  C  CD1   . LEU A 1 1090 ? 156.472 177.268 135.171 1.00 37.25  ?  962  LEU A CD1   1 
ATOM   3842  C  CD2   . LEU A 1 1090 ? 155.902 177.008 132.755 1.00 43.25  ?  962  LEU A CD2   1 
ATOM   3843  N  N     . ALA A 1 1091 ? 160.827 174.900 132.239 1.00 56.39  ?  963  ALA A N     1 
ATOM   3844  C  CA    . ALA A 1 1091 ? 162.273 175.111 132.214 1.00 61.40  ?  963  ALA A CA    1 
ATOM   3845  C  C     . ALA A 1 1091 ? 162.919 174.706 130.889 1.00 63.88  ?  963  ALA A C     1 
ATOM   3846  O  O     . ALA A 1 1091 ? 163.613 175.512 130.261 1.00 66.59  ?  963  ALA A O     1 
ATOM   3847  C  CB    . ALA A 1 1091 ? 162.929 174.354 133.375 1.00 64.60  ?  963  ALA A CB    1 
ATOM   3848  N  N     . HIS A 1 1092 ? 162.716 173.460 130.459 1.00 63.98  ?  964  HIS A N     1 
ATOM   3849  C  CA    . HIS A 1 1092 ? 163.499 172.884 129.372 1.00 68.48  ?  964  HIS A CA    1 
ATOM   3850  C  C     . HIS A 1 1092 ? 162.711 172.624 128.096 1.00 63.62  ?  964  HIS A C     1 
ATOM   3851  O  O     . HIS A 1 1092 ? 163.284 172.090 127.141 1.00 59.57  ?  964  HIS A O     1 
ATOM   3852  C  CB    . HIS A 1 1092 ? 164.141 171.572 129.831 1.00 65.48  ?  964  HIS A CB    1 
ATOM   3853  C  CG    . HIS A 1 1092 ? 164.391 171.510 131.303 1.00 56.56  ?  964  HIS A CG    1 
ATOM   3854  N  ND1   . HIS A 1 1092 ? 163.512 170.909 132.178 1.00 52.21  ?  964  HIS A ND1   1 
ATOM   3855  C  CD2   . HIS A 1 1092 ? 165.425 171.958 132.054 1.00 56.03  ?  964  HIS A CD2   1 
ATOM   3856  C  CE1   . HIS A 1 1092 ? 163.990 170.994 133.405 1.00 51.29  ?  964  HIS A CE1   1 
ATOM   3857  N  NE2   . HIS A 1 1092 ? 165.149 171.627 133.359 1.00 55.05  ?  964  HIS A NE2   1 
ATOM   3858  N  N     . VAL A 1 1093 ? 161.424 172.975 128.046 1.00 53.34  ?  965  VAL A N     1 
ATOM   3859  C  CA    . VAL A 1 1093 ? 160.628 172.673 126.855 1.00 41.66  ?  965  VAL A CA    1 
ATOM   3860  C  C     . VAL A 1 1093 ? 161.256 173.211 125.573 1.00 45.46  ?  965  VAL A C     1 
ATOM   3861  O  O     . VAL A 1 1093 ? 161.368 172.446 124.604 1.00 53.08  ?  965  VAL A O     1 
ATOM   3862  C  CB    . VAL A 1 1093 ? 159.173 173.152 127.053 1.00 42.55  ?  965  VAL A CB    1 
ATOM   3863  C  CG1   . VAL A 1 1093 ? 158.445 173.142 125.727 1.00 46.86  ?  965  VAL A CG1   1 
ATOM   3864  C  CG2   . VAL A 1 1093 ? 158.467 172.247 128.030 1.00 45.95  ?  965  VAL A CG2   1 
ATOM   3865  N  N     . PRO A 1 1094 ? 161.689 174.478 125.489 1.00 47.23  ?  966  PRO A N     1 
ATOM   3866  C  CA    . PRO A 1 1094 ? 162.399 174.896 124.268 1.00 50.19  ?  966  PRO A CA    1 
ATOM   3867  C  C     . PRO A 1 1094 ? 163.666 174.097 124.035 1.00 52.63  ?  966  PRO A C     1 
ATOM   3868  O  O     . PRO A 1 1094 ? 163.957 173.706 122.894 1.00 59.97  ?  966  PRO A O     1 
ATOM   3869  C  CB    . PRO A 1 1094 ? 162.692 176.383 124.522 1.00 46.03  ?  966  PRO A CB    1 
ATOM   3870  C  CG    . PRO A 1 1094 ? 162.634 176.539 125.996 1.00 47.99  ?  966  PRO A CG    1 
ATOM   3871  C  CD    . PRO A 1 1094 ? 161.570 175.591 126.450 1.00 48.73  ?  966  PRO A CD    1 
ATOM   3872  N  N     . GLU A 1 1095 ? 164.419 173.830 125.104 1.00 56.73  ?  967  GLU A N     1 
ATOM   3873  C  CA    . GLU A 1 1095 ? 165.603 172.987 124.992 1.00 67.22  ?  967  GLU A CA    1 
ATOM   3874  C  C     . GLU A 1 1095 ? 165.251 171.619 124.423 1.00 74.61  ?  967  GLU A C     1 
ATOM   3875  O  O     . GLU A 1 1095 ? 165.912 171.134 123.502 1.00 82.37  ?  967  GLU A O     1 
ATOM   3876  C  CB    . GLU A 1 1095 ? 166.276 172.849 126.359 1.00 77.06  ?  967  GLU A CB    1 
ATOM   3877  C  CG    . GLU A 1 1095 ? 167.168 171.625 126.488 1.00 96.21  ?  967  GLU A CG    1 
ATOM   3878  C  CD    . GLU A 1 1095 ? 168.289 171.606 125.468 1.00 118.77 ?  967  GLU A CD    1 
ATOM   3879  O  OE1   . GLU A 1 1095 ? 168.940 172.655 125.280 1.00 122.13 ?  967  GLU A OE1   1 
ATOM   3880  O  OE2   . GLU A 1 1095 ? 168.513 170.544 124.848 1.00 157.48 -1 967  GLU A OE2   1 
ATOM   3881  N  N     . ILE A 1 1096 ? 164.201 170.985 124.952 1.00 69.24  ?  968  ILE A N     1 
ATOM   3882  C  CA    . ILE A 1 1096 ? 163.828 169.646 124.494 1.00 72.33  ?  968  ILE A CA    1 
ATOM   3883  C  C     . ILE A 1 1096 ? 163.404 169.680 123.030 1.00 75.34  ?  968  ILE A C     1 
ATOM   3884  O  O     . ILE A 1 1096 ? 163.837 168.850 122.217 1.00 79.49  ?  968  ILE A O     1 
ATOM   3885  C  CB    . ILE A 1 1096 ? 162.716 169.058 125.383 1.00 70.68  ?  968  ILE A CB    1 
ATOM   3886  C  CG1   . ILE A 1 1096 ? 163.158 168.993 126.846 1.00 73.24  ?  968  ILE A CG1   1 
ATOM   3887  C  CG2   . ILE A 1 1096 ? 162.328 167.671 124.899 1.00 73.76  ?  968  ILE A CG2   1 
ATOM   3888  C  CD1   . ILE A 1 1096 ? 162.075 168.491 127.785 1.00 73.36  ?  968  ILE A CD1   1 
ATOM   3889  N  N     . VAL A 1 1097 ? 162.533 170.631 122.679 1.00 72.69  ?  969  VAL A N     1 
ATOM   3890  C  CA    . VAL A 1 1097 ? 162.014 170.715 121.315 1.00 73.79  ?  969  VAL A CA    1 
ATOM   3891  C  C     . VAL A 1 1097 ? 163.151 170.926 120.325 1.00 75.92  ?  969  VAL A C     1 
ATOM   3892  O  O     . VAL A 1 1097 ? 163.154 170.352 119.228 1.00 76.22  ?  969  VAL A O     1 
ATOM   3893  C  CB    . VAL A 1 1097 ? 160.956 171.830 121.212 1.00 79.04  ?  969  VAL A CB    1 
ATOM   3894  C  CG1   . VAL A 1 1097 ? 160.624 172.129 119.755 1.00 85.05  ?  969  VAL A CG1   1 
ATOM   3895  C  CG2   . VAL A 1 1097 ? 159.703 171.443 121.971 1.00 71.09  ?  969  VAL A CG2   1 
ATOM   3896  N  N     . GLU A 1 1098 ? 164.140 171.745 120.693 1.00 79.62  ?  970  GLU A N     1 
ATOM   3897  C  CA    . GLU A 1 1098 ? 165.295 171.907 119.817 1.00 90.48  ?  970  GLU A CA    1 
ATOM   3898  C  C     . GLU A 1 1098 ? 166.165 170.654 119.813 1.00 91.66  ?  970  GLU A C     1 
ATOM   3899  O  O     . GLU A 1 1098 ? 166.778 170.327 118.790 1.00 97.90  ?  970  GLU A O     1 
ATOM   3900  C  CB    . GLU A 1 1098 ? 166.105 173.131 120.244 1.00 99.23  ?  970  GLU A CB    1 
ATOM   3901  C  CG    . GLU A 1 1098 ? 166.685 173.926 119.086 1.00 121.04 ?  970  GLU A CG    1 
ATOM   3902  C  CD    . GLU A 1 1098 ? 167.777 173.178 118.349 1.00 147.27 ?  970  GLU A CD    1 
ATOM   3903  O  OE1   . GLU A 1 1098 ? 168.559 172.460 119.010 1.00 135.46 ?  970  GLU A OE1   1 
ATOM   3904  O  OE2   . GLU A 1 1098 ? 167.849 173.299 117.109 1.00 205.17 -1 970  GLU A OE2   1 
ATOM   3905  N  N     . ARG A 1 1099 ? 166.210 169.936 120.937 1.00 85.00  ?  971  ARG A N     1 
ATOM   3906  C  CA    . ARG A 1 1099 ? 167.021 168.729 121.034 1.00 85.18  ?  971  ARG A CA    1 
ATOM   3907  C  C     . ARG A 1 1099 ? 166.518 167.641 120.097 1.00 83.21  ?  971  ARG A C     1 
ATOM   3908  O  O     . ARG A 1 1099 ? 167.315 166.928 119.475 1.00 81.67  ?  971  ARG A O     1 
ATOM   3909  C  CB    . ARG A 1 1099 ? 167.020 168.226 122.477 1.00 79.32  ?  971  ARG A CB    1 
ATOM   3910  C  CG    . ARG A 1 1099 ? 167.485 166.793 122.640 1.00 66.64  ?  971  ARG A CG    1 
ATOM   3911  C  CD    . ARG A 1 1099 ? 166.790 166.129 123.812 1.00 54.25  ?  971  ARG A CD    1 
ATOM   3912  N  NE    . ARG A 1 1099 ? 167.709 165.295 124.578 1.00 49.14  ?  971  ARG A NE    1 
ATOM   3913  C  CZ    . ARG A 1 1099 ? 167.415 164.743 125.749 1.00 45.55  ?  971  ARG A CZ    1 
ATOM   3914  N  NH1   . ARG A 1 1099 ? 168.316 164.000 126.376 1.00 45.69  ?  971  ARG A NH1   1 
ATOM   3915  N  NH2   . ARG A 1 1099 ? 166.221 164.932 126.293 1.00 40.42  ?  971  ARG A NH2   1 
ATOM   3916  N  N     . ASP A 1 1100 ? 165.203 167.492 119.986 1.00 85.11  ?  972  ASP A N     1 
ATOM   3917  C  CA    . ASP A 1 1100 ? 164.634 166.371 119.247 1.00 87.73  ?  972  ASP A CA    1 
ATOM   3918  C  C     . ASP A 1 1100 ? 163.910 166.773 117.973 1.00 87.71  ?  972  ASP A C     1 
ATOM   3919  O  O     . ASP A 1 1100 ? 163.982 166.049 116.977 1.00 88.25  ?  972  ASP A O     1 
ATOM   3920  C  CB    . ASP A 1 1100 ? 163.674 165.588 120.147 1.00 92.99  ?  972  ASP A CB    1 
ATOM   3921  C  CG    . ASP A 1 1100 ? 162.813 164.620 119.369 1.00 99.27  ?  972  ASP A CG    1 
ATOM   3922  O  OD1   . ASP A 1 1100 ? 163.378 163.764 118.654 1.00 87.87  ?  972  ASP A OD1   1 
ATOM   3923  O  OD2   . ASP A 1 1100 ? 161.572 164.717 119.468 1.00 149.17 -1 972  ASP A OD2   1 
ATOM   3924  N  N     . GLY A 1 1101 ? 163.219 167.910 117.970 1.00 77.51  ?  973  GLY A N     1 
ATOM   3925  C  CA    . GLY A 1 1101 ? 162.411 168.328 116.842 1.00 70.01  ?  973  GLY A CA    1 
ATOM   3926  C  C     . GLY A 1 1101 ? 160.923 168.299 117.106 1.00 67.42  ?  973  GLY A C     1 
ATOM   3927  O  O     . GLY A 1 1101 ? 160.159 168.877 116.320 1.00 72.32  ?  973  GLY A O     1 
ATOM   3928  N  N     . SER A 1 1102 ? 160.488 167.644 118.178 1.00 60.96  ?  974  SER A N     1 
ATOM   3929  C  CA    . SER A 1 1102 ? 159.086 167.602 118.568 1.00 54.94  ?  974  SER A CA    1 
ATOM   3930  C  C     . SER A 1 1102 ? 159.012 167.131 120.014 1.00 45.20  ?  974  SER A C     1 
ATOM   3931  O  O     . SER A 1 1102 ? 160.032 166.847 120.649 1.00 52.74  ?  974  SER A O     1 
ATOM   3932  C  CB    . SER A 1 1102 ? 158.273 166.688 117.646 1.00 58.29  ?  974  SER A CB    1 
ATOM   3933  O  OG    . SER A 1 1102 ? 157.199 166.087 118.349 1.00 48.32  ?  974  SER A OG    1 
ATOM   3934  N  N     . ILE A 1 1103 ? 157.791 167.055 120.535 1.00 37.91  ?  975  ILE A N     1 
ATOM   3935  C  CA    . ILE A 1 1103 ? 157.566 166.500 121.863 1.00 31.56  ?  975  ILE A CA    1 
ATOM   3936  C  C     . ILE A 1 1103 ? 156.521 165.398 121.770 1.00 34.05  ?  975  ILE A C     1 
ATOM   3937  O  O     . ILE A 1 1103 ? 156.749 164.269 122.223 1.00 32.93  ?  975  ILE A O     1 
ATOM   3938  C  CB    . ILE A 1 1103 ? 157.149 167.593 122.861 1.00 37.13  ?  975  ILE A CB    1 
ATOM   3939  C  CG1   . ILE A 1 1103 ? 158.363 168.449 123.224 1.00 42.33  ?  975  ILE A CG1   1 
ATOM   3940  C  CG2   . ILE A 1 1103 ? 156.540 166.974 124.102 1.00 47.54  ?  975  ILE A CG2   1 
ATOM   3941  C  CD1   . ILE A 1 1103 ? 158.235 169.190 124.538 1.00 47.33  ?  975  ILE A CD1   1 
ATOM   3942  N  N     . GLY A 1 1104 ? 155.373 165.714 121.167 1.00 38.84  ?  976  GLY A N     1 
ATOM   3943  C  CA    . GLY A 1 1104 ? 154.302 164.741 121.040 1.00 39.51  ?  976  GLY A CA    1 
ATOM   3944  C  C     . GLY A 1 1104 ? 154.670 163.510 120.236 1.00 36.69  ?  976  GLY A C     1 
ATOM   3945  O  O     . GLY A 1 1104 ? 154.022 162.468 120.385 1.00 33.14  ?  976  GLY A O     1 
ATOM   3946  N  N     . ALA A 1 1105 ? 155.706 163.596 119.399 1.00 37.49  ?  977  ALA A N     1 
ATOM   3947  C  CA    . ALA A 1 1105 ? 156.088 162.514 118.499 1.00 35.62  ?  977  ALA A CA    1 
ATOM   3948  C  C     . ALA A 1 1105 ? 156.914 161.426 119.178 1.00 30.18  ?  977  ALA A C     1 
ATOM   3949  O  O     . ALA A 1 1105 ? 157.567 160.640 118.481 1.00 27.97  ?  977  ALA A O     1 
ATOM   3950  C  CB    . ALA A 1 1105 ? 156.858 163.073 117.301 1.00 37.40  ?  977  ALA A CB    1 
ATOM   3951  N  N     . TRP A 1 1106 ? 156.927 161.370 120.510 1.00 27.07  ?  978  TRP A N     1 
ATOM   3952  C  CA    . TRP A 1 1106 ? 157.634 160.304 121.208 1.00 24.16  ?  978  TRP A CA    1 
ATOM   3953  C  C     . TRP A 1 1106 ? 156.846 159.787 122.403 1.00 25.99  ?  978  TRP A C     1 
ATOM   3954  O  O     . TRP A 1 1106 ? 157.420 159.083 123.245 1.00 26.14  ?  978  TRP A O     1 
ATOM   3955  C  CB    . TRP A 1 1106 ? 159.017 160.778 121.663 1.00 22.79  ?  978  TRP A CB    1 
ATOM   3956  C  CG    . TRP A 1 1106 ? 159.884 161.195 120.529 1.00 24.69  ?  978  TRP A CG    1 
ATOM   3957  C  CD1   . TRP A 1 1106 ? 159.782 162.344 119.806 1.00 34.30  ?  978  TRP A CD1   1 
ATOM   3958  C  CD2   . TRP A 1 1106 ? 160.993 160.475 119.983 1.00 23.41  ?  978  TRP A CD2   1 
ATOM   3959  N  NE1   . TRP A 1 1106 ? 160.750 162.382 118.837 1.00 41.92  ?  978  TRP A NE1   1 
ATOM   3960  C  CE2   . TRP A 1 1106 ? 161.511 161.248 118.927 1.00 32.07  ?  978  TRP A CE2   1 
ATOM   3961  C  CE3   . TRP A 1 1106 ? 161.598 159.254 120.283 1.00 18.50  ?  978  TRP A CE3   1 
ATOM   3962  C  CZ2   . TRP A 1 1106 ? 162.604 160.840 118.172 1.00 30.48  ?  978  TRP A CZ2   1 
ATOM   3963  C  CZ3   . TRP A 1 1106 ? 162.680 158.851 119.532 1.00 22.92  ?  978  TRP A CZ3   1 
ATOM   3964  C  CH2   . TRP A 1 1106 ? 163.175 159.642 118.491 1.00 25.08  ?  978  TRP A CH2   1 
ATOM   3965  N  N     . ALA A 1 1107 ? 155.558 160.111 122.496 1.00 33.90  ?  979  ALA A N     1 
ATOM   3966  C  CA    . ALA A 1 1107 ? 154.749 159.703 123.634 1.00 36.96  ?  979  ALA A CA    1 
ATOM   3967  C  C     . ALA A 1 1107 ? 154.731 158.187 123.778 1.00 34.08  ?  979  ALA A C     1 
ATOM   3968  O  O     . ALA A 1 1107 ? 154.577 157.452 122.797 1.00 33.62  ?  979  ALA A O     1 
ATOM   3969  C  CB    . ALA A 1 1107 ? 153.322 160.228 123.476 1.00 47.74  ?  979  ALA A CB    1 
ATOM   3970  N  N     . SER A 1 1108 ? 154.895 157.723 125.020 1.00 34.48  ?  980  SER A N     1 
ATOM   3971  C  CA    . SER A 1 1108 ? 154.771 156.298 125.307 1.00 33.91  ?  980  SER A CA    1 
ATOM   3972  C  C     . SER A 1 1108 ? 153.406 155.764 124.902 1.00 38.16  ?  980  SER A C     1 
ATOM   3973  O  O     . SER A 1 1108 ? 153.270 154.566 124.614 1.00 38.05  ?  980  SER A O     1 
ATOM   3974  C  CB    . SER A 1 1108 ? 155.005 156.040 126.796 1.00 36.94  ?  980  SER A CB    1 
ATOM   3975  O  OG    . SER A 1 1108 ? 153.845 156.349 127.553 1.00 41.80  ?  980  SER A OG    1 
ATOM   3976  N  N     . GLU A 1 1109 ? 152.399 156.643 124.848 1.00 45.33  ?  981  GLU A N     1 
ATOM   3977  C  CA    . GLU A 1 1109 ? 150.998 156.282 124.654 1.00 54.80  ?  981  GLU A CA    1 
ATOM   3978  C  C     . GLU A 1 1109 ? 150.823 155.242 123.558 1.00 45.90  ?  981  GLU A C     1 
ATOM   3979  O  O     . GLU A 1 1109 ? 149.894 154.429 123.614 1.00 42.07  ?  981  GLU A O     1 
ATOM   3980  C  CB    . GLU A 1 1109 ? 150.168 157.528 124.332 1.00 65.23  ?  981  GLU A CB    1 
ATOM   3981  C  CG    . GLU A 1 1109 ? 148.658 157.305 124.398 1.00 87.29  ?  981  GLU A CG    1 
ATOM   3982  C  CD    . GLU A 1 1109 ? 148.071 156.777 123.100 1.00 96.05  ?  981  GLU A CD    1 
ATOM   3983  O  OE1   . GLU A 1 1109 ? 148.768 156.825 122.063 1.00 86.04  ?  981  GLU A OE1   1 
ATOM   3984  O  OE2   . GLU A 1 1109 ? 146.917 156.299 123.122 1.00 134.75 -1 981  GLU A OE2   1 
ATOM   3985  N  N     . GLY A 1 1110 ? 151.712 155.260 122.567 1.00 40.36  ?  982  GLY A N     1 
ATOM   3986  C  CA    . GLY A 1 1110 ? 151.697 154.258 121.524 1.00 38.03  ?  982  GLY A CA    1 
ATOM   3987  C  C     . GLY A 1 1110 ? 151.577 152.853 122.069 1.00 34.36  ?  982  GLY A C     1 
ATOM   3988  O  O     . GLY A 1 1110 ? 150.533 152.209 121.910 1.00 32.58  ?  982  GLY A O     1 
ATOM   3989  N  N     . ASN A 1 1111 ? 152.626 152.385 122.752 1.00 27.20  ?  983  ASN A N     1 
ATOM   3990  C  CA    . ASN A 1 1111 ? 152.566 151.059 123.354 1.00 22.76  ?  983  ASN A CA    1 
ATOM   3991  C  C     . ASN A 1 1111 ? 151.379 150.944 124.299 1.00 24.60  ?  983  ASN A C     1 
ATOM   3992  O  O     . ASN A 1 1111 ? 150.799 149.860 124.440 1.00 25.49  ?  983  ASN A O     1 
ATOM   3993  C  CB    . ASN A 1 1111 ? 153.873 150.751 124.087 1.00 19.85  ?  983  ASN A CB    1 
ATOM   3994  C  CG    . ASN A 1 1111 ? 153.945 149.316 124.579 1.00 14.50  ?  983  ASN A CG    1 
ATOM   3995  O  OD1   . ASN A 1 1111 ? 154.276 148.403 123.823 1.00 12.36  ?  983  ASN A OD1   1 
ATOM   3996  N  ND2   . ASN A 1 1111 ? 153.637 149.112 125.854 1.00 17.54  ?  983  ASN A ND2   1 
ATOM   3997  N  N     . GLU A 1 1112 ? 150.988 152.058 124.926 1.00 30.94  ?  984  GLU A N     1 
ATOM   3998  C  CA    . GLU A 1 1112 ? 149.812 152.055 125.788 1.00 35.66  ?  984  GLU A CA    1 
ATOM   3999  C  C     . GLU A 1 1112 ? 148.590 151.555 125.034 1.00 32.37  ?  984  GLU A C     1 
ATOM   4000  O  O     . GLU A 1 1112 ? 147.884 150.652 125.501 1.00 32.54  ?  984  GLU A O     1 
ATOM   4001  C  CB    . GLU A 1 1112 ? 149.563 153.456 126.345 1.00 50.23  ?  984  GLU A CB    1 
ATOM   4002  C  CG    . GLU A 1 1112 ? 148.328 153.569 127.229 1.00 64.77  ?  984  GLU A CG    1 
ATOM   4003  C  CD    . GLU A 1 1112 ? 148.465 152.807 128.534 1.00 87.87  ?  984  GLU A CD    1 
ATOM   4004  O  OE1   . GLU A 1 1112 ? 148.145 151.600 128.558 1.00 72.10  ?  984  GLU A OE1   1 
ATOM   4005  O  OE2   . GLU A 1 1112 ? 148.890 153.417 129.539 1.00 151.94 -1 984  GLU A OE2   1 
ATOM   4006  N  N     . SER A 1 1113 ? 148.328 152.123 123.855 1.00 30.43  ?  985  SER A N     1 
ATOM   4007  C  CA    . SER A 1 1113 ? 147.217 151.630 123.052 1.00 30.31  ?  985  SER A CA    1 
ATOM   4008  C  C     . SER A 1 1113 ? 147.387 150.148 122.758 1.00 26.51  ?  985  SER A C     1 
ATOM   4009  O  O     . SER A 1 1113 ? 146.418 149.377 122.818 1.00 26.23  ?  985  SER A O     1 
ATOM   4010  C  CB    . SER A 1 1113 ? 147.107 152.427 121.755 1.00 36.56  ?  985  SER A CB    1 
ATOM   4011  O  OG    . SER A 1 1113 ? 146.074 151.904 120.942 1.00 40.34  ?  985  SER A OG    1 
ATOM   4012  N  N     . GLY A 1 1114 ? 148.628 149.726 122.487 1.00 25.90  ?  986  GLY A N     1 
ATOM   4013  C  CA    . GLY A 1 1114 ? 148.894 148.325 122.217 1.00 25.63  ?  986  GLY A CA    1 
ATOM   4014  C  C     . GLY A 1 1114 ? 148.359 147.404 123.292 1.00 23.82  ?  986  GLY A C     1 
ATOM   4015  O  O     . GLY A 1 1114 ? 148.045 146.240 123.020 1.00 23.45  ?  986  GLY A O     1 
ATOM   4016  N  N     . ASN A 1 1115 ? 148.222 147.915 124.519 1.00 22.92  ?  987  ASN A N     1 
ATOM   4017  C  CA    . ASN A 1 1115 ? 147.707 147.100 125.612 1.00 24.49  ?  987  ASN A CA    1 
ATOM   4018  C  C     . ASN A 1 1115 ? 146.333 146.535 125.278 1.00 19.23  ?  987  ASN A C     1 
ATOM   4019  O  O     . ASN A 1 1115 ? 146.087 145.334 125.449 1.00 16.58  ?  987  ASN A O     1 
ATOM   4020  C  CB    . ASN A 1 1115 ? 147.655 147.921 126.900 1.00 25.02  ?  987  ASN A CB    1 
ATOM   4021  C  CG    . ASN A 1 1115 ? 149.001 148.507 127.271 1.00 27.76  ?  987  ASN A CG    1 
ATOM   4022  O  OD1   . ASN A 1 1115 ? 150.045 148.029 126.829 1.00 26.24  ?  987  ASN A OD1   1 
ATOM   4023  N  ND2   . ASN A 1 1115 ? 148.984 149.542 128.100 1.00 38.19  ?  987  ASN A ND2   1 
ATOM   4024  N  N     . LYS A 1 1116 ? 145.426 147.382 124.781 1.00 23.18  ?  988  LYS A N     1 
ATOM   4025  C  CA    . LYS A 1 1116 ? 144.086 146.876 124.505 1.00 21.62  ?  988  LYS A CA    1 
ATOM   4026  C  C     . LYS A 1 1116 ? 144.084 145.835 123.397 1.00 18.89  ?  988  LYS A C     1 
ATOM   4027  O  O     . LYS A 1 1116 ? 143.092 145.112 123.249 1.00 18.20  ?  988  LYS A O     1 
ATOM   4028  C  CB    . LYS A 1 1116 ? 143.130 148.028 124.176 1.00 31.38  ?  988  LYS A CB    1 
ATOM   4029  C  CG    . LYS A 1 1116 ? 143.355 148.733 122.850 1.00 32.78  ?  988  LYS A CG    1 
ATOM   4030  C  CD    . LYS A 1 1116 ? 142.375 149.891 122.709 1.00 39.44  ?  988  LYS A CD    1 
ATOM   4031  C  CE    . LYS A 1 1116 ? 142.500 150.593 121.370 1.00 51.55  ?  988  LYS A CE    1 
ATOM   4032  N  NZ    . LYS A 1 1116 ? 141.490 151.681 121.237 1.00 61.19  ?  988  LYS A NZ    1 
ATOM   4033  N  N     . LEU A 1 1117 ? 145.178 145.725 122.639 1.00 17.33  ?  989  LEU A N     1 
ATOM   4034  C  CA    . LEU A 1 1117 ? 145.325 144.607 121.715 1.00 16.55  ?  989  LEU A CA    1 
ATOM   4035  C  C     . LEU A 1 1117 ? 145.675 143.328 122.463 1.00 16.21  ?  989  LEU A C     1 
ATOM   4036  O  O     . LEU A 1 1117 ? 145.039 142.287 122.256 1.00 14.64  ?  989  LEU A O     1 
ATOM   4037  C  CB    . LEU A 1 1117 ? 146.399 144.917 120.674 1.00 14.83  ?  989  LEU A CB    1 
ATOM   4038  C  CG    . LEU A 1 1117 ? 146.208 146.143 119.783 1.00 15.14  ?  989  LEU A CG    1 
ATOM   4039  C  CD1   . LEU A 1 1117 ? 147.455 146.361 118.947 1.00 16.83  ?  989  LEU A CD1   1 
ATOM   4040  C  CD2   . LEU A 1 1117 ? 144.982 145.988 118.899 1.00 16.13  ?  989  LEU A CD2   1 
ATOM   4041  N  N     . PHE A 1 1118 ? 146.681 143.394 123.343 1.00 16.23  ?  990  PHE A N     1 
ATOM   4042  C  CA    . PHE A 1 1118 ? 147.247 142.191 123.948 1.00 17.73  ?  990  PHE A CA    1 
ATOM   4043  C  C     . PHE A 1 1118 ? 146.160 141.322 124.574 1.00 15.69  ?  990  PHE A C     1 
ATOM   4044  O  O     . PHE A 1 1118 ? 146.004 140.148 124.213 1.00 13.78  ?  990  PHE A O     1 
ATOM   4045  C  CB    . PHE A 1 1118 ? 148.311 142.581 124.980 1.00 18.66  ?  990  PHE A CB    1 
ATOM   4046  C  CG    . PHE A 1 1118 ? 148.854 141.420 125.770 1.00 10.72  ?  990  PHE A CG    1 
ATOM   4047  C  CD1   . PHE A 1 1118 ? 149.570 140.412 125.153 1.00 6.97   ?  990  PHE A CD1   1 
ATOM   4048  C  CD2   . PHE A 1 1118 ? 148.647 141.340 127.134 1.00 7.81   ?  990  PHE A CD2   1 
ATOM   4049  C  CE1   . PHE A 1 1118 ? 150.060 139.352 125.886 1.00 4.53   ?  990  PHE A CE1   1 
ATOM   4050  C  CE2   . PHE A 1 1118 ? 149.141 140.284 127.863 1.00 5.29   ?  990  PHE A CE2   1 
ATOM   4051  C  CZ    . PHE A 1 1118 ? 149.847 139.291 127.239 1.00 1.70   ?  990  PHE A CZ    1 
ATOM   4052  N  N     . ARG A 1 1119 ? 145.370 141.901 125.485 1.00 16.84  ?  991  ARG A N     1 
ATOM   4053  C  CA    . ARG A 1 1119 ? 144.283 141.152 126.111 1.00 17.59  ?  991  ARG A CA    1 
ATOM   4054  C  C     . ARG A 1 1119 ? 143.401 140.494 125.060 1.00 15.36  ?  991  ARG A C     1 
ATOM   4055  O  O     . ARG A 1 1119 ? 143.099 139.297 125.141 1.00 13.74  ?  991  ARG A O     1 
ATOM   4056  C  CB    . ARG A 1 1119 ? 143.433 142.068 126.991 1.00 23.22  ?  991  ARG A CB    1 
ATOM   4057  C  CG    . ARG A 1 1119 ? 144.188 143.081 127.818 1.00 23.97  ?  991  ARG A CG    1 
ATOM   4058  C  CD    . ARG A 1 1119 ? 143.225 144.173 128.240 1.00 31.88  ?  991  ARG A CD    1 
ATOM   4059  N  NE    . ARG A 1 1119 ? 143.724 144.962 129.359 1.00 40.00  ?  991  ARG A NE    1 
ATOM   4060  C  CZ    . ARG A 1 1119 ? 144.558 145.985 129.232 1.00 38.48  ?  991  ARG A CZ    1 
ATOM   4061  N  NH1   . ARG A 1 1119 ? 144.960 146.653 130.304 1.00 49.95  ?  991  ARG A NH1   1 
ATOM   4062  N  NH2   . ARG A 1 1119 ? 144.985 146.345 128.030 1.00 29.09  ?  991  ARG A NH2   1 
ATOM   4063  N  N     . ARG A 1 1120 ? 142.987 141.274 124.059 1.00 12.83  ?  992  ARG A N     1 
ATOM   4064  C  CA    . ARG A 1 1120 ? 142.169 140.748 122.973 1.00 10.06  ?  992  ARG A CA    1 
ATOM   4065  C  C     . ARG A 1 1120 ? 142.767 139.474 122.395 1.00 10.33  ?  992  ARG A C     1 
ATOM   4066  O  O     . ARG A 1 1120 ? 142.080 138.453 122.260 1.00 10.21  ?  992  ARG A O     1 
ATOM   4067  C  CB    . ARG A 1 1120 ? 142.024 141.809 121.885 1.00 10.30  ?  992  ARG A CB    1 
ATOM   4068  C  CG    . ARG A 1 1120 ? 141.284 141.327 120.666 1.00 8.83   ?  992  ARG A CG    1 
ATOM   4069  C  CD    . ARG A 1 1120 ? 139.796 141.384 120.893 1.00 14.64  ?  992  ARG A CD    1 
ATOM   4070  N  NE    . ARG A 1 1120 ? 139.061 140.851 119.756 1.00 16.60  ?  992  ARG A NE    1 
ATOM   4071  C  CZ    . ARG A 1 1120 ? 137.738 140.864 119.657 1.00 17.07  ?  992  ARG A CZ    1 
ATOM   4072  N  NH1   . ARG A 1 1120 ? 137.007 141.388 120.631 1.00 25.64  ?  992  ARG A NH1   1 
ATOM   4073  N  NH2   . ARG A 1 1120 ? 137.145 140.356 118.586 1.00 14.04  ?  992  ARG A NH2   1 
ATOM   4074  N  N     . PHE A 1 1121 ? 144.063 139.508 122.070 1.00 8.84   ?  993  PHE A N     1 
ATOM   4075  C  CA    . PHE A 1 1121 ? 144.684 138.347 121.445 1.00 7.54   ?  993  PHE A CA    1 
ATOM   4076  C  C     . PHE A 1 1121 ? 144.697 137.154 122.385 1.00 10.72  ?  993  PHE A C     1 
ATOM   4077  O  O     . PHE A 1 1121 ? 144.604 136.005 121.936 1.00 10.96  ?  993  PHE A O     1 
ATOM   4078  C  CB    . PHE A 1 1121 ? 146.099 138.689 120.990 1.00 5.11   ?  993  PHE A CB    1 
ATOM   4079  C  CG    . PHE A 1 1121 ? 146.186 139.070 119.547 1.00 2.24   ?  993  PHE A CG    1 
ATOM   4080  C  CD1   . PHE A 1 1121 ? 145.442 138.392 118.602 1.00 2.27   ?  993  PHE A CD1   1 
ATOM   4081  C  CD2   . PHE A 1 1121 ? 146.999 140.108 119.134 1.00 3.54   ?  993  PHE A CD2   1 
ATOM   4082  C  CE1   . PHE A 1 1121 ? 145.512 138.735 117.274 1.00 2.59   ?  993  PHE A CE1   1 
ATOM   4083  C  CE2   . PHE A 1 1121 ? 147.071 140.455 117.804 1.00 2.61   ?  993  PHE A CE2   1 
ATOM   4084  C  CZ    . PHE A 1 1121 ? 146.326 139.767 116.873 1.00 2.08   ?  993  PHE A CZ    1 
ATOM   4085  N  N     . ARG A 1 1122 ? 144.789 137.406 123.689 1.00 11.20  ?  994  ARG A N     1 
ATOM   4086  C  CA    . ARG A 1 1122 ? 144.756 136.323 124.658 1.00 9.24   ?  994  ARG A CA    1 
ATOM   4087  C  C     . ARG A 1 1122 ? 143.391 135.662 124.727 1.00 11.19  ?  994  ARG A C     1 
ATOM   4088  O  O     . ARG A 1 1122 ? 143.294 134.505 125.152 1.00 11.74  ?  994  ARG A O     1 
ATOM   4089  C  CB    . ARG A 1 1122 ? 145.142 136.857 126.032 1.00 9.82   ?  994  ARG A CB    1 
ATOM   4090  C  CG    . ARG A 1 1122 ? 145.624 135.808 126.991 1.00 9.53   ?  994  ARG A CG    1 
ATOM   4091  C  CD    . ARG A 1 1122 ? 146.665 136.406 127.906 1.00 17.25  ?  994  ARG A CD    1 
ATOM   4092  N  NE    . ARG A 1 1122 ? 146.888 135.575 129.079 1.00 25.17  ?  994  ARG A NE    1 
ATOM   4093  C  CZ    . ARG A 1 1122 ? 146.129 135.626 130.167 1.00 35.80  ?  994  ARG A CZ    1 
ATOM   4094  N  NH1   . ARG A 1 1122 ? 145.097 136.457 130.212 1.00 48.16  ?  994  ARG A NH1   1 
ATOM   4095  N  NH2   . ARG A 1 1122 ? 146.392 134.841 131.202 1.00 43.02  ?  994  ARG A NH2   1 
ATOM   4096  N  N     . LYS A 1 1123 ? 142.341 136.365 124.311 1.00 14.98  ?  995  LYS A N     1 
ATOM   4097  C  CA    . LYS A 1 1123 ? 140.989 135.865 124.492 1.00 17.65  ?  995  LYS A CA    1 
ATOM   4098  C  C     . LYS A 1 1123 ? 140.528 134.965 123.356 1.00 17.31  ?  995  LYS A C     1 
ATOM   4099  O  O     . LYS A 1 1123 ? 139.650 134.121 123.572 1.00 18.90  ?  995  LYS A O     1 
ATOM   4100  C  CB    . LYS A 1 1123 ? 140.019 137.040 124.652 1.00 17.21  ?  995  LYS A CB    1 
ATOM   4101  C  CG    . LYS A 1 1123 ? 138.679 136.668 125.264 1.00 21.60  ?  995  LYS A CG    1 
ATOM   4102  C  CD    . LYS A 1 1123 ? 138.189 137.748 126.214 1.00 26.92  ?  995  LYS A CD    1 
ATOM   4103  C  CE    . LYS A 1 1123 ? 137.991 139.063 125.485 1.00 29.76  ?  995  LYS A CE    1 
ATOM   4104  N  NZ    . LYS A 1 1123 ? 136.923 138.947 124.456 1.00 36.00  ?  995  LYS A NZ    1 
ATOM   4105  N  N     . MET A 1 1124 ? 141.110 135.099 122.162 1.00 12.25  ?  996  MET A N     1 
ATOM   4106  C  CA    . MET A 1 1124 ? 140.602 134.395 120.995 1.00 11.74  ?  996  MET A CA    1 
ATOM   4107  C  C     . MET A 1 1124 ? 141.641 133.612 120.206 1.00 10.76  ?  996  MET A C     1 
ATOM   4108  O  O     . MET A 1 1124 ? 141.250 132.817 119.343 1.00 13.56  ?  996  MET A O     1 
ATOM   4109  C  CB    . MET A 1 1124 ? 139.906 135.381 120.045 1.00 11.38  ?  996  MET A CB    1 
ATOM   4110  C  CG    . MET A 1 1124 ? 138.690 136.051 120.662 1.00 13.63  ?  996  MET A CG    1 
ATOM   4111  S  SD    . MET A 1 1124 ? 137.910 137.279 119.601 1.00 20.29  ?  996  MET A SD    1 
ATOM   4112  C  CE    . MET A 1 1124 ? 136.518 137.762 120.621 1.00 17.99  ?  996  MET A CE    1 
ATOM   4113  N  N     . ASN A 1 1125 ? 142.938 133.805 120.454 1.00 8.62   ?  997  ASN A N     1 
ATOM   4114  C  CA    . ASN A 1 1125 ? 143.961 133.166 119.639 1.00 11.55  ?  997  ASN A CA    1 
ATOM   4115  C  C     . ASN A 1 1125 ? 145.010 132.407 120.442 1.00 9.89   ?  997  ASN A C     1 
ATOM   4116  O  O     . ASN A 1 1125 ? 145.957 131.883 119.843 1.00 9.87   ?  997  ASN A O     1 
ATOM   4117  C  CB    . ASN A 1 1125 ? 144.671 134.205 118.753 1.00 10.23  ?  997  ASN A CB    1 
ATOM   4118  C  CG    . ASN A 1 1125 ? 143.802 134.700 117.603 1.00 11.28  ?  997  ASN A CG    1 
ATOM   4119  O  OD1   . ASN A 1 1125 ? 144.223 134.689 116.449 1.00 9.04   ?  997  ASN A OD1   1 
ATOM   4120  N  ND2   . ASN A 1 1125 ? 142.598 135.160 117.915 1.00 13.25  ?  997  ASN A ND2   1 
ATOM   4121  N  N     . ALA A 1 1126 ? 144.877 132.331 121.765 1.00 7.32   ?  998  ALA A N     1 
ATOM   4122  C  CA    . ALA A 1 1126 ? 145.860 131.638 122.584 1.00 7.44   ?  998  ALA A CA    1 
ATOM   4123  C  C     . ALA A 1 1126 ? 145.849 130.144 122.260 1.00 14.94  ?  998  ALA A C     1 
ATOM   4124  O  O     . ALA A 1 1126 ? 145.044 129.658 121.461 1.00 19.22  ?  998  ALA A O     1 
ATOM   4125  C  CB    . ALA A 1 1126 ? 145.584 131.889 124.064 1.00 12.74  ?  998  ALA A CB    1 
ATOM   4126  N  N     . ARG A 1 1127 ? 146.752 129.394 122.896 1.00 15.29  ?  999  ARG A N     1 
ATOM   4127  C  CA    . ARG A 1 1127 ? 146.883 127.978 122.555 1.00 17.98  ?  999  ARG A CA    1 
ATOM   4128  C  C     . ARG A 1 1127 ? 145.757 127.116 123.146 1.00 21.07  ?  999  ARG A C     1 
ATOM   4129  O  O     . ARG A 1 1127 ? 145.058 126.427 122.397 1.00 22.89  ?  999  ARG A O     1 
ATOM   4130  C  CB    . ARG A 1 1127 ? 148.270 127.449 122.950 1.00 18.68  ?  999  ARG A CB    1 
ATOM   4131  C  CG    . ARG A 1 1127 ? 148.554 126.054 122.416 1.00 20.04  ?  999  ARG A CG    1 
ATOM   4132  C  CD    . ARG A 1 1127 ? 148.837 126.082 120.922 1.00 24.20  ?  999  ARG A CD    1 
ATOM   4133  N  NE    . ARG A 1 1127 ? 150.263 126.184 120.628 1.00 23.06  ?  999  ARG A NE    1 
ATOM   4134  C  CZ    . ARG A 1 1127 ? 151.118 125.173 120.734 1.00 19.45  ?  999  ARG A CZ    1 
ATOM   4135  N  NH1   . ARG A 1 1127 ? 152.400 125.353 120.450 1.00 21.09  ?  999  ARG A NH1   1 
ATOM   4136  N  NH2   . ARG A 1 1127 ? 150.694 123.982 121.135 1.00 20.38  ?  999  ARG A NH2   1 
ATOM   4137  N  N     . GLN A 1 1128 ? 145.539 127.124 124.471 1.00 15.02  ?  1000 GLN A N     1 
ATOM   4138  C  CA    . GLN A 1 1128 ? 146.231 127.921 125.483 1.00 15.31  ?  1000 GLN A CA    1 
ATOM   4139  C  C     . GLN A 1 1128 ? 146.832 127.038 126.578 1.00 16.64  ?  1000 GLN A C     1 
ATOM   4140  O  O     . GLN A 1 1128 ? 146.168 126.169 127.151 1.00 23.15  ?  1000 GLN A O     1 
ATOM   4141  C  CB    . GLN A 1 1128 ? 145.281 128.971 126.088 1.00 15.88  ?  1000 GLN A CB    1 
ATOM   4142  C  CG    . GLN A 1 1128 ? 144.367 128.498 127.215 1.00 16.62  ?  1000 GLN A CG    1 
ATOM   4143  C  CD    . GLN A 1 1128 ? 143.338 127.487 126.755 1.00 18.60  ?  1000 GLN A CD    1 
ATOM   4144  O  OE1   . GLN A 1 1128 ? 142.401 127.823 126.031 1.00 17.25  ?  1000 GLN A OE1   1 
ATOM   4145  N  NE2   . GLN A 1 1128 ? 143.509 126.238 127.172 1.00 18.48  ?  1000 GLN A NE2   1 
ATOM   4146  N  N     . SER A 1 1129 ? 148.125 127.250 126.808 1.00 20.78  ?  1001 SER A N     1 
ATOM   4147  C  CA    . SER A 1 1129 ? 148.856 126.687 127.941 1.00 27.12  ?  1001 SER A CA    1 
ATOM   4148  C  C     . SER A 1 1129 ? 150.154 127.471 128.042 1.00 26.08  ?  1001 SER A C     1 
ATOM   4149  O  O     . SER A 1 1129 ? 150.911 127.526 127.068 1.00 28.47  ?  1001 SER A O     1 
ATOM   4150  C  CB    . SER A 1 1129 ? 149.108 125.184 127.764 1.00 32.42  ?  1001 SER A CB    1 
ATOM   4151  O  OG    . SER A 1 1129 ? 149.821 124.906 126.572 1.00 34.37  ?  1001 SER A OG    1 
ATOM   4152  N  N     . LYS A 1 1130 ? 150.416 128.062 129.215 1.00 26.79  ?  1002 LYS A N     1 
ATOM   4153  C  CA    . LYS A 1 1130 ? 151.320 129.209 129.330 1.00 27.87  ?  1002 LYS A CA    1 
ATOM   4154  C  C     . LYS A 1 1130 ? 152.686 129.003 128.680 1.00 26.45  ?  1002 LYS A C     1 
ATOM   4155  O  O     . LYS A 1 1130 ? 153.401 129.987 128.450 1.00 20.75  ?  1002 LYS A O     1 
ATOM   4156  C  CB    . LYS A 1 1130 ? 151.495 129.570 130.805 1.00 25.21  ?  1002 LYS A CB    1 
ATOM   4157  C  CG    . LYS A 1 1130 ? 150.241 130.152 131.435 1.00 29.76  ?  1002 LYS A CG    1 
ATOM   4158  C  CD    . LYS A 1 1130 ? 150.228 129.923 132.933 1.00 42.74  ?  1002 LYS A CD    1 
ATOM   4159  C  CE    . LYS A 1 1130 ? 150.296 128.437 133.250 1.00 49.68  ?  1002 LYS A CE    1 
ATOM   4160  N  NZ    . LYS A 1 1130 ? 150.317 128.167 134.714 1.00 55.88  ?  1002 LYS A NZ    1 
ATOM   4161  N  N     . THR A 1 1131 ? 153.071 127.761 128.379 1.00 28.23  ?  1003 THR A N     1 
ATOM   4162  C  CA    . THR A 1 1131 ? 154.275 127.539 127.583 1.00 24.93  ?  1003 THR A CA    1 
ATOM   4163  C  C     . THR A 1 1131 ? 154.116 128.125 126.183 1.00 20.68  ?  1003 THR A C     1 
ATOM   4164  O  O     . THR A 1 1131 ? 154.960 128.903 125.721 1.00 19.80  ?  1003 THR A O     1 
ATOM   4165  C  CB    . THR A 1 1131 ? 154.595 126.042 127.510 1.00 28.10  ?  1003 THR A CB    1 
ATOM   4166  O  OG1   . THR A 1 1131 ? 153.882 125.448 126.418 1.00 26.77  ?  1003 THR A OG1   1 
ATOM   4167  C  CG2   . THR A 1 1131 ? 154.209 125.338 128.805 1.00 24.03  ?  1003 THR A CG2   1 
ATOM   4168  N  N     . PHE A 1 1132 ? 153.022 127.778 125.500 1.00 24.77  ?  1004 PHE A N     1 
ATOM   4169  C  CA    . PHE A 1 1132 ? 152.792 128.192 124.119 1.00 27.58  ?  1004 PHE A CA    1 
ATOM   4170  C  C     . PHE A 1 1132 ? 151.955 129.458 123.993 1.00 27.03  ?  1004 PHE A C     1 
ATOM   4171  O  O     . PHE A 1 1132 ? 151.943 130.071 122.914 1.00 28.19  ?  1004 PHE A O     1 
ATOM   4172  C  CB    . PHE A 1 1132 ? 152.082 127.078 123.340 1.00 33.39  ?  1004 PHE A CB    1 
ATOM   4173  C  CG    . PHE A 1 1132 ? 152.770 125.742 123.403 1.00 35.69  ?  1004 PHE A CG    1 
ATOM   4174  C  CD1   . PHE A 1 1132 ? 154.055 125.582 122.913 1.00 40.02  ?  1004 PHE A CD1   1 
ATOM   4175  C  CD2   . PHE A 1 1132 ? 152.116 124.637 123.928 1.00 37.01  ?  1004 PHE A CD2   1 
ATOM   4176  C  CE1   . PHE A 1 1132 ? 154.682 124.350 122.961 1.00 44.08  ?  1004 PHE A CE1   1 
ATOM   4177  C  CE2   . PHE A 1 1132 ? 152.739 123.402 123.978 1.00 41.59  ?  1004 PHE A CE2   1 
ATOM   4178  C  CZ    . PHE A 1 1132 ? 154.023 123.259 123.494 1.00 44.23  ?  1004 PHE A CZ    1 
ATOM   4179  N  N     . GLU A 1 1133 ? 151.225 129.828 125.047 1.00 20.89  ?  1005 GLU A N     1 
ATOM   4180  C  CA    . GLU A 1 1133 ? 150.301 130.955 124.971 1.00 18.60  ?  1005 GLU A CA    1 
ATOM   4181  C  C     . GLU A 1 1133 ? 151.023 132.233 124.565 1.00 16.39  ?  1005 GLU A C     1 
ATOM   4182  O  O     . GLU A 1 1133 ? 150.580 132.962 123.664 1.00 17.15  ?  1005 GLU A O     1 
ATOM   4183  C  CB    . GLU A 1 1133 ? 149.608 131.125 126.323 1.00 23.61  ?  1005 GLU A CB    1 
ATOM   4184  C  CG    . GLU A 1 1133 ? 148.684 132.314 126.431 1.00 26.31  ?  1005 GLU A CG    1 
ATOM   4185  C  CD    . GLU A 1 1133 ? 147.994 132.377 127.784 1.00 50.51  ?  1005 GLU A CD    1 
ATOM   4186  O  OE1   . GLU A 1 1133 ? 147.008 133.129 127.915 1.00 49.03  ?  1005 GLU A OE1   1 
ATOM   4187  O  OE2   . GLU A 1 1133 ? 148.439 131.674 128.719 1.00 103.68 -1 1005 GLU A OE2   1 
ATOM   4188  N  N     . LEU A 1 1134 ? 152.152 132.512 125.215 1.00 17.71  ?  1006 LEU A N     1 
ATOM   4189  C  CA    . LEU A 1 1134 ? 152.902 133.717 124.895 1.00 13.95  ?  1006 LEU A CA    1 
ATOM   4190  C  C     . LEU A 1 1134 ? 153.498 133.646 123.499 1.00 14.82  ?  1006 LEU A C     1 
ATOM   4191  O  O     . LEU A 1 1134 ? 153.510 134.649 122.774 1.00 16.17  ?  1006 LEU A O     1 
ATOM   4192  C  CB    . LEU A 1 1134 ? 153.993 133.944 125.931 1.00 8.12   ?  1006 LEU A CB    1 
ATOM   4193  C  CG    . LEU A 1 1134 ? 153.492 134.910 126.996 1.00 5.10   ?  1006 LEU A CG    1 
ATOM   4194  C  CD1   . LEU A 1 1134 ? 154.400 134.886 128.206 1.00 7.09   ?  1006 LEU A CD1   1 
ATOM   4195  C  CD2   . LEU A 1 1134 ? 153.377 136.302 126.403 1.00 3.84   ?  1006 LEU A CD2   1 
ATOM   4196  N  N     . GLU A 1 1135 ? 154.016 132.479 123.113 1.00 13.34  ?  1007 GLU A N     1 
ATOM   4197  C  CA    . GLU A 1 1135 ? 154.526 132.312 121.757 1.00 13.86  ?  1007 GLU A CA    1 
ATOM   4198  C  C     . GLU A 1 1135 ? 153.475 132.713 120.727 1.00 15.07  ?  1007 GLU A C     1 
ATOM   4199  O  O     . GLU A 1 1135 ? 153.746 133.502 119.808 1.00 9.76   ?  1007 GLU A O     1 
ATOM   4200  C  CB    . GLU A 1 1135 ? 154.965 130.864 121.547 1.00 15.34  ?  1007 GLU A CB    1 
ATOM   4201  C  CG    . GLU A 1 1135 ? 155.189 130.510 120.098 1.00 21.39  ?  1007 GLU A CG    1 
ATOM   4202  C  CD    . GLU A 1 1135 ? 155.667 129.090 119.917 1.00 32.35  ?  1007 GLU A CD    1 
ATOM   4203  O  OE1   . GLU A 1 1135 ? 156.191 128.507 120.889 1.00 28.14  ?  1007 GLU A OE1   1 
ATOM   4204  O  OE2   . GLU A 1 1135 ? 155.513 128.557 118.800 1.00 110.74 -1 1007 GLU A OE2   1 
ATOM   4205  N  N     . ASP A 1 1136 ? 152.254 132.194 120.888 1.00 20.31  ?  1008 ASP A N     1 
ATOM   4206  C  CA    . ASP A 1 1136 ? 151.199 132.464 119.914 1.00 21.74  ?  1008 ASP A CA    1 
ATOM   4207  C  C     . ASP A 1 1136 ? 150.790 133.933 119.927 1.00 15.15  ?  1008 ASP A C     1 
ATOM   4208  O  O     . ASP A 1 1136 ? 150.595 134.543 118.862 1.00 13.05  ?  1008 ASP A O     1 
ATOM   4209  C  CB    . ASP A 1 1136 ? 149.985 131.570 120.181 1.00 36.41  ?  1008 ASP A CB    1 
ATOM   4210  C  CG    . ASP A 1 1136 ? 150.215 130.123 119.766 1.00 65.00  ?  1008 ASP A CG    1 
ATOM   4211  O  OD1   . ASP A 1 1136 ? 150.857 129.898 118.717 1.00 53.39  ?  1008 ASP A OD1   1 
ATOM   4212  O  OD2   . ASP A 1 1136 ? 149.736 129.211 120.474 1.00 147.99 -1 1008 ASP A OD2   1 
ATOM   4213  N  N     . ILE A 1 1137 ? 150.650 134.517 121.119 1.00 14.00  ?  1009 ILE A N     1 
ATOM   4214  C  CA    . ILE A 1 1137 ? 150.267 135.923 121.205 1.00 6.88   ?  1009 ILE A CA    1 
ATOM   4215  C  C     . ILE A 1 1137 ? 151.303 136.802 120.515 1.00 3.70   ?  1009 ILE A C     1 
ATOM   4216  O  O     . ILE A 1 1137 ? 150.959 137.707 119.741 1.00 14.15  ?  1009 ILE A O     1 
ATOM   4217  C  CB    . ILE A 1 1137 ? 150.062 136.335 122.670 1.00 6.02   ?  1009 ILE A CB    1 
ATOM   4218  C  CG1   . ILE A 1 1137 ? 148.667 135.928 123.138 1.00 4.64   ?  1009 ILE A CG1   1 
ATOM   4219  C  CG2   . ILE A 1 1137 ? 150.252 137.824 122.825 1.00 5.01   ?  1009 ILE A CG2   1 
ATOM   4220  C  CD1   . ILE A 1 1137 ? 148.269 136.583 124.427 1.00 11.09  ?  1009 ILE A CD1   1 
ATOM   4221  N  N     . LEU A 1 1138 ? 152.587 136.551 120.782 1.00 6.84   ?  1010 LEU A N     1 
ATOM   4222  C  CA    . LEU A 1 1138 ? 153.641 137.356 120.174 1.00 4.21   ?  1010 LEU A CA    1 
ATOM   4223  C  C     . LEU A 1 1138 ? 153.633 137.216 118.657 1.00 4.71   ?  1010 LEU A C     1 
ATOM   4224  O  O     . LEU A 1 1138 ? 153.760 138.211 117.927 1.00 3.85   ?  1010 LEU A O     1 
ATOM   4225  C  CB    . LEU A 1 1138 ? 155.002 136.949 120.733 1.00 0.94   ?  1010 LEU A CB    1 
ATOM   4226  C  CG    . LEU A 1 1138 ? 156.180 137.389 119.863 1.00 3.28   ?  1010 LEU A CG    1 
ATOM   4227  C  CD1   . LEU A 1 1138 ? 156.292 138.903 119.868 1.00 2.52   ?  1010 LEU A CD1   1 
ATOM   4228  C  CD2   . LEU A 1 1138 ? 157.471 136.744 120.321 1.00 4.69   ?  1010 LEU A CD2   1 
ATOM   4229  N  N     . LYS A 1 1139 ? 153.509 135.979 118.164 1.00 6.22   ?  1011 LYS A N     1 
ATOM   4230  C  CA    . LYS A 1 1139 ? 153.476 135.757 116.722 1.00 5.99   ?  1011 LYS A CA    1 
ATOM   4231  C  C     . LYS A 1 1139 ? 152.349 136.553 116.071 1.00 4.32   ?  1011 LYS A C     1 
ATOM   4232  O  O     . LYS A 1 1139 ? 152.562 137.263 115.076 1.00 3.29   ?  1011 LYS A O     1 
ATOM   4233  C  CB    . LYS A 1 1139 ? 153.326 134.262 116.435 1.00 13.97  ?  1011 LYS A CB    1 
ATOM   4234  C  CG    . LYS A 1 1139 ? 153.508 133.870 114.977 1.00 14.43  ?  1011 LYS A CG    1 
ATOM   4235  C  CD    . LYS A 1 1139 ? 153.600 132.359 114.822 1.00 11.92  ?  1011 LYS A CD    1 
ATOM   4236  C  CE    . LYS A 1 1139 ? 152.245 131.709 115.025 1.00 7.67   ?  1011 LYS A CE    1 
ATOM   4237  N  NZ    . LYS A 1 1139 ? 151.288 132.091 113.953 1.00 7.35   ?  1011 LYS A NZ    1 
ATOM   4238  N  N     . HIS A 1 1140 ? 151.140 136.462 116.635 1.00 5.09   ?  1012 HIS A N     1 
ATOM   4239  C  CA    . HIS A 1 1140 ? 150.009 137.153 116.023 1.00 3.71   ?  1012 HIS A CA    1 
ATOM   4240  C  C     . HIS A 1 1140 ? 150.144 138.669 116.129 1.00 3.33   ?  1012 HIS A C     1 
ATOM   4241  O  O     . HIS A 1 1140 ? 149.782 139.391 115.192 1.00 3.29   ?  1012 HIS A O     1 
ATOM   4242  C  CB    . HIS A 1 1140 ? 148.697 136.672 116.636 1.00 3.99   ?  1012 HIS A CB    1 
ATOM   4243  C  CG    . HIS A 1 1140 ? 148.171 135.425 115.999 1.00 5.10   ?  1012 HIS A CG    1 
ATOM   4244  N  ND1   . HIS A 1 1140 ? 147.024 134.791 116.424 1.00 7.28   ?  1012 HIS A ND1   1 
ATOM   4245  C  CD2   . HIS A 1 1140 ? 148.642 134.695 114.960 1.00 6.57   ?  1012 HIS A CD2   1 
ATOM   4246  C  CE1   . HIS A 1 1140 ? 146.813 133.722 115.676 1.00 10.31  ?  1012 HIS A CE1   1 
ATOM   4247  N  NE2   . HIS A 1 1140 ? 147.779 133.643 114.779 1.00 7.82   ?  1012 HIS A NE2   1 
ATOM   4248  N  N     . HIS A 1 1141 ? 150.665 139.174 117.250 1.00 4.61   ?  1013 HIS A N     1 
ATOM   4249  C  CA    . HIS A 1 1141 ? 150.903 140.611 117.359 1.00 3.50   ?  1013 HIS A CA    1 
ATOM   4250  C  C     . HIS A 1 1141 ? 151.849 141.088 116.263 1.00 2.25   ?  1013 HIS A C     1 
ATOM   4251  O  O     . HIS A 1 1141 ? 151.533 142.024 115.510 1.00 2.78   ?  1013 HIS A O     1 
ATOM   4252  C  CB    . HIS A 1 1141 ? 151.460 140.951 118.742 1.00 4.11   ?  1013 HIS A CB    1 
ATOM   4253  C  CG    . HIS A 1 1141 ? 151.267 142.383 119.140 1.00 2.77   ?  1013 HIS A CG    1 
ATOM   4254  N  ND1   . HIS A 1 1141 ? 150.824 143.349 118.261 1.00 17.60  ?  1013 HIS A ND1   1 
ATOM   4255  C  CD2   . HIS A 1 1141 ? 151.456 143.012 120.324 1.00 3.43   ?  1013 HIS A CD2   1 
ATOM   4256  C  CE1   . HIS A 1 1141 ? 150.751 144.510 118.887 1.00 3.52   ?  1013 HIS A CE1   1 
ATOM   4257  N  NE2   . HIS A 1 1141 ? 151.130 144.333 120.140 1.00 5.71   ?  1013 HIS A NE2   1 
ATOM   4258  N  N     . TRP A 1 1142 ? 153.012 140.436 116.147 1.00 3.06   ?  1014 TRP A N     1 
ATOM   4259  C  CA    . TRP A 1 1142 ? 153.976 140.836 115.127 1.00 2.82   ?  1014 TRP A CA    1 
ATOM   4260  C  C     . TRP A 1 1142 ? 153.358 140.789 113.739 1.00 2.51   ?  1014 TRP A C     1 
ATOM   4261  O  O     . TRP A 1 1142 ? 153.618 141.667 112.907 1.00 3.32   ?  1014 TRP A O     1 
ATOM   4262  C  CB    . TRP A 1 1142 ? 155.223 139.955 115.177 1.00 2.22   ?  1014 TRP A CB    1 
ATOM   4263  C  CG    . TRP A 1 1142 ? 156.209 140.307 114.103 1.00 1.85   ?  1014 TRP A CG    1 
ATOM   4264  C  CD1   . TRP A 1 1142 ? 156.323 139.737 112.868 1.00 4.11   ?  1014 TRP A CD1   1 
ATOM   4265  C  CD2   . TRP A 1 1142 ? 157.195 141.337 114.161 1.00 2.62   ?  1014 TRP A CD2   1 
ATOM   4266  N  NE1   . TRP A 1 1142 ? 157.334 140.339 112.161 1.00 4.18   ?  1014 TRP A NE1   1 
ATOM   4267  C  CE2   . TRP A 1 1142 ? 157.884 141.327 112.933 1.00 0.63   ?  1014 TRP A CE2   1 
ATOM   4268  C  CE3   . TRP A 1 1142 ? 157.569 142.262 115.136 1.00 3.88   ?  1014 TRP A CE3   1 
ATOM   4269  C  CZ2   . TRP A 1 1142 ? 158.922 142.205 112.658 1.00 9.66   ?  1014 TRP A CZ2   1 
ATOM   4270  C  CZ3   . TRP A 1 1142 ? 158.597 143.128 114.861 1.00 6.10   ?  1014 TRP A CZ3   1 
ATOM   4271  C  CH2   . TRP A 1 1142 ? 159.263 143.097 113.633 1.00 9.67   ?  1014 TRP A CH2   1 
ATOM   4272  N  N     . LEU A 1 1143 ? 152.535 139.773 113.469 1.00 1.45   ?  1015 LEU A N     1 
ATOM   4273  C  CA    . LEU A 1 1143 ? 151.829 139.745 112.193 1.00 3.98   ?  1015 LEU A CA    1 
ATOM   4274  C  C     . LEU A 1 1143 ? 150.943 140.970 112.028 1.00 6.95   ?  1015 LEU A C     1 
ATOM   4275  O  O     . LEU A 1 1143 ? 150.893 141.575 110.949 1.00 1.72   ?  1015 LEU A O     1 
ATOM   4276  C  CB    . LEU A 1 1143 ? 150.993 138.475 112.075 1.00 2.51   ?  1015 LEU A CB    1 
ATOM   4277  C  CG    . LEU A 1 1143 ? 151.673 137.395 111.250 1.00 4.85   ?  1015 LEU A CG    1 
ATOM   4278  C  CD1   . LEU A 1 1143 ? 151.762 137.883 109.829 1.00 5.09   ?  1015 LEU A CD1   1 
ATOM   4279  C  CD2   . LEU A 1 1143 ? 153.044 137.105 111.790 1.00 6.41   ?  1015 LEU A CD2   1 
ATOM   4280  N  N     . TYR A 1 1144 ? 150.239 141.349 113.092 1.00 2.94   ?  1016 TYR A N     1 
ATOM   4281  C  CA    . TYR A 1 1144 ? 149.298 142.457 113.019 1.00 2.54   ?  1016 TYR A CA    1 
ATOM   4282  C  C     . TYR A 1 1144 ? 149.991 143.805 112.878 1.00 1.79   ?  1016 TYR A C     1 
ATOM   4283  O  O     . TYR A 1 1144 ? 149.345 144.785 112.491 1.00 3.60   ?  1016 TYR A O     1 
ATOM   4284  C  CB    . TYR A 1 1144 ? 148.409 142.438 114.262 1.00 4.26   ?  1016 TYR A CB    1 
ATOM   4285  C  CG    . TYR A 1 1144 ? 147.504 143.632 114.423 1.00 4.32   ?  1016 TYR A CG    1 
ATOM   4286  C  CD1   . TYR A 1 1144 ? 146.636 144.017 113.413 1.00 5.89   ?  1016 TYR A CD1   1 
ATOM   4287  C  CD2   . TYR A 1 1144 ? 147.515 144.370 115.595 1.00 5.08   ?  1016 TYR A CD2   1 
ATOM   4288  C  CE1   . TYR A 1 1144 ? 145.811 145.109 113.568 1.00 8.17   ?  1016 TYR A CE1   1 
ATOM   4289  C  CE2   . TYR A 1 1144 ? 146.694 145.457 115.756 1.00 7.79   ?  1016 TYR A CE2   1 
ATOM   4290  C  CZ    . TYR A 1 1144 ? 145.845 145.824 114.743 1.00 8.00   ?  1016 TYR A CZ    1 
ATOM   4291  O  OH    . TYR A 1 1144 ? 145.026 146.914 114.914 1.00 8.86   ?  1016 TYR A OH    1 
ATOM   4292  N  N     . THR A 1 1145 ? 151.285 143.888 113.169 1.00 3.22   ?  1017 THR A N     1 
ATOM   4293  C  CA    . THR A 1 1145 ? 151.906 145.206 113.104 1.00 3.28   ?  1017 THR A CA    1 
ATOM   4294  C  C     . THR A 1 1145 ? 153.011 145.300 112.061 1.00 4.39   ?  1017 THR A C     1 
ATOM   4295  O  O     . THR A 1 1145 ? 154.077 145.863 112.331 1.00 7.30   ?  1017 THR A O     1 
ATOM   4296  C  CB    . THR A 1 1145 ? 152.471 145.598 114.464 1.00 3.92   ?  1017 THR A CB    1 
ATOM   4297  O  OG1   . THR A 1 1145 ? 153.215 146.814 114.326 1.00 7.82   ?  1017 THR A OG1   1 
ATOM   4298  C  CG2   . THR A 1 1145 ? 153.393 144.510 114.980 1.00 4.56   ?  1017 THR A CG2   1 
ATOM   4299  N  N     . SER A 1 1146 ? 152.774 144.779 110.864 1.00 7.79   ?  1018 SER A N     1 
ATOM   4300  C  CA    . SER A 1 1146 ? 153.758 144.854 109.793 1.00 14.85  ?  1018 SER A CA    1 
ATOM   4301  C  C     . SER A 1 1146 ? 153.191 145.707 108.666 1.00 19.28  ?  1018 SER A C     1 
ATOM   4302  O  O     . SER A 1 1146 ? 152.095 145.429 108.164 1.00 15.38  ?  1018 SER A O     1 
ATOM   4303  C  CB    . SER A 1 1146 ? 154.135 143.454 109.305 1.00 17.29  ?  1018 SER A CB    1 
ATOM   4304  O  OG    . SER A 1 1146 ? 155.439 143.441 108.751 1.00 22.12  ?  1018 SER A OG    1 
ATOM   4305  N  N     . LYS A 1 1147 ? 153.943 146.750 108.285 1.00 20.11  ?  1019 LYS A N     1 
ATOM   4306  C  CA    . LYS A 1 1147 ? 153.524 147.695 107.249 1.00 18.43  ?  1019 LYS A CA    1 
ATOM   4307  C  C     . LYS A 1 1147 ? 153.030 146.992 105.993 1.00 18.37  ?  1019 LYS A C     1 
ATOM   4308  O  O     . LYS A 1 1147 ? 152.130 147.497 105.306 1.00 18.33  ?  1019 LYS A O     1 
ATOM   4309  C  CB    . LYS A 1 1147 ? 154.693 148.625 106.906 1.00 23.22  ?  1019 LYS A CB    1 
ATOM   4310  C  CG    . LYS A 1 1147 ? 154.309 149.912 106.198 1.00 23.04  ?  1019 LYS A CG    1 
ATOM   4311  C  CD    . LYS A 1 1147 ? 153.486 150.807 107.107 1.00 21.36  ?  1019 LYS A CD    1 
ATOM   4312  C  CE    . LYS A 1 1147 ? 154.251 151.172 108.370 1.00 19.94  ?  1019 LYS A CE    1 
ATOM   4313  N  NZ    . LYS A 1 1147 ? 153.423 151.983 109.307 1.00 19.90  ?  1019 LYS A NZ    1 
ATOM   4314  N  N     . TYR A 1 1148 ? 153.608 145.829 105.681 1.00 21.56  ?  1020 TYR A N     1 
ATOM   4315  C  CA    . TYR A 1 1148 ? 153.201 145.067 104.506 1.00 18.50  ?  1020 TYR A CA    1 
ATOM   4316  C  C     . TYR A 1 1148 ? 151.717 144.725 104.568 1.00 17.30  ?  1020 TYR A C     1 
ATOM   4317  O  O     . TYR A 1 1148 ? 150.950 145.060 103.658 1.00 20.02  ?  1020 TYR A O     1 
ATOM   4318  C  CB    . TYR A 1 1148 ? 154.060 143.801 104.399 1.00 20.53  ?  1020 TYR A CB    1 
ATOM   4319  C  CG    . TYR A 1 1148 ? 153.925 142.993 103.115 1.00 16.55  ?  1020 TYR A CG    1 
ATOM   4320  C  CD1   . TYR A 1 1148 ? 152.905 143.236 102.202 1.00 16.73  ?  1020 TYR A CD1   1 
ATOM   4321  C  CD2   . TYR A 1 1148 ? 154.823 141.973 102.826 1.00 16.21  ?  1020 TYR A CD2   1 
ATOM   4322  C  CE1   . TYR A 1 1148 ? 152.785 142.495 101.047 1.00 20.51  ?  1020 TYR A CE1   1 
ATOM   4323  C  CE2   . TYR A 1 1148 ? 154.710 141.225 101.666 1.00 17.92  ?  1020 TYR A CE2   1 
ATOM   4324  C  CZ    . TYR A 1 1148 ? 153.688 141.491 100.782 1.00 20.90  ?  1020 TYR A CZ    1 
ATOM   4325  O  OH    . TYR A 1 1148 ? 153.568 140.753 99.626  1.00 18.23  ?  1020 TYR A OH    1 
ATOM   4326  N  N     . LEU A 1 1149 ? 151.289 144.057 105.634 1.00 13.34  ?  1021 LEU A N     1 
ATOM   4327  C  CA    . LEU A 1 1149 ? 149.903 143.618 105.714 1.00 11.37  ?  1021 LEU A CA    1 
ATOM   4328  C  C     . LEU A 1 1149 ? 148.941 144.738 106.084 1.00 15.47  ?  1021 LEU A C     1 
ATOM   4329  O  O     . LEU A 1 1149 ? 147.757 144.467 106.315 1.00 14.43  ?  1021 LEU A O     1 
ATOM   4330  C  CB    . LEU A 1 1149 ? 149.771 142.463 106.703 1.00 6.69   ?  1021 LEU A CB    1 
ATOM   4331  C  CG    . LEU A 1 1149 ? 150.710 141.308 106.377 1.00 4.48   ?  1021 LEU A CG    1 
ATOM   4332  C  CD1   . LEU A 1 1149 ? 151.891 141.351 107.317 1.00 6.16   ?  1021 LEU A CD1   1 
ATOM   4333  C  CD2   . LEU A 1 1149 ? 149.976 139.990 106.483 1.00 2.95   ?  1021 LEU A CD2   1 
ATOM   4334  N  N     . GLN A 1 1150 ? 149.416 145.977 106.155 1.00 18.25  ?  1022 GLN A N     1 
ATOM   4335  C  CA    . GLN A 1 1150 ? 148.540 147.139 106.127 1.00 18.76  ?  1022 GLN A CA    1 
ATOM   4336  C  C     . GLN A 1 1150 ? 148.425 147.725 104.730 1.00 24.42  ?  1022 GLN A C     1 
ATOM   4337  O  O     . GLN A 1 1150 ? 147.345 148.180 104.337 1.00 24.62  ?  1022 GLN A O     1 
ATOM   4338  C  CB    . GLN A 1 1150 ? 149.040 148.208 107.101 1.00 14.73  ?  1022 GLN A CB    1 
ATOM   4339  C  CG    . GLN A 1 1150 ? 148.731 147.883 108.549 1.00 15.05  ?  1022 GLN A CG    1 
ATOM   4340  C  CD    . GLN A 1 1150 ? 149.888 148.189 109.472 1.00 18.46  ?  1022 GLN A CD    1 
ATOM   4341  O  OE1   . GLN A 1 1150 ? 151.037 147.878 109.168 1.00 16.34  ?  1022 GLN A OE1   1 
ATOM   4342  N  NE2   . GLN A 1 1150 ? 149.589 148.787 110.616 1.00 17.22  ?  1022 GLN A NE2   1 
ATOM   4343  N  N     . LYS A 1 1151 ? 149.522 147.698 103.964 1.00 25.66  ?  1023 LYS A N     1 
ATOM   4344  C  CA    . LYS A 1 1151 ? 149.475 148.087 102.558 1.00 28.90  ?  1023 LYS A CA    1 
ATOM   4345  C  C     . LYS A 1 1151 ? 148.485 147.253 101.754 1.00 29.42  ?  1023 LYS A C     1 
ATOM   4346  O  O     . LYS A 1 1151 ? 148.039 147.696 100.689 1.00 37.96  ?  1023 LYS A O     1 
ATOM   4347  C  CB    . LYS A 1 1151 ? 150.867 147.976 101.932 1.00 29.63  ?  1023 LYS A CB    1 
ATOM   4348  C  CG    . LYS A 1 1151 ? 151.442 149.302 101.465 1.00 33.87  ?  1023 LYS A CG    1 
ATOM   4349  C  CD    . LYS A 1 1151 ? 151.399 150.340 102.574 1.00 36.98  ?  1023 LYS A CD    1 
ATOM   4350  C  CE    . LYS A 1 1151 ? 152.159 151.594 102.182 1.00 48.09  ?  1023 LYS A CE    1 
ATOM   4351  N  NZ    . LYS A 1 1151 ? 151.690 152.120 100.871 1.00 52.53  ?  1023 LYS A NZ    1 
ATOM   4352  N  N     . PHE A 1 1152 ? 148.139 146.056 102.229 1.00 23.17  ?  1024 PHE A N     1 
ATOM   4353  C  CA    . PHE A 1 1152 ? 147.141 145.232 101.563 1.00 22.14  ?  1024 PHE A CA    1 
ATOM   4354  C  C     . PHE A 1 1152 ? 145.734 145.489 102.067 1.00 22.67  ?  1024 PHE A C     1 
ATOM   4355  O  O     . PHE A 1 1152 ? 144.766 145.133 101.383 1.00 21.23  ?  1024 PHE A O     1 
ATOM   4356  C  CB    . PHE A 1 1152 ? 147.479 143.752 101.733 1.00 20.25  ?  1024 PHE A CB    1 
ATOM   4357  C  CG    . PHE A 1 1152 ? 148.335 143.212 100.638 1.00 20.84  ?  1024 PHE A CG    1 
ATOM   4358  C  CD1   . PHE A 1 1152 ? 148.421 143.882 99.430  1.00 21.60  ?  1024 PHE A CD1   1 
ATOM   4359  C  CD2   . PHE A 1 1152 ? 149.057 142.046 100.807 1.00 16.97  ?  1024 PHE A CD2   1 
ATOM   4360  C  CE1   . PHE A 1 1152 ? 149.208 143.398 98.409  1.00 26.04  ?  1024 PHE A CE1   1 
ATOM   4361  C  CE2   . PHE A 1 1152 ? 149.845 141.558 99.786  1.00 21.19  ?  1024 PHE A CE2   1 
ATOM   4362  C  CZ    . PHE A 1 1152 ? 149.922 142.234 98.587  1.00 25.17  ?  1024 PHE A CZ    1 
ATOM   4363  N  N     . MET A 1 1153 ? 145.599 146.081 103.246 1.00 21.51  ?  1025 MET A N     1 
ATOM   4364  C  CA    . MET A 1 1153 ? 144.300 146.521 103.741 1.00 23.47  ?  1025 MET A CA    1 
ATOM   4365  C  C     . MET A 1 1153 ? 144.116 148.008 103.450 1.00 32.91  ?  1025 MET A C     1 
ATOM   4366  O  O     . MET A 1 1153 ? 144.017 148.852 104.347 1.00 32.61  ?  1025 MET A O     1 
ATOM   4367  C  CB    . MET A 1 1153 ? 144.175 146.207 105.225 1.00 22.18  ?  1025 MET A CB    1 
ATOM   4368  C  CG    . MET A 1 1153 ? 142.750 146.133 105.713 1.00 20.76  ?  1025 MET A CG    1 
ATOM   4369  S  SD    . MET A 1 1153 ? 142.534 144.684 106.755 1.00 18.54  ?  1025 MET A SD    1 
ATOM   4370  C  CE    . MET A 1 1153 ? 140.947 145.032 107.489 1.00 34.04  ?  1025 MET A CE    1 
ATOM   4371  N  N     . GLU A 1 1154 ? 144.089 148.305 102.147 1.00 43.46  ?  1026 GLU A N     1 
ATOM   4372  C  CA    . GLU A 1 1154 ? 144.008 149.685 101.679 1.00 61.93  ?  1026 GLU A CA    1 
ATOM   4373  C  C     . GLU A 1 1154 ? 142.786 150.389 102.252 1.00 68.99  ?  1026 GLU A C     1 
ATOM   4374  O  O     . GLU A 1 1154 ? 142.911 151.369 102.997 1.00 73.76  ?  1026 GLU A O     1 
ATOM   4375  C  CB    . GLU A 1 1154 ? 143.977 149.719 100.149 1.00 77.81  ?  1026 GLU A CB    1 
ATOM   4376  C  CG    . GLU A 1 1154 ? 145.199 149.122 99.473  1.00 92.76  ?  1026 GLU A CG    1 
ATOM   4377  C  CD    . GLU A 1 1154 ? 145.353 149.591 98.037  1.00 131.51 ?  1026 GLU A CD    1 
ATOM   4378  O  OE1   . GLU A 1 1154 ? 145.226 150.810 97.794  1.00 124.25 ?  1026 GLU A OE1   1 
ATOM   4379  O  OE2   . GLU A 1 1154 ? 145.600 148.745 97.152  1.00 185.48 -1 1026 GLU A OE2   1 
ATOM   4380  N  N     . ALA A 1 1155 ? 141.595 149.897 101.916 1.00 63.91  ?  1027 ALA A N     1 
ATOM   4381  C  CA    . ALA A 1 1155 ? 140.335 150.476 102.376 1.00 67.13  ?  1027 ALA A CA    1 
ATOM   4382  C  C     . ALA A 1 1155 ? 140.271 151.964 102.031 1.00 82.45  ?  1027 ALA A C     1 
ATOM   4383  O  O     . ALA A 1 1155 ? 140.231 152.837 102.901 1.00 84.95  ?  1027 ALA A O     1 
ATOM   4384  C  CB    . ALA A 1 1155 ? 140.140 150.239 103.876 1.00 57.92  ?  1027 ALA A CB    1 
ATOM   4385  N  N     . HIS A 1 1156 ? 140.287 152.234 100.728 1.00 98.46  ?  1028 HIS A N     1 
ATOM   4386  C  CA    . HIS A 1 1156 ? 140.272 153.598 100.204 1.00 110.77 ?  1028 HIS A CA    1 
ATOM   4387  C  C     . HIS A 1 1156 ? 139.088 154.397 100.739 1.00 121.17 ?  1028 HIS A C     1 
ATOM   4388  O  O     . HIS A 1 1156 ? 138.830 155.514 100.293 1.00 126.21 ?  1028 HIS A O     1 
ATOM   4389  C  CB    . HIS A 1 1156 ? 140.235 153.582 98.672  1.00 122.54 ?  1028 HIS A CB    1 
ATOM   4390  C  CG    . HIS A 1 1156 ? 141.575 153.761 98.029  1.00 137.47 ?  1028 HIS A CG    1 
ATOM   4391  N  ND1   . HIS A 1 1156 ? 142.492 154.694 98.463  1.00 137.72 ?  1028 HIS A ND1   1 
ATOM   4392  C  CD2   . HIS A 1 1156 ? 142.149 153.132 96.975  1.00 144.17 ?  1028 HIS A CD2   1 
ATOM   4393  C  CE1   . HIS A 1 1156 ? 143.575 154.628 97.709  1.00 136.89 ?  1028 HIS A CE1   1 
ATOM   4394  N  NE2   . HIS A 1 1156 ? 143.392 153.689 96.798  1.00 140.49 ?  1028 HIS A NE2   1 
ATOM   4395  N  N     . MET B 2 4    ? 164.151 122.066 170.202 1.00 101.42 ?  1    MET B N     1 
ATOM   4396  C  CA    . MET B 2 4    ? 163.635 121.573 168.934 1.00 97.31  ?  1    MET B CA    1 
ATOM   4397  C  C     . MET B 2 4    ? 162.131 121.770 168.874 1.00 90.10  ?  1    MET B C     1 
ATOM   4398  O  O     . MET B 2 4    ? 161.364 120.810 168.926 1.00 90.42  ?  1    MET B O     1 
ATOM   4399  C  CB    . MET B 2 4    ? 163.989 120.098 168.743 1.00 100.57 ?  1    MET B CB    1 
ATOM   4400  C  CG    . MET B 2 4    ? 165.476 119.833 168.737 1.00 109.98 ?  1    MET B CG    1 
ATOM   4401  S  SD    . MET B 2 4    ? 166.323 120.946 167.605 1.00 113.36 ?  1    MET B SD    1 
ATOM   4402  C  CE    . MET B 2 4    ? 165.622 120.464 166.032 1.00 93.22  ?  1    MET B CE    1 
ATOM   4403  N  N     . SER B 2 5    ? 161.713 123.028 168.768 1.00 79.02  ?  2    SER B N     1 
ATOM   4404  C  CA    . SER B 2 5    ? 160.298 123.355 168.751 1.00 70.95  ?  2    SER B CA    1 
ATOM   4405  C  C     . SER B 2 5    ? 160.081 124.570 167.864 1.00 72.10  ?  2    SER B C     1 
ATOM   4406  O  O     . SER B 2 5    ? 160.959 125.432 167.737 1.00 72.80  ?  2    SER B O     1 
ATOM   4407  C  CB    . SER B 2 5    ? 159.766 123.614 170.165 1.00 70.48  ?  2    SER B CB    1 
ATOM   4408  O  OG    . SER B 2 5    ? 158.399 123.258 170.266 1.00 72.51  ?  2    SER B OG    1 
ATOM   4409  N  N     . LEU B 2 6    ? 158.899 124.620 167.253 1.00 72.32  ?  3    LEU B N     1 
ATOM   4410  C  CA    . LEU B 2 6    ? 158.515 125.663 166.317 1.00 69.98  ?  3    LEU B CA    1 
ATOM   4411  C  C     . LEU B 2 6    ? 157.364 126.487 166.881 1.00 69.71  ?  3    LEU B C     1 
ATOM   4412  O  O     . LEU B 2 6    ? 156.502 125.977 167.604 1.00 71.29  ?  3    LEU B O     1 
ATOM   4413  C  CB    . LEU B 2 6    ? 158.102 125.066 164.964 1.00 65.97  ?  3    LEU B CB    1 
ATOM   4414  C  CG    . LEU B 2 6    ? 156.794 124.267 164.882 1.00 67.72  ?  3    LEU B CG    1 
ATOM   4415  C  CD1   . LEU B 2 6    ? 155.615 125.136 164.446 1.00 63.53  ?  3    LEU B CD1   1 
ATOM   4416  C  CD2   . LEU B 2 6    ? 156.952 123.079 163.948 1.00 75.74  ?  3    LEU B CD2   1 
ATOM   4417  N  N     . GLN B 2 7    ? 157.368 127.773 166.540 1.00 70.92  ?  4    GLN B N     1 
ATOM   4418  C  CA    . GLN B 2 7    ? 156.249 128.667 166.815 1.00 70.69  ?  4    GLN B CA    1 
ATOM   4419  C  C     . GLN B 2 7    ? 155.971 129.445 165.536 1.00 67.82  ?  4    GLN B C     1 
ATOM   4420  O  O     . GLN B 2 7    ? 156.893 130.094 164.994 1.00 66.02  ?  4    GLN B O     1 
ATOM   4421  C  CB    . GLN B 2 7    ? 156.534 129.606 167.993 1.00 72.64  ?  4    GLN B CB    1 
ATOM   4422  C  CG    . GLN B 2 7    ? 157.913 130.256 167.990 1.00 75.86  ?  4    GLN B CG    1 
ATOM   4423  C  CD    . GLN B 2 7    ? 158.976 129.396 168.651 1.00 78.19  ?  4    GLN B CD    1 
ATOM   4424  O  OE1   . GLN B 2 7    ? 158.786 128.197 168.854 1.00 75.89  ?  4    GLN B OE1   1 
ATOM   4425  N  NE2   . GLN B 2 7    ? 160.105 130.008 168.988 1.00 79.08  ?  4    GLN B NE2   1 
ATOM   4426  N  N     . PRO B 2 8    ? 154.753 129.383 164.994 1.00 67.23  ?  5    PRO B N     1 
ATOM   4427  C  CA    . PRO B 2 8    ? 154.422 130.192 163.812 1.00 65.99  ?  5    PRO B CA    1 
ATOM   4428  C  C     . PRO B 2 8    ? 154.378 131.668 164.176 1.00 67.39  ?  5    PRO B C     1 
ATOM   4429  O  O     . PRO B 2 8    ? 153.569 132.096 165.003 1.00 66.51  ?  5    PRO B O     1 
ATOM   4430  C  CB    . PRO B 2 8    ? 153.045 129.665 163.392 1.00 59.33  ?  5    PRO B CB    1 
ATOM   4431  C  CG    . PRO B 2 8    ? 152.468 129.084 164.636 1.00 59.82  ?  5    PRO B CG    1 
ATOM   4432  C  CD    . PRO B 2 8    ? 153.631 128.521 165.405 1.00 65.96  ?  5    PRO B CD    1 
ATOM   4433  N  N     . LEU B 2 9    ? 155.261 132.443 163.558 1.00 71.72  ?  6    LEU B N     1 
ATOM   4434  C  CA    . LEU B 2 9    ? 155.343 133.871 163.808 1.00 76.16  ?  6    LEU B CA    1 
ATOM   4435  C  C     . LEU B 2 9    ? 154.411 134.594 162.835 1.00 77.70  ?  6    LEU B C     1 
ATOM   4436  O  O     . LEU B 2 9    ? 153.621 133.967 162.125 1.00 76.91  ?  6    LEU B O     1 
ATOM   4437  C  CB    . LEU B 2 9    ? 156.796 134.336 163.699 1.00 71.40  ?  6    LEU B CB    1 
ATOM   4438  C  CG    . LEU B 2 9    ? 157.853 133.636 164.565 1.00 68.49  ?  6    LEU B CG    1 
ATOM   4439  C  CD1   . LEU B 2 9    ? 159.043 134.553 164.778 1.00 70.95  ?  6    LEU B CD1   1 
ATOM   4440  C  CD2   . LEU B 2 9    ? 157.294 133.178 165.905 1.00 72.44  ?  6    LEU B CD2   1 
ATOM   4441  N  N     . THR B 2 10   ? 154.484 135.924 162.795 1.00 76.58  ?  7    THR B N     1 
ATOM   4442  C  CA    . THR B 2 10   ? 153.659 136.713 161.890 1.00 75.81  ?  7    THR B CA    1 
ATOM   4443  C  C     . THR B 2 10   ? 154.419 137.969 161.489 1.00 84.37  ?  7    THR B C     1 
ATOM   4444  O  O     . THR B 2 10   ? 155.275 138.457 162.231 1.00 88.54  ?  7    THR B O     1 
ATOM   4445  C  CB    . THR B 2 10   ? 152.310 137.097 162.520 1.00 81.11  ?  7    THR B CB    1 
ATOM   4446  O  OG1   . THR B 2 10   ? 152.491 137.377 163.914 1.00 97.39  ?  7    THR B OG1   1 
ATOM   4447  C  CG2   . THR B 2 10   ? 151.279 135.983 162.345 1.00 64.08  ?  7    THR B CG2   1 
ATOM   4448  N  N     . ALA B 2 11   ? 154.096 138.484 160.304 1.00 92.34  ?  8    ALA B N     1 
ATOM   4449  C  CA    . ALA B 2 11   ? 154.711 139.702 159.782 1.00 99.85  ?  8    ALA B CA    1 
ATOM   4450  C  C     . ALA B 2 11   ? 153.819 140.879 160.143 1.00 109.86 ?  8    ALA B C     1 
ATOM   4451  O  O     . ALA B 2 11   ? 152.781 141.107 159.509 1.00 107.44 ?  8    ALA B O     1 
ATOM   4452  C  CB    . ALA B 2 11   ? 154.922 139.600 158.276 1.00 102.00 ?  8    ALA B CB    1 
ATOM   4453  N  N     . VAL B 2 12   ? 154.243 141.641 161.160 1.00 122.39 ?  9    VAL B N     1 
ATOM   4454  C  CA    . VAL B 2 12   ? 153.456 142.806 161.589 1.00 132.90 ?  9    VAL B CA    1 
ATOM   4455  C  C     . VAL B 2 12   ? 153.392 143.835 160.476 1.00 131.48 ?  9    VAL B C     1 
ATOM   4456  O  O     . VAL B 2 12   ? 152.335 144.210 160.009 1.00 130.36 ?  9    VAL B O     1 
ATOM   4457  C  CB    . VAL B 2 12   ? 154.000 143.386 162.913 1.00 129.83 ?  9    VAL B CB    1 
ATOM   4458  C  CG1   . VAL B 2 12   ? 155.495 143.544 162.867 1.00 113.84 ?  9    VAL B CG1   1 
ATOM   4459  C  CG2   . VAL B 2 12   ? 153.272 144.661 163.285 1.00 125.38 ?  9    VAL B CG2   1 
ATOM   4460  N  N     . ASN B 2 13   ? 154.519 144.219 159.937 1.00 121.50 ?  10   ASN B N     1 
ATOM   4461  C  CA    . ASN B 2 13   ? 154.526 145.259 158.928 1.00 114.78 ?  10   ASN B CA    1 
ATOM   4462  C  C     . ASN B 2 13   ? 155.925 145.092 158.279 1.00 110.75 ?  10   ASN B C     1 
ATOM   4463  O  O     . ASN B 2 13   ? 156.725 144.298 158.789 1.00 106.28 ?  10   ASN B O     1 
ATOM   4464  C  CB    . ASN B 2 13   ? 154.214 146.407 159.803 1.00 113.56 ?  10   ASN B CB    1 
ATOM   4465  C  CG    . ASN B 2 13   ? 155.265 147.181 160.282 1.00 112.84 ?  10   ASN B CG    1 
ATOM   4466  O  OD1   . ASN B 2 13   ? 156.432 147.177 160.504 1.00 110.89 ?  10   ASN B OD1   1 
ATOM   4467  N  ND2   . ASN B 2 13   ? 154.596 147.413 161.394 1.00 118.10 ?  10   ASN B ND2   1 
ATOM   4468  N  N     . CYS B 2 14   ? 156.233 145.802 157.191 1.00 107.65 ?  11   CYS B N     1 
ATOM   4469  C  CA    . CYS B 2 14   ? 157.535 145.653 156.491 1.00 97.72  ?  11   CYS B CA    1 
ATOM   4470  C  C     . CYS B 2 14   ? 157.783 144.186 156.123 1.00 84.06  ?  11   CYS B C     1 
ATOM   4471  O  O     . CYS B 2 14   ? 158.834 143.605 156.406 1.00 75.88  ?  11   CYS B O     1 
ATOM   4472  C  CB    . CYS B 2 14   ? 158.683 146.205 157.349 1.00 91.08  ?  11   CYS B CB    1 
ATOM   4473  S  SG    . CYS B 2 14   ? 158.350 147.849 158.038 1.00 97.54  ?  11   CYS B SG    1 
ATOM   4474  N  N     . GLY B 2 15   ? 156.782 143.587 155.479 1.00 83.34  ?  12   GLY B N     1 
ATOM   4475  C  CA    . GLY B 2 15   ? 156.842 142.185 155.122 1.00 85.78  ?  12   GLY B CA    1 
ATOM   4476  C  C     . GLY B 2 15   ? 157.191 141.938 153.671 1.00 72.20  ?  12   GLY B C     1 
ATOM   4477  O  O     . GLY B 2 15   ? 157.588 140.828 153.301 1.00 74.48  ?  12   GLY B O     1 
ATOM   4478  N  N     . SER B 2 16   ? 157.055 142.966 152.835 1.00 59.82  ?  13   SER B N     1 
ATOM   4479  C  CA    . SER B 2 16   ? 157.382 142.846 151.422 1.00 47.96  ?  13   SER B CA    1 
ATOM   4480  C  C     . SER B 2 16   ? 158.865 143.006 151.167 1.00 43.51  ?  13   SER B C     1 
ATOM   4481  O  O     . SER B 2 16   ? 159.273 143.340 150.047 1.00 41.81  ?  13   SER B O     1 
ATOM   4482  C  CB    . SER B 2 16   ? 156.595 143.875 150.607 1.00 43.37  ?  13   SER B CB    1 
ATOM   4483  O  OG    . SER B 2 16   ? 157.051 145.191 150.868 1.00 41.42  ?  13   SER B OG    1 
ATOM   4484  N  N     . LEU B 2 17   ? 159.677 142.777 152.198 1.00 39.50  ?  14   LEU B N     1 
ATOM   4485  C  CA    . LEU B 2 17   ? 161.088 143.128 152.176 1.00 32.90  ?  14   LEU B CA    1 
ATOM   4486  C  C     . LEU B 2 17   ? 162.009 141.939 152.424 1.00 29.50  ?  14   LEU B C     1 
ATOM   4487  O  O     . LEU B 2 17   ? 163.209 142.139 152.640 1.00 25.59  ?  14   LEU B O     1 
ATOM   4488  C  CB    . LEU B 2 17   ? 161.358 144.228 153.207 1.00 33.05  ?  14   LEU B CB    1 
ATOM   4489  C  CG    . LEU B 2 17   ? 160.316 145.352 153.242 1.00 39.41  ?  14   LEU B CG    1 
ATOM   4490  C  CD1   . LEU B 2 17   ? 160.657 146.375 154.307 1.00 43.03  ?  14   LEU B CD1   1 
ATOM   4491  C  CD2   . LEU B 2 17   ? 160.170 146.027 151.881 1.00 34.92  ?  14   LEU B CD2   1 
ATOM   4492  N  N     . VAL B 2 18   ? 161.493 140.712 152.398 1.00 32.53  ?  15   VAL B N     1 
ATOM   4493  C  CA    . VAL B 2 18   ? 162.307 139.510 152.549 1.00 27.29  ?  15   VAL B CA    1 
ATOM   4494  C  C     . VAL B 2 18   ? 162.180 138.685 151.276 1.00 25.93  ?  15   VAL B C     1 
ATOM   4495  O  O     . VAL B 2 18   ? 161.070 138.465 150.780 1.00 30.61  ?  15   VAL B O     1 
ATOM   4496  C  CB    . VAL B 2 18   ? 161.894 138.686 153.783 1.00 31.28  ?  15   VAL B CB    1 
ATOM   4497  C  CG1   . VAL B 2 18   ? 162.748 137.433 153.896 1.00 28.36  ?  15   VAL B CG1   1 
ATOM   4498  C  CG2   . VAL B 2 18   ? 162.021 139.525 155.043 1.00 34.80  ?  15   VAL B CG2   1 
ATOM   4499  N  N     . GLN B 2 19   ? 163.316 138.232 150.755 1.00 20.40  ?  16   GLN B N     1 
ATOM   4500  C  CA    . GLN B 2 19   ? 163.402 137.472 149.520 1.00 20.13  ?  16   GLN B CA    1 
ATOM   4501  C  C     . GLN B 2 19   ? 164.137 136.163 149.769 1.00 21.36  ?  16   GLN B C     1 
ATOM   4502  O  O     . GLN B 2 19   ? 164.966 136.082 150.681 1.00 21.08  ?  16   GLN B O     1 
ATOM   4503  C  CB    . GLN B 2 19   ? 164.121 138.289 148.436 1.00 17.12  ?  16   GLN B CB    1 
ATOM   4504  C  CG    . GLN B 2 19   ? 165.407 138.932 148.922 1.00 18.03  ?  16   GLN B CG    1 
ATOM   4505  C  CD    . GLN B 2 19   ? 166.032 139.849 147.891 1.00 17.57  ?  16   GLN B CD    1 
ATOM   4506  O  OE1   . GLN B 2 19   ? 165.525 139.988 146.777 1.00 16.06  ?  16   GLN B OE1   1 
ATOM   4507  N  NE2   . GLN B 2 19   ? 167.142 140.481 148.256 1.00 16.88  ?  16   GLN B NE2   1 
ATOM   4508  N  N     . PRO B 2 20   ? 163.852 135.124 148.971 1.00 17.80  ?  17   PRO B N     1 
ATOM   4509  C  CA    . PRO B 2 20   ? 164.406 133.783 149.250 1.00 18.68  ?  17   PRO B CA    1 
ATOM   4510  C  C     . PRO B 2 20   ? 165.904 133.745 149.501 1.00 17.67  ?  17   PRO B C     1 
ATOM   4511  O  O     . PRO B 2 20   ? 166.381 132.836 150.197 1.00 18.56  ?  17   PRO B O     1 
ATOM   4512  C  CB    . PRO B 2 20   ? 164.032 132.999 147.987 1.00 20.37  ?  17   PRO B CB    1 
ATOM   4513  C  CG    . PRO B 2 20   ? 162.753 133.617 147.561 1.00 22.07  ?  17   PRO B CG    1 
ATOM   4514  C  CD    . PRO B 2 20   ? 162.894 135.092 147.852 1.00 22.96  ?  17   PRO B CD    1 
ATOM   4515  N  N     . GLY B 2 21   ? 166.663 134.689 148.955 1.00 11.91  ?  18   GLY B N     1 
ATOM   4516  C  CA    . GLY B 2 21   ? 168.052 134.857 149.307 1.00 12.13  ?  18   GLY B CA    1 
ATOM   4517  C  C     . GLY B 2 21   ? 168.211 136.049 150.227 1.00 13.41  ?  18   GLY B C     1 
ATOM   4518  O  O     . GLY B 2 21   ? 167.872 137.176 149.860 1.00 17.38  ?  18   GLY B O     1 
ATOM   4519  N  N     . PHE B 2 22   ? 168.719 135.795 151.429 1.00 13.73  ?  19   PHE B N     1 
ATOM   4520  C  CA    . PHE B 2 22   ? 168.974 136.861 152.390 1.00 14.84  ?  19   PHE B CA    1 
ATOM   4521  C  C     . PHE B 2 22   ? 169.938 136.339 153.443 1.00 16.44  ?  19   PHE B C     1 
ATOM   4522  O  O     . PHE B 2 22   ? 170.257 135.148 153.487 1.00 17.97  ?  19   PHE B O     1 
ATOM   4523  C  CB    . PHE B 2 22   ? 167.684 137.366 153.046 1.00 14.34  ?  19   PHE B CB    1 
ATOM   4524  C  CG    . PHE B 2 22   ? 167.110 136.425 154.066 1.00 14.68  ?  19   PHE B CG    1 
ATOM   4525  C  CD1   . PHE B 2 22   ? 166.926 135.083 153.775 1.00 19.35  ?  19   PHE B CD1   1 
ATOM   4526  C  CD2   . PHE B 2 22   ? 166.754 136.885 155.320 1.00 18.35  ?  19   PHE B CD2   1 
ATOM   4527  C  CE1   . PHE B 2 22   ? 166.398 134.222 154.713 1.00 24.62  ?  19   PHE B CE1   1 
ATOM   4528  C  CE2   . PHE B 2 22   ? 166.224 136.027 156.262 1.00 25.70  ?  19   PHE B CE2   1 
ATOM   4529  C  CZ    . PHE B 2 22   ? 166.046 134.694 155.958 1.00 28.51  ?  19   PHE B CZ    1 
ATOM   4530  N  N     . SER B 2 23   ? 170.387 137.248 154.307 1.00 17.82  ?  20   SER B N     1 
ATOM   4531  C  CA    . SER B 2 23   ? 171.358 136.896 155.330 1.00 21.37  ?  20   SER B CA    1 
ATOM   4532  C  C     . SER B 2 23   ? 170.989 137.543 156.656 1.00 27.55  ?  20   SER B C     1 
ATOM   4533  O  O     . SER B 2 23   ? 170.313 138.576 156.702 1.00 27.10  ?  20   SER B O     1 
ATOM   4534  C  CB    . SER B 2 23   ? 172.774 137.306 154.918 1.00 19.29  ?  20   SER B CB    1 
ATOM   4535  O  OG    . SER B 2 23   ? 173.159 136.622 153.739 1.00 15.91  ?  20   SER B OG    1 
ATOM   4536  N  N     . LEU B 2 24   ? 171.447 136.914 157.736 1.00 27.56  ?  21   LEU B N     1 
ATOM   4537  C  CA    . LEU B 2 24   ? 171.209 137.386 159.093 1.00 27.87  ?  21   LEU B CA    1 
ATOM   4538  C  C     . LEU B 2 24   ? 172.545 137.500 159.806 1.00 26.98  ?  21   LEU B C     1 
ATOM   4539  O  O     . LEU B 2 24   ? 173.241 136.497 160.000 1.00 27.28  ?  21   LEU B O     1 
ATOM   4540  C  CB    . LEU B 2 24   ? 170.261 136.452 159.853 1.00 32.69  ?  21   LEU B CB    1 
ATOM   4541  C  CG    . LEU B 2 24   ? 168.837 136.368 159.294 1.00 33.33  ?  21   LEU B CG    1 
ATOM   4542  C  CD1   . LEU B 2 24   ? 167.965 135.426 160.116 1.00 39.08  ?  21   LEU B CD1   1 
ATOM   4543  C  CD2   . LEU B 2 24   ? 168.209 137.754 159.224 1.00 29.81  ?  21   LEU B CD2   1 
ATOM   4544  N  N     . LEU B 2 25   ? 172.899 138.722 160.182 1.00 29.18  ?  22   LEU B N     1 
ATOM   4545  C  CA    . LEU B 2 25   ? 174.144 139.002 160.880 1.00 34.63  ?  22   LEU B CA    1 
ATOM   4546  C  C     . LEU B 2 25   ? 173.844 138.999 162.372 1.00 47.15  ?  22   LEU B C     1 
ATOM   4547  O  O     . LEU B 2 25   ? 173.075 139.837 162.860 1.00 48.61  ?  22   LEU B O     1 
ATOM   4548  C  CB    . LEU B 2 25   ? 174.721 140.338 160.426 1.00 33.83  ?  22   LEU B CB    1 
ATOM   4549  C  CG    . LEU B 2 25   ? 174.550 140.619 158.930 1.00 31.55  ?  22   LEU B CG    1 
ATOM   4550  C  CD1   . LEU B 2 25   ? 175.213 141.928 158.559 1.00 32.76  ?  22   LEU B CD1   1 
ATOM   4551  C  CD2   . LEU B 2 25   ? 175.110 139.480 158.090 1.00 30.15  ?  22   LEU B CD2   1 
ATOM   4552  N  N     . ASP B 2 26   ? 174.424 138.035 163.080 1.00 64.22  ?  23   ASP B N     1 
ATOM   4553  C  CA    . ASP B 2 26   ? 174.243 137.878 164.517 1.00 82.62  ?  23   ASP B CA    1 
ATOM   4554  C  C     . ASP B 2 26   ? 175.467 138.460 165.209 1.00 85.07  ?  23   ASP B C     1 
ATOM   4555  O  O     . ASP B 2 26   ? 176.568 137.907 165.108 1.00 80.03  ?  23   ASP B O     1 
ATOM   4556  C  CB    . ASP B 2 26   ? 174.048 136.407 164.879 1.00 106.23 ?  23   ASP B CB    1 
ATOM   4557  C  CG    . ASP B 2 26   ? 173.625 136.205 166.327 1.00 135.01 ?  23   ASP B CG    1 
ATOM   4558  O  OD1   . ASP B 2 26   ? 174.177 136.875 167.225 1.00 129.33 ?  23   ASP B OD1   1 
ATOM   4559  O  OD2   . ASP B 2 26   ? 172.734 135.366 166.566 1.00 180.55 -1 23   ASP B OD2   1 
ATOM   4560  N  N     . LEU B 2 27   ? 175.274 139.576 165.906 1.00 83.10  ?  24   LEU B N     1 
ATOM   4561  C  CA    . LEU B 2 27   ? 176.337 140.191 166.685 1.00 88.91  ?  24   LEU B CA    1 
ATOM   4562  C  C     . LEU B 2 27   ? 175.721 141.214 167.624 1.00 84.99  ?  24   LEU B C     1 
ATOM   4563  O  O     . LEU B 2 27   ? 174.799 141.938 167.236 1.00 80.06  ?  24   LEU B O     1 
ATOM   4564  C  CB    . LEU B 2 27   ? 177.394 140.848 165.781 1.00 88.20  ?  24   LEU B CB    1 
ATOM   4565  C  CG    . LEU B 2 27   ? 176.974 141.698 164.575 1.00 67.91  ?  24   LEU B CG    1 
ATOM   4566  C  CD1   . LEU B 2 27   ? 176.661 143.130 164.973 1.00 72.09  ?  24   LEU B CD1   1 
ATOM   4567  C  CD2   . LEU B 2 27   ? 178.062 141.676 163.514 1.00 55.98  ?  24   LEU B CD2   1 
ATOM   4568  N  N     . GLU B 2 28   ? 176.223 141.251 168.858 1.00 86.10  ?  25   GLU B N     1 
ATOM   4569  C  CA    . GLU B 2 28   ? 175.812 142.230 169.864 1.00 85.80  ?  25   GLU B CA    1 
ATOM   4570  C  C     . GLU B 2 28   ? 174.291 142.246 170.035 1.00 80.29  ?  25   GLU B C     1 
ATOM   4571  O  O     . GLU B 2 28   ? 173.600 143.202 169.681 1.00 80.94  ?  25   GLU B O     1 
ATOM   4572  C  CB    . GLU B 2 28   ? 176.341 143.627 169.522 1.00 90.90  ?  25   GLU B CB    1 
ATOM   4573  C  CG    . GLU B 2 28   ? 177.764 143.889 169.996 1.00 104.09 ?  25   GLU B CG    1 
ATOM   4574  C  CD    . GLU B 2 28   ? 178.786 142.982 169.342 1.00 122.44 ?  25   GLU B CD    1 
ATOM   4575  O  OE1   . GLU B 2 28   ? 178.524 142.501 168.221 1.00 112.40 ?  25   GLU B OE1   1 
ATOM   4576  O  OE2   . GLU B 2 28   ? 179.851 142.747 169.951 1.00 173.44 -1 25   GLU B OE2   1 
ATOM   4577  N  N     . GLY B 2 29   ? 173.783 141.135 170.558 1.00 79.60  ?  26   GLY B N     1 
ATOM   4578  C  CA    . GLY B 2 29   ? 172.366 141.044 170.844 1.00 83.49  ?  26   GLY B CA    1 
ATOM   4579  C  C     . GLY B 2 29   ? 171.510 140.969 169.598 1.00 84.77  ?  26   GLY B C     1 
ATOM   4580  O  O     . GLY B 2 29   ? 171.477 139.932 168.927 1.00 85.26  ?  26   GLY B O     1 
ATOM   4581  N  N     . ASP B 2 30   ? 170.812 142.065 169.289 1.00 95.52  ?  27   ASP B N     1 
ATOM   4582  C  CA    . ASP B 2 30   ? 169.905 142.097 168.149 1.00 100.23 ?  27   ASP B CA    1 
ATOM   4583  C  C     . ASP B 2 30   ? 170.611 141.650 166.874 1.00 80.56  ?  27   ASP B C     1 
ATOM   4584  O  O     . ASP B 2 30   ? 171.827 141.799 166.718 1.00 72.34  ?  27   ASP B O     1 
ATOM   4585  C  CB    . ASP B 2 30   ? 169.324 143.503 167.957 1.00 125.04 ?  27   ASP B CB    1 
ATOM   4586  C  CG    . ASP B 2 30   ? 168.134 143.779 168.867 1.00 139.61 ?  27   ASP B CG    1 
ATOM   4587  O  OD1   . ASP B 2 30   ? 167.729 142.865 169.616 1.00 128.71 ?  27   ASP B OD1   1 
ATOM   4588  O  OD2   . ASP B 2 30   ? 167.590 144.905 168.818 1.00 161.03 -1 27   ASP B OD2   1 
ATOM   4589  N  N     . VAL B 2 31   ? 169.826 141.090 165.962 1.00 70.19  ?  28   VAL B N     1 
ATOM   4590  C  CA    . VAL B 2 31   ? 170.315 140.555 164.700 1.00 57.51  ?  28   VAL B CA    1 
ATOM   4591  C  C     . VAL B 2 31   ? 169.856 141.463 163.563 1.00 45.20  ?  28   VAL B C     1 
ATOM   4592  O  O     . VAL B 2 31   ? 168.844 142.172 163.668 1.00 43.44  ?  28   VAL B O     1 
ATOM   4593  C  CB    . VAL B 2 31   ? 169.864 139.081 164.541 1.00 56.86  ?  28   VAL B CB    1 
ATOM   4594  C  CG1   . VAL B 2 31   ? 168.402 138.918 164.884 1.00 49.00  ?  28   VAL B CG1   1 
ATOM   4595  C  CG2   . VAL B 2 31   ? 170.135 138.550 163.149 1.00 50.89  ?  28   VAL B CG2   1 
ATOM   4596  N  N     . TYR B 2 32   ? 170.655 141.492 162.496 1.00 41.87  ?  29   TYR B N     1 
ATOM   4597  C  CA    . TYR B 2 32   ? 170.446 142.401 161.376 1.00 35.54  ?  29   TYR B CA    1 
ATOM   4598  C  C     . TYR B 2 32   ? 170.123 141.616 160.115 1.00 32.05  ?  29   TYR B C     1 
ATOM   4599  O  O     . TYR B 2 32   ? 170.862 140.701 159.739 1.00 31.93  ?  29   TYR B O     1 
ATOM   4600  C  CB    . TYR B 2 32   ? 171.679 143.280 161.154 1.00 33.16  ?  29   TYR B CB    1 
ATOM   4601  C  CG    . TYR B 2 32   ? 172.056 144.064 162.382 1.00 34.81  ?  29   TYR B CG    1 
ATOM   4602  C  CD1   . TYR B 2 32   ? 171.077 144.604 163.202 1.00 37.15  ?  29   TYR B CD1   1 
ATOM   4603  C  CD2   . TYR B 2 32   ? 173.384 144.239 162.741 1.00 40.52  ?  29   TYR B CD2   1 
ATOM   4604  C  CE1   . TYR B 2 32   ? 171.406 145.313 164.332 1.00 46.17  ?  29   TYR B CE1   1 
ATOM   4605  C  CE2   . TYR B 2 32   ? 173.726 144.947 163.874 1.00 49.02  ?  29   TYR B CE2   1 
ATOM   4606  C  CZ    . TYR B 2 32   ? 172.732 145.481 164.666 1.00 54.16  ?  29   TYR B CZ    1 
ATOM   4607  O  OH    . TYR B 2 32   ? 173.063 146.187 165.798 1.00 61.97  ?  29   TYR B OH    1 
ATOM   4608  N  N     . LEU B 2 33   ? 169.022 141.982 159.471 1.00 27.26  ?  30   LEU B N     1 
ATOM   4609  C  CA    . LEU B 2 33   ? 168.657 141.411 158.185 1.00 20.34  ?  30   LEU B CA    1 
ATOM   4610  C  C     . LEU B 2 33   ? 169.407 142.138 157.078 1.00 16.11  ?  30   LEU B C     1 
ATOM   4611  O  O     . LEU B 2 33   ? 169.604 143.357 157.137 1.00 16.23  ?  30   LEU B O     1 
ATOM   4612  C  CB    . LEU B 2 33   ? 167.147 141.515 157.966 1.00 21.23  ?  30   LEU B CB    1 
ATOM   4613  C  CG    . LEU B 2 33   ? 166.501 140.672 156.861 1.00 16.42  ?  30   LEU B CG    1 
ATOM   4614  C  CD1   . LEU B 2 33   ? 165.055 140.383 157.215 1.00 16.38  ?  30   LEU B CD1   1 
ATOM   4615  C  CD2   . LEU B 2 33   ? 166.577 141.361 155.509 1.00 16.90  ?  30   LEU B CD2   1 
ATOM   4616  N  N     . PHE B 2 34   ? 169.820 141.383 156.063 1.00 16.60  ?  31   PHE B N     1 
ATOM   4617  C  CA    . PHE B 2 34   ? 170.670 141.925 155.016 1.00 14.75  ?  31   PHE B CA    1 
ATOM   4618  C  C     . PHE B 2 34   ? 170.299 141.297 153.683 1.00 15.57  ?  31   PHE B C     1 
ATOM   4619  O  O     . PHE B 2 34   ? 170.136 140.075 153.593 1.00 15.95  ?  31   PHE B O     1 
ATOM   4620  C  CB    . PHE B 2 34   ? 172.143 141.668 155.343 1.00 16.62  ?  31   PHE B CB    1 
ATOM   4621  C  CG    . PHE B 2 34   ? 173.090 142.311 154.389 1.00 15.74  ?  31   PHE B CG    1 
ATOM   4622  C  CD1   . PHE B 2 34   ? 173.215 143.687 154.345 1.00 16.42  ?  31   PHE B CD1   1 
ATOM   4623  C  CD2   . PHE B 2 34   ? 173.862 141.542 153.540 1.00 17.21  ?  31   PHE B CD2   1 
ATOM   4624  C  CE1   . PHE B 2 34   ? 174.091 144.286 153.466 1.00 20.23  ?  31   PHE B CE1   1 
ATOM   4625  C  CE2   . PHE B 2 34   ? 174.740 142.135 152.659 1.00 18.04  ?  31   PHE B CE2   1 
ATOM   4626  C  CZ    . PHE B 2 34   ? 174.855 143.509 152.622 1.00 19.41  ?  31   PHE B CZ    1 
ATOM   4627  N  N     . GLY B 2 35   ? 170.182 142.135 152.652 1.00 15.36  ?  32   GLY B N     1 
ATOM   4628  C  CA    . GLY B 2 35   ? 169.811 141.678 151.326 1.00 14.82  ?  32   GLY B CA    1 
ATOM   4629  C  C     . GLY B 2 35   ? 168.336 141.822 151.003 1.00 11.35  ?  32   GLY B C     1 
ATOM   4630  O  O     . GLY B 2 35   ? 167.692 140.860 150.573 1.00 12.11  ?  32   GLY B O     1 
ATOM   4631  N  N     . GLN B 2 36   ? 167.790 143.017 151.207 1.00 11.09  ?  33   GLN B N     1 
ATOM   4632  C  CA    . GLN B 2 36   ? 166.387 143.265 150.917 1.00 11.31  ?  33   GLN B CA    1 
ATOM   4633  C  C     . GLN B 2 36   ? 166.122 143.171 149.415 1.00 13.07  ?  33   GLN B C     1 
ATOM   4634  O  O     . GLN B 2 36   ? 167.025 143.323 148.587 1.00 13.66  ?  33   GLN B O     1 
ATOM   4635  C  CB    . GLN B 2 36   ? 165.983 144.644 151.435 1.00 13.88  ?  33   GLN B CB    1 
ATOM   4636  C  CG    . GLN B 2 36   ? 164.492 144.869 151.546 1.00 19.73  ?  33   GLN B CG    1 
ATOM   4637  C  CD    . GLN B 2 36   ? 164.148 146.336 151.665 1.00 21.84  ?  33   GLN B CD    1 
ATOM   4638  O  OE1   . GLN B 2 36   ? 163.243 146.716 152.405 1.00 24.82  ?  33   GLN B OE1   1 
ATOM   4639  N  NE2   . GLN B 2 36   ? 164.870 147.173 150.929 1.00 17.99  ?  33   GLN B NE2   1 
ATOM   4640  N  N     . LYS B 2 37   ? 164.862 142.908 149.066 1.00 15.62  ?  34   LYS B N     1 
ATOM   4641  C  CA    . LYS B 2 37   ? 164.451 142.899 147.668 1.00 15.32  ?  34   LYS B CA    1 
ATOM   4642  C  C     . LYS B 2 37   ? 164.312 144.323 147.149 1.00 14.41  ?  34   LYS B C     1 
ATOM   4643  O  O     . LYS B 2 37   ? 163.792 145.205 147.840 1.00 15.78  ?  34   LYS B O     1 
ATOM   4644  C  CB    . LYS B 2 37   ? 163.125 142.156 147.493 1.00 14.50  ?  34   LYS B CB    1 
ATOM   4645  C  CG    . LYS B 2 37   ? 162.470 142.388 146.133 1.00 13.45  ?  34   LYS B CG    1 
ATOM   4646  C  CD    . LYS B 2 37   ? 161.029 141.917 146.100 1.00 11.40  ?  34   LYS B CD    1 
ATOM   4647  C  CE    . LYS B 2 37   ? 160.945 140.407 146.166 1.00 10.50  ?  34   LYS B CE    1 
ATOM   4648  N  NZ    . LYS B 2 37   ? 159.531 139.952 146.155 1.00 7.86   ?  34   LYS B NZ    1 
ATOM   4649  N  N     . GLY B 2 38   ? 164.777 144.547 145.923 1.00 11.20  ?  35   GLY B N     1 
ATOM   4650  C  CA    . GLY B 2 38   ? 164.725 145.879 145.359 1.00 9.72   ?  35   GLY B CA    1 
ATOM   4651  C  C     . GLY B 2 38   ? 165.746 146.792 146.004 1.00 9.82   ?  35   GLY B C     1 
ATOM   4652  O  O     . GLY B 2 38   ? 166.166 146.562 147.143 1.00 10.84  ?  35   GLY B O     1 
ATOM   4653  N  N     . TRP B 2 39   ? 166.153 147.835 145.284 1.00 9.94   ?  36   TRP B N     1 
ATOM   4654  C  CA    . TRP B 2 39   ? 167.203 148.713 145.765 1.00 11.75  ?  36   TRP B CA    1 
ATOM   4655  C  C     . TRP B 2 39   ? 166.782 149.389 147.071 1.00 10.98  ?  36   TRP B C     1 
ATOM   4656  O  O     . TRP B 2 39   ? 165.598 149.407 147.419 1.00 12.92  ?  36   TRP B O     1 
ATOM   4657  C  CB    . TRP B 2 39   ? 167.541 149.742 144.687 1.00 9.96   ?  36   TRP B CB    1 
ATOM   4658  C  CG    . TRP B 2 39   ? 168.321 149.136 143.562 1.00 6.18   ?  36   TRP B CG    1 
ATOM   4659  C  CD1   . TRP B 2 39   ? 167.830 148.675 142.377 1.00 5.40   ?  36   TRP B CD1   1 
ATOM   4660  C  CD2   . TRP B 2 39   ? 169.735 148.913 143.524 1.00 4.66   ?  36   TRP B CD2   1 
ATOM   4661  N  NE1   . TRP B 2 39   ? 168.851 148.183 141.600 1.00 5.73   ?  36   TRP B NE1   1 
ATOM   4662  C  CE2   . TRP B 2 39   ? 170.031 148.319 142.282 1.00 4.96   ?  36   TRP B CE2   1 
ATOM   4663  C  CE3   . TRP B 2 39   ? 170.778 149.165 144.417 1.00 5.76   ?  36   TRP B CE3   1 
ATOM   4664  C  CZ2   . TRP B 2 39   ? 171.325 147.971 141.914 1.00 5.86   ?  36   TRP B CZ2   1 
ATOM   4665  C  CZ3   . TRP B 2 39   ? 172.061 148.818 144.048 1.00 5.94   ?  36   TRP B CZ3   1 
ATOM   4666  C  CH2   . TRP B 2 39   ? 172.324 148.228 142.809 1.00 5.33   ?  36   TRP B CH2   1 
ATOM   4667  N  N     . PRO B 2 40   ? 167.743 149.911 147.835 1.00 7.74   ?  37   PRO B N     1 
ATOM   4668  C  CA    . PRO B 2 40   ? 167.391 150.590 149.089 1.00 8.57   ?  37   PRO B CA    1 
ATOM   4669  C  C     . PRO B 2 40   ? 166.430 151.743 148.843 1.00 10.32  ?  37   PRO B C     1 
ATOM   4670  O  O     . PRO B 2 40   ? 166.683 152.620 148.013 1.00 11.43  ?  37   PRO B O     1 
ATOM   4671  C  CB    . PRO B 2 40   ? 168.743 151.086 149.614 1.00 8.47   ?  37   PRO B CB    1 
ATOM   4672  C  CG    . PRO B 2 40   ? 169.734 150.173 149.004 1.00 7.58   ?  37   PRO B CG    1 
ATOM   4673  C  CD    . PRO B 2 40   ? 169.203 149.827 147.650 1.00 6.30   ?  37   PRO B CD    1 
ATOM   4674  N  N     . LYS B 2 41   ? 165.319 151.734 149.575 1.00 19.38  ?  38   LYS B N     1 
ATOM   4675  C  CA    . LYS B 2 41   ? 164.316 152.787 149.478 1.00 25.34  ?  38   LYS B CA    1 
ATOM   4676  C  C     . LYS B 2 41   ? 164.834 154.044 150.178 1.00 36.24  ?  38   LYS B C     1 
ATOM   4677  O  O     . LYS B 2 41   ? 165.995 154.136 150.587 1.00 33.19  ?  38   LYS B O     1 
ATOM   4678  C  CB    . LYS B 2 41   ? 162.995 152.327 150.087 1.00 25.11  ?  38   LYS B CB    1 
ATOM   4679  C  CG    . LYS B 2 41   ? 162.580 150.919 149.721 1.00 22.71  ?  38   LYS B CG    1 
ATOM   4680  C  CD    . LYS B 2 41   ? 161.906 150.873 148.364 1.00 29.18  ?  38   LYS B CD    1 
ATOM   4681  C  CE    . LYS B 2 41   ? 161.407 149.471 148.051 1.00 29.23  ?  38   LYS B CE    1 
ATOM   4682  N  NZ    . LYS B 2 41   ? 160.458 148.978 149.088 1.00 35.38  ?  38   LYS B NZ    1 
ATOM   4683  N  N     . ARG B 2 42   ? 163.954 155.037 150.321 1.00 38.34  ?  39   ARG B N     1 
ATOM   4684  C  CA    . ARG B 2 42   ? 164.283 156.234 151.087 1.00 42.08  ?  39   ARG B CA    1 
ATOM   4685  C  C     . ARG B 2 42   ? 164.168 155.999 152.589 1.00 35.91  ?  39   ARG B C     1 
ATOM   4686  O  O     . ARG B 2 42   ? 164.939 156.576 153.366 1.00 32.19  ?  39   ARG B O     1 
ATOM   4687  C  CB    . ARG B 2 42   ? 163.369 157.385 150.663 1.00 52.13  ?  39   ARG B CB    1 
ATOM   4688  C  CG    . ARG B 2 42   ? 163.355 158.563 151.614 1.00 57.40  ?  39   ARG B CG    1 
ATOM   4689  C  CD    . ARG B 2 42   ? 164.682 159.290 151.620 1.00 53.62  ?  39   ARG B CD    1 
ATOM   4690  N  NE    . ARG B 2 42   ? 164.556 160.592 152.265 1.00 61.49  ?  39   ARG B NE    1 
ATOM   4691  C  CZ    . ARG B 2 42   ? 163.806 161.583 151.793 1.00 68.17  ?  39   ARG B CZ    1 
ATOM   4692  N  NH1   . ARG B 2 42   ? 163.117 161.421 150.671 1.00 65.97  ?  39   ARG B NH1   1 
ATOM   4693  N  NH2   . ARG B 2 42   ? 163.747 162.738 152.441 1.00 68.57  ?  39   ARG B NH2   1 
ATOM   4694  N  N     . SER B 2 43   ? 163.222 155.150 153.005 1.00 33.95  ?  40   SER B N     1 
ATOM   4695  C  CA    . SER B 2 43   ? 163.015 154.878 154.425 1.00 32.83  ?  40   SER B CA    1 
ATOM   4696  C  C     . SER B 2 43   ? 164.274 154.339 155.094 1.00 25.86  ?  40   SER B C     1 
ATOM   4697  O  O     . SER B 2 43   ? 164.494 154.582 156.287 1.00 29.17  ?  40   SER B O     1 
ATOM   4698  C  CB    . SER B 2 43   ? 161.864 153.886 154.598 1.00 30.93  ?  40   SER B CB    1 
ATOM   4699  O  OG    . SER B 2 43   ? 160.724 154.293 153.860 1.00 37.29  ?  40   SER B OG    1 
ATOM   4700  N  N     . CYS B 2 44   ? 165.107 153.614 154.351 1.00 24.79  ?  41   CYS B N     1 
ATOM   4701  C  CA    . CYS B 2 44   ? 166.303 152.975 154.899 1.00 20.82  ?  41   CYS B CA    1 
ATOM   4702  C  C     . CYS B 2 44   ? 167.459 153.188 153.933 1.00 19.46  ?  41   CYS B C     1 
ATOM   4703  O  O     . CYS B 2 44   ? 167.818 152.294 153.155 1.00 18.05  ?  41   CYS B O     1 
ATOM   4704  C  CB    . CYS B 2 44   ? 166.058 151.487 155.156 1.00 19.09  ?  41   CYS B CB    1 
ATOM   4705  S  SG    . CYS B 2 44   ? 167.507 150.595 155.729 1.00 16.30  ?  41   CYS B SG    1 
ATOM   4706  N  N     . PRO B 2 45   ? 168.092 154.365 153.979 1.00 27.48  ?  42   PRO B N     1 
ATOM   4707  C  CA    . PRO B 2 45   ? 169.111 154.702 152.967 1.00 30.21  ?  42   PRO B CA    1 
ATOM   4708  C  C     . PRO B 2 45   ? 170.288 153.748 152.948 1.00 23.78  ?  42   PRO B C     1 
ATOM   4709  O  O     . PRO B 2 45   ? 171.043 153.730 151.968 1.00 23.56  ?  42   PRO B O     1 
ATOM   4710  C  CB    . PRO B 2 45   ? 169.543 156.117 153.374 1.00 37.44  ?  42   PRO B CB    1 
ATOM   4711  C  CG    . PRO B 2 45   ? 169.304 156.153 154.852 1.00 37.64  ?  42   PRO B CG    1 
ATOM   4712  C  CD    . PRO B 2 45   ? 168.038 155.364 155.060 1.00 34.75  ?  42   PRO B CD    1 
ATOM   4713  N  N     . THR B 2 46   ? 170.465 152.962 154.005 1.00 17.30  ?  43   THR B N     1 
ATOM   4714  C  CA    . THR B 2 46   ? 171.482 151.922 154.030 1.00 14.35  ?  43   THR B CA    1 
ATOM   4715  C  C     . THR B 2 46   ? 170.992 150.619 153.415 1.00 13.15  ?  43   THR B C     1 
ATOM   4716  O  O     . THR B 2 46   ? 171.671 150.031 152.564 1.00 13.26  ?  43   THR B O     1 
ATOM   4717  C  CB    . THR B 2 46   ? 171.931 151.685 155.462 1.00 22.63  ?  43   THR B CB    1 
ATOM   4718  O  OG1   . THR B 2 46   ? 172.899 152.677 155.830 1.00 26.51  ?  43   THR B OG1   1 
ATOM   4719  C  CG2   . THR B 2 46   ? 172.428 150.266 155.620 1.00 20.86  ?  43   THR B CG2   1 
ATOM   4720  N  N     . GLY B 2 47   ? 169.832 150.138 153.851 1.00 13.48  ?  44   GLY B N     1 
ATOM   4721  C  CA    . GLY B 2 47   ? 169.364 148.834 153.424 1.00 15.49  ?  44   GLY B CA    1 
ATOM   4722  C  C     . GLY B 2 47   ? 169.384 147.779 154.514 1.00 13.70  ?  44   GLY B C     1 
ATOM   4723  O  O     . GLY B 2 47   ? 168.452 146.975 154.611 1.00 13.66  ?  44   GLY B O     1 
ATOM   4724  N  N     . ILE B 2 48   ? 170.443 147.755 155.329 1.00 13.51  ?  45   ILE B N     1 
ATOM   4725  C  CA    . ILE B 2 48   ? 170.491 146.832 156.457 1.00 14.24  ?  45   ILE B CA    1 
ATOM   4726  C  C     . ILE B 2 48   ? 169.315 147.110 157.381 1.00 18.37  ?  45   ILE B C     1 
ATOM   4727  O  O     . ILE B 2 48   ? 168.977 148.269 157.657 1.00 23.10  ?  45   ILE B O     1 
ATOM   4728  C  CB    . ILE B 2 48   ? 171.826 146.964 157.211 1.00 15.96  ?  45   ILE B CB    1 
ATOM   4729  C  CG1   . ILE B 2 48   ? 173.009 146.734 156.271 1.00 15.59  ?  45   ILE B CG1   1 
ATOM   4730  C  CG2   . ILE B 2 48   ? 171.889 145.994 158.379 1.00 20.58  ?  45   ILE B CG2   1 
ATOM   4731  C  CD1   . ILE B 2 48   ? 174.350 146.907 156.946 1.00 16.78  ?  45   ILE B CD1   1 
ATOM   4732  N  N     . PHE B 2 49   ? 168.670 146.047 157.851 1.00 20.84  ?  46   PHE B N     1 
ATOM   4733  C  CA    . PHE B 2 49   ? 167.578 146.173 158.804 1.00 25.28  ?  46   PHE B CA    1 
ATOM   4734  C  C     . PHE B 2 49   ? 167.992 145.582 160.144 1.00 31.29  ?  46   PHE B C     1 
ATOM   4735  O  O     . PHE B 2 49   ? 168.880 144.734 160.219 1.00 33.32  ?  46   PHE B O     1 
ATOM   4736  C  CB    . PHE B 2 49   ? 166.313 145.464 158.300 1.00 24.40  ?  46   PHE B CB    1 
ATOM   4737  C  CG    . PHE B 2 49   ? 165.498 146.277 157.335 1.00 25.01  ?  46   PHE B CG    1 
ATOM   4738  C  CD1   . PHE B 2 49   ? 166.102 147.192 156.492 1.00 23.70  ?  46   PHE B CD1   1 
ATOM   4739  C  CD2   . PHE B 2 49   ? 164.123 146.129 157.275 1.00 28.22  ?  46   PHE B CD2   1 
ATOM   4740  C  CE1   . PHE B 2 49   ? 165.354 147.940 155.603 1.00 23.70  ?  46   PHE B CE1   1 
ATOM   4741  C  CE2   . PHE B 2 49   ? 163.370 146.878 156.390 1.00 30.63  ?  46   PHE B CE2   1 
ATOM   4742  C  CZ    . PHE B 2 49   ? 163.988 147.784 155.553 1.00 25.37  ?  46   PHE B CZ    1 
ATOM   4743  N  N     . GLY B 2 50   ? 167.336 146.031 161.208 1.00 30.76  ?  47   GLY B N     1 
ATOM   4744  C  CA    . GLY B 2 50   ? 167.388 145.347 162.489 1.00 34.93  ?  47   GLY B CA    1 
ATOM   4745  C  C     . GLY B 2 50   ? 166.084 144.594 162.685 1.00 41.34  ?  47   GLY B C     1 
ATOM   4746  O  O     . GLY B 2 50   ? 165.014 145.098 162.352 1.00 42.59  ?  47   GLY B O     1 
ATOM   4747  N  N     . VAL B 2 51   ? 166.180 143.374 163.207 1.00 39.39  ?  48   VAL B N     1 
ATOM   4748  C  CA    . VAL B 2 51   ? 165.008 142.527 163.398 1.00 43.70  ?  48   VAL B CA    1 
ATOM   4749  C  C     . VAL B 2 51   ? 164.827 142.237 164.881 1.00 49.93  ?  48   VAL B C     1 
ATOM   4750  O  O     . VAL B 2 51   ? 165.790 141.904 165.580 1.00 56.13  ?  48   VAL B O     1 
ATOM   4751  C  CB    . VAL B 2 51   ? 165.097 141.232 162.565 1.00 42.81  ?  48   VAL B CB    1 
ATOM   4752  C  CG1   . VAL B 2 51   ? 166.427 140.574 162.727 1.00 37.51  ?  48   VAL B CG1   1 
ATOM   4753  C  CG2   . VAL B 2 51   ? 164.011 140.269 162.982 1.00 50.04  ?  48   VAL B CG2   1 
ATOM   4754  N  N     . ARG B 2 52   ? 163.592 142.400 165.356 1.00 57.64  ?  49   ARG B N     1 
ATOM   4755  C  CA    . ARG B 2 52   ? 163.201 142.064 166.716 1.00 58.91  ?  49   ARG B CA    1 
ATOM   4756  C  C     . ARG B 2 52   ? 162.081 141.036 166.671 1.00 66.27  ?  49   ARG B C     1 
ATOM   4757  O  O     . ARG B 2 52   ? 161.213 141.081 165.789 1.00 69.69  ?  49   ARG B O     1 
ATOM   4758  C  CB    . ARG B 2 52   ? 162.729 143.298 167.492 1.00 57.26  ?  49   ARG B CB    1 
ATOM   4759  C  CG    . ARG B 2 52   ? 163.809 144.318 167.794 1.00 62.73  ?  49   ARG B CG    1 
ATOM   4760  C  CD    . ARG B 2 52   ? 163.274 145.371 168.748 1.00 65.88  ?  49   ARG B CD    1 
ATOM   4761  N  NE    . ARG B 2 52   ? 162.008 145.926 168.276 1.00 68.00  ?  49   ARG B NE    1 
ATOM   4762  C  CZ    . ARG B 2 52   ? 161.867 147.144 167.763 1.00 61.73  ?  49   ARG B CZ    1 
ATOM   4763  N  NH1   . ARG B 2 52   ? 160.676 147.561 167.357 1.00 59.78  ?  49   ARG B NH1   1 
ATOM   4764  N  NH2   . ARG B 2 52   ? 162.913 147.950 167.669 1.00 56.65  ?  49   ARG B NH2   1 
ATOM   4765  N  N     . ILE B 2 53   ? 162.111 140.110 167.623 1.00 74.74  ?  50   ILE B N     1 
ATOM   4766  C  CA    . ILE B 2 53   ? 161.084 139.090 167.775 1.00 84.24  ?  50   ILE B CA    1 
ATOM   4767  C  C     . ILE B 2 53   ? 160.452 139.278 169.145 1.00 94.24  ?  50   ILE B C     1 
ATOM   4768  O  O     . ILE B 2 53   ? 161.139 139.189 170.171 1.00 92.94  ?  50   ILE B O     1 
ATOM   4769  C  CB    . ILE B 2 53   ? 161.656 137.674 167.612 1.00 79.99  ?  50   ILE B CB    1 
ATOM   4770  C  CG1   . ILE B 2 53   ? 161.979 137.415 166.141 1.00 72.04  ?  50   ILE B CG1   1 
ATOM   4771  C  CG2   . ILE B 2 53   ? 160.679 136.640 168.144 1.00 86.26  ?  50   ILE B CG2   1 
ATOM   4772  C  CD1   . ILE B 2 53   ? 162.160 135.962 165.797 1.00 72.78  ?  50   ILE B CD1   1 
ATOM   4773  N  N     . LYS B 2 54   ? 159.150 139.551 169.158 1.00 100.03 ?  51   LYS B N     1 
ATOM   4774  C  CA    . LYS B 2 54   ? 158.428 139.891 170.382 1.00 101.19 ?  51   LYS B CA    1 
ATOM   4775  C  C     . LYS B 2 54   ? 157.094 139.162 170.369 1.00 106.16 ?  51   LYS B C     1 
ATOM   4776  O  O     . LYS B 2 54   ? 156.204 139.523 169.594 1.00 108.10 ?  51   LYS B O     1 
ATOM   4777  C  CB    . LYS B 2 54   ? 158.223 141.401 170.492 1.00 94.37  ?  51   LYS B CB    1 
ATOM   4778  C  CG    . LYS B 2 54   ? 157.341 141.832 171.647 1.00 84.34  ?  51   LYS B CG    1 
ATOM   4779  C  CD    . LYS B 2 54   ? 157.286 143.344 171.729 1.00 80.50  ?  51   LYS B CD    1 
ATOM   4780  C  CE    . LYS B 2 54   ? 158.685 143.924 171.851 1.00 83.73  ?  51   LYS B CE    1 
ATOM   4781  N  NZ    . LYS B 2 54   ? 158.673 145.409 171.934 1.00 82.36  ?  51   LYS B NZ    1 
ATOM   4782  N  N     . LYS B 2 55   ? 156.958 138.163 171.241 1.00 111.35 ?  52   LYS B N     1 
ATOM   4783  C  CA    . LYS B 2 55   ? 155.788 137.282 171.328 1.00 116.11 ?  52   LYS B CA    1 
ATOM   4784  C  C     . LYS B 2 55   ? 155.292 136.873 169.939 1.00 116.72 ?  52   LYS B C     1 
ATOM   4785  O  O     . LYS B 2 55   ? 154.165 137.153 169.529 1.00 121.16 ?  52   LYS B O     1 
ATOM   4786  C  CB    . LYS B 2 55   ? 154.667 137.905 172.174 1.00 126.65 ?  52   LYS B CB    1 
ATOM   4787  C  CG    . LYS B 2 55   ? 154.114 139.257 171.728 1.00 127.02 ?  52   LYS B CG    1 
ATOM   4788  C  CD    . LYS B 2 55   ? 152.720 139.499 172.286 1.00 137.15 ?  52   LYS B CD    1 
ATOM   4789  C  CE    . LYS B 2 55   ? 152.696 139.371 173.801 1.00 137.76 ?  52   LYS B CE    1 
ATOM   4790  N  NZ    . LYS B 2 55   ? 151.322 139.547 174.348 1.00 123.09 ?  52   LYS B NZ    1 
ATOM   4791  N  N     . GLY B 2 56   ? 156.175 136.192 169.213 1.00 115.15 ?  53   GLY B N     1 
ATOM   4792  C  CA    . GLY B 2 56   ? 155.857 135.705 167.889 1.00 119.11 ?  53   GLY B CA    1 
ATOM   4793  C  C     . GLY B 2 56   ? 155.754 136.760 166.812 1.00 118.21 ?  53   GLY B C     1 
ATOM   4794  O  O     . GLY B 2 56   ? 155.543 136.410 165.648 1.00 107.66 ?  53   GLY B O     1 
ATOM   4795  N  N     . GLU B 2 57   ? 155.887 138.036 167.151 1.00 122.25 ?  54   GLU B N     1 
ATOM   4796  C  CA    . GLU B 2 57   ? 155.825 139.098 166.160 1.00 119.79 ?  54   GLU B CA    1 
ATOM   4797  C  C     . GLU B 2 57   ? 157.222 139.408 165.644 1.00 107.67 ?  54   GLU B C     1 
ATOM   4798  O  O     . GLU B 2 57   ? 158.191 139.424 166.409 1.00 103.66 ?  54   GLU B O     1 
ATOM   4799  C  CB    . GLU B 2 57   ? 155.186 140.355 166.749 1.00 126.05 ?  54   GLU B CB    1 
ATOM   4800  C  CG    . GLU B 2 57   ? 153.774 140.130 167.256 1.00 135.59 ?  54   GLU B CG    1 
ATOM   4801  C  CD    . GLU B 2 57   ? 152.892 139.449 166.226 1.00 149.71 ?  54   GLU B CD    1 
ATOM   4802  O  OE1   . GLU B 2 57   ? 152.904 139.874 165.051 1.00 135.51 ?  54   GLU B OE1   1 
ATOM   4803  O  OE2   . GLU B 2 57   ? 152.192 138.480 166.590 1.00 206.74 -1 54   GLU B OE2   1 
ATOM   4804  N  N     . LEU B 2 58   ? 157.313 139.654 164.341 1.00 101.48 ?  55   LEU B N     1 
ATOM   4805  C  CA    . LEU B 2 58   ? 158.578 139.887 163.653 1.00 95.04  ?  55   LEU B CA    1 
ATOM   4806  C  C     . LEU B 2 58   ? 158.593 141.336 163.175 1.00 90.20  ?  55   LEU B C     1 
ATOM   4807  O  O     . LEU B 2 58   ? 158.058 141.652 162.108 1.00 87.41  ?  55   LEU B O     1 
ATOM   4808  C  CB    . LEU B 2 58   ? 158.745 138.910 162.492 1.00 95.30  ?  55   LEU B CB    1 
ATOM   4809  C  CG    . LEU B 2 58   ? 160.126 138.852 161.841 1.00 90.30  ?  55   LEU B CG    1 
ATOM   4810  C  CD1   . LEU B 2 58   ? 161.119 138.207 162.786 1.00 78.88  ?  55   LEU B CD1   1 
ATOM   4811  C  CD2   . LEU B 2 58   ? 160.073 138.098 160.521 1.00 78.90  ?  55   LEU B CD2   1 
ATOM   4812  N  N     . LYS B 2 59   ? 159.200 142.214 163.967 1.00 86.39  ?  56   LYS B N     1 
ATOM   4813  C  CA    . LYS B 2 59   ? 159.267 143.628 163.634 1.00 79.66  ?  56   LYS B CA    1 
ATOM   4814  C  C     . LYS B 2 59   ? 160.633 143.966 163.049 1.00 69.22  ?  56   LYS B C     1 
ATOM   4815  O  O     . LYS B 2 59   ? 161.649 143.359 163.400 1.00 65.31  ?  56   LYS B O     1 
ATOM   4816  C  CB    . LYS B 2 59   ? 158.996 144.493 164.867 1.00 85.43  ?  56   LYS B CB    1 
ATOM   4817  C  CG    . LYS B 2 59   ? 158.505 145.898 164.549 1.00 84.00  ?  56   LYS B CG    1 
ATOM   4818  C  CD    . LYS B 2 59   ? 157.872 146.544 165.770 1.00 89.47  ?  56   LYS B CD    1 
ATOM   4819  C  CE    . LYS B 2 59   ? 157.215 147.868 165.419 1.00 95.97  ?  56   LYS B CE    1 
ATOM   4820  N  NZ    . LYS B 2 59   ? 156.503 148.451 166.590 1.00 97.37  ?  56   LYS B NZ    1 
ATOM   4821  N  N     . LEU B 2 60   ? 160.645 144.946 162.148 1.00 59.19  ?  57   LEU B N     1 
ATOM   4822  C  CA    . LEU B 2 60   ? 161.865 145.390 161.487 1.00 45.85  ?  57   LEU B CA    1 
ATOM   4823  C  C     . LEU B 2 60   ? 162.014 146.892 161.663 1.00 39.72  ?  57   LEU B C     1 
ATOM   4824  O  O     . LEU B 2 60   ? 161.059 147.646 161.446 1.00 44.51  ?  57   LEU B O     1 
ATOM   4825  C  CB    . LEU B 2 60   ? 161.854 145.027 160.000 1.00 42.77  ?  57   LEU B CB    1 
ATOM   4826  C  CG    . LEU B 2 60   ? 161.815 143.524 159.730 1.00 42.45  ?  57   LEU B CG    1 
ATOM   4827  C  CD1   . LEU B 2 60   ? 161.735 143.228 158.246 1.00 43.57  ?  57   LEU B CD1   1 
ATOM   4828  C  CD2   . LEU B 2 60   ? 163.042 142.889 160.320 1.00 36.56  ?  57   LEU B CD2   1 
ATOM   4829  N  N     . ARG B 2 61   ? 163.208 147.320 162.056 1.00 37.48  ?  58   ARG B N     1 
ATOM   4830  C  CA    . ARG B 2 61   ? 163.518 148.725 162.246 1.00 34.97  ?  58   ARG B CA    1 
ATOM   4831  C  C     . ARG B 2 61   ? 164.689 149.117 161.356 1.00 28.82  ?  58   ARG B C     1 
ATOM   4832  O  O     . ARG B 2 61   ? 165.488 148.276 160.927 1.00 27.71  ?  58   ARG B O     1 
ATOM   4833  C  CB    . ARG B 2 61   ? 163.838 149.040 163.715 1.00 45.49  ?  58   ARG B CB    1 
ATOM   4834  C  CG    . ARG B 2 61   ? 165.091 148.362 164.246 1.00 52.18  ?  58   ARG B CG    1 
ATOM   4835  C  CD    . ARG B 2 61   ? 165.334 148.683 165.721 1.00 66.47  ?  58   ARG B CD    1 
ATOM   4836  N  NE    . ARG B 2 61   ? 165.768 150.062 165.943 1.00 66.94  ?  58   ARG B NE    1 
ATOM   4837  C  CZ    . ARG B 2 61   ? 165.044 150.986 166.567 1.00 63.44  ?  58   ARG B CZ    1 
ATOM   4838  N  NH1   . ARG B 2 61   ? 163.841 150.684 167.039 1.00 58.91  ?  58   ARG B NH1   1 
ATOM   4839  N  NH2   . ARG B 2 61   ? 165.524 152.213 166.724 1.00 60.42  ?  58   ARG B NH2   1 
ATOM   4840  N  N     . ALA B 2 62   ? 164.781 150.415 161.087 1.00 25.34  ?  59   ALA B N     1 
ATOM   4841  C  CA    . ALA B 2 62   ? 165.751 150.951 160.141 1.00 18.75  ?  59   ALA B CA    1 
ATOM   4842  C  C     . ALA B 2 62   ? 167.049 151.259 160.875 1.00 15.78  ?  59   ALA B C     1 
ATOM   4843  O  O     . ALA B 2 62   ? 167.094 152.152 161.729 1.00 18.59  ?  59   ALA B O     1 
ATOM   4844  C  CB    . ALA B 2 62   ? 165.201 152.198 159.457 1.00 20.95  ?  59   ALA B CB    1 
ATOM   4845  N  N     . ILE B 2 63   ? 168.103 150.514 160.544 1.00 12.91  ?  60   ILE B N     1 
ATOM   4846  C  CA    . ILE B 2 63   ? 169.425 150.848 161.044 1.00 15.93  ?  60   ILE B CA    1 
ATOM   4847  C  C     . ILE B 2 63   ? 169.925 152.093 160.320 1.00 15.18  ?  60   ILE B C     1 
ATOM   4848  O  O     . ILE B 2 63   ? 169.412 152.486 159.266 1.00 17.16  ?  60   ILE B O     1 
ATOM   4849  C  CB    . ILE B 2 63   ? 170.387 149.663 160.851 1.00 18.50  ?  60   ILE B CB    1 
ATOM   4850  C  CG1   . ILE B 2 63   ? 169.701 148.356 161.245 1.00 21.03  ?  60   ILE B CG1   1 
ATOM   4851  C  CG2   . ILE B 2 63   ? 171.651 149.833 161.682 1.00 18.34  ?  60   ILE B CG2   1 
ATOM   4852  C  CD1   . ILE B 2 63   ? 169.349 148.269 162.709 1.00 23.66  ?  60   ILE B CD1   1 
ATOM   4853  N  N     . SER B 2 64   ? 170.913 152.744 160.911 1.00 16.01  ?  61   SER B N     1 
ATOM   4854  C  CA    . SER B 2 64   ? 171.613 153.836 160.257 1.00 17.80  ?  61   SER B CA    1 
ATOM   4855  C  C     . SER B 2 64   ? 173.065 153.425 160.068 1.00 20.73  ?  61   SER B C     1 
ATOM   4856  O  O     . SER B 2 64   ? 173.461 152.307 160.393 1.00 24.33  ?  61   SER B O     1 
ATOM   4857  C  CB    . SER B 2 64   ? 171.507 155.130 161.066 1.00 16.88  ?  61   SER B CB    1 
ATOM   4858  O  OG    . SER B 2 64   ? 172.255 155.041 162.265 1.00 26.29  ?  61   SER B OG    1 
ATOM   4859  N  N     . PHE B 2 65   ? 173.865 154.344 159.541 1.00 30.84  ?  62   PHE B N     1 
ATOM   4860  C  CA    . PHE B 2 65   ? 175.266 154.055 159.301 1.00 36.01  ?  62   PHE B CA    1 
ATOM   4861  C  C     . PHE B 2 65   ? 176.171 155.053 160.026 1.00 38.15  ?  62   PHE B C     1 
ATOM   4862  O  O     . PHE B 2 65   ? 175.717 155.945 160.740 1.00 38.89  ?  62   PHE B O     1 
ATOM   4863  C  CB    . PHE B 2 65   ? 175.618 154.041 157.810 1.00 35.70  ?  62   PHE B CB    1 
ATOM   4864  C  CG    . PHE B 2 65   ? 175.549 152.681 157.202 1.00 36.27  ?  62   PHE B CG    1 
ATOM   4865  C  CD1   . PHE B 2 65   ? 174.900 151.658 157.850 1.00 37.24  ?  62   PHE B CD1   1 
ATOM   4866  C  CD2   . PHE B 2 65   ? 176.372 152.361 156.133 1.00 36.25  ?  62   PHE B CD2   1 
ATOM   4867  C  CE1   . PHE B 2 65   ? 174.909 150.385 157.347 1.00 38.48  ?  62   PHE B CE1   1 
ATOM   4868  C  CE2   . PHE B 2 65   ? 176.393 151.077 155.623 1.00 38.45  ?  62   PHE B CE2   1 
ATOM   4869  C  CZ    . PHE B 2 65   ? 175.652 150.091 156.223 1.00 38.17  ?  62   PHE B CZ    1 
ATOM   4870  N  N     . SER B 2 66   ? 177.472 154.868 159.812 1.00 42.88  ?  63   SER B N     1 
ATOM   4871  C  CA    . SER B 2 66   ? 178.481 155.804 160.276 1.00 47.62  ?  63   SER B CA    1 
ATOM   4872  C  C     . SER B 2 66   ? 178.538 156.976 159.303 1.00 46.76  ?  63   SER B C     1 
ATOM   4873  O  O     . SER B 2 66   ? 177.661 157.158 158.455 1.00 47.74  ?  63   SER B O     1 
ATOM   4874  C  CB    . SER B 2 66   ? 179.837 155.114 160.400 1.00 53.97  ?  63   SER B CB    1 
ATOM   4875  O  OG    . SER B 2 66   ? 180.648 155.382 159.265 1.00 51.61  ?  63   SER B OG    1 
ATOM   4876  N  N     . ASN B 2 67   ? 179.578 157.793 159.422 1.00 47.35  ?  64   ASN B N     1 
ATOM   4877  C  CA    . ASN B 2 67   ? 179.855 158.805 158.416 1.00 51.32  ?  64   ASN B CA    1 
ATOM   4878  C  C     . ASN B 2 67   ? 181.019 158.426 157.514 1.00 54.93  ?  64   ASN B C     1 
ATOM   4879  O  O     . ASN B 2 67   ? 180.987 158.734 156.320 1.00 60.21  ?  64   ASN B O     1 
ATOM   4880  C  CB    . ASN B 2 67   ? 180.136 160.153 159.088 1.00 54.59  ?  64   ASN B CB    1 
ATOM   4881  C  CG    . ASN B 2 67   ? 179.012 160.584 160.014 1.00 54.60  ?  64   ASN B CG    1 
ATOM   4882  O  OD1   . ASN B 2 67   ? 178.167 159.777 160.405 1.00 47.98  ?  64   ASN B OD1   1 
ATOM   4883  N  ND2   . ASN B 2 67   ? 178.995 161.863 160.368 1.00 60.00  ?  64   ASN B ND2   1 
ATOM   4884  N  N     . ASN B 2 68   ? 182.020 157.726 158.049 1.00 54.74  ?  65   ASN B N     1 
ATOM   4885  C  CA    . ASN B 2 68   ? 183.227 157.373 157.311 1.00 58.95  ?  65   ASN B CA    1 
ATOM   4886  C  C     . ASN B 2 68   ? 183.062 156.139 156.436 1.00 55.48  ?  65   ASN B C     1 
ATOM   4887  O  O     . ASN B 2 68   ? 183.966 155.833 155.649 1.00 55.39  ?  65   ASN B O     1 
ATOM   4888  C  CB    . ASN B 2 68   ? 184.371 157.128 158.293 1.00 69.57  ?  65   ASN B CB    1 
ATOM   4889  C  CG    . ASN B 2 68   ? 183.996 156.134 159.378 1.00 74.26  ?  65   ASN B CG    1 
ATOM   4890  O  OD1   . ASN B 2 68   ? 182.939 155.502 159.319 1.00 63.48  ?  65   ASN B OD1   1 
ATOM   4891  N  ND2   . ASN B 2 68   ? 184.856 155.996 160.378 1.00 86.17  ?  65   ASN B ND2   1 
ATOM   4892  N  N     . SER B 2 69   ? 181.949 155.427 156.560 1.00 51.45  ?  66   SER B N     1 
ATOM   4893  C  CA    . SER B 2 69   ? 181.789 154.118 155.950 1.00 50.84  ?  66   SER B CA    1 
ATOM   4894  C  C     . SER B 2 69   ? 181.161 154.224 154.564 1.00 49.92  ?  66   SER B C     1 
ATOM   4895  O  O     . SER B 2 69   ? 180.552 155.233 154.200 1.00 50.68  ?  66   SER B O     1 
ATOM   4896  C  CB    . SER B 2 69   ? 180.928 153.221 156.839 1.00 51.39  ?  66   SER B CB    1 
ATOM   4897  O  OG    . SER B 2 69   ? 179.827 153.936 157.377 1.00 50.51  ?  66   SER B OG    1 
ATOM   4898  N  N     . SER B 2 70   ? 181.323 153.154 153.789 1.00 48.14  ?  67   SER B N     1 
ATOM   4899  C  CA    . SER B 2 70   ? 180.672 153.042 152.496 1.00 42.42  ?  67   SER B CA    1 
ATOM   4900  C  C     . SER B 2 70   ? 179.230 152.571 152.671 1.00 35.70  ?  67   SER B C     1 
ATOM   4901  O  O     . SER B 2 70   ? 178.787 152.223 153.769 1.00 37.08  ?  67   SER B O     1 
ATOM   4902  C  CB    . SER B 2 70   ? 181.437 152.080 151.588 1.00 44.83  ?  67   SER B CB    1 
ATOM   4903  O  OG    . SER B 2 70   ? 181.380 150.753 152.085 1.00 43.14  ?  67   SER B OG    1 
ATOM   4904  N  N     . TYR B 2 71   ? 178.492 152.561 151.564 1.00 31.44  ?  68   TYR B N     1 
ATOM   4905  C  CA    . TYR B 2 71   ? 177.098 152.141 151.550 1.00 30.29  ?  68   TYR B CA    1 
ATOM   4906  C  C     . TYR B 2 71   ? 176.942 150.928 150.647 1.00 24.97  ?  68   TYR B C     1 
ATOM   4907  O  O     . TYR B 2 71   ? 177.566 150.851 149.583 1.00 24.10  ?  68   TYR B O     1 
ATOM   4908  C  CB    . TYR B 2 71   ? 176.182 153.281 151.094 1.00 31.23  ?  68   TYR B CB    1 
ATOM   4909  C  CG    . TYR B 2 71   ? 176.074 154.389 152.120 1.00 34.29  ?  68   TYR B CG    1 
ATOM   4910  C  CD1   . TYR B 2 71   ? 177.154 155.221 152.388 1.00 39.48  ?  68   TYR B CD1   1 
ATOM   4911  C  CD2   . TYR B 2 71   ? 174.904 154.583 152.843 1.00 32.03  ?  68   TYR B CD2   1 
ATOM   4912  C  CE1   . TYR B 2 71   ? 177.067 156.224 153.332 1.00 41.57  ?  68   TYR B CE1   1 
ATOM   4913  C  CE2   . TYR B 2 71   ? 174.809 155.588 153.793 1.00 35.11  ?  68   TYR B CE2   1 
ATOM   4914  C  CZ    . TYR B 2 71   ? 175.895 156.406 154.031 1.00 42.15  ?  68   TYR B CZ    1 
ATOM   4915  O  OH    . TYR B 2 71   ? 175.819 157.408 154.971 1.00 43.63  ?  68   TYR B OH    1 
ATOM   4916  N  N     . LEU B 2 72   ? 176.085 149.986 151.073 1.00 17.53  ?  69   LEU B N     1 
ATOM   4917  C  CA    . LEU B 2 72   ? 176.274 148.682 150.490 1.00 12.82  ?  69   LEU B CA    1 
ATOM   4918  C  C     . LEU B 2 72   ? 175.102 148.362 149.574 1.00 9.82   ?  69   LEU B C     1 
ATOM   4919  O  O     . LEU B 2 72   ? 173.966 148.671 149.914 1.00 10.70  ?  69   LEU B O     1 
ATOM   4920  C  CB    . LEU B 2 72   ? 176.375 147.639 151.614 1.00 14.49  ?  69   LEU B CB    1 
ATOM   4921  C  CG    . LEU B 2 72   ? 177.782 147.095 151.742 1.00 23.53  ?  69   LEU B CG    1 
ATOM   4922  C  CD1   . LEU B 2 72   ? 178.626 148.373 151.848 1.00 27.21  ?  69   LEU B CD1   1 
ATOM   4923  C  CD2   . LEU B 2 72   ? 177.950 146.277 152.999 1.00 31.34  ?  69   LEU B CD2   1 
ATOM   4924  N  N     . PRO B 2 73   ? 175.353 147.805 148.396 1.00 6.73   ?  70   PRO B N     1 
ATOM   4925  C  CA    . PRO B 2 73   ? 174.257 147.312 147.560 1.00 3.44   ?  70   PRO B CA    1 
ATOM   4926  C  C     . PRO B 2 73   ? 173.714 146.007 148.112 1.00 4.28   ?  70   PRO B C     1 
ATOM   4927  O  O     . PRO B 2 73   ? 174.485 145.119 148.500 1.00 7.54   ?  70   PRO B O     1 
ATOM   4928  C  CB    . PRO B 2 73   ? 174.919 147.113 146.192 1.00 3.66   ?  70   PRO B CB    1 
ATOM   4929  C  CG    . PRO B 2 73   ? 176.341 146.814 146.530 1.00 8.59   ?  70   PRO B CG    1 
ATOM   4930  C  CD    . PRO B 2 73   ? 176.669 147.609 147.760 1.00 10.90  ?  70   PRO B CD    1 
ATOM   4931  N  N     . PRO B 2 74   ? 172.398 145.848 148.154 1.00 1.80   ?  71   PRO B N     1 
ATOM   4932  C  CA    . PRO B 2 74   ? 171.821 144.672 148.817 1.00 7.60   ?  71   PRO B CA    1 
ATOM   4933  C  C     . PRO B 2 74   ? 172.080 143.385 148.054 1.00 15.58  ?  71   PRO B C     1 
ATOM   4934  O  O     . PRO B 2 74   ? 171.227 142.930 147.286 1.00 13.28  ?  71   PRO B O     1 
ATOM   4935  C  CB    . PRO B 2 74   ? 170.321 144.994 148.863 1.00 5.77   ?  71   PRO B CB    1 
ATOM   4936  C  CG    . PRO B 2 74   ? 170.246 146.473 148.731 1.00 6.09   ?  71   PRO B CG    1 
ATOM   4937  C  CD    . PRO B 2 74   ? 171.373 146.849 147.822 1.00 1.88   ?  71   PRO B CD    1 
ATOM   4938  N  N     . LEU B 2 75   ? 173.266 142.811 148.244 1.00 7.24   ?  72   LEU B N     1 
ATOM   4939  C  CA    . LEU B 2 75   ? 173.584 141.520 147.650 1.00 5.58   ?  72   LEU B CA    1 
ATOM   4940  C  C     . LEU B 2 75   ? 172.554 140.476 148.066 1.00 5.82   ?  72   LEU B C     1 
ATOM   4941  O  O     . LEU B 2 75   ? 171.927 140.576 149.124 1.00 7.95   ?  72   LEU B O     1 
ATOM   4942  C  CB    . LEU B 2 75   ? 174.983 141.082 148.071 1.00 6.18   ?  72   LEU B CB    1 
ATOM   4943  C  CG    . LEU B 2 75   ? 175.987 142.234 148.065 1.00 5.95   ?  72   LEU B CG    1 
ATOM   4944  C  CD1   . LEU B 2 75   ? 177.325 141.782 148.609 1.00 9.11   ?  72   LEU B CD1   1 
ATOM   4945  C  CD2   . LEU B 2 75   ? 176.139 142.783 146.658 1.00 8.32   ?  72   LEU B CD2   1 
ATOM   4946  N  N     . ARG B 2 76   ? 172.370 139.464 147.218 1.00 8.13   ?  73   ARG B N     1 
ATOM   4947  C  CA    . ARG B 2 76   ? 171.255 138.540 147.402 1.00 7.64   ?  73   ARG B CA    1 
ATOM   4948  C  C     . ARG B 2 76   ? 171.669 137.225 148.052 1.00 5.96   ?  73   ARG B C     1 
ATOM   4949  O  O     . ARG B 2 76   ? 171.154 136.871 149.116 1.00 7.40   ?  73   ARG B O     1 
ATOM   4950  C  CB    . ARG B 2 76   ? 170.571 138.266 146.063 1.00 11.18  ?  73   ARG B CB    1 
ATOM   4951  C  CG    . ARG B 2 76   ? 169.163 137.734 146.217 1.00 9.00   ?  73   ARG B CG    1 
ATOM   4952  C  CD    . ARG B 2 76   ? 168.193 138.694 145.586 1.00 9.57   ?  73   ARG B CD    1 
ATOM   4953  N  NE    . ARG B 2 76   ? 168.722 139.158 144.312 1.00 15.71  ?  73   ARG B NE    1 
ATOM   4954  C  CZ    . ARG B 2 76   ? 168.700 138.437 143.199 1.00 15.12  ?  73   ARG B CZ    1 
ATOM   4955  N  NH1   . ARG B 2 76   ? 168.172 137.220 143.208 1.00 17.10  ?  73   ARG B NH1   1 
ATOM   4956  N  NH2   . ARG B 2 76   ? 169.211 138.928 142.080 1.00 14.64  ?  73   ARG B NH2   1 
ATOM   4957  N  N     . CYS B 2 77   ? 172.582 136.484 147.430 1.00 5.02   ?  74   CYS B N     1 
ATOM   4958  C  CA    . CYS B 2 77   ? 172.958 135.196 148.001 1.00 5.53   ?  74   CYS B CA    1 
ATOM   4959  C  C     . CYS B 2 77   ? 174.457 135.132 148.254 1.00 3.85   ?  74   CYS B C     1 
ATOM   4960  O  O     . CYS B 2 77   ? 175.122 134.181 147.823 1.00 4.90   ?  74   CYS B O     1 
ATOM   4961  C  CB    . CYS B 2 77   ? 172.531 134.052 147.080 1.00 10.39  ?  74   CYS B CB    1 
ATOM   4962  S  SG    . CYS B 2 77   ? 172.082 132.529 147.944 1.00 12.08  ?  74   CYS B SG    1 
ATOM   4963  N  N     . PRO B 2 78   ? 175.018 136.096 148.973 1.00 5.09   ?  75   PRO B N     1 
ATOM   4964  C  CA    . PRO B 2 78   ? 176.476 136.167 149.093 1.00 6.79   ?  75   PRO B CA    1 
ATOM   4965  C  C     . PRO B 2 78   ? 177.031 135.128 150.048 1.00 8.37   ?  75   PRO B C     1 
ATOM   4966  O  O     . PRO B 2 78   ? 176.296 134.267 150.543 1.00 8.76   ?  75   PRO B O     1 
ATOM   4967  C  CB    . PRO B 2 78   ? 176.694 137.585 149.623 1.00 8.74   ?  75   PRO B CB    1 
ATOM   4968  C  CG    . PRO B 2 78   ? 175.523 137.778 150.529 1.00 6.73   ?  75   PRO B CG    1 
ATOM   4969  C  CD    . PRO B 2 78   ? 174.362 137.041 149.896 1.00 5.22   ?  75   PRO B CD    1 
ATOM   4970  N  N     . ALA B 2 79   ? 178.334 135.204 150.308 1.00 12.56  ?  76   ALA B N     1 
ATOM   4971  C  CA    . ALA B 2 79   ? 179.000 134.365 151.295 1.00 17.44  ?  76   ALA B CA    1 
ATOM   4972  C  C     . ALA B 2 79   ? 179.329 135.216 152.513 1.00 18.55  ?  76   ALA B C     1 
ATOM   4973  O  O     . ALA B 2 79   ? 180.062 136.206 152.406 1.00 17.18  ?  76   ALA B O     1 
ATOM   4974  C  CB    . ALA B 2 79   ? 180.270 133.737 150.724 1.00 16.49  ?  76   ALA B CB    1 
ATOM   4975  N  N     . ILE B 2 80   ? 178.791 134.832 153.657 1.00 19.20  ?  77   ILE B N     1 
ATOM   4976  C  CA    . ILE B 2 80   ? 178.998 135.547 154.909 1.00 15.16  ?  77   ILE B CA    1 
ATOM   4977  C  C     . ILE B 2 80   ? 180.113 134.849 155.671 1.00 15.97  ?  77   ILE B C     1 
ATOM   4978  O  O     . ILE B 2 80   ? 180.304 133.632 155.551 1.00 17.82  ?  77   ILE B O     1 
ATOM   4979  C  CB    . ILE B 2 80   ? 177.683 135.609 155.724 1.00 13.29  ?  77   ILE B CB    1 
ATOM   4980  C  CG1   . ILE B 2 80   ? 176.834 136.812 155.298 1.00 12.34  ?  77   ILE B CG1   1 
ATOM   4981  C  CG2   . ILE B 2 80   ? 177.940 135.634 157.226 1.00 20.87  ?  77   ILE B CG2   1 
ATOM   4982  C  CD1   . ILE B 2 80   ? 176.246 136.698 153.912 1.00 9.31   ?  77   ILE B CD1   1 
ATOM   4983  N  N     . ALA B 2 81   ? 180.886 135.620 156.433 1.00 20.01  ?  78   ALA B N     1 
ATOM   4984  C  CA    . ALA B 2 81   ? 181.925 135.025 157.264 1.00 27.53  ?  78   ALA B CA    1 
ATOM   4985  C  C     . ALA B 2 81   ? 182.046 135.819 158.553 1.00 34.47  ?  78   ALA B C     1 
ATOM   4986  O  O     . ALA B 2 81   ? 182.382 137.005 158.520 1.00 37.04  ?  78   ALA B O     1 
ATOM   4987  C  CB    . ALA B 2 81   ? 183.260 134.987 156.523 1.00 33.80  ?  78   ALA B CB    1 
ATOM   4988  N  N     . HIS B 2 82   ? 181.777 135.166 159.682 1.00 36.58  ?  79   HIS B N     1 
ATOM   4989  C  CA    . HIS B 2 82   ? 181.884 135.825 160.976 1.00 41.65  ?  79   HIS B CA    1 
ATOM   4990  C  C     . HIS B 2 82   ? 183.354 136.009 161.327 1.00 45.53  ?  79   HIS B C     1 
ATOM   4991  O  O     . HIS B 2 82   ? 183.982 135.097 161.876 1.00 48.98  ?  79   HIS B O     1 
ATOM   4992  C  CB    . HIS B 2 82   ? 181.156 135.010 162.053 1.00 43.19  ?  79   HIS B CB    1 
ATOM   4993  C  CG    . HIS B 2 82   ? 181.101 135.670 163.400 1.00 51.60  ?  79   HIS B CG    1 
ATOM   4994  N  ND1   . HIS B 2 82   ? 182.065 136.549 163.849 1.00 57.33  ?  79   HIS B ND1   1 
ATOM   4995  C  CD2   . HIS B 2 82   ? 180.189 135.576 164.397 1.00 54.05  ?  79   HIS B CD2   1 
ATOM   4996  C  CE1   . HIS B 2 82   ? 181.751 136.964 165.063 1.00 64.96  ?  79   HIS B CE1   1 
ATOM   4997  N  NE2   . HIS B 2 82   ? 180.616 136.390 165.418 1.00 58.50  ?  79   HIS B NE2   1 
ATOM   4998  N  N     . PHE B 2 83   ? 183.915 137.176 161.010 1.00 53.97  ?  80   PHE B N     1 
ATOM   4999  C  CA    . PHE B 2 83   ? 185.275 137.484 161.432 1.00 63.43  ?  80   PHE B CA    1 
ATOM   5000  C  C     . PHE B 2 83   ? 185.244 137.649 162.942 1.00 72.69  ?  80   PHE B C     1 
ATOM   5001  O  O     . PHE B 2 83   ? 184.829 138.693 163.464 1.00 79.34  ?  80   PHE B O     1 
ATOM   5002  C  CB    . PHE B 2 83   ? 185.799 138.740 160.749 1.00 68.62  ?  80   PHE B CB    1 
ATOM   5003  C  CG    . PHE B 2 83   ? 187.124 139.202 161.286 1.00 75.37  ?  80   PHE B CG    1 
ATOM   5004  C  CD1   . PHE B 2 83   ? 188.209 138.344 161.321 1.00 76.44  ?  80   PHE B CD1   1 
ATOM   5005  C  CD2   . PHE B 2 83   ? 187.278 140.487 161.778 1.00 81.91  ?  80   PHE B CD2   1 
ATOM   5006  C  CE1   . PHE B 2 83   ? 189.426 138.766 161.822 1.00 90.01  ?  80   PHE B CE1   1 
ATOM   5007  C  CE2   . PHE B 2 83   ? 188.491 140.913 162.281 1.00 90.14  ?  80   PHE B CE2   1 
ATOM   5008  C  CZ    . PHE B 2 83   ? 189.566 140.052 162.303 1.00 97.80  ?  80   PHE B CZ    1 
ATOM   5009  N  N     . GLU B 2 84   ? 185.684 136.597 163.632 1.00 79.70  ?  81   GLU B N     1 
ATOM   5010  C  CA    . GLU B 2 84   ? 185.481 136.452 165.064 1.00 97.69  ?  81   GLU B CA    1 
ATOM   5011  C  C     . GLU B 2 84   ? 186.116 137.610 165.824 1.00 108.39 ?  81   GLU B C     1 
ATOM   5012  O  O     . GLU B 2 84   ? 187.093 138.220 165.379 1.00 105.86 ?  81   GLU B O     1 
ATOM   5013  C  CB    . GLU B 2 84   ? 186.057 135.109 165.528 1.00 111.77 ?  81   GLU B CB    1 
ATOM   5014  C  CG    . GLU B 2 84   ? 185.765 134.736 166.972 1.00 127.58 ?  81   GLU B CG    1 
ATOM   5015  C  CD    . GLU B 2 84   ? 186.743 135.366 167.939 1.00 147.37 ?  81   GLU B CD    1 
ATOM   5016  O  OE1   . GLU B 2 84   ? 187.887 135.652 167.527 1.00 133.99 ?  81   GLU B OE1   1 
ATOM   5017  O  OE2   . GLU B 2 84   ? 186.356 135.605 169.101 1.00 206.86 -1 81   GLU B OE2   1 
ATOM   5018  N  N     . ALA B 2 85   ? 185.538 137.912 166.986 1.00 112.80 ?  82   ALA B N     1 
ATOM   5019  C  CA    . ALA B 2 85   ? 185.988 139.024 167.810 1.00 117.26 ?  82   ALA B CA    1 
ATOM   5020  C  C     . ALA B 2 85   ? 187.434 138.851 168.253 1.00 123.89 ?  82   ALA B C     1 
ATOM   5021  O  O     . ALA B 2 85   ? 187.733 137.998 169.096 1.00 130.59 ?  82   ALA B O     1 
ATOM   5022  C  CB    . ALA B 2 85   ? 185.083 139.177 169.034 1.00 117.40 ?  82   ALA B CB    1 
ATOM   5023  N  N     . GLN B 2 86   ? 188.328 139.662 167.701 1.00 120.15 ?  83   GLN B N     1 
ATOM   5024  C  CA    . GLN B 2 86   ? 189.745 139.661 168.057 1.00 120.59 ?  83   GLN B CA    1 
ATOM   5025  C  C     . GLN B 2 86   ? 190.389 140.873 167.390 1.00 133.51 ?  83   GLN B C     1 
ATOM   5026  O  O     . GLN B 2 86   ? 189.701 141.709 166.790 1.00 133.29 ?  83   GLN B O     1 
ATOM   5027  C  CB    . GLN B 2 86   ? 190.432 138.359 167.644 1.00 111.54 ?  83   GLN B CB    1 
ATOM   5028  C  CG    . GLN B 2 86   ? 190.346 138.058 166.163 1.00 106.90 ?  83   GLN B CG    1 
ATOM   5029  C  CD    . GLN B 2 86   ? 191.241 136.908 165.761 1.00 102.43 ?  83   GLN B CD    1 
ATOM   5030  O  OE1   . GLN B 2 86   ? 192.354 136.767 166.269 1.00 102.95 ?  83   GLN B OE1   1 
ATOM   5031  N  NE2   . GLN B 2 86   ? 190.761 136.076 164.846 1.00 100.26 ?  83   GLN B NE2   1 
ATOM   5032  N  N     . ASP B 2 87   ? 191.712 140.967 167.502 1.00 150.72 ?  84   ASP B N     1 
ATOM   5033  C  CA    . ASP B 2 87   ? 192.457 142.039 166.855 1.00 164.69 ?  84   ASP B CA    1 
ATOM   5034  C  C     . ASP B 2 87   ? 192.237 141.994 165.345 1.00 158.96 ?  84   ASP B C     1 
ATOM   5035  O  O     . ASP B 2 87   ? 192.199 140.918 164.742 1.00 147.33 ?  84   ASP B O     1 
ATOM   5036  C  CB    . ASP B 2 87   ? 193.945 141.903 167.190 1.00 176.96 ?  84   ASP B CB    1 
ATOM   5037  C  CG    . ASP B 2 87   ? 194.649 143.243 167.298 1.00 189.07 ?  84   ASP B CG    1 
ATOM   5038  O  OD1   . ASP B 2 87   ? 194.352 144.000 168.246 1.00 179.96 ?  84   ASP B OD1   1 
ATOM   5039  O  OD2   . ASP B 2 87   ? 195.506 143.535 166.438 1.00 230.24 -1 84   ASP B OD2   1 
ATOM   5040  N  N     . GLY B 2 88   ? 192.094 143.167 164.727 1.00 161.08 ?  85   GLY B N     1 
ATOM   5041  C  CA    . GLY B 2 88   ? 192.210 144.448 165.402 1.00 163.37 ?  85   GLY B CA    1 
ATOM   5042  C  C     . GLY B 2 88   ? 190.942 145.024 166.002 1.00 154.63 ?  85   GLY B C     1 
ATOM   5043  O  O     . GLY B 2 88   ? 190.910 145.355 167.187 1.00 152.10 ?  85   GLY B O     1 
ATOM   5044  N  N     . LYS B 2 89   ? 189.893 145.151 165.186 1.00 142.75 ?  86   LYS B N     1 
ATOM   5045  C  CA    . LYS B 2 89   ? 188.641 145.773 165.609 1.00 135.79 ?  86   LYS B CA    1 
ATOM   5046  C  C     . LYS B 2 89   ? 187.523 144.740 165.630 1.00 125.60 ?  86   LYS B C     1 
ATOM   5047  O  O     . LYS B 2 89   ? 186.830 144.541 164.621 1.00 115.14 ?  86   LYS B O     1 
ATOM   5048  C  CB    . LYS B 2 89   ? 188.279 146.942 164.692 1.00 138.18 ?  86   LYS B CB    1 
ATOM   5049  C  CG    . LYS B 2 89   ? 187.096 147.757 165.181 1.00 135.81 ?  86   LYS B CG    1 
ATOM   5050  C  CD    . LYS B 2 89   ? 187.539 149.143 165.611 1.00 146.96 ?  86   LYS B CD    1 
ATOM   5051  C  CE    . LYS B 2 89   ? 188.207 149.883 164.464 1.00 151.55 ?  86   LYS B CE    1 
ATOM   5052  N  NZ    . LYS B 2 89   ? 188.581 151.275 164.837 1.00 146.04 ?  86   LYS B NZ    1 
ATOM   5053  N  N     . PRO B 2 90   ? 187.301 144.064 166.753 1.00 127.34 ?  87   PRO B N     1 
ATOM   5054  C  CA    . PRO B 2 90   ? 186.170 143.141 166.851 1.00 115.89 ?  87   PRO B CA    1 
ATOM   5055  C  C     . PRO B 2 90   ? 184.854 143.895 166.957 1.00 109.46 ?  87   PRO B C     1 
ATOM   5056  O  O     . PRO B 2 90   ? 184.803 145.050 167.385 1.00 113.64 ?  87   PRO B O     1 
ATOM   5057  C  CB    . PRO B 2 90   ? 186.467 142.373 168.140 1.00 121.98 ?  87   PRO B CB    1 
ATOM   5058  C  CG    . PRO B 2 90   ? 187.204 143.351 168.976 1.00 134.06 ?  87   PRO B CG    1 
ATOM   5059  C  CD    . PRO B 2 90   ? 188.046 144.158 168.020 1.00 138.23 ?  87   PRO B CD    1 
ATOM   5060  N  N     . GLU B 2 91   ? 183.777 143.235 166.540 1.00 101.68 ?  88   GLU B N     1 
ATOM   5061  C  CA    . GLU B 2 91   ? 183.817 141.946 165.852 1.00 97.69  ?  88   GLU B CA    1 
ATOM   5062  C  C     . GLU B 2 91   ? 183.200 142.167 164.486 1.00 90.67  ?  88   GLU B C     1 
ATOM   5063  O  O     . GLU B 2 91   ? 182.279 142.974 164.359 1.00 88.75  ?  88   GLU B O     1 
ATOM   5064  C  CB    . GLU B 2 91   ? 183.050 140.882 166.628 1.00 101.68 ?  88   GLU B CB    1 
ATOM   5065  C  CG    . GLU B 2 91   ? 181.682 141.348 167.090 1.00 112.00 ?  88   GLU B CG    1 
ATOM   5066  C  CD    . GLU B 2 91   ? 180.823 140.213 167.599 1.00 125.51 ?  88   GLU B CD    1 
ATOM   5067  O  OE1   . GLU B 2 91   ? 180.944 139.090 167.070 1.00 109.56 ?  88   GLU B OE1   1 
ATOM   5068  O  OE2   . GLU B 2 91   ? 180.024 140.445 168.529 1.00 178.19 -1 88   GLU B OE2   1 
ATOM   5069  N  N     . CYS B 2 92   ? 183.677 141.478 163.456 1.00 82.01  ?  89   CYS B N     1 
ATOM   5070  C  CA    . CYS B 2 92   ? 183.282 141.894 162.120 1.00 64.76  ?  89   CYS B CA    1 
ATOM   5071  C  C     . CYS B 2 92   ? 182.582 140.777 161.361 1.00 52.02  ?  89   CYS B C     1 
ATOM   5072  O  O     . CYS B 2 92   ? 182.563 139.612 161.765 1.00 56.02  ?  89   CYS B O     1 
ATOM   5073  C  CB    . CYS B 2 92   ? 184.489 142.397 161.317 1.00 69.20  ?  89   CYS B CB    1 
ATOM   5074  S  SG    . CYS B 2 92   ? 185.224 143.924 161.949 1.00 82.82  ?  89   CYS B SG    1 
ATOM   5075  N  N     . TYR B 2 93   ? 181.999 141.175 160.238 1.00 41.89  ?  90   TYR B N     1 
ATOM   5076  C  CA    . TYR B 2 93   ? 181.428 140.265 159.261 1.00 36.23  ?  90   TYR B CA    1 
ATOM   5077  C  C     . TYR B 2 93   ? 182.055 140.579 157.913 1.00 33.88  ?  90   TYR B C     1 
ATOM   5078  O  O     . TYR B 2 93   ? 182.076 141.738 157.491 1.00 38.52  ?  90   TYR B O     1 
ATOM   5079  C  CB    . TYR B 2 93   ? 179.903 140.409 159.190 1.00 34.46  ?  90   TYR B CB    1 
ATOM   5080  C  CG    . TYR B 2 93   ? 179.140 139.377 159.989 1.00 31.13  ?  90   TYR B CG    1 
ATOM   5081  C  CD1   . TYR B 2 93   ? 179.302 139.270 161.362 1.00 40.08  ?  90   TYR B CD1   1 
ATOM   5082  C  CD2   . TYR B 2 93   ? 178.253 138.511 159.366 1.00 28.90  ?  90   TYR B CD2   1 
ATOM   5083  C  CE1   . TYR B 2 93   ? 178.601 138.327 162.092 1.00 43.98  ?  90   TYR B CE1   1 
ATOM   5084  C  CE2   . TYR B 2 93   ? 177.549 137.567 160.088 1.00 29.76  ?  90   TYR B CE2   1 
ATOM   5085  C  CZ    . TYR B 2 93   ? 177.727 137.478 161.448 1.00 36.06  ?  90   TYR B CZ    1 
ATOM   5086  O  OH    . TYR B 2 93   ? 177.026 136.536 162.164 1.00 41.81  ?  90   TYR B OH    1 
ATOM   5087  N  N     . LEU B 2 94   ? 182.585 139.562 157.249 1.00 27.25  ?  91   LEU B N     1 
ATOM   5088  C  CA    . LEU B 2 94   ? 183.100 139.710 155.897 1.00 22.30  ?  91   LEU B CA    1 
ATOM   5089  C  C     . LEU B 2 94   ? 182.036 139.239 154.916 1.00 22.19  ?  91   LEU B C     1 
ATOM   5090  O  O     . LEU B 2 94   ? 181.498 138.133 155.059 1.00 21.23  ?  91   LEU B O     1 
ATOM   5091  C  CB    . LEU B 2 94   ? 184.400 138.926 155.717 1.00 23.10  ?  91   LEU B CB    1 
ATOM   5092  C  CG    . LEU B 2 94   ? 185.555 139.400 156.605 1.00 29.49  ?  91   LEU B CG    1 
ATOM   5093  C  CD1   . LEU B 2 94   ? 186.812 138.613 156.301 1.00 35.56  ?  91   LEU B CD1   1 
ATOM   5094  C  CD2   . LEU B 2 94   ? 185.805 140.894 156.441 1.00 30.00  ?  91   LEU B CD2   1 
ATOM   5095  N  N     . ILE B 2 95   ? 181.715 140.089 153.941 1.00 20.32  ?  92   ILE B N     1 
ATOM   5096  C  CA    . ILE B 2 95   ? 180.654 139.815 152.978 1.00 14.86  ?  92   ILE B CA    1 
ATOM   5097  C  C     . ILE B 2 95   ? 181.229 139.933 151.575 1.00 18.68  ?  92   ILE B C     1 
ATOM   5098  O  O     . ILE B 2 95   ? 181.737 140.996 151.193 1.00 23.44  ?  92   ILE B O     1 
ATOM   5099  C  CB    . ILE B 2 95   ? 179.455 140.760 153.152 1.00 9.44   ?  92   ILE B CB    1 
ATOM   5100  C  CG1   . ILE B 2 95   ? 178.802 140.549 154.518 1.00 6.98   ?  92   ILE B CG1   1 
ATOM   5101  C  CG2   . ILE B 2 95   ? 178.438 140.524 152.059 1.00 10.67  ?  92   ILE B CG2   1 
ATOM   5102  C  CD1   . ILE B 2 95   ? 177.504 141.305 154.693 1.00 7.12   ?  92   ILE B CD1   1 
ATOM   5103  N  N     . HIS B 2 96   ? 181.145 138.843 150.812 1.00 15.30  ?  93   HIS B N     1 
ATOM   5104  C  CA    . HIS B 2 96   ? 181.626 138.781 149.439 1.00 14.98  ?  93   HIS B CA    1 
ATOM   5105  C  C     . HIS B 2 96   ? 181.107 137.502 148.795 1.00 11.98  ?  93   HIS B C     1 
ATOM   5106  O  O     . HIS B 2 96   ? 181.221 136.426 149.386 1.00 13.77  ?  93   HIS B O     1 
ATOM   5107  C  CB    . HIS B 2 96   ? 183.157 138.841 149.409 1.00 19.24  ?  93   HIS B CB    1 
ATOM   5108  C  CG    . HIS B 2 96   ? 183.778 138.233 148.188 1.00 19.02  ?  93   HIS B CG    1 
ATOM   5109  N  ND1   . HIS B 2 96   ? 183.964 136.875 148.042 1.00 17.50  ?  93   HIS B ND1   1 
ATOM   5110  C  CD2   . HIS B 2 96   ? 184.275 138.803 147.064 1.00 19.22  ?  93   HIS B CD2   1 
ATOM   5111  C  CE1   . HIS B 2 96   ? 184.540 136.634 146.877 1.00 19.38  ?  93   HIS B CE1   1 
ATOM   5112  N  NE2   . HIS B 2 96   ? 184.739 137.787 146.265 1.00 20.93  ?  93   HIS B NE2   1 
ATOM   5113  N  N     . GLY B 2 97   ? 180.511 137.606 147.612 1.00 7.71   ?  94   GLY B N     1 
ATOM   5114  C  CA    . GLY B 2 97   ? 180.235 138.890 147.002 1.00 7.96   ?  94   GLY B CA    1 
ATOM   5115  C  C     . GLY B 2 97   ? 178.805 138.972 146.509 1.00 7.15   ?  94   GLY B C     1 
ATOM   5116  O  O     . GLY B 2 97   ? 178.309 140.057 146.225 1.00 9.34   ?  94   GLY B O     1 
ATOM   5117  N  N     . GLY B 2 98   ? 178.136 137.820 146.419 1.00 6.85   ?  95   GLY B N     1 
ATOM   5118  C  CA    . GLY B 2 98   ? 176.744 137.772 145.978 1.00 7.00   ?  95   GLY B CA    1 
ATOM   5119  C  C     . GLY B 2 98   ? 176.542 138.406 144.605 1.00 9.46   ?  95   GLY B C     1 
ATOM   5120  O  O     . GLY B 2 98   ? 177.480 138.669 143.856 1.00 10.18  ?  95   GLY B O     1 
ATOM   5121  N  N     . ARG B 2 99   ? 175.272 138.652 144.285 1.00 8.16   ?  96   ARG B N     1 
ATOM   5122  C  CA    . ARG B 2 99   ? 174.922 139.366 143.062 1.00 6.58   ?  96   ARG B CA    1 
ATOM   5123  C  C     . ARG B 2 99   ? 173.873 140.427 143.366 1.00 7.57   ?  96   ARG B C     1 
ATOM   5124  O  O     . ARG B 2 99   ? 172.888 140.153 144.061 1.00 8.63   ?  96   ARG B O     1 
ATOM   5125  C  CB    . ARG B 2 99   ? 174.419 138.413 141.973 1.00 6.15   ?  96   ARG B CB    1 
ATOM   5126  C  CG    . ARG B 2 99   ? 173.323 137.464 142.393 1.00 5.66   ?  96   ARG B CG    1 
ATOM   5127  C  CD    . ARG B 2 99   ? 172.860 136.709 141.171 1.00 7.61   ?  96   ARG B CD    1 
ATOM   5128  N  NE    . ARG B 2 99   ? 171.834 135.719 141.461 1.00 5.01   ?  96   ARG B NE    1 
ATOM   5129  C  CZ    . ARG B 2 99   ? 171.143 135.089 140.519 1.00 5.54   ?  96   ARG B CZ    1 
ATOM   5130  N  NH1   . ARG B 2 99   ? 170.225 134.199 140.852 1.00 10.72  ?  96   ARG B NH1   1 
ATOM   5131  N  NH2   . ARG B 2 99   ? 171.373 135.354 139.240 1.00 5.47   ?  96   ARG B NH2   1 
ATOM   5132  N  N     . THR B 2 100  ? 174.088 141.637 142.833 1.00 8.29   ?  97   THR B N     1 
ATOM   5133  C  CA    . THR B 2 100  ? 173.266 142.818 143.083 1.00 7.89   ?  97   THR B CA    1 
ATOM   5134  C  C     . THR B 2 100  ? 171.845 142.602 142.568 1.00 8.06   ?  97   THR B C     1 
ATOM   5135  O  O     . THR B 2 100  ? 171.591 141.620 141.857 1.00 10.11  ?  97   THR B O     1 
ATOM   5136  C  CB    . THR B 2 100  ? 173.889 144.045 142.413 1.00 8.20   ?  97   THR B CB    1 
ATOM   5137  O  OG1   . THR B 2 100  ? 173.430 144.127 141.058 1.00 10.89  ?  97   THR B OG1   1 
ATOM   5138  C  CG2   . THR B 2 100  ? 175.404 143.942 142.420 1.00 10.39  ?  97   THR B CG2   1 
ATOM   5139  N  N     . PRO B 2 101  ? 170.890 143.483 142.896 1.00 5.78   ?  98   PRO B N     1 
ATOM   5140  C  CA    . PRO B 2 101  ? 169.525 143.313 142.370 1.00 7.00   ?  98   PRO B CA    1 
ATOM   5141  C  C     . PRO B 2 101  ? 169.416 143.524 140.872 1.00 8.68   ?  98   PRO B C     1 
ATOM   5142  O  O     . PRO B 2 101  ? 168.337 143.295 140.309 1.00 9.75   ?  98   PRO B O     1 
ATOM   5143  C  CB    . PRO B 2 101  ? 168.721 144.368 143.139 1.00 4.63   ?  98   PRO B CB    1 
ATOM   5144  C  CG    . PRO B 2 101  ? 169.507 144.575 144.383 1.00 5.72   ?  98   PRO B CG    1 
ATOM   5145  C  CD    . PRO B 2 101  ? 170.927 144.529 143.932 1.00 6.09   ?  98   PRO B CD    1 
ATOM   5146  N  N     . ASN B 2 102  ? 170.475 143.987 140.224 1.00 7.75   ?  99   ASN B N     1 
ATOM   5147  C  CA    . ASN B 2 102  ? 170.657 143.815 138.794 1.00 8.02   ?  99   ASN B CA    1 
ATOM   5148  C  C     . ASN B 2 102  ? 171.654 142.684 138.613 1.00 9.87   ?  99   ASN B C     1 
ATOM   5149  O  O     . ASN B 2 102  ? 172.668 142.629 139.315 1.00 10.67  ?  99   ASN B O     1 
ATOM   5150  C  CB    . ASN B 2 102  ? 171.162 145.099 138.142 1.00 10.64  ?  99   ASN B CB    1 
ATOM   5151  C  CG    . ASN B 2 102  ? 170.190 146.243 138.309 1.00 10.40  ?  99   ASN B CG    1 
ATOM   5152  O  OD1   . ASN B 2 102  ? 169.255 146.160 139.105 1.00 8.42   ?  99   ASN B OD1   1 
ATOM   5153  N  ND2   . ASN B 2 102  ? 170.401 147.317 137.559 1.00 10.81  ?  99   ASN B ND2   1 
ATOM   5154  N  N     . ASN B 2 103  ? 171.367 141.780 137.679 1.00 10.89  ?  100  ASN B N     1 
ATOM   5155  C  CA    . ASN B 2 103  ? 172.046 140.492 137.717 1.00 9.46   ?  100  ASN B CA    1 
ATOM   5156  C  C     . ASN B 2 103  ? 173.513 140.641 137.348 1.00 8.83   ?  100  ASN B C     1 
ATOM   5157  O  O     . ASN B 2 103  ? 173.956 140.209 136.279 1.00 9.57   ?  100  ASN B O     1 
ATOM   5158  C  CB    . ASN B 2 103  ? 171.354 139.487 136.800 1.00 9.25   ?  100  ASN B CB    1 
ATOM   5159  C  CG    . ASN B 2 103  ? 170.018 139.037 137.347 1.00 13.48  ?  100  ASN B CG    1 
ATOM   5160  O  OD1   . ASN B 2 103  ? 169.475 139.646 138.270 1.00 14.31  ?  100  ASN B OD1   1 
ATOM   5161  N  ND2   . ASN B 2 103  ? 169.493 137.950 136.800 1.00 19.43  ?  100  ASN B ND2   1 
ATOM   5162  N  N     . GLU B 2 104  ? 174.262 141.263 138.252 1.00 11.88  ?  101  GLU B N     1 
ATOM   5163  C  CA    . GLU B 2 104  ? 175.696 141.444 138.133 1.00 14.32  ?  101  GLU B CA    1 
ATOM   5164  C  C     . GLU B 2 104  ? 176.296 141.139 139.494 1.00 11.45  ?  101  GLU B C     1 
ATOM   5165  O  O     . GLU B 2 104  ? 175.591 141.095 140.504 1.00 10.69  ?  101  GLU B O     1 
ATOM   5166  C  CB    . GLU B 2 104  ? 176.043 142.864 137.669 1.00 22.32  ?  101  GLU B CB    1 
ATOM   5167  C  CG    . GLU B 2 104  ? 175.570 143.950 138.627 1.00 26.15  ?  101  GLU B CG    1 
ATOM   5168  C  CD    . GLU B 2 104  ? 175.774 145.350 138.078 1.00 51.31  ?  101  GLU B CD    1 
ATOM   5169  O  OE1   . GLU B 2 104  ? 174.979 145.768 137.209 1.00 37.06  ?  101  GLU B OE1   1 
ATOM   5170  O  OE2   . GLU B 2 104  ? 176.725 146.035 138.512 1.00 130.14 -1 101  GLU B OE2   1 
ATOM   5171  N  N     . LEU B 2 105  ? 177.602 140.924 139.525 1.00 8.00   ?  102  LEU B N     1 
ATOM   5172  C  CA    . LEU B 2 105  ? 178.224 140.380 140.718 1.00 7.60   ?  102  LEU B CA    1 
ATOM   5173  C  C     . LEU B 2 105  ? 179.304 141.326 141.228 1.00 8.92   ?  102  LEU B C     1 
ATOM   5174  O  O     . LEU B 2 105  ? 179.833 142.161 140.488 1.00 8.81   ?  102  LEU B O     1 
ATOM   5175  C  CB    . LEU B 2 105  ? 178.777 138.979 140.438 1.00 6.21   ?  102  LEU B CB    1 
ATOM   5176  C  CG    . LEU B 2 105  ? 177.676 137.963 140.100 1.00 4.69   ?  102  LEU B CG    1 
ATOM   5177  C  CD1   . LEU B 2 105  ? 177.352 137.952 138.613 1.00 5.99   ?  102  LEU B CD1   1 
ATOM   5178  C  CD2   . LEU B 2 105  ? 178.044 136.570 140.569 1.00 6.37   ?  102  LEU B CD2   1 
ATOM   5179  N  N     . SER B 2 106  ? 179.625 141.182 142.515 1.00 9.58   ?  103  SER B N     1 
ATOM   5180  C  CA    . SER B 2 106  ? 180.369 142.218 143.225 1.00 11.90  ?  103  SER B CA    1 
ATOM   5181  C  C     . SER B 2 106  ? 181.855 142.215 142.873 1.00 14.67  ?  103  SER B C     1 
ATOM   5182  O  O     . SER B 2 106  ? 182.376 143.200 142.335 1.00 15.88  ?  103  SER B O     1 
ATOM   5183  C  CB    . SER B 2 106  ? 180.175 142.044 144.734 1.00 12.93  ?  103  SER B CB    1 
ATOM   5184  O  OG    . SER B 2 106  ? 181.294 142.518 145.458 1.00 15.14  ?  103  SER B OG    1 
ATOM   5185  N  N     . SER B 2 107  ? 182.552 141.114 143.171 1.00 15.78  ?  104  SER B N     1 
ATOM   5186  C  CA    . SER B 2 107  ? 184.018 141.057 143.111 1.00 17.87  ?  104  SER B CA    1 
ATOM   5187  C  C     . SER B 2 107  ? 184.645 142.154 143.972 1.00 22.54  ?  104  SER B C     1 
ATOM   5188  O  O     . SER B 2 107  ? 185.662 142.752 143.610 1.00 22.73  ?  104  SER B O     1 
ATOM   5189  C  CB    . SER B 2 107  ? 184.533 141.140 141.670 1.00 16.12  ?  104  SER B CB    1 
ATOM   5190  O  OG    . SER B 2 107  ? 185.939 141.331 141.636 1.00 15.15  ?  104  SER B OG    1 
ATOM   5191  N  N     . SER B 2 108  ? 184.034 142.419 145.126 1.00 24.89  ?  105  SER B N     1 
ATOM   5192  C  CA    . SER B 2 108  ? 184.538 143.441 146.042 1.00 27.24  ?  105  SER B CA    1 
ATOM   5193  C  C     . SER B 2 108  ? 184.018 143.117 147.438 1.00 28.92  ?  105  SER B C     1 
ATOM   5194  O  O     . SER B 2 108  ? 182.817 143.246 147.692 1.00 31.31  ?  105  SER B O     1 
ATOM   5195  C  CB    . SER B 2 108  ? 184.106 144.834 145.591 1.00 30.19  ?  105  SER B CB    1 
ATOM   5196  O  OG    . SER B 2 108  ? 182.693 144.945 145.525 1.00 30.96  ?  105  SER B OG    1 
ATOM   5197  N  N     . LEU B 2 109  ? 184.915 142.703 148.332 1.00 28.00  ?  106  LEU B N     1 
ATOM   5198  C  CA    . LEU B 2 109  ? 184.515 142.279 149.667 1.00 26.12  ?  106  LEU B CA    1 
ATOM   5199  C  C     . LEU B 2 109  ? 184.368 143.477 150.598 1.00 32.50  ?  106  LEU B C     1 
ATOM   5200  O  O     . LEU B 2 109  ? 185.096 144.469 150.495 1.00 36.08  ?  106  LEU B O     1 
ATOM   5201  C  CB    . LEU B 2 109  ? 185.524 141.269 150.229 1.00 27.40  ?  106  LEU B CB    1 
ATOM   5202  C  CG    . LEU B 2 109  ? 185.521 140.754 151.678 1.00 33.01  ?  106  LEU B CG    1 
ATOM   5203  C  CD1   . LEU B 2 109  ? 186.332 139.480 151.733 1.00 40.28  ?  106  LEU B CD1   1 
ATOM   5204  C  CD2   . LEU B 2 109  ? 186.121 141.744 152.669 1.00 37.61  ?  106  LEU B CD2   1 
ATOM   5205  N  N     . TYR B 2 110  ? 183.413 143.368 151.521 1.00 31.37  ?  107  TYR B N     1 
ATOM   5206  C  CA    . TYR B 2 110  ? 183.097 144.422 152.474 1.00 36.61  ?  107  TYR B CA    1 
ATOM   5207  C  C     . TYR B 2 110  ? 183.278 143.912 153.897 1.00 37.46  ?  107  TYR B C     1 
ATOM   5208  O  O     . TYR B 2 110  ? 182.963 142.752 154.195 1.00 35.53  ?  107  TYR B O     1 
ATOM   5209  C  CB    . TYR B 2 110  ? 181.658 144.918 152.296 1.00 34.63  ?  107  TYR B CB    1 
ATOM   5210  C  CG    . TYR B 2 110  ? 181.337 145.383 150.899 1.00 30.68  ?  107  TYR B CG    1 
ATOM   5211  C  CD1   . TYR B 2 110  ? 181.938 146.515 150.370 1.00 35.43  ?  107  TYR B CD1   1 
ATOM   5212  C  CD2   . TYR B 2 110  ? 180.426 144.694 150.111 1.00 31.36  ?  107  TYR B CD2   1 
ATOM   5213  C  CE1   . TYR B 2 110  ? 181.645 146.946 149.091 1.00 39.40  ?  107  TYR B CE1   1 
ATOM   5214  C  CE2   . TYR B 2 110  ? 180.127 145.117 148.832 1.00 30.54  ?  107  TYR B CE2   1 
ATOM   5215  C  CZ    . TYR B 2 110  ? 180.738 146.243 148.326 1.00 31.74  ?  107  TYR B CZ    1 
ATOM   5216  O  OH    . TYR B 2 110  ? 180.439 146.664 147.050 1.00 33.96  ?  107  TYR B OH    1 
ATOM   5217  N  N     . MET B 2 111  ? 183.773 144.786 154.775 1.00 39.15  ?  108  MET B N     1 
ATOM   5218  C  CA    . MET B 2 111  ? 183.919 144.495 156.196 1.00 38.32  ?  108  MET B CA    1 
ATOM   5219  C  C     . MET B 2 111  ? 182.883 145.299 156.972 1.00 43.03  ?  108  MET B C     1 
ATOM   5220  O  O     . MET B 2 111  ? 182.900 146.535 156.935 1.00 47.76  ?  108  MET B O     1 
ATOM   5221  C  CB    . MET B 2 111  ? 185.329 144.835 156.677 1.00 43.07  ?  108  MET B CB    1 
ATOM   5222  C  CG    . MET B 2 111  ? 185.480 144.831 158.184 1.00 48.69  ?  108  MET B CG    1 
ATOM   5223  S  SD    . MET B 2 111  ? 187.143 145.298 158.690 1.00 73.10  ?  108  MET B SD    1 
ATOM   5224  C  CE    . MET B 2 111  ? 187.241 146.951 158.009 1.00 62.83  ?  108  MET B CE    1 
ATOM   5225  N  N     . LEU B 2 112  ? 181.996 144.601 157.679 1.00 42.98  ?  109  LEU B N     1 
ATOM   5226  C  CA    . LEU B 2 112  ? 180.914 145.213 158.440 1.00 46.19  ?  109  LEU B CA    1 
ATOM   5227  C  C     . LEU B 2 112  ? 181.216 145.104 159.928 1.00 51.43  ?  109  LEU B C     1 
ATOM   5228  O  O     . LEU B 2 112  ? 181.528 144.016 160.423 1.00 51.71  ?  109  LEU B O     1 
ATOM   5229  C  CB    . LEU B 2 112  ? 179.577 144.537 158.116 1.00 37.07  ?  109  LEU B CB    1 
ATOM   5230  C  CG    . LEU B 2 112  ? 178.268 145.250 158.474 1.00 31.68  ?  109  LEU B CG    1 
ATOM   5231  C  CD1   . LEU B 2 112  ? 177.152 144.744 157.583 1.00 20.35  ?  109  LEU B CD1   1 
ATOM   5232  C  CD2   . LEU B 2 112  ? 177.893 145.064 159.938 1.00 38.16  ?  109  LEU B CD2   1 
ATOM   5233  N  N     . SER B 2 113  ? 181.109 146.226 160.639 1.00 61.36  ?  110  SER B N     1 
ATOM   5234  C  CA    . SER B 2 113  ? 181.393 146.271 162.067 1.00 70.83  ?  110  SER B CA    1 
ATOM   5235  C  C     . SER B 2 113  ? 180.416 147.218 162.751 1.00 75.19  ?  110  SER B C     1 
ATOM   5236  O  O     . SER B 2 113  ? 179.661 147.946 162.101 1.00 69.38  ?  110  SER B O     1 
ATOM   5237  C  CB    . SER B 2 113  ? 182.842 146.702 162.335 1.00 73.34  ?  110  SER B CB    1 
ATOM   5238  O  OG    . SER B 2 113  ? 183.063 146.936 163.716 1.00 80.18  ?  110  SER B OG    1 
ATOM   5239  N  N     . VAL B 2 114  ? 180.440 147.202 164.087 1.00 75.17  ?  111  VAL B N     1 
ATOM   5240  C  CA    . VAL B 2 114  ? 179.607 148.071 164.912 1.00 73.00  ?  111  VAL B CA    1 
ATOM   5241  C  C     . VAL B 2 114  ? 180.482 149.182 165.478 1.00 77.68  ?  111  VAL B C     1 
ATOM   5242  O  O     . VAL B 2 114  ? 181.691 149.007 165.679 1.00 76.59  ?  111  VAL B O     1 
ATOM   5243  C  CB    . VAL B 2 114  ? 178.901 147.272 166.032 1.00 68.82  ?  111  VAL B CB    1 
ATOM   5244  C  CG1   . VAL B 2 114  ? 179.897 146.831 167.099 1.00 78.12  ?  111  VAL B CG1   1 
ATOM   5245  C  CG2   . VAL B 2 114  ? 177.763 148.080 166.641 1.00 67.27  ?  111  VAL B CG2   1 
ATOM   5246  N  N     . ASP B 2 115  ? 179.876 150.349 165.719 1.00 88.91  ?  112  ASP B N     1 
ATOM   5247  C  CA    . ASP B 2 115  ? 180.627 151.533 166.123 1.00 104.09 ?  112  ASP B CA    1 
ATOM   5248  C  C     . ASP B 2 115  ? 180.231 152.051 167.500 1.00 118.60 ?  112  ASP B C     1 
ATOM   5249  O  O     . ASP B 2 115  ? 181.096 152.172 168.373 1.00 124.97 ?  112  ASP B O     1 
ATOM   5250  C  CB    . ASP B 2 115  ? 180.453 152.633 165.067 1.00 109.65 ?  112  ASP B CB    1 
ATOM   5251  C  CG    . ASP B 2 115  ? 180.837 154.006 165.584 1.00 134.06 ?  112  ASP B CG    1 
ATOM   5252  O  OD1   . ASP B 2 115  ? 182.049 154.297 165.662 1.00 130.48 ?  112  ASP B OD1   1 
ATOM   5253  O  OD2   . ASP B 2 115  ? 179.927 154.799 165.909 1.00 165.92 -1 112  ASP B OD2   1 
ATOM   5254  N  N     . SER B 2 116  ? 178.953 152.354 167.731 1.00 116.34 ?  113  SER B N     1 
ATOM   5255  C  CA    . SER B 2 116  ? 178.553 153.026 168.961 1.00 119.27 ?  113  SER B CA    1 
ATOM   5256  C  C     . SER B 2 116  ? 177.082 152.753 169.242 1.00 106.60 ?  113  SER B C     1 
ATOM   5257  O  O     . SER B 2 116  ? 176.328 152.327 168.363 1.00 98.73  ?  113  SER B O     1 
ATOM   5258  C  CB    . SER B 2 116  ? 178.804 154.537 168.882 1.00 124.26 ?  113  SER B CB    1 
ATOM   5259  O  OG    . SER B 2 116  ? 178.168 155.105 167.748 1.00 120.13 ?  113  SER B OG    1 
ATOM   5260  N  N     . ARG B 2 117  ? 176.684 153.035 170.481 1.00 100.02 ?  114  ARG B N     1 
ATOM   5261  C  CA    . ARG B 2 117  ? 175.344 152.743 170.972 1.00 97.69  ?  114  ARG B CA    1 
ATOM   5262  C  C     . ARG B 2 117  ? 175.194 153.375 172.352 1.00 106.40 ?  114  ARG B C     1 
ATOM   5263  O  O     . ARG B 2 117  ? 176.189 153.674 173.018 1.00 106.30 ?  114  ARG B O     1 
ATOM   5264  C  CB    . ARG B 2 117  ? 175.096 151.228 171.030 1.00 87.53  ?  114  ARG B CB    1 
ATOM   5265  C  CG    . ARG B 2 117  ? 175.245 150.628 172.415 1.00 84.59  ?  114  ARG B CG    1 
ATOM   5266  C  CD    . ARG B 2 117  ? 175.076 149.127 172.367 1.00 81.91  ?  114  ARG B CD    1 
ATOM   5267  N  NE    . ARG B 2 117  ? 176.169 148.500 171.632 1.00 81.02  ?  114  ARG B NE    1 
ATOM   5268  C  CZ    . ARG B 2 117  ? 176.190 147.223 171.269 1.00 79.32  ?  114  ARG B CZ    1 
ATOM   5269  N  NH1   . ARG B 2 117  ? 177.229 146.743 170.602 1.00 78.56  ?  114  ARG B NH1   1 
ATOM   5270  N  NH2   . ARG B 2 117  ? 175.173 146.427 171.571 1.00 79.54  ?  114  ARG B NH2   1 
ATOM   5271  N  N     . GLY B 2 118  ? 173.943 153.583 172.774 1.00 117.20 ?  115  GLY B N     1 
ATOM   5272  C  CA    . GLY B 2 118  ? 172.778 153.435 171.918 1.00 117.77 ?  115  GLY B CA    1 
ATOM   5273  C  C     . GLY B 2 118  ? 172.431 154.622 171.034 1.00 120.31 ?  115  GLY B C     1 
ATOM   5274  O  O     . GLY B 2 118  ? 172.600 154.548 169.818 1.00 115.23 ?  115  GLY B O     1 
ATOM   5275  N  N     . CYS B 2 119  ? 171.980 155.728 171.628 1.00 114.83 ?  116  CYS B N     1 
ATOM   5276  C  CA    . CYS B 2 119  ? 171.683 155.819 173.058 1.00 111.37 ?  116  CYS B CA    1 
ATOM   5277  C  C     . CYS B 2 119  ? 170.451 155.006 173.459 1.00 110.34 ?  116  CYS B C     1 
ATOM   5278  O  O     . CYS B 2 119  ? 170.546 154.076 174.260 1.00 108.96 ?  116  CYS B O     1 
ATOM   5279  C  CB    . CYS B 2 119  ? 171.476 157.280 173.463 1.00 102.13 ?  116  CYS B CB    1 
ATOM   5280  S  SG    . CYS B 2 119  ? 169.940 158.009 172.841 1.00 82.61  ?  116  CYS B SG    1 
ATOM   5281  N  N     . ASN B 2 120  ? 169.299 155.354 172.888 1.00 111.77 ?  117  ASN B N     1 
ATOM   5282  C  CA    . ASN B 2 120  ? 168.022 154.735 173.241 1.00 115.93 ?  117  ASN B CA    1 
ATOM   5283  C  C     . ASN B 2 120  ? 167.698 153.663 172.204 1.00 124.40 ?  117  ASN B C     1 
ATOM   5284  O  O     . ASN B 2 120  ? 167.066 153.933 171.181 1.00 126.83 ?  117  ASN B O     1 
ATOM   5285  C  CB    . ASN B 2 120  ? 166.921 155.787 173.329 1.00 107.44 ?  117  ASN B CB    1 
ATOM   5286  C  CG    . ASN B 2 120  ? 165.537 155.177 173.443 1.00 109.51 ?  117  ASN B CG    1 
ATOM   5287  O  OD1   . ASN B 2 120  ? 164.733 155.256 172.515 1.00 109.69 ?  117  ASN B OD1   1 
ATOM   5288  N  ND2   . ASN B 2 120  ? 165.255 154.561 174.585 1.00 118.63 ?  117  ASN B ND2   1 
ATOM   5289  N  N     . ARG B 2 121  ? 168.143 152.433 172.477 1.00 127.57 ?  118  ARG B N     1 
ATOM   5290  C  CA    . ARG B 2 121  ? 167.851 151.267 171.637 1.00 131.75 ?  118  ARG B CA    1 
ATOM   5291  C  C     . ARG B 2 121  ? 168.263 151.493 170.184 1.00 126.01 ?  118  ARG B C     1 
ATOM   5292  O  O     . ARG B 2 121  ? 167.663 150.940 169.259 1.00 113.55 ?  118  ARG B O     1 
ATOM   5293  C  CB    . ARG B 2 121  ? 166.372 150.882 171.724 1.00 135.36 ?  118  ARG B CB    1 
ATOM   5294  C  CG    . ARG B 2 121  ? 165.857 150.773 173.148 1.00 132.57 ?  118  ARG B CG    1 
ATOM   5295  C  CD    . ARG B 2 121  ? 166.696 149.801 173.958 1.00 136.76 ?  118  ARG B CD    1 
ATOM   5296  N  NE    . ARG B 2 121  ? 166.483 149.965 175.392 1.00 142.75 ?  118  ARG B NE    1 
ATOM   5297  C  CZ    . ARG B 2 121  ? 167.009 149.173 176.320 1.00 148.38 ?  118  ARG B CZ    1 
ATOM   5298  N  NH1   . ARG B 2 121  ? 167.781 148.155 175.965 1.00 146.77 ?  118  ARG B NH1   1 
ATOM   5299  N  NH2   . ARG B 2 121  ? 166.762 149.397 177.603 1.00 150.33 ?  118  ARG B NH2   1 
ATOM   5300  N  N     . LYS B 2 122  ? 169.291 152.308 169.985 1.00 116.97 ?  119  LYS B N     1 
ATOM   5301  C  CA    . LYS B 2 122  ? 169.795 152.667 168.672 1.00 102.22 ?  119  LYS B CA    1 
ATOM   5302  C  C     . LYS B 2 122  ? 171.191 152.081 168.501 1.00 92.09  ?  119  LYS B C     1 
ATOM   5303  O  O     . LYS B 2 122  ? 171.900 151.830 169.479 1.00 97.99  ?  119  LYS B O     1 
ATOM   5304  C  CB    . LYS B 2 122  ? 169.811 154.193 168.514 1.00 101.70 ?  119  LYS B CB    1 
ATOM   5305  C  CG    . LYS B 2 122  ? 170.276 154.729 167.174 1.00 95.91  ?  119  LYS B CG    1 
ATOM   5306  C  CD    . LYS B 2 122  ? 170.593 156.214 167.292 1.00 99.32  ?  119  LYS B CD    1 
ATOM   5307  C  CE    . LYS B 2 122  ? 170.889 156.837 165.941 1.00 99.48  ?  119  LYS B CE    1 
ATOM   5308  N  NZ    . LYS B 2 122  ? 169.688 156.833 165.063 1.00 95.92  ?  119  LYS B NZ    1 
ATOM   5309  N  N     . VAL B 2 123  ? 171.571 151.824 167.251 1.00 73.65  ?  120  VAL B N     1 
ATOM   5310  C  CA    . VAL B 2 123  ? 172.879 151.265 166.944 1.00 62.61  ?  120  VAL B CA    1 
ATOM   5311  C  C     . VAL B 2 123  ? 173.529 152.138 165.880 1.00 60.46  ?  120  VAL B C     1 
ATOM   5312  O  O     . VAL B 2 123  ? 172.881 152.970 165.241 1.00 61.65  ?  120  VAL B O     1 
ATOM   5313  C  CB    . VAL B 2 123  ? 172.792 149.795 166.465 1.00 57.13  ?  120  VAL B CB    1 
ATOM   5314  C  CG1   . VAL B 2 123  ? 174.135 149.086 166.626 1.00 56.15  ?  120  VAL B CG1   1 
ATOM   5315  C  CG2   . VAL B 2 123  ? 171.697 149.047 167.216 1.00 60.92  ?  120  VAL B CG2   1 
ATOM   5316  N  N     . THR B 2 124  ? 174.838 151.959 165.718 1.00 62.10  ?  121  THR B N     1 
ATOM   5317  C  CA    . THR B 2 124  ? 175.585 152.543 164.614 1.00 64.85  ?  121  THR B CA    1 
ATOM   5318  C  C     . THR B 2 124  ? 176.480 151.467 164.020 1.00 67.89  ?  121  THR B C     1 
ATOM   5319  O  O     . THR B 2 124  ? 177.169 150.751 164.754 1.00 71.86  ?  121  THR B O     1 
ATOM   5320  C  CB    . THR B 2 124  ? 176.429 153.741 165.062 1.00 76.32  ?  121  THR B CB    1 
ATOM   5321  O  OG1   . THR B 2 124  ? 177.404 153.306 166.016 1.00 93.10  ?  121  THR B OG1   1 
ATOM   5322  C  CG2   . THR B 2 124  ? 175.555 154.821 165.685 1.00 71.03  ?  121  THR B CG2   1 
ATOM   5323  N  N     . LEU B 2 125  ? 176.472 151.359 162.697 1.00 61.22  ?  122  LEU B N     1 
ATOM   5324  C  CA    . LEU B 2 125  ? 177.274 150.378 161.987 1.00 56.45  ?  122  LEU B CA    1 
ATOM   5325  C  C     . LEU B 2 125  ? 178.221 151.082 161.026 1.00 53.49  ?  122  LEU B C     1 
ATOM   5326  O  O     . LEU B 2 125  ? 178.107 152.282 160.765 1.00 53.19  ?  122  LEU B O     1 
ATOM   5327  C  CB    . LEU B 2 125  ? 176.386 149.386 161.226 1.00 46.54  ?  122  LEU B CB    1 
ATOM   5328  C  CG    . LEU B 2 125  ? 175.325 148.687 162.076 1.00 46.36  ?  122  LEU B CG    1 
ATOM   5329  C  CD1   . LEU B 2 125  ? 174.557 147.675 161.245 1.00 38.20  ?  122  LEU B CD1   1 
ATOM   5330  C  CD2   . LEU B 2 125  ? 175.970 148.020 163.280 1.00 53.69  ?  122  LEU B CD2   1 
ATOM   5331  N  N     . ARG B 2 126  ? 179.171 150.312 160.505 1.00 52.69  ?  123  ARG B N     1 
ATOM   5332  C  CA    . ARG B 2 126  ? 180.084 150.810 159.490 1.00 51.27  ?  123  ARG B CA    1 
ATOM   5333  C  C     . ARG B 2 126  ? 180.409 149.679 158.527 1.00 51.76  ?  123  ARG B C     1 
ATOM   5334  O  O     . ARG B 2 126  ? 180.519 148.517 158.930 1.00 53.90  ?  123  ARG B O     1 
ATOM   5335  C  CB    . ARG B 2 126  ? 181.365 151.382 160.107 1.00 55.07  ?  123  ARG B CB    1 
ATOM   5336  C  CG    . ARG B 2 126  ? 182.184 150.390 160.910 1.00 63.16  ?  123  ARG B CG    1 
ATOM   5337  C  CD    . ARG B 2 126  ? 183.392 151.080 161.501 1.00 72.51  ?  123  ARG B CD    1 
ATOM   5338  N  NE    . ARG B 2 126  ? 184.158 151.764 160.464 1.00 81.25  ?  123  ARG B NE    1 
ATOM   5339  C  CZ    . ARG B 2 126  ? 184.891 152.852 160.672 1.00 88.98  ?  123  ARG B CZ    1 
ATOM   5340  N  NH1   . ARG B 2 126  ? 185.552 153.408 159.666 1.00 92.30  ?  123  ARG B NH1   1 
ATOM   5341  N  NH2   . ARG B 2 126  ? 184.963 153.382 161.885 1.00 84.88  ?  123  ARG B NH2   1 
ATOM   5342  N  N     . CYS B 2 127  ? 180.543 150.032 157.250 1.00 48.20  ?  124  CYS B N     1 
ATOM   5343  C  CA    . CYS B 2 127  ? 180.821 149.079 156.178 1.00 43.78  ?  124  CYS B CA    1 
ATOM   5344  C  C     . CYS B 2 127  ? 182.003 149.620 155.385 1.00 46.81  ?  124  CYS B C     1 
ATOM   5345  O  O     . CYS B 2 127  ? 181.835 150.441 154.479 1.00 48.66  ?  124  CYS B O     1 
ATOM   5346  C  CB    . CYS B 2 127  ? 179.596 148.874 155.300 1.00 39.53  ?  124  CYS B CB    1 
ATOM   5347  S  SG    . CYS B 2 127  ? 178.329 147.840 156.054 1.00 44.21  ?  124  CYS B SG    1 
ATOM   5348  N  N     . GLU B 2 128  ? 183.200 149.161 155.732 1.00 51.01  ?  125  GLU B N     1 
ATOM   5349  C  CA    . GLU B 2 128  ? 184.410 149.587 155.046 1.00 56.46  ?  125  GLU B CA    1 
ATOM   5350  C  C     . GLU B 2 128  ? 184.667 148.649 153.874 1.00 46.65  ?  125  GLU B C     1 
ATOM   5351  O  O     . GLU B 2 128  ? 184.812 147.434 154.059 1.00 48.29  ?  125  GLU B O     1 
ATOM   5352  C  CB    . GLU B 2 128  ? 185.599 149.617 156.006 1.00 75.01  ?  125  GLU B CB    1 
ATOM   5353  C  CG    . GLU B 2 128  ? 185.469 150.674 157.099 1.00 93.67  ?  125  GLU B CG    1 
ATOM   5354  C  CD    . GLU B 2 128  ? 186.718 150.806 157.952 1.00 111.54 ?  125  GLU B CD    1 
ATOM   5355  O  OE1   . GLU B 2 128  ? 187.742 150.175 157.619 1.00 103.29 ?  125  GLU B OE1   1 
ATOM   5356  O  OE2   . GLU B 2 128  ? 186.676 151.549 158.956 1.00 147.86 -1 125  GLU B OE2   1 
ATOM   5357  N  N     . GLU B 2 129  ? 184.678 149.207 152.668 1.00 42.52  ?  126  GLU B N     1 
ATOM   5358  C  CA    . GLU B 2 129  ? 185.101 148.443 151.506 1.00 46.40  ?  126  GLU B CA    1 
ATOM   5359  C  C     . GLU B 2 129  ? 186.577 148.107 151.652 1.00 51.78  ?  126  GLU B C     1 
ATOM   5360  O  O     . GLU B 2 129  ? 187.416 149.006 151.771 1.00 57.79  ?  126  GLU B O     1 
ATOM   5361  C  CB    . GLU B 2 129  ? 184.856 149.232 150.223 1.00 56.52  ?  126  GLU B CB    1 
ATOM   5362  C  CG    . GLU B 2 129  ? 185.574 148.656 149.008 1.00 76.93  ?  126  GLU B CG    1 
ATOM   5363  C  CD    . GLU B 2 129  ? 185.367 149.483 147.751 1.00 98.56  ?  126  GLU B CD    1 
ATOM   5364  O  OE1   . GLU B 2 129  ? 184.582 150.455 147.795 1.00 80.72  ?  126  GLU B OE1   1 
ATOM   5365  O  OE2   . GLU B 2 129  ? 185.984 149.158 146.714 1.00 187.37 -1 126  GLU B OE2   1 
ATOM   5366  N  N     . LYS B 2 130  ? 186.894 146.819 151.663 1.00 48.68  ?  127  LYS B N     1 
ATOM   5367  C  CA    . LYS B 2 130  ? 188.268 146.357 151.784 1.00 55.79  ?  127  LYS B CA    1 
ATOM   5368  C  C     . LYS B 2 130  ? 188.726 145.862 150.421 1.00 53.64  ?  127  LYS B C     1 
ATOM   5369  O  O     . LYS B 2 130  ? 188.138 144.927 149.866 1.00 52.52  ?  127  LYS B O     1 
ATOM   5370  C  CB    . LYS B 2 130  ? 188.389 145.260 152.841 1.00 62.30  ?  127  LYS B CB    1 
ATOM   5371  C  CG    . LYS B 2 130  ? 189.496 145.506 153.861 1.00 73.91  ?  127  LYS B CG    1 
ATOM   5372  C  CD    . LYS B 2 130  ? 189.242 146.779 154.661 1.00 74.68  ?  127  LYS B CD    1 
ATOM   5373  C  CE    . LYS B 2 130  ? 190.284 146.978 155.754 1.00 83.05  ?  127  LYS B CE    1 
ATOM   5374  N  NZ    . LYS B 2 130  ? 191.664 147.059 155.201 1.00 98.29  ?  127  LYS B NZ    1 
ATOM   5375  N  N     . GLU B 2 131  ? 189.756 146.503 149.880 1.00 56.88  ?  128  GLU B N     1 
ATOM   5376  C  CA    . GLU B 2 131  ? 190.269 146.125 148.575 1.00 61.93  ?  128  GLU B CA    1 
ATOM   5377  C  C     . GLU B 2 131  ? 190.892 144.733 148.634 1.00 69.85  ?  128  GLU B C     1 
ATOM   5378  O  O     . GLU B 2 131  ? 191.447 144.318 149.655 1.00 74.98  ?  128  GLU B O     1 
ATOM   5379  C  CB    . GLU B 2 131  ? 191.294 147.158 148.098 1.00 73.01  ?  128  GLU B CB    1 
ATOM   5380  C  CG    . GLU B 2 131  ? 191.904 146.878 146.732 1.00 99.84  ?  128  GLU B CG    1 
ATOM   5381  C  CD    . GLU B 2 131  ? 193.084 145.926 146.797 1.00 119.24 ?  128  GLU B CD    1 
ATOM   5382  O  OE1   . GLU B 2 131  ? 193.609 145.696 147.908 1.00 109.28 ?  128  GLU B OE1   1 
ATOM   5383  O  OE2   . GLU B 2 131  ? 193.466 145.383 145.740 1.00 170.71 -1 128  GLU B OE2   1 
ATOM   5384  N  N     . LEU B 2 132  ? 190.788 144.005 147.521 1.00 75.79  ?  129  LEU B N     1 
ATOM   5385  C  CA    . LEU B 2 132  ? 191.413 142.695 147.361 1.00 80.32  ?  129  LEU B CA    1 
ATOM   5386  C  C     . LEU B 2 132  ? 192.423 142.770 146.222 1.00 87.59  ?  129  LEU B C     1 
ATOM   5387  O  O     . LEU B 2 132  ? 192.039 142.922 145.057 1.00 87.46  ?  129  LEU B O     1 
ATOM   5388  C  CB    . LEU B 2 132  ? 190.369 141.613 147.087 1.00 72.56  ?  129  LEU B CB    1 
ATOM   5389  C  CG    . LEU B 2 132  ? 189.441 141.242 148.245 1.00 71.23  ?  129  LEU B CG    1 
ATOM   5390  C  CD1   . LEU B 2 132  ? 188.825 139.870 148.019 1.00 62.71  ?  129  LEU B CD1   1 
ATOM   5391  C  CD2   . LEU B 2 132  ? 190.189 141.282 149.566 1.00 79.80  ?  129  LEU B CD2   1 
ATOM   5392  N  N     . VAL B 2 133  ? 193.704 142.667 146.555 1.00 95.45  ?  130  VAL B N     1 
ATOM   5393  C  CA    . VAL B 2 133  ? 194.761 142.650 145.562 1.00 99.52  ?  130  VAL B CA    1 
ATOM   5394  C  C     . VAL B 2 133  ? 195.223 141.212 145.359 1.00 97.25  ?  130  VAL B C     1 
ATOM   5395  O  O     . VAL B 2 133  ? 194.899 140.314 146.131 1.00 96.82  ?  130  VAL B O     1 
ATOM   5396  C  CB    . VAL B 2 133  ? 195.941 143.582 145.954 1.00 105.85 ?  130  VAL B CB    1 
ATOM   5397  C  CG1   . VAL B 2 133  ? 196.933 142.860 146.856 1.00 104.11 ?  130  VAL B CG1   1 
ATOM   5398  C  CG2   . VAL B 2 133  ? 196.636 144.129 144.710 1.00 99.40  ?  130  VAL B CG2   1 
ATOM   5399  N  N     . GLY B 2 134  ? 195.982 140.984 144.291 1.00 97.60  ?  131  GLY B N     1 
ATOM   5400  C  CA    . GLY B 2 134  ? 196.485 139.660 143.989 1.00 96.79  ?  131  GLY B CA    1 
ATOM   5401  C  C     . GLY B 2 134  ? 196.805 139.498 142.516 1.00 99.00  ?  131  GLY B C     1 
ATOM   5402  O  O     . GLY B 2 134  ? 197.498 140.361 141.969 1.00 102.39 ?  131  GLY B O     1 
ATOM   5403  N  N     . ASP B 2 135  ? 196.343 138.438 141.840 1.00 97.89  ?  132  ASP B N     1 
ATOM   5404  C  CA    . ASP B 2 135  ? 195.566 137.298 142.362 1.00 92.99  ?  132  ASP B CA    1 
ATOM   5405  C  C     . ASP B 2 135  ? 194.278 137.661 143.108 1.00 91.15  ?  132  ASP B C     1 
ATOM   5406  O  O     . ASP B 2 135  ? 194.133 137.361 144.292 1.00 91.93  ?  132  ASP B O     1 
ATOM   5407  C  CB    . ASP B 2 135  ? 196.447 136.421 143.265 1.00 104.87 ?  132  ASP B CB    1 
ATOM   5408  C  CG    . ASP B 2 135  ? 195.862 135.039 143.483 1.00 114.36 ?  132  ASP B CG    1 
ATOM   5409  O  OD1   . ASP B 2 135  ? 194.830 134.725 142.855 1.00 100.65 ?  132  ASP B OD1   1 
ATOM   5410  O  OD2   . ASP B 2 135  ? 196.431 134.269 144.284 1.00 145.76 -1 132  ASP B OD2   1 
ATOM   5411  N  N     . VAL B 2 136  ? 193.347 138.303 142.412 1.00 76.77  ?  133  VAL B N     1 
ATOM   5412  C  CA    . VAL B 2 136  ? 192.047 138.618 142.997 1.00 64.86  ?  133  VAL B CA    1 
ATOM   5413  C  C     . VAL B 2 136  ? 191.130 137.420 142.782 1.00 46.84  ?  133  VAL B C     1 
ATOM   5414  O  O     . VAL B 2 136  ? 191.381 136.601 141.885 1.00 47.56  ?  133  VAL B O     1 
ATOM   5415  C  CB    . VAL B 2 136  ? 191.449 139.900 142.392 1.00 61.06  ?  133  VAL B CB    1 
ATOM   5416  C  CG1   . VAL B 2 136  ? 192.520 140.971 142.247 1.00 73.37  ?  133  VAL B CG1   1 
ATOM   5417  C  CG2   . VAL B 2 136  ? 190.785 139.608 141.051 1.00 53.23  ?  133  VAL B CG2   1 
ATOM   5418  N  N     . PRO B 2 137  ? 190.086 137.252 143.587 1.00 42.22  ?  134  PRO B N     1 
ATOM   5419  C  CA    . PRO B 2 137  ? 189.065 136.257 143.265 1.00 33.51  ?  134  PRO B CA    1 
ATOM   5420  C  C     . PRO B 2 137  ? 188.105 136.796 142.219 1.00 30.02  ?  134  PRO B C     1 
ATOM   5421  O  O     . PRO B 2 137  ? 187.998 138.003 141.990 1.00 30.50  ?  134  PRO B O     1 
ATOM   5422  C  CB    . PRO B 2 137  ? 188.357 136.042 144.605 1.00 34.65  ?  134  PRO B CB    1 
ATOM   5423  C  CG    . PRO B 2 137  ? 188.439 137.378 145.248 1.00 40.41  ?  134  PRO B CG    1 
ATOM   5424  C  CD    . PRO B 2 137  ? 189.793 137.938 144.859 1.00 48.89  ?  134  PRO B CD    1 
ATOM   5425  N  N     . SER B 2 138  ? 187.403 135.874 141.576 1.00 29.53  ?  135  SER B N     1 
ATOM   5426  C  CA    . SER B 2 138  ? 186.386 136.260 140.615 1.00 24.91  ?  135  SER B CA    1 
ATOM   5427  C  C     . SER B 2 138  ? 185.046 136.406 141.319 1.00 19.68  ?  135  SER B C     1 
ATOM   5428  O  O     . SER B 2 138  ? 184.762 135.722 142.307 1.00 20.14  ?  135  SER B O     1 
ATOM   5429  C  CB    . SER B 2 138  ? 186.276 135.237 139.483 1.00 28.04  ?  135  SER B CB    1 
ATOM   5430  O  OG    . SER B 2 138  ? 185.740 134.010 139.945 1.00 24.32  ?  135  SER B OG    1 
ATOM   5431  N  N     . ALA B 2 139  ? 184.231 137.321 140.812 1.00 13.22  ?  136  ALA B N     1 
ATOM   5432  C  CA    . ALA B 2 139  ? 182.890 137.483 141.346 1.00 8.97   ?  136  ALA B CA    1 
ATOM   5433  C  C     . ALA B 2 139  ? 182.071 136.230 141.072 1.00 7.70   ?  136  ALA B C     1 
ATOM   5434  O  O     . ALA B 2 139  ? 182.110 135.666 139.975 1.00 9.30   ?  136  ALA B O     1 
ATOM   5435  C  CB    . ALA B 2 139  ? 182.217 138.705 140.733 1.00 7.44   ?  136  ALA B CB    1 
ATOM   5436  N  N     . ARG B 2 140  ? 181.330 135.795 142.084 1.00 8.32   ?  137  ARG B N     1 
ATOM   5437  C  CA    . ARG B 2 140  ? 180.581 134.549 142.033 1.00 7.99   ?  137  ARG B CA    1 
ATOM   5438  C  C     . ARG B 2 140  ? 179.583 134.585 143.178 1.00 7.23   ?  137  ARG B C     1 
ATOM   5439  O  O     . ARG B 2 140  ? 179.651 135.452 144.052 1.00 8.01   ?  137  ARG B O     1 
ATOM   5440  C  CB    . ARG B 2 140  ? 181.509 133.338 142.145 1.00 11.49  ?  137  ARG B CB    1 
ATOM   5441  C  CG    . ARG B 2 140  ? 182.321 133.327 143.425 1.00 13.82  ?  137  ARG B CG    1 
ATOM   5442  C  CD    . ARG B 2 140  ? 183.448 132.317 143.360 1.00 18.42  ?  137  ARG B CD    1 
ATOM   5443  N  NE    . ARG B 2 140  ? 184.584 132.824 142.598 1.00 16.82  ?  137  ARG B NE    1 
ATOM   5444  C  CZ    . ARG B 2 140  ? 185.647 132.097 142.275 1.00 15.95  ?  137  ARG B CZ    1 
ATOM   5445  N  NH1   . ARG B 2 140  ? 185.720 130.827 142.647 1.00 19.79  ?  137  ARG B NH1   1 
ATOM   5446  N  NH2   . ARG B 2 140  ? 186.636 132.638 141.579 1.00 22.94  ?  137  ARG B NH2   1 
ATOM   5447  N  N     . TYR B 2 141  ? 178.656 133.633 143.176 1.00 8.66   ?  138  TYR B N     1 
ATOM   5448  C  CA    . TYR B 2 141  ? 177.660 133.592 144.235 1.00 8.50   ?  138  TYR B CA    1 
ATOM   5449  C  C     . TYR B 2 141  ? 177.481 132.161 144.714 1.00 14.75  ?  138  TYR B C     1 
ATOM   5450  O  O     . TYR B 2 141  ? 177.707 131.205 143.967 1.00 17.07  ?  138  TYR B O     1 
ATOM   5451  C  CB    . TYR B 2 141  ? 176.323 134.198 143.775 1.00 7.39   ?  138  TYR B CB    1 
ATOM   5452  C  CG    . TYR B 2 141  ? 175.488 133.357 142.831 1.00 7.71   ?  138  TYR B CG    1 
ATOM   5453  C  CD1   . TYR B 2 141  ? 176.040 132.770 141.701 1.00 10.53  ?  138  TYR B CD1   1 
ATOM   5454  C  CD2   . TYR B 2 141  ? 174.127 133.202 143.047 1.00 6.75   ?  138  TYR B CD2   1 
ATOM   5455  C  CE1   . TYR B 2 141  ? 175.261 132.020 140.838 1.00 11.32  ?  138  TYR B CE1   1 
ATOM   5456  C  CE2   . TYR B 2 141  ? 173.345 132.463 142.190 1.00 6.04   ?  138  TYR B CE2   1 
ATOM   5457  C  CZ    . TYR B 2 141  ? 173.913 131.874 141.089 1.00 8.90   ?  138  TYR B CZ    1 
ATOM   5458  O  OH    . TYR B 2 141  ? 173.123 131.136 140.240 1.00 15.03  ?  138  TYR B OH    1 
ATOM   5459  N  N     . GLY B 2 142  ? 177.089 132.028 145.983 1.00 16.07  ?  139  GLY B N     1 
ATOM   5460  C  CA    . GLY B 2 142  ? 176.882 130.736 146.598 1.00 13.91  ?  139  GLY B CA    1 
ATOM   5461  C  C     . GLY B 2 142  ? 178.118 130.090 147.183 1.00 11.21  ?  139  GLY B C     1 
ATOM   5462  O  O     . GLY B 2 142  ? 178.000 129.038 147.826 1.00 11.65  ?  139  GLY B O     1 
ATOM   5463  N  N     . HIS B 2 143  ? 179.297 130.670 146.982 1.00 14.67  ?  140  HIS B N     1 
ATOM   5464  C  CA    . HIS B 2 143  ? 180.513 130.119 147.557 1.00 16.15  ?  140  HIS B CA    1 
ATOM   5465  C  C     . HIS B 2 143  ? 180.539 130.399 149.059 1.00 17.80  ?  140  HIS B C     1 
ATOM   5466  O  O     . HIS B 2 143  ? 179.576 130.908 149.639 1.00 15.84  ?  140  HIS B O     1 
ATOM   5467  C  CB    . HIS B 2 143  ? 181.733 130.686 146.837 1.00 20.12  ?  140  HIS B CB    1 
ATOM   5468  C  CG    . HIS B 2 143  ? 182.017 132.118 147.153 1.00 20.25  ?  140  HIS B CG    1 
ATOM   5469  N  ND1   . HIS B 2 143  ? 181.023 133.032 147.427 1.00 15.87  ?  140  HIS B ND1   1 
ATOM   5470  C  CD2   . HIS B 2 143  ? 183.184 132.801 147.204 1.00 19.11  ?  140  HIS B CD2   1 
ATOM   5471  C  CE1   . HIS B 2 143  ? 181.568 134.213 147.654 1.00 12.70  ?  140  HIS B CE1   1 
ATOM   5472  N  NE2   . HIS B 2 143  ? 182.878 134.100 147.527 1.00 15.69  ?  140  HIS B NE2   1 
ATOM   5473  N  N     . THR B 2 144  ? 181.646 130.041 149.710 1.00 23.29  ?  141  THR B N     1 
ATOM   5474  C  CA    . THR B 2 144  ? 181.737 130.177 151.157 1.00 25.52  ?  141  THR B CA    1 
ATOM   5475  C  C     . THR B 2 144  ? 183.075 130.770 151.565 1.00 26.78  ?  141  THR B C     1 
ATOM   5476  O  O     . THR B 2 144  ? 184.123 130.423 151.008 1.00 32.22  ?  141  THR B O     1 
ATOM   5477  C  CB    . THR B 2 144  ? 181.560 128.833 151.868 1.00 28.92  ?  141  THR B CB    1 
ATOM   5478  O  OG1   . THR B 2 144  ? 182.567 127.918 151.418 1.00 31.10  ?  141  THR B OG1   1 
ATOM   5479  C  CG2   . THR B 2 144  ? 180.192 128.267 151.579 1.00 34.50  ?  141  THR B CG2   1 
ATOM   5480  N  N     . LEU B 2 145  ? 183.020 131.658 152.554 1.00 23.47  ?  142  LEU B N     1 
ATOM   5481  C  CA    . LEU B 2 145  ? 184.191 132.218 153.204 1.00 25.93  ?  142  LEU B CA    1 
ATOM   5482  C  C     . LEU B 2 145  ? 184.203 131.778 154.662 1.00 29.90  ?  142  LEU B C     1 
ATOM   5483  O  O     . LEU B 2 145  ? 183.149 131.540 155.260 1.00 29.85  ?  142  LEU B O     1 
ATOM   5484  C  CB    . LEU B 2 145  ? 184.197 133.749 153.116 1.00 26.40  ?  142  LEU B CB    1 
ATOM   5485  C  CG    . LEU B 2 145  ? 185.450 134.464 153.624 1.00 30.57  ?  142  LEU B CG    1 
ATOM   5486  C  CD1   . LEU B 2 145  ? 186.644 134.120 152.758 1.00 37.90  ?  142  LEU B CD1   1 
ATOM   5487  C  CD2   . LEU B 2 145  ? 185.238 135.967 153.671 1.00 31.94  ?  142  LEU B CD2   1 
ATOM   5488  N  N     . SER B 2 146  ? 185.402 131.654 155.226 1.00 37.03  ?  143  SER B N     1 
ATOM   5489  C  CA    . SER B 2 146  ? 185.532 131.273 156.626 1.00 41.04  ?  143  SER B CA    1 
ATOM   5490  C  C     . SER B 2 146  ? 186.851 131.795 157.173 1.00 44.06  ?  143  SER B C     1 
ATOM   5491  O  O     . SER B 2 146  ? 187.839 131.908 156.447 1.00 46.26  ?  143  SER B O     1 
ATOM   5492  C  CB    . SER B 2 146  ? 185.439 129.753 156.805 1.00 45.95  ?  143  SER B CB    1 
ATOM   5493  O  OG    . SER B 2 146  ? 184.172 129.269 156.392 1.00 43.27  ?  143  SER B OG    1 
ATOM   5494  N  N     . VAL B 2 147  ? 186.858 132.113 158.459 1.00 38.99  ?  144  VAL B N     1 
ATOM   5495  C  CA    . VAL B 2 147  ? 188.035 132.680 159.106 1.00 44.38  ?  144  VAL B CA    1 
ATOM   5496  C  C     . VAL B 2 147  ? 188.852 131.556 159.721 1.00 47.62  ?  144  VAL B C     1 
ATOM   5497  O  O     . VAL B 2 147  ? 188.311 130.550 160.194 1.00 49.55  ?  144  VAL B O     1 
ATOM   5498  C  CB    . VAL B 2 147  ? 187.632 133.730 160.163 1.00 43.93  ?  144  VAL B CB    1 
ATOM   5499  C  CG1   . VAL B 2 147  ? 188.853 134.489 160.665 1.00 50.58  ?  144  VAL B CG1   1 
ATOM   5500  C  CG2   . VAL B 2 147  ? 186.608 134.688 159.585 1.00 47.06  ?  144  VAL B CG2   1 
ATOM   5501  N  N     . ILE B 2 148  ? 190.176 131.719 159.701 1.00 62.09  ?  145  ILE B N     1 
ATOM   5502  C  CA    . ILE B 2 148  ? 191.096 130.764 160.303 1.00 72.04  ?  145  ILE B CA    1 
ATOM   5503  C  C     . ILE B 2 148  ? 192.210 131.537 160.992 1.00 82.52  ?  145  ILE B C     1 
ATOM   5504  O  O     . ILE B 2 148  ? 192.455 132.711 160.706 1.00 85.01  ?  145  ILE B O     1 
ATOM   5505  C  CB    . ILE B 2 148  ? 191.690 129.775 159.272 1.00 78.83  ?  145  ILE B CB    1 
ATOM   5506  C  CG1   . ILE B 2 148  ? 192.382 130.530 158.131 1.00 86.73  ?  145  ILE B CG1   1 
ATOM   5507  C  CG2   . ILE B 2 148  ? 190.615 128.836 158.738 1.00 64.89  ?  145  ILE B CG2   1 
ATOM   5508  C  CD1   . ILE B 2 148  ? 193.890 130.681 158.292 1.00 93.44  ?  145  ILE B CD1   1 
ATOM   5509  N  N     . ASN B 2 149  ? 192.911 130.840 161.885 1.00 86.22  ?  146  ASN B N     1 
ATOM   5510  C  CA    . ASN B 2 149  ? 193.957 131.452 162.703 1.00 91.90  ?  146  ASN B CA    1 
ATOM   5511  C  C     . ASN B 2 149  ? 195.028 130.391 162.942 1.00 100.87 ?  146  ASN B C     1 
ATOM   5512  O  O     . ASN B 2 149  ? 194.852 129.506 163.784 1.00 104.64 ?  146  ASN B O     1 
ATOM   5513  C  CB    . ASN B 2 149  ? 193.375 131.974 164.008 1.00 92.88  ?  146  ASN B CB    1 
ATOM   5514  C  CG    . ASN B 2 149  ? 192.400 130.996 164.637 1.00 89.17  ?  146  ASN B CG    1 
ATOM   5515  O  OD1   . ASN B 2 149  ? 191.185 131.180 164.564 1.00 86.30  ?  146  ASN B OD1   1 
ATOM   5516  N  ND2   . ASN B 2 149  ? 192.929 129.943 165.248 1.00 96.98  ?  146  ASN B ND2   1 
ATOM   5517  N  N     . SER B 2 150  ? 196.131 130.487 162.203 1.00 109.07 ?  147  SER B N     1 
ATOM   5518  C  CA    . SER B 2 150  ? 197.200 129.493 162.263 1.00 120.65 ?  147  SER B CA    1 
ATOM   5519  C  C     . SER B 2 150  ? 198.507 130.176 162.641 1.00 128.69 ?  147  SER B C     1 
ATOM   5520  O  O     . SER B 2 150  ? 199.083 130.914 161.833 1.00 134.06 ?  147  SER B O     1 
ATOM   5521  C  CB    . SER B 2 150  ? 197.338 128.751 160.934 1.00 126.39 ?  147  SER B CB    1 
ATOM   5522  O  OG    . SER B 2 150  ? 198.472 127.900 160.943 1.00 130.19 ?  147  SER B OG    1 
ATOM   5523  N  N     . ARG B 2 151  ? 198.931 129.965 163.890 1.00 135.92 ?  148  ARG B N     1 
ATOM   5524  C  CA    . ARG B 2 151  ? 200.273 130.262 164.390 1.00 146.71 ?  148  ARG B CA    1 
ATOM   5525  C  C     . ARG B 2 151  ? 200.874 131.553 163.835 1.00 146.93 ?  148  ARG B C     1 
ATOM   5526  O  O     . ARG B 2 151  ? 201.854 131.508 163.084 1.00 147.60 ?  148  ARG B O     1 
ATOM   5527  C  CB    . ARG B 2 151  ? 201.200 129.071 164.121 1.00 148.61 ?  148  ARG B CB    1 
ATOM   5528  C  CG    . ARG B 2 151  ? 202.501 129.094 164.919 1.00 150.43 ?  148  ARG B CG    1 
ATOM   5529  C  CD    . ARG B 2 151  ? 203.475 128.040 164.413 1.00 148.80 ?  148  ARG B CD    1 
ATOM   5530  N  NE    . ARG B 2 151  ? 203.957 128.332 163.066 1.00 150.68 ?  148  ARG B NE    1 
ATOM   5531  C  CZ    . ARG B 2 151  ? 203.489 127.757 161.962 1.00 154.32 ?  148  ARG B CZ    1 
ATOM   5532  N  NH1   . ARG B 2 151  ? 203.988 128.086 160.779 1.00 158.55 ?  148  ARG B NH1   1 
ATOM   5533  N  NH2   . ARG B 2 151  ? 202.524 126.849 162.039 1.00 152.00 ?  148  ARG B NH2   1 
ATOM   5534  N  N     . GLY B 2 152  ? 200.267 132.701 164.129 1.00 141.29 ?  149  GLY B N     1 
ATOM   5535  C  CA    . GLY B 2 152  ? 198.982 132.797 164.797 1.00 133.85 ?  149  GLY B CA    1 
ATOM   5536  C  C     . GLY B 2 152  ? 198.091 133.601 163.877 1.00 129.10 ?  149  GLY B C     1 
ATOM   5537  O  O     . GLY B 2 152  ? 197.045 134.112 164.279 1.00 124.40 ?  149  GLY B O     1 
ATOM   5538  N  N     . LYS B 2 153  ? 198.524 133.690 162.621 1.00 133.43 ?  150  LYS B N     1 
ATOM   5539  C  CA    . LYS B 2 153  ? 197.965 134.659 161.687 1.00 132.13 ?  150  LYS B CA    1 
ATOM   5540  C  C     . LYS B 2 153  ? 196.508 134.351 161.372 1.00 119.86 ?  150  LYS B C     1 
ATOM   5541  O  O     . LYS B 2 153  ? 196.124 133.194 161.186 1.00 113.99 ?  150  LYS B O     1 
ATOM   5542  C  CB    . LYS B 2 153  ? 198.785 134.683 160.397 1.00 135.70 ?  150  LYS B CB    1 
ATOM   5543  C  CG    . LYS B 2 153  ? 198.301 135.695 159.370 1.00 127.52 ?  150  LYS B CG    1 
ATOM   5544  C  CD    . LYS B 2 153  ? 199.420 136.101 158.428 1.00 134.67 ?  150  LYS B CD    1 
ATOM   5545  C  CE    . LYS B 2 153  ? 200.574 136.726 159.191 1.00 136.15 ?  150  LYS B CE    1 
ATOM   5546  N  NZ    . LYS B 2 153  ? 201.694 137.106 158.289 1.00 136.35 ?  150  LYS B NZ    1 
ATOM   5547  N  N     . THR B 2 154  ? 195.699 135.406 161.319 1.00 116.07 ?  151  THR B N     1 
ATOM   5548  C  CA    . THR B 2 154  ? 194.282 135.307 161.000 1.00 106.29 ?  151  THR B CA    1 
ATOM   5549  C  C     . THR B 2 154  ? 194.097 135.575 159.512 1.00 98.09  ?  151  THR B C     1 
ATOM   5550  O  O     . THR B 2 154  ? 194.379 136.681 159.035 1.00 100.16 ?  151  THR B O     1 
ATOM   5551  C  CB    . THR B 2 154  ? 193.465 136.294 161.833 1.00 110.17 ?  151  THR B CB    1 
ATOM   5552  O  OG1   . THR B 2 154  ? 193.482 135.890 163.207 1.00 114.64 ?  151  THR B OG1   1 
ATOM   5553  C  CG2   . THR B 2 154  ? 192.025 136.344 161.344 1.00 105.38 ?  151  THR B CG2   1 
ATOM   5554  N  N     . ALA B 2 155  ? 193.638 134.563 158.784 1.00 92.12  ?  152  ALA B N     1 
ATOM   5555  C  CA    . ALA B 2 155  ? 193.380 134.679 157.356 1.00 88.34  ?  152  ALA B CA    1 
ATOM   5556  C  C     . ALA B 2 155  ? 191.965 134.194 157.067 1.00 86.48  ?  152  ALA B C     1 
ATOM   5557  O  O     . ALA B 2 155  ? 191.212 133.824 157.975 1.00 81.01  ?  152  ALA B O     1 
ATOM   5558  C  CB    . ALA B 2 155  ? 194.416 133.896 156.539 1.00 85.84  ?  152  ALA B CB    1 
ATOM   5559  N  N     . CYS B 2 156  ? 191.599 134.192 155.787 1.00 80.51  ?  153  CYS B N     1 
ATOM   5560  C  CA    . CYS B 2 156  ? 190.281 133.752 155.357 1.00 68.70  ?  153  CYS B CA    1 
ATOM   5561  C  C     . CYS B 2 156  ? 190.422 132.766 154.206 1.00 61.29  ?  153  CYS B C     1 
ATOM   5562  O  O     . CYS B 2 156  ? 191.212 132.986 153.288 1.00 62.35  ?  153  CYS B O     1 
ATOM   5563  C  CB    . CYS B 2 156  ? 189.422 134.947 154.929 1.00 68.14  ?  153  CYS B CB    1 
ATOM   5564  S  SG    . CYS B 2 156  ? 189.509 136.354 156.062 1.00 85.95  ?  153  CYS B SG    1 
ATOM   5565  N  N     . VAL B 2 157  ? 189.662 131.677 154.264 1.00 53.77  ?  154  VAL B N     1 
ATOM   5566  C  CA    . VAL B 2 157  ? 189.627 130.673 153.207 1.00 54.16  ?  154  VAL B CA    1 
ATOM   5567  C  C     . VAL B 2 157  ? 188.316 130.833 152.449 1.00 50.14  ?  154  VAL B C     1 
ATOM   5568  O  O     . VAL B 2 157  ? 187.250 130.998 153.059 1.00 44.03  ?  154  VAL B O     1 
ATOM   5569  C  CB    . VAL B 2 157  ? 189.789 129.249 153.770 1.00 52.30  ?  154  VAL B CB    1 
ATOM   5570  C  CG1   . VAL B 2 157  ? 188.700 128.933 154.789 1.00 51.94  ?  154  VAL B CG1   1 
ATOM   5571  C  CG2   . VAL B 2 157  ? 189.794 128.223 152.644 1.00 50.23  ?  154  VAL B CG2   1 
ATOM   5572  N  N     . LEU B 2 158  ? 188.395 130.797 151.119 1.00 49.22  ?  155  LEU B N     1 
ATOM   5573  C  CA    . LEU B 2 158  ? 187.246 131.058 150.265 1.00 37.15  ?  155  LEU B CA    1 
ATOM   5574  C  C     . LEU B 2 158  ? 187.192 130.002 149.172 1.00 32.74  ?  155  LEU B C     1 
ATOM   5575  O  O     . LEU B 2 158  ? 188.194 129.764 148.489 1.00 37.46  ?  155  LEU B O     1 
ATOM   5576  C  CB    . LEU B 2 158  ? 187.344 132.451 149.648 1.00 35.74  ?  155  LEU B CB    1 
ATOM   5577  C  CG    . LEU B 2 158  ? 186.264 132.851 148.653 1.00 30.69  ?  155  LEU B CG    1 
ATOM   5578  C  CD1   . LEU B 2 158  ? 185.759 134.211 149.075 1.00 30.29  ?  155  LEU B CD1   1 
ATOM   5579  C  CD2   . LEU B 2 158  ? 186.771 132.874 147.219 1.00 31.14  ?  155  LEU B CD2   1 
ATOM   5580  N  N     . PHE B 2 159  ? 186.028 129.379 148.998 1.00 25.57  ?  156  PHE B N     1 
ATOM   5581  C  CA    . PHE B 2 159  ? 185.952 128.281 148.043 1.00 26.78  ?  156  PHE B CA    1 
ATOM   5582  C  C     . PHE B 2 159  ? 184.522 128.101 147.553 1.00 25.19  ?  156  PHE B C     1 
ATOM   5583  O  O     . PHE B 2 159  ? 183.562 128.415 148.261 1.00 27.08  ?  156  PHE B O     1 
ATOM   5584  C  CB    . PHE B 2 159  ? 186.473 126.976 148.661 1.00 32.87  ?  156  PHE B CB    1 
ATOM   5585  C  CG    . PHE B 2 159  ? 186.110 125.746 147.880 1.00 32.09  ?  156  PHE B CG    1 
ATOM   5586  C  CD1   . PHE B 2 159  ? 186.824 125.392 146.748 1.00 34.05  ?  156  PHE B CD1   1 
ATOM   5587  C  CD2   . PHE B 2 159  ? 185.049 124.946 148.273 1.00 30.88  ?  156  PHE B CD2   1 
ATOM   5588  C  CE1   . PHE B 2 159  ? 186.491 124.262 146.026 1.00 35.44  ?  156  PHE B CE1   1 
ATOM   5589  C  CE2   . PHE B 2 159  ? 184.711 123.816 147.553 1.00 31.65  ?  156  PHE B CE2   1 
ATOM   5590  C  CZ    . PHE B 2 159  ? 185.433 123.474 146.429 1.00 34.18  ?  156  PHE B CZ    1 
ATOM   5591  N  N     . GLY B 2 160  ? 184.402 127.583 146.332 1.00 30.03  ?  157  GLY B N     1 
ATOM   5592  C  CA    . GLY B 2 160  ? 183.126 127.216 145.751 1.00 29.34  ?  157  GLY B CA    1 
ATOM   5593  C  C     . GLY B 2 160  ? 182.574 128.294 144.840 1.00 22.65  ?  157  GLY B C     1 
ATOM   5594  O  O     . GLY B 2 160  ? 183.243 129.268 144.484 1.00 21.36  ?  157  GLY B O     1 
ATOM   5595  N  N     . GLY B 2 161  ? 181.322 128.101 144.458 1.00 23.23  ?  158  GLY B N     1 
ATOM   5596  C  CA    . GLY B 2 161  ? 180.572 129.169 143.818 1.00 22.30  ?  158  GLY B CA    1 
ATOM   5597  C  C     . GLY B 2 161  ? 180.370 128.989 142.324 1.00 22.60  ?  158  GLY B C     1 
ATOM   5598  O  O     . GLY B 2 161  ? 181.256 128.514 141.601 1.00 23.88  ?  158  GLY B O     1 
ATOM   5599  N  N     . ARG B 2 162  ? 179.188 129.382 141.855 1.00 20.40  ?  159  ARG B N     1 
ATOM   5600  C  CA    . ARG B 2 162  ? 178.869 129.436 140.439 1.00 19.41  ?  159  ARG B CA    1 
ATOM   5601  C  C     . ARG B 2 162  ? 179.132 130.838 139.901 1.00 19.19  ?  159  ARG B C     1 
ATOM   5602  O  O     . ARG B 2 162  ? 179.353 131.790 140.651 1.00 17.03  ?  159  ARG B O     1 
ATOM   5603  C  CB    . ARG B 2 162  ? 177.406 129.061 140.192 1.00 16.68  ?  159  ARG B CB    1 
ATOM   5604  C  CG    . ARG B 2 162  ? 176.799 128.132 141.227 1.00 20.47  ?  159  ARG B CG    1 
ATOM   5605  C  CD    . ARG B 2 162  ? 175.278 128.109 141.122 1.00 19.87  ?  159  ARG B CD    1 
ATOM   5606  N  NE    . ARG B 2 162  ? 174.797 126.926 140.414 1.00 20.86  ?  159  ARG B NE    1 
ATOM   5607  C  CZ    . ARG B 2 162  ? 174.338 125.833 141.015 1.00 21.33  ?  159  ARG B CZ    1 
ATOM   5608  N  NH1   . ARG B 2 162  ? 174.291 125.774 142.339 1.00 24.32  ?  159  ARG B NH1   1 
ATOM   5609  N  NH2   . ARG B 2 162  ? 173.923 124.801 140.293 1.00 33.00  ?  159  ARG B NH2   1 
ATOM   5610  N  N     . SER B 2 163  ? 179.088 130.963 138.580 1.00 23.23  ?  160  SER B N     1 
ATOM   5611  C  CA    . SER B 2 163  ? 179.170 132.262 137.930 1.00 17.42  ?  160  SER B CA    1 
ATOM   5612  C  C     . SER B 2 163  ? 178.513 132.153 136.562 1.00 14.98  ?  160  SER B C     1 
ATOM   5613  O  O     . SER B 2 163  ? 178.084 131.077 136.135 1.00 15.03  ?  160  SER B O     1 
ATOM   5614  C  CB    . SER B 2 163  ? 180.619 132.743 137.813 1.00 15.96  ?  160  SER B CB    1 
ATOM   5615  O  OG    . SER B 2 163  ? 180.748 133.702 136.776 1.00 13.38  ?  160  SER B OG    1 
ATOM   5616  N  N     . TYR B 2 164  ? 178.425 133.289 135.883 1.00 16.21  ?  161  TYR B N     1 
ATOM   5617  C  CA    . TYR B 2 164  ? 178.006 133.289 134.497 1.00 17.15  ?  161  TYR B CA    1 
ATOM   5618  C  C     . TYR B 2 164  ? 179.170 132.859 133.613 1.00 21.91  ?  161  TYR B C     1 
ATOM   5619  O  O     . TYR B 2 164  ? 180.335 132.884 134.021 1.00 24.38  ?  161  TYR B O     1 
ATOM   5620  C  CB    . TYR B 2 164  ? 177.503 134.672 134.088 1.00 17.68  ?  161  TYR B CB    1 
ATOM   5621  C  CG    . TYR B 2 164  ? 176.247 135.093 134.811 1.00 13.48  ?  161  TYR B CG    1 
ATOM   5622  C  CD1   . TYR B 2 164  ? 175.022 134.525 134.495 1.00 13.70  ?  161  TYR B CD1   1 
ATOM   5623  C  CD2   . TYR B 2 164  ? 176.285 136.056 135.809 1.00 11.06  ?  161  TYR B CD2   1 
ATOM   5624  C  CE1   . TYR B 2 164  ? 173.869 134.906 135.151 1.00 13.01  ?  161  TYR B CE1   1 
ATOM   5625  C  CE2   . TYR B 2 164  ? 175.136 136.442 136.470 1.00 10.74  ?  161  TYR B CE2   1 
ATOM   5626  C  CZ    . TYR B 2 164  ? 173.932 135.864 136.138 1.00 12.51  ?  161  TYR B CZ    1 
ATOM   5627  O  OH    . TYR B 2 164  ? 172.785 136.245 136.795 1.00 10.61  ?  161  TYR B OH    1 
ATOM   5628  N  N     . MET B 2 165  ? 178.837 132.446 132.396 1.00 25.84  ?  162  MET B N     1 
ATOM   5629  C  CA    . MET B 2 165  ? 179.858 132.026 131.450 1.00 31.26  ?  162  MET B CA    1 
ATOM   5630  C  C     . MET B 2 165  ? 180.878 133.145 131.246 1.00 36.53  ?  162  MET B C     1 
ATOM   5631  O  O     . MET B 2 165  ? 180.506 134.325 131.204 1.00 38.61  ?  162  MET B O     1 
ATOM   5632  C  CB    . MET B 2 165  ? 179.215 131.650 130.116 1.00 39.25  ?  162  MET B CB    1 
ATOM   5633  C  CG    . MET B 2 165  ? 178.215 130.512 130.220 1.00 42.37  ?  162  MET B CG    1 
ATOM   5634  S  SD    . MET B 2 165  ? 177.505 130.063 128.626 1.00 74.28  ?  162  MET B SD    1 
ATOM   5635  C  CE    . MET B 2 165  ? 176.496 128.659 129.093 1.00 61.21  ?  162  MET B CE    1 
ATOM   5636  N  N     . PRO B 2 166  ? 182.165 132.816 131.145 1.00 38.14  ?  163  PRO B N     1 
ATOM   5637  C  CA    . PRO B 2 166  ? 183.166 133.846 130.887 1.00 42.08  ?  163  PRO B CA    1 
ATOM   5638  C  C     . PRO B 2 166  ? 182.865 134.563 129.581 1.00 51.91  ?  163  PRO B C     1 
ATOM   5639  O  O     . PRO B 2 166  ? 182.360 133.951 128.623 1.00 53.21  ?  163  PRO B O     1 
ATOM   5640  C  CB    . PRO B 2 166  ? 184.476 133.054 130.809 1.00 43.65  ?  163  PRO B CB    1 
ATOM   5641  C  CG    . PRO B 2 166  ? 184.210 131.836 131.649 1.00 45.35  ?  163  PRO B CG    1 
ATOM   5642  C  CD    . PRO B 2 166  ? 182.773 131.496 131.389 1.00 38.10  ?  163  PRO B CD    1 
ATOM   5643  N  N     . PRO B 2 167  ? 183.185 135.865 129.493 1.00 58.78  ?  164  PRO B N     1 
ATOM   5644  C  CA    . PRO B 2 167  ? 182.598 136.699 128.431 1.00 61.19  ?  164  PRO B CA    1 
ATOM   5645  C  C     . PRO B 2 167  ? 183.158 136.465 127.033 1.00 65.63  ?  164  PRO B C     1 
ATOM   5646  O  O     . PRO B 2 167  ? 183.507 137.423 126.335 1.00 63.21  ?  164  PRO B O     1 
ATOM   5647  C  CB    . PRO B 2 167  ? 182.900 138.125 128.908 1.00 62.92  ?  164  PRO B CB    1 
ATOM   5648  C  CG    . PRO B 2 167  ? 184.131 137.983 129.736 1.00 64.93  ?  164  PRO B CG    1 
ATOM   5649  C  CD    . PRO B 2 167  ? 184.004 136.656 130.431 1.00 58.45  ?  164  PRO B CD    1 
ATOM   5650  N  N     . THR B 2 168  ? 183.237 135.204 126.610 1.00 68.28  ?  165  THR B N     1 
ATOM   5651  C  CA    . THR B 2 168  ? 183.519 134.856 125.222 1.00 70.54  ?  165  THR B CA    1 
ATOM   5652  C  C     . THR B 2 168  ? 182.325 134.157 124.584 1.00 64.05  ?  165  THR B C     1 
ATOM   5653  O  O     . THR B 2 168  ? 181.814 134.606 123.553 1.00 62.05  ?  165  THR B O     1 
ATOM   5654  C  CB    . THR B 2 168  ? 184.764 133.960 125.121 1.00 79.68  ?  165  THR B CB    1 
ATOM   5655  O  OG1   . THR B 2 168  ? 184.414 132.613 125.465 1.00 76.40  ?  165  THR B OG1   1 
ATOM   5656  C  CG2   . THR B 2 168  ? 185.860 134.449 126.055 1.00 87.75  ?  165  THR B CG2   1 
ATOM   5657  N  N     . GLU B 2 169  ? 181.868 133.061 125.185 1.00 66.54  ?  166  GLU B N     1 
ATOM   5658  C  CA    . GLU B 2 169  ? 180.652 132.373 124.783 1.00 63.53  ?  166  GLU B CA    1 
ATOM   5659  C  C     . GLU B 2 169  ? 179.429 132.898 125.516 1.00 51.95  ?  166  GLU B C     1 
ATOM   5660  O  O     . GLU B 2 169  ? 178.354 132.294 125.425 1.00 43.92  ?  166  GLU B O     1 
ATOM   5661  C  CB    . GLU B 2 169  ? 180.795 130.870 125.028 1.00 70.45  ?  166  GLU B CB    1 
ATOM   5662  C  CG    . GLU B 2 169  ? 181.611 130.537 126.263 1.00 82.27  ?  166  GLU B CG    1 
ATOM   5663  C  CD    . GLU B 2 169  ? 181.784 129.047 126.462 1.00 118.55 ?  166  GLU B CD    1 
ATOM   5664  O  OE1   . GLU B 2 169  ? 181.119 128.270 125.745 1.00 111.73 ?  166  GLU B OE1   1 
ATOM   5665  O  OE2   . GLU B 2 169  ? 182.583 128.653 127.337 1.00 197.57 -1 166  GLU B OE2   1 
ATOM   5666  N  N     . ARG B 2 170  ? 179.572 134.000 126.248 1.00 46.36  ?  167  ARG B N     1 
ATOM   5667  C  CA    . ARG B 2 170  ? 178.454 134.601 126.965 1.00 38.41  ?  167  ARG B CA    1 
ATOM   5668  C  C     . ARG B 2 170  ? 177.504 135.178 125.929 1.00 33.34  ?  167  ARG B C     1 
ATOM   5669  O  O     . ARG B 2 170  ? 177.725 136.268 125.399 1.00 30.11  ?  167  ARG B O     1 
ATOM   5670  C  CB    . ARG B 2 170  ? 178.948 135.672 127.929 1.00 40.51  ?  167  ARG B CB    1 
ATOM   5671  C  CG    . ARG B 2 170  ? 177.843 136.355 128.721 1.00 34.74  ?  167  ARG B CG    1 
ATOM   5672  C  CD    . ARG B 2 170  ? 178.189 136.398 130.203 1.00 33.24  ?  167  ARG B CD    1 
ATOM   5673  N  NE    . ARG B 2 170  ? 177.438 137.417 130.936 1.00 28.21  ?  167  ARG B NE    1 
ATOM   5674  C  CZ    . ARG B 2 170  ? 176.199 137.254 131.391 1.00 23.86  ?  167  ARG B CZ    1 
ATOM   5675  N  NH1   . ARG B 2 170  ? 175.597 138.236 132.048 1.00 20.59  ?  167  ARG B NH1   1 
ATOM   5676  N  NH2   . ARG B 2 170  ? 175.558 136.113 131.184 1.00 20.59  ?  167  ARG B NH2   1 
ATOM   5677  N  N     . THR B 2 171  ? 176.449 134.435 125.627 1.00 24.53  ?  168  THR B N     1 
ATOM   5678  C  CA    . THR B 2 171  ? 175.547 134.754 124.536 1.00 19.06  ?  168  THR B CA    1 
ATOM   5679  C  C     . THR B 2 171  ? 174.184 135.132 125.091 1.00 17.14  ?  168  THR B C     1 
ATOM   5680  O  O     . THR B 2 171  ? 173.793 134.691 126.175 1.00 19.02  ?  168  THR B O     1 
ATOM   5681  C  CB    . THR B 2 171  ? 175.408 133.565 123.584 1.00 21.86  ?  168  THR B CB    1 
ATOM   5682  O  OG1   . THR B 2 171  ? 175.405 132.350 124.345 1.00 22.65  ?  168  THR B OG1   1 
ATOM   5683  C  CG2   . THR B 2 171  ? 176.569 133.534 122.607 1.00 30.94  ?  168  THR B CG2   1 
ATOM   5684  N  N     . THR B 2 172  ? 173.448 135.930 124.327 1.00 12.61  ?  169  THR B N     1 
ATOM   5685  C  CA    . THR B 2 172  ? 172.149 136.401 124.781 1.00 12.97  ?  169  THR B CA    1 
ATOM   5686  C  C     . THR B 2 172  ? 171.047 135.366 124.584 1.00 11.02  ?  169  THR B C     1 
ATOM   5687  O  O     . THR B 2 172  ? 169.862 135.719 124.540 1.00 11.72  ?  169  THR B O     1 
ATOM   5688  C  CB    . THR B 2 172  ? 171.796 137.714 124.082 1.00 16.47  ?  169  THR B CB    1 
ATOM   5689  O  OG1   . THR B 2 172  ? 171.122 137.434 122.849 1.00 18.53  ?  169  THR B OG1   1 
ATOM   5690  C  CG2   . THR B 2 172  ? 173.062 138.508 123.801 1.00 21.16  ?  169  THR B CG2   1 
ATOM   5691  N  N     . GLN B 2 173  ? 171.430 134.100 124.437 1.00 12.53  ?  170  GLN B N     1 
ATOM   5692  C  CA    . GLN B 2 173  ? 170.543 132.973 124.659 1.00 11.24  ?  170  GLN B CA    1 
ATOM   5693  C  C     . GLN B 2 173  ? 171.026 132.089 125.800 1.00 11.55  ?  170  GLN B C     1 
ATOM   5694  O  O     . GLN B 2 173  ? 170.291 131.188 126.221 1.00 11.26  ?  170  GLN B O     1 
ATOM   5695  C  CB    . GLN B 2 173  ? 170.399 132.148 123.372 1.00 9.32   ?  170  GLN B CB    1 
ATOM   5696  C  CG    . GLN B 2 173  ? 170.457 133.009 122.113 1.00 11.48  ?  170  GLN B CG    1 
ATOM   5697  C  CD    . GLN B 2 173  ? 170.349 132.204 120.832 1.00 15.72  ?  170  GLN B CD    1 
ATOM   5698  O  OE1   . GLN B 2 173  ? 170.423 132.752 119.731 1.00 15.15  ?  170  GLN B OE1   1 
ATOM   5699  N  NE2   . GLN B 2 173  ? 170.172 130.895 120.970 1.00 15.47  ?  170  GLN B NE2   1 
ATOM   5700  N  N     . ASN B 2 174  ? 172.235 132.334 126.312 1.00 14.75  ?  171  ASN B N     1 
ATOM   5701  C  CA    . ASN B 2 174  ? 172.770 131.678 127.499 1.00 16.21  ?  171  ASN B CA    1 
ATOM   5702  C  C     . ASN B 2 174  ? 173.092 132.670 128.610 1.00 15.39  ?  171  ASN B C     1 
ATOM   5703  O  O     . ASN B 2 174  ? 173.725 132.288 129.603 1.00 16.60  ?  171  ASN B O     1 
ATOM   5704  C  CB    . ASN B 2 174  ? 174.032 130.886 127.145 1.00 19.03  ?  171  ASN B CB    1 
ATOM   5705  C  CG    . ASN B 2 174  ? 173.752 129.733 126.213 1.00 21.14  ?  171  ASN B CG    1 
ATOM   5706  O  OD1   . ASN B 2 174  ? 172.640 129.209 126.178 1.00 18.56  ?  171  ASN B OD1   1 
ATOM   5707  N  ND2   . ASN B 2 174  ? 174.760 129.330 125.448 1.00 23.72  ?  171  ASN B ND2   1 
ATOM   5708  N  N     . TRP B 2 175  ? 172.668 133.931 128.473 1.00 13.52  ?  172  TRP B N     1 
ATOM   5709  C  CA    . TRP B 2 175  ? 173.072 135.019 129.360 1.00 13.51  ?  172  TRP B CA    1 
ATOM   5710  C  C     . TRP B 2 175  ? 172.594 134.827 130.793 1.00 16.64  ?  172  TRP B C     1 
ATOM   5711  O  O     . TRP B 2 175  ? 172.924 135.652 131.656 1.00 15.24  ?  172  TRP B O     1 
ATOM   5712  C  CB    . TRP B 2 175  ? 172.550 136.347 128.812 1.00 14.93  ?  172  TRP B CB    1 
ATOM   5713  C  CG    . TRP B 2 175  ? 173.414 137.522 129.121 1.00 12.74  ?  172  TRP B CG    1 
ATOM   5714  C  CD1   . TRP B 2 175  ? 174.660 137.781 128.629 1.00 18.35  ?  172  TRP B CD1   1 
ATOM   5715  C  CD2   . TRP B 2 175  ? 173.104 138.589 130.013 1.00 9.66   ?  172  TRP B CD2   1 
ATOM   5716  N  NE1   . TRP B 2 175  ? 175.137 138.960 129.151 1.00 18.11  ?  172  TRP B NE1   1 
ATOM   5717  C  CE2   . TRP B 2 175  ? 174.199 139.473 130.007 1.00 24.36  ?  172  TRP B CE2   1 
ATOM   5718  C  CE3   . TRP B 2 175  ? 172.001 138.886 130.813 1.00 10.22  ?  172  TRP B CE3   1 
ATOM   5719  C  CZ2   . TRP B 2 175  ? 174.224 140.631 130.773 1.00 12.18  ?  172  TRP B CZ2   1 
ATOM   5720  C  CZ3   . TRP B 2 175  ? 172.026 140.033 131.569 1.00 15.90  ?  172  TRP B CZ3   1 
ATOM   5721  C  CH2   . TRP B 2 175  ? 173.129 140.894 131.545 1.00 16.70  ?  172  TRP B CH2   1 
ATOM   5722  N  N     . ASN B 2 176  ? 171.826 133.771 131.058 1.00 18.08  ?  173  ASN B N     1 
ATOM   5723  C  CA    . ASN B 2 176  ? 171.392 133.423 132.403 1.00 17.62  ?  173  ASN B CA    1 
ATOM   5724  C  C     . ASN B 2 176  ? 171.773 131.997 132.784 1.00 18.30  ?  173  ASN B C     1 
ATOM   5725  O  O     . ASN B 2 176  ? 171.359 131.520 133.847 1.00 18.97  ?  173  ASN B O     1 
ATOM   5726  C  CB    . ASN B 2 176  ? 169.880 133.622 132.545 1.00 16.72  ?  173  ASN B CB    1 
ATOM   5727  C  CG    . ASN B 2 176  ? 169.467 135.072 132.371 1.00 15.35  ?  173  ASN B CG    1 
ATOM   5728  O  OD1   . ASN B 2 176  ? 169.407 135.585 131.253 1.00 15.98  ?  173  ASN B OD1   1 
ATOM   5729  N  ND2   . ASN B 2 176  ? 169.180 135.740 133.483 1.00 14.75  ?  173  ASN B ND2   1 
ATOM   5730  N  N     . SER B 2 177  ? 172.540 131.303 131.948 1.00 17.08  ?  174  SER B N     1 
ATOM   5731  C  CA    . SER B 2 177  ? 173.096 130.018 132.339 1.00 17.00  ?  174  SER B CA    1 
ATOM   5732  C  C     . SER B 2 177  ? 174.290 130.239 133.258 1.00 16.58  ?  174  SER B C     1 
ATOM   5733  O  O     . SER B 2 177  ? 174.939 131.290 133.227 1.00 16.48  ?  174  SER B O     1 
ATOM   5734  C  CB    . SER B 2 177  ? 173.510 129.210 131.108 1.00 17.48  ?  174  SER B CB    1 
ATOM   5735  O  OG    . SER B 2 177  ? 174.214 128.035 131.474 1.00 19.62  ?  174  SER B OG    1 
ATOM   5736  N  N     . VAL B 2 178  ? 174.566 129.246 134.104 1.00 13.79  ?  175  VAL B N     1 
ATOM   5737  C  CA    . VAL B 2 178  ? 175.654 129.360 135.062 1.00 13.11  ?  175  VAL B CA    1 
ATOM   5738  C  C     . VAL B 2 178  ? 176.518 128.112 134.988 1.00 15.35  ?  175  VAL B C     1 
ATOM   5739  O  O     . VAL B 2 178  ? 176.109 127.061 134.488 1.00 13.77  ?  175  VAL B O     1 
ATOM   5740  C  CB    . VAL B 2 178  ? 175.166 129.573 136.515 1.00 15.95  ?  175  VAL B CB    1 
ATOM   5741  C  CG1   . VAL B 2 178  ? 174.019 130.573 136.562 1.00 18.46  ?  175  VAL B CG1   1 
ATOM   5742  C  CG2   . VAL B 2 178  ? 174.797 128.243 137.170 1.00 16.34  ?  175  VAL B CG2   1 
ATOM   5743  N  N     . VAL B 2 179  ? 177.736 128.256 135.500 1.00 21.22  ?  176  VAL B N     1 
ATOM   5744  C  CA    . VAL B 2 179  ? 178.695 127.165 135.567 1.00 23.28  ?  176  VAL B CA    1 
ATOM   5745  C  C     . VAL B 2 179  ? 179.547 127.391 136.805 1.00 24.36  ?  176  VAL B C     1 
ATOM   5746  O  O     . VAL B 2 179  ? 179.809 128.530 137.201 1.00 26.09  ?  176  VAL B O     1 
ATOM   5747  C  CB    . VAL B 2 179  ? 179.552 127.072 134.279 1.00 25.91  ?  176  VAL B CB    1 
ATOM   5748  C  CG1   . VAL B 2 179  ? 180.483 128.274 134.149 1.00 23.39  ?  176  VAL B CG1   1 
ATOM   5749  C  CG2   . VAL B 2 179  ? 180.333 125.767 134.245 1.00 30.25  ?  176  VAL B CG2   1 
ATOM   5750  N  N     . ASP B 2 180  ? 179.947 126.297 137.440 1.00 26.63  ?  177  ASP B N     1 
ATOM   5751  C  CA    . ASP B 2 180  ? 180.710 126.398 138.672 1.00 27.94  ?  177  ASP B CA    1 
ATOM   5752  C  C     . ASP B 2 180  ? 182.070 127.021 138.401 1.00 24.84  ?  177  ASP B C     1 
ATOM   5753  O  O     . ASP B 2 180  ? 182.701 126.758 137.372 1.00 25.16  ?  177  ASP B O     1 
ATOM   5754  C  CB    . ASP B 2 180  ? 180.867 125.018 139.301 1.00 39.53  ?  177  ASP B CB    1 
ATOM   5755  C  CG    . ASP B 2 180  ? 179.536 124.328 139.504 1.00 58.07  ?  177  ASP B CG    1 
ATOM   5756  O  OD1   . ASP B 2 180  ? 178.760 124.777 140.373 1.00 43.61  ?  177  ASP B OD1   1 
ATOM   5757  O  OD2   . ASP B 2 180  ? 179.252 123.357 138.772 1.00 152.10 -1 177  ASP B OD2   1 
ATOM   5758  N  N     . CYS B 2 181  ? 182.511 127.871 139.322 1.00 24.63  ?  178  CYS B N     1 
ATOM   5759  C  CA    . CYS B 2 181  ? 183.822 128.472 139.194 1.00 30.87  ?  178  CYS B CA    1 
ATOM   5760  C  C     . CYS B 2 181  ? 184.893 127.384 139.251 1.00 36.94  ?  178  CYS B C     1 
ATOM   5761  O  O     . CYS B 2 181  ? 184.657 126.291 139.773 1.00 38.29  ?  178  CYS B O     1 
ATOM   5762  C  CB    . CYS B 2 181  ? 184.043 129.497 140.303 1.00 30.14  ?  178  CYS B CB    1 
ATOM   5763  S  SG    . CYS B 2 181  ? 184.745 128.798 141.807 1.00 33.11  ?  178  CYS B SG    1 
ATOM   5764  N  N     . PRO B 2 182  ? 186.071 127.651 138.697 1.00 46.46  ?  179  PRO B N     1 
ATOM   5765  C  CA    . PRO B 2 182  ? 187.164 126.681 138.785 1.00 50.82  ?  179  PRO B CA    1 
ATOM   5766  C  C     . PRO B 2 182  ? 187.626 126.528 140.223 1.00 50.90  ?  179  PRO B C     1 
ATOM   5767  O  O     . PRO B 2 182  ? 187.879 127.527 140.913 1.00 49.13  ?  179  PRO B O     1 
ATOM   5768  C  CB    . PRO B 2 182  ? 188.259 127.300 137.902 1.00 53.82  ?  179  PRO B CB    1 
ATOM   5769  C  CG    . PRO B 2 182  ? 187.539 128.257 137.008 1.00 56.48  ?  179  PRO B CG    1 
ATOM   5770  C  CD    . PRO B 2 182  ? 186.408 128.790 137.826 1.00 49.12  ?  179  PRO B CD    1 
ATOM   5771  N  N     . PRO B 2 183  ? 187.744 125.292 140.717 1.00 44.07  ?  180  PRO B N     1 
ATOM   5772  C  CA    . PRO B 2 183  ? 188.069 125.096 142.138 1.00 42.95  ?  180  PRO B CA    1 
ATOM   5773  C  C     . PRO B 2 183  ? 189.513 125.421 142.498 1.00 44.33  ?  180  PRO B C     1 
ATOM   5774  O  O     . PRO B 2 183  ? 190.320 124.515 142.724 1.00 49.34  ?  180  PRO B O     1 
ATOM   5775  C  CB    . PRO B 2 183  ? 187.760 123.610 142.360 1.00 47.15  ?  180  PRO B CB    1 
ATOM   5776  C  CG    . PRO B 2 183  ? 187.933 122.989 141.018 1.00 45.66  ?  180  PRO B CG    1 
ATOM   5777  C  CD    . PRO B 2 183  ? 187.460 124.018 140.032 1.00 39.18  ?  180  PRO B CD    1 
ATOM   5778  N  N     . GLN B 2 184  ? 189.849 126.709 142.554 1.00 44.39  ?  181  GLN B N     1 
ATOM   5779  C  CA    . GLN B 2 184  ? 191.103 127.184 143.139 1.00 45.14  ?  181  GLN B CA    1 
ATOM   5780  C  C     . GLN B 2 184  ? 190.739 127.937 144.410 1.00 48.69  ?  181  GLN B C     1 
ATOM   5781  O  O     . GLN B 2 184  ? 190.314 129.095 144.348 1.00 51.07  ?  181  GLN B O     1 
ATOM   5782  C  CB    . GLN B 2 184  ? 191.884 128.082 142.181 1.00 43.39  ?  181  GLN B CB    1 
ATOM   5783  C  CG    . GLN B 2 184  ? 192.603 127.355 141.065 1.00 47.37  ?  181  GLN B CG    1 
ATOM   5784  C  CD    . GLN B 2 184  ? 191.679 127.024 139.924 1.00 46.76  ?  181  GLN B CD    1 
ATOM   5785  O  OE1   . GLN B 2 184  ? 190.474 127.228 140.020 1.00 44.38  ?  181  GLN B OE1   1 
ATOM   5786  N  NE2   . GLN B 2 184  ? 192.234 126.504 138.836 1.00 50.84  ?  181  GLN B NE2   1 
ATOM   5787  N  N     . VAL B 2 185  ? 190.893 127.275 145.560 1.00 50.32  ?  182  VAL B N     1 
ATOM   5788  C  CA    . VAL B 2 185  ? 190.628 127.941 146.828 1.00 48.99  ?  182  VAL B CA    1 
ATOM   5789  C  C     . VAL B 2 185  ? 191.471 129.202 146.924 1.00 53.46  ?  182  VAL B C     1 
ATOM   5790  O  O     . VAL B 2 185  ? 192.614 129.256 146.450 1.00 59.52  ?  182  VAL B O     1 
ATOM   5791  C  CB    . VAL B 2 185  ? 190.900 127.007 148.020 1.00 50.99  ?  182  VAL B CB    1 
ATOM   5792  C  CG1   . VAL B 2 185  ? 190.009 125.786 147.954 1.00 47.85  ?  182  VAL B CG1   1 
ATOM   5793  C  CG2   . VAL B 2 185  ? 192.366 126.599 148.066 1.00 69.86  ?  182  VAL B CG2   1 
ATOM   5794  N  N     . TYR B 2 186  ? 190.893 130.237 147.518 1.00 52.09  ?  183  TYR B N     1 
ATOM   5795  C  CA    . TYR B 2 186  ? 191.582 131.497 147.723 1.00 58.39  ?  183  TYR B CA    1 
ATOM   5796  C  C     . TYR B 2 186  ? 191.858 131.696 149.205 1.00 60.04  ?  183  TYR B C     1 
ATOM   5797  O  O     . TYR B 2 186  ? 191.088 131.256 150.066 1.00 58.42  ?  183  TYR B O     1 
ATOM   5798  C  CB    . TYR B 2 186  ? 190.762 132.678 147.191 1.00 61.34  ?  183  TYR B CB    1 
ATOM   5799  C  CG    . TYR B 2 186  ? 190.682 132.772 145.681 1.00 61.65  ?  183  TYR B CG    1 
ATOM   5800  C  CD1   . TYR B 2 186  ? 191.827 132.925 144.910 1.00 64.98  ?  183  TYR B CD1   1 
ATOM   5801  C  CD2   . TYR B 2 186  ? 189.457 132.722 145.030 1.00 52.77  ?  183  TYR B CD2   1 
ATOM   5802  C  CE1   . TYR B 2 186  ? 191.750 133.017 143.530 1.00 60.92  ?  183  TYR B CE1   1 
ATOM   5803  C  CE2   . TYR B 2 186  ? 189.372 132.812 143.654 1.00 45.12  ?  183  TYR B CE2   1 
ATOM   5804  C  CZ    . TYR B 2 186  ? 190.521 132.961 142.909 1.00 50.07  ?  183  TYR B CZ    1 
ATOM   5805  O  OH    . TYR B 2 186  ? 190.438 133.051 141.539 1.00 47.51  ?  183  TYR B OH    1 
ATOM   5806  N  N     . LEU B 2 187  ? 192.971 132.362 149.491 1.00 68.26  ?  184  LEU B N     1 
ATOM   5807  C  CA    . LEU B 2 187  ? 193.296 132.813 150.835 1.00 69.36  ?  184  LEU B CA    1 
ATOM   5808  C  C     . LEU B 2 187  ? 193.327 134.332 150.834 1.00 72.34  ?  184  LEU B C     1 
ATOM   5809  O  O     . LEU B 2 187  ? 194.090 134.943 150.079 1.00 77.81  ?  184  LEU B O     1 
ATOM   5810  C  CB    . LEU B 2 187  ? 194.626 132.235 151.314 1.00 76.28  ?  184  LEU B CB    1 
ATOM   5811  C  CG    . LEU B 2 187  ? 194.597 130.724 151.543 1.00 76.59  ?  184  LEU B CG    1 
ATOM   5812  C  CD1   . LEU B 2 187  ? 195.844 130.271 152.282 1.00 88.27  ?  184  LEU B CD1   1 
ATOM   5813  C  CD2   . LEU B 2 187  ? 193.340 130.322 152.302 1.00 66.53  ?  184  LEU B CD2   1 
ATOM   5814  N  N     . ILE B 2 188  ? 192.489 134.928 151.668 1.00 69.60  ?  185  ILE B N     1 
ATOM   5815  C  CA    . ILE B 2 188  ? 192.352 136.370 151.783 1.00 77.15  ?  185  ILE B CA    1 
ATOM   5816  C  C     . ILE B 2 188  ? 193.035 136.785 153.077 1.00 85.14  ?  185  ILE B C     1 
ATOM   5817  O  O     . ILE B 2 188  ? 192.600 136.405 154.172 1.00 83.53  ?  185  ILE B O     1 
ATOM   5818  C  CB    . ILE B 2 188  ? 190.879 136.802 151.766 1.00 75.13  ?  185  ILE B CB    1 
ATOM   5819  C  CG1   . ILE B 2 188  ? 190.232 136.441 150.425 1.00 64.46  ?  185  ILE B CG1   1 
ATOM   5820  C  CG2   . ILE B 2 188  ? 190.755 138.290 152.038 1.00 84.31  ?  185  ILE B CG2   1 
ATOM   5821  C  CD1   . ILE B 2 188  ? 188.763 136.805 150.332 1.00 50.82  ?  185  ILE B CD1   1 
ATOM   5822  N  N     . ASP B 2 189  ? 194.131 137.526 152.954 1.00 95.21  ?  186  ASP B N     1 
ATOM   5823  C  CA    . ASP B 2 189  ? 194.704 138.213 154.099 1.00 104.03 ?  186  ASP B CA    1 
ATOM   5824  C  C     . ASP B 2 189  ? 193.913 139.493 154.319 1.00 105.66 ?  186  ASP B C     1 
ATOM   5825  O  O     . ASP B 2 189  ? 193.717 140.278 153.386 1.00 107.20 ?  186  ASP B O     1 
ATOM   5826  C  CB    . ASP B 2 189  ? 196.184 138.515 153.866 1.00 115.87 ?  186  ASP B CB    1 
ATOM   5827  C  CG    . ASP B 2 189  ? 196.861 139.112 155.086 1.00 130.53 ?  186  ASP B CG    1 
ATOM   5828  O  OD1   . ASP B 2 189  ? 196.199 139.256 156.136 1.00 123.05 ?  186  ASP B OD1   1 
ATOM   5829  O  OD2   . ASP B 2 189  ? 198.064 139.435 154.996 1.00 163.23 -1 186  ASP B OD2   1 
ATOM   5830  N  N     . LEU B 2 190  ? 193.432 139.690 155.546 1.00 106.06 ?  187  LEU B N     1 
ATOM   5831  C  CA    . LEU B 2 190  ? 192.501 140.786 155.779 1.00 103.98 ?  187  LEU B CA    1 
ATOM   5832  C  C     . LEU B 2 190  ? 193.189 142.142 155.693 1.00 107.43 ?  187  LEU B C     1 
ATOM   5833  O  O     . LEU B 2 190  ? 192.538 143.143 155.372 1.00 106.99 ?  187  LEU B O     1 
ATOM   5834  C  CB    . LEU B 2 190  ? 191.809 140.613 157.129 1.00 109.43 ?  187  LEU B CB    1 
ATOM   5835  C  CG    . LEU B 2 190  ? 190.445 141.298 157.255 1.00 104.45 ?  187  LEU B CG    1 
ATOM   5836  C  CD1   . LEU B 2 190  ? 189.665 141.213 155.948 1.00 82.60  ?  187  LEU B CD1   1 
ATOM   5837  C  CD2   . LEU B 2 190  ? 189.645 140.683 158.391 1.00 97.91  ?  187  LEU B CD2   1 
ATOM   5838  N  N     . GLU B 2 191  ? 194.493 142.201 155.961 1.00 115.71 ?  188  GLU B N     1 
ATOM   5839  C  CA    . GLU B 2 191  ? 195.219 143.460 155.816 1.00 131.74 ?  188  GLU B CA    1 
ATOM   5840  C  C     . GLU B 2 191  ? 196.696 143.145 155.621 1.00 143.55 ?  188  GLU B C     1 
ATOM   5841  O  O     . GLU B 2 191  ? 197.337 142.618 156.536 1.00 144.27 ?  188  GLU B O     1 
ATOM   5842  C  CB    . GLU B 2 191  ? 195.003 144.353 157.030 1.00 137.72 ?  188  GLU B CB    1 
ATOM   5843  C  CG    . GLU B 2 191  ? 195.549 145.752 156.843 1.00 156.67 ?  188  GLU B CG    1 
ATOM   5844  C  CD    . GLU B 2 191  ? 195.076 146.373 155.542 1.00 162.24 ?  188  GLU B CD    1 
ATOM   5845  O  OE1   . GLU B 2 191  ? 193.855 146.357 155.287 1.00 145.83 ?  188  GLU B OE1   1 
ATOM   5846  O  OE2   . GLU B 2 191  ? 195.916 146.881 154.775 1.00 204.48 -1 188  GLU B OE2   1 
ATOM   5847  N  N     . PHE B 2 192  ? 197.233 143.462 154.443 1.00 148.06 ?  189  PHE B N     1 
ATOM   5848  C  CA    . PHE B 2 192  ? 196.449 144.028 153.348 1.00 142.72 ?  189  PHE B CA    1 
ATOM   5849  C  C     . PHE B 2 192  ? 195.775 142.907 152.568 1.00 127.70 ?  189  PHE B C     1 
ATOM   5850  O  O     . PHE B 2 192  ? 195.940 141.733 152.894 1.00 124.26 ?  189  PHE B O     1 
ATOM   5851  C  CB    . PHE B 2 192  ? 197.328 144.868 152.413 1.00 147.24 ?  189  PHE B CB    1 
ATOM   5852  C  CG    . PHE B 2 192  ? 198.548 145.452 153.075 1.00 156.13 ?  189  PHE B CG    1 
ATOM   5853  C  CD1   . PHE B 2 192  ? 198.429 146.462 154.014 1.00 160.21 ?  189  PHE B CD1   1 
ATOM   5854  C  CD2   . PHE B 2 192  ? 199.815 145.000 152.748 1.00 157.48 ?  189  PHE B CD2   1 
ATOM   5855  C  CE1   . PHE B 2 192  ? 199.543 147.004 154.622 1.00 160.51 ?  189  PHE B CE1   1 
ATOM   5856  C  CE2   . PHE B 2 192  ? 200.937 145.540 153.353 1.00 158.25 ?  189  PHE B CE2   1 
ATOM   5857  C  CZ    . PHE B 2 192  ? 200.798 146.543 154.292 1.00 160.46 ?  189  PHE B CZ    1 
ATOM   5858  N  N     . GLY B 2 193  ? 195.024 143.268 151.533 1.00 114.89 ?  190  GLY B N     1 
ATOM   5859  C  CA    . GLY B 2 193  ? 194.300 142.277 150.765 1.00 102.16 ?  190  GLY B CA    1 
ATOM   5860  C  C     . GLY B 2 193  ? 195.166 141.504 149.793 1.00 97.69  ?  190  GLY B C     1 
ATOM   5861  O  O     . GLY B 2 193  ? 194.775 141.303 148.640 1.00 93.74  ?  190  GLY B O     1 
ATOM   5862  N  N     . CYS B 2 194  ? 196.337 141.051 150.245 1.00 108.48 ?  191  CYS B N     1 
ATOM   5863  C  CA    . CYS B 2 194  ? 197.228 140.274 149.392 1.00 110.56 ?  191  CYS B CA    1 
ATOM   5864  C  C     . CYS B 2 194  ? 196.683 138.863 149.219 1.00 98.98  ?  191  CYS B C     1 
ATOM   5865  O  O     . CYS B 2 194  ? 197.231 137.903 149.771 1.00 96.31  ?  191  CYS B O     1 
ATOM   5866  C  CB    . CYS B 2 194  ? 198.646 140.241 149.967 1.00 124.74 ?  191  CYS B CB    1 
ATOM   5867  S  SG    . CYS B 2 194  ? 198.760 139.811 151.720 1.00 142.80 ?  191  CYS B SG    1 
ATOM   5868  N  N     . CYS B 2 195  ? 195.600 138.738 148.457 1.00 96.09  ?  192  CYS B N     1 
ATOM   5869  C  CA    . CYS B 2 195  ? 194.978 137.441 148.241 1.00 93.88  ?  192  CYS B CA    1 
ATOM   5870  C  C     . CYS B 2 195  ? 195.939 136.501 147.525 1.00 92.75  ?  192  CYS B C     1 
ATOM   5871  O  O     . CYS B 2 195  ? 196.759 136.919 146.702 1.00 94.98  ?  192  CYS B O     1 
ATOM   5872  C  CB    . CYS B 2 195  ? 193.695 137.598 147.427 1.00 97.27  ?  192  CYS B CB    1 
ATOM   5873  S  SG    . CYS B 2 195  ? 192.604 138.921 147.993 1.00 96.59  ?  192  CYS B SG    1 
ATOM   5874  N  N     . THR B 2 196  ? 195.840 135.216 147.855 1.00 89.27  ?  193  THR B N     1 
ATOM   5875  C  CA    . THR B 2 196  ? 196.690 134.187 147.275 1.00 90.43  ?  193  THR B CA    1 
ATOM   5876  C  C     . THR B 2 196  ? 195.823 133.017 146.835 1.00 86.51  ?  193  THR B C     1 
ATOM   5877  O  O     . THR B 2 196  ? 195.023 132.504 147.624 1.00 81.10  ?  193  THR B O     1 
ATOM   5878  C  CB    . THR B 2 196  ? 197.755 133.707 148.272 1.00 91.29  ?  193  THR B CB    1 
ATOM   5879  O  OG1   . THR B 2 196  ? 197.131 132.931 149.302 1.00 91.00  ?  193  THR B OG1   1 
ATOM   5880  C  CG2   . THR B 2 196  ? 198.487 134.888 148.905 1.00 90.68  ?  193  THR B CG2   1 
ATOM   5881  N  N     . ALA B 2 197  ? 195.978 132.604 145.581 1.00 93.94  ?  194  ALA B N     1 
ATOM   5882  C  CA    . ALA B 2 197  ? 195.255 131.457 145.053 1.00 89.65  ?  194  ALA B CA    1 
ATOM   5883  C  C     . ALA B 2 197  ? 196.060 130.182 145.259 1.00 92.12  ?  194  ALA B C     1 
ATOM   5884  O  O     . ALA B 2 197  ? 197.293 130.182 145.193 1.00 94.01  ?  194  ALA B O     1 
ATOM   5885  C  CB    . ALA B 2 197  ? 194.950 131.636 143.566 1.00 88.88  ?  194  ALA B CB    1 
ATOM   5886  N  N     . HIS B 2 198  ? 195.346 129.090 145.516 1.00 83.58  ?  195  HIS B N     1 
ATOM   5887  C  CA    . HIS B 2 198  ? 195.973 127.789 145.689 1.00 81.56  ?  195  HIS B CA    1 
ATOM   5888  C  C     . HIS B 2 198  ? 195.046 126.724 145.128 1.00 77.69  ?  195  HIS B C     1 
ATOM   5889  O  O     . HIS B 2 198  ? 193.836 126.929 145.004 1.00 73.65  ?  195  HIS B O     1 
ATOM   5890  C  CB    . HIS B 2 198  ? 196.291 127.500 147.161 1.00 82.09  ?  195  HIS B CB    1 
ATOM   5891  C  CG    . HIS B 2 198  ? 196.869 128.669 147.894 1.00 91.43  ?  195  HIS B CG    1 
ATOM   5892  N  ND1   . HIS B 2 198  ? 198.129 129.162 147.635 1.00 100.12 ?  195  HIS B ND1   1 
ATOM   5893  C  CD2   . HIS B 2 198  ? 196.352 129.452 148.870 1.00 91.69  ?  195  HIS B CD2   1 
ATOM   5894  C  CE1   . HIS B 2 198  ? 198.368 130.193 148.425 1.00 100.48 ?  195  HIS B CE1   1 
ATOM   5895  N  NE2   . HIS B 2 198  ? 197.305 130.390 149.185 1.00 97.71  ?  195  HIS B NE2   1 
ATOM   5896  N  N     . THR B 2 199  ? 195.631 125.581 144.789 1.00 71.88  ?  196  THR B N     1 
ATOM   5897  C  CA    . THR B 2 199  ? 194.887 124.440 144.282 1.00 67.85  ?  196  THR B CA    1 
ATOM   5898  C  C     . THR B 2 199  ? 195.260 123.204 145.087 1.00 75.75  ?  196  THR B C     1 
ATOM   5899  O  O     . THR B 2 199  ? 196.251 123.188 145.822 1.00 80.34  ?  196  THR B O     1 
ATOM   5900  C  CB    . THR B 2 199  ? 195.162 124.201 142.791 1.00 63.62  ?  196  THR B CB    1 
ATOM   5901  O  OG1   . THR B 2 199  ? 194.674 122.907 142.415 1.00 67.16  ?  196  THR B OG1   1 
ATOM   5902  C  CG2   . THR B 2 199  ? 196.653 124.276 142.508 1.00 62.96  ?  196  THR B CG2   1 
ATOM   5903  N  N     . LEU B 2 200  ? 194.446 122.158 144.941 1.00 84.49  ?  197  LEU B N     1 
ATOM   5904  C  CA    . LEU B 2 200  ? 194.732 120.894 145.582 1.00 95.87  ?  197  LEU B CA    1 
ATOM   5905  C  C     . LEU B 2 200  ? 194.162 119.765 144.736 1.00 105.80 ?  197  LEU B C     1 
ATOM   5906  O  O     . LEU B 2 200  ? 192.978 119.822 144.368 1.00 103.27 ?  197  LEU B O     1 
ATOM   5907  C  CB    . LEU B 2 200  ? 194.161 120.827 146.994 1.00 95.59  ?  197  LEU B CB    1 
ATOM   5908  C  CG    . LEU B 2 200  ? 195.181 121.125 148.089 1.00 107.42 ?  197  LEU B CG    1 
ATOM   5909  C  CD1   . LEU B 2 200  ? 194.709 120.497 149.358 1.00 106.46 ?  197  LEU B CD1   1 
ATOM   5910  C  CD2   . LEU B 2 200  ? 196.571 120.613 147.730 1.00 111.04 ?  197  LEU B CD2   1 
ATOM   5911  N  N     . PRO B 2 201  ? 194.959 118.738 144.428 1.00 121.75 ?  198  PRO B N     1 
ATOM   5912  C  CA    . PRO B 2 201  ? 194.497 117.679 143.517 1.00 133.76 ?  198  PRO B CA    1 
ATOM   5913  C  C     . PRO B 2 201  ? 193.338 116.859 144.058 1.00 133.27 ?  198  PRO B C     1 
ATOM   5914  O  O     . PRO B 2 201  ? 192.882 115.936 143.373 1.00 138.84 ?  198  PRO B O     1 
ATOM   5915  C  CB    . PRO B 2 201  ? 195.752 116.809 143.329 1.00 136.88 ?  198  PRO B CB    1 
ATOM   5916  C  CG    . PRO B 2 201  ? 196.901 117.696 143.715 1.00 134.89 ?  198  PRO B CG    1 
ATOM   5917  C  CD    . PRO B 2 201  ? 196.371 118.569 144.805 1.00 127.71 ?  198  PRO B CD    1 
ATOM   5918  N  N     . GLU B 2 202  ? 192.850 117.157 145.258 1.00 120.43 ?  199  GLU B N     1 
ATOM   5919  C  CA    . GLU B 2 202  ? 191.621 116.561 145.752 1.00 114.33 ?  199  GLU B CA    1 
ATOM   5920  C  C     . GLU B 2 202  ? 190.404 117.416 145.446 1.00 102.55 ?  199  GLU B C     1 
ATOM   5921  O  O     . GLU B 2 202  ? 189.274 116.939 145.594 1.00 98.87  ?  199  GLU B O     1 
ATOM   5922  C  CB    . GLU B 2 202  ? 191.720 116.326 147.259 1.00 118.23 ?  199  GLU B CB    1 
ATOM   5923  C  CG    . GLU B 2 202  ? 193.028 115.696 147.681 1.00 132.82 ?  199  GLU B CG    1 
ATOM   5924  C  CD    . GLU B 2 202  ? 193.388 114.500 146.827 1.00 160.31 ?  199  GLU B CD    1 
ATOM   5925  O  OE1   . GLU B 2 202  ? 192.548 113.584 146.698 1.00 151.25 ?  199  GLU B OE1   1 
ATOM   5926  O  OE2   . GLU B 2 202  ? 194.506 114.485 146.273 1.00 206.01 -1 199  GLU B OE2   1 
ATOM   5927  N  N     . LEU B 2 203  ? 190.615 118.657 145.014 1.00 98.26  ?  200  LEU B N     1 
ATOM   5928  C  CA    . LEU B 2 203  ? 189.530 119.533 144.601 1.00 92.64  ?  200  LEU B CA    1 
ATOM   5929  C  C     . LEU B 2 203  ? 189.021 119.080 143.241 1.00 93.86  ?  200  LEU B C     1 
ATOM   5930  O  O     . LEU B 2 203  ? 189.255 119.748 142.227 1.00 88.34  ?  200  LEU B O     1 
ATOM   5931  C  CB    . LEU B 2 203  ? 190.006 120.986 144.548 1.00 88.53  ?  200  LEU B CB    1 
ATOM   5932  C  CG    . LEU B 2 203  ? 189.905 121.830 145.820 1.00 82.14  ?  200  LEU B CG    1 
ATOM   5933  C  CD1   . LEU B 2 203  ? 190.350 121.057 147.054 1.00 85.56  ?  200  LEU B CD1   1 
ATOM   5934  C  CD2   . LEU B 2 203  ? 190.735 123.090 145.658 1.00 72.66  ?  200  LEU B CD2   1 
ATOM   5935  N  N     . THR B 2 204  ? 188.341 117.931 143.217 1.00 99.37  ?  201  THR B N     1 
ATOM   5936  C  CA    . THR B 2 204  ? 187.880 117.352 141.959 1.00 104.38 ?  201  THR B CA    1 
ATOM   5937  C  C     . THR B 2 204  ? 186.976 118.319 141.205 1.00 99.24  ?  201  THR B C     1 
ATOM   5938  O  O     . THR B 2 204  ? 187.200 118.606 140.024 1.00 97.09  ?  201  THR B O     1 
ATOM   5939  C  CB    . THR B 2 204  ? 187.153 116.033 142.230 1.00 105.04 ?  201  THR B CB    1 
ATOM   5940  O  OG1   . THR B 2 204  ? 187.772 115.362 143.337 1.00 97.85  ?  201  THR B OG1   1 
ATOM   5941  C  CG2   . THR B 2 204  ? 187.199 115.130 141.005 1.00 108.12 ?  201  THR B CG2   1 
ATOM   5942  N  N     . ASP B 2 205  ? 185.956 118.844 141.878 1.00 96.17  ?  202  ASP B N     1 
ATOM   5943  C  CA    . ASP B 2 205  ? 185.000 119.730 141.233 1.00 89.02  ?  202  ASP B CA    1 
ATOM   5944  C  C     . ASP B 2 205  ? 184.522 120.763 142.241 1.00 82.34  ?  202  ASP B C     1 
ATOM   5945  O  O     . ASP B 2 205  ? 184.221 120.428 143.390 1.00 77.51  ?  202  ASP B O     1 
ATOM   5946  C  CB    . ASP B 2 205  ? 183.812 118.941 140.670 1.00 90.98  ?  202  ASP B CB    1 
ATOM   5947  C  CG    . ASP B 2 205  ? 182.773 119.830 140.012 1.00 99.06  ?  202  ASP B CG    1 
ATOM   5948  O  OD1   . ASP B 2 205  ? 183.056 121.022 139.768 1.00 91.93  ?  202  ASP B OD1   1 
ATOM   5949  O  OD2   . ASP B 2 205  ? 181.663 119.328 139.741 1.00 149.76 -1 202  ASP B OD2   1 
ATOM   5950  N  N     . GLY B 2 206  ? 184.456 122.015 141.799 1.00 72.89  ?  203  GLY B N     1 
ATOM   5951  C  CA    . GLY B 2 206  ? 183.915 123.065 142.644 1.00 60.94  ?  203  GLY B CA    1 
ATOM   5952  C  C     . GLY B 2 206  ? 182.408 122.935 142.752 1.00 57.27  ?  203  GLY B C     1 
ATOM   5953  O  O     . GLY B 2 206  ? 181.701 122.851 141.741 1.00 60.48  ?  203  GLY B O     1 
ATOM   5954  N  N     . GLN B 2 207  ? 181.910 122.906 143.981 1.00 44.46  ?  204  GLN B N     1 
ATOM   5955  C  CA    . GLN B 2 207  ? 180.491 122.763 144.243 1.00 38.99  ?  204  GLN B CA    1 
ATOM   5956  C  C     . GLN B 2 207  ? 179.906 124.108 144.663 1.00 35.03  ?  204  GLN B C     1 
ATOM   5957  O  O     . GLN B 2 207  ? 180.588 125.136 144.678 1.00 32.80  ?  204  GLN B O     1 
ATOM   5958  C  CB    . GLN B 2 207  ? 180.259 121.679 145.296 1.00 41.27  ?  204  GLN B CB    1 
ATOM   5959  C  CG    . GLN B 2 207  ? 181.335 121.622 146.365 1.00 43.27  ?  204  GLN B CG    1 
ATOM   5960  C  CD    . GLN B 2 207  ? 181.014 120.620 147.452 1.00 47.71  ?  204  GLN B CD    1 
ATOM   5961  O  OE1   . GLN B 2 207  ? 179.952 120.675 148.068 1.00 45.97  ?  204  GLN B OE1   1 
ATOM   5962  N  NE2   . GLN B 2 207  ? 181.933 119.691 147.692 1.00 56.03  ?  204  GLN B NE2   1 
ATOM   5963  N  N     . SER B 2 208  ? 178.621 124.098 145.005 1.00 34.27  ?  205  SER B N     1 
ATOM   5964  C  CA    . SER B 2 208  ? 177.899 125.322 145.310 1.00 30.74  ?  205  SER B CA    1 
ATOM   5965  C  C     . SER B 2 208  ? 176.985 125.096 146.505 1.00 28.63  ?  205  SER B C     1 
ATOM   5966  O  O     . SER B 2 208  ? 176.537 123.974 146.762 1.00 31.97  ?  205  SER B O     1 
ATOM   5967  C  CB    . SER B 2 208  ? 177.080 125.798 144.103 1.00 28.52  ?  205  SER B CB    1 
ATOM   5968  O  OG    . SER B 2 208  ? 177.812 125.627 142.901 1.00 28.96  ?  205  SER B OG    1 
ATOM   5969  N  N     . PHE B 2 209  ? 176.724 126.182 147.239 1.00 25.06  ?  206  PHE B N     1 
ATOM   5970  C  CA    . PHE B 2 209  ? 175.793 126.191 148.371 1.00 22.05  ?  206  PHE B CA    1 
ATOM   5971  C  C     . PHE B 2 209  ? 176.228 125.244 149.488 1.00 24.66  ?  206  PHE B C     1 
ATOM   5972  O  O     . PHE B 2 209  ? 175.393 124.736 150.241 1.00 25.25  ?  206  PHE B O     1 
ATOM   5973  C  CB    . PHE B 2 209  ? 174.366 125.846 147.928 1.00 24.23  ?  206  PHE B CB    1 
ATOM   5974  C  CG    . PHE B 2 209  ? 173.681 126.937 147.152 1.00 25.77  ?  206  PHE B CG    1 
ATOM   5975  C  CD1   . PHE B 2 209  ? 174.315 128.140 146.897 1.00 22.62  ?  206  PHE B CD1   1 
ATOM   5976  C  CD2   . PHE B 2 209  ? 172.388 126.760 146.691 1.00 30.68  ?  206  PHE B CD2   1 
ATOM   5977  C  CE1   . PHE B 2 209  ? 173.676 129.136 146.186 1.00 19.92  ?  206  PHE B CE1   1 
ATOM   5978  C  CE2   . PHE B 2 209  ? 171.746 127.755 145.982 1.00 29.14  ?  206  PHE B CE2   1 
ATOM   5979  C  CZ    . PHE B 2 209  ? 172.390 128.943 145.730 1.00 27.31  ?  206  PHE B CZ    1 
ATOM   5980  N  N     . HIS B 2 210  ? 177.532 125.012 149.626 1.00 31.78  ?  207  HIS B N     1 
ATOM   5981  C  CA    . HIS B 2 210  ? 178.059 124.000 150.537 1.00 38.41  ?  207  HIS B CA    1 
ATOM   5982  C  C     . HIS B 2 210  ? 178.449 124.661 151.856 1.00 40.63  ?  207  HIS B C     1 
ATOM   5983  O  O     . HIS B 2 210  ? 179.457 125.369 151.928 1.00 40.17  ?  207  HIS B O     1 
ATOM   5984  C  CB    . HIS B 2 210  ? 179.247 123.276 149.902 1.00 42.68  ?  207  HIS B CB    1 
ATOM   5985  C  CG    . HIS B 2 210  ? 180.336 124.188 149.421 1.00 39.96  ?  207  HIS B CG    1 
ATOM   5986  N  ND1   . HIS B 2 210  ? 181.005 125.058 150.257 1.00 37.81  ?  207  HIS B ND1   1 
ATOM   5987  C  CD2   . HIS B 2 210  ? 180.864 124.373 148.188 1.00 39.23  ?  207  HIS B CD2   1 
ATOM   5988  C  CE1   . HIS B 2 210  ? 181.904 125.730 149.561 1.00 34.58  ?  207  HIS B CE1   1 
ATOM   5989  N  NE2   . HIS B 2 210  ? 181.838 125.335 148.303 1.00 35.69  ?  207  HIS B NE2   1 
ATOM   5990  N  N     . VAL B 2 211  ? 177.654 124.423 152.902 1.00 40.61  ?  208  VAL B N     1 
ATOM   5991  C  CA    . VAL B 2 211  ? 177.936 125.031 154.197 1.00 43.63  ?  208  VAL B CA    1 
ATOM   5992  C  C     . VAL B 2 211  ? 179.291 124.556 154.709 1.00 40.75  ?  208  VAL B C     1 
ATOM   5993  O  O     . VAL B 2 211  ? 179.657 123.381 154.571 1.00 42.92  ?  208  VAL B O     1 
ATOM   5994  C  CB    . VAL B 2 211  ? 176.807 124.710 155.191 1.00 45.95  ?  208  VAL B CB    1 
ATOM   5995  C  CG1   . VAL B 2 211  ? 177.068 125.376 156.535 1.00 49.11  ?  208  VAL B CG1   1 
ATOM   5996  C  CG2   . VAL B 2 211  ? 175.467 125.155 154.621 1.00 39.98  ?  208  VAL B CG2   1 
ATOM   5997  N  N     . ALA B 2 212  ? 180.050 125.480 155.295 1.00 38.59  ?  209  ALA B N     1 
ATOM   5998  C  CA    . ALA B 2 212  ? 181.400 125.224 155.774 1.00 46.35  ?  209  ALA B CA    1 
ATOM   5999  C  C     . ALA B 2 212  ? 181.464 125.397 157.286 1.00 50.93  ?  209  ALA B C     1 
ATOM   6000  O  O     . ALA B 2 212  ? 180.562 125.964 157.910 1.00 51.38  ?  209  ALA B O     1 
ATOM   6001  C  CB    . ALA B 2 212  ? 182.409 126.160 155.096 1.00 45.82  ?  209  ALA B CB    1 
ATOM   6002  N  N     . LEU B 2 213  ? 182.556 124.904 157.875 1.00 53.58  ?  210  LEU B N     1 
ATOM   6003  C  CA    . LEU B 2 213  ? 182.780 125.045 159.313 1.00 53.48  ?  210  LEU B CA    1 
ATOM   6004  C  C     . LEU B 2 213  ? 184.279 125.100 159.572 1.00 58.98  ?  210  LEU B C     1 
ATOM   6005  O  O     . LEU B 2 213  ? 184.982 124.114 159.340 1.00 63.66  ?  210  LEU B O     1 
ATOM   6006  C  CB    . LEU B 2 213  ? 182.138 123.894 160.082 1.00 50.20  ?  210  LEU B CB    1 
ATOM   6007  C  CG    . LEU B 2 213  ? 180.688 124.138 160.497 1.00 56.90  ?  210  LEU B CG    1 
ATOM   6008  C  CD1   . LEU B 2 213  ? 180.057 122.881 161.069 1.00 66.22  ?  210  LEU B CD1   1 
ATOM   6009  C  CD2   . LEU B 2 213  ? 180.626 125.282 161.494 1.00 63.51  ?  210  LEU B CD2   1 
ATOM   6010  N  N     . ALA B 2 214  ? 184.764 126.236 160.066 1.00 60.14  ?  211  ALA B N     1 
ATOM   6011  C  CA    . ALA B 2 214  ? 186.182 126.441 160.332 1.00 67.69  ?  211  ALA B CA    1 
ATOM   6012  C  C     . ALA B 2 214  ? 186.420 126.503 161.834 1.00 75.61  ?  211  ALA B C     1 
ATOM   6013  O  O     . ALA B 2 214  ? 185.680 127.182 162.555 1.00 73.35  ?  211  ALA B O     1 
ATOM   6014  C  CB    . ALA B 2 214  ? 186.683 127.724 159.666 1.00 62.28  ?  211  ALA B CB    1 
ATOM   6015  N  N     . ARG B 2 215  ? 187.454 125.802 162.301 1.00 85.18  ?  212  ARG B N     1 
ATOM   6016  C  CA    . ARG B 2 215  ? 187.827 125.817 163.709 1.00 86.84  ?  212  ARG B CA    1 
ATOM   6017  C  C     . ARG B 2 215  ? 189.311 125.513 163.826 1.00 87.77  ?  212  ARG B C     1 
ATOM   6018  O  O     . ARG B 2 215  ? 189.787 124.535 163.240 1.00 91.69  ?  212  ARG B O     1 
ATOM   6019  C  CB    . ARG B 2 215  ? 187.030 124.787 164.515 1.00 87.49  ?  212  ARG B CB    1 
ATOM   6020  C  CG    . ARG B 2 215  ? 187.844 124.176 165.643 1.00 86.66  ?  212  ARG B CG    1 
ATOM   6021  C  CD    . ARG B 2 215  ? 187.175 122.980 166.276 1.00 94.00  ?  212  ARG B CD    1 
ATOM   6022  N  NE    . ARG B 2 215  ? 188.172 122.004 166.700 1.00 107.77 ?  212  ARG B NE    1 
ATOM   6023  C  CZ    . ARG B 2 215  ? 189.104 122.241 167.617 1.00 114.27 ?  212  ARG B CZ    1 
ATOM   6024  N  NH1   . ARG B 2 215  ? 189.168 123.424 168.213 1.00 106.54 ?  212  ARG B NH1   1 
ATOM   6025  N  NH2   . ARG B 2 215  ? 189.975 121.296 167.941 1.00 129.99 ?  212  ARG B NH2   1 
ATOM   6026  N  N     . GLN B 2 216  ? 190.026 126.345 164.583 1.00 89.46  ?  213  GLN B N     1 
ATOM   6027  C  CA    . GLN B 2 216  ? 191.417 126.093 164.956 1.00 100.54 ?  213  GLN B CA    1 
ATOM   6028  C  C     . GLN B 2 216  ? 192.242 125.659 163.744 1.00 109.00 ?  213  GLN B C     1 
ATOM   6029  O  O     . GLN B 2 216  ? 192.763 124.544 163.676 1.00 114.97 ?  213  GLN B O     1 
ATOM   6030  C  CB    . GLN B 2 216  ? 191.488 125.052 166.077 1.00 105.52 ?  213  GLN B CB    1 
ATOM   6031  C  CG    . GLN B 2 216  ? 192.817 125.006 166.813 1.00 118.15 ?  213  GLN B CG    1 
ATOM   6032  C  CD    . GLN B 2 216  ? 192.941 126.092 167.863 1.00 121.56 ?  213  GLN B CD    1 
ATOM   6033  O  OE1   . GLN B 2 216  ? 191.941 126.644 168.323 1.00 118.95 ?  213  GLN B OE1   1 
ATOM   6034  N  NE2   . GLN B 2 216  ? 194.173 126.405 168.248 1.00 120.38 ?  213  GLN B NE2   1 
ATOM   6035  N  N     . ASP B 2 217  ? 192.329 126.571 162.772 1.00 109.02 ?  214  ASP B N     1 
ATOM   6036  C  CA    . ASP B 2 217  ? 193.033 126.381 161.503 1.00 116.19 ?  214  ASP B CA    1 
ATOM   6037  C  C     . ASP B 2 217  ? 192.822 124.997 160.891 1.00 111.41 ?  214  ASP B C     1 
ATOM   6038  O  O     . ASP B 2 217  ? 193.762 124.395 160.362 1.00 114.41 ?  214  ASP B O     1 
ATOM   6039  C  CB    . ASP B 2 217  ? 194.534 126.672 161.664 1.00 129.90 ?  214  ASP B CB    1 
ATOM   6040  C  CG    . ASP B 2 217  ? 195.176 125.902 162.803 1.00 142.02 ?  214  ASP B CG    1 
ATOM   6041  O  OD1   . ASP B 2 217  ? 195.419 124.687 162.646 1.00 138.96 ?  214  ASP B OD1   1 
ATOM   6042  O  OD2   . ASP B 2 217  ? 195.437 126.515 163.860 1.00 174.20 -1 214  ASP B OD2   1 
ATOM   6043  N  N     . CYS B 2 218  ? 191.589 124.494 160.953 1.00 100.71 ?  215  CYS B N     1 
ATOM   6044  C  CA    . CYS B 2 218  ? 191.178 123.302 160.221 1.00 95.80  ?  215  CYS B CA    1 
ATOM   6045  C  C     . CYS B 2 218  ? 189.717 123.476 159.839 1.00 88.94  ?  215  CYS B C     1 
ATOM   6046  O  O     . CYS B 2 218  ? 188.898 123.853 160.683 1.00 88.63  ?  215  CYS B O     1 
ATOM   6047  C  CB    . CYS B 2 218  ? 191.372 122.025 161.049 1.00 95.72  ?  215  CYS B CB    1 
ATOM   6048  S  SG    . CYS B 2 218  ? 193.030 121.303 160.954 1.00 94.58  ?  215  CYS B SG    1 
ATOM   6049  N  N     . VAL B 2 219  ? 189.390 123.220 158.574 1.00 88.18  ?  216  VAL B N     1 
ATOM   6050  C  CA    . VAL B 2 219  ? 188.063 123.522 158.060 1.00 80.90  ?  216  VAL B CA    1 
ATOM   6051  C  C     . VAL B 2 219  ? 187.446 122.256 157.483 1.00 76.35  ?  216  VAL B C     1 
ATOM   6052  O  O     . VAL B 2 219  ? 188.145 121.363 156.995 1.00 78.21  ?  216  VAL B O     1 
ATOM   6053  C  CB    . VAL B 2 219  ? 188.103 124.645 156.998 1.00 78.79  ?  216  VAL B CB    1 
ATOM   6054  C  CG1   . VAL B 2 219  ? 186.733 125.280 156.849 1.00 71.79  ?  216  VAL B CG1   1 
ATOM   6055  C  CG2   . VAL B 2 219  ? 189.142 125.698 157.365 1.00 83.89  ?  216  VAL B CG2   1 
ATOM   6056  N  N     . TYR B 2 220  ? 186.118 122.189 157.551 1.00 68.55  ?  217  TYR B N     1 
ATOM   6057  C  CA    . TYR B 2 220  ? 185.341 121.056 157.068 1.00 67.83  ?  217  TYR B CA    1 
ATOM   6058  C  C     . TYR B 2 220  ? 184.234 121.581 156.168 1.00 63.07  ?  217  TYR B C     1 
ATOM   6059  O  O     . TYR B 2 220  ? 183.422 122.412 156.595 1.00 59.44  ?  217  TYR B O     1 
ATOM   6060  C  CB    . TYR B 2 220  ? 184.750 120.252 158.232 1.00 66.44  ?  217  TYR B CB    1 
ATOM   6061  C  CG    . TYR B 2 220  ? 185.759 119.428 159.002 1.00 73.56  ?  217  TYR B CG    1 
ATOM   6062  C  CD1   . TYR B 2 220  ? 186.708 120.034 159.815 1.00 76.91  ?  217  TYR B CD1   1 
ATOM   6063  C  CD2   . TYR B 2 220  ? 185.756 118.041 158.923 1.00 73.57  ?  217  TYR B CD2   1 
ATOM   6064  C  CE1   . TYR B 2 220  ? 187.629 119.285 160.520 1.00 77.27  ?  217  TYR B CE1   1 
ATOM   6065  C  CE2   . TYR B 2 220  ? 186.673 117.283 159.626 1.00 77.47  ?  217  TYR B CE2   1 
ATOM   6066  C  CZ    . TYR B 2 220  ? 187.605 117.911 160.424 1.00 79.99  ?  217  TYR B CZ    1 
ATOM   6067  O  OH    . TYR B 2 220  ? 188.522 117.163 161.126 1.00 88.30  ?  217  TYR B OH    1 
ATOM   6068  N  N     . PHE B 2 221  ? 184.213 121.109 154.925 1.00 63.59  ?  218  PHE B N     1 
ATOM   6069  C  CA    . PHE B 2 221  ? 183.164 121.433 153.968 1.00 53.61  ?  218  PHE B CA    1 
ATOM   6070  C  C     . PHE B 2 221  ? 182.230 120.239 153.847 1.00 50.72  ?  218  PHE B C     1 
ATOM   6071  O  O     . PHE B 2 221  ? 182.677 119.117 153.574 1.00 58.46  ?  218  PHE B O     1 
ATOM   6072  C  CB    . PHE B 2 221  ? 183.740 121.781 152.593 1.00 52.35  ?  218  PHE B CB    1 
ATOM   6073  C  CG    . PHE B 2 221  ? 184.640 122.986 152.587 1.00 53.11  ?  218  PHE B CG    1 
ATOM   6074  C  CD1   . PHE B 2 221  ? 184.692 123.844 153.672 1.00 57.57  ?  218  PHE B CD1   1 
ATOM   6075  C  CD2   . PHE B 2 221  ? 185.430 123.263 151.485 1.00 50.32  ?  218  PHE B CD2   1 
ATOM   6076  C  CE1   . PHE B 2 221  ? 185.518 124.948 153.659 1.00 55.76  ?  218  PHE B CE1   1 
ATOM   6077  C  CE2   . PHE B 2 221  ? 186.256 124.369 151.467 1.00 49.82  ?  218  PHE B CE2   1 
ATOM   6078  C  CZ    . PHE B 2 221  ? 186.302 125.211 152.557 1.00 53.66  ?  218  PHE B CZ    1 
ATOM   6079  N  N     . LEU B 2 222  ? 180.941 120.484 154.050 1.00 45.89  ?  219  LEU B N     1 
ATOM   6080  C  CA    . LEU B 2 222  ? 179.951 119.423 154.001 1.00 48.95  ?  219  LEU B CA    1 
ATOM   6081  C  C     . LEU B 2 222  ? 179.429 119.274 152.576 1.00 52.40  ?  219  LEU B C     1 
ATOM   6082  O  O     . LEU B 2 222  ? 179.964 119.853 151.626 1.00 49.03  ?  219  LEU B O     1 
ATOM   6083  C  CB    . LEU B 2 222  ? 178.822 119.700 154.990 1.00 51.65  ?  219  LEU B CB    1 
ATOM   6084  C  CG    . LEU B 2 222  ? 179.188 119.666 156.474 1.00 59.10  ?  219  LEU B CG    1 
ATOM   6085  C  CD1   . LEU B 2 222  ? 177.972 119.282 157.299 1.00 66.73  ?  219  LEU B CD1   1 
ATOM   6086  C  CD2   . LEU B 2 222  ? 180.339 118.708 156.736 1.00 62.76  ?  219  LEU B CD2   1 
ATOM   6087  N  N     . GLY B 2 223  ? 178.369 118.486 152.421 1.00 60.29  ?  220  GLY B N     1 
ATOM   6088  C  CA    . GLY B 2 223  ? 177.812 118.273 151.099 1.00 62.40  ?  220  GLY B CA    1 
ATOM   6089  C  C     . GLY B 2 223  ? 177.253 119.559 150.524 1.00 55.48  ?  220  GLY B C     1 
ATOM   6090  O  O     . GLY B 2 223  ? 176.713 120.408 151.239 1.00 52.12  ?  220  GLY B O     1 
ATOM   6091  N  N     . GLY B 2 224  ? 177.410 119.701 149.223 1.00 57.85  ?  221  GLY B N     1 
ATOM   6092  C  CA    . GLY B 2 224  ? 176.843 120.797 148.477 1.00 53.43  ?  221  GLY B CA    1 
ATOM   6093  C  C     . GLY B 2 224  ? 176.137 120.307 147.237 1.00 57.22  ?  221  GLY B C     1 
ATOM   6094  O  O     . GLY B 2 224  ? 175.656 119.150 147.197 1.00 58.86  ?  221  GLY B O     1 
ATOM   6095  N  N     . HIS B 2 225  ? 176.107 121.194 146.180 1.00 50.84  ?  222  HIS B N     1 
ATOM   6096  C  CA    . HIS B 2 225  ? 175.277 120.879 144.994 1.00 53.09  ?  222  HIS B CA    1 
ATOM   6097  C  C     . HIS B 2 225  ? 176.424 120.904 143.953 1.00 50.61  ?  222  HIS B C     1 
ATOM   6098  O  O     . HIS B 2 225  ? 177.241 121.823 144.043 1.00 44.53  ?  222  HIS B O     1 
ATOM   6099  C  CB    . HIS B 2 225  ? 174.737 121.769 144.190 1.00 55.52  ?  222  HIS B CB    1 
ATOM   6100  C  CG    . HIS B 2 225  ? 173.923 121.195 143.070 1.00 56.41  ?  222  HIS B CG    1 
ATOM   6101  N  ND1   . HIS B 2 225  ? 173.345 122.173 142.260 1.00 58.32  ?  222  HIS B ND1   1 
ATOM   6102  C  CD2   . HIS B 2 225  ? 172.933 120.218 143.183 1.00 55.45  ?  222  HIS B CD2   1 
ATOM   6103  C  CE1   . HIS B 2 225  ? 172.657 121.463 141.387 1.00 54.42  ?  222  HIS B CE1   1 
ATOM   6104  N  NE2   . HIS B 2 225  ? 172.186 120.361 142.026 1.00 59.80  ?  222  HIS B NE2   1 
ATOM   6105  N  N     . ILE B 2 226  ? 176.326 120.182 142.814 1.00 51.71  ?  223  ILE B N     1 
ATOM   6106  C  CA    . ILE B 2 226  ? 177.168 120.380 141.622 1.00 49.96  ?  223  ILE B CA    1 
ATOM   6107  C  C     . ILE B 2 226  ? 176.306 120.300 140.360 1.00 58.34  ?  223  ILE B C     1 
ATOM   6108  O  O     . ILE B 2 226  ? 175.490 119.388 140.240 1.00 63.81  ?  223  ILE B O     1 
ATOM   6109  C  CB    . ILE B 2 226  ? 178.304 119.326 141.532 1.00 53.43  ?  223  ILE B CB    1 
ATOM   6110  C  CG1   . ILE B 2 226  ? 179.512 119.747 142.361 1.00 52.54  ?  223  ILE B CG1   1 
ATOM   6111  C  CG2   . ILE B 2 226  ? 178.728 119.035 140.073 1.00 62.37  ?  223  ILE B CG2   1 
ATOM   6112  C  CD1   . ILE B 2 226  ? 180.607 118.712 142.434 1.00 61.05  ?  223  ILE B CD1   1 
ATOM   6113  N  N     . LEU B 2 227  ? 176.464 121.250 139.416 1.00 60.79  ?  224  LEU B N     1 
ATOM   6114  C  CA    . LEU B 2 227  ? 175.664 121.187 138.189 1.00 64.36  ?  224  LEU B CA    1 
ATOM   6115  C  C     . LEU B 2 227  ? 176.306 120.286 137.141 1.00 66.95  ?  224  LEU B C     1 
ATOM   6116  O  O     . LEU B 2 227  ? 175.600 119.584 136.407 1.00 67.89  ?  224  LEU B O     1 
ATOM   6117  C  CB    . LEU B 2 227  ? 175.454 122.587 137.614 1.00 60.96  ?  224  LEU B CB    1 
ATOM   6118  C  CG    . LEU B 2 227  ? 174.351 122.646 136.556 1.00 59.34  ?  224  LEU B CG    1 
ATOM   6119  C  CD1   . LEU B 2 227  ? 172.981 122.503 137.204 1.00 55.75  ?  224  LEU B CD1   1 
ATOM   6120  C  CD2   . LEU B 2 227  ? 174.443 123.920 135.730 1.00 51.84  ?  224  LEU B CD2   1 
ATOM   6121  N  N     . SER B 2 228  ? 177.642 120.291 137.069 1.00 62.86  ?  225  SER B N     1 
ATOM   6122  C  CA    . SER B 2 228  ? 178.351 119.578 136.009 1.00 61.70  ?  225  SER B CA    1 
ATOM   6123  C  C     . SER B 2 228  ? 177.977 118.101 135.986 1.00 59.97  ?  225  SER B C     1 
ATOM   6124  O  O     . SER B 2 228  ? 177.381 117.611 135.020 1.00 61.97  ?  225  SER B O     1 
ATOM   6125  C  CB    . SER B 2 228  ? 179.862 119.745 136.187 1.00 64.85  ?  225  SER B CB    1 
ATOM   6126  O  OG    . SER B 2 228  ? 180.233 121.111 136.199 1.00 67.35  ?  225  SER B OG    1 
ATOM   6127  N  N     . SER B 2 229  ? 178.317 117.375 137.048 1.00 60.43  ?  226  SER B N     1 
ATOM   6128  C  CA    . SER B 2 229  ? 177.915 115.980 137.155 1.00 60.00  ?  226  SER B CA    1 
ATOM   6129  C  C     . SER B 2 229  ? 176.450 115.824 137.531 1.00 62.16  ?  226  SER B C     1 
ATOM   6130  O  O     . SER B 2 229  ? 175.929 114.703 137.476 1.00 65.26  ?  226  SER B O     1 
ATOM   6131  C  CB    . SER B 2 229  ? 178.792 115.257 138.181 1.00 63.65  ?  226  SER B CB    1 
ATOM   6132  O  OG    . SER B 2 229  ? 178.642 115.825 139.471 1.00 67.13  ?  226  SER B OG    1 
ATOM   6133  N  N     . ASP B 2 230  ? 175.780 116.917 137.901 1.00 67.31  ?  227  ASP B N     1 
ATOM   6134  C  CA    . ASP B 2 230  ? 174.395 116.914 138.365 1.00 78.06  ?  227  ASP B CA    1 
ATOM   6135  C  C     . ASP B 2 230  ? 174.188 115.979 139.554 1.00 81.99  ?  227  ASP B C     1 
ATOM   6136  O  O     . ASP B 2 230  ? 173.069 115.520 139.805 1.00 88.55  ?  227  ASP B O     1 
ATOM   6137  C  CB    . ASP B 2 230  ? 173.424 116.561 137.231 1.00 89.39  ?  227  ASP B CB    1 
ATOM   6138  C  CG    . ASP B 2 230  ? 171.997 116.993 137.528 1.00 111.55 ?  227  ASP B CG    1 
ATOM   6139  O  OD1   . ASP B 2 230  ? 171.705 118.203 137.424 1.00 103.64 ?  227  ASP B OD1   1 
ATOM   6140  O  OD2   . ASP B 2 230  ? 171.170 116.122 137.870 1.00 160.80 -1 227  ASP B OD2   1 
ATOM   6141  N  N     . CYS B 2 231  ? 175.250 115.686 140.297 1.00 81.96  ?  228  CYS B N     1 
ATOM   6142  C  CA    . CYS B 2 231  ? 175.156 114.906 141.518 1.00 78.23  ?  228  CYS B CA    1 
ATOM   6143  C  C     . CYS B 2 231  ? 175.540 115.772 142.710 1.00 70.69  ?  228  CYS B C     1 
ATOM   6144  O  O     . CYS B 2 231  ? 176.340 116.705 142.596 1.00 67.03  ?  228  CYS B O     1 
ATOM   6145  C  CB    . CYS B 2 231  ? 176.054 113.664 141.462 1.00 91.77  ?  228  CYS B CB    1 
ATOM   6146  S  SG    . CYS B 2 231  ? 177.805 113.961 141.817 1.00 109.43 ?  228  CYS B SG    1 
ATOM   6147  N  N     . ARG B 2 232  ? 174.946 115.456 143.858 1.00 61.02  ?  229  ARG B N     1 
ATOM   6148  C  CA    . ARG B 2 232  ? 175.254 116.103 145.129 1.00 54.55  ?  229  ARG B CA    1 
ATOM   6149  C  C     . ARG B 2 232  ? 176.061 115.114 145.955 1.00 58.94  ?  229  ARG B C     1 
ATOM   6150  O  O     . ARG B 2 232  ? 175.491 114.329 146.728 1.00 57.48  ?  229  ARG B O     1 
ATOM   6151  C  CB    . ARG B 2 232  ? 173.970 116.504 145.850 1.00 49.73  ?  229  ARG B CB    1 
ATOM   6152  C  CG    . ARG B 2 232  ? 172.787 115.687 145.389 1.00 52.78  ?  229  ARG B CG    1 
ATOM   6153  C  CD    . ARG B 2 232  ? 171.564 116.011 146.190 1.00 55.06  ?  229  ARG B CD    1 
ATOM   6154  N  NE    . ARG B 2 232  ? 171.188 117.408 146.021 1.00 53.95  ?  229  ARG B NE    1 
ATOM   6155  C  CZ    . ARG B 2 232  ? 170.465 117.857 145.004 1.00 59.48  ?  229  ARG B CZ    1 
ATOM   6156  N  NH1   . ARG B 2 232  ? 170.052 117.013 144.068 1.00 64.72  ?  229  ARG B NH1   1 
ATOM   6157  N  NH2   . ARG B 2 232  ? 170.163 119.144 144.919 1.00 56.72  ?  229  ARG B NH2   1 
ATOM   6158  N  N     . PRO B 2 233  ? 177.385 115.106 145.829 1.00 65.77  ?  230  PRO B N     1 
ATOM   6159  C  CA    . PRO B 2 233  ? 178.171 114.013 146.405 1.00 69.24  ?  230  PRO B CA    1 
ATOM   6160  C  C     . PRO B 2 233  ? 178.156 114.035 147.924 1.00 70.67  ?  230  PRO B C     1 
ATOM   6161  O  O     . PRO B 2 233  ? 177.989 115.081 148.557 1.00 68.20  ?  230  PRO B O     1 
ATOM   6162  C  CB    . PRO B 2 233  ? 179.578 114.271 145.857 1.00 66.55  ?  230  PRO B CB    1 
ATOM   6163  C  CG    . PRO B 2 233  ? 179.625 115.749 145.686 1.00 60.57  ?  230  PRO B CG    1 
ATOM   6164  C  CD    . PRO B 2 233  ? 178.244 116.132 145.210 1.00 64.26  ?  230  PRO B CD    1 
ATOM   6165  N  N     . SER B 2 234  ? 178.328 112.850 148.502 1.00 70.43  ?  231  SER B N     1 
ATOM   6166  C  CA    . SER B 2 234  ? 178.380 112.679 149.946 1.00 69.09  ?  231  SER B CA    1 
ATOM   6167  C  C     . SER B 2 234  ? 179.786 112.823 150.511 1.00 73.63  ?  231  SER B C     1 
ATOM   6168  O  O     . SER B 2 234  ? 179.964 112.685 151.724 1.00 77.17  ?  231  SER B O     1 
ATOM   6169  C  CB    . SER B 2 234  ? 177.817 111.307 150.335 1.00 67.20  ?  231  SER B CB    1 
ATOM   6170  O  OG    . SER B 2 234  ? 178.539 110.262 149.703 1.00 65.84  ?  231  SER B OG    1 
ATOM   6171  N  N     . ARG B 2 235  ? 180.784 113.097 149.677 1.00 75.24  ?  232  ARG B N     1 
ATOM   6172  C  CA    . ARG B 2 235  ? 182.175 113.116 150.129 1.00 73.04  ?  232  ARG B CA    1 
ATOM   6173  C  C     . ARG B 2 235  ? 182.437 114.370 150.953 1.00 63.28  ?  232  ARG B C     1 
ATOM   6174  O  O     . ARG B 2 235  ? 182.718 115.439 150.406 1.00 62.33  ?  232  ARG B O     1 
ATOM   6175  C  CB    . ARG B 2 235  ? 183.128 113.042 148.942 1.00 77.63  ?  232  ARG B CB    1 
ATOM   6176  C  CG    . ARG B 2 235  ? 182.544 113.527 147.632 1.00 77.77  ?  232  ARG B CG    1 
ATOM   6177  C  CD    . ARG B 2 235  ? 183.567 114.313 146.830 1.00 82.81  ?  232  ARG B CD    1 
ATOM   6178  N  NE    . ARG B 2 235  ? 183.701 115.685 147.310 1.00 81.17  ?  232  ARG B NE    1 
ATOM   6179  C  CZ    . ARG B 2 235  ? 184.370 116.638 146.670 1.00 86.00  ?  232  ARG B CZ    1 
ATOM   6180  N  NH1   . ARG B 2 235  ? 184.438 117.860 147.179 1.00 76.97  ?  232  ARG B NH1   1 
ATOM   6181  N  NH2   . ARG B 2 235  ? 184.977 116.368 145.522 1.00 95.90  ?  232  ARG B NH2   1 
ATOM   6182  N  N     . LEU B 2 236  ? 182.357 114.239 152.277 1.00 62.37  ?  233  LEU B N     1 
ATOM   6183  C  CA    . LEU B 2 236  ? 182.801 115.309 153.158 1.00 59.64  ?  233  LEU B CA    1 
ATOM   6184  C  C     . LEU B 2 236  ? 184.251 115.653 152.856 1.00 57.05  ?  233  LEU B C     1 
ATOM   6185  O  O     . LEU B 2 236  ? 185.057 114.781 152.518 1.00 60.24  ?  233  LEU B O     1 
ATOM   6186  C  CB    . LEU B 2 236  ? 182.655 114.897 154.626 1.00 68.70  ?  233  LEU B CB    1 
ATOM   6187  C  CG    . LEU B 2 236  ? 183.046 115.873 155.747 1.00 71.58  ?  233  LEU B CG    1 
ATOM   6188  C  CD1   . LEU B 2 236  ? 182.200 115.632 156.987 1.00 70.42  ?  233  LEU B CD1   1 
ATOM   6189  C  CD2   . LEU B 2 236  ? 184.524 115.766 156.112 1.00 73.55  ?  233  LEU B CD2   1 
ATOM   6190  N  N     . ILE B 2 237  ? 184.586 116.931 152.975 1.00 58.93  ?  234  ILE B N     1 
ATOM   6191  C  CA    . ILE B 2 237  ? 185.943 117.390 152.723 1.00 60.07  ?  234  ILE B CA    1 
ATOM   6192  C  C     . ILE B 2 237  ? 186.485 118.020 153.993 1.00 65.16  ?  234  ILE B C     1 
ATOM   6193  O  O     . ILE B 2 237  ? 185.747 118.681 154.731 1.00 69.48  ?  234  ILE B O     1 
ATOM   6194  C  CB    . ILE B 2 237  ? 185.995 118.390 151.551 1.00 62.42  ?  234  ILE B CB    1 
ATOM   6195  C  CG1   . ILE B 2 237  ? 185.216 117.841 150.355 1.00 70.00  ?  234  ILE B CG1   1 
ATOM   6196  C  CG2   . ILE B 2 237  ? 187.436 118.689 151.167 1.00 63.23  ?  234  ILE B CG2   1 
ATOM   6197  C  CD1   . ILE B 2 237  ? 185.731 116.516 149.852 1.00 73.11  ?  234  ILE B CD1   1 
ATOM   6198  N  N     . ARG B 2 238  ? 187.773 117.816 154.248 1.00 71.67  ?  235  ARG B N     1 
ATOM   6199  C  CA    . ARG B 2 238  ? 188.477 118.550 155.282 1.00 80.57  ?  235  ARG B CA    1 
ATOM   6200  C  C     . ARG B 2 238  ? 189.710 119.167 154.645 1.00 83.80  ?  235  ARG B C     1 
ATOM   6201  O  O     . ARG B 2 238  ? 190.260 118.620 153.688 1.00 83.99  ?  235  ARG B O     1 
ATOM   6202  C  CB    . ARG B 2 238  ? 188.865 117.633 156.454 1.00 89.02  ?  235  ARG B CB    1 
ATOM   6203  C  CG    . ARG B 2 238  ? 189.605 118.324 157.591 1.00 94.10  ?  235  ARG B CG    1 
ATOM   6204  C  CD    . ARG B 2 238  ? 190.295 117.315 158.499 1.00 95.56  ?  235  ARG B CD    1 
ATOM   6205  N  NE    . ARG B 2 238  ? 191.072 117.969 159.549 1.00 93.44  ?  235  ARG B NE    1 
ATOM   6206  C  CZ    . ARG B 2 238  ? 192.384 118.174 159.492 1.00 93.06  ?  235  ARG B CZ    1 
ATOM   6207  N  NH1   . ARG B 2 238  ? 193.006 118.780 160.493 1.00 92.36  ?  235  ARG B NH1   1 
ATOM   6208  N  NH2   . ARG B 2 238  ? 193.075 117.767 158.436 1.00 93.18  ?  235  ARG B NH2   1 
ATOM   6209  N  N     . LEU B 2 239  ? 190.128 120.320 155.158 1.00 83.70  ?  236  LEU B N     1 
ATOM   6210  C  CA    . LEU B 2 239  ? 191.361 120.933 154.688 1.00 84.73  ?  236  LEU B CA    1 
ATOM   6211  C  C     . LEU B 2 239  ? 192.044 121.669 155.831 1.00 91.51  ?  236  LEU B C     1 
ATOM   6212  O  O     . LEU B 2 239  ? 191.388 122.294 156.670 1.00 92.06  ?  236  LEU B O     1 
ATOM   6213  C  CB    . LEU B 2 239  ? 191.111 121.879 153.507 1.00 74.92  ?  236  LEU B CB    1 
ATOM   6214  C  CG    . LEU B 2 239  ? 190.260 123.126 153.726 1.00 72.78  ?  236  LEU B CG    1 
ATOM   6215  C  CD1   . LEU B 2 239  ? 191.135 124.345 153.908 1.00 78.48  ?  236  LEU B CD1   1 
ATOM   6216  C  CD2   . LEU B 2 239  ? 189.335 123.310 152.546 1.00 66.35  ?  236  LEU B CD2   1 
ATOM   6217  N  N     . HIS B 2 240  ? 193.370 121.590 155.844 1.00 97.61  ?  237  HIS B N     1 
ATOM   6218  C  CA    . HIS B 2 240  ? 194.199 122.146 156.903 1.00 105.61 ?  237  HIS B CA    1 
ATOM   6219  C  C     . HIS B 2 240  ? 195.195 123.114 156.282 1.00 113.19 ?  237  HIS B C     1 
ATOM   6220  O  O     . HIS B 2 240  ? 195.979 122.732 155.402 1.00 115.28 ?  237  HIS B O     1 
ATOM   6221  C  CB    . HIS B 2 240  ? 194.910 121.030 157.668 1.00 104.13 ?  237  HIS B CB    1 
ATOM   6222  C  CG    . HIS B 2 240  ? 195.790 121.519 158.774 1.00 107.76 ?  237  HIS B CG    1 
ATOM   6223  N  ND1   . HIS B 2 240  ? 195.558 122.702 159.442 1.00 113.38 ?  237  HIS B ND1   1 
ATOM   6224  C  CD2   . HIS B 2 240  ? 196.897 120.979 159.336 1.00 114.78 ?  237  HIS B CD2   1 
ATOM   6225  C  CE1   . HIS B 2 240  ? 196.489 122.873 160.364 1.00 120.72 ?  237  HIS B CE1   1 
ATOM   6226  N  NE2   . HIS B 2 240  ? 197.313 121.842 160.321 1.00 121.19 ?  237  HIS B NE2   1 
ATOM   6227  N  N     . VAL B 2 241  ? 195.151 124.367 156.732 1.00 116.74 ?  238  VAL B N     1 
ATOM   6228  C  CA    . VAL B 2 241  ? 195.994 125.433 156.207 1.00 121.78 ?  238  VAL B CA    1 
ATOM   6229  C  C     . VAL B 2 241  ? 196.942 125.872 157.311 1.00 125.61 ?  238  VAL B C     1 
ATOM   6230  O  O     . VAL B 2 241  ? 196.628 125.768 158.502 1.00 124.85 ?  238  VAL B O     1 
ATOM   6231  C  CB    . VAL B 2 241  ? 195.169 126.637 155.704 1.00 114.33 ?  238  VAL B CB    1 
ATOM   6232  C  CG1   . VAL B 2 241  ? 193.957 126.168 154.924 1.00 110.84 ?  238  VAL B CG1   1 
ATOM   6233  C  CG2   . VAL B 2 241  ? 194.772 127.545 156.858 1.00 105.89 ?  238  VAL B CG2   1 
ATOM   6234  N  N     . GLU B 2 242  ? 198.129 126.328 156.913 1.00 131.59 ?  239  GLU B N     1 
ATOM   6235  C  CA    . GLU B 2 242  ? 199.123 126.752 157.888 1.00 137.09 ?  239  GLU B CA    1 
ATOM   6236  C  C     . GLU B 2 242  ? 200.021 127.800 157.241 1.00 138.87 ?  239  GLU B C     1 
ATOM   6237  O  O     . GLU B 2 242  ? 200.607 127.554 156.180 1.00 142.33 ?  239  GLU B O     1 
ATOM   6238  C  CB    . GLU B 2 242  ? 199.964 125.565 158.398 1.00 147.17 ?  239  GLU B CB    1 
ATOM   6239  C  CG    . GLU B 2 242  ? 200.424 124.550 157.332 1.00 163.13 ?  239  GLU B CG    1 
ATOM   6240  C  CD    . GLU B 2 242  ? 199.351 123.603 156.797 1.00 157.15 ?  239  GLU B CD    1 
ATOM   6241  O  OE1   . GLU B 2 242  ? 198.246 123.529 157.365 1.00 139.35 ?  239  GLU B OE1   1 
ATOM   6242  O  OE2   . GLU B 2 242  ? 199.599 122.968 155.751 1.00 206.78 -1 239  GLU B OE2   1 
ATOM   6243  N  N     . LEU B 2 243  ? 200.127 128.966 157.882 1.00 144.73 ?  240  LEU B N     1 
ATOM   6244  C  CA    . LEU B 2 243  ? 200.934 130.068 157.359 1.00 152.79 ?  240  LEU B CA    1 
ATOM   6245  C  C     . LEU B 2 243  ? 202.365 129.918 157.868 1.00 160.18 ?  240  LEU B C     1 
ATOM   6246  O  O     . LEU B 2 243  ? 202.775 130.517 158.865 1.00 160.84 ?  240  LEU B O     1 
ATOM   6247  C  CB    . LEU B 2 243  ? 200.333 131.411 157.759 1.00 160.15 ?  240  LEU B CB    1 
ATOM   6248  C  CG    . LEU B 2 243  ? 198.838 131.610 157.502 1.00 162.14 ?  240  LEU B CG    1 
ATOM   6249  C  CD1   . LEU B 2 243  ? 198.045 131.474 158.789 1.00 147.74 ?  240  LEU B CD1   1 
ATOM   6250  C  CD2   . LEU B 2 243  ? 198.573 132.961 156.856 1.00 158.91 ?  240  LEU B CD2   1 
ATOM   6251  N  N     . LEU B 2 244  ? 203.140 129.088 157.166 1.00 164.37 ?  241  LEU B N     1 
ATOM   6252  C  CA    . LEU B 2 244  ? 204.567 128.957 157.450 1.00 172.14 ?  241  LEU B CA    1 
ATOM   6253  C  C     . LEU B 2 244  ? 205.275 130.034 156.634 1.00 178.00 ?  241  LEU B C     1 
ATOM   6254  O  O     . LEU B 2 244  ? 205.834 129.786 155.564 1.00 177.25 ?  241  LEU B O     1 
ATOM   6255  C  CB    . LEU B 2 244  ? 205.064 127.556 157.115 1.00 168.62 ?  241  LEU B CB    1 
ATOM   6256  C  CG    . LEU B 2 244  ? 206.533 127.263 157.431 1.00 167.20 ?  241  LEU B CG    1 
ATOM   6257  C  CD1   . LEU B 2 244  ? 206.794 127.374 158.925 1.00 167.48 ?  241  LEU B CD1   1 
ATOM   6258  C  CD2   . LEU B 2 244  ? 206.937 125.892 156.909 1.00 160.30 ?  241  LEU B CD2   1 
ATOM   6259  N  N     . LEU B 2 245  ? 205.223 131.261 157.160 1.00 177.35 ?  242  LEU B N     1 
ATOM   6260  C  CA    . LEU B 2 245  ? 205.661 132.440 156.421 1.00 178.52 ?  242  LEU B CA    1 
ATOM   6261  C  C     . LEU B 2 245  ? 207.075 132.263 155.882 1.00 176.41 ?  242  LEU B C     1 
ATOM   6262  O  O     . LEU B 2 245  ? 207.948 131.706 156.554 1.00 173.19 ?  242  LEU B O     1 
ATOM   6263  C  CB    . LEU B 2 245  ? 205.590 133.681 157.318 1.00 177.44 ?  242  LEU B CB    1 
ATOM   6264  C  CG    . LEU B 2 245  ? 204.259 134.438 157.397 1.00 169.09 ?  242  LEU B CG    1 
ATOM   6265  C  CD1   . LEU B 2 245  ? 203.220 133.668 158.199 1.00 163.20 ?  242  LEU B CD1   1 
ATOM   6266  C  CD2   . LEU B 2 245  ? 204.464 135.830 157.979 1.00 160.78 ?  242  LEU B CD2   1 
ATOM   6267  N  N     . GLY B 2 246  ? 207.300 132.740 154.658 1.00 177.70 ?  243  GLY B N     1 
ATOM   6268  C  CA    . GLY B 2 246  ? 206.286 133.437 153.881 1.00 175.34 ?  243  GLY B CA    1 
ATOM   6269  C  C     . GLY B 2 246  ? 205.490 132.602 152.891 1.00 173.64 ?  243  GLY B C     1 
ATOM   6270  O  O     . GLY B 2 246  ? 205.278 133.024 151.754 1.00 166.81 ?  243  GLY B O     1 
ATOM   6271  N  N     . SER B 2 247  ? 205.046 131.419 153.315 1.00 174.66 ?  244  SER B N     1 
ATOM   6272  C  CA    . SER B 2 247  ? 204.289 130.515 152.453 1.00 165.05 ?  244  SER B CA    1 
ATOM   6273  C  C     . SER B 2 247  ? 203.047 130.024 153.185 1.00 153.00 ?  244  SER B C     1 
ATOM   6274  O  O     . SER B 2 247  ? 203.166 129.411 154.266 1.00 156.60 ?  244  SER B O     1 
ATOM   6275  C  CB    . SER B 2 247  ? 205.156 129.334 152.007 1.00 162.92 ?  244  SER B CB    1 
ATOM   6276  O  OG    . SER B 2 247  ? 204.470 128.523 151.069 1.00 154.69 ?  244  SER B OG    1 
ATOM   6277  N  N     . PRO B 2 248  ? 201.850 130.271 152.662 1.00 133.40 ?  245  PRO B N     1 
ATOM   6278  C  CA    . PRO B 2 248  ? 200.640 129.652 153.239 1.00 126.61 ?  245  PRO B CA    1 
ATOM   6279  C  C     . PRO B 2 248  ? 200.416 128.241 152.700 1.00 131.75 ?  245  PRO B C     1 
ATOM   6280  O  O     . PRO B 2 248  ? 199.665 128.006 151.756 1.00 125.38 ?  245  PRO B O     1 
ATOM   6281  C  CB    . PRO B 2 248  ? 199.532 130.608 152.793 1.00 121.46 ?  245  PRO B CB    1 
ATOM   6282  C  CG    . PRO B 2 248  ? 200.021 131.143 151.485 1.00 118.15 ?  245  PRO B CG    1 
ATOM   6283  C  CD    . PRO B 2 248  ? 201.526 131.221 151.584 1.00 129.28 ?  245  PRO B CD    1 
ATOM   6284  N  N     . VAL B 2 249  ? 201.079 127.258 153.307 1.00 143.88 ?  246  VAL B N     1 
ATOM   6285  C  CA    . VAL B 2 249  ? 201.004 125.891 152.798 1.00 147.75 ?  246  VAL B CA    1 
ATOM   6286  C  C     . VAL B 2 249  ? 199.690 125.260 153.244 1.00 142.88 ?  246  VAL B C     1 
ATOM   6287  O  O     . VAL B 2 249  ? 199.296 125.358 154.413 1.00 145.14 ?  246  VAL B O     1 
ATOM   6288  C  CB    . VAL B 2 249  ? 202.226 125.064 153.242 1.00 154.64 ?  246  VAL B CB    1 
ATOM   6289  C  CG1   . VAL B 2 249  ? 202.518 125.252 154.715 1.00 162.40 ?  246  VAL B CG1   1 
ATOM   6290  C  CG2   . VAL B 2 249  ? 202.027 123.584 152.914 1.00 146.51 ?  246  VAL B CG2   1 
ATOM   6291  N  N     . LEU B 2 250  ? 199.001 124.623 152.299 1.00 128.58 ?  247  LEU B N     1 
ATOM   6292  C  CA    . LEU B 2 250  ? 197.664 124.084 152.499 1.00 118.56 ?  247  LEU B CA    1 
ATOM   6293  C  C     . LEU B 2 250  ? 197.637 122.636 152.035 1.00 113.56 ?  247  LEU B C     1 
ATOM   6294  O  O     . LEU B 2 250  ? 198.246 122.295 151.016 1.00 116.56 ?  247  LEU B O     1 
ATOM   6295  C  CB    . LEU B 2 250  ? 196.626 124.903 151.710 1.00 110.62 ?  247  LEU B CB    1 
ATOM   6296  C  CG    . LEU B 2 250  ? 195.116 124.743 151.919 1.00 109.43 ?  247  LEU B CG    1 
ATOM   6297  C  CD1   . LEU B 2 250  ? 194.408 125.986 151.395 1.00 102.37 ?  247  LEU B CD1   1 
ATOM   6298  C  CD2   . LEU B 2 250  ? 194.530 123.493 151.275 1.00 103.79 ?  247  LEU B CD2   1 
ATOM   6299  N  N     . THR B 2 251  ? 196.928 121.787 152.777 1.00 108.90 ?  248  THR B N     1 
ATOM   6300  C  CA    . THR B 2 251  ? 196.639 120.432 152.329 1.00 101.73 ?  248  THR B CA    1 
ATOM   6301  C  C     . THR B 2 251  ? 195.193 120.119 152.686 1.00 93.08  ?  248  THR B C     1 
ATOM   6302  O  O     . THR B 2 251  ? 194.499 120.931 153.301 1.00 94.77  ?  248  THR B O     1 
ATOM   6303  C  CB    . THR B 2 251  ? 197.601 119.407 152.941 1.00 107.82 ?  248  THR B CB    1 
ATOM   6304  O  OG1   . THR B 2 251  ? 197.258 118.095 152.477 1.00 98.74  ?  248  THR B OG1   1 
ATOM   6305  C  CG2   . THR B 2 251  ? 197.520 119.438 154.455 1.00 116.51 ?  248  THR B CG2   1 
ATOM   6306  N  N     . CYS B 2 252  ? 194.728 118.937 152.296 1.00 84.63  ?  249  CYS B N     1 
ATOM   6307  C  CA    . CYS B 2 252  ? 193.344 118.563 152.557 1.00 82.13  ?  249  CYS B CA    1 
ATOM   6308  C  C     . CYS B 2 252  ? 193.229 117.045 152.542 1.00 80.48  ?  249  CYS B C     1 
ATOM   6309  O  O     . CYS B 2 252  ? 194.220 116.325 152.391 1.00 83.17  ?  249  CYS B O     1 
ATOM   6310  C  CB    . CYS B 2 252  ? 192.395 119.194 151.537 1.00 86.36  ?  249  CYS B CB    1 
ATOM   6311  S  SG    . CYS B 2 252  ? 192.015 118.123 150.146 1.00 94.05  ?  249  CYS B SG    1 
ATOM   6312  N  N     . THR B 2 253  ? 191.994 116.570 152.696 1.00 82.10  ?  250  THR B N     1 
ATOM   6313  C  CA    . THR B 2 253  ? 191.709 115.143 152.738 1.00 80.96  ?  250  THR B CA    1 
ATOM   6314  C  C     . THR B 2 253  ? 190.216 114.911 152.542 1.00 76.82  ?  250  THR B C     1 
ATOM   6315  O  O     . THR B 2 253  ? 189.384 115.583 153.167 1.00 74.49  ?  250  THR B O     1 
ATOM   6316  C  CB    . THR B 2 253  ? 192.182 114.521 154.063 1.00 81.09  ?  250  THR B CB    1 
ATOM   6317  O  OG1   . THR B 2 253  ? 191.609 113.216 154.217 1.00 83.53  ?  250  THR B OG1   1 
ATOM   6318  C  CG2   . THR B 2 253  ? 191.797 115.397 155.250 1.00 80.35  ?  250  THR B CG2   1 
ATOM   6319  N  N     . ILE B 2 254  ? 189.887 113.971 151.655 1.00 73.52  ?  251  ILE B N     1 
ATOM   6320  C  CA    . ILE B 2 254  ? 188.534 113.440 151.594 1.00 69.08  ?  251  ILE B CA    1 
ATOM   6321  C  C     . ILE B 2 254  ? 188.282 112.617 152.850 1.00 68.16  ?  251  ILE B C     1 
ATOM   6322  O  O     . ILE B 2 254  ? 189.196 111.990 153.401 1.00 76.32  ?  251  ILE B O     1 
ATOM   6323  C  CB    . ILE B 2 254  ? 188.340 112.576 150.334 1.00 71.05  ?  251  ILE B CB    1 
ATOM   6324  C  CG1   . ILE B 2 254  ? 189.044 113.197 149.124 1.00 80.84  ?  251  ILE B CG1   1 
ATOM   6325  C  CG2   . ILE B 2 254  ? 186.860 112.357 150.057 1.00 69.67  ?  251  ILE B CG2   1 
ATOM   6326  C  CD1   . ILE B 2 254  ? 188.394 114.453 148.604 1.00 88.52  ?  251  ILE B CD1   1 
ATOM   6327  N  N     . LEU B 2 255  ? 187.040 112.610 153.319 1.00 62.33  ?  252  LEU B N     1 
ATOM   6328  C  CA    . LEU B 2 255  ? 186.679 111.716 154.407 1.00 63.85  ?  252  LEU B CA    1 
ATOM   6329  C  C     . LEU B 2 255  ? 185.450 110.913 153.998 1.00 64.82  ?  252  LEU B C     1 
ATOM   6330  O  O     . LEU B 2 255  ? 184.945 111.037 152.879 1.00 65.73  ?  252  LEU B O     1 
ATOM   6331  C  CB    . LEU B 2 255  ? 186.463 112.480 155.720 1.00 73.43  ?  252  LEU B CB    1 
ATOM   6332  C  CG    . LEU B 2 255  ? 187.750 112.642 156.540 1.00 78.28  ?  252  LEU B CG    1 
ATOM   6333  C  CD1   . LEU B 2 255  ? 188.603 113.800 156.031 1.00 74.08  ?  252  LEU B CD1   1 
ATOM   6334  C  CD2   . LEU B 2 255  ? 187.459 112.792 158.026 1.00 86.64  ?  252  LEU B CD2   1 
ATOM   6335  N  N     . HIS B 2 256  ? 184.967 110.072 154.914 1.00 76.95  ?  253  HIS B N     1 
ATOM   6336  C  CA    . HIS B 2 256  ? 183.986 109.065 154.524 1.00 92.48  ?  253  HIS B CA    1 
ATOM   6337  C  C     . HIS B 2 256  ? 182.585 109.652 154.392 1.00 92.16  ?  253  HIS B C     1 
ATOM   6338  O  O     . HIS B 2 256  ? 181.998 109.645 153.304 1.00 97.15  ?  253  HIS B O     1 
ATOM   6339  C  CB    . HIS B 2 256  ? 183.985 107.906 155.525 1.00 108.86 ?  253  HIS B CB    1 
ATOM   6340  C  CG    . HIS B 2 256  ? 182.937 106.872 155.246 1.00 124.46 ?  253  HIS B CG    1 
ATOM   6341  N  ND1   . HIS B 2 256  ? 181.635 106.992 155.686 1.00 124.43 ?  253  HIS B ND1   1 
ATOM   6342  C  CD2   . HIS B 2 256  ? 182.995 105.705 154.561 1.00 129.77 ?  253  HIS B CD2   1 
ATOM   6343  C  CE1   . HIS B 2 256  ? 180.940 105.941 155.290 1.00 129.00 ?  253  HIS B CE1   1 
ATOM   6344  N  NE2   . HIS B 2 256  ? 181.742 105.145 154.605 1.00 132.52 ?  253  HIS B NE2   1 
ATOM   6345  N  N     . GLU B 2 257  ? 182.030 110.162 155.485 1.00 86.33  ?  254  GLU B N     1 
ATOM   6346  C  CA    . GLU B 2 257  ? 180.627 110.553 155.529 1.00 94.97  ?  254  GLU B CA    1 
ATOM   6347  C  C     . GLU B 2 257  ? 180.504 112.069 155.484 1.00 96.85  ?  254  GLU B C     1 
ATOM   6348  O  O     . GLU B 2 257  ? 181.074 112.769 156.327 1.00 92.94  ?  254  GLU B O     1 
ATOM   6349  C  CB    . GLU B 2 257  ? 179.942 110.002 156.780 1.00 95.80  ?  254  GLU B CB    1 
ATOM   6350  C  CG    . GLU B 2 257  ? 178.632 110.701 157.113 1.00 104.33 ?  254  GLU B CG    1 
ATOM   6351  C  CD    . GLU B 2 257  ? 177.674 110.745 155.934 1.00 110.83 ?  254  GLU B CD    1 
ATOM   6352  O  OE1   . GLU B 2 257  ? 177.498 109.704 155.266 1.00 107.18 ?  254  GLU B OE1   1 
ATOM   6353  O  OE2   . GLU B 2 257  ? 177.113 111.829 155.665 1.00 140.95 -1 254  GLU B OE2   1 
ATOM   6354  N  N     . GLY B 2 258  ? 179.750 112.562 154.506 1.00 95.25  ?  255  GLY B N     1 
ATOM   6355  C  CA    . GLY B 2 258  ? 179.324 113.945 154.458 1.00 86.98  ?  255  GLY B CA    1 
ATOM   6356  C  C     . GLY B 2 258  ? 177.877 114.014 154.022 1.00 85.50  ?  255  GLY B C     1 
ATOM   6357  O  O     . GLY B 2 258  ? 177.509 113.449 152.988 1.00 82.34  ?  255  GLY B O     1 
ATOM   6358  N  N     . LEU B 2 259  ? 177.047 114.691 154.809 1.00 81.79  ?  256  LEU B N     1 
ATOM   6359  C  CA    . LEU B 2 259  ? 175.611 114.675 154.570 1.00 78.20  ?  256  LEU B CA    1 
ATOM   6360  C  C     . LEU B 2 259  ? 175.277 115.236 153.193 1.00 76.93  ?  256  LEU B C     1 
ATOM   6361  O  O     . LEU B 2 259  ? 175.922 116.170 152.709 1.00 73.15  ?  256  LEU B O     1 
ATOM   6362  C  CB    . LEU B 2 259  ? 174.896 115.468 155.659 1.00 71.63  ?  256  LEU B CB    1 
ATOM   6363  C  CG    . LEU B 2 259  ? 173.411 115.175 155.839 1.00 71.89  ?  256  LEU B CG    1 
ATOM   6364  C  CD1   . LEU B 2 259  ? 173.150 113.679 155.809 1.00 72.68  ?  256  LEU B CD1   1 
ATOM   6365  C  CD2   . LEU B 2 259  ? 172.966 115.763 157.157 1.00 70.60  ?  256  LEU B CD2   1 
ATOM   6366  N  N     . THR B 2 260  ? 174.264 114.646 152.559 1.00 78.61  ?  257  THR B N     1 
ATOM   6367  C  CA    . THR B 2 260  ? 173.858 115.029 151.206 1.00 78.79  ?  257  THR B CA    1 
ATOM   6368  C  C     . THR B 2 260  ? 172.741 116.071 151.282 1.00 73.65  ?  257  THR B C     1 
ATOM   6369  O  O     . THR B 2 260  ? 171.570 115.811 150.997 1.00 69.91  ?  257  THR B O     1 
ATOM   6370  C  CB    . THR B 2 260  ? 173.427 113.801 150.412 1.00 74.77  ?  257  THR B CB    1 
ATOM   6371  O  OG1   . THR B 2 260  ? 172.233 113.251 150.984 1.00 70.43  ?  257  THR B OG1   1 
ATOM   6372  C  CG2   . THR B 2 260  ? 174.519 112.744 150.431 1.00 70.03  ?  257  THR B CG2   1 
ATOM   6373  N  N     . ILE B 2 261  ? 173.132 117.281 151.683 1.00 65.55  ?  258  ILE B N     1 
ATOM   6374  C  CA    . ILE B 2 261  ? 172.204 118.394 151.842 1.00 59.00  ?  258  ILE B CA    1 
ATOM   6375  C  C     . ILE B 2 261  ? 172.807 119.647 151.224 1.00 54.31  ?  258  ILE B C     1 
ATOM   6376  O  O     . ILE B 2 261  ? 174.029 119.819 151.182 1.00 53.49  ?  258  ILE B O     1 
ATOM   6377  C  CB    . ILE B 2 261  ? 171.849 118.652 153.324 1.00 61.42  ?  258  ILE B CB    1 
ATOM   6378  C  CG1   . ILE B 2 261  ? 173.089 119.108 154.098 1.00 57.31  ?  258  ILE B CG1   1 
ATOM   6379  C  CG2   . ILE B 2 261  ? 171.224 117.419 153.951 1.00 61.05  ?  258  ILE B CG2   1 
ATOM   6380  C  CD1   . ILE B 2 261  ? 172.793 119.587 155.498 1.00 55.84  ?  258  ILE B CD1   1 
ATOM   6381  N  N     . THR B 2 262  ? 171.933 120.522 150.733 1.00 48.86  ?  259  THR B N     1 
ATOM   6382  C  CA    . THR B 2 262  ? 172.324 121.820 150.206 1.00 43.78  ?  259  THR B CA    1 
ATOM   6383  C  C     . THR B 2 262  ? 171.428 122.889 150.813 1.00 42.94  ?  259  THR B C     1 
ATOM   6384  O  O     . THR B 2 262  ? 170.325 122.603 151.287 1.00 43.86  ?  259  THR B O     1 
ATOM   6385  C  CB    . THR B 2 262  ? 172.221 121.878 148.674 1.00 43.52  ?  259  THR B CB    1 
ATOM   6386  O  OG1   . THR B 2 262  ? 170.842 121.829 148.289 1.00 50.98  ?  259  THR B OG1   1 
ATOM   6387  C  CG2   . THR B 2 262  ? 172.943 120.709 148.042 1.00 46.24  ?  259  THR B CG2   1 
ATOM   6388  N  N     . SER B 2 263  ? 171.918 124.131 150.789 1.00 44.42  ?  260  SER B N     1 
ATOM   6389  C  CA    . SER B 2 263  ? 171.165 125.293 151.262 1.00 50.65  ?  260  SER B CA    1 
ATOM   6390  C  C     . SER B 2 263  ? 170.705 125.094 152.708 1.00 52.42  ?  260  SER B C     1 
ATOM   6391  O  O     . SER B 2 263  ? 169.516 125.152 153.030 1.00 52.80  ?  260  SER B O     1 
ATOM   6392  C  CB    . SER B 2 263  ? 169.978 125.582 150.334 1.00 53.33  ?  260  SER B CB    1 
ATOM   6393  O  OG    . SER B 2 263  ? 169.058 126.482 150.928 1.00 51.72  ?  260  SER B OG    1 
ATOM   6394  N  N     . ALA B 2 264  ? 171.678 124.858 153.582 1.00 51.58  ?  261  ALA B N     1 
ATOM   6395  C  CA    . ALA B 2 264  ? 171.409 124.525 154.971 1.00 51.68  ?  261  ALA B CA    1 
ATOM   6396  C  C     . ALA B 2 264  ? 171.481 125.762 155.857 1.00 50.31  ?  261  ALA B C     1 
ATOM   6397  O  O     . ALA B 2 264  ? 172.162 126.742 155.543 1.00 51.13  ?  261  ALA B O     1 
ATOM   6398  C  CB    . ALA B 2 264  ? 172.393 123.469 155.476 1.00 55.84  ?  261  ALA B CB    1 
ATOM   6399  N  N     . ILE B 2 265  ? 170.767 125.699 156.976 1.00 47.50  ?  262  ILE B N     1 
ATOM   6400  C  CA    . ILE B 2 265  ? 170.732 126.767 157.966 1.00 44.66  ?  262  ILE B CA    1 
ATOM   6401  C  C     . ILE B 2 265  ? 171.438 126.247 159.208 1.00 48.04  ?  262  ILE B C     1 
ATOM   6402  O  O     . ILE B 2 265  ? 170.910 125.384 159.921 1.00 49.67  ?  262  ILE B O     1 
ATOM   6403  C  CB    . ILE B 2 265  ? 169.296 127.204 158.280 1.00 44.68  ?  262  ILE B CB    1 
ATOM   6404  C  CG1   . ILE B 2 265  ? 168.588 127.650 157.000 1.00 42.28  ?  262  ILE B CG1   1 
ATOM   6405  C  CG2   . ILE B 2 265  ? 169.298 128.325 159.302 1.00 51.77  ?  262  ILE B CG2   1 
ATOM   6406  C  CD1   . ILE B 2 265  ? 167.112 127.908 157.183 1.00 40.55  ?  262  ILE B CD1   1 
ATOM   6407  N  N     . ALA B 2 266  ? 172.633 126.768 159.468 1.00 52.42  ?  263  ALA B N     1 
ATOM   6408  C  CA    . ALA B 2 266  ? 173.484 126.296 160.551 1.00 59.85  ?  263  ALA B CA    1 
ATOM   6409  C  C     . ALA B 2 266  ? 173.349 127.229 161.746 1.00 62.85  ?  263  ALA B C     1 
ATOM   6410  O  O     . ALA B 2 266  ? 173.599 128.433 161.627 1.00 62.23  ?  263  ALA B O     1 
ATOM   6411  C  CB    . ALA B 2 266  ? 174.941 126.222 160.097 1.00 64.14  ?  263  ALA B CB    1 
ATOM   6412  N  N     . SER B 2 267  ? 172.965 126.677 162.896 1.00 64.69  ?  264  SER B N     1 
ATOM   6413  C  CA    . SER B 2 267  ? 172.900 127.466 164.115 1.00 65.87  ?  264  SER B CA    1 
ATOM   6414  C  C     . SER B 2 267  ? 173.984 127.008 165.074 1.00 67.51  ?  264  SER B C     1 
ATOM   6415  O  O     . SER B 2 267  ? 174.058 125.812 165.401 1.00 70.09  ?  264  SER B O     1 
ATOM   6416  C  CB    . SER B 2 267  ? 171.525 127.355 164.771 1.00 68.28  ?  264  SER B CB    1 
ATOM   6417  O  OG    . SER B 2 267  ? 171.486 128.087 165.984 1.00 72.92  ?  264  SER B OG    1 
ATOM   6418  N  N     . PRO B 2 268  ? 174.850 127.913 165.531 1.00 67.59  ?  265  PRO B N     1 
ATOM   6419  C  CA    . PRO B 2 268  ? 175.824 127.557 166.570 1.00 74.51  ?  265  PRO B CA    1 
ATOM   6420  C  C     . PRO B 2 268  ? 175.183 127.605 167.951 1.00 80.39  ?  265  PRO B C     1 
ATOM   6421  O  O     . PRO B 2 268  ? 174.544 128.594 168.319 1.00 80.68  ?  265  PRO B O     1 
ATOM   6422  C  CB    . PRO B 2 268  ? 176.908 128.630 166.419 1.00 75.36  ?  265  PRO B CB    1 
ATOM   6423  C  CG    . PRO B 2 268  ? 176.170 129.817 165.882 1.00 71.67  ?  265  PRO B CG    1 
ATOM   6424  C  CD    . PRO B 2 268  ? 175.053 129.281 165.020 1.00 65.42  ?  265  PRO B CD    1 
ATOM   6425  N  N     . ILE B 2 269  ? 175.351 126.526 168.714 1.00 78.06  ?  266  ILE B N     1 
ATOM   6426  C  CA    . ILE B 2 269  ? 174.882 126.454 170.097 1.00 75.59  ?  266  ILE B CA    1 
ATOM   6427  C  C     . ILE B 2 269  ? 176.055 126.400 171.072 1.00 73.73  ?  266  ILE B C     1 
ATOM   6428  O  O     . ILE B 2 269  ? 176.222 127.292 171.906 1.00 70.48  ?  266  ILE B O     1 
ATOM   6429  C  CB    . ILE B 2 269  ? 173.922 125.261 170.305 1.00 78.14  ?  266  ILE B CB    1 
ATOM   6430  C  CG1   . ILE B 2 269  ? 174.421 124.011 169.576 1.00 78.16  ?  266  ILE B CG1   1 
ATOM   6431  C  CG2   . ILE B 2 269  ? 172.528 125.615 169.835 1.00 83.14  ?  266  ILE B CG2   1 
ATOM   6432  C  CD1   . ILE B 2 269  ? 173.523 122.804 169.752 1.00 80.75  ?  266  ILE B CD1   1 
ATOM   6433  N  N     . GLY B 2 270  ? 176.885 125.367 170.975 1.00 77.18  ?  267  GLY B N     1 
ATOM   6434  C  CA    . GLY B 2 270  ? 178.050 125.245 171.818 1.00 79.61  ?  267  GLY B CA    1 
ATOM   6435  C  C     . GLY B 2 270  ? 179.232 126.004 171.251 1.00 75.38  ?  267  GLY B C     1 
ATOM   6436  O  O     . GLY B 2 270  ? 179.136 126.739 170.266 1.00 75.54  ?  267  GLY B O     1 
ATOM   6437  N  N     . TYR B 2 271  ? 180.377 125.822 171.910 1.00 81.13  ?  268  TYR B N     1 
ATOM   6438  C  CA    . TYR B 2 271  ? 181.610 126.423 171.415 1.00 86.56  ?  268  TYR B CA    1 
ATOM   6439  C  C     . TYR B 2 271  ? 181.912 125.945 170.001 1.00 83.13  ?  268  TYR B C     1 
ATOM   6440  O  O     . TYR B 2 271  ? 182.291 126.740 169.133 1.00 88.06  ?  268  TYR B O     1 
ATOM   6441  C  CB    . TYR B 2 271  ? 182.765 126.100 172.364 1.00 102.22 ?  268  TYR B CB    1 
ATOM   6442  C  CG    . TYR B 2 271  ? 184.063 126.791 172.018 1.00 114.85 ?  268  TYR B CG    1 
ATOM   6443  C  CD1   . TYR B 2 271  ? 184.261 128.132 172.325 1.00 123.81 ?  268  TYR B CD1   1 
ATOM   6444  C  CD2   . TYR B 2 271  ? 185.096 126.102 171.400 1.00 115.09 ?  268  TYR B CD2   1 
ATOM   6445  C  CE1   . TYR B 2 271  ? 185.448 128.769 172.012 1.00 129.72 ?  268  TYR B CE1   1 
ATOM   6446  C  CE2   . TYR B 2 271  ? 186.288 126.730 171.086 1.00 123.17 ?  268  TYR B CE2   1 
ATOM   6447  C  CZ    . TYR B 2 271  ? 186.458 128.063 171.393 1.00 130.67 ?  268  TYR B CZ    1 
ATOM   6448  O  OH    . TYR B 2 271  ? 187.642 128.691 171.081 1.00 127.01 ?  268  TYR B OH    1 
ATOM   6449  N  N     . HIS B 2 272  ? 181.748 124.649 169.753 1.00 80.55  ?  269  HIS B N     1 
ATOM   6450  C  CA    . HIS B 2 272  ? 181.875 124.081 168.415 1.00 83.43  ?  269  HIS B CA    1 
ATOM   6451  C  C     . HIS B 2 272  ? 180.796 123.028 168.197 1.00 83.13  ?  269  HIS B C     1 
ATOM   6452  O  O     . HIS B 2 272  ? 181.056 121.915 167.737 1.00 84.63  ?  269  HIS B O     1 
ATOM   6453  C  CB    . HIS B 2 272  ? 183.276 123.523 168.193 1.00 87.55  ?  269  HIS B CB    1 
ATOM   6454  C  CG    . HIS B 2 272  ? 184.273 124.569 167.805 1.00 89.55  ?  269  HIS B CG    1 
ATOM   6455  N  ND1   . HIS B 2 272  ? 185.430 124.797 168.517 1.00 95.34  ?  269  HIS B ND1   1 
ATOM   6456  C  CD2   . HIS B 2 272  ? 184.271 125.467 166.791 1.00 86.96  ?  269  HIS B CD2   1 
ATOM   6457  C  CE1   . HIS B 2 272  ? 186.103 125.784 167.953 1.00 95.40  ?  269  HIS B CE1   1 
ATOM   6458  N  NE2   . HIS B 2 272  ? 185.422 126.208 166.904 1.00 89.44  ?  269  HIS B NE2   1 
ATOM   6459  N  N     . GLU B 2 273  ? 179.564 123.368 168.562 1.00 84.53  ?  270  GLU B N     1 
ATOM   6460  C  CA    . GLU B 2 273  ? 178.407 122.509 168.349 1.00 91.48  ?  270  GLU B CA    1 
ATOM   6461  C  C     . GLU B 2 273  ? 177.443 123.240 167.427 1.00 84.13  ?  270  GLU B C     1 
ATOM   6462  O  O     . GLU B 2 273  ? 177.007 124.353 167.740 1.00 83.47  ?  270  GLU B O     1 
ATOM   6463  C  CB    . GLU B 2 273  ? 177.742 122.158 169.680 1.00 101.08 ?  270  GLU B CB    1 
ATOM   6464  C  CG    . GLU B 2 273  ? 178.745 121.878 170.790 1.00 114.95 ?  270  GLU B CG    1 
ATOM   6465  C  CD    . GLU B 2 273  ? 178.256 120.841 171.780 1.00 154.07 ?  270  GLU B CD    1 
ATOM   6466  O  OE1   . GLU B 2 273  ? 177.341 120.068 171.433 1.00 141.68 ?  270  GLU B OE1   1 
ATOM   6467  O  OE2   . GLU B 2 273  ? 178.794 120.796 172.907 1.00 220.49 -1 270  GLU B OE2   1 
ATOM   6468  N  N     . TYR B 2 274  ? 177.117 122.623 166.292 1.00 78.08  ?  271  TYR B N     1 
ATOM   6469  C  CA    . TYR B 2 274  ? 176.310 123.266 165.263 1.00 70.37  ?  271  TYR B CA    1 
ATOM   6470  C  C     . TYR B 2 274  ? 175.128 122.378 164.917 1.00 71.14  ?  271  TYR B C     1 
ATOM   6471  O  O     . TYR B 2 274  ? 175.308 121.240 164.468 1.00 73.39  ?  271  TYR B O     1 
ATOM   6472  C  CB    . TYR B 2 274  ? 177.151 123.565 164.020 1.00 65.66  ?  271  TYR B CB    1 
ATOM   6473  C  CG    . TYR B 2 274  ? 178.169 124.649 164.270 1.00 69.46  ?  271  TYR B CG    1 
ATOM   6474  C  CD1   . TYR B 2 274  ? 179.377 124.362 164.891 1.00 76.01  ?  271  TYR B CD1   1 
ATOM   6475  C  CD2   . TYR B 2 274  ? 177.913 125.964 163.911 1.00 68.95  ?  271  TYR B CD2   1 
ATOM   6476  C  CE1   . TYR B 2 274  ? 180.307 125.352 165.136 1.00 83.29  ?  271  TYR B CE1   1 
ATOM   6477  C  CE2   . TYR B 2 274  ? 178.839 126.961 164.148 1.00 74.48  ?  271  TYR B CE2   1 
ATOM   6478  C  CZ    . TYR B 2 274  ? 180.034 126.650 164.763 1.00 82.08  ?  271  TYR B CZ    1 
ATOM   6479  O  OH    . TYR B 2 274  ? 180.961 127.638 165.005 1.00 80.75  ?  271  TYR B OH    1 
ATOM   6480  N  N     . ILE B 2 275  ? 173.925 122.894 165.135 1.00 68.76  ?  272  ILE B N     1 
ATOM   6481  C  CA    . ILE B 2 275  ? 172.708 122.204 164.732 1.00 67.58  ?  272  ILE B CA    1 
ATOM   6482  C  C     . ILE B 2 275  ? 172.368 122.627 163.310 1.00 66.26  ?  272  ILE B C     1 
ATOM   6483  O  O     . ILE B 2 275  ? 172.316 123.824 162.997 1.00 68.31  ?  272  ILE B O     1 
ATOM   6484  C  CB    . ILE B 2 275  ? 171.553 122.502 165.703 1.00 69.34  ?  272  ILE B CB    1 
ATOM   6485  C  CG1   . ILE B 2 275  ? 170.227 122.036 165.109 1.00 68.86  ?  272  ILE B CG1   1 
ATOM   6486  C  CG2   . ILE B 2 275  ? 171.501 123.978 166.068 1.00 76.95  ?  272  ILE B CG2   1 
ATOM   6487  C  CD1   . ILE B 2 275  ? 169.087 122.182 166.057 1.00 78.45  ?  272  ILE B CD1   1 
ATOM   6488  N  N     . ILE B 2 276  ? 172.156 121.645 162.440 1.00 60.13  ?  273  ILE B N     1 
ATOM   6489  C  CA    . ILE B 2 276  ? 171.910 121.876 161.024 1.00 54.58  ?  273  ILE B CA    1 
ATOM   6490  C  C     . ILE B 2 276  ? 170.454 121.544 160.739 1.00 55.54  ?  273  ILE B C     1 
ATOM   6491  O  O     . ILE B 2 276  ? 170.033 120.387 160.875 1.00 58.96  ?  273  ILE B O     1 
ATOM   6492  C  CB    . ILE B 2 276  ? 172.848 121.036 160.143 1.00 51.31  ?  273  ILE B CB    1 
ATOM   6493  C  CG1   . ILE B 2 276  ? 174.305 121.227 160.571 1.00 52.47  ?  273  ILE B CG1   1 
ATOM   6494  C  CG2   . ILE B 2 276  ? 172.672 121.405 158.680 1.00 46.09  ?  273  ILE B CG2   1 
ATOM   6495  C  CD1   . ILE B 2 276  ? 174.763 122.663 160.575 1.00 52.65  ?  273  ILE B CD1   1 
ATOM   6496  N  N     . PHE B 2 277  ? 169.681 122.561 160.356 1.00 51.46  ?  274  PHE B N     1 
ATOM   6497  C  CA    . PHE B 2 277  ? 168.320 122.320 159.892 1.00 47.39  ?  274  PHE B CA    1 
ATOM   6498  C  C     . PHE B 2 277  ? 168.324 121.766 158.476 1.00 50.05  ?  274  PHE B C     1 
ATOM   6499  O  O     . PHE B 2 277  ? 167.603 120.808 158.172 1.00 56.00  ?  274  PHE B O     1 
ATOM   6500  C  CB    . PHE B 2 277  ? 167.499 123.608 159.962 1.00 45.59  ?  274  PHE B CB    1 
ATOM   6501  C  CG    . PHE B 2 277  ? 166.828 123.816 161.281 1.00 54.80  ?  274  PHE B CG    1 
ATOM   6502  C  CD1   . PHE B 2 277  ? 167.528 124.343 162.352 1.00 62.13  ?  274  PHE B CD1   1 
ATOM   6503  C  CD2   . PHE B 2 277  ? 165.501 123.465 161.459 1.00 58.73  ?  274  PHE B CD2   1 
ATOM   6504  C  CE1   . PHE B 2 277  ? 166.915 124.528 163.575 1.00 66.80  ?  274  PHE B CE1   1 
ATOM   6505  C  CE2   . PHE B 2 277  ? 164.883 123.647 162.679 1.00 67.56  ?  274  PHE B CE2   1 
ATOM   6506  C  CZ    . PHE B 2 277  ? 165.592 124.177 163.739 1.00 70.26  ?  274  PHE B CZ    1 
ATOM   6507  N  N     . GLY B 2 278  ? 169.131 122.358 157.601 1.00 53.94  ?  275  GLY B N     1 
ATOM   6508  C  CA    . GLY B 2 278  ? 169.244 121.893 156.236 1.00 62.24  ?  275  GLY B CA    1 
ATOM   6509  C  C     . GLY B 2 278  ? 168.052 122.304 155.403 1.00 56.56  ?  275  GLY B C     1 
ATOM   6510  O  O     . GLY B 2 278  ? 166.922 122.294 155.894 1.00 51.38  ?  275  GLY B O     1 
ATOM   6511  N  N     . GLY B 2 279  ? 168.287 122.667 154.146 1.00 55.13  ?  276  GLY B N     1 
ATOM   6512  C  CA    . GLY B 2 279  ? 167.196 123.021 153.264 1.00 54.33  ?  276  GLY B CA    1 
ATOM   6513  C  C     . GLY B 2 279  ? 166.707 121.889 152.385 1.00 54.34  ?  276  GLY B C     1 
ATOM   6514  O  O     . GLY B 2 279  ? 165.514 121.573 152.382 1.00 52.50  ?  276  GLY B O     1 
ATOM   6515  N  N     . TYR B 2 280  ? 167.616 121.262 151.638 1.00 50.83  ?  277  TYR B N     1 
ATOM   6516  C  CA    . TYR B 2 280  ? 167.231 120.351 150.565 1.00 48.60  ?  277  TYR B CA    1 
ATOM   6517  C  C     . TYR B 2 280  ? 168.144 119.137 150.563 1.00 46.37  ?  277  TYR B C     1 
ATOM   6518  O  O     . TYR B 2 280  ? 169.369 119.276 150.496 1.00 46.69  ?  277  TYR B O     1 
ATOM   6519  C  CB    . TYR B 2 280  ? 167.278 121.061 149.206 1.00 49.76  ?  277  TYR B CB    1 
ATOM   6520  C  CG    . TYR B 2 280  ? 166.374 122.270 149.148 1.00 52.67  ?  277  TYR B CG    1 
ATOM   6521  C  CD1   . TYR B 2 280  ? 166.822 123.515 149.567 1.00 53.74  ?  277  TYR B CD1   1 
ATOM   6522  C  CD2   . TYR B 2 280  ? 165.065 122.163 148.697 1.00 52.22  ?  277  TYR B CD2   1 
ATOM   6523  C  CE1   . TYR B 2 280  ? 165.999 124.617 149.533 1.00 52.58  ?  277  TYR B CE1   1 
ATOM   6524  C  CE2   . TYR B 2 280  ? 164.231 123.265 148.660 1.00 47.16  ?  277  TYR B CE2   1 
ATOM   6525  C  CZ    . TYR B 2 280  ? 164.708 124.489 149.079 1.00 46.72  ?  277  TYR B CZ    1 
ATOM   6526  O  OH    . TYR B 2 280  ? 163.903 125.599 149.052 1.00 42.36  ?  277  TYR B OH    1 
ATOM   6527  N  N     . GLN B 2 281  ? 167.540 117.949 150.634 1.00 51.16  ?  278  GLN B N     1 
ATOM   6528  C  CA    . GLN B 2 281  ? 168.294 116.708 150.497 1.00 57.62  ?  278  GLN B CA    1 
ATOM   6529  C  C     . GLN B 2 281  ? 168.573 116.402 149.029 1.00 59.63  ?  278  GLN B C     1 
ATOM   6530  O  O     . GLN B 2 281  ? 169.733 116.311 148.614 1.00 61.64  ?  278  GLN B O     1 
ATOM   6531  C  CB    . GLN B 2 281  ? 167.529 115.555 151.152 1.00 63.71  ?  278  GLN B CB    1 
ATOM   6532  C  CG    . GLN B 2 281  ? 167.932 114.176 150.654 1.00 63.17  ?  278  GLN B CG    1 
ATOM   6533  C  CD    . GLN B 2 281  ? 166.801 113.173 150.752 1.00 60.86  ?  278  GLN B CD    1 
ATOM   6534  O  OE1   . GLN B 2 281  ? 166.100 112.914 149.774 1.00 57.59  ?  278  GLN B OE1   1 
ATOM   6535  N  NE2   . GLN B 2 281  ? 166.612 112.607 151.938 1.00 61.58  ?  278  GLN B NE2   1 
ATOM   6536  N  N     . SER B 2 282  ? 167.520 116.249 148.230 1.00 57.85  ?  279  SER B N     1 
ATOM   6537  C  CA    . SER B 2 282  ? 167.620 115.933 146.813 1.00 58.51  ?  279  SER B CA    1 
ATOM   6538  C  C     . SER B 2 282  ? 167.160 117.121 145.975 1.00 62.20  ?  279  SER B C     1 
ATOM   6539  O  O     . SER B 2 282  ? 166.585 118.087 146.485 1.00 62.80  ?  279  SER B O     1 
ATOM   6540  C  CB    . SER B 2 282  ? 166.793 114.686 146.477 1.00 53.90  ?  279  SER B CB    1 
ATOM   6541  O  OG    . SER B 2 282  ? 166.749 114.464 145.078 1.00 54.48  ?  279  SER B OG    1 
ATOM   6542  N  N     . GLU B 2 283  ? 167.413 117.035 144.665 1.00 62.05  ?  280  GLU B N     1 
ATOM   6543  C  CA    . GLU B 2 283  ? 167.084 118.127 143.753 1.00 65.20  ?  280  GLU B CA    1 
ATOM   6544  C  C     . GLU B 2 283  ? 165.589 118.377 143.632 1.00 54.08  ?  280  GLU B C     1 
ATOM   6545  O  O     . GLU B 2 283  ? 165.194 119.407 143.076 1.00 52.17  ?  280  GLU B O     1 
ATOM   6546  C  CB    . GLU B 2 283  ? 167.661 117.856 142.362 1.00 78.26  ?  280  GLU B CB    1 
ATOM   6547  C  CG    . GLU B 2 283  ? 168.842 118.743 141.987 1.00 89.91  ?  280  GLU B CG    1 
ATOM   6548  C  CD    . GLU B 2 283  ? 169.481 118.346 140.669 1.00 124.21 ?  280  GLU B CD    1 
ATOM   6549  O  OE1   . GLU B 2 283  ? 168.870 117.549 139.926 1.00 131.13 ?  280  GLU B OE1   1 
ATOM   6550  O  OE2   . GLU B 2 283  ? 170.592 118.836 140.373 1.00 178.66 -1 280  GLU B OE2   1 
ATOM   6551  N  N     . THR B 2 284  ? 164.757 117.461 144.119 1.00 52.55  ?  281  THR B N     1 
ATOM   6552  C  CA    . THR B 2 284  ? 163.311 117.612 144.045 1.00 53.40  ?  281  THR B CA    1 
ATOM   6553  C  C     . THR B 2 284  ? 162.649 117.713 145.416 1.00 52.19  ?  281  THR B C     1 
ATOM   6554  O  O     . THR B 2 284  ? 161.899 118.645 145.653 1.00 56.39  ?  281  THR B O     1 
ATOM   6555  C  CB    . THR B 2 284  ? 162.701 116.458 143.240 1.00 61.79  ?  281  THR B CB    1 
ATOM   6556  O  OG1   . THR B 2 284  ? 162.837 115.249 143.990 1.00 61.66  ?  281  THR B OG1   1 
ATOM   6557  C  CG2   . THR B 2 284  ? 163.427 116.303 141.912 1.00 64.51  ?  281  THR B CG2   1 
ATOM   6558  N  N     . GLN B 2 285  ? 162.880 116.801 146.355 1.00 55.03  ?  282  GLN B N     1 
ATOM   6559  C  CA    . GLN B 2 285  ? 162.183 116.756 147.649 1.00 59.06  ?  282  GLN B CA    1 
ATOM   6560  C  C     . GLN B 2 285  ? 163.239 117.397 148.560 1.00 58.67  ?  282  GLN B C     1 
ATOM   6561  O  O     . GLN B 2 285  ? 164.270 116.714 148.813 1.00 56.61  ?  282  GLN B O     1 
ATOM   6562  C  CB    . GLN B 2 285  ? 162.241 115.513 148.535 1.00 58.54  ?  282  GLN B CB    1 
ATOM   6563  C  CG    . GLN B 2 285  ? 161.689 114.320 148.720 1.00 57.25  ?  282  GLN B CG    1 
ATOM   6564  C  CD    . GLN B 2 285  ? 162.942 113.919 149.784 1.00 55.23  ?  282  GLN B CD    1 
ATOM   6565  O  OE1   . GLN B 2 285  ? 162.835 113.055 150.470 1.00 55.24  ?  282  GLN B OE1   1 
ATOM   6566  N  NE2   . GLN B 2 285  ? 163.509 115.124 150.302 1.00 59.29  ?  282  GLN B NE2   1 
ATOM   6567  N  N     . LYS B 2 286  ? 162.861 118.397 149.327 1.00 57.39  ?  283  LYS B N     1 
ATOM   6568  C  CA    . LYS B 2 286  ? 163.682 118.961 150.369 1.00 53.50  ?  283  LYS B CA    1 
ATOM   6569  C  C     . LYS B 2 286  ? 163.716 118.048 151.581 1.00 53.65  ?  283  LYS B C     1 
ATOM   6570  O  O     . LYS B 2 286  ? 162.774 117.298 151.862 1.00 57.58  ?  283  LYS B O     1 
ATOM   6571  C  CB    . LYS B 2 286  ? 163.087 120.303 150.741 1.00 53.12  ?  283  LYS B CB    1 
ATOM   6572  C  CG    . LYS B 2 286  ? 161.564 120.396 150.597 1.00 49.43  ?  283  LYS B CG    1 
ATOM   6573  C  CD    . LYS B 2 286  ? 160.863 119.724 151.770 1.00 50.45  ?  283  LYS B CD    1 
ATOM   6574  C  CE    . LYS B 2 286  ? 159.358 119.867 151.693 1.00 52.94  ?  283  LYS B CE    1 
ATOM   6575  N  NZ    . LYS B 2 286  ? 158.671 119.232 152.853 1.00 63.66  ?  283  LYS B NZ    1 
ATOM   6576  N  N     . ARG B 2 287  ? 164.802 118.154 152.325 1.00 56.50  ?  284  ARG B N     1 
ATOM   6577  C  CA    . ARG B 2 287  ? 164.924 117.414 153.566 1.00 61.54  ?  284  ARG B CA    1 
ATOM   6578  C  C     . ARG B 2 287  ? 163.904 117.903 154.590 1.00 67.07  ?  284  ARG B C     1 
ATOM   6579  O  O     . ARG B 2 287  ? 163.521 119.075 154.609 1.00 63.90  ?  284  ARG B O     1 
ATOM   6580  C  CB    . ARG B 2 287  ? 166.338 117.555 154.119 1.00 57.84  ?  284  ARG B CB    1 
ATOM   6581  C  CG    . ARG B 2 287  ? 166.399 117.866 155.595 1.00 58.71  ?  284  ARG B CG    1 
ATOM   6582  C  CD    . ARG B 2 287  ? 167.808 117.756 156.068 1.00 59.69  ?  284  ARG B CD    1 
ATOM   6583  N  NE    . ARG B 2 287  ? 168.233 116.364 156.039 1.00 68.35  ?  284  ARG B NE    1 
ATOM   6584  C  CZ    . ARG B 2 287  ? 169.436 115.957 156.415 1.00 76.79  ?  284  ARG B CZ    1 
ATOM   6585  N  NH1   . ARG B 2 287  ? 170.317 116.845 156.847 1.00 69.08  ?  284  ARG B NH1   1 
ATOM   6586  N  NH2   . ARG B 2 287  ? 169.756 114.672 156.357 1.00 93.29  ?  284  ARG B NH2   1 
ATOM   6587  N  N     . MET B 2 288  ? 163.453 116.982 155.447 1.00 74.66  ?  285  MET B N     1 
ATOM   6588  C  CA    . MET B 2 288  ? 162.548 117.328 156.534 1.00 77.24  ?  285  MET B CA    1 
ATOM   6589  C  C     . MET B 2 288  ? 163.165 117.186 157.917 1.00 77.05  ?  285  MET B C     1 
ATOM   6590  O  O     . MET B 2 288  ? 162.628 117.753 158.873 1.00 77.65  ?  285  MET B O     1 
ATOM   6591  C  CB    . MET B 2 288  ? 161.281 116.462 156.476 1.00 80.17  ?  285  MET B CB    1 
ATOM   6592  C  CG    . MET B 2 288  ? 160.472 116.638 155.206 1.00 85.41  ?  285  MET B CG    1 
ATOM   6593  S  SD    . MET B 2 288  ? 160.014 118.356 154.899 1.00 91.91  ?  285  MET B SD    1 
ATOM   6594  C  CE    . MET B 2 288  ? 159.243 118.808 156.449 1.00 81.97  ?  285  MET B CE    1 
ATOM   6595  N  N     . GLU B 2 289  ? 164.274 116.464 158.044 1.00 77.02  ?  286  GLU B N     1 
ATOM   6596  C  CA    . GLU B 2 289  ? 164.846 116.143 159.339 1.00 80.30  ?  286  GLU B CA    1 
ATOM   6597  C  C     . GLU B 2 289  ? 165.880 117.188 159.754 1.00 76.13  ?  286  GLU B C     1 
ATOM   6598  O  O     . GLU B 2 289  ? 166.092 118.201 159.081 1.00 72.44  ?  286  GLU B O     1 
ATOM   6599  C  CB    . GLU B 2 289  ? 165.466 114.749 159.300 1.00 85.13  ?  286  GLU B CB    1 
ATOM   6600  C  CG    . GLU B 2 289  ? 166.429 114.564 158.145 1.00 88.53  ?  286  GLU B CG    1 
ATOM   6601  C  CD    . GLU B 2 289  ? 166.938 113.146 158.028 1.00 114.33 ?  286  GLU B CD    1 
ATOM   6602  O  OE1   . GLU B 2 289  ? 166.802 112.380 159.004 1.00 109.21 ?  286  GLU B OE1   1 
ATOM   6603  O  OE2   . GLU B 2 289  ? 167.473 112.798 156.955 1.00 181.48 -1 286  GLU B OE2   1 
ATOM   6604  N  N     . CYS B 2 290  ? 166.536 116.932 160.880 1.00 72.84  ?  287  CYS B N     1 
ATOM   6605  C  CA    . CYS B 2 290  ? 167.558 117.802 161.443 1.00 62.31  ?  287  CYS B CA    1 
ATOM   6606  C  C     . CYS B 2 290  ? 168.870 117.031 161.563 1.00 54.67  ?  287  CYS B C     1 
ATOM   6607  O  O     . CYS B 2 290  ? 168.956 115.849 161.220 1.00 60.45  ?  287  CYS B O     1 
ATOM   6608  C  CB    . CYS B 2 290  ? 167.115 118.348 162.803 1.00 65.73  ?  287  CYS B CB    1 
ATOM   6609  S  SG    . CYS B 2 290  ? 165.390 118.883 162.850 1.00 76.64  ?  287  CYS B SG    1 
ATOM   6610  N  N     . THR B 2 291  ? 169.904 117.719 162.042 1.00 53.00  ?  288  THR B N     1 
ATOM   6611  C  CA    . THR B 2 291  ? 171.199 117.089 162.263 1.00 59.74  ?  288  THR B CA    1 
ATOM   6612  C  C     . THR B 2 291  ? 171.945 117.883 163.325 1.00 64.15  ?  288  THR B C     1 
ATOM   6613  O  O     . THR B 2 291  ? 171.656 119.058 163.561 1.00 60.43  ?  288  THR B O     1 
ATOM   6614  C  CB    . THR B 2 291  ? 172.021 117.007 160.966 1.00 56.02  ?  288  THR B CB    1 
ATOM   6615  O  OG1   . THR B 2 291  ? 171.167 116.655 159.870 1.00 55.44  ?  288  THR B OG1   1 
ATOM   6616  C  CG2   . THR B 2 291  ? 173.113 115.954 161.083 1.00 64.64  ?  288  THR B CG2   1 
ATOM   6617  N  N     . TYR B 2 292  ? 172.911 117.226 163.964 1.00 76.03  ?  289  TYR B N     1 
ATOM   6618  C  CA    . TYR B 2 292  ? 173.797 117.854 164.931 1.00 81.38  ?  289  TYR B CA    1 
ATOM   6619  C  C     . TYR B 2 292  ? 175.226 117.476 164.582 1.00 82.04  ?  289  TYR B C     1 
ATOM   6620  O  O     . TYR B 2 292  ? 175.505 116.321 164.238 1.00 84.38  ?  289  TYR B O     1 
ATOM   6621  C  CB    . TYR B 2 292  ? 173.454 117.421 166.371 1.00 95.33  ?  289  TYR B CB    1 
ATOM   6622  C  CG    . TYR B 2 292  ? 174.554 117.610 167.404 1.00 98.86  ?  289  TYR B CG    1 
ATOM   6623  C  CD1   . TYR B 2 292  ? 175.542 116.647 167.589 1.00 96.33  ?  289  TYR B CD1   1 
ATOM   6624  C  CD2   . TYR B 2 292  ? 174.584 118.736 168.216 1.00 99.92  ?  289  TYR B CD2   1 
ATOM   6625  C  CE1   . TYR B 2 292  ? 176.537 116.811 168.531 1.00 97.81  ?  289  TYR B CE1   1 
ATOM   6626  C  CE2   . TYR B 2 292  ? 175.576 118.906 169.165 1.00 99.47  ?  289  TYR B CE2   1 
ATOM   6627  C  CZ    . TYR B 2 292  ? 176.549 117.941 169.318 1.00 100.35 ?  289  TYR B CZ    1 
ATOM   6628  O  OH    . TYR B 2 292  ? 177.540 118.103 170.259 1.00 106.07 ?  289  TYR B OH    1 
ATOM   6629  N  N     . VAL B 2 293  ? 176.130 118.449 164.684 1.00 82.33  ?  290  VAL B N     1 
ATOM   6630  C  CA    . VAL B 2 293  ? 177.528 118.257 164.324 1.00 84.08  ?  290  VAL B CA    1 
ATOM   6631  C  C     . VAL B 2 293  ? 178.391 118.884 165.409 1.00 86.02  ?  290  VAL B C     1 
ATOM   6632  O  O     . VAL B 2 293  ? 178.396 120.110 165.574 1.00 83.63  ?  290  VAL B O     1 
ATOM   6633  C  CB    . VAL B 2 293  ? 177.865 118.862 162.954 1.00 85.59  ?  290  VAL B CB    1 
ATOM   6634  C  CG1   . VAL B 2 293  ? 179.368 118.989 162.785 1.00 91.89  ?  290  VAL B CG1   1 
ATOM   6635  C  CG2   . VAL B 2 293  ? 177.278 118.006 161.846 1.00 88.75  ?  290  VAL B CG2   1 
ATOM   6636  N  N     . GLY B 2 294  ? 179.100 118.050 166.163 1.00 91.01  ?  291  GLY B N     1 
ATOM   6637  C  CA    . GLY B 2 294  ? 180.218 118.531 166.940 1.00 91.72  ?  291  GLY B CA    1 
ATOM   6638  C  C     . GLY B 2 294  ? 181.493 118.463 166.127 1.00 92.25  ?  291  GLY B C     1 
ATOM   6639  O  O     . GLY B 2 294  ? 181.537 117.866 165.053 1.00 93.12  ?  291  GLY B O     1 
ATOM   6640  N  N     . LEU B 2 295  ? 182.538 119.102 166.640 1.00 91.23  ?  292  LEU B N     1 
ATOM   6641  C  CA    . LEU B 2 295  ? 183.830 118.994 165.982 1.00 94.54  ?  292  LEU B CA    1 
ATOM   6642  C  C     . LEU B 2 295  ? 184.931 119.358 166.962 1.00 103.41 ?  292  LEU B C     1 
ATOM   6643  O  O     . LEU B 2 295  ? 184.736 120.165 167.875 1.00 104.12 ?  292  LEU B O     1 
ATOM   6644  C  CB    . LEU B 2 295  ? 183.923 119.883 164.736 1.00 92.71  ?  292  LEU B CB    1 
ATOM   6645  C  CG    . LEU B 2 295  ? 183.925 121.395 164.948 1.00 92.09  ?  292  LEU B CG    1 
ATOM   6646  C  CD1   . LEU B 2 295  ? 184.708 122.070 163.840 1.00 94.48  ?  292  LEU B CD1   1 
ATOM   6647  C  CD2   . LEU B 2 295  ? 182.507 121.921 164.982 1.00 93.40  ?  292  LEU B CD2   1 
ATOM   6648  N  N     . ASP B 2 296  ? 186.088 118.745 166.752 1.00 117.52 ?  293  ASP B N     1 
ATOM   6649  C  CA    . ASP B 2 296  ? 187.293 119.015 167.521 1.00 131.94 ?  293  ASP B CA    1 
ATOM   6650  C  C     . ASP B 2 296  ? 188.471 118.587 166.654 1.00 144.11 ?  293  ASP B C     1 
ATOM   6651  O  O     . ASP B 2 296  ? 188.320 118.362 165.448 1.00 142.67 ?  293  ASP B O     1 
ATOM   6652  C  CB    . ASP B 2 296  ? 187.248 118.300 168.876 1.00 146.25 ?  293  ASP B CB    1 
ATOM   6653  C  CG    . ASP B 2 296  ? 188.203 118.903 169.886 1.00 167.34 ?  293  ASP B CG    1 
ATOM   6654  O  OD1   . ASP B 2 296  ? 188.914 119.867 169.534 1.00 156.33 ?  293  ASP B OD1   1 
ATOM   6655  O  OD2   . ASP B 2 296  ? 188.239 118.414 171.034 1.00 224.42 -1 293  ASP B OD2   1 
ATOM   6656  N  N     . ASP B 2 297  ? 189.652 118.471 167.262 1.00 152.87 ?  294  ASP B N     1 
ATOM   6657  C  CA    . ASP B 2 297  ? 190.814 117.999 166.518 1.00 155.08 ?  294  ASP B CA    1 
ATOM   6658  C  C     . ASP B 2 297  ? 190.674 116.549 166.073 1.00 152.06 ?  294  ASP B C     1 
ATOM   6659  O  O     . ASP B 2 297  ? 191.514 116.073 165.301 1.00 151.07 ?  294  ASP B O     1 
ATOM   6660  C  CB    . ASP B 2 297  ? 192.080 118.174 167.356 1.00 162.48 ?  294  ASP B CB    1 
ATOM   6661  C  CG    . ASP B 2 297  ? 191.868 117.816 168.810 1.00 180.44 ?  294  ASP B CG    1 
ATOM   6662  O  OD1   . ASP B 2 297  ? 190.766 117.337 169.151 1.00 172.46 ?  294  ASP B OD1   1 
ATOM   6663  O  OD2   . ASP B 2 297  ? 192.802 118.019 169.613 1.00 228.86 -1 294  ASP B OD2   1 
ATOM   6664  N  N     . VAL B 2 298  ? 189.649 115.840 166.547 1.00 147.24 ?  295  VAL B N     1 
ATOM   6665  C  CA    . VAL B 2 298  ? 189.312 114.536 165.988 1.00 138.52 ?  295  VAL B CA    1 
ATOM   6666  C  C     . VAL B 2 298  ? 188.617 114.700 164.644 1.00 137.21 ?  295  VAL B C     1 
ATOM   6667  O  O     . VAL B 2 298  ? 189.043 114.134 163.630 1.00 136.20 ?  295  VAL B O     1 
ATOM   6668  C  CB    . VAL B 2 298  ? 188.435 113.742 166.975 1.00 127.14 ?  295  VAL B CB    1 
ATOM   6669  C  CG1   . VAL B 2 298  ? 188.063 112.390 166.385 1.00 124.08 ?  295  VAL B CG1   1 
ATOM   6670  C  CG2   . VAL B 2 298  ? 189.143 113.577 168.309 1.00 127.17 ?  295  VAL B CG2   1 
ATOM   6671  N  N     . GLY B 2 299  ? 187.547 115.478 164.619 1.00 132.44 ?  296  GLY B N     1 
ATOM   6672  C  CA    . GLY B 2 299  ? 186.780 115.711 163.417 1.00 117.31 ?  296  GLY B CA    1 
ATOM   6673  C  C     . GLY B 2 299  ? 185.324 115.940 163.770 1.00 109.61 ?  296  GLY B C     1 
ATOM   6674  O  O     . GLY B 2 299  ? 184.990 116.220 164.916 1.00 114.62 ?  296  GLY B O     1 
ATOM   6675  N  N     . VAL B 2 300  ? 184.469 115.808 162.757 1.00 100.00 ?  297  VAL B N     1 
ATOM   6676  C  CA    . VAL B 2 300  ? 183.034 115.939 162.971 1.00 96.96  ?  297  VAL B CA    1 
ATOM   6677  C  C     . VAL B 2 300  ? 182.517 114.735 163.745 1.00 102.03 ?  297  VAL B C     1 
ATOM   6678  O  O     . VAL B 2 300  ? 182.841 113.583 163.430 1.00 103.72 ?  297  VAL B O     1 
ATOM   6679  C  CB    . VAL B 2 300  ? 182.300 116.098 161.631 1.00 94.03  ?  297  VAL B CB    1 
ATOM   6680  C  CG1   . VAL B 2 300  ? 182.770 115.049 160.643 1.00 95.64  ?  297  VAL B CG1   1 
ATOM   6681  C  CG2   . VAL B 2 300  ? 180.803 115.963 161.836 1.00 94.03  ?  297  VAL B CG2   1 
ATOM   6682  N  N     . HIS B 2 301  ? 181.722 115.001 164.776 1.00 107.38 ?  298  HIS B N     1 
ATOM   6683  C  CA    . HIS B 2 301  ? 180.945 113.978 165.464 1.00 110.83 ?  298  HIS B CA    1 
ATOM   6684  C  C     . HIS B 2 301  ? 179.492 114.197 165.067 1.00 101.27 ?  298  HIS B C     1 
ATOM   6685  O  O     . HIS B 2 301  ? 178.888 115.214 165.429 1.00 100.12 ?  298  HIS B O     1 
ATOM   6686  C  CB    . HIS B 2 301  ? 181.142 114.052 166.976 1.00 123.17 ?  298  HIS B CB    1 
ATOM   6687  C  CG    . HIS B 2 301  ? 182.559 113.828 167.409 1.00 135.70 ?  298  HIS B CG    1 
ATOM   6688  N  ND1   . HIS B 2 301  ? 183.537 113.379 166.548 1.00 134.71 ?  298  HIS B ND1   1 
ATOM   6689  C  CD2   . HIS B 2 301  ? 183.161 113.990 168.611 1.00 144.20 ?  298  HIS B CD2   1 
ATOM   6690  C  CE1   . HIS B 2 301  ? 184.682 113.276 167.200 1.00 137.23 ?  298  HIS B CE1   1 
ATOM   6691  N  NE2   . HIS B 2 301  ? 184.480 113.640 168.454 1.00 140.41 ?  298  HIS B NE2   1 
ATOM   6692  N  N     . MET B 2 302  ? 178.953 113.261 164.294 1.00 94.39  ?  299  MET B N     1 
ATOM   6693  C  CA    . MET B 2 302  ? 177.613 113.386 163.752 1.00 91.47  ?  299  MET B CA    1 
ATOM   6694  C  C     . MET B 2 302  ? 176.578 112.942 164.778 1.00 88.00  ?  299  MET B C     1 
ATOM   6695  O  O     . MET B 2 302  ? 176.877 112.214 165.728 1.00 90.42  ?  299  MET B O     1 
ATOM   6696  C  CB    . MET B 2 302  ? 177.472 112.553 162.479 1.00 95.62  ?  299  MET B CB    1 
ATOM   6697  C  CG    . MET B 2 302  ? 176.332 112.982 161.578 1.00 99.78  ?  299  MET B CG    1 
ATOM   6698  S  SD    . MET B 2 302  ? 176.653 114.585 160.824 1.00 104.52 ?  299  MET B SD    1 
ATOM   6699  C  CE    . MET B 2 302  ? 178.160 114.234 159.922 1.00 92.93  ?  299  MET B CE    1 
ATOM   6700  N  N     . GLU B 2 303  ? 175.346 113.402 164.577 1.00 86.84  ?  300  GLU B N     1 
ATOM   6701  C  CA    . GLU B 2 303  ? 174.239 112.957 165.409 1.00 89.56  ?  300  GLU B CA    1 
ATOM   6702  C  C     . GLU B 2 303  ? 172.937 113.354 164.728 1.00 87.78  ?  300  GLU B C     1 
ATOM   6703  O  O     . GLU B 2 303  ? 172.889 114.337 163.983 1.00 88.32  ?  300  GLU B O     1 
ATOM   6704  C  CB    . GLU B 2 303  ? 174.336 113.565 166.817 1.00 98.70  ?  300  GLU B CB    1 
ATOM   6705  C  CG    . GLU B 2 303  ? 173.325 113.062 167.831 1.00 111.09 ?  300  GLU B CG    1 
ATOM   6706  C  CD    . GLU B 2 303  ? 172.039 113.852 167.796 1.00 118.19 ?  300  GLU B CD    1 
ATOM   6707  O  OE1   . GLU B 2 303  ? 171.969 114.824 167.019 1.00 107.66 ?  300  GLU B OE1   1 
ATOM   6708  O  OE2   . GLU B 2 303  ? 171.096 113.506 168.537 1.00 169.37 -1 300  GLU B OE2   1 
ATOM   6709  N  N     . SER B 2 304  ? 171.886 112.582 164.992 1.00 89.76  ?  301  SER B N     1 
ATOM   6710  C  CA    . SER B 2 304  ? 170.537 112.888 164.522 1.00 92.00  ?  301  SER B CA    1 
ATOM   6711  C  C     . SER B 2 304  ? 169.685 113.251 165.735 1.00 96.96  ?  301  SER B C     1 
ATOM   6712  O  O     . SER B 2 304  ? 169.161 112.368 166.422 1.00 98.51  ?  301  SER B O     1 
ATOM   6713  C  CB    . SER B 2 304  ? 169.944 111.708 163.758 1.00 91.98  ?  301  SER B CB    1 
ATOM   6714  O  OG    . SER B 2 304  ? 168.582 111.940 163.443 1.00 93.79  ?  301  SER B OG    1 
ATOM   6715  N  N     . ARG B 2 305  ? 169.546 114.548 165.995 1.00 97.48  ?  302  ARG B N     1 
ATOM   6716  C  CA    . ARG B 2 305  ? 168.765 115.018 167.133 1.00 99.61  ?  302  ARG B CA    1 
ATOM   6717  C  C     . ARG B 2 305  ? 167.278 114.838 166.839 1.00 90.95  ?  302  ARG B C     1 
ATOM   6718  O  O     . ARG B 2 305  ? 166.874 114.256 165.829 1.00 81.74  ?  302  ARG B O     1 
ATOM   6719  C  CB    . ARG B 2 305  ? 169.091 116.474 167.461 1.00 101.72 ?  302  ARG B CB    1 
ATOM   6720  C  CG    . ARG B 2 305  ? 170.127 116.676 168.565 1.00 99.90  ?  302  ARG B CG    1 
ATOM   6721  C  CD    . ARG B 2 305  ? 169.749 115.943 169.846 1.00 101.97 ?  302  ARG B CD    1 
ATOM   6722  N  NE    . ARG B 2 305  ? 168.545 116.484 170.471 1.00 104.93 ?  302  ARG B NE    1 
ATOM   6723  C  CZ    . ARG B 2 305  ? 168.050 116.059 171.630 1.00 105.94 ?  302  ARG B CZ    1 
ATOM   6724  N  NH1   . ARG B 2 305  ? 166.950 116.608 172.125 1.00 102.90 ?  302  ARG B NH1   1 
ATOM   6725  N  NH2   . ARG B 2 305  ? 168.652 115.080 172.293 1.00 104.88 ?  302  ARG B NH2   1 
ATOM   6726  N  N     . GLU B 2 306  ? 166.452 115.350 167.735 1.00 99.75  ?  303  GLU B N     1 
ATOM   6727  C  CA    . GLU B 2 306  ? 165.007 115.217 167.648 1.00 110.89 ?  303  GLU B CA    1 
ATOM   6728  C  C     . GLU B 2 306  ? 164.461 116.067 166.510 1.00 98.60  ?  303  GLU B C     1 
ATOM   6729  O  O     . GLU B 2 306  ? 164.556 117.300 166.579 1.00 94.94  ?  303  GLU B O     1 
ATOM   6730  C  CB    . GLU B 2 306  ? 164.378 115.634 168.976 1.00 126.28 ?  303  GLU B CB    1 
ATOM   6731  C  CG    . GLU B 2 306  ? 162.908 115.282 169.133 1.00 144.12 ?  303  GLU B CG    1 
ATOM   6732  C  CD    . GLU B 2 306  ? 162.695 113.847 169.574 1.00 168.26 ?  303  GLU B CD    1 
ATOM   6733  O  OE1   . GLU B 2 306  ? 163.696 113.149 169.840 1.00 154.59 ?  303  GLU B OE1   1 
ATOM   6734  O  OE2   . GLU B 2 306  ? 161.525 113.419 169.665 1.00 227.86 -1 303  GLU B OE2   1 
ATOM   6735  N  N     . PRO B 2 307  ? 163.906 115.478 165.455 1.00 91.09  ?  304  PRO B N     1 
ATOM   6736  C  CA    . PRO B 2 307  ? 163.241 116.278 164.430 1.00 83.08  ?  304  PRO B CA    1 
ATOM   6737  C  C     . PRO B 2 307  ? 161.849 116.677 164.885 1.00 78.76  ?  304  PRO B C     1 
ATOM   6738  O  O     . PRO B 2 307  ? 160.946 115.830 164.967 1.00 79.94  ?  304  PRO B O     1 
ATOM   6739  C  CB    . PRO B 2 307  ? 163.187 115.330 163.224 1.00 82.42  ?  304  PRO B CB    1 
ATOM   6740  C  CG    . PRO B 2 307  ? 163.138 113.971 163.831 1.00 83.60  ?  304  PRO B CG    1 
ATOM   6741  C  CD    . PRO B 2 307  ? 163.930 114.043 165.112 1.00 90.22  ?  304  PRO B CD    1 
ATOM   6742  N  N     . PRO B 2 308  ? 161.634 117.955 165.195 1.00 75.56  ?  305  PRO B N     1 
ATOM   6743  C  CA    . PRO B 2 308  ? 160.299 118.385 165.621 1.00 74.63  ?  305  PRO B CA    1 
ATOM   6744  C  C     . PRO B 2 308  ? 159.295 118.147 164.508 1.00 80.51  ?  305  PRO B C     1 
ATOM   6745  O  O     . PRO B 2 308  ? 159.630 118.193 163.322 1.00 79.56  ?  305  PRO B O     1 
ATOM   6746  C  CB    . PRO B 2 308  ? 160.474 119.884 165.903 1.00 76.62  ?  305  PRO B CB    1 
ATOM   6747  C  CG    . PRO B 2 308  ? 161.950 120.138 165.863 1.00 75.13  ?  305  PRO B CG    1 
ATOM   6748  C  CD    . PRO B 2 308  ? 162.534 119.096 164.978 1.00 75.34  ?  305  PRO B CD    1 
ATOM   6749  N  N     . GLN B 2 309  ? 158.053 117.873 164.895 1.00 95.18  ?  306  GLN B N     1 
ATOM   6750  C  CA    . GLN B 2 309  ? 157.020 117.656 163.892 1.00 103.83 ?  306  GLN B CA    1 
ATOM   6751  C  C     . GLN B 2 309  ? 156.679 118.997 163.247 1.00 100.40 ?  306  GLN B C     1 
ATOM   6752  O  O     . GLN B 2 309  ? 156.238 119.935 163.919 1.00 98.68  ?  306  GLN B O     1 
ATOM   6753  C  CB    . GLN B 2 309  ? 155.799 116.961 164.502 1.00 112.28 ?  306  GLN B CB    1 
ATOM   6754  C  CG    . GLN B 2 309  ? 154.763 117.823 165.223 1.00 114.80 ?  306  GLN B CG    1 
ATOM   6755  C  CD    . GLN B 2 309  ? 155.300 118.463 166.487 1.00 115.55 ?  306  GLN B CD    1 
ATOM   6756  O  OE1   . GLN B 2 309  ? 155.547 117.784 167.483 1.00 116.19 ?  306  GLN B OE1   1 
ATOM   6757  N  NE2   . GLN B 2 309  ? 155.481 119.778 166.453 1.00 110.40 ?  306  GLN B NE2   1 
ATOM   6758  N  N     . TRP B 2 310  ? 156.962 119.116 161.954 1.00 92.77  ?  307  TRP B N     1 
ATOM   6759  C  CA    . TRP B 2 310  ? 156.560 120.303 161.221 1.00 87.53  ?  307  TRP B CA    1 
ATOM   6760  C  C     . TRP B 2 310  ? 155.056 120.272 160.972 1.00 90.46  ?  307  TRP B C     1 
ATOM   6761  O  O     . TRP B 2 310  ? 154.413 119.219 161.018 1.00 93.14  ?  307  TRP B O     1 
ATOM   6762  C  CB    . TRP B 2 310  ? 157.313 120.402 159.891 1.00 84.63  ?  307  TRP B CB    1 
ATOM   6763  C  CG    . TRP B 2 310  ? 158.753 119.991 159.966 1.00 84.23  ?  307  TRP B CG    1 
ATOM   6764  C  CD1   . TRP B 2 310  ? 159.257 118.737 159.778 1.00 83.95  ?  307  TRP B CD1   1 
ATOM   6765  C  CD2   . TRP B 2 310  ? 159.878 120.839 160.234 1.00 82.45  ?  307  TRP B CD2   1 
ATOM   6766  N  NE1   . TRP B 2 310  ? 160.624 118.750 159.916 1.00 80.45  ?  307  TRP B NE1   1 
ATOM   6767  C  CE2   . TRP B 2 310  ? 161.030 120.027 160.198 1.00 80.52  ?  307  TRP B CE2   1 
ATOM   6768  C  CE3   . TRP B 2 310  ? 160.022 122.203 160.505 1.00 79.96  ?  307  TRP B CE3   1 
ATOM   6769  C  CZ2   . TRP B 2 310  ? 162.308 120.534 160.422 1.00 79.49  ?  307  TRP B CZ2   1 
ATOM   6770  C  CZ3   . TRP B 2 310  ? 161.293 122.704 160.728 1.00 77.10  ?  307  TRP B CZ3   1 
ATOM   6771  C  CH2   . TRP B 2 310  ? 162.418 121.871 160.685 1.00 79.20  ?  307  TRP B CH2   1 
ATOM   6772  N  N     . THR B 2 311  ? 154.491 121.451 160.714 1.00 94.24  ?  308  THR B N     1 
ATOM   6773  C  CA    . THR B 2 311  ? 153.091 121.541 160.329 1.00 100.42 ?  308  THR B CA    1 
ATOM   6774  C  C     . THR B 2 311  ? 152.906 120.871 158.963 1.00 103.15 ?  308  THR B C     1 
ATOM   6775  O  O     . THR B 2 311  ? 153.863 120.426 158.323 1.00 97.91  ?  308  THR B O     1 
ATOM   6776  C  CB    . THR B 2 311  ? 152.641 123.004 160.305 1.00 94.55  ?  308  THR B CB    1 
ATOM   6777  O  OG1   . THR B 2 311  ? 153.021 123.640 161.532 1.00 91.86  ?  308  THR B OG1   1 
ATOM   6778  C  CG2   . THR B 2 311  ? 151.124 123.103 160.166 1.00 96.60  ?  308  THR B CG2   1 
ATOM   6779  N  N     . SER B 2 312  ? 151.654 120.787 158.507 1.00 107.65 ?  309  SER B N     1 
ATOM   6780  C  CA    . SER B 2 312  ? 151.384 120.115 157.239 1.00 107.68 ?  309  SER B CA    1 
ATOM   6781  C  C     . SER B 2 312  ? 151.820 120.963 156.047 1.00 102.54 ?  309  SER B C     1 
ATOM   6782  O  O     . SER B 2 312  ? 152.449 120.450 155.113 1.00 95.89  ?  309  SER B O     1 
ATOM   6783  C  CB    . SER B 2 312  ? 149.899 119.763 157.136 1.00 106.01 ?  309  SER B CB    1 
ATOM   6784  O  OG    . SER B 2 312  ? 149.092 120.927 157.187 1.00 103.98 ?  309  SER B OG    1 
ATOM   6785  N  N     . GLU B 2 313  ? 151.502 122.261 156.061 1.00 97.02  ?  310  GLU B N     1 
ATOM   6786  C  CA    . GLU B 2 313  ? 151.773 123.102 154.898 1.00 85.13  ?  310  GLU B CA    1 
ATOM   6787  C  C     . GLU B 2 313  ? 153.268 123.287 154.659 1.00 73.30  ?  310  GLU B C     1 
ATOM   6788  O  O     . GLU B 2 313  ? 153.699 123.383 153.504 1.00 72.18  ?  310  GLU B O     1 
ATOM   6789  C  CB    . GLU B 2 313  ? 151.090 124.462 155.057 1.00 87.03  ?  310  GLU B CB    1 
ATOM   6790  C  CG    . GLU B 2 313  ? 151.631 125.310 156.197 1.00 95.99  ?  310  GLU B CG    1 
ATOM   6791  C  CD    . GLU B 2 313  ? 151.087 126.724 156.183 1.00 114.70 ?  310  GLU B CD    1 
ATOM   6792  O  OE1   . GLU B 2 313  ? 150.036 126.952 155.548 1.00 110.35 ?  310  GLU B OE1   1 
ATOM   6793  O  OE2   . GLU B 2 313  ? 151.716 127.610 156.801 1.00 134.76 -1 310  GLU B OE2   1 
ATOM   6794  N  N     . ILE B 2 314  ? 154.072 123.336 155.725 1.00 60.95  ?  311  ILE B N     1 
ATOM   6795  C  CA    . ILE B 2 314  ? 155.513 123.496 155.556 1.00 50.23  ?  311  ILE B CA    1 
ATOM   6796  C  C     . ILE B 2 314  ? 156.145 122.221 155.010 1.00 56.47  ?  311  ILE B C     1 
ATOM   6797  O  O     . ILE B 2 314  ? 157.116 122.279 154.244 1.00 56.26  ?  311  ILE B O     1 
ATOM   6798  C  CB    . ILE B 2 314  ? 156.159 123.934 156.885 1.00 46.65  ?  311  ILE B CB    1 
ATOM   6799  C  CG1   . ILE B 2 314  ? 157.682 123.795 156.817 1.00 43.09  ?  311  ILE B CG1   1 
ATOM   6800  C  CG2   . ILE B 2 314  ? 155.594 123.142 158.042 1.00 60.52  ?  311  ILE B CG2   1 
ATOM   6801  C  CD1   . ILE B 2 314  ? 158.408 124.328 158.028 1.00 43.84  ?  311  ILE B CD1   1 
ATOM   6802  N  N     . SER B 2 315  ? 155.610 121.056 155.377 1.00 68.89  ?  312  SER B N     1 
ATOM   6803  C  CA    . SER B 2 315  ? 156.134 119.804 154.844 1.00 68.52  ?  312  SER B CA    1 
ATOM   6804  C  C     . SER B 2 315  ? 155.652 119.540 153.422 1.00 75.08  ?  312  SER B C     1 
ATOM   6805  O  O     . SER B 2 315  ? 156.371 118.911 152.637 1.00 74.28  ?  312  SER B O     1 
ATOM   6806  C  CB    . SER B 2 315  ? 155.740 118.638 155.753 1.00 74.60  ?  312  SER B CB    1 
ATOM   6807  O  OG    . SER B 2 315  ? 156.350 117.431 155.328 1.00 79.33  ?  312  SER B OG    1 
ATOM   6808  N  N     . HIS B 2 316  ? 154.453 120.005 153.076 1.00 82.75  ?  313  HIS B N     1 
ATOM   6809  C  CA    . HIS B 2 316  ? 153.879 119.791 151.754 1.00 87.21  ?  313  HIS B CA    1 
ATOM   6810  C  C     . HIS B 2 316  ? 154.215 120.906 150.773 1.00 81.31  ?  313  HIS B C     1 
ATOM   6811  O  O     . HIS B 2 316  ? 153.708 120.896 149.646 1.00 79.29  ?  313  HIS B O     1 
ATOM   6812  C  CB    . HIS B 2 316  ? 152.358 119.635 151.854 1.00 91.63  ?  313  HIS B CB    1 
ATOM   6813  C  CG    . HIS B 2 316  ? 151.896 118.211 151.840 1.00 103.85 ?  313  HIS B CG    1 
ATOM   6814  N  ND1   . HIS B 2 316  ? 152.098 117.353 152.899 1.00 108.10 ?  313  HIS B ND1   1 
ATOM   6815  C  CD2   . HIS B 2 316  ? 151.245 117.494 150.894 1.00 103.21 ?  313  HIS B CD2   1 
ATOM   6816  C  CE1   . HIS B 2 316  ? 151.590 116.169 152.608 1.00 107.03 ?  313  HIS B CE1   1 
ATOM   6817  N  NE2   . HIS B 2 316  ? 151.066 116.228 151.397 1.00 104.92 ?  313  HIS B NE2   1 
ATOM   6818  N  N     . SER B 2 317  ? 155.045 121.862 151.170 1.00 77.23  ?  314  SER B N     1 
ATOM   6819  C  CA    . SER B 2 317  ? 155.477 122.913 150.264 1.00 70.91  ?  314  SER B CA    1 
ATOM   6820  C  C     . SER B 2 317  ? 156.741 122.491 149.530 1.00 62.36  ?  314  SER B C     1 
ATOM   6821  O  O     . SER B 2 317  ? 157.515 121.658 150.008 1.00 60.62  ?  314  SER B O     1 
ATOM   6822  C  CB    . SER B 2 317  ? 155.725 124.219 151.018 1.00 62.95  ?  314  SER B CB    1 
ATOM   6823  O  OG    . SER B 2 317  ? 156.370 125.169 150.186 1.00 55.68  ?  314  SER B OG    1 
ATOM   6824  N  N     . ARG B 2 318  ? 156.941 123.080 148.354 1.00 62.08  ?  315  ARG B N     1 
ATOM   6825  C  CA    . ARG B 2 318  ? 158.092 122.725 147.534 1.00 63.73  ?  315  ARG B CA    1 
ATOM   6826  C  C     . ARG B 2 318  ? 159.387 123.238 148.152 1.00 59.32  ?  315  ARG B C     1 
ATOM   6827  O  O     . ARG B 2 318  ? 160.308 122.462 148.436 1.00 54.58  ?  315  ARG B O     1 
ATOM   6828  C  CB    . ARG B 2 318  ? 157.911 123.278 146.122 1.00 71.70  ?  315  ARG B CB    1 
ATOM   6829  C  CG    . ARG B 2 318  ? 159.115 123.076 145.235 1.00 75.05  ?  315  ARG B CG    1 
ATOM   6830  C  CD    . ARG B 2 318  ? 159.412 121.600 145.066 1.00 80.08  ?  315  ARG B CD    1 
ATOM   6831  N  NE    . ARG B 2 318  ? 160.418 121.369 144.036 1.00 89.80  ?  315  ARG B NE    1 
ATOM   6832  C  CZ    . ARG B 2 318  ? 160.153 121.321 142.735 1.00 101.56 ?  315  ARG B CZ    1 
ATOM   6833  N  NH1   . ARG B 2 318  ? 161.131 121.105 141.866 1.00 98.11  ?  315  ARG B NH1   1 
ATOM   6834  N  NH2   . ARG B 2 318  ? 158.910 121.490 142.303 1.00 100.43 ?  315  ARG B NH2   1 
ATOM   6835  N  N     . THR B 2 319  ? 159.475 124.546 148.368 1.00 56.66  ?  316  THR B N     1 
ATOM   6836  C  CA    . THR B 2 319  ? 160.709 125.193 148.785 1.00 47.17  ?  316  THR B CA    1 
ATOM   6837  C  C     . THR B 2 319  ? 160.529 125.923 150.107 1.00 44.89  ?  316  THR B C     1 
ATOM   6838  O  O     . THR B 2 319  ? 159.410 126.188 150.556 1.00 48.50  ?  316  THR B O     1 
ATOM   6839  C  CB    . THR B 2 319  ? 161.194 126.194 147.735 1.00 44.73  ?  316  THR B CB    1 
ATOM   6840  O  OG1   . THR B 2 319  ? 162.329 126.895 148.257 1.00 42.15  ?  316  THR B OG1   1 
ATOM   6841  C  CG2   . THR B 2 319  ? 160.102 127.197 147.430 1.00 48.03  ?  316  THR B CG2   1 
ATOM   6842  N  N     . TRP B 2 320  ? 161.664 126.270 150.713 1.00 39.18  ?  317  TRP B N     1 
ATOM   6843  C  CA    . TRP B 2 320  ? 161.693 127.059 151.937 1.00 36.44  ?  317  TRP B CA    1 
ATOM   6844  C  C     . TRP B 2 320  ? 163.138 127.361 152.296 1.00 32.87  ?  317  TRP B C     1 
ATOM   6845  O  O     . TRP B 2 320  ? 164.065 126.675 151.853 1.00 35.01  ?  317  TRP B O     1 
ATOM   6846  C  CB    . TRP B 2 320  ? 161.020 126.348 153.101 1.00 41.99  ?  317  TRP B CB    1 
ATOM   6847  C  CG    . TRP B 2 320  ? 161.304 124.884 153.219 1.00 51.76  ?  317  TRP B CG    1 
ATOM   6848  C  CD1   . TRP B 2 320  ? 160.553 123.859 152.721 1.00 57.93  ?  317  TRP B CD1   1 
ATOM   6849  C  CD2   . TRP B 2 320  ? 162.396 124.278 153.918 1.00 47.49  ?  317  TRP B CD2   1 
ATOM   6850  N  NE1   . TRP B 2 320  ? 161.116 122.654 153.058 1.00 51.72  ?  317  TRP B NE1   1 
ATOM   6851  C  CE2   . TRP B 2 320  ? 162.249 122.884 153.791 1.00 47.41  ?  317  TRP B CE2   1 
ATOM   6852  C  CE3   . TRP B 2 320  ? 163.488 124.780 154.632 1.00 42.67  ?  317  TRP B CE3   1 
ATOM   6853  C  CZ2   . TRP B 2 320  ? 163.148 121.988 154.350 1.00 44.52  ?  317  TRP B CZ2   1 
ATOM   6854  C  CZ3   . TRP B 2 320  ? 164.377 123.887 155.186 1.00 39.82  ?  317  TRP B CZ3   1 
ATOM   6855  C  CH2   . TRP B 2 320  ? 164.200 122.507 155.043 1.00 40.58  ?  317  TRP B CH2   1 
ATOM   6856  N  N     . PHE B 2 321  ? 163.312 128.370 153.144 1.00 34.91  ?  318  PHE B N     1 
ATOM   6857  C  CA    . PHE B 2 321  ? 164.646 128.897 153.407 1.00 32.57  ?  318  PHE B CA    1 
ATOM   6858  C  C     . PHE B 2 321  ? 164.663 129.509 154.800 1.00 33.40  ?  318  PHE B C     1 
ATOM   6859  O  O     . PHE B 2 321  ? 163.753 129.291 155.603 1.00 38.82  ?  318  PHE B O     1 
ATOM   6860  C  CB    . PHE B 2 321  ? 165.022 129.927 152.338 1.00 31.46  ?  318  PHE B CB    1 
ATOM   6861  C  CG    . PHE B 2 321  ? 163.996 131.010 152.172 1.00 36.38  ?  318  PHE B CG    1 
ATOM   6862  C  CD1   . PHE B 2 321  ? 164.000 132.117 153.004 1.00 35.71  ?  318  PHE B CD1   1 
ATOM   6863  C  CD2   . PHE B 2 321  ? 163.008 130.908 151.206 1.00 40.52  ?  318  PHE B CD2   1 
ATOM   6864  C  CE1   . PHE B 2 321  ? 163.052 133.111 152.864 1.00 38.28  ?  318  PHE B CE1   1 
ATOM   6865  C  CE2   . PHE B 2 321  ? 162.055 131.902 151.062 1.00 41.88  ?  318  PHE B CE2   1 
ATOM   6866  C  CZ    . PHE B 2 321  ? 162.080 133.005 151.892 1.00 40.73  ?  318  PHE B CZ    1 
ATOM   6867  N  N     . GLY B 2 322  ? 165.692 130.290 155.080 1.00 25.49  ?  319  GLY B N     1 
ATOM   6868  C  CA    . GLY B 2 322  ? 165.731 131.081 156.290 1.00 31.16  ?  319  GLY B CA    1 
ATOM   6869  C  C     . GLY B 2 322  ? 167.159 131.321 156.734 1.00 32.69  ?  319  GLY B C     1 
ATOM   6870  O  O     . GLY B 2 322  ? 168.114 131.037 156.016 1.00 34.96  ?  319  GLY B O     1 
ATOM   6871  N  N     . GLY B 2 323  ? 167.277 131.850 157.952 1.00 33.70  ?  320  GLY B N     1 
ATOM   6872  C  CA    . GLY B 2 323  ? 168.564 132.145 158.544 1.00 35.18  ?  320  GLY B CA    1 
ATOM   6873  C  C     . GLY B 2 323  ? 168.608 131.698 159.993 1.00 43.31  ?  320  GLY B C     1 
ATOM   6874  O  O     . GLY B 2 323  ? 167.613 131.232 160.550 1.00 44.77  ?  320  GLY B O     1 
ATOM   6875  N  N     . SER B 2 324  ? 169.785 131.845 160.592 1.00 47.61  ?  321  SER B N     1 
ATOM   6876  C  CA    . SER B 2 324  ? 170.016 131.438 161.973 1.00 53.15  ?  321  SER B CA    1 
ATOM   6877  C  C     . SER B 2 324  ? 169.975 132.673 162.864 1.00 59.27  ?  321  SER B C     1 
ATOM   6878  O  O     . SER B 2 324  ? 170.839 133.550 162.762 1.00 60.12  ?  321  SER B O     1 
ATOM   6879  C  CB    . SER B 2 324  ? 171.352 130.714 162.113 1.00 53.73  ?  321  SER B CB    1 
ATOM   6880  O  OG    . SER B 2 324  ? 172.423 131.554 161.718 1.00 53.21  ?  321  SER B OG    1 
ATOM   6881  N  N     . LEU B 2 325  ? 168.977 132.733 163.749 1.00 62.77  ?  322  LEU B N     1 
ATOM   6882  C  CA    . LEU B 2 325  ? 168.924 133.793 164.747 1.00 65.63  ?  322  LEU B CA    1 
ATOM   6883  C  C     . LEU B 2 325  ? 170.085 133.733 165.727 1.00 78.58  ?  322  LEU B C     1 
ATOM   6884  O  O     . LEU B 2 325  ? 170.273 134.684 166.495 1.00 80.67  ?  322  LEU B O     1 
ATOM   6885  C  CB    . LEU B 2 325  ? 167.612 133.719 165.524 1.00 63.26  ?  322  LEU B CB    1 
ATOM   6886  C  CG    . LEU B 2 325  ? 166.394 134.318 164.834 1.00 57.56  ?  322  LEU B CG    1 
ATOM   6887  C  CD1   . LEU B 2 325  ? 165.161 134.060 165.673 1.00 66.00  ?  322  LEU B CD1   1 
ATOM   6888  C  CD2   . LEU B 2 325  ? 166.611 135.801 164.622 1.00 53.16  ?  322  LEU B CD2   1 
ATOM   6889  N  N     . GLY B 2 326  ? 170.855 132.647 165.725 1.00 85.97  ?  323  GLY B N     1 
ATOM   6890  C  CA    . GLY B 2 326  ? 171.930 132.465 166.677 1.00 90.01  ?  323  GLY B CA    1 
ATOM   6891  C  C     . GLY B 2 326  ? 171.442 131.898 167.993 1.00 87.14  ?  323  GLY B C     1 
ATOM   6892  O  O     . GLY B 2 326  ? 170.280 132.091 168.365 1.00 87.91  ?  323  GLY B O     1 
ATOM   6893  N  N     . LYS B 2 327  ? 172.325 131.191 168.700 1.00 83.79  ?  324  LYS B N     1 
ATOM   6894  C  CA    . LYS B 2 327  ? 172.029 130.628 170.021 1.00 82.36  ?  324  LYS B CA    1 
ATOM   6895  C  C     . LYS B 2 327  ? 170.864 129.640 169.959 1.00 83.26  ?  324  LYS B C     1 
ATOM   6896  O  O     . LYS B 2 327  ? 169.934 129.687 170.768 1.00 84.40  ?  324  LYS B O     1 
ATOM   6897  C  CB    . LYS B 2 327  ? 171.755 131.733 171.049 1.00 78.72  ?  324  LYS B CB    1 
ATOM   6898  C  CG    . LYS B 2 327  ? 172.648 132.962 170.927 1.00 82.18  ?  324  LYS B CG    1 
ATOM   6899  C  CD    . LYS B 2 327  ? 174.125 132.593 170.932 1.00 86.72  ?  324  LYS B CD    1 
ATOM   6900  C  CE    . LYS B 2 327  ? 174.544 131.944 172.242 1.00 90.28  ?  324  LYS B CE    1 
ATOM   6901  N  NZ    . LYS B 2 327  ? 175.982 131.559 172.223 1.00 88.62  ?  324  LYS B NZ    1 
ATOM   6902  N  N     . GLY B 2 328  ? 170.922 128.731 168.983 1.00 83.50  ?  325  GLY B N     1 
ATOM   6903  C  CA    . GLY B 2 328  ? 169.905 127.715 168.815 1.00 84.68  ?  325  GLY B CA    1 
ATOM   6904  C  C     . GLY B 2 328  ? 168.598 128.218 168.260 1.00 86.06  ?  325  GLY B C     1 
ATOM   6905  O  O     . GLY B 2 328  ? 167.839 127.430 167.683 1.00 82.73  ?  325  GLY B O     1 
ATOM   6906  N  N     . THR B 2 329  ? 168.312 129.505 168.418 1.00 90.37  ?  326  THR B N     1 
ATOM   6907  C  CA    . THR B 2 329  ? 167.168 130.120 167.775 1.00 91.85  ?  326  THR B CA    1 
ATOM   6908  C  C     . THR B 2 329  ? 167.471 130.330 166.299 1.00 84.73  ?  326  THR B C     1 
ATOM   6909  O  O     . THR B 2 329  ? 168.590 130.693 165.923 1.00 83.62  ?  326  THR B O     1 
ATOM   6910  C  CB    . THR B 2 329  ? 166.831 131.452 168.448 1.00 91.66  ?  326  THR B CB    1 
ATOM   6911  O  OG1   . THR B 2 329  ? 168.031 132.214 168.640 1.00 90.34  ?  326  THR B OG1   1 
ATOM   6912  C  CG2   . THR B 2 329  ? 166.174 131.214 169.800 1.00 92.54  ?  326  THR B CG2   1 
ATOM   6913  N  N     . ALA B 2 330  ? 166.471 130.082 165.460 1.00 75.99  ?  327  ALA B N     1 
ATOM   6914  C  CA    . ALA B 2 330  ? 166.629 130.248 164.025 1.00 67.92  ?  327  ALA B CA    1 
ATOM   6915  C  C     . ALA B 2 330  ? 165.275 130.576 163.420 1.00 67.29  ?  327  ALA B C     1 
ATOM   6916  O  O     . ALA B 2 330  ? 164.229 130.221 163.972 1.00 69.05  ?  327  ALA B O     1 
ATOM   6917  C  CB    . ALA B 2 330  ? 167.223 128.994 163.371 1.00 62.00  ?  327  ALA B CB    1 
ATOM   6918  N  N     . LEU B 2 331  ? 165.302 131.274 162.290 1.00 58.15  ?  328  LEU B N     1 
ATOM   6919  C  CA    . LEU B 2 331  ? 164.100 131.661 161.570 1.00 51.92  ?  328  LEU B CA    1 
ATOM   6920  C  C     . LEU B 2 331  ? 164.054 130.913 160.245 1.00 43.76  ?  328  LEU B C     1 
ATOM   6921  O  O     . LEU B 2 331  ? 165.048 130.887 159.511 1.00 42.38  ?  328  LEU B O     1 
ATOM   6922  C  CB    . LEU B 2 331  ? 164.077 133.171 161.325 1.00 49.47  ?  328  LEU B CB    1 
ATOM   6923  C  CG    . LEU B 2 331  ? 162.960 133.672 160.411 1.00 46.97  ?  328  LEU B CG    1 
ATOM   6924  C  CD1   . LEU B 2 331  ? 161.607 133.281 160.979 1.00 52.40  ?  328  LEU B CD1   1 
ATOM   6925  C  CD2   . LEU B 2 331  ? 163.056 135.176 160.217 1.00 44.35  ?  328  LEU B CD2   1 
ATOM   6926  N  N     . VAL B 2 332  ? 162.914 130.291 159.949 1.00 40.49  ?  329  VAL B N     1 
ATOM   6927  C  CA    . VAL B 2 332  ? 162.690 129.689 158.643 1.00 37.22  ?  329  VAL B CA    1 
ATOM   6928  C  C     . VAL B 2 332  ? 161.409 130.278 158.072 1.00 38.13  ?  329  VAL B C     1 
ATOM   6929  O  O     . VAL B 2 332  ? 160.574 130.828 158.792 1.00 42.25  ?  329  VAL B O     1 
ATOM   6930  C  CB    . VAL B 2 332  ? 162.620 128.145 158.695 1.00 34.05  ?  329  VAL B CB    1 
ATOM   6931  C  CG1   . VAL B 2 332  ? 163.881 127.576 159.329 1.00 33.60  ?  329  VAL B CG1   1 
ATOM   6932  C  CG2   . VAL B 2 332  ? 161.385 127.685 159.450 1.00 40.17  ?  329  VAL B CG2   1 
ATOM   6933  N  N     . ALA B 2 333  ? 161.270 130.178 156.753 1.00 40.92  ?  330  ALA B N     1 
ATOM   6934  C  CA    . ALA B 2 333  ? 160.136 130.779 156.071 1.00 43.86  ?  330  ALA B CA    1 
ATOM   6935  C  C     . ALA B 2 333  ? 159.781 129.956 154.843 1.00 45.51  ?  330  ALA B C     1 
ATOM   6936  O  O     . ALA B 2 333  ? 160.651 129.353 154.196 1.00 43.44  ?  330  ALA B O     1 
ATOM   6937  C  CB    . ALA B 2 333  ? 160.420 132.233 155.675 1.00 44.11  ?  330  ALA B CB    1 
ATOM   6938  N  N     . ILE B 2 334  ? 158.485 129.945 154.537 1.00 48.23  ?  331  ILE B N     1 
ATOM   6939  C  CA    . ILE B 2 334  ? 157.941 129.183 153.417 1.00 45.20  ?  331  ILE B CA    1 
ATOM   6940  C  C     . ILE B 2 334  ? 157.162 130.161 152.550 1.00 54.84  ?  331  ILE B C     1 
ATOM   6941  O  O     . ILE B 2 334  ? 156.417 130.992 153.095 1.00 58.89  ?  331  ILE B O     1 
ATOM   6942  C  CB    . ILE B 2 334  ? 156.981 128.071 153.870 1.00 44.48  ?  331  ILE B CB    1 
ATOM   6943  C  CG1   . ILE B 2 334  ? 157.310 127.525 155.267 1.00 52.08  ?  331  ILE B CG1   1 
ATOM   6944  C  CG2   . ILE B 2 334  ? 157.008 126.943 152.858 1.00 44.73  ?  331  ILE B CG2   1 
ATOM   6945  C  CD1   . ILE B 2 334  ? 158.610 126.800 155.413 1.00 55.32  ?  331  ILE B CD1   1 
ATOM   6946  N  N     . PRO B 2 335  ? 157.247 130.087 151.221 1.00 55.83  ?  332  PRO B N     1 
ATOM   6947  C  CA    . PRO B 2 335  ? 156.349 130.905 150.396 1.00 60.20  ?  332  PRO B CA    1 
ATOM   6948  C  C     . PRO B 2 335  ? 154.894 130.479 150.528 1.00 64.37  ?  332  PRO B C     1 
ATOM   6949  O  O     . PRO B 2 335  ? 154.520 129.379 150.107 1.00 66.43  ?  332  PRO B O     1 
ATOM   6950  C  CB    . PRO B 2 335  ? 156.875 130.685 148.973 1.00 60.13  ?  332  PRO B CB    1 
ATOM   6951  C  CG    . PRO B 2 335  ? 157.557 129.367 149.024 1.00 58.32  ?  332  PRO B CG    1 
ATOM   6952  C  CD    . PRO B 2 335  ? 158.148 129.256 150.402 1.00 52.80  ?  332  PRO B CD    1 
ATOM   6953  N  N     . SER B 2 336  ? 154.063 131.346 151.111 1.00 73.94  ?  333  SER B N     1 
ATOM   6954  C  CA    . SER B 2 336  ? 152.651 131.032 151.292 1.00 83.95  ?  333  SER B CA    1 
ATOM   6955  C  C     . SER B 2 336  ? 151.976 130.881 149.937 1.00 99.10  ?  333  SER B C     1 
ATOM   6956  O  O     . SER B 2 336  ? 151.856 131.853 149.183 1.00 105.41 ?  333  SER B O     1 
ATOM   6957  C  CB    . SER B 2 336  ? 151.951 132.114 152.117 1.00 87.59  ?  333  SER B CB    1 
ATOM   6958  O  OG    . SER B 2 336  ? 151.452 133.148 151.286 1.00 96.07  ?  333  SER B OG    1 
ATOM   6959  N  N     . GLU B 2 337  ? 151.545 129.668 149.614 1.00 117.27 ?  334  GLU B N     1 
ATOM   6960  C  CA    . GLU B 2 337  ? 150.965 129.363 148.312 1.00 137.17 ?  334  GLU B CA    1 
ATOM   6961  C  C     . GLU B 2 337  ? 149.462 129.182 148.484 1.00 142.97 ?  334  GLU B C     1 
ATOM   6962  O  O     . GLU B 2 337  ? 148.998 128.137 148.948 1.00 136.79 ?  334  GLU B O     1 
ATOM   6963  C  CB    . GLU B 2 337  ? 151.612 128.126 147.700 1.00 145.09 ?  334  GLU B CB    1 
ATOM   6964  C  CG    . GLU B 2 337  ? 151.357 128.014 146.212 1.00 173.38 ?  334  GLU B CG    1 
ATOM   6965  C  CD    . GLU B 2 337  ? 151.611 129.325 145.491 1.00 193.31 ?  334  GLU B CD    1 
ATOM   6966  O  OE1   . GLU B 2 337  ? 152.736 129.857 145.600 1.00 177.91 ?  334  GLU B OE1   1 
ATOM   6967  O  OE2   . GLU B 2 337  ? 150.681 129.831 144.827 1.00 255.65 -1 334  GLU B OE2   1 
ATOM   6968  N  N     . GLY B 2 338  ? 148.711 130.205 148.101 1.00 149.16 ?  335  GLY B N     1 
ATOM   6969  C  CA    . GLY B 2 338  ? 147.267 130.166 148.193 1.00 149.95 ?  335  GLY B CA    1 
ATOM   6970  C  C     . GLY B 2 338  ? 146.694 131.534 147.911 1.00 161.70 ?  335  GLY B C     1 
ATOM   6971  O  O     . GLY B 2 338  ? 147.405 132.543 147.873 1.00 159.71 ?  335  GLY B O     1 
ATOM   6972  N  N     . ASN B 2 339  ? 145.381 131.550 147.706 1.00 169.56 ?  336  ASN B N     1 
ATOM   6973  C  CA    . ASN B 2 339  ? 144.692 132.806 147.446 1.00 175.93 ?  336  ASN B CA    1 
ATOM   6974  C  C     . ASN B 2 339  ? 144.132 133.378 148.747 1.00 178.42 ?  336  ASN B C     1 
ATOM   6975  O  O     . ASN B 2 339  ? 143.569 132.636 149.558 1.00 174.15 ?  336  ASN B O     1 
ATOM   6976  C  CB    . ASN B 2 339  ? 143.555 132.601 146.448 1.00 171.89 ?  336  ASN B CB    1 
ATOM   6977  C  CG    . ASN B 2 339  ? 143.947 132.973 145.030 1.00 162.00 ?  336  ASN B CG    1 
ATOM   6978  O  OD1   . ASN B 2 339  ? 145.106 133.285 144.756 1.00 165.18 ?  336  ASN B OD1   1 
ATOM   6979  N  ND2   . ASN B 2 339  ? 142.979 132.946 144.121 1.00 149.98 ?  336  ASN B ND2   1 
ATOM   6980  N  N     . PRO B 2 340  ? 144.279 134.692 148.981 1.00 182.04 ?  337  PRO B N     1 
ATOM   6981  C  CA    . PRO B 2 340  ? 144.987 135.606 148.081 1.00 183.73 ?  337  PRO B CA    1 
ATOM   6982  C  C     . PRO B 2 340  ? 146.444 135.841 148.475 1.00 182.23 ?  337  PRO B C     1 
ATOM   6983  O  O     . PRO B 2 340  ? 146.788 135.723 149.653 1.00 179.68 ?  337  PRO B O     1 
ATOM   6984  C  CB    . PRO B 2 340  ? 144.184 136.898 148.218 1.00 179.91 ?  337  PRO B CB    1 
ATOM   6985  C  CG    . PRO B 2 340  ? 143.733 136.880 149.643 1.00 173.44 ?  337  PRO B CG    1 
ATOM   6986  C  CD    . PRO B 2 340  ? 143.533 135.423 150.021 1.00 178.51 ?  337  PRO B CD    1 
ATOM   6987  N  N     . THR B 2 341  ? 147.283 136.160 147.495 1.00 179.20 ?  338  THR B N     1 
ATOM   6988  C  CA    . THR B 2 341  ? 148.645 136.580 147.791 1.00 178.12 ?  338  THR B CA    1 
ATOM   6989  C  C     . THR B 2 341  ? 148.594 137.836 148.659 1.00 184.86 ?  338  THR B C     1 
ATOM   6990  O  O     . THR B 2 341  ? 147.901 138.801 148.304 1.00 181.67 ?  338  THR B O     1 
ATOM   6991  C  CB    . THR B 2 341  ? 149.418 136.835 146.495 1.00 164.44 ?  338  THR B CB    1 
ATOM   6992  O  OG1   . THR B 2 341  ? 149.351 135.668 145.665 1.00 150.35 ?  338  THR B OG1   1 
ATOM   6993  C  CG2   . THR B 2 341  ? 150.876 137.134 146.787 1.00 163.47 ?  338  THR B CG2   1 
ATOM   6994  N  N     . PRO B 2 342  ? 149.285 137.861 149.794 1.00 178.16 ?  339  PRO B N     1 
ATOM   6995  C  CA    . PRO B 2 342  ? 148.968 138.837 150.854 1.00 180.78 ?  339  PRO B CA    1 
ATOM   6996  C  C     . PRO B 2 342  ? 149.273 140.282 150.480 1.00 181.06 ?  339  PRO B C     1 
ATOM   6997  O  O     . PRO B 2 342  ? 148.522 141.179 150.893 1.00 179.75 ?  339  PRO B O     1 
ATOM   6998  C  CB    . PRO B 2 342  ? 149.833 138.361 152.030 1.00 169.07 ?  339  PRO B CB    1 
ATOM   6999  C  CG    . PRO B 2 342  ? 149.958 136.885 151.793 1.00 158.08 ?  339  PRO B CG    1 
ATOM   7000  C  CD    . PRO B 2 342  ? 150.130 136.767 150.305 1.00 164.89 ?  339  PRO B CD    1 
ATOM   7001  N  N     . PRO B 2 343  ? 150.344 140.584 149.710 1.00 170.15 ?  340  PRO B N     1 
ATOM   7002  C  CA    . PRO B 2 343  ? 151.411 139.902 148.966 1.00 163.25 ?  340  PRO B CA    1 
ATOM   7003  C  C     . PRO B 2 343  ? 152.608 139.471 149.804 1.00 150.09 ?  340  PRO B C     1 
ATOM   7004  O  O     . PRO B 2 343  ? 153.590 138.984 149.243 1.00 142.63 ?  340  PRO B O     1 
ATOM   7005  C  CB    . PRO B 2 343  ? 151.842 140.959 147.950 1.00 148.12 ?  340  PRO B CB    1 
ATOM   7006  C  CG    . PRO B 2 343  ? 151.683 142.221 148.687 1.00 142.88 ?  340  PRO B CG    1 
ATOM   7007  C  CD    . PRO B 2 343  ? 150.434 142.045 149.517 1.00 162.00 ?  340  PRO B CD    1 
ATOM   7008  N  N     . GLU B 2 344  ? 152.539 139.648 151.123 1.00 146.18 ?  341  GLU B N     1 
ATOM   7009  C  CA    . GLU B 2 344  ? 153.556 139.090 152.011 1.00 135.69 ?  341  GLU B CA    1 
ATOM   7010  C  C     . GLU B 2 344  ? 153.326 137.584 152.050 1.00 127.78 ?  341  GLU B C     1 
ATOM   7011  O  O     . GLU B 2 344  ? 152.752 137.026 152.988 1.00 127.95 ?  341  GLU B O     1 
ATOM   7012  C  CB    . GLU B 2 344  ? 153.484 139.703 153.403 1.00 133.05 ?  341  GLU B CB    1 
ATOM   7013  C  CG    . GLU B 2 344  ? 154.763 139.528 154.215 1.00 138.79 ?  341  GLU B CG    1 
ATOM   7014  C  CD    . GLU B 2 344  ? 155.059 138.080 154.572 1.00 143.85 ?  341  GLU B CD    1 
ATOM   7015  O  OE1   . GLU B 2 344  ? 154.258 137.468 155.310 1.00 131.48 ?  341  GLU B OE1   1 
ATOM   7016  O  OE2   . GLU B 2 344  ? 156.084 137.548 154.094 1.00 178.12 -1 341  GLU B OE2   1 
ATOM   7017  N  N     . ALA B 2 345  ? 153.801 136.913 151.004 1.00 111.10 ?  342  ALA B N     1 
ATOM   7018  C  CA    . ALA B 2 345  ? 153.535 135.496 150.808 1.00 99.37  ?  342  ALA B CA    1 
ATOM   7019  C  C     . ALA B 2 345  ? 154.624 134.614 151.394 1.00 88.77  ?  342  ALA B C     1 
ATOM   7020  O  O     . ALA B 2 345  ? 154.908 133.543 150.848 1.00 79.82  ?  342  ALA B O     1 
ATOM   7021  C  CB    . ALA B 2 345  ? 153.341 135.200 149.321 1.00 101.66 ?  342  ALA B CB    1 
ATOM   7022  N  N     . TYR B 2 346  ? 155.253 135.046 152.486 1.00 90.68  ?  343  TYR B N     1 
ATOM   7023  C  CA    . TYR B 2 346  ? 156.277 134.267 153.178 1.00 81.51  ?  343  TYR B CA    1 
ATOM   7024  C  C     . TYR B 2 346  ? 155.875 134.134 154.643 1.00 79.80  ?  343  TYR B C     1 
ATOM   7025  O  O     . TYR B 2 346  ? 155.993 135.090 155.416 1.00 80.82  ?  343  TYR B O     1 
ATOM   7026  C  CB    . TYR B 2 346  ? 157.650 134.915 153.039 1.00 69.31  ?  343  TYR B CB    1 
ATOM   7027  C  CG    . TYR B 2 346  ? 158.194 134.856 151.636 1.00 60.44  ?  343  TYR B CG    1 
ATOM   7028  C  CD1   . TYR B 2 346  ? 158.870 133.733 151.184 1.00 55.87  ?  343  TYR B CD1   1 
ATOM   7029  C  CD2   . TYR B 2 346  ? 158.026 135.917 150.760 1.00 65.32  ?  343  TYR B CD2   1 
ATOM   7030  C  CE1   . TYR B 2 346  ? 159.367 133.669 149.900 1.00 52.37  ?  343  TYR B CE1   1 
ATOM   7031  C  CE2   . TYR B 2 346  ? 158.520 135.863 149.474 1.00 63.62  ?  343  TYR B CE2   1 
ATOM   7032  C  CZ    . TYR B 2 346  ? 159.190 134.737 149.049 1.00 56.17  ?  343  TYR B CZ    1 
ATOM   7033  O  OH    . TYR B 2 346  ? 159.683 134.680 147.766 1.00 52.35  ?  343  TYR B OH    1 
ATOM   7034  N  N     . HIS B 2 347  ? 155.405 132.950 155.022 1.00 65.66  ?  344  HIS B N     1 
ATOM   7035  C  CA    . HIS B 2 347  ? 155.098 132.685 156.420 1.00 52.25  ?  344  HIS B CA    1 
ATOM   7036  C  C     . HIS B 2 347  ? 156.361 132.281 157.163 1.00 52.57  ?  344  HIS B C     1 
ATOM   7037  O  O     . HIS B 2 347  ? 157.185 131.517 156.649 1.00 53.39  ?  344  HIS B O     1 
ATOM   7038  C  CB    . HIS B 2 347  ? 154.035 131.595 156.547 1.00 48.51  ?  344  HIS B CB    1 
ATOM   7039  C  CG    . HIS B 2 347  ? 152.651 132.074 156.250 1.00 53.79  ?  344  HIS B CG    1 
ATOM   7040  N  ND1   . HIS B 2 347  ? 151.702 131.283 155.638 1.00 65.05  ?  344  HIS B ND1   1 
ATOM   7041  C  CD2   . HIS B 2 347  ? 152.056 133.269 156.476 1.00 55.94  ?  344  HIS B CD2   1 
ATOM   7042  C  CE1   . HIS B 2 347  ? 150.582 131.970 155.503 1.00 66.31  ?  344  HIS B CE1   1 
ATOM   7043  N  NE2   . HIS B 2 347  ? 150.769 133.178 156.003 1.00 64.04  ?  344  HIS B NE2   1 
ATOM   7044  N  N     . PHE B 2 348  ? 156.509 132.803 158.378 1.00 55.05  ?  345  PHE B N     1 
ATOM   7045  C  CA    . PHE B 2 348  ? 157.707 132.621 159.183 1.00 59.10  ?  345  PHE B CA    1 
ATOM   7046  C  C     . PHE B 2 348  ? 157.428 131.697 160.360 1.00 62.11  ?  345  PHE B C     1 
ATOM   7047  O  O     . PHE B 2 348  ? 156.380 131.795 161.007 1.00 64.71  ?  345  PHE B O     1 
ATOM   7048  C  CB    . PHE B 2 348  ? 158.225 133.962 159.711 1.00 59.53  ?  345  PHE B CB    1 
ATOM   7049  C  CG    . PHE B 2 348  ? 158.780 134.863 158.650 1.00 52.96  ?  345  PHE B CG    1 
ATOM   7050  C  CD1   . PHE B 2 348  ? 160.079 134.705 158.199 1.00 49.54  ?  345  PHE B CD1   1 
ATOM   7051  C  CD2   . PHE B 2 348  ? 158.009 135.877 158.111 1.00 56.71  ?  345  PHE B CD2   1 
ATOM   7052  C  CE1   . PHE B 2 348  ? 160.596 135.535 157.227 1.00 46.23  ?  345  PHE B CE1   1 
ATOM   7053  C  CE2   . PHE B 2 348  ? 158.520 136.710 157.139 1.00 61.51  ?  345  PHE B CE2   1 
ATOM   7054  C  CZ    . PHE B 2 348  ? 159.815 136.538 156.696 1.00 51.60  ?  345  PHE B CZ    1 
ATOM   7055  N  N     . TYR B 2 349  ? 158.378 130.808 160.634 1.00 53.93  ?  346  TYR B N     1 
ATOM   7056  C  CA    . TYR B 2 349  ? 158.382 129.977 161.828 1.00 51.89  ?  346  TYR B CA    1 
ATOM   7057  C  C     . TYR B 2 349  ? 159.690 130.207 162.567 1.00 50.95  ?  346  TYR B C     1 
ATOM   7058  O  O     . TYR B 2 349  ? 160.764 130.215 161.951 1.00 51.33  ?  346  TYR B O     1 
ATOM   7059  C  CB    . TYR B 2 349  ? 158.242 128.490 161.485 1.00 54.20  ?  346  TYR B CB    1 
ATOM   7060  C  CG    . TYR B 2 349  ? 157.043 128.140 160.634 1.00 58.70  ?  346  TYR B CG    1 
ATOM   7061  C  CD1   . TYR B 2 349  ? 155.848 128.835 160.755 1.00 63.00  ?  346  TYR B CD1   1 
ATOM   7062  C  CD2   . TYR B 2 349  ? 157.109 127.110 159.709 1.00 57.60  ?  346  TYR B CD2   1 
ATOM   7063  C  CE1   . TYR B 2 349  ? 154.753 128.516 159.974 1.00 63.63  ?  346  TYR B CE1   1 
ATOM   7064  C  CE2   . TYR B 2 349  ? 156.021 126.783 158.926 1.00 59.07  ?  346  TYR B CE2   1 
ATOM   7065  C  CZ    . TYR B 2 349  ? 154.846 127.487 159.061 1.00 65.63  ?  346  TYR B CZ    1 
ATOM   7066  O  OH    . TYR B 2 349  ? 153.763 127.159 158.280 1.00 74.17  ?  346  TYR B OH    1 
ATOM   7067  N  N     . GLN B 2 350  ? 159.608 130.397 163.880 1.00 56.98  ?  347  GLN B N     1 
ATOM   7068  C  CA    . GLN B 2 350  ? 160.806 130.389 164.706 1.00 62.13  ?  347  GLN B CA    1 
ATOM   7069  C  C     . GLN B 2 350  ? 161.007 128.985 165.257 1.00 67.04  ?  347  GLN B C     1 
ATOM   7070  O  O     . GLN B 2 350  ? 160.064 128.370 165.762 1.00 69.40  ?  347  GLN B O     1 
ATOM   7071  C  CB    . GLN B 2 350  ? 160.713 131.401 165.846 1.00 66.32  ?  347  GLN B CB    1 
ATOM   7072  C  CG    . GLN B 2 350  ? 162.015 131.544 166.623 1.00 66.54  ?  347  GLN B CG    1 
ATOM   7073  C  CD    . GLN B 2 350  ? 161.906 132.516 167.780 1.00 68.80  ?  347  GLN B CD    1 
ATOM   7074  O  OE1   . GLN B 2 350  ? 160.820 132.998 168.101 1.00 73.53  ?  347  GLN B OE1   1 
ATOM   7075  N  NE2   . GLN B 2 350  ? 163.036 132.809 168.414 1.00 65.11  ?  347  GLN B NE2   1 
ATOM   7076  N  N     . VAL B 2 351  ? 162.231 128.478 165.156 1.00 65.49  ?  348  VAL B N     1 
ATOM   7077  C  CA    . VAL B 2 351  ? 162.549 127.115 165.557 1.00 64.99  ?  348  VAL B CA    1 
ATOM   7078  C  C     . VAL B 2 351  ? 163.793 127.145 166.431 1.00 68.92  ?  348  VAL B C     1 
ATOM   7079  O  O     . VAL B 2 351  ? 164.768 127.837 166.117 1.00 70.18  ?  348  VAL B O     1 
ATOM   7080  C  CB    . VAL B 2 351  ? 162.748 126.201 164.331 1.00 61.18  ?  348  VAL B CB    1 
ATOM   7081  C  CG1   . VAL B 2 351  ? 161.403 125.791 163.762 1.00 61.47  ?  348  VAL B CG1   1 
ATOM   7082  C  CG2   . VAL B 2 351  ? 163.562 126.917 163.268 1.00 58.92  ?  348  VAL B CG2   1 
ATOM   7083  N  N     . SER B 2 352  ? 163.755 126.403 167.535 1.00 74.58  ?  349  SER B N     1 
ATOM   7084  C  CA    . SER B 2 352  ? 164.828 126.471 168.517 1.00 80.09  ?  349  SER B CA    1 
ATOM   7085  C  C     . SER B 2 352  ? 165.201 125.077 169.001 1.00 89.52  ?  349  SER B C     1 
ATOM   7086  O  O     . SER B 2 352  ? 164.363 124.173 169.050 1.00 92.69  ?  349  SER B O     1 
ATOM   7087  C  CB    . SER B 2 352  ? 164.436 127.354 169.709 1.00 80.14  ?  349  SER B CB    1 
ATOM   7088  O  OG    . SER B 2 352  ? 163.113 127.079 170.133 1.00 76.35  ?  349  SER B OG    1 
ATOM   7089  N  N     . PHE B 2 353  ? 166.474 124.917 169.361 1.00 91.55  ?  350  PHE B N     1 
ATOM   7090  C  CA    . PHE B 2 353  ? 166.984 123.660 169.892 1.00 102.13 ?  350  PHE B CA    1 
ATOM   7091  C  C     . PHE B 2 353  ? 166.769 123.609 171.400 1.00 111.84 ?  350  PHE B C     1 
ATOM   7092  O  O     . PHE B 2 353  ? 166.905 124.623 172.092 1.00 110.18 ?  350  PHE B O     1 
ATOM   7093  C  CB    . PHE B 2 353  ? 168.470 123.497 169.557 1.00 104.76 ?  350  PHE B CB    1 
ATOM   7094  C  CG    . PHE B 2 353  ? 169.138 122.353 170.273 1.00 122.02 ?  350  PHE B CG    1 
ATOM   7095  C  CD1   . PHE B 2 353  ? 168.759 121.043 170.025 1.00 125.55 ?  350  PHE B CD1   1 
ATOM   7096  C  CD2   . PHE B 2 353  ? 170.154 122.587 171.186 1.00 124.63 ?  350  PHE B CD2   1 
ATOM   7097  C  CE1   . PHE B 2 353  ? 169.374 119.990 170.679 1.00 122.54 ?  350  PHE B CE1   1 
ATOM   7098  C  CE2   . PHE B 2 353  ? 170.774 121.537 171.842 1.00 124.69 ?  350  PHE B CE2   1 
ATOM   7099  C  CZ    . PHE B 2 353  ? 170.382 120.237 171.588 1.00 123.15 ?  350  PHE B CZ    1 
ATOM   7100  N  N     . GLN B 2 354  ? 166.428 122.421 171.899 1.00 112.95 ?  351  GLN B N     1 
ATOM   7101  C  CA    . GLN B 2 354  ? 166.083 122.210 173.308 1.00 109.88 ?  351  GLN B CA    1 
ATOM   7102  C  C     . GLN B 2 354  ? 164.960 123.141 173.761 1.00 105.14 ?  351  GLN B C     1 
ATOM   7103  O  O     . GLN B 2 354  ? 165.121 123.907 174.711 1.00 106.26 ?  351  GLN B O     1 
ATOM   7104  C  CB    . GLN B 2 354  ? 167.309 122.396 174.207 1.00 111.47 ?  351  GLN B CB    1 
ATOM   7105  C  CG    . GLN B 2 354  ? 168.235 121.191 174.261 1.00 114.19 ?  351  GLN B CG    1 
ATOM   7106  C  CD    . GLN B 2 354  ? 169.487 121.455 175.079 1.00 106.04 ?  351  GLN B CD    1 
ATOM   7107  O  OE1   . GLN B 2 354  ? 169.700 122.564 175.567 1.00 99.72  ?  351  GLN B OE1   1 
ATOM   7108  N  NE2   . GLN B 2 354  ? 170.322 120.433 175.229 1.00 102.12 ?  351  GLN B NE2   1 
ATOM   7109  N  N     . PHE C 1 607  ? 132.329 135.171 90.085  1.00 90.14  ?  479  PHE C N     1 
ATOM   7110  C  CA    . PHE C 1 607  ? 130.904 135.193 90.389  1.00 91.37  ?  479  PHE C CA    1 
ATOM   7111  C  C     . PHE C 1 607  ? 130.619 135.952 91.678  1.00 75.23  ?  479  PHE C C     1 
ATOM   7112  O  O     . PHE C 1 607  ? 131.261 135.711 92.701  1.00 68.33  ?  479  PHE C O     1 
ATOM   7113  C  CB    . PHE C 1 607  ? 130.351 133.766 90.507  1.00 99.58  ?  479  PHE C CB    1 
ATOM   7114  C  CG    . PHE C 1 607  ? 130.162 133.068 89.186  1.00 118.02 ?  479  PHE C CG    1 
ATOM   7115  C  CD1   . PHE C 1 607  ? 130.398 133.730 87.992  1.00 129.28 ?  479  PHE C CD1   1 
ATOM   7116  C  CD2   . PHE C 1 607  ? 129.737 131.749 89.142  1.00 113.93 ?  479  PHE C CD2   1 
ATOM   7117  C  CE1   . PHE C 1 607  ? 130.220 133.086 86.779  1.00 133.64 ?  479  PHE C CE1   1 
ATOM   7118  C  CE2   . PHE C 1 607  ? 129.557 131.101 87.933  1.00 117.00 ?  479  PHE C CE2   1 
ATOM   7119  C  CZ    . PHE C 1 607  ? 129.799 131.770 86.750  1.00 126.41 ?  479  PHE C CZ    1 
ATOM   7120  N  N     . GLY C 1 608  ? 129.664 136.879 91.629  1.00 77.82  ?  480  GLY C N     1 
ATOM   7121  C  CA    . GLY C 1 608  ? 129.102 137.393 92.862  1.00 69.83  ?  480  GLY C CA    1 
ATOM   7122  C  C     . GLY C 1 608  ? 128.500 136.266 93.676  1.00 61.85  ?  480  GLY C C     1 
ATOM   7123  O  O     . GLY C 1 608  ? 128.056 135.251 93.135  1.00 63.29  ?  480  GLY C O     1 
ATOM   7124  N  N     . LEU C 1 609  ? 128.508 136.423 94.995  1.00 42.98  ?  481  LEU C N     1 
ATOM   7125  C  CA    . LEU C 1 609  ? 128.102 135.335 95.875  1.00 30.77  ?  481  LEU C CA    1 
ATOM   7126  C  C     . LEU C 1 609  ? 126.684 135.544 96.390  1.00 24.57  ?  481  LEU C C     1 
ATOM   7127  O  O     . LEU C 1 609  ? 126.274 136.672 96.679  1.00 23.06  ?  481  LEU C O     1 
ATOM   7128  C  CB    . LEU C 1 609  ? 129.069 135.189 97.049  1.00 24.14  ?  481  LEU C CB    1 
ATOM   7129  C  CG    . LEU C 1 609  ? 129.020 133.813 97.712  1.00 22.80  ?  481  LEU C CG    1 
ATOM   7130  C  CD1   . LEU C 1 609  ? 129.009 132.720 96.655  1.00 21.75  ?  481  LEU C CD1   1 
ATOM   7131  C  CD2   . LEU C 1 609  ? 130.201 133.646 98.645  1.00 19.99  ?  481  LEU C CD2   1 
ATOM   7132  N  N     . HIS C 1 610  ? 125.948 134.445 96.506  1.00 23.64  ?  482  HIS C N     1 
ATOM   7133  C  CA    . HIS C 1 610  ? 124.556 134.457 96.940  1.00 23.90  ?  482  HIS C CA    1 
ATOM   7134  C  C     . HIS C 1 610  ? 124.427 135.081 98.330  1.00 21.49  ?  482  HIS C C     1 
ATOM   7135  O  O     . HIS C 1 610  ? 125.100 134.624 99.266  1.00 18.85  ?  482  HIS C O     1 
ATOM   7136  C  CB    . HIS C 1 610  ? 124.035 133.021 96.936  1.00 22.18  ?  482  HIS C CB    1 
ATOM   7137  C  CG    . HIS C 1 610  ? 122.583 132.897 96.595  1.00 29.58  ?  482  HIS C CG    1 
ATOM   7138  N  ND1   . HIS C 1 610  ? 121.660 133.873 96.903  1.00 30.70  ?  482  HIS C ND1   1 
ATOM   7139  C  CD2   . HIS C 1 610  ? 121.896 131.915 95.964  1.00 37.57  ?  482  HIS C CD2   1 
ATOM   7140  C  CE1   . HIS C 1 610  ? 120.466 133.495 96.484  1.00 43.80  ?  482  HIS C CE1   1 
ATOM   7141  N  NE2   . HIS C 1 610  ? 120.582 132.311 95.910  1.00 46.60  ?  482  HIS C NE2   1 
ATOM   7142  N  N     . PRO C 1 611  ? 123.596 136.118 98.510  1.00 17.20  ?  483  PRO C N     1 
ATOM   7143  C  CA    . PRO C 1 611  ? 123.508 136.769 99.833  1.00 11.52  ?  483  PRO C CA    1 
ATOM   7144  C  C     . PRO C 1 611  ? 123.160 135.822 100.968 1.00 9.44   ?  483  PRO C C     1 
ATOM   7145  O  O     . PRO C 1 611  ? 123.631 136.018 102.099 1.00 8.88   ?  483  PRO C O     1 
ATOM   7146  C  CB    . PRO C 1 611  ? 122.411 137.824 99.628  1.00 10.81  ?  483  PRO C CB    1 
ATOM   7147  C  CG    . PRO C 1 611  ? 122.449 138.121 98.175  1.00 12.70  ?  483  PRO C CG    1 
ATOM   7148  C  CD    . PRO C 1 611  ? 122.787 136.821 97.498  1.00 15.03  ?  483  PRO C CD    1 
ATOM   7149  N  N     . ALA C 1 612  ? 122.347 134.798 100.700 1.00 10.31  ?  484  ALA C N     1 
ATOM   7150  C  CA    . ALA C 1 612  ? 122.034 133.817 101.732 1.00 10.55  ?  484  ALA C CA    1 
ATOM   7151  C  C     . ALA C 1 612  ? 123.290 133.083 102.196 1.00 8.20   ?  484  ALA C C     1 
ATOM   7152  O  O     . ALA C 1 612  ? 123.465 132.835 103.398 1.00 5.60   ?  484  ALA C O     1 
ATOM   7153  C  CB    . ALA C 1 612  ? 120.985 132.837 101.213 1.00 13.88  ?  484  ALA C CB    1 
ATOM   7154  N  N     . VAL C 1 613  ? 124.177 132.731 101.258 1.00 11.15  ?  485  VAL C N     1 
ATOM   7155  C  CA    . VAL C 1 613  ? 125.439 132.088 101.621 1.00 7.96   ?  485  VAL C CA    1 
ATOM   7156  C  C     . VAL C 1 613  ? 126.264 133.000 102.516 1.00 4.74   ?  485  VAL C C     1 
ATOM   7157  O  O     . VAL C 1 613  ? 126.922 132.542 103.457 1.00 4.12   ?  485  VAL C O     1 
ATOM   7158  C  CB    . VAL C 1 613  ? 126.223 131.683 100.358 1.00 10.12  ?  485  VAL C CB    1 
ATOM   7159  C  CG1   . VAL C 1 613  ? 127.722 131.634 100.643 1.00 6.88   ?  485  VAL C CG1   1 
ATOM   7160  C  CG2   . VAL C 1 613  ? 125.746 130.338 99.852  1.00 15.06  ?  485  VAL C CG2   1 
ATOM   7161  N  N     . CYS C 1 614  ? 126.250 134.303 102.236 1.00 6.60   ?  486  CYS C N     1 
ATOM   7162  C  CA    . CYS C 1 614  ? 127.024 135.229 103.053 1.00 6.35   ?  486  CYS C CA    1 
ATOM   7163  C  C     . CYS C 1 614  ? 126.443 135.340 104.457 1.00 4.96   ?  486  CYS C C     1 
ATOM   7164  O  O     . CYS C 1 614  ? 127.188 135.385 105.444 1.00 5.30   ?  486  CYS C O     1 
ATOM   7165  C  CB    . CYS C 1 614  ? 127.083 136.597 102.379 1.00 12.11  ?  486  CYS C CB    1 
ATOM   7166  S  SG    . CYS C 1 614  ? 128.618 137.502 102.679 1.00 18.25  ?  486  CYS C SG    1 
ATOM   7167  N  N     . LEU C 1 615  ? 125.115 135.379 104.572 1.00 4.77   ?  487  LEU C N     1 
ATOM   7168  C  CA    . LEU C 1 615  ? 124.517 135.352 105.902 1.00 4.09   ?  487  LEU C CA    1 
ATOM   7169  C  C     . LEU C 1 615  ? 124.918 134.088 106.652 1.00 4.01   ?  487  LEU C C     1 
ATOM   7170  O  O     . LEU C 1 615  ? 125.306 134.139 107.829 1.00 4.94   ?  487  LEU C O     1 
ATOM   7171  C  CB    . LEU C 1 615  ? 122.999 135.457 105.808 1.00 6.46   ?  487  LEU C CB    1 
ATOM   7172  C  CG    . LEU C 1 615  ? 122.321 135.245 107.162 1.00 6.45   ?  487  LEU C CG    1 
ATOM   7173  C  CD1   . LEU C 1 615  ? 122.554 136.435 108.077 1.00 9.24   ?  487  LEU C CD1   1 
ATOM   7174  C  CD2   . LEU C 1 615  ? 120.846 134.989 106.968 1.00 7.05   ?  487  LEU C CD2   1 
ATOM   7175  N  N     . ALA C 1 616  ? 124.842 132.938 105.977 1.00 4.27   ?  488  ALA C N     1 
ATOM   7176  C  CA    . ALA C 1 616  ? 125.222 131.689 106.625 1.00 4.25   ?  488  ALA C CA    1 
ATOM   7177  C  C     . ALA C 1 616  ? 126.677 131.728 107.070 1.00 4.41   ?  488  ALA C C     1 
ATOM   7178  O  O     . ALA C 1 616  ? 126.999 131.360 108.205 1.00 4.96   ?  488  ALA C O     1 
ATOM   7179  C  CB    . ALA C 1 616  ? 124.974 130.506 105.690 1.00 7.37   ?  488  ALA C CB    1 
ATOM   7180  N  N     . ILE C 1 617  ? 127.569 132.208 106.201 1.00 5.46   ?  489  ILE C N     1 
ATOM   7181  C  CA    . ILE C 1 617  ? 128.981 132.282 106.544 1.00 5.00   ?  489  ILE C CA    1 
ATOM   7182  C  C     . ILE C 1 617  ? 129.274 133.332 107.600 1.00 5.94   ?  489  ILE C C     1 
ATOM   7183  O  O     . ILE C 1 617  ? 130.380 133.352 108.152 1.00 6.29   ?  489  ILE C O     1 
ATOM   7184  C  CB    . ILE C 1 617  ? 129.832 132.534 105.284 1.00 3.82   ?  489  ILE C CB    1 
ATOM   7185  C  CG1   . ILE C 1 617  ? 131.203 131.931 105.512 1.00 6.36   ?  489  ILE C CG1   1 
ATOM   7186  C  CG2   . ILE C 1 617  ? 129.985 134.011 105.017 1.00 4.05   ?  489  ILE C CG2   1 
ATOM   7187  C  CD1   . ILE C 1 617  ? 131.085 130.506 105.913 1.00 12.34  ?  489  ILE C CD1   1 
ATOM   7188  N  N     . ARG C 1 618  ? 128.322 134.219 107.886 1.00 5.88   ?  490  ARG C N     1 
ATOM   7189  C  CA    . ARG C 1 618  ? 128.482 135.066 109.061 1.00 6.02   ?  490  ARG C CA    1 
ATOM   7190  C  C     . ARG C 1 618  ? 127.995 134.376 110.329 1.00 4.75   ?  490  ARG C C     1 
ATOM   7191  O  O     . ARG C 1 618  ? 128.559 134.599 111.407 1.00 5.08   ?  490  ARG C O     1 
ATOM   7192  C  CB    . ARG C 1 618  ? 127.740 136.390 108.891 1.00 5.28   ?  490  ARG C CB    1 
ATOM   7193  C  CG    . ARG C 1 618  ? 128.136 137.406 109.949 1.00 3.60   ?  490  ARG C CG    1 
ATOM   7194  C  CD    . ARG C 1 618  ? 127.190 138.576 110.016 1.00 2.33   ?  490  ARG C CD    1 
ATOM   7195  N  NE    . ARG C 1 618  ? 126.119 138.330 110.974 1.00 3.26   ?  490  ARG C NE    1 
ATOM   7196  C  CZ    . ARG C 1 618  ? 125.276 139.263 111.395 1.00 6.31   ?  490  ARG C CZ    1 
ATOM   7197  N  NH1   . ARG C 1 618  ? 124.329 138.956 112.268 1.00 9.32   ?  490  ARG C NH1   1 
ATOM   7198  N  NH2   . ARG C 1 618  ? 125.390 140.508 110.951 1.00 7.85   ?  490  ARG C NH2   1 
ATOM   7199  N  N     . VAL C 1 619  ? 126.962 133.545 110.223 1.00 4.26   ?  491  VAL C N     1 
ATOM   7200  C  CA    . VAL C 1 619  ? 126.370 132.903 111.389 1.00 3.25   ?  491  VAL C CA    1 
ATOM   7201  C  C     . VAL C 1 619  ? 126.912 131.495 111.605 1.00 3.93   ?  491  VAL C C     1 
ATOM   7202  O  O     . VAL C 1 619  ? 127.185 131.102 112.741 1.00 5.19   ?  491  VAL C O     1 
ATOM   7203  C  CB    . VAL C 1 619  ? 124.831 132.897 111.267 1.00 2.99   ?  491  VAL C CB    1 
ATOM   7204  C  CG1   . VAL C 1 619  ? 124.235 131.720 112.020 1.00 2.28   ?  491  VAL C CG1   1 
ATOM   7205  C  CG2   . VAL C 1 619  ? 124.268 134.204 111.790 1.00 3.38   ?  491  VAL C CG2   1 
ATOM   7206  N  N     . ASN C 1 620  ? 127.081 130.718 110.533 1.00 4.75   ?  492  ASN C N     1 
ATOM   7207  C  CA    . ASN C 1 620  ? 127.490 129.328 110.697 1.00 5.78   ?  492  ASN C CA    1 
ATOM   7208  C  C     . ASN C 1 620  ? 128.888 129.188 111.286 1.00 4.83   ?  492  ASN C C     1 
ATOM   7209  O  O     . ASN C 1 620  ? 129.263 128.082 111.690 1.00 5.39   ?  492  ASN C O     1 
ATOM   7210  C  CB    . ASN C 1 620  ? 127.405 128.600 109.355 1.00 8.04   ?  492  ASN C CB    1 
ATOM   7211  C  CG    . ASN C 1 620  ? 127.168 127.112 109.509 1.00 7.71   ?  492  ASN C CG    1 
ATOM   7212  O  OD1   . ASN C 1 620  ? 127.241 126.567 110.609 1.00 7.45   ?  492  ASN C OD1   1 
ATOM   7213  N  ND2   . ASN C 1 620  ? 126.860 126.448 108.401 1.00 10.35  ?  492  ASN C ND2   1 
ATOM   7214  N  N     . THR C 1 621  ? 129.661 130.272 111.357 1.00 4.94   ?  493  THR C N     1 
ATOM   7215  C  CA    . THR C 1 621  ? 130.983 130.224 111.966 1.00 5.61   ?  493  THR C CA    1 
ATOM   7216  C  C     . THR C 1 621  ? 131.177 131.358 112.965 1.00 5.58   ?  493  THR C C     1 
ATOM   7217  O  O     . THR C 1 621  ? 132.282 131.893 113.098 1.00 4.77   ?  493  THR C O     1 
ATOM   7218  C  CB    . THR C 1 621  ? 132.081 130.247 110.904 1.00 6.86   ?  493  THR C CB    1 
ATOM   7219  O  OG1   . THR C 1 621  ? 133.341 130.521 111.526 1.00 6.65   ?  493  THR C OG1   1 
ATOM   7220  C  CG2   . THR C 1 621  ? 131.798 131.308 109.875 1.00 6.01   ?  493  THR C CG2   1 
ATOM   7221  N  N     . PHE C 1 622  ? 130.107 131.745 113.659 1.00 5.81   ?  494  PHE C N     1 
ATOM   7222  C  CA    . PHE C 1 622  ? 130.185 132.602 114.840 1.00 5.58   ?  494  PHE C CA    1 
ATOM   7223  C  C     . PHE C 1 622  ? 130.894 133.923 114.566 1.00 5.68   ?  494  PHE C C     1 
ATOM   7224  O  O     . PHE C 1 622  ? 131.318 134.603 115.506 1.00 7.61   ?  494  PHE C O     1 
ATOM   7225  C  CB    . PHE C 1 622  ? 130.887 131.882 115.996 1.00 5.49   ?  494  PHE C CB    1 
ATOM   7226  C  CG    . PHE C 1 622  ? 130.230 130.600 116.404 1.00 5.93   ?  494  PHE C CG    1 
ATOM   7227  C  CD1   . PHE C 1 622  ? 130.358 129.458 115.630 1.00 6.84   ?  494  PHE C CD1   1 
ATOM   7228  C  CD2   . PHE C 1 622  ? 129.498 130.530 117.570 1.00 7.23   ?  494  PHE C CD2   1 
ATOM   7229  C  CE1   . PHE C 1 622  ? 129.759 128.278 116.008 1.00 11.54  ?  494  PHE C CE1   1 
ATOM   7230  C  CE2   . PHE C 1 622  ? 128.899 129.350 117.951 1.00 8.74   ?  494  PHE C CE2   1 
ATOM   7231  C  CZ    . PHE C 1 622  ? 129.031 128.223 117.170 1.00 11.67  ?  494  PHE C CZ    1 
ATOM   7232  N  N     . LEU C 1 623  ? 131.051 134.289 113.297 1.00 4.86   ?  495  LEU C N     1 
ATOM   7233  C  CA    . LEU C 1 623  ? 131.708 135.541 112.959 1.00 5.13   ?  495  LEU C CA    1 
ATOM   7234  C  C     . LEU C 1 623  ? 130.992 136.714 113.620 1.00 7.04   ?  495  LEU C C     1 
ATOM   7235  O  O     . LEU C 1 623  ? 129.792 136.659 113.902 1.00 8.35   ?  495  LEU C O     1 
ATOM   7236  C  CB    . LEU C 1 623  ? 131.740 135.725 111.443 1.00 6.39   ?  495  LEU C CB    1 
ATOM   7237  C  CG    . LEU C 1 623  ? 133.137 135.646 110.833 1.00 6.37   ?  495  LEU C CG    1 
ATOM   7238  C  CD1   . LEU C 1 623  ? 133.101 135.857 109.323 1.00 6.91   ?  495  LEU C CD1   1 
ATOM   7239  C  CD2   . LEU C 1 623  ? 134.037 136.668 111.507 1.00 6.02   ?  495  LEU C CD2   1 
ATOM   7240  N  N     . SER C 1 624  ? 131.741 137.786 113.871 1.00 6.45   ?  496  SER C N     1 
ATOM   7241  C  CA    . SER C 1 624  ? 131.169 138.979 114.480 1.00 8.08   ?  496  SER C CA    1 
ATOM   7242  C  C     . SER C 1 624  ? 130.401 139.752 113.412 1.00 8.77   ?  496  SER C C     1 
ATOM   7243  O  O     . SER C 1 624  ? 130.115 139.244 112.325 1.00 7.40   ?  496  SER C O     1 
ATOM   7244  C  CB    . SER C 1 624  ? 132.248 139.866 115.088 1.00 10.79  ?  496  SER C CB    1 
ATOM   7245  O  OG    . SER C 1 624  ? 132.538 140.932 114.200 1.00 10.88  ?  496  SER C OG    1 
ATOM   7246  N  N     . CYS C 1 625  ? 130.054 141.001 113.715 1.00 11.76  ?  497  CYS C N     1 
ATOM   7247  C  CA    . CYS C 1 625  ? 129.455 141.900 112.737 1.00 12.89  ?  497  CYS C CA    1 
ATOM   7248  C  C     . CYS C 1 625  ? 130.426 142.962 112.245 1.00 7.53   ?  497  CYS C C     1 
ATOM   7249  O  O     . CYS C 1 625  ? 130.533 143.186 111.035 1.00 6.84   ?  497  CYS C O     1 
ATOM   7250  C  CB    . CYS C 1 625  ? 128.199 142.564 113.320 1.00 20.69  ?  497  CYS C CB    1 
ATOM   7251  S  SG    . CYS C 1 625  ? 126.784 141.445 113.507 1.00 30.78  ?  497  CYS C SG    1 
ATOM   7252  N  N     . SER C 1 626  ? 131.142 143.630 113.152 1.00 5.16   ?  498  SER C N     1 
ATOM   7253  C  CA    . SER C 1 626  ? 132.191 144.549 112.724 1.00 4.25   ?  498  SER C CA    1 
ATOM   7254  C  C     . SER C 1 626  ? 133.266 143.817 111.926 1.00 6.36   ?  498  SER C C     1 
ATOM   7255  O  O     . SER C 1 626  ? 133.693 144.284 110.861 1.00 7.75   ?  498  SER C O     1 
ATOM   7256  C  CB    . SER C 1 626  ? 132.802 145.244 113.938 1.00 6.64   ?  498  SER C CB    1 
ATOM   7257  O  OG    . SER C 1 626  ? 133.525 144.315 114.726 1.00 9.47   ?  498  SER C OG    1 
ATOM   7258  N  N     . GLN C 1 627  ? 133.719 142.665 112.436 1.00 7.32   ?  499  GLN C N     1 
ATOM   7259  C  CA    . GLN C 1 627  ? 134.749 141.883 111.751 1.00 7.73   ?  499  GLN C CA    1 
ATOM   7260  C  C     . GLN C 1 627  ? 134.331 141.553 110.326 1.00 7.90   ?  499  GLN C C     1 
ATOM   7261  O  O     . GLN C 1 627  ? 135.133 141.656 109.387 1.00 7.84   ?  499  GLN C O     1 
ATOM   7262  C  CB    . GLN C 1 627  ? 135.028 140.585 112.510 1.00 6.79   ?  499  GLN C CB    1 
ATOM   7263  C  CG    . GLN C 1 627  ? 135.642 140.741 113.882 1.00 7.80   ?  499  GLN C CG    1 
ATOM   7264  C  CD    . GLN C 1 627  ? 135.706 139.418 114.622 1.00 10.72  ?  499  GLN C CD    1 
ATOM   7265  O  OE1   . GLN C 1 627  ? 135.720 138.351 114.006 1.00 10.82  ?  499  GLN C OE1   1 
ATOM   7266  N  NE2   . GLN C 1 627  ? 135.736 139.480 115.947 1.00 10.84  ?  499  GLN C NE2   1 
ATOM   7267  N  N     . TYR C 1 628  ? 133.086 141.104 110.159 1.00 5.98   ?  500  TYR C N     1 
ATOM   7268  C  CA    . TYR C 1 628  ? 132.577 140.793 108.831 1.00 5.77   ?  500  TYR C CA    1 
ATOM   7269  C  C     . TYR C 1 628  ? 132.688 141.997 107.906 1.00 6.78   ?  500  TYR C C     1 
ATOM   7270  O  O     . TYR C 1 628  ? 133.138 141.872 106.761 1.00 8.87   ?  500  TYR C O     1 
ATOM   7271  C  CB    . TYR C 1 628  ? 131.131 140.313 108.927 1.00 5.10   ?  500  TYR C CB    1 
ATOM   7272  C  CG    . TYR C 1 628  ? 130.489 140.122 107.583 1.00 1.86   ?  500  TYR C CG    1 
ATOM   7273  C  CD1   . TYR C 1 628  ? 130.725 138.980 106.837 1.00 1.93   ?  500  TYR C CD1   1 
ATOM   7274  C  CD2   . TYR C 1 628  ? 129.651 141.088 107.055 1.00 1.69   ?  500  TYR C CD2   1 
ATOM   7275  C  CE1   . TYR C 1 628  ? 130.144 138.808 105.607 1.00 3.36   ?  500  TYR C CE1   1 
ATOM   7276  C  CE2   . TYR C 1 628  ? 129.069 140.926 105.830 1.00 6.79   ?  500  TYR C CE2   1 
ATOM   7277  C  CZ    . TYR C 1 628  ? 129.316 139.787 105.110 1.00 3.03   ?  500  TYR C CZ    1 
ATOM   7278  O  OH    . TYR C 1 628  ? 128.726 139.633 103.882 1.00 8.23   ?  500  TYR C OH    1 
ATOM   7279  N  N     . HIS C 1 629  ? 132.280 143.178 108.385 1.00 6.60   ?  501  HIS C N     1 
ATOM   7280  C  CA    . HIS C 1 629  ? 132.360 144.376 107.553 1.00 6.94   ?  501  HIS C CA    1 
ATOM   7281  C  C     . HIS C 1 629  ? 133.797 144.691 107.167 1.00 6.46   ?  501  HIS C C     1 
ATOM   7282  O  O     . HIS C 1 629  ? 134.075 145.052 106.016 1.00 7.23   ?  501  HIS C O     1 
ATOM   7283  C  CB    . HIS C 1 629  ? 131.746 145.574 108.273 1.00 6.22   ?  501  HIS C CB    1 
ATOM   7284  C  CG    . HIS C 1 629  ? 131.985 146.879 107.573 1.00 4.71   ?  501  HIS C CG    1 
ATOM   7285  N  ND1   . HIS C 1 629  ? 131.818 147.036 106.213 1.00 5.70   ?  501  HIS C ND1   1 
ATOM   7286  C  CD2   . HIS C 1 629  ? 132.397 148.081 108.042 1.00 6.32   ?  501  HIS C CD2   1 
ATOM   7287  C  CE1   . HIS C 1 629  ? 132.106 148.281 105.877 1.00 10.68  ?  501  HIS C CE1   1 
ATOM   7288  N  NE2   . HIS C 1 629  ? 132.461 148.936 106.968 1.00 11.35  ?  501  HIS C NE2   1 
ATOM   7289  N  N     . LYS C 1 630  ? 134.720 144.586 108.123 1.00 6.29   ?  502  LYS C N     1 
ATOM   7290  C  CA    . LYS C 1 630  ? 136.110 144.918 107.833 1.00 6.86   ?  502  LYS C CA    1 
ATOM   7291  C  C     . LYS C 1 630  ? 136.685 143.969 106.788 1.00 7.04   ?  502  LYS C C     1 
ATOM   7292  O  O     . LYS C 1 630  ? 137.335 144.399 105.823 1.00 8.74   ?  502  LYS C O     1 
ATOM   7293  C  CB    . LYS C 1 630  ? 136.933 144.880 109.119 1.00 5.22   ?  502  LYS C CB    1 
ATOM   7294  C  CG    . LYS C 1 630  ? 138.083 145.862 109.129 1.00 6.05   ?  502  LYS C CG    1 
ATOM   7295  C  CD    . LYS C 1 630  ? 138.355 146.391 110.520 1.00 5.63   ?  502  LYS C CD    1 
ATOM   7296  C  CE    . LYS C 1 630  ? 138.543 145.258 111.508 1.00 2.67   ?  502  LYS C CE    1 
ATOM   7297  N  NZ    . LYS C 1 630  ? 138.695 145.769 112.895 1.00 0.00   ?  502  LYS C NZ    1 
ATOM   7298  N  N     . MET C 1 631  ? 136.426 142.670 106.948 1.00 7.40   ?  503  MET C N     1 
ATOM   7299  C  CA    . MET C 1 631  ? 136.949 141.708 105.987 1.00 8.95   ?  503  MET C CA    1 
ATOM   7300  C  C     . MET C 1 631  ? 136.289 141.867 104.622 1.00 9.08   ?  503  MET C C     1 
ATOM   7301  O  O     . MET C 1 631  ? 136.945 141.676 103.586 1.00 10.01  ?  503  MET C O     1 
ATOM   7302  C  CB    . MET C 1 631  ? 136.792 140.284 106.533 1.00 10.69  ?  503  MET C CB    1 
ATOM   7303  C  CG    . MET C 1 631  ? 135.432 139.634 106.349 1.00 10.95  ?  503  MET C CG    1 
ATOM   7304  S  SD    . MET C 1 631  ? 135.420 138.495 104.952 1.00 18.22  ?  503  MET C SD    1 
ATOM   7305  C  CE    . MET C 1 631  ? 136.550 137.229 105.525 1.00 12.08  ?  503  MET C CE    1 
ATOM   7306  N  N     . TYR C 1 632  ? 135.010 142.252 104.600 1.00 8.90   ?  504  TYR C N     1 
ATOM   7307  C  CA    . TYR C 1 632  ? 134.331 142.493 103.334 1.00 9.10   ?  504  TYR C CA    1 
ATOM   7308  C  C     . TYR C 1 632  ? 134.946 143.678 102.607 1.00 11.66  ?  504  TYR C C     1 
ATOM   7309  O  O     . TYR C 1 632  ? 135.195 143.613 101.399 1.00 13.13  ?  504  TYR C O     1 
ATOM   7310  C  CB    . TYR C 1 632  ? 132.842 142.733 103.571 1.00 8.73   ?  504  TYR C CB    1 
ATOM   7311  C  CG    . TYR C 1 632  ? 132.248 143.711 102.585 1.00 11.59  ?  504  TYR C CG    1 
ATOM   7312  C  CD1   . TYR C 1 632  ? 131.900 143.307 101.307 1.00 12.24  ?  504  TYR C CD1   1 
ATOM   7313  C  CD2   . TYR C 1 632  ? 132.054 145.043 102.925 1.00 15.87  ?  504  TYR C CD2   1 
ATOM   7314  C  CE1   . TYR C 1 632  ? 131.366 144.197 100.399 1.00 13.14  ?  504  TYR C CE1   1 
ATOM   7315  C  CE2   . TYR C 1 632  ? 131.524 145.939 102.021 1.00 20.16  ?  504  TYR C CE2   1 
ATOM   7316  C  CZ    . TYR C 1 632  ? 131.179 145.509 100.760 1.00 17.80  ?  504  TYR C CZ    1 
ATOM   7317  O  OH    . TYR C 1 632  ? 130.645 146.392 99.851  1.00 27.10  ?  504  TYR C OH    1 
ATOM   7318  N  N     . ARG C 1 633  ? 135.162 144.784 103.323 1.00 11.64  ?  505  ARG C N     1 
ATOM   7319  C  CA    . ARG C 1 633  ? 135.812 145.935 102.708 1.00 13.23  ?  505  ARG C CA    1 
ATOM   7320  C  C     . ARG C 1 633  ? 137.190 145.561 102.181 1.00 11.88  ?  505  ARG C C     1 
ATOM   7321  O  O     . ARG C 1 633  ? 137.591 146.005 101.096 1.00 13.34  ?  505  ARG C O     1 
ATOM   7322  C  CB    . ARG C 1 633  ? 135.912 147.085 103.707 1.00 16.88  ?  505  ARG C CB    1 
ATOM   7323  C  CG    . ARG C 1 633  ? 136.603 148.313 103.143 1.00 22.87  ?  505  ARG C CG    1 
ATOM   7324  C  CD    . ARG C 1 633  ? 136.577 149.458 104.129 1.00 30.45  ?  505  ARG C CD    1 
ATOM   7325  N  NE    . ARG C 1 633  ? 137.308 149.129 105.347 1.00 25.55  ?  505  ARG C NE    1 
ATOM   7326  C  CZ    . ARG C 1 633  ? 137.308 149.884 106.438 1.00 30.89  ?  505  ARG C CZ    1 
ATOM   7327  N  NH1   . ARG C 1 633  ? 138.001 149.511 107.505 1.00 26.01  ?  505  ARG C NH1   1 
ATOM   7328  N  NH2   . ARG C 1 633  ? 136.616 151.015 106.461 1.00 44.05  ?  505  ARG C NH2   1 
ATOM   7329  N  N     . THR C 1 634  ? 137.924 144.730 102.928 1.00 10.20  ?  506  THR C N     1 
ATOM   7330  C  CA    . THR C 1 634  ? 139.237 144.289 102.466 1.00 9.76   ?  506  THR C CA    1 
ATOM   7331  C  C     . THR C 1 634  ? 139.137 143.557 101.133 1.00 11.08  ?  506  THR C C     1 
ATOM   7332  O  O     . THR C 1 634  ? 139.786 143.936 100.147 1.00 12.75  ?  506  THR C O     1 
ATOM   7333  C  CB    . THR C 1 634  ? 139.893 143.389 103.511 1.00 10.10  ?  506  THR C CB    1 
ATOM   7334  O  OG1   . THR C 1 634  ? 140.401 144.192 104.580 1.00 10.93  ?  506  THR C OG1   1 
ATOM   7335  C  CG2   . THR C 1 634  ? 141.042 142.602 102.889 1.00 11.87  ?  506  THR C CG2   1 
ATOM   7336  N  N     . VAL C 1 635  ? 138.328 142.495 101.086 1.00 9.03   ?  507  VAL C N     1 
ATOM   7337  C  CA    . VAL C 1 635  ? 138.281 141.677 99.875  1.00 9.55   ?  507  VAL C CA    1 
ATOM   7338  C  C     . VAL C 1 635  ? 137.650 142.448 98.719  1.00 10.16  ?  507  VAL C C     1 
ATOM   7339  O  O     . VAL C 1 635  ? 137.941 142.171 97.547  1.00 10.99  ?  507  VAL C O     1 
ATOM   7340  C  CB    . VAL C 1 635  ? 137.548 140.351 100.146 1.00 11.20  ?  507  VAL C CB    1 
ATOM   7341  C  CG1   . VAL C 1 635  ? 136.088 140.603 100.479 1.00 12.83  ?  507  VAL C CG1   1 
ATOM   7342  C  CG2   . VAL C 1 635  ? 137.681 139.418 98.952  1.00 10.49  ?  507  VAL C CG2   1 
ATOM   7343  N  N     . LYS C 1 636  ? 136.789 143.424 99.018  1.00 13.27  ?  508  LYS C N     1 
ATOM   7344  C  CA    . LYS C 1 636  ? 136.284 144.319 97.984  1.00 18.12  ?  508  LYS C CA    1 
ATOM   7345  C  C     . LYS C 1 636  ? 137.419 145.124 97.373  1.00 18.31  ?  508  LYS C C     1 
ATOM   7346  O  O     . LYS C 1 636  ? 137.692 145.033 96.169  1.00 19.01  ?  508  LYS C O     1 
ATOM   7347  C  CB    . LYS C 1 636  ? 135.226 145.258 98.574  1.00 18.04  ?  508  LYS C CB    1 
ATOM   7348  C  CG    . LYS C 1 636  ? 135.078 146.586 97.830  1.00 17.22  ?  508  LYS C CG    1 
ATOM   7349  C  CD    . LYS C 1 636  ? 134.180 146.456 96.617  1.00 18.01  ?  508  LYS C CD    1 
ATOM   7350  C  CE    . LYS C 1 636  ? 132.744 146.774 96.983  1.00 18.98  ?  508  LYS C CE    1 
ATOM   7351  N  NZ    . LYS C 1 636  ? 132.618 148.187 97.435  1.00 20.10  ?  508  LYS C NZ    1 
ATOM   7352  N  N     . ALA C 1 637  ? 138.113 145.904 98.208  1.00 20.78  ?  509  ALA C N     1 
ATOM   7353  C  CA    . ALA C 1 637  ? 139.109 146.837 97.701  1.00 23.57  ?  509  ALA C CA    1 
ATOM   7354  C  C     . ALA C 1 637  ? 140.279 146.120 97.046  1.00 24.22  ?  509  ALA C C     1 
ATOM   7355  O  O     . ALA C 1 637  ? 140.906 146.671 96.134  1.00 27.98  ?  509  ALA C O     1 
ATOM   7356  C  CB    . ALA C 1 637  ? 139.607 147.738 98.830  1.00 31.33  ?  509  ALA C CB    1 
ATOM   7357  N  N     . THR C 1 638  ? 140.592 144.899 97.484  1.00 20.20  ?  510  THR C N     1 
ATOM   7358  C  CA    . THR C 1 638  ? 141.769 144.228 96.943  1.00 21.16  ?  510  THR C CA    1 
ATOM   7359  C  C     . THR C 1 638  ? 141.552 143.804 95.495  1.00 19.43  ?  510  THR C C     1 
ATOM   7360  O  O     . THR C 1 638  ? 142.277 144.243 94.594  1.00 23.39  ?  510  THR C O     1 
ATOM   7361  C  CB    . THR C 1 638  ? 142.154 143.027 97.806  1.00 21.46  ?  510  THR C CB    1 
ATOM   7362  O  OG1   . THR C 1 638  ? 142.701 143.489 99.047  1.00 21.55  ?  510  THR C OG1   1 
ATOM   7363  C  CG2   . THR C 1 638  ? 143.201 142.185 97.091  1.00 21.80  ?  510  THR C CG2   1 
ATOM   7364  N  N     . SER C 1 639  ? 140.556 142.957 95.241  1.00 19.70  ?  511  SER C N     1 
ATOM   7365  C  CA    . SER C 1 639  ? 140.438 142.325 93.927  1.00 26.32  ?  511  SER C CA    1 
ATOM   7366  C  C     . SER C 1 639  ? 139.069 142.586 93.306  1.00 30.80  ?  511  SER C C     1 
ATOM   7367  O  O     . SER C 1 639  ? 138.157 141.762 93.408  1.00 34.95  ?  511  SER C O     1 
ATOM   7368  C  CB    . SER C 1 639  ? 140.717 140.824 94.042  1.00 30.22  ?  511  SER C CB    1 
ATOM   7369  O  OG    . SER C 1 639  ? 140.319 140.139 92.866  1.00 33.25  ?  511  SER C OG    1 
ATOM   7370  N  N     . GLY C 1 640  ? 138.926 143.757 92.688  1.00 35.05  ?  512  GLY C N     1 
ATOM   7371  C  CA    . GLY C 1 640  ? 138.091 143.944 91.514  1.00 42.93  ?  512  GLY C CA    1 
ATOM   7372  C  C     . GLY C 1 640  ? 136.684 143.381 91.494  1.00 38.98  ?  512  GLY C C     1 
ATOM   7373  O  O     . GLY C 1 640  ? 136.040 143.388 90.440  1.00 42.81  ?  512  GLY C O     1 
ATOM   7374  N  N     . ARG C 1 641  ? 136.180 142.891 92.623  1.00 36.07  ?  513  ARG C N     1 
ATOM   7375  C  CA    . ARG C 1 641  ? 134.905 142.196 92.588  1.00 37.46  ?  513  ARG C CA    1 
ATOM   7376  C  C     . ARG C 1 641  ? 134.218 142.312 93.938  1.00 35.03  ?  513  ARG C C     1 
ATOM   7377  O  O     . ARG C 1 641  ? 134.868 142.424 94.981  1.00 31.80  ?  513  ARG C O     1 
ATOM   7378  C  CB    . ARG C 1 641  ? 135.089 140.722 92.202  1.00 41.75  ?  513  ARG C CB    1 
ATOM   7379  C  CG    . ARG C 1 641  ? 133.804 139.985 91.850  1.00 47.60  ?  513  ARG C CG    1 
ATOM   7380  C  CD    . ARG C 1 641  ? 133.896 139.323 90.481  1.00 60.22  ?  513  ARG C CD    1 
ATOM   7381  N  NE    . ARG C 1 641  ? 134.894 138.255 90.437  1.00 60.61  ?  513  ARG C NE    1 
ATOM   7382  C  CZ    . ARG C 1 641  ? 136.146 138.416 90.020  1.00 61.39  ?  513  ARG C CZ    1 
ATOM   7383  N  NH1   . ARG C 1 641  ? 136.565 139.608 89.615  1.00 54.81  ?  513  ARG C NH1   1 
ATOM   7384  N  NH2   . ARG C 1 641  ? 136.982 137.388 90.014  1.00 70.19  ?  513  ARG C NH2   1 
ATOM   7385  N  N     . GLN C 1 642  ? 132.886 142.293 93.894  1.00 33.29  ?  514  GLN C N     1 
ATOM   7386  C  CA    . GLN C 1 642  ? 132.047 142.324 95.089  1.00 29.56  ?  514  GLN C CA    1 
ATOM   7387  C  C     . GLN C 1 642  ? 131.780 140.879 95.501  1.00 26.94  ?  514  GLN C C     1 
ATOM   7388  O  O     . GLN C 1 642  ? 130.767 140.272 95.147  1.00 28.39  ?  514  GLN C O     1 
ATOM   7389  C  CB    . GLN C 1 642  ? 130.758 143.082 94.801  1.00 29.70  ?  514  GLN C CB    1 
ATOM   7390  C  CG    . GLN C 1 642  ? 130.103 143.738 95.996  1.00 26.21  ?  514  GLN C CG    1 
ATOM   7391  C  CD    . GLN C 1 642  ? 128.870 144.529 95.603  1.00 29.50  ?  514  GLN C CD    1 
ATOM   7392  O  OE1   . GLN C 1 642  ? 128.392 144.435 94.471  1.00 31.07  ?  514  GLN C OE1   1 
ATOM   7393  N  NE2   . GLN C 1 642  ? 128.355 145.323 96.533  1.00 31.13  ?  514  GLN C NE2   1 
ATOM   7394  N  N     . ILE C 1 643  ? 132.720 140.316 96.261  1.00 19.44  ?  515  ILE C N     1 
ATOM   7395  C  CA    . ILE C 1 643  ? 132.650 138.891 96.571  1.00 13.37  ?  515  ILE C CA    1 
ATOM   7396  C  C     . ILE C 1 643  ? 131.663 138.618 97.700  1.00 15.62  ?  515  ILE C C     1 
ATOM   7397  O  O     . ILE C 1 643  ? 130.938 137.617 97.676  1.00 18.79  ?  515  ILE C O     1 
ATOM   7398  C  CB    . ILE C 1 643  ? 134.056 138.350 96.884  1.00 9.31   ?  515  ILE C CB    1 
ATOM   7399  C  CG1   . ILE C 1 643  ? 134.783 138.042 95.575  1.00 12.40  ?  515  ILE C CG1   1 
ATOM   7400  C  CG2   . ILE C 1 643  ? 133.990 137.116 97.770  1.00 8.80   ?  515  ILE C CG2   1 
ATOM   7401  C  CD1   . ILE C 1 643  ? 134.148 136.924 94.785  1.00 17.50  ?  515  ILE C CD1   1 
ATOM   7402  N  N     . PHE C 1 644  ? 131.608 139.494 98.698  1.00 13.93  ?  516  PHE C N     1 
ATOM   7403  C  CA    . PHE C 1 644  ? 130.641 139.386 99.782  1.00 12.48  ?  516  PHE C CA    1 
ATOM   7404  C  C     . PHE C 1 644  ? 129.688 140.568 99.707  1.00 13.30  ?  516  PHE C C     1 
ATOM   7405  O  O     . PHE C 1 644  ? 130.123 141.705 99.505  1.00 14.04  ?  516  PHE C O     1 
ATOM   7406  C  CB    . PHE C 1 644  ? 131.334 139.348 101.147 1.00 11.18  ?  516  PHE C CB    1 
ATOM   7407  C  CG    . PHE C 1 644  ? 132.077 138.073 101.410 1.00 10.20  ?  516  PHE C CG    1 
ATOM   7408  C  CD1   . PHE C 1 644  ? 131.921 136.986 100.572 1.00 11.04  ?  516  PHE C CD1   1 
ATOM   7409  C  CD2   . PHE C 1 644  ? 132.911 137.951 102.506 1.00 8.12   ?  516  PHE C CD2   1 
ATOM   7410  C  CE1   . PHE C 1 644  ? 132.596 135.813 100.805 1.00 9.00   ?  516  PHE C CE1   1 
ATOM   7411  C  CE2   . PHE C 1 644  ? 133.584 136.771 102.746 1.00 8.40   ?  516  PHE C CE2   1 
ATOM   7412  C  CZ    . PHE C 1 644  ? 133.428 135.704 101.895 1.00 7.33   ?  516  PHE C CZ    1 
ATOM   7413  N  N     . GLN C 1 645  ? 128.394 140.301 99.850  1.00 11.78  ?  517  GLN C N     1 
ATOM   7414  C  CA    . GLN C 1 645  ? 127.431 141.386 99.833  1.00 10.90  ?  517  GLN C CA    1 
ATOM   7415  C  C     . GLN C 1 645  ? 127.683 142.321 101.015 1.00 10.47  ?  517  GLN C C     1 
ATOM   7416  O  O     . GLN C 1 645  ? 128.199 141.898 102.055 1.00 9.51   ?  517  GLN C O     1 
ATOM   7417  C  CB    . GLN C 1 645  ? 126.005 140.840 99.885  1.00 10.98  ?  517  GLN C CB    1 
ATOM   7418  C  CG    . GLN C 1 645  ? 125.795 139.567 99.076  1.00 12.96  ?  517  GLN C CG    1 
ATOM   7419  C  CD    . GLN C 1 645  ? 125.782 139.806 97.575  1.00 11.79  ?  517  GLN C CD    1 
ATOM   7420  O  OE1   . GLN C 1 645  ? 126.080 140.903 97.100  1.00 11.91  ?  517  GLN C OE1   1 
ATOM   7421  N  NE2   . GLN C 1 645  ? 125.431 138.774 96.820  1.00 14.70  ?  517  GLN C NE2   1 
ATOM   7422  N  N     . PRO C 1 646  ? 127.358 143.603 100.873 1.00 11.98  ?  518  PRO C N     1 
ATOM   7423  C  CA    . PRO C 1 646  ? 127.514 144.529 102.000 1.00 11.77  ?  518  PRO C CA    1 
ATOM   7424  C  C     . PRO C 1 646  ? 126.548 144.241 103.135 1.00 8.97   ?  518  PRO C C     1 
ATOM   7425  O  O     . PRO C 1 646  ? 125.700 143.346 103.051 1.00 10.70  ?  518  PRO C O     1 
ATOM   7426  C  CB    . PRO C 1 646  ? 127.249 145.904 101.372 1.00 15.20  ?  518  PRO C CB    1 
ATOM   7427  C  CG    . PRO C 1 646  ? 126.522 145.621 100.112 1.00 21.33  ?  518  PRO C CG    1 
ATOM   7428  C  CD    . PRO C 1 646  ? 127.045 144.310 99.621  1.00 15.40  ?  518  PRO C CD    1 
ATOM   7429  N  N     . LEU C 1 647  ? 126.674 145.027 104.202 1.00 9.26   ?  519  LEU C N     1 
ATOM   7430  C  CA    . LEU C 1 647  ? 126.019 144.700 105.462 1.00 6.91   ?  519  LEU C CA    1 
ATOM   7431  C  C     . LEU C 1 647  ? 124.506 144.820 105.361 1.00 12.21  ?  519  LEU C C     1 
ATOM   7432  O  O     . LEU C 1 647  ? 123.774 143.842 105.578 1.00 15.36  ?  519  LEU C O     1 
ATOM   7433  C  CB    . LEU C 1 647  ? 126.545 145.614 106.566 1.00 9.39   ?  519  LEU C CB    1 
ATOM   7434  C  CG    . LEU C 1 647  ? 127.626 145.012 107.454 1.00 6.08   ?  519  LEU C CG    1 
ATOM   7435  C  CD1   . LEU C 1 647  ? 126.987 144.054 108.439 1.00 10.51  ?  519  LEU C CD1   1 
ATOM   7436  C  CD2   . LEU C 1 647  ? 128.680 144.316 106.621 1.00 2.30   ?  519  LEU C CD2   1 
ATOM   7437  N  N     . HIS C 1 648  ? 124.019 146.024 105.053 1.00 16.79  ?  520  HIS C N     1 
ATOM   7438  C  CA    . HIS C 1 648  ? 122.590 146.286 105.160 1.00 21.30  ?  520  HIS C CA    1 
ATOM   7439  C  C     . HIS C 1 648  ? 121.790 145.369 104.243 1.00 22.62  ?  520  HIS C C     1 
ATOM   7440  O  O     . HIS C 1 648  ? 120.708 144.899 104.617 1.00 26.12  ?  520  HIS C O     1 
ATOM   7441  C  CB    . HIS C 1 648  ? 122.303 147.756 104.857 1.00 24.36  ?  520  HIS C CB    1 
ATOM   7442  C  CG    . HIS C 1 648  ? 122.396 148.100 103.405 1.00 31.34  ?  520  HIS C CG    1 
ATOM   7443  N  ND1   . HIS C 1 648  ? 123.534 148.632 102.839 1.00 40.15  ?  520  HIS C ND1   1 
ATOM   7444  C  CD2   . HIS C 1 648  ? 121.492 147.988 102.403 1.00 32.93  ?  520  HIS C CD2   1 
ATOM   7445  C  CE1   . HIS C 1 648  ? 123.328 148.830 101.549 1.00 47.78  ?  520  HIS C CE1   1 
ATOM   7446  N  NE2   . HIS C 1 648  ? 122.097 148.446 101.259 1.00 39.23  ?  520  HIS C NE2   1 
ATOM   7447  N  N     . THR C 1 649  ? 122.319 145.070 103.051 1.00 21.47  ?  521  THR C N     1 
ATOM   7448  C  CA    . THR C 1 649  ? 121.597 144.173 102.154 1.00 22.75  ?  521  THR C CA    1 
ATOM   7449  C  C     . THR C 1 649  ? 121.643 142.730 102.642 1.00 20.48  ?  521  THR C C     1 
ATOM   7450  O  O     . THR C 1 649  ? 120.701 141.973 102.395 1.00 21.11  ?  521  THR C O     1 
ATOM   7451  C  CB    . THR C 1 649  ? 122.140 144.263 100.727 1.00 24.66  ?  521  THR C CB    1 
ATOM   7452  O  OG1   . THR C 1 649  ? 121.400 143.370 99.883  1.00 20.56  ?  521  THR C OG1   1 
ATOM   7453  C  CG2   . THR C 1 649  ? 123.592 143.868 100.686 1.00 22.02  ?  521  THR C CG2   1 
ATOM   7454  N  N     . LEU C 1 650  ? 122.704 142.334 103.352 1.00 16.82  ?  522  LEU C N     1 
ATOM   7455  C  CA    . LEU C 1 650  ? 122.722 141.005 103.959 1.00 15.89  ?  522  LEU C CA    1 
ATOM   7456  C  C     . LEU C 1 650  ? 121.651 140.886 105.034 1.00 15.98  ?  522  LEU C C     1 
ATOM   7457  O  O     . LEU C 1 650  ? 120.899 139.902 105.073 1.00 16.14  ?  522  LEU C O     1 
ATOM   7458  C  CB    . LEU C 1 650  ? 124.099 140.703 104.551 1.00 11.27  ?  522  LEU C CB    1 
ATOM   7459  C  CG    . LEU C 1 650  ? 124.219 139.372 105.304 1.00 8.61   ?  522  LEU C CG    1 
ATOM   7460  C  CD1   . LEU C 1 650  ? 125.502 138.668 104.918 1.00 7.54   ?  522  LEU C CD1   1 
ATOM   7461  C  CD2   . LEU C 1 650  ? 124.159 139.571 106.813 1.00 8.86   ?  522  LEU C CD2   1 
ATOM   7462  N  N     . ARG C 1 651  ? 121.581 141.872 105.932 1.00 17.09  ?  523  ARG C N     1 
ATOM   7463  C  CA    . ARG C 1 651  ? 120.539 141.850 106.953 1.00 19.40  ?  523  ARG C CA    1 
ATOM   7464  C  C     . ARG C 1 651  ? 119.155 141.838 106.318 1.00 17.11  ?  523  ARG C C     1 
ATOM   7465  O  O     . ARG C 1 651  ? 118.278 141.067 106.727 1.00 20.70  ?  523  ARG C O     1 
ATOM   7466  C  CB    . ARG C 1 651  ? 120.688 143.041 107.898 1.00 18.93  ?  523  ARG C CB    1 
ATOM   7467  C  CG    . ARG C 1 651  ? 121.369 142.693 109.209 1.00 20.16  ?  523  ARG C CG    1 
ATOM   7468  C  CD    . ARG C 1 651  ? 121.153 143.764 110.264 1.00 27.81  ?  523  ARG C CD    1 
ATOM   7469  N  NE    . ARG C 1 651  ? 121.979 144.944 110.026 1.00 31.09  ?  523  ARG C NE    1 
ATOM   7470  C  CZ    . ARG C 1 651  ? 121.599 145.987 109.295 1.00 33.49  ?  523  ARG C CZ    1 
ATOM   7471  N  NH1   . ARG C 1 651  ? 120.396 146.003 108.736 1.00 35.04  ?  523  ARG C NH1   1 
ATOM   7472  N  NH2   . ARG C 1 651  ? 122.419 147.015 109.128 1.00 30.74  ?  523  ARG C NH2   1 
ATOM   7473  N  N     . ASN C 1 652  ? 118.944 142.681 105.302 1.00 22.49  ?  524  ASN C N     1 
ATOM   7474  C  CA    . ASN C 1 652  ? 117.668 142.688 104.594 1.00 27.37  ?  524  ASN C CA    1 
ATOM   7475  C  C     . ASN C 1 652  ? 117.368 141.323 103.980 1.00 26.82  ?  524  ASN C C     1 
ATOM   7476  O  O     . ASN C 1 652  ? 116.221 140.860 104.010 1.00 29.82  ?  524  ASN C O     1 
ATOM   7477  C  CB    . ASN C 1 652  ? 117.676 143.777 103.519 1.00 34.69  ?  524  ASN C CB    1 
ATOM   7478  C  CG    . ASN C 1 652  ? 116.313 143.984 102.878 1.00 39.54  ?  524  ASN C CG    1 
ATOM   7479  O  OD1   . ASN C 1 652  ? 115.279 143.659 103.462 1.00 41.05  ?  524  ASN C OD1   1 
ATOM   7480  N  ND2   . ASN C 1 652  ? 116.308 144.531 101.666 1.00 37.95  ?  524  ASN C ND2   1 
ATOM   7481  N  N     . ALA C 1 653  ? 118.386 140.662 103.421 1.00 23.31  ?  525  ALA C N     1 
ATOM   7482  C  CA    . ALA C 1 653  ? 118.202 139.323 102.878 1.00 19.66  ?  525  ALA C CA    1 
ATOM   7483  C  C     . ALA C 1 653  ? 117.892 138.309 103.966 1.00 17.73  ?  525  ALA C C     1 
ATOM   7484  O  O     . ALA C 1 653  ? 117.279 137.274 103.681 1.00 17.70  ?  525  ALA C O     1 
ATOM   7485  C  CB    . ALA C 1 653  ? 119.449 138.892 102.105 1.00 21.57  ?  525  ALA C CB    1 
ATOM   7486  N  N     . GLU C 1 654  ? 118.300 138.587 105.201 1.00 17.23  ?  526  GLU C N     1 
ATOM   7487  C  CA    . GLU C 1 654  ? 118.001 137.689 106.306 1.00 16.23  ?  526  GLU C CA    1 
ATOM   7488  C  C     . GLU C 1 654  ? 116.556 137.820 106.779 1.00 20.29  ?  526  GLU C C     1 
ATOM   7489  O  O     . GLU C 1 654  ? 115.973 136.832 107.242 1.00 19.54  ?  526  GLU C O     1 
ATOM   7490  C  CB    . GLU C 1 654  ? 118.989 137.955 107.449 1.00 17.47  ?  526  GLU C CB    1 
ATOM   7491  C  CG    . GLU C 1 654  ? 118.575 137.452 108.828 1.00 27.53  ?  526  GLU C CG    1 
ATOM   7492  C  CD    . GLU C 1 654  ? 117.694 138.435 109.586 1.00 47.38  ?  526  GLU C CD    1 
ATOM   7493  O  OE1   . GLU C 1 654  ? 117.411 139.527 109.046 1.00 34.59  ?  526  GLU C OE1   1 
ATOM   7494  O  OE2   . GLU C 1 654  ? 117.273 138.112 110.716 1.00 144.72 -1 526  GLU C OE2   1 
ATOM   7495  N  N     . LYS C 1 655  ? 115.955 139.010 106.636 1.00 21.85  ?  527  LYS C N     1 
ATOM   7496  C  CA    . LYS C 1 655  ? 114.688 139.336 107.295 1.00 21.15  ?  527  LYS C CA    1 
ATOM   7497  C  C     . LYS C 1 655  ? 113.573 138.333 107.024 1.00 18.59  ?  527  LYS C C     1 
ATOM   7498  O  O     . LYS C 1 655  ? 112.611 138.266 107.799 1.00 17.00  ?  527  LYS C O     1 
ATOM   7499  C  CB    . LYS C 1 655  ? 114.223 140.731 106.868 1.00 19.60  ?  527  LYS C CB    1 
ATOM   7500  C  CG    . LYS C 1 655  ? 113.059 141.280 107.680 1.00 19.49  ?  527  LYS C CG    1 
ATOM   7501  C  CD    . LYS C 1 655  ? 113.285 142.735 108.030 1.00 25.16  ?  527  LYS C CD    1 
ATOM   7502  C  CE    . LYS C 1 655  ? 114.606 142.914 108.756 1.00 27.64  ?  527  LYS C CE    1 
ATOM   7503  N  NZ    . LYS C 1 655  ? 114.869 144.336 109.106 1.00 34.50  ?  527  LYS C NZ    1 
ATOM   7504  N  N     . GLU C 1 656  ? 113.668 137.555 105.951 1.00 19.19  ?  528  GLU C N     1 
ATOM   7505  C  CA    . GLU C 1 656  ? 112.643 136.567 105.651 1.00 20.85  ?  528  GLU C CA    1 
ATOM   7506  C  C     . GLU C 1 656  ? 112.955 135.189 106.221 1.00 14.59  ?  528  GLU C C     1 
ATOM   7507  O  O     . GLU C 1 656  ? 112.131 134.278 106.085 1.00 14.51  ?  528  GLU C O     1 
ATOM   7508  C  CB    . GLU C 1 656  ? 112.438 136.461 104.141 1.00 24.80  ?  528  GLU C CB    1 
ATOM   7509  C  CG    . GLU C 1 656  ? 113.428 135.556 103.448 1.00 29.59  ?  528  GLU C CG    1 
ATOM   7510  C  CD    . GLU C 1 656  ? 113.261 135.578 101.947 1.00 60.93  ?  528  GLU C CD    1 
ATOM   7511  O  OE1   . GLU C 1 656  ? 113.060 136.677 101.386 1.00 53.71  ?  528  GLU C OE1   1 
ATOM   7512  O  OE2   . GLU C 1 656  ? 113.316 134.496 101.328 1.00 148.60 -1 528  GLU C OE2   1 
ATOM   7513  N  N     . LEU C 1 657  ? 114.113 135.009 106.852 1.00 11.88  ?  529  LEU C N     1 
ATOM   7514  C  CA    . LEU C 1 657  ? 114.409 133.728 107.478 1.00 10.24  ?  529  LEU C CA    1 
ATOM   7515  C  C     . LEU C 1 657  ? 113.857 133.637 108.894 1.00 13.17  ?  529  LEU C C     1 
ATOM   7516  O  O     . LEU C 1 657  ? 113.300 132.600 109.274 1.00 10.42  ?  529  LEU C O     1 
ATOM   7517  C  CB    . LEU C 1 657  ? 115.915 133.485 107.485 1.00 8.52   ?  529  LEU C CB    1 
ATOM   7518  C  CG    . LEU C 1 657  ? 116.412 132.890 106.174 1.00 3.66   ?  529  LEU C CG    1 
ATOM   7519  C  CD1   . LEU C 1 657  ? 117.916 132.903 106.169 1.00 5.55   ?  529  LEU C CD1   1 
ATOM   7520  C  CD2   . LEU C 1 657  ? 115.874 131.480 106.000 1.00 1.24   ?  529  LEU C CD2   1 
ATOM   7521  N  N     . LEU C 1 658  ? 114.002 134.705 109.682 1.00 13.19  ?  530  LEU C N     1 
ATOM   7522  C  CA    . LEU C 1 658  ? 113.411 134.803 111.012 1.00 10.50  ?  530  LEU C CA    1 
ATOM   7523  C  C     . LEU C 1 658  ? 111.917 134.522 110.960 1.00 9.56   ?  530  LEU C C     1 
ATOM   7524  O  O     . LEU C 1 658  ? 111.292 134.658 109.901 1.00 12.37  ?  530  LEU C O     1 
ATOM   7525  C  CB    . LEU C 1 658  ? 113.647 136.194 111.607 1.00 6.01   ?  530  LEU C CB    1 
ATOM   7526  C  CG    . LEU C 1 658  ? 115.032 136.555 112.131 1.00 8.33   ?  530  LEU C CG    1 
ATOM   7527  C  CD1   . LEU C 1 658  ? 115.000 137.922 112.782 1.00 7.86   ?  530  LEU C CD1   1 
ATOM   7528  C  CD2   . LEU C 1 658  ? 115.424 135.517 113.143 1.00 6.69   ?  530  LEU C CD2   1 
ATOM   7529  N  N     . PRO C 1 659  ? 111.308 134.126 112.071 1.00 8.54   ?  531  PRO C N     1 
ATOM   7530  C  CA    . PRO C 1 659  ? 109.848 134.029 112.101 1.00 3.76   ?  531  PRO C CA    1 
ATOM   7531  C  C     . PRO C 1 659  ? 109.206 135.396 111.938 1.00 3.76   ?  531  PRO C C     1 
ATOM   7532  O  O     . PRO C 1 659  ? 109.790 136.432 112.270 1.00 1.56   ?  531  PRO C O     1 
ATOM   7533  C  CB    . PRO C 1 659  ? 109.560 133.439 113.485 1.00 6.66   ?  531  PRO C CB    1 
ATOM   7534  C  CG    . PRO C 1 659  ? 110.766 133.780 114.290 1.00 6.97   ?  531  PRO C CG    1 
ATOM   7535  C  CD    . PRO C 1 659  ? 111.913 133.691 113.340 1.00 7.92   ?  531  PRO C CD    1 
ATOM   7536  N  N     . GLY C 1 660  ? 107.990 135.387 111.414 1.00 7.10   ?  532  GLY C N     1 
ATOM   7537  C  CA    . GLY C 1 660  ? 107.218 136.592 111.254 1.00 9.78   ?  532  GLY C CA    1 
ATOM   7538  C  C     . GLY C 1 660  ? 107.259 137.197 109.875 1.00 11.55  ?  532  GLY C C     1 
ATOM   7539  O  O     . GLY C 1 660  ? 107.237 138.427 109.760 1.00 21.47  ?  532  GLY C O     1 
ATOM   7540  N  N     . PHE C 1 661  ? 107.333 136.389 108.838 1.00 13.50  ?  533  PHE C N     1 
ATOM   7541  C  CA    . PHE C 1 661  ? 107.413 136.929 107.489 1.00 16.68  ?  533  PHE C CA    1 
ATOM   7542  C  C     . PHE C 1 661  ? 106.373 136.353 106.547 1.00 16.57  ?  533  PHE C C     1 
ATOM   7543  O  O     . PHE C 1 661  ? 105.848 137.080 105.702 1.00 20.75  ?  533  PHE C O     1 
ATOM   7544  C  CB    . PHE C 1 661  ? 108.806 136.686 106.907 1.00 15.67  ?  533  PHE C CB    1 
ATOM   7545  C  CG    . PHE C 1 661  ? 109.025 137.366 105.598 1.00 14.22  ?  533  PHE C CG    1 
ATOM   7546  C  CD1   . PHE C 1 661  ? 109.357 138.707 105.556 1.00 14.85  ?  533  PHE C CD1   1 
ATOM   7547  C  CD2   . PHE C 1 661  ? 108.876 136.675 104.406 1.00 12.74  ?  533  PHE C CD2   1 
ATOM   7548  C  CE1   . PHE C 1 661  ? 109.551 139.347 104.352 1.00 22.97  ?  533  PHE C CE1   1 
ATOM   7549  C  CE2   . PHE C 1 661  ? 109.069 137.310 103.198 1.00 19.84  ?  533  PHE C CE2   1 
ATOM   7550  C  CZ    . PHE C 1 661  ? 109.407 138.649 103.170 1.00 26.62  ?  533  PHE C CZ    1 
ATOM   7551  N  N     . HIS C 1 662  ? 106.067 135.071 106.661 1.00 17.36  ?  534  HIS C N     1 
ATOM   7552  C  CA    . HIS C 1 662  ? 105.176 134.412 105.723 1.00 16.29  ?  534  HIS C CA    1 
ATOM   7553  C  C     . HIS C 1 662  ? 103.747 134.465 106.231 1.00 22.77  ?  534  HIS C C     1 
ATOM   7554  O  O     . HIS C 1 662  ? 103.430 133.880 107.272 1.00 28.40  ?  534  HIS C O     1 
ATOM   7555  C  CB    . HIS C 1 662  ? 105.618 132.979 105.531 1.00 18.57  ?  534  HIS C CB    1 
ATOM   7556  C  CG    . HIS C 1 662  ? 107.014 132.855 105.022 1.00 12.87  ?  534  HIS C CG    1 
ATOM   7557  N  ND1   . HIS C 1 662  ? 107.370 133.211 103.737 1.00 15.24  ?  534  HIS C ND1   1 
ATOM   7558  C  CD2   . HIS C 1 662  ? 108.134 132.361 105.601 1.00 14.29  ?  534  HIS C CD2   1 
ATOM   7559  C  CE1   . HIS C 1 662  ? 108.653 132.956 103.552 1.00 10.92  ?  534  HIS C CE1   1 
ATOM   7560  N  NE2   . HIS C 1 662  ? 109.138 132.431 104.665 1.00 15.30  ?  534  HIS C NE2   1 
ATOM   7561  N  N     . GLN C 1 663  ? 102.892 135.164 105.494 1.00 30.62  ?  535  GLN C N     1 
ATOM   7562  C  CA    . GLN C 1 663  ? 101.481 135.211 105.838 1.00 34.52  ?  535  GLN C CA    1 
ATOM   7563  C  C     . GLN C 1 663  ? 100.866 133.822 105.739 1.00 39.05  ?  535  GLN C C     1 
ATOM   7564  O  O     . GLN C 1 663  ? 101.106 133.083 104.779 1.00 40.54  ?  535  GLN C O     1 
ATOM   7565  C  CB    . GLN C 1 663  ? 100.753 136.182 104.915 1.00 35.33  ?  535  GLN C CB    1 
ATOM   7566  C  CG    . GLN C 1 663  ? 99.252  136.180 105.083 1.00 40.65  ?  535  GLN C CG    1 
ATOM   7567  C  CD    . GLN C 1 663  ? 98.539  136.512 103.793 1.00 55.67  ?  535  GLN C CD    1 
ATOM   7568  O  OE1   . GLN C 1 663  ? 99.159  136.583 102.731 1.00 51.82  ?  535  GLN C OE1   1 
ATOM   7569  N  NE2   . GLN C 1 663  ? 97.229  136.711 103.873 1.00 67.16  ?  535  GLN C NE2   1 
ATOM   7570  N  N     . PHE C 1 664  ? 100.070 133.465 106.744 1.00 38.88  ?  536  PHE C N     1 
ATOM   7571  C  CA    . PHE C 1 664  ? 99.477  132.139 106.824 1.00 41.62  ?  536  PHE C CA    1 
ATOM   7572  C  C     . PHE C 1 664  ? 98.033  132.260 107.281 1.00 46.55  ?  536  PHE C C     1 
ATOM   7573  O  O     . PHE C 1 664  ? 97.552  133.344 107.627 1.00 44.01  ?  536  PHE C O     1 
ATOM   7574  C  CB    . PHE C 1 664  ? 100.270 131.229 107.767 1.00 38.51  ?  536  PHE C CB    1 
ATOM   7575  C  CG    . PHE C 1 664  ? 100.547 131.833 109.113 1.00 34.76  ?  536  PHE C CG    1 
ATOM   7576  C  CD1   . PHE C 1 664  ? 99.564  131.884 110.087 1.00 40.15  ?  536  PHE C CD1   1 
ATOM   7577  C  CD2   . PHE C 1 664  ? 101.798 132.340 109.407 1.00 31.37  ?  536  PHE C CD2   1 
ATOM   7578  C  CE1   . PHE C 1 664  ? 99.826  132.436 111.325 1.00 38.45  ?  536  PHE C CE1   1 
ATOM   7579  C  CE2   . PHE C 1 664  ? 102.063 132.893 110.644 1.00 27.08  ?  536  PHE C CE2   1 
ATOM   7580  C  CZ    . PHE C 1 664  ? 101.079 132.940 111.603 1.00 28.50  ?  536  PHE C CZ    1 
ATOM   7581  N  N     . GLU C 1 665  ? 97.344  131.123 107.299 1.00 51.92  ?  537  GLU C N     1 
ATOM   7582  C  CA    . GLU C 1 665  ? 95.952  131.093 107.713 1.00 53.17  ?  537  GLU C CA    1 
ATOM   7583  C  C     . GLU C 1 665  ? 95.723  129.866 108.579 1.00 49.96  ?  537  GLU C C     1 
ATOM   7584  O  O     . GLU C 1 665  ? 96.484  128.897 108.534 1.00 50.57  ?  537  GLU C O     1 
ATOM   7585  C  CB    . GLU C 1 665  ? 95.019  131.098 106.500 1.00 64.57  ?  537  GLU C CB    1 
ATOM   7586  C  CG    . GLU C 1 665  ? 93.616  131.569 106.798 1.00 86.41  ?  537  GLU C CG    1 
ATOM   7587  C  CD    . GLU C 1 665  ? 92.834  131.846 105.536 1.00 129.01 ?  537  GLU C CD    1 
ATOM   7588  O  OE1   . GLU C 1 665  ? 93.465  132.173 104.509 1.00 119.27 ?  537  GLU C OE1   1 
ATOM   7589  O  OE2   . GLU C 1 665  ? 91.591  131.733 105.568 1.00 196.27 -1 537  GLU C OE2   1 
ATOM   7590  N  N     . TRP C 1 666  ? 94.665  129.922 109.384 1.00 49.05  ?  538  TRP C N     1 
ATOM   7591  C  CA    . TRP C 1 666  ? 94.390  128.867 110.346 1.00 50.85  ?  538  TRP C CA    1 
ATOM   7592  C  C     . TRP C 1 666  ? 92.905  128.533 110.322 1.00 55.07  ?  538  TRP C C     1 
ATOM   7593  O  O     . TRP C 1 666  ? 92.070  129.441 110.370 1.00 55.76  ?  538  TRP C O     1 
ATOM   7594  C  CB    . TRP C 1 666  ? 94.789  129.281 111.770 1.00 46.61  ?  538  TRP C CB    1 
ATOM   7595  C  CG    . TRP C 1 666  ? 95.385  128.140 112.503 1.00 47.70  ?  538  TRP C CG    1 
ATOM   7596  C  CD1   . TRP C 1 666  ? 94.807  126.938 112.672 1.00 53.94  ?  538  TRP C CD1   1 
ATOM   7597  C  CD2   . TRP C 1 666  ? 96.554  128.136 113.331 1.00 38.23  ?  538  TRP C CD2   1 
ATOM   7598  N  NE1   . TRP C 1 666  ? 95.588  126.121 113.441 1.00 52.00  ?  538  TRP C NE1   1 
ATOM   7599  C  CE2   . TRP C 1 666  ? 96.663  126.842 113.881 1.00 43.47  ?  538  TRP C CE2   1 
ATOM   7600  C  CE3   . TRP C 1 666  ? 97.542  129.077 113.626 1.00 30.19  ?  538  TRP C CE3   1 
ATOM   7601  C  CZ2   . TRP C 1 666  ? 97.709  126.467 114.703 1.00 30.95  ?  538  TRP C CZ2   1 
ATOM   7602  C  CZ3   . TRP C 1 666  ? 98.582  128.698 114.444 1.00 27.01  ?  538  TRP C CZ3   1 
ATOM   7603  C  CH2   . TRP C 1 666  ? 98.659  127.405 114.967 1.00 25.47  ?  538  TRP C CH2   1 
ATOM   7604  N  N     . GLN C 1 667  ? 92.571  127.243 110.262 1.00 51.62  ?  539  GLN C N     1 
ATOM   7605  C  CA    . GLN C 1 667  ? 91.173  126.810 110.194 1.00 48.21  ?  539  GLN C CA    1 
ATOM   7606  C  C     . GLN C 1 667  ? 90.842  125.874 111.347 1.00 44.59  ?  539  GLN C C     1 
ATOM   7607  O  O     . GLN C 1 667  ? 91.357  124.740 111.386 1.00 45.83  ?  539  GLN C O     1 
ATOM   7608  C  CB    . GLN C 1 667  ? 90.885  126.116 108.864 1.00 52.74  ?  539  GLN C CB    1 
ATOM   7609  C  CG    . GLN C 1 667  ? 90.704  127.059 107.692 1.00 53.56  ?  539  GLN C CG    1 
ATOM   7610  C  CD    . GLN C 1 667  ? 90.482  126.320 106.388 1.00 53.66  ?  539  GLN C CD    1 
ATOM   7611  O  OE1   . GLN C 1 667  ? 90.632  125.100 106.319 1.00 52.11  ?  539  GLN C OE1   1 
ATOM   7612  N  NE2   . GLN C 1 667  ? 90.120  127.058 105.345 1.00 58.50  ?  539  GLN C NE2   1 
ATOM   7613  N  N     . PRO C 1 668  ? 90.017  126.291 112.322 1.00 48.63  ?  540  PRO C N     1 
ATOM   7614  C  CA    . PRO C 1 668  ? 89.465  127.646 112.416 1.00 51.64  ?  540  PRO C CA    1 
ATOM   7615  C  C     . PRO C 1 668  ? 90.440  128.613 113.068 1.00 50.19  ?  540  PRO C C     1 
ATOM   7616  O  O     . PRO C 1 668  ? 91.617  128.282 113.207 1.00 52.03  ?  540  PRO C O     1 
ATOM   7617  C  CB    . PRO C 1 668  ? 88.236  127.453 113.298 1.00 58.39  ?  540  PRO C CB    1 
ATOM   7618  C  CG    . PRO C 1 668  ? 88.635  126.348 114.212 1.00 52.89  ?  540  PRO C CG    1 
ATOM   7619  C  CD    . PRO C 1 668  ? 89.467  125.411 113.370 1.00 49.54  ?  540  PRO C CD    1 
ATOM   7620  N  N     . ALA C 1 669  ? 89.955  129.789 113.462 1.00 55.37  ?  541  ALA C N     1 
ATOM   7621  C  CA    . ALA C 1 669  ? 90.771  130.690 114.261 1.00 58.34  ?  541  ALA C CA    1 
ATOM   7622  C  C     . ALA C 1 669  ? 91.185  130.000 115.554 1.00 58.04  ?  541  ALA C C     1 
ATOM   7623  O  O     . ALA C 1 669  ? 90.422  129.221 116.135 1.00 54.19  ?  541  ALA C O     1 
ATOM   7624  C  CB    . ALA C 1 669  ? 90.007  131.979 114.567 1.00 57.97  ?  541  ALA C CB    1 
ATOM   7625  N  N     . LEU C 1 670  ? 92.406  130.278 115.997 1.00 46.29  ?  542  LEU C N     1 
ATOM   7626  C  CA    . LEU C 1 670  ? 92.938  129.585 117.155 1.00 38.20  ?  542  LEU C CA    1 
ATOM   7627  C  C     . LEU C 1 670  ? 92.265  130.062 118.439 1.00 38.17  ?  542  LEU C C     1 
ATOM   7628  O  O     . LEU C 1 670  ? 91.652  131.131 118.498 1.00 39.92  ?  542  LEU C O     1 
ATOM   7629  C  CB    . LEU C 1 670  ? 94.447  129.773 117.260 1.00 34.05  ?  542  LEU C CB    1 
ATOM   7630  C  CG    . LEU C 1 670  ? 95.193  128.537 116.776 1.00 34.21  ?  542  LEU C CG    1 
ATOM   7631  C  CD1   . LEU C 1 670  ? 96.602  128.888 116.498 1.00 35.45  ?  542  LEU C CD1   1 
ATOM   7632  C  CD2   . LEU C 1 670  ? 95.108  127.444 117.817 1.00 31.37  ?  542  LEU C CD2   1 
ATOM   7633  N  N     . LYS C 1 671  ? 92.386  129.238 119.476 1.00 36.53  ?  543  LYS C N     1 
ATOM   7634  C  CA    . LYS C 1 671  ? 91.770  129.532 120.761 1.00 39.99  ?  543  LYS C CA    1 
ATOM   7635  C  C     . LYS C 1 671  ? 92.608  130.571 121.495 1.00 38.21  ?  543  LYS C C     1 
ATOM   7636  O  O     . LYS C 1 671  ? 93.765  130.307 121.843 1.00 35.88  ?  543  LYS C O     1 
ATOM   7637  C  CB    . LYS C 1 671  ? 91.635  128.255 121.588 1.00 43.70  ?  543  LYS C CB    1 
ATOM   7638  C  CG    . LYS C 1 671  ? 90.248  128.040 122.172 1.00 48.40  ?  543  LYS C CG    1 
ATOM   7639  C  CD    . LYS C 1 671  ? 89.194  128.047 121.075 1.00 51.59  ?  543  LYS C CD    1 
ATOM   7640  C  CE    . LYS C 1 671  ? 87.796  127.900 121.649 1.00 55.21  ?  543  LYS C CE    1 
ATOM   7641  N  NZ    . LYS C 1 671  ? 87.510  128.961 122.651 1.00 58.03  ?  543  LYS C NZ    1 
ATOM   7642  N  N     . ASN C 1 672  ? 92.021  131.750 121.712 1.00 38.18  ?  544  ASN C N     1 
ATOM   7643  C  CA    . ASN C 1 672  ? 92.621  132.857 122.464 1.00 34.45  ?  544  ASN C CA    1 
ATOM   7644  C  C     . ASN C 1 672  ? 94.076  133.106 122.052 1.00 29.49  ?  544  ASN C C     1 
ATOM   7645  O  O     . ASN C 1 672  ? 95.003  133.112 122.866 1.00 27.83  ?  544  ASN C O     1 
ATOM   7646  C  CB    . ASN C 1 672  ? 92.492  132.628 123.976 1.00 34.35  ?  544  ASN C CB    1 
ATOM   7647  C  CG    . ASN C 1 672  ? 93.264  131.418 124.462 1.00 34.47  ?  544  ASN C CG    1 
ATOM   7648  O  OD1   . ASN C 1 672  ? 92.728  130.312 124.537 1.00 35.50  ?  544  ASN C OD1   1 
ATOM   7649  N  ND2   . ASN C 1 672  ? 94.536  131.620 124.784 1.00 31.98  ?  544  ASN C ND2   1 
ATOM   7650  N  N     . VAL C 1 673  ? 94.252  133.334 120.752 1.00 30.14  ?  545  VAL C N     1 
ATOM   7651  C  CA    . VAL C 1 673  ? 95.551  133.625 120.156 1.00 27.68  ?  545  VAL C CA    1 
ATOM   7652  C  C     . VAL C 1 673  ? 95.330  134.670 119.074 1.00 27.70  ?  545  VAL C C     1 
ATOM   7653  O  O     . VAL C 1 673  ? 94.593  134.419 118.113 1.00 33.95  ?  545  VAL C O     1 
ATOM   7654  C  CB    . VAL C 1 673  ? 96.208  132.372 119.554 1.00 28.11  ?  545  VAL C CB    1 
ATOM   7655  C  CG1   . VAL C 1 673  ? 97.402  132.763 118.704 1.00 29.42  ?  545  VAL C CG1   1 
ATOM   7656  C  CG2   . VAL C 1 673  ? 96.613  131.401 120.650 1.00 35.15  ?  545  VAL C CG2   1 
ATOM   7657  N  N     . SER C 1 674  ? 95.958  135.837 119.223 1.00 27.70  ?  546  SER C N     1 
ATOM   7658  C  CA    . SER C 1 674  ? 95.758  136.908 118.255 1.00 31.11  ?  546  SER C CA    1 
ATOM   7659  C  C     . SER C 1 674  ? 96.211  136.464 116.869 1.00 32.91  ?  546  SER C C     1 
ATOM   7660  O  O     . SER C 1 674  ? 97.160  135.689 116.716 1.00 33.22  ?  546  SER C O     1 
ATOM   7661  C  CB    . SER C 1 674  ? 96.510  138.169 118.680 1.00 32.08  ?  546  SER C CB    1 
ATOM   7662  O  OG    . SER C 1 674  ? 96.276  139.229 117.768 1.00 32.08  ?  546  SER C OG    1 
ATOM   7663  N  N     . THR C 1 675  ? 95.513  136.965 115.849 1.00 36.46  ?  547  THR C N     1 
ATOM   7664  C  CA    . THR C 1 675  ? 95.660  136.455 114.492 1.00 38.56  ?  547  THR C CA    1 
ATOM   7665  C  C     . THR C 1 675  ? 96.853  137.041 113.749 1.00 31.45  ?  547  THR C C     1 
ATOM   7666  O  O     . THR C 1 675  ? 97.218  136.509 112.694 1.00 30.78  ?  547  THR C O     1 
ATOM   7667  C  CB    . THR C 1 675  ? 94.383  136.723 113.686 1.00 43.72  ?  547  THR C CB    1 
ATOM   7668  O  OG1   . THR C 1 675  ? 93.997  138.097 113.833 1.00 40.27  ?  547  THR C OG1   1 
ATOM   7669  C  CG2   . THR C 1 675  ? 93.245  135.824 114.162 1.00 43.46  ?  547  THR C CG2   1 
ATOM   7670  N  N     . SER C 1 676  ? 97.460  138.109 114.267 1.00 29.03  ?  548  SER C N     1 
ATOM   7671  C  CA    . SER C 1 676  ? 98.571  138.754 113.579 1.00 29.12  ?  548  SER C CA    1 
ATOM   7672  C  C     . SER C 1 676  ? 99.670  137.745 113.272 1.00 26.03  ?  548  SER C C     1 
ATOM   7673  O  O     . SER C 1 676  ? 99.955  136.848 114.071 1.00 26.11  ?  548  SER C O     1 
ATOM   7674  C  CB    . SER C 1 676  ? 99.124  139.895 114.433 1.00 33.05  ?  548  SER C CB    1 
ATOM   7675  O  OG    . SER C 1 676  ? 98.094  140.795 114.805 1.00 33.28  ?  548  SER C OG    1 
ATOM   7676  N  N     . TRP C 1 677  ? 100.280 137.890 112.097 1.00 28.83  ?  549  TRP C N     1 
ATOM   7677  C  CA    . TRP C 1 677  ? 101.258 136.922 111.617 1.00 25.31  ?  549  TRP C CA    1 
ATOM   7678  C  C     . TRP C 1 677  ? 102.644 137.518 111.409 1.00 25.72  ?  549  TRP C C     1 
ATOM   7679  O  O     . TRP C 1 677  ? 103.523 136.832 110.875 1.00 28.21  ?  549  TRP C O     1 
ATOM   7680  C  CB    . TRP C 1 677  ? 100.775 136.277 110.313 1.00 31.40  ?  549  TRP C CB    1 
ATOM   7681  C  CG    . TRP C 1 677  ? 100.468 137.256 109.207 1.00 38.72  ?  549  TRP C CG    1 
ATOM   7682  C  CD1   . TRP C 1 677  ? 99.253  137.806 108.913 1.00 40.87  ?  549  TRP C CD1   1 
ATOM   7683  C  CD2   . TRP C 1 677  ? 101.392 137.793 108.248 1.00 38.94  ?  549  TRP C CD2   1 
ATOM   7684  N  NE1   . TRP C 1 677  ? 99.363  138.649 107.832 1.00 43.03  ?  549  TRP C NE1   1 
ATOM   7685  C  CE2   . TRP C 1 677  ? 100.665 138.659 107.407 1.00 40.46  ?  549  TRP C CE2   1 
ATOM   7686  C  CE3   . TRP C 1 677  ? 102.761 137.625 108.021 1.00 31.65  ?  549  TRP C CE3   1 
ATOM   7687  C  CZ2   . TRP C 1 677  ? 101.262 139.355 106.358 1.00 38.83  ?  549  TRP C CZ2   1 
ATOM   7688  C  CZ3   . TRP C 1 677  ? 103.350 138.316 106.980 1.00 29.76  ?  549  TRP C CZ3   1 
ATOM   7689  C  CH2   . TRP C 1 677  ? 102.603 139.169 106.161 1.00 34.25  ?  549  TRP C CH2   1 
ATOM   7690  N  N     . ASP C 1 678  ? 102.874 138.766 111.816 1.00 31.82  ?  550  ASP C N     1 
ATOM   7691  C  CA    . ASP C 1 678  ? 104.145 139.422 111.544 1.00 33.46  ?  550  ASP C CA    1 
ATOM   7692  C  C     . ASP C 1 678  ? 104.935 139.786 112.793 1.00 31.80  ?  550  ASP C C     1 
ATOM   7693  O  O     . ASP C 1 678  ? 106.007 140.392 112.670 1.00 29.49  ?  550  ASP C O     1 
ATOM   7694  C  CB    . ASP C 1 678  ? 103.919 140.685 110.704 1.00 40.98  ?  550  ASP C CB    1 
ATOM   7695  C  CG    . ASP C 1 678  ? 103.589 141.895 111.553 1.00 67.95  ?  550  ASP C CG    1 
ATOM   7696  O  OD1   . ASP C 1 678  ? 102.726 141.781 112.450 1.00 56.96  ?  550  ASP C OD1   1 
ATOM   7697  O  OD2   . ASP C 1 678  ? 104.205 142.957 111.331 1.00 149.33 -1 550  ASP C OD2   1 
ATOM   7698  N  N     . VAL C 1 679  ? 104.448 139.441 113.986 1.00 28.41  ?  551  VAL C N     1 
ATOM   7699  C  CA    . VAL C 1 679  ? 105.164 139.780 115.209 1.00 23.78  ?  551  VAL C CA    1 
ATOM   7700  C  C     . VAL C 1 679  ? 106.487 139.028 115.256 1.00 16.48  ?  551  VAL C C     1 
ATOM   7701  O  O     . VAL C 1 679  ? 106.568 137.843 114.899 1.00 15.66  ?  551  VAL C O     1 
ATOM   7702  C  CB    . VAL C 1 679  ? 104.298 139.476 116.443 1.00 22.92  ?  551  VAL C CB    1 
ATOM   7703  C  CG1   . VAL C 1 679  ? 103.300 140.601 116.680 1.00 26.25  ?  551  VAL C CG1   1 
ATOM   7704  C  CG2   . VAL C 1 679  ? 103.571 138.157 116.263 1.00 22.69  ?  551  VAL C CG2   1 
ATOM   7705  N  N     . GLY C 1 680  ? 107.537 139.719 115.694 1.00 15.17  ?  552  GLY C N     1 
ATOM   7706  C  CA    . GLY C 1 680  ? 108.862 139.135 115.742 1.00 11.85  ?  552  GLY C CA    1 
ATOM   7707  C  C     . GLY C 1 680  ? 109.192 138.540 117.094 1.00 10.63  ?  552  GLY C C     1 
ATOM   7708  O  O     . GLY C 1 680  ? 108.631 137.509 117.477 1.00 11.64  ?  552  GLY C O     1 
ATOM   7709  N  N     . ILE C 1 681  ? 110.098 139.174 117.830 1.00 9.91   ?  553  ILE C N     1 
ATOM   7710  C  CA    . ILE C 1 681  ? 110.515 138.681 119.136 1.00 5.89   ?  553  ILE C CA    1 
ATOM   7711  C  C     . ILE C 1 681  ? 109.641 139.342 120.197 1.00 16.78  ?  553  ILE C C     1 
ATOM   7712  O  O     . ILE C 1 681  ? 109.780 140.536 120.475 1.00 22.97  ?  553  ILE C O     1 
ATOM   7713  C  CB    . ILE C 1 681  ? 112.002 138.946 119.388 1.00 64.11  ?  553  ILE C CB    1 
ATOM   7714  C  CG1   . ILE C 1 681  ? 112.832 138.272 118.296 1.00 9.15   ?  553  ILE C CG1   1 
ATOM   7715  C  CG2   . ILE C 1 681  ? 112.403 138.436 120.756 1.00 18.19  ?  553  ILE C CG2   1 
ATOM   7716  C  CD1   . ILE C 1 681  ? 114.296 138.150 118.614 1.00 2.08   ?  553  ILE C CD1   1 
ATOM   7717  N  N     . ILE C 1 682  ? 108.736 138.563 120.783 1.00 13.45  ?  554  ILE C N     1 
ATOM   7718  C  CA    . ILE C 1 682  ? 107.852 139.049 121.836 1.00 16.73  ?  554  ILE C CA    1 
ATOM   7719  C  C     . ILE C 1 682  ? 108.625 139.137 123.143 1.00 18.03  ?  554  ILE C C     1 
ATOM   7720  O  O     . ILE C 1 682  ? 109.417 138.246 123.474 1.00 19.30  ?  554  ILE C O     1 
ATOM   7721  C  CB    . ILE C 1 682  ? 106.626 138.125 121.973 1.00 16.83  ?  554  ILE C CB    1 
ATOM   7722  C  CG1   . ILE C 1 682  ? 105.566 138.477 120.932 1.00 21.14  ?  554  ILE C CG1   1 
ATOM   7723  C  CG2   . ILE C 1 682  ? 106.029 138.191 123.371 1.00 17.73  ?  554  ILE C CG2   1 
ATOM   7724  C  CD1   . ILE C 1 682  ? 104.219 137.862 121.221 1.00 17.74  ?  554  ILE C CD1   1 
ATOM   7725  N  N     . ASP C 1 683  ? 108.411 140.221 123.887 1.00 25.61  ?  555  ASP C N     1 
ATOM   7726  C  CA    . ASP C 1 683  ? 108.913 140.287 125.253 1.00 32.10  ?  555  ASP C CA    1 
ATOM   7727  C  C     . ASP C 1 683  ? 108.249 139.198 126.091 1.00 23.47  ?  555  ASP C C     1 
ATOM   7728  O  O     . ASP C 1 683  ? 107.019 139.133 126.179 1.00 28.70  ?  555  ASP C O     1 
ATOM   7729  C  CB    . ASP C 1 683  ? 108.651 141.672 125.847 1.00 45.51  ?  555  ASP C CB    1 
ATOM   7730  C  CG    . ASP C 1 683  ? 107.263 142.204 125.515 1.00 83.34  ?  555  ASP C CG    1 
ATOM   7731  O  OD1   . ASP C 1 683  ? 106.740 141.887 124.424 1.00 62.57  ?  555  ASP C OD1   1 
ATOM   7732  O  OD2   . ASP C 1 683  ? 106.696 142.949 126.345 1.00 185.87 -1 555  ASP C OD2   1 
ATOM   7733  N  N     . GLY C 1 684  ? 109.066 138.339 126.706 1.00 12.25  ?  556  GLY C N     1 
ATOM   7734  C  CA    . GLY C 1 684  ? 108.547 137.122 127.309 1.00 10.17  ?  556  GLY C CA    1 
ATOM   7735  C  C     . GLY C 1 684  ? 107.682 137.331 128.536 1.00 8.71   ?  556  GLY C C     1 
ATOM   7736  O  O     . GLY C 1 684  ? 106.876 136.453 128.865 1.00 7.89   ?  556  GLY C O     1 
ATOM   7737  N  N     . LEU C 1 685  ? 107.833 138.469 129.223 1.00 10.71  ?  557  LEU C N     1 
ATOM   7738  C  CA    . LEU C 1 685  ? 107.048 138.737 130.426 1.00 10.32  ?  557  LEU C CA    1 
ATOM   7739  C  C     . LEU C 1 685  ? 105.551 138.646 130.178 1.00 11.90  ?  557  LEU C C     1 
ATOM   7740  O  O     . LEU C 1 685  ? 104.788 138.445 131.131 1.00 13.37  ?  557  LEU C O     1 
ATOM   7741  C  CB    . LEU C 1 685  ? 107.372 140.126 130.980 1.00 11.38  ?  557  LEU C CB    1 
ATOM   7742  C  CG    . LEU C 1 685  ? 108.841 140.524 131.147 1.00 18.85  ?  557  LEU C CG    1 
ATOM   7743  C  CD1   . LEU C 1 685  ? 109.358 141.270 129.918 1.00 21.63  ?  557  LEU C CD1   1 
ATOM   7744  C  CD2   . LEU C 1 685  ? 109.039 141.355 132.411 1.00 19.96  ?  557  LEU C CD2   1 
ATOM   7745  N  N     . SER C 1 686  ? 105.118 138.803 128.926 1.00 12.21  ?  558  SER C N     1 
ATOM   7746  C  CA    . SER C 1 686  ? 103.701 138.790 128.568 1.00 13.92  ?  558  SER C CA    1 
ATOM   7747  C  C     . SER C 1 686  ? 102.926 139.856 129.342 1.00 15.19  ?  558  SER C C     1 
ATOM   7748  O  O     . SER C 1 686  ? 101.794 139.638 129.778 1.00 15.30  ?  558  SER C O     1 
ATOM   7749  C  CB    . SER C 1 686  ? 103.092 137.400 128.777 1.00 13.20  ?  558  SER C CB    1 
ATOM   7750  O  OG    . SER C 1 686  ? 101.736 137.483 129.176 1.00 14.12  ?  558  SER C OG    1 
ATOM   7751  N  N     . GLY C 1 687  ? 103.546 141.022 129.518 1.00 14.60  ?  559  GLY C N     1 
ATOM   7752  C  CA    . GLY C 1 687  ? 102.876 142.153 130.129 1.00 15.07  ?  559  GLY C CA    1 
ATOM   7753  C  C     . GLY C 1 687  ? 102.536 141.986 131.596 1.00 18.37  ?  559  GLY C C     1 
ATOM   7754  O  O     . GLY C 1 687  ? 101.358 141.908 131.958 1.00 18.02  ?  559  GLY C O     1 
ATOM   7755  N  N     . TRP C 1 688  ? 103.556 141.927 132.450 1.00 19.48  ?  560  TRP C N     1 
ATOM   7756  C  CA    . TRP C 1 688  ? 103.349 141.911 133.893 1.00 20.65  ?  560  TRP C CA    1 
ATOM   7757  C  C     . TRP C 1 688  ? 103.081 143.323 134.388 1.00 19.05  ?  560  TRP C C     1 
ATOM   7758  O  O     . TRP C 1 688  ? 103.834 144.250 134.074 1.00 21.71  ?  560  TRP C O     1 
ATOM   7759  C  CB    . TRP C 1 688  ? 104.575 141.342 134.604 1.00 21.92  ?  560  TRP C CB    1 
ATOM   7760  C  CG    . TRP C 1 688  ? 104.431 139.921 135.004 1.00 20.75  ?  560  TRP C CG    1 
ATOM   7761  C  CD1   . TRP C 1 688  ? 103.332 139.137 134.844 1.00 23.27  ?  560  TRP C CD1   1 
ATOM   7762  C  CD2   . TRP C 1 688  ? 105.432 139.093 135.603 1.00 23.35  ?  560  TRP C CD2   1 
ATOM   7763  N  NE1   . TRP C 1 688  ? 103.577 137.873 135.319 1.00 25.54  ?  560  TRP C NE1   1 
ATOM   7764  C  CE2   . TRP C 1 688  ? 104.862 137.820 135.790 1.00 25.26  ?  560  TRP C CE2   1 
ATOM   7765  C  CE3   . TRP C 1 688  ? 106.753 139.305 136.003 1.00 23.78  ?  560  TRP C CE3   1 
ATOM   7766  C  CZ2   . TRP C 1 688  ? 105.567 136.764 136.361 1.00 27.01  ?  560  TRP C CZ2   1 
ATOM   7767  C  CZ3   . TRP C 1 688  ? 107.450 138.258 136.570 1.00 25.58  ?  560  TRP C CZ3   1 
ATOM   7768  C  CH2   . TRP C 1 688  ? 106.857 137.003 136.744 1.00 25.36  ?  560  TRP C CH2   1 
ATOM   7769  N  N     . THR C 1 689  ? 102.019 143.492 135.165 1.00 11.67  ?  561  THR C N     1 
ATOM   7770  C  CA    . THR C 1 689  ? 101.742 144.802 135.739 1.00 16.28  ?  561  THR C CA    1 
ATOM   7771  C  C     . THR C 1 689  ? 102.864 145.150 136.705 1.00 18.74  ?  561  THR C C     1 
ATOM   7772  O  O     . THR C 1 689  ? 102.961 144.578 137.797 1.00 24.60  ?  561  THR C O     1 
ATOM   7773  C  CB    . THR C 1 689  ? 100.383 144.806 136.424 1.00 15.78  ?  561  THR C CB    1 
ATOM   7774  O  OG1   . THR C 1 689  ? 100.441 144.000 137.607 1.00 17.55  ?  561  THR C OG1   1 
ATOM   7775  C  CG2   . THR C 1 689  ? 99.356  144.231 135.481 1.00 12.64  ?  561  THR C CG2   1 
ATOM   7776  N  N     . VAL C 1 690  ? 103.716 146.092 136.293 1.00 23.30  ?  562  VAL C N     1 
ATOM   7777  C  CA    . VAL C 1 690  ? 105.002 146.310 136.944 1.00 25.88  ?  562  VAL C CA    1 
ATOM   7778  C  C     . VAL C 1 690  ? 104.882 146.839 138.365 1.00 33.44  ?  562  VAL C C     1 
ATOM   7779  O  O     . VAL C 1 690  ? 105.906 146.966 139.047 1.00 38.45  ?  562  VAL C O     1 
ATOM   7780  C  CB    . VAL C 1 690  ? 105.850 147.263 136.074 1.00 29.12  ?  562  VAL C CB    1 
ATOM   7781  C  CG1   . VAL C 1 690  ? 105.519 148.721 136.380 1.00 31.14  ?  562  VAL C CG1   1 
ATOM   7782  C  CG2   . VAL C 1 690  ? 107.339 146.979 136.242 1.00 29.30  ?  562  VAL C CG2   1 
ATOM   7783  N  N     . SER C 1 691  ? 103.666 147.135 138.833 1.00 40.53  ?  563  SER C N     1 
ATOM   7784  C  CA    . SER C 1 691  ? 103.463 147.660 140.180 1.00 50.46  ?  563  SER C CA    1 
ATOM   7785  C  C     . SER C 1 691  ? 104.154 146.784 141.216 1.00 51.93  ?  563  SER C C     1 
ATOM   7786  O  O     . SER C 1 691  ? 103.889 145.581 141.309 1.00 49.67  ?  563  SER C O     1 
ATOM   7787  C  CB    . SER C 1 691  ? 101.965 147.766 140.480 1.00 53.72  ?  563  SER C CB    1 
ATOM   7788  O  OG    . SER C 1 691  ? 101.508 146.662 141.244 1.00 48.79  ?  563  SER C OG    1 
ATOM   7789  N  N     . VAL C 1 692  ? 105.042 147.406 142.002 1.00 51.42  ?  564  VAL C N     1 
ATOM   7790  C  CA    . VAL C 1 692  ? 105.946 146.666 142.881 1.00 51.00  ?  564  VAL C CA    1 
ATOM   7791  C  C     . VAL C 1 692  ? 105.232 146.122 144.103 1.00 47.69  ?  564  VAL C C     1 
ATOM   7792  O  O     . VAL C 1 692  ? 105.877 145.540 144.987 1.00 50.34  ?  564  VAL C O     1 
ATOM   7793  C  CB    . VAL C 1 692  ? 107.133 147.554 143.307 1.00 56.67  ?  564  VAL C CB    1 
ATOM   7794  C  CG1   . VAL C 1 692  ? 108.197 147.577 142.211 1.00 63.05  ?  564  VAL C CG1   1 
ATOM   7795  C  CG2   . VAL C 1 692  ? 106.663 148.957 143.635 1.00 51.16  ?  564  VAL C CG2   1 
ATOM   7796  N  N     . ASP C 1 693  ? 103.918 146.299 144.182 1.00 44.17  ?  565  ASP C N     1 
ATOM   7797  C  CA    . ASP C 1 693  ? 103.136 145.707 145.251 1.00 43.81  ?  565  ASP C CA    1 
ATOM   7798  C  C     . ASP C 1 693  ? 102.821 144.242 144.995 1.00 41.24  ?  565  ASP C C     1 
ATOM   7799  O  O     . ASP C 1 693  ? 102.603 143.495 145.953 1.00 37.35  ?  565  ASP C O     1 
ATOM   7800  C  CB    . ASP C 1 693  ? 101.846 146.501 145.428 1.00 51.32  ?  565  ASP C CB    1 
ATOM   7801  C  CG    . ASP C 1 693  ? 102.057 147.984 145.224 1.00 70.70  ?  565  ASP C CG    1 
ATOM   7802  O  OD1   . ASP C 1 693  ? 103.078 148.507 145.717 1.00 63.60  ?  565  ASP C OD1   1 
ATOM   7803  O  OD2   . ASP C 1 693  ? 101.215 148.621 144.557 1.00 138.09 -1 565  ASP C OD2   1 
ATOM   7804  N  N     . ASP C 1 694  ? 102.802 143.818 143.734 1.00 43.44  ?  566  ASP C N     1 
ATOM   7805  C  CA    . ASP C 1 694  ? 102.539 142.434 143.372 1.00 44.18  ?  566  ASP C CA    1 
ATOM   7806  C  C     . ASP C 1 694  ? 103.861 141.666 143.327 1.00 41.76  ?  566  ASP C C     1 
ATOM   7807  O  O     . ASP C 1 694  ? 104.914 142.182 143.714 1.00 41.05  ?  566  ASP C O     1 
ATOM   7808  C  CB    . ASP C 1 694  ? 101.785 142.388 142.042 1.00 45.84  ?  566  ASP C CB    1 
ATOM   7809  C  CG    . ASP C 1 694  ? 101.066 141.070 141.817 1.00 54.29  ?  566  ASP C CG    1 
ATOM   7810  O  OD1   . ASP C 1 694  ? 101.538 140.031 142.325 1.00 41.63  ?  566  ASP C OD1   1 
ATOM   7811  O  OD2   . ASP C 1 694  ? 100.016 141.080 141.141 1.00 108.33 -1 566  ASP C OD2   1 
ATOM   7812  N  N     . VAL C 1 695  ? 103.819 140.416 142.870 1.00 30.98  ?  567  VAL C N     1 
ATOM   7813  C  CA    . VAL C 1 695  ? 105.069 139.681 142.652 1.00 23.36  ?  567  VAL C CA    1 
ATOM   7814  C  C     . VAL C 1 695  ? 105.894 140.431 141.613 1.00 20.43  ?  567  VAL C C     1 
ATOM   7815  O  O     . VAL C 1 695  ? 105.347 140.846 140.571 1.00 21.74  ?  567  VAL C O     1 
ATOM   7816  C  CB    . VAL C 1 695  ? 104.785 138.233 142.203 1.00 21.36  ?  567  VAL C CB    1 
ATOM   7817  C  CG1   . VAL C 1 695  ? 103.810 138.204 141.042 1.00 17.82  ?  567  VAL C CG1   1 
ATOM   7818  C  CG2   . VAL C 1 695  ? 106.073 137.517 141.831 1.00 18.96  ?  567  VAL C CG2   1 
ATOM   7819  N  N     . PRO C 1 696  ? 107.185 140.660 141.849 1.00 21.57  ?  568  PRO C N     1 
ATOM   7820  C  CA    . PRO C 1 696  ? 107.941 141.590 141.000 1.00 27.61  ?  568  PRO C CA    1 
ATOM   7821  C  C     . PRO C 1 696  ? 107.903 141.222 139.522 1.00 34.77  ?  568  PRO C C     1 
ATOM   7822  O  O     . PRO C 1 696  ? 107.726 140.061 139.147 1.00 30.31  ?  568  PRO C O     1 
ATOM   7823  C  CB    . PRO C 1 696  ? 109.364 141.493 141.561 1.00 31.08  ?  568  PRO C CB    1 
ATOM   7824  C  CG    . PRO C 1 696  ? 109.165 141.106 142.991 1.00 25.88  ?  568  PRO C CG    1 
ATOM   7825  C  CD    . PRO C 1 696  ? 107.977 140.191 143.001 1.00 20.06  ?  568  PRO C CD    1 
ATOM   7826  N  N     . ALA C 1 697  ? 108.068 142.248 138.679 1.00 32.15  ?  569  ALA C N     1 
ATOM   7827  C  CA    . ALA C 1 697  ? 108.156 142.095 137.230 1.00 28.60  ?  569  ALA C CA    1 
ATOM   7828  C  C     . ALA C 1 697  ? 109.596 141.993 136.745 1.00 24.64  ?  569  ALA C C     1 
ATOM   7829  O  O     . ALA C 1 697  ? 109.910 142.441 135.632 1.00 22.06  ?  569  ALA C O     1 
ATOM   7830  C  CB    . ALA C 1 697  ? 107.437 143.249 136.530 1.00 23.34  ?  569  ALA C CB    1 
ATOM   7831  N  N     . ASP C 1 698  ? 110.479 141.410 137.559 1.00 29.52  ?  570  ASP C N     1 
ATOM   7832  C  CA    . ASP C 1 698  ? 111.910 141.430 137.272 1.00 31.83  ?  570  ASP C CA    1 
ATOM   7833  C  C     . ASP C 1 698  ? 112.268 140.490 136.126 1.00 23.75  ?  570  ASP C C     1 
ATOM   7834  O  O     . ASP C 1 698  ? 112.885 140.908 135.139 1.00 22.09  ?  570  ASP C O     1 
ATOM   7835  C  CB    . ASP C 1 698  ? 112.692 141.062 138.536 1.00 56.09  ?  570  ASP C CB    1 
ATOM   7836  C  CG    . ASP C 1 698  ? 114.157 141.460 138.457 1.00 98.75  ?  570  ASP C CG    1 
ATOM   7837  O  OD1   . ASP C 1 698  ? 114.527 142.185 137.510 1.00 88.55  ?  570  ASP C OD1   1 
ATOM   7838  O  OD2   . ASP C 1 698  ? 114.940 141.047 139.340 1.00 201.04 -1 570  ASP C OD2   1 
ATOM   7839  N  N     . THR C 1 699  ? 111.886 139.216 136.247 1.00 16.43  ?  571  THR C N     1 
ATOM   7840  C  CA    . THR C 1 699  ? 112.313 138.139 135.354 1.00 9.31   ?  571  THR C CA    1 
ATOM   7841  C  C     . THR C 1 699  ? 112.358 138.559 133.888 1.00 8.74   ?  571  THR C C     1 
ATOM   7842  O  O     . THR C 1 699  ? 111.378 139.077 133.347 1.00 10.48  ?  571  THR C O     1 
ATOM   7843  C  CB    . THR C 1 699  ? 111.368 136.949 135.526 1.00 7.27   ?  571  THR C CB    1 
ATOM   7844  O  OG1   . THR C 1 699  ? 111.484 136.432 136.858 1.00 11.37  ?  571  THR C OG1   1 
ATOM   7845  C  CG2   . THR C 1 699  ? 111.685 135.867 134.523 1.00 5.03   ?  571  THR C CG2   1 
ATOM   7846  N  N     . ILE C 1 700  ? 113.503 138.321 133.248 1.00 8.66   ?  572  ILE C N     1 
ATOM   7847  C  CA    . ILE C 1 700  ? 113.755 138.741 131.872 1.00 5.25   ?  572  ILE C CA    1 
ATOM   7848  C  C     . ILE C 1 700  ? 113.691 137.520 130.967 1.00 5.41   ?  572  ILE C C     1 
ATOM   7849  O  O     . ILE C 1 700  ? 114.340 136.502 131.240 1.00 7.88   ?  572  ILE C O     1 
ATOM   7850  C  CB    . ILE C 1 700  ? 115.116 139.446 131.742 1.00 1.47   ?  572  ILE C CB    1 
ATOM   7851  C  CG1   . ILE C 1 700  ? 115.040 140.852 132.332 1.00 2.42   ?  572  ILE C CG1   1 
ATOM   7852  C  CG2   . ILE C 1 700  ? 115.552 139.509 130.291 1.00 3.90   ?  572  ILE C CG2   1 
ATOM   7853  C  CD1   . ILE C 1 700  ? 116.315 141.642 132.178 1.00 9.09   ?  572  ILE C CD1   1 
ATOM   7854  N  N     . SER C 1 701  ? 112.923 137.625 129.883 1.00 5.25   ?  573  SER C N     1 
ATOM   7855  C  CA    . SER C 1 701  ? 112.784 136.512 128.955 1.00 6.28   ?  573  SER C CA    1 
ATOM   7856  C  C     . SER C 1 701  ? 112.359 137.037 127.593 1.00 5.37   ?  573  SER C C     1 
ATOM   7857  O  O     . SER C 1 701  ? 111.759 138.110 127.482 1.00 7.31   ?  573  SER C O     1 
ATOM   7858  C  CB    . SER C 1 701  ? 111.782 135.472 129.476 1.00 6.52   ?  573  SER C CB    1 
ATOM   7859  O  OG    . SER C 1 701  ? 110.460 135.978 129.514 1.00 7.22   ?  573  SER C OG    1 
ATOM   7860  N  N     . ARG C 1 702  ? 112.690 136.269 126.558 1.00 4.36   ?  574  ARG C N     1 
ATOM   7861  C  CA    . ARG C 1 702  ? 112.342 136.630 125.192 1.00 3.33   ?  574  ARG C CA    1 
ATOM   7862  C  C     . ARG C 1 702  ? 112.027 135.364 124.413 1.00 3.83   ?  574  ARG C C     1 
ATOM   7863  O  O     . ARG C 1 702  ? 112.626 134.309 124.646 1.00 6.28   ?  574  ARG C O     1 
ATOM   7864  C  CB    . ARG C 1 702  ? 113.472 137.399 124.497 1.00 3.62   ?  574  ARG C CB    1 
ATOM   7865  C  CG    . ARG C 1 702  ? 113.785 138.745 125.113 1.00 3.81   ?  574  ARG C CG    1 
ATOM   7866  C  CD    . ARG C 1 702  ? 112.742 139.773 124.735 1.00 5.50   ?  574  ARG C CD    1 
ATOM   7867  N  NE    . ARG C 1 702  ? 113.211 141.126 125.009 1.00 5.77   ?  574  ARG C NE    1 
ATOM   7868  C  CZ    . ARG C 1 702  ? 112.905 141.814 126.103 1.00 6.64   ?  574  ARG C CZ    1 
ATOM   7869  N  NH1   . ARG C 1 702  ? 112.120 141.278 127.028 1.00 10.84  ?  574  ARG C NH1   1 
ATOM   7870  N  NH2   . ARG C 1 702  ? 113.379 143.040 126.269 1.00 8.44   ?  574  ARG C NH2   1 
ATOM   7871  N  N     . ARG C 1 703  ? 111.095 135.480 123.471 1.00 5.31   ?  575  ARG C N     1 
ATOM   7872  C  CA    . ARG C 1 703  ? 110.650 134.297 122.750 1.00 4.55   ?  575  ARG C CA    1 
ATOM   7873  C  C     . ARG C 1 703  ? 109.860 134.710 121.520 1.00 4.95   ?  575  ARG C C     1 
ATOM   7874  O  O     . ARG C 1 703  ? 109.412 135.853 121.394 1.00 6.48   ?  575  ARG C O     1 
ATOM   7875  C  CB    . ARG C 1 703  ? 109.789 133.395 123.635 1.00 5.04   ?  575  ARG C CB    1 
ATOM   7876  C  CG    . ARG C 1 703  ? 108.401 133.931 123.876 1.00 4.88   ?  575  ARG C CG    1 
ATOM   7877  C  CD    . ARG C 1 703  ? 107.614 133.026 124.794 1.00 3.38   ?  575  ARG C CD    1 
ATOM   7878  N  NE    . ARG C 1 703  ? 106.360 133.662 125.172 1.00 4.88   ?  575  ARG C NE    1 
ATOM   7879  C  CZ    . ARG C 1 703  ? 105.271 133.653 124.414 1.00 7.66   ?  575  ARG C CZ    1 
ATOM   7880  N  NH1   . ARG C 1 703  ? 105.284 133.031 123.243 1.00 8.26   ?  575  ARG C NH1   1 
ATOM   7881  N  NH2   . ARG C 1 703  ? 104.170 134.263 124.826 1.00 10.11  ?  575  ARG C NH2   1 
ATOM   7882  N  N     . PHE C 1 704  ? 109.694 133.750 120.619 1.00 4.74   ?  576  PHE C N     1 
ATOM   7883  C  CA    . PHE C 1 704  ? 108.763 133.868 119.514 1.00 3.21   ?  576  PHE C CA    1 
ATOM   7884  C  C     . PHE C 1 704  ? 107.390 133.386 119.959 1.00 5.64   ?  576  PHE C C     1 
ATOM   7885  O  O     . PHE C 1 704  ? 107.211 132.868 121.063 1.00 7.92   ?  576  PHE C O     1 
ATOM   7886  C  CB    . PHE C 1 704  ? 109.240 133.045 118.322 1.00 2.96   ?  576  PHE C CB    1 
ATOM   7887  C  CG    . PHE C 1 704  ? 110.592 133.433 117.833 1.00 5.17   ?  576  PHE C CG    1 
ATOM   7888  C  CD1   . PHE C 1 704  ? 110.952 134.764 117.748 1.00 7.02   ?  576  PHE C CD1   1 
ATOM   7889  C  CD2   . PHE C 1 704  ? 111.511 132.469 117.466 1.00 6.62   ?  576  PHE C CD2   1 
ATOM   7890  C  CE1   . PHE C 1 704  ? 112.200 135.124 117.295 1.00 7.40   ?  576  PHE C CE1   1 
ATOM   7891  C  CE2   . PHE C 1 704  ? 112.763 132.827 117.014 1.00 6.52   ?  576  PHE C CE2   1 
ATOM   7892  C  CZ    . PHE C 1 704  ? 113.108 134.156 116.929 1.00 5.34   ?  576  PHE C CZ    1 
ATOM   7893  N  N     . ARG C 1 705  ? 106.409 133.559 119.085 1.00 6.26   ?  577  ARG C N     1 
ATOM   7894  C  CA    . ARG C 1 705  ? 105.128 132.901 119.270 1.00 8.45   ?  577  ARG C CA    1 
ATOM   7895  C  C     . ARG C 1 705  ? 105.207 131.508 118.665 1.00 8.45   ?  577  ARG C C     1 
ATOM   7896  O  O     . ARG C 1 705  ? 105.796 131.319 117.597 1.00 10.22  ?  577  ARG C O     1 
ATOM   7897  C  CB    . ARG C 1 705  ? 103.998 133.698 118.626 1.00 13.07  ?  577  ARG C CB    1 
ATOM   7898  C  CG    . ARG C 1 705  ? 104.036 135.180 118.922 1.00 13.10  ?  577  ARG C CG    1 
ATOM   7899  C  CD    . ARG C 1 705  ? 102.668 135.786 118.716 1.00 11.95  ?  577  ARG C CD    1 
ATOM   7900  N  NE    . ARG C 1 705  ? 101.836 134.925 117.886 1.00 10.75  ?  577  ARG C NE    1 
ATOM   7901  C  CZ    . ARG C 1 705  ? 100.538 135.110 117.688 1.00 14.38  ?  577  ARG C CZ    1 
ATOM   7902  N  NH1   . ARG C 1 705  ? 99.917  136.132 118.262 1.00 17.15  ?  577  ARG C NH1   1 
ATOM   7903  N  NH2   . ARG C 1 705  ? 99.861  134.272 116.917 1.00 21.63  ?  577  ARG C NH2   1 
ATOM   7904  N  N     . TYR C 1 706  ? 104.623 130.534 119.365 1.00 7.08   ?  578  TYR C N     1 
ATOM   7905  C  CA    . TYR C 1 706  ? 104.742 129.137 118.955 1.00 7.02   ?  578  TYR C CA    1 
ATOM   7906  C  C     . TYR C 1 706  ? 104.311 128.944 117.506 1.00 9.14   ?  578  TYR C C     1 
ATOM   7907  O  O     . TYR C 1 706  ? 105.043 128.367 116.689 1.00 10.31  ?  578  TYR C O     1 
ATOM   7908  C  CB    . TYR C 1 706  ? 103.904 128.259 119.883 1.00 9.91   ?  578  TYR C CB    1 
ATOM   7909  C  CG    . TYR C 1 706  ? 104.459 126.871 120.090 1.00 9.37   ?  578  TYR C CG    1 
ATOM   7910  C  CD1   . TYR C 1 706  ? 105.399 126.616 121.077 1.00 6.87   ?  578  TYR C CD1   1 
ATOM   7911  C  CD2   . TYR C 1 706  ? 104.030 125.810 119.307 1.00 13.67  ?  578  TYR C CD2   1 
ATOM   7912  C  CE1   . TYR C 1 706  ? 105.908 125.344 121.271 1.00 8.87   ?  578  TYR C CE1   1 
ATOM   7913  C  CE2   . TYR C 1 706  ? 104.531 124.536 119.494 1.00 13.30  ?  578  TYR C CE2   1 
ATOM   7914  C  CZ    . TYR C 1 706  ? 105.469 124.308 120.477 1.00 11.88  ?  578  TYR C CZ    1 
ATOM   7915  O  OH    . TYR C 1 706  ? 105.968 123.040 120.666 1.00 13.35  ?  578  TYR C OH    1 
ATOM   7916  N  N     . ASP C 1 707  ? 103.115 129.435 117.179 1.00 12.82  ?  579  ASP C N     1 
ATOM   7917  C  CA    . ASP C 1 707  ? 102.559 129.300 115.838 1.00 14.44  ?  579  ASP C CA    1 
ATOM   7918  C  C     . ASP C 1 707  ? 103.502 129.837 114.764 1.00 15.17  ?  579  ASP C C     1 
ATOM   7919  O  O     . ASP C 1 707  ? 103.789 129.156 113.769 1.00 16.35  ?  579  ASP C O     1 
ATOM   7920  C  CB    . ASP C 1 707  ? 101.215 130.026 115.786 1.00 21.65  ?  579  ASP C CB    1 
ATOM   7921  C  CG    . ASP C 1 707  ? 101.320 131.481 116.212 1.00 26.69  ?  579  ASP C CG    1 
ATOM   7922  O  OD1   . ASP C 1 707  ? 102.430 131.911 116.583 1.00 19.02  ?  579  ASP C OD1   1 
ATOM   7923  O  OD2   . ASP C 1 707  ? 100.299 132.199 116.168 1.00 66.91  -1 579  ASP C OD2   1 
ATOM   7924  N  N     . VAL C 1 708  ? 103.976 131.072 114.937 1.00 11.92  ?  580  VAL C N     1 
ATOM   7925  C  CA    . VAL C 1 708  ? 104.758 131.717 113.889 1.00 9.46   ?  580  VAL C CA    1 
ATOM   7926  C  C     . VAL C 1 708  ? 106.110 131.031 113.730 1.00 9.85   ?  580  VAL C C     1 
ATOM   7927  O  O     . VAL C 1 708  ? 106.611 130.865 112.610 1.00 10.92  ?  580  VAL C O     1 
ATOM   7928  C  CB    . VAL C 1 708  ? 104.906 133.219 114.187 1.00 7.31   ?  580  VAL C CB    1 
ATOM   7929  C  CG1   . VAL C 1 708  ? 105.698 133.889 113.095 1.00 8.61   ?  580  VAL C CG1   1 
ATOM   7930  C  CG2   . VAL C 1 708  ? 103.539 133.867 114.312 1.00 13.16  ?  580  VAL C CG2   1 
ATOM   7931  N  N     . ALA C 1 709  ? 106.720 130.611 114.840 1.00 8.88   ?  581  ALA C N     1 
ATOM   7932  C  CA    . ALA C 1 709  ? 107.971 129.865 114.748 1.00 8.41   ?  581  ALA C CA    1 
ATOM   7933  C  C     . ALA C 1 709  ? 107.773 128.562 113.985 1.00 10.40  ?  581  ALA C C     1 
ATOM   7934  O  O     . ALA C 1 709  ? 108.598 128.192 113.134 1.00 12.49  ?  581  ALA C O     1 
ATOM   7935  C  CB    . ALA C 1 709  ? 108.520 129.588 116.146 1.00 7.58   ?  581  ALA C CB    1 
ATOM   7936  N  N     . LEU C 1 710  ? 106.677 127.857 114.273 1.00 10.45  ?  582  LEU C N     1 
ATOM   7937  C  CA    . LEU C 1 710  ? 106.390 126.612 113.571 1.00 10.34  ?  582  LEU C CA    1 
ATOM   7938  C  C     . LEU C 1 710  ? 106.215 126.845 112.074 1.00 12.42  ?  582  LEU C C     1 
ATOM   7939  O  O     . LEU C 1 710  ? 106.757 126.095 111.252 1.00 15.12  ?  582  LEU C O     1 
ATOM   7940  C  CB    . LEU C 1 710  ? 105.147 125.955 114.166 1.00 8.61   ?  582  LEU C CB    1 
ATOM   7941  C  CG    . LEU C 1 710  ? 105.390 124.572 114.764 1.00 7.63   ?  582  LEU C CG    1 
ATOM   7942  C  CD1   . LEU C 1 710  ? 104.094 123.960 115.260 1.00 13.78  ?  582  LEU C CD1   1 
ATOM   7943  C  CD2   . LEU C 1 710  ? 106.035 123.687 113.725 1.00 7.24   ?  582  LEU C CD2   1 
ATOM   7944  N  N     . VAL C 1 711  ? 105.443 127.872 111.697 1.00 11.21  ?  583  VAL C N     1 
ATOM   7945  C  CA    . VAL C 1 711  ? 105.228 128.110 110.270 1.00 10.61  ?  583  VAL C CA    1 
ATOM   7946  C  C     . VAL C 1 711  ? 106.531 128.519 109.597 1.00 11.99  ?  583  VAL C C     1 
ATOM   7947  O  O     . VAL C 1 711  ? 106.776 128.164 108.437 1.00 17.10  ?  583  VAL C O     1 
ATOM   7948  C  CB    . VAL C 1 711  ? 104.117 129.152 110.015 1.00 13.63  ?  583  VAL C CB    1 
ATOM   7949  C  CG1   . VAL C 1 711  ? 102.837 128.770 110.739 1.00 21.73  ?  583  VAL C CG1   1 
ATOM   7950  C  CG2   . VAL C 1 711  ? 104.566 130.550 110.392 1.00 12.20  ?  583  VAL C CG2   1 
ATOM   7951  N  N     . SER C 1 712  ? 107.395 129.248 110.309 1.00 10.33  ?  584  SER C N     1 
ATOM   7952  C  CA    . SER C 1 712  ? 108.692 129.607 109.751 1.00 15.22  ?  584  SER C CA    1 
ATOM   7953  C  C     . SER C 1 712  ? 109.522 128.362 109.462 1.00 21.16  ?  584  SER C C     1 
ATOM   7954  O  O     . SER C 1 712  ? 110.078 128.209 108.366 1.00 20.31  ?  584  SER C O     1 
ATOM   7955  C  CB    . SER C 1 712  ? 109.426 130.544 110.712 1.00 16.68  ?  584  SER C CB    1 
ATOM   7956  O  OG    . SER C 1 712  ? 110.589 131.094 110.118 1.00 13.54  ?  584  SER C OG    1 
ATOM   7957  N  N     . ALA C 1 713  ? 109.608 127.453 110.439 1.00 17.44  ?  585  ALA C N     1 
ATOM   7958  C  CA    . ALA C 1 713  ? 110.374 126.223 110.237 1.00 17.01  ?  585  ALA C CA    1 
ATOM   7959  C  C     . ALA C 1 713  ? 109.789 125.385 109.107 1.00 20.34  ?  585  ALA C C     1 
ATOM   7960  O  O     . ALA C 1 713  ? 110.527 124.781 108.315 1.00 26.37  ?  585  ALA C O     1 
ATOM   7961  C  CB    . ALA C 1 713  ? 110.417 125.413 111.531 1.00 14.88  ?  585  ALA C CB    1 
ATOM   7962  N  N     . LEU C 1 714  ? 108.461 125.336 109.016 1.00 17.98  ?  586  LEU C N     1 
ATOM   7963  C  CA    . LEU C 1 714  ? 107.821 124.568 107.956 1.00 21.04  ?  586  LEU C CA    1 
ATOM   7964  C  C     . LEU C 1 714  ? 108.154 125.144 106.580 1.00 24.54  ?  586  LEU C C     1 
ATOM   7965  O  O     . LEU C 1 714  ? 108.538 124.401 105.663 1.00 26.87  ?  586  LEU C O     1 
ATOM   7966  C  CB    . LEU C 1 714  ? 106.313 124.540 108.186 1.00 15.83  ?  586  LEU C CB    1 
ATOM   7967  C  CG    . LEU C 1 714  ? 105.655 123.219 107.804 1.00 24.12  ?  586  LEU C CG    1 
ATOM   7968  C  CD1   . LEU C 1 714  ? 106.437 122.056 108.395 1.00 20.41  ?  586  LEU C CD1   1 
ATOM   7969  C  CD2   . LEU C 1 714  ? 104.209 123.194 108.265 1.00 28.14  ?  586  LEU C CD2   1 
ATOM   7970  N  N     . LYS C 1 715  ? 108.008 126.475 106.417 1.00 23.65  ?  587  LYS C N     1 
ATOM   7971  C  CA    . LYS C 1 715  ? 108.382 127.114 105.159 1.00 24.51  ?  587  LYS C CA    1 
ATOM   7972  C  C     . LYS C 1 715  ? 109.833 126.866 104.826 1.00 25.64  ?  587  LYS C C     1 
ATOM   7973  O  O     . LYS C 1 715  ? 110.189 126.804 103.645 1.00 33.51  ?  587  LYS C O     1 
ATOM   7974  C  CB    . LYS C 1 715  ? 108.173 128.623 105.189 1.00 21.76  ?  587  LYS C CB    1 
ATOM   7975  C  CG    . LYS C 1 715  ? 107.961 129.135 103.762 1.00 20.83  ?  587  LYS C CG    1 
ATOM   7976  C  CD    . LYS C 1 715  ? 107.008 130.235 103.711 1.00 18.98  ?  587  LYS C CD    1 
ATOM   7977  C  CE    . LYS C 1 715  ? 105.706 129.942 104.304 1.00 21.05  ?  587  LYS C CE    1 
ATOM   7978  N  NZ    . LYS C 1 715  ? 105.223 128.663 103.886 1.00 27.39  ?  587  LYS C NZ    1 
ATOM   7979  N  N     . ASP C 1 716  ? 110.680 126.848 105.846 1.00 27.49  ?  588  ASP C N     1 
ATOM   7980  C  CA    . ASP C 1 716  ? 112.062 126.458 105.645 1.00 36.38  ?  588  ASP C CA    1 
ATOM   7981  C  C     . ASP C 1 716  ? 112.145 125.079 105.006 1.00 37.02  ?  588  ASP C C     1 
ATOM   7982  O  O     . ASP C 1 716  ? 112.823 124.887 103.988 1.00 42.01  ?  588  ASP C O     1 
ATOM   7983  C  CB    . ASP C 1 716  ? 112.814 126.478 106.981 1.00 41.74  ?  588  ASP C CB    1 
ATOM   7984  C  CG    . ASP C 1 716  ? 114.306 126.210 106.829 1.00 53.81  ?  588  ASP C CG    1 
ATOM   7985  O  OD1   . ASP C 1 716  ? 114.689 125.172 106.248 1.00 60.75  ?  588  ASP C OD1   1 
ATOM   7986  O  OD2   . ASP C 1 716  ? 115.100 127.050 107.295 1.00 106.20 -1 588  ASP C OD2   1 
ATOM   7987  N  N     . LEU C 1 717  ? 111.454 124.108 105.593 1.00 37.85  ?  589  LEU C N     1 
ATOM   7988  C  CA    . LEU C 1 717  ? 111.533 122.725 105.136 1.00 35.67  ?  589  LEU C CA    1 
ATOM   7989  C  C     . LEU C 1 717  ? 110.760 122.470 103.848 1.00 40.94  ?  589  LEU C C     1 
ATOM   7990  O  O     . LEU C 1 717  ? 110.752 121.328 103.362 1.00 51.59  ?  589  LEU C O     1 
ATOM   7991  C  CB    . LEU C 1 717  ? 111.027 121.793 106.230 1.00 34.35  ?  589  LEU C CB    1 
ATOM   7992  C  CG    . LEU C 1 717  ? 111.989 120.658 106.559 1.00 38.90  ?  589  LEU C CG    1 
ATOM   7993  C  CD1   . LEU C 1 717  ? 113.373 121.202 106.872 1.00 31.96  ?  589  LEU C CD1   1 
ATOM   7994  C  CD2   . LEU C 1 717  ? 111.439 119.887 107.728 1.00 36.32  ?  589  LEU C CD2   1 
ATOM   7995  N  N     . GLU C 1 718  ? 110.089 123.493 103.325 1.00 41.04  ?  590  GLU C N     1 
ATOM   7996  C  CA    . GLU C 1 718  ? 109.403 123.413 102.039 1.00 48.23  ?  590  GLU C CA    1 
ATOM   7997  C  C     . GLU C 1 718  ? 110.221 122.684 100.974 1.00 57.54  ?  590  GLU C C     1 
ATOM   7998  O  O     . GLU C 1 718  ? 109.668 121.911 100.181 1.00 60.37  ?  590  GLU C O     1 
ATOM   7999  C  CB    . GLU C 1 718  ? 109.047 124.822 101.559 1.00 50.25  ?  590  GLU C CB    1 
ATOM   8000  C  CG    . GLU C 1 718  ? 109.210 125.051 100.068 1.00 64.81  ?  590  GLU C CG    1 
ATOM   8001  C  CD    . GLU C 1 718  ? 109.208 126.522 99.709  1.00 87.73  ?  590  GLU C CD    1 
ATOM   8002  O  OE1   . GLU C 1 718  ? 108.285 127.241 100.149 1.00 66.75  ?  590  GLU C OE1   1 
ATOM   8003  O  OE2   . GLU C 1 718  ? 110.128 126.961 98.988  1.00 173.45 -1 590  GLU C OE2   1 
ATOM   8004  N  N     . GLU C 1 719  ? 111.538 122.911 100.954 1.00 64.19  ?  591  GLU C N     1 
ATOM   8005  C  CA    . GLU C 1 719  ? 112.395 122.254 99.971  1.00 76.57  ?  591  GLU C CA    1 
ATOM   8006  C  C     . GLU C 1 719  ? 112.284 120.737 100.073 1.00 74.99  ?  591  GLU C C     1 
ATOM   8007  O  O     . GLU C 1 719  ? 111.976 120.051 99.089  1.00 77.58  ?  591  GLU C O     1 
ATOM   8008  C  CB    . GLU C 1 719  ? 113.846 122.704 100.161 1.00 85.23  ?  591  GLU C CB    1 
ATOM   8009  C  CG    . GLU C 1 719  ? 114.689 122.682 98.890  1.00 103.83 ?  591  GLU C CG    1 
ATOM   8010  C  CD    . GLU C 1 719  ? 115.121 121.284 98.482  1.00 117.46 ?  591  GLU C CD    1 
ATOM   8011  O  OE1   . GLU C 1 719  ? 115.097 120.370 99.333  1.00 103.23 ?  591  GLU C OE1   1 
ATOM   8012  O  OE2   . GLU C 1 719  ? 115.488 121.099 97.303  1.00 180.26 -1 591  GLU C OE2   1 
ATOM   8013  N  N     . ASP C 1 720  ? 112.536 120.194 101.266 1.00 69.18  ?  592  ASP C N     1 
ATOM   8014  C  CA    . ASP C 1 720  ? 112.514 118.746 101.428 1.00 65.48  ?  592  ASP C CA    1 
ATOM   8015  C  C     . ASP C 1 720  ? 111.106 118.185 101.293 1.00 60.66  ?  592  ASP C C     1 
ATOM   8016  O  O     . ASP C 1 720  ? 110.943 117.054 100.822 1.00 63.20  ?  592  ASP C O     1 
ATOM   8017  C  CB    . ASP C 1 720  ? 113.118 118.353 102.775 1.00 70.99  ?  592  ASP C CB    1 
ATOM   8018  C  CG    . ASP C 1 720  ? 114.590 118.705 102.876 1.00 92.60  ?  592  ASP C CG    1 
ATOM   8019  O  OD1   . ASP C 1 720  ? 115.065 119.515 102.053 1.00 89.76  ?  592  ASP C OD1   1 
ATOM   8020  O  OD2   . ASP C 1 720  ? 115.272 118.175 103.779 1.00 135.98 -1 592  ASP C OD2   1 
ATOM   8021  N  N     . ILE C 1 721  ? 110.078 118.947 101.679 1.00 60.57  ?  593  ILE C N     1 
ATOM   8022  C  CA    . ILE C 1 721  ? 108.726 118.416 101.511 1.00 66.98  ?  593  ILE C CA    1 
ATOM   8023  C  C     . ILE C 1 721  ? 108.385 118.293 100.027 1.00 73.97  ?  593  ILE C C     1 
ATOM   8024  O  O     . ILE C 1 721  ? 107.783 117.300 99.594  1.00 78.32  ?  593  ILE C O     1 
ATOM   8025  C  CB    . ILE C 1 721  ? 107.679 119.249 102.284 1.00 61.94  ?  593  ILE C CB    1 
ATOM   8026  C  CG1   . ILE C 1 721  ? 107.294 120.533 101.545 1.00 55.99  ?  593  ILE C CG1   1 
ATOM   8027  C  CG2   . ILE C 1 721  ? 108.162 119.557 103.694 1.00 63.44  ?  593  ILE C CG2   1 
ATOM   8028  C  CD1   . ILE C 1 721  ? 106.138 121.267 102.183 1.00 51.20  ?  593  ILE C CD1   1 
ATOM   8029  N  N     . MET C 1 722  ? 108.810 119.265 99.212  1.00 68.06  ?  594  MET C N     1 
ATOM   8030  C  CA    . MET C 1 722  ? 108.546 119.173 97.780  1.00 67.88  ?  594  MET C CA    1 
ATOM   8031  C  C     . MET C 1 722  ? 109.395 118.082 97.138  1.00 71.19  ?  594  MET C C     1 
ATOM   8032  O  O     . MET C 1 722  ? 108.932 117.373 96.233  1.00 82.31  ?  594  MET C O     1 
ATOM   8033  C  CB    . MET C 1 722  ? 108.794 120.524 97.113  1.00 64.67  ?  594  MET C CB    1 
ATOM   8034  C  CG    . MET C 1 722  ? 108.004 120.733 95.833  1.00 67.92  ?  594  MET C CG    1 
ATOM   8035  S  SD    . MET C 1 722  ? 106.225 120.608 96.109  1.00 67.67  ?  594  MET C SD    1 
ATOM   8036  C  CE    . MET C 1 722  ? 105.958 121.930 97.288  1.00 44.97  ?  594  MET C CE    1 
ATOM   8037  N  N     . GLU C 1 723  ? 110.634 117.916 97.610  1.00 69.34  ?  595  GLU C N     1 
ATOM   8038  C  CA    . GLU C 1 723  ? 111.462 116.820 97.119  1.00 76.69  ?  595  GLU C CA    1 
ATOM   8039  C  C     . GLU C 1 723  ? 110.827 115.469 97.427  1.00 84.00  ?  595  GLU C C     1 
ATOM   8040  O  O     . GLU C 1 723  ? 110.829 114.566 96.581  1.00 91.47  ?  595  GLU C O     1 
ATOM   8041  C  CB    . GLU C 1 723  ? 112.865 116.907 97.723  1.00 84.97  ?  595  GLU C CB    1 
ATOM   8042  C  CG    . GLU C 1 723  ? 113.482 115.557 98.072  1.00 95.73  ?  595  GLU C CG    1 
ATOM   8043  C  CD    . GLU C 1 723  ? 113.970 114.794 96.853  1.00 117.41 ?  595  GLU C CD    1 
ATOM   8044  O  OE1   . GLU C 1 723  ? 113.882 115.334 95.729  1.00 107.49 ?  595  GLU C OE1   1 
ATOM   8045  O  OE2   . GLU C 1 723  ? 114.431 113.645 97.018  1.00 202.08 -1 595  GLU C OE2   1 
ATOM   8046  N  N     . GLY C 1 724  ? 110.272 115.312 98.632  1.00 82.12  ?  596  GLY C N     1 
ATOM   8047  C  CA    . GLY C 1 724  ? 109.633 114.058 98.986  1.00 82.54  ?  596  GLY C CA    1 
ATOM   8048  C  C     . GLY C 1 724  ? 108.352 113.808 98.218  1.00 81.47  ?  596  GLY C C     1 
ATOM   8049  O  O     . GLY C 1 724  ? 108.031 112.658 97.899  1.00 83.19  ?  596  GLY C O     1 
ATOM   8050  N  N     . LEU C 1 725  ? 107.600 114.870 97.917  1.00 81.96  ?  597  LEU C N     1 
ATOM   8051  C  CA    . LEU C 1 725  ? 106.438 114.712 97.047  1.00 84.27  ?  597  LEU C CA    1 
ATOM   8052  C  C     . LEU C 1 725  ? 106.859 114.288 95.645  1.00 95.13  ?  597  LEU C C     1 
ATOM   8053  O  O     . LEU C 1 725  ? 106.151 113.522 94.979  1.00 98.06  ?  597  LEU C O     1 
ATOM   8054  C  CB    . LEU C 1 725  ? 105.631 116.009 97.001  1.00 81.20  ?  597  LEU C CB    1 
ATOM   8055  C  CG    . LEU C 1 725  ? 104.909 116.418 98.289  1.00 70.03  ?  597  LEU C CG    1 
ATOM   8056  C  CD1   . LEU C 1 725  ? 103.848 117.470 98.004  1.00 62.24  ?  597  LEU C CD1   1 
ATOM   8057  C  CD2   . LEU C 1 725  ? 104.297 115.210 98.978  1.00 68.53  ?  597  LEU C CD2   1 
ATOM   8058  N  N     . ARG C 1 726  ? 108.011 114.779 95.178  1.00 102.69 ?  598  ARG C N     1 
ATOM   8059  C  CA    . ARG C 1 726  ? 108.543 114.323 93.895  1.00 105.45 ?  598  ARG C CA    1 
ATOM   8060  C  C     . ARG C 1 726  ? 108.922 112.847 93.947  1.00 101.54 ?  598  ARG C C     1 
ATOM   8061  O  O     . ARG C 1 726  ? 108.552 112.066 93.061  1.00 101.74 ?  598  ARG C O     1 
ATOM   8062  C  CB    . ARG C 1 726  ? 109.753 115.168 93.492  1.00 105.41 ?  598  ARG C CB    1 
ATOM   8063  C  CG    . ARG C 1 726  ? 109.400 116.573 93.066  1.00 108.77 ?  598  ARG C CG    1 
ATOM   8064  C  CD    . ARG C 1 726  ? 108.437 116.544 91.896  1.00 122.15 ?  598  ARG C CD    1 
ATOM   8065  N  NE    . ARG C 1 726  ? 107.546 117.696 91.914  1.00 138.72 ?  598  ARG C NE    1 
ATOM   8066  C  CZ    . ARG C 1 726  ? 106.362 117.711 92.519  1.00 140.52 ?  598  ARG C CZ    1 
ATOM   8067  N  NH1   . ARG C 1 726  ? 105.928 116.632 93.157  1.00 128.62 ?  598  ARG C NH1   1 
ATOM   8068  N  NH2   . ARG C 1 726  ? 105.615 118.805 92.487  1.00 158.79 ?  598  ARG C NH2   1 
ATOM   8069  N  N     . GLU C 1 727  ? 109.665 112.448 94.984  1.00 100.46 ?  599  GLU C N     1 
ATOM   8070  C  CA    . GLU C 1 727  ? 110.174 111.081 95.063  1.00 98.89  ?  599  GLU C CA    1 
ATOM   8071  C  C     . GLU C 1 727  ? 109.038 110.073 95.167  1.00 96.77  ?  599  GLU C C     1 
ATOM   8072  O  O     . GLU C 1 727  ? 108.959 109.124 94.377  1.00 100.20 ?  599  GLU C O     1 
ATOM   8073  C  CB    . GLU C 1 727  ? 111.126 110.946 96.255  1.00 99.82  ?  599  GLU C CB    1 
ATOM   8074  C  CG    . GLU C 1 727  ? 111.895 109.628 96.308  1.00 110.38 ?  599  GLU C CG    1 
ATOM   8075  C  CD    . GLU C 1 727  ? 111.051 108.462 96.796  1.00 119.03 ?  599  GLU C CD    1 
ATOM   8076  O  OE1   . GLU C 1 727  ? 110.097 108.696 97.569  1.00 102.57 ?  599  GLU C OE1   1 
ATOM   8077  O  OE2   . GLU C 1 727  ? 111.328 107.315 96.390  1.00 174.14 -1 599  GLU C OE2   1 
ATOM   8078  N  N     . ARG C 1 728  ? 108.153 110.253 96.153  1.00 90.95  ?  600  ARG C N     1 
ATOM   8079  C  CA    . ARG C 1 728  ? 107.027 109.347 96.345  1.00 85.13  ?  600  ARG C CA    1 
ATOM   8080  C  C     . ARG C 1 728  ? 106.113 109.310 95.129  1.00 91.20  ?  600  ARG C C     1 
ATOM   8081  O  O     . ARG C 1 728  ? 105.198 108.478 95.078  1.00 90.82  ?  600  ARG C O     1 
ATOM   8082  C  CB    . ARG C 1 728  ? 106.247 109.760 97.597  1.00 79.77  ?  600  ARG C CB    1 
ATOM   8083  C  CG    . ARG C 1 728  ? 105.272 108.716 98.113  1.00 74.38  ?  600  ARG C CG    1 
ATOM   8084  C  CD    . ARG C 1 728  ? 105.984 107.402 98.397  1.00 71.01  ?  600  ARG C CD    1 
ATOM   8085  N  NE    . ARG C 1 728  ? 107.076 107.563 99.354  1.00 69.79  ?  600  ARG C NE    1 
ATOM   8086  C  CZ    . ARG C 1 728  ? 107.683 106.554 99.972  1.00 66.17  ?  600  ARG C CZ    1 
ATOM   8087  N  NH1   . ARG C 1 728  ? 107.309 105.304 99.732  1.00 68.58  ?  600  ARG C NH1   1 
ATOM   8088  N  NH2   . ARG C 1 728  ? 108.666 106.794 100.828 1.00 63.81  ?  600  ARG C NH2   1 
ATOM   8089  N  N     . ALA C 1 729  ? 106.356 110.185 94.153  1.00 105.14 ?  601  ALA C N     1 
ATOM   8090  C  CA    . ALA C 1 729  ? 105.609 110.264 92.905  1.00 117.61 ?  601  ALA C CA    1 
ATOM   8091  C  C     . ALA C 1 729  ? 104.143 110.588 93.137  1.00 123.31 ?  601  ALA C C     1 
ATOM   8092  O  O     . ALA C 1 729  ? 103.296 110.280 92.294  1.00 128.86 ?  601  ALA C O     1 
ATOM   8093  C  CB    . ALA C 1 729  ? 105.750 108.975 92.087  1.00 121.39 ?  601  ALA C CB    1 
ATOM   8094  N  N     . LEU C 1 730  ? 103.827 111.207 94.270  1.00 118.08 ?  602  LEU C N     1 
ATOM   8095  C  CA    . LEU C 1 730  ? 102.456 111.604 94.537  1.00 128.91 ?  602  LEU C CA    1 
ATOM   8096  C  C     . LEU C 1 730  ? 102.077 112.802 93.675  1.00 135.70 ?  602  LEU C C     1 
ATOM   8097  O  O     . LEU C 1 730  ? 102.908 113.661 93.364  1.00 128.01 ?  602  LEU C O     1 
ATOM   8098  C  CB    . LEU C 1 730  ? 102.274 111.937 96.019  1.00 123.76 ?  602  LEU C CB    1 
ATOM   8099  C  CG    . LEU C 1 730  ? 100.884 112.408 96.457  1.00 129.87 ?  602  LEU C CG    1 
ATOM   8100  C  CD1   . LEU C 1 730  ? 99.836  111.348 96.156  1.00 133.52 ?  602  LEU C CD1   1 
ATOM   8101  C  CD2   . LEU C 1 730  ? 100.874 112.764 97.932  1.00 120.46 ?  602  LEU C CD2   1 
ATOM   8102  N  N     . ASP C 1 731  ? 100.808 112.841 93.275  1.00 144.20 ?  603  ASP C N     1 
ATOM   8103  C  CA    . ASP C 1 731  ? 100.281 113.975 92.538  1.00 146.13 ?  603  ASP C CA    1 
ATOM   8104  C  C     . ASP C 1 731  ? 100.377 115.243 93.385  1.00 137.94 ?  603  ASP C C     1 
ATOM   8105  O  O     . ASP C 1 731  ? 100.637 115.204 94.588  1.00 134.00 ?  603  ASP C O     1 
ATOM   8106  C  CB    . ASP C 1 731  ? 98.831  113.718 92.136  1.00 158.36 ?  603  ASP C CB    1 
ATOM   8107  C  CG    . ASP C 1 731  ? 98.579  112.271 91.764  1.00 178.55 ?  603  ASP C CG    1 
ATOM   8108  O  OD1   . ASP C 1 731  ? 99.427  111.679 91.063  1.00 173.06 ?  603  ASP C OD1   1 
ATOM   8109  O  OD2   . ASP C 1 731  ? 97.538  111.722 92.182  1.00 227.32 -1 603  ASP C OD2   1 
ATOM   8110  N  N     . ASP C 1 732  ? 100.158 116.383 92.737  1.00 133.82 ?  604  ASP C N     1 
ATOM   8111  C  CA    . ASP C 1 732  ? 100.220 117.677 93.408  1.00 130.93 ?  604  ASP C CA    1 
ATOM   8112  C  C     . ASP C 1 732  ? 98.859  118.320 93.610  1.00 124.35 ?  604  ASP C C     1 
ATOM   8113  O  O     . ASP C 1 732  ? 98.601  118.876 94.680  1.00 122.10 ?  604  ASP C O     1 
ATOM   8114  C  CB    . ASP C 1 732  ? 101.126 118.633 92.626  1.00 146.18 ?  604  ASP C CB    1 
ATOM   8115  C  CG    . ASP C 1 732  ? 102.566 118.164 92.592  1.00 161.41 ?  604  ASP C CG    1 
ATOM   8116  O  OD1   . ASP C 1 732  ? 102.846 117.056 93.098  1.00 144.96 ?  604  ASP C OD1   1 
ATOM   8117  O  OD2   . ASP C 1 732  ? 103.422 118.904 92.065  1.00 217.34 -1 604  ASP C OD2   1 
ATOM   8118  N  N     . SER C 1 733  ? 97.972  118.257 92.617  1.00 123.93 ?  605  SER C N     1 
ATOM   8119  C  CA    . SER C 1 733  ? 96.610  118.740 92.808  1.00 127.77 ?  605  SER C CA    1 
ATOM   8120  C  C     . SER C 1 733  ? 95.785  117.838 93.718  1.00 134.73 ?  605  SER C C     1 
ATOM   8121  O  O     . SER C 1 733  ? 94.596  118.115 93.915  1.00 133.23 ?  605  SER C O     1 
ATOM   8122  C  CB    . SER C 1 733  ? 95.910  118.886 91.455  1.00 127.56 ?  605  SER C CB    1 
ATOM   8123  O  OG    . SER C 1 733  ? 94.580  119.350 91.616  1.00 122.99 ?  605  SER C OG    1 
ATOM   8124  N  N     . MET C 1 734  ? 96.377  116.780 94.278  1.00 137.17 ?  606  MET C N     1 
ATOM   8125  C  CA    . MET C 1 734  ? 95.663  115.832 95.125  1.00 145.48 ?  606  MET C CA    1 
ATOM   8126  C  C     . MET C 1 734  ? 96.307  115.654 96.496  1.00 135.30 ?  606  MET C C     1 
ATOM   8127  O  O     . MET C 1 734  ? 95.942  114.721 97.221  1.00 132.74 ?  606  MET C O     1 
ATOM   8128  C  CB    . MET C 1 734  ? 95.557  114.473 94.424  1.00 152.67 ?  606  MET C CB    1 
ATOM   8129  C  CG    . MET C 1 734  ? 94.157  114.122 93.943  1.00 150.89 ?  606  MET C CG    1 
ATOM   8130  S  SD    . MET C 1 734  ? 92.981  113.916 95.293  1.00 146.09 ?  606  MET C SD    1 
ATOM   8131  C  CE    . MET C 1 734  ? 91.553  113.297 94.406  1.00 143.18 ?  606  MET C CE    1 
ATOM   8132  N  N     . CYS C 1 735  ? 97.249  116.517 96.875  1.00 126.91 ?  607  CYS C N     1 
ATOM   8133  C  CA    . CYS C 1 735  ? 97.935  116.433 98.164  1.00 112.60 ?  607  CYS C CA    1 
ATOM   8134  C  C     . CYS C 1 735  ? 97.887  117.777 98.881  1.00 99.05  ?  607  CYS C C     1 
ATOM   8135  O  O     . CYS C 1 735  ? 98.885  118.268 99.412  1.00 91.38  ?  607  CYS C O     1 
ATOM   8136  C  CB    . CYS C 1 735  ? 99.380  115.972 97.993  1.00 108.67 ?  607  CYS C CB    1 
ATOM   8137  S  SG    . CYS C 1 735  ? 100.425 117.074 97.009  1.00 115.30 ?  607  CYS C SG    1 
ATOM   8138  N  N     . THR C 1 736  ? 96.707  118.393 98.908  1.00 91.68  ?  608  THR C N     1 
ATOM   8139  C  CA    . THR C 1 736  ? 96.538  119.692 99.543  1.00 73.30  ?  608  THR C CA    1 
ATOM   8140  C  C     . THR C 1 736  ? 95.986  119.608 100.961 1.00 73.58  ?  608  THR C C     1 
ATOM   8141  O  O     . THR C 1 736  ? 95.968  120.628 101.657 1.00 70.54  ?  608  THR C O     1 
ATOM   8142  C  CB    . THR C 1 736  ? 95.616  120.585 98.699  1.00 66.19  ?  608  THR C CB    1 
ATOM   8143  O  OG1   . THR C 1 736  ? 94.268  120.104 98.786  1.00 66.60  ?  608  THR C OG1   1 
ATOM   8144  C  CG2   . THR C 1 736  ? 96.056  120.589 97.243  1.00 75.18  ?  608  THR C CG2   1 
ATOM   8145  N  N     . SER C 1 737  ? 95.538  118.436 101.410 1.00 76.24  ?  609  SER C N     1 
ATOM   8146  C  CA    . SER C 1 737  ? 94.893  118.323 102.714 1.00 71.52  ?  609  SER C CA    1 
ATOM   8147  C  C     . SER C 1 737  ? 95.637  117.421 103.686 1.00 67.88  ?  609  SER C C     1 
ATOM   8148  O  O     . SER C 1 737  ? 95.962  117.852 104.799 1.00 62.30  ?  609  SER C O     1 
ATOM   8149  C  CB    . SER C 1 737  ? 93.452  117.816 102.544 1.00 73.26  ?  609  SER C CB    1 
ATOM   8150  O  OG    . SER C 1 737  ? 92.821  117.655 103.803 1.00 72.48  ?  609  SER C OG    1 
ATOM   8151  N  N     . GLY C 1 738  ? 95.923  116.182 103.300 1.00 72.80  ?  610  GLY C N     1 
ATOM   8152  C  CA    . GLY C 1 738  ? 96.352  115.177 104.254 1.00 78.80  ?  610  GLY C CA    1 
ATOM   8153  C  C     . GLY C 1 738  ? 97.799  115.219 104.704 1.00 65.60  ?  610  GLY C C     1 
ATOM   8154  O  O     . GLY C 1 738  ? 98.583  114.341 104.337 1.00 64.72  ?  610  GLY C O     1 
ATOM   8155  N  N     . PHE C 1 739  ? 98.164  116.208 105.516 1.00 55.87  ?  611  PHE C N     1 
ATOM   8156  C  CA    . PHE C 1 739  ? 99.508  116.311 106.065 1.00 47.33  ?  611  PHE C CA    1 
ATOM   8157  C  C     . PHE C 1 739  ? 99.494  116.061 107.570 1.00 42.59  ?  611  PHE C C     1 
ATOM   8158  O  O     . PHE C 1 739  ? 98.508  116.348 108.255 1.00 42.17  ?  611  PHE C O     1 
ATOM   8159  C  CB    . PHE C 1 739  ? 100.121 117.682 105.766 1.00 48.71  ?  611  PHE C CB    1 
ATOM   8160  C  CG    . PHE C 1 739  ? 100.756 117.774 104.408 1.00 57.03  ?  611  PHE C CG    1 
ATOM   8161  C  CD1   . PHE C 1 739  ? 99.980  117.943 103.275 1.00 66.35  ?  611  PHE C CD1   1 
ATOM   8162  C  CD2   . PHE C 1 739  ? 102.129 117.672 104.263 1.00 60.34  ?  611  PHE C CD2   1 
ATOM   8163  C  CE1   . PHE C 1 739  ? 100.564 118.024 102.024 1.00 74.03  ?  611  PHE C CE1   1 
ATOM   8164  C  CE2   . PHE C 1 739  ? 102.719 117.748 103.015 1.00 65.98  ?  611  PHE C CE2   1 
ATOM   8165  C  CZ    . PHE C 1 739  ? 101.935 117.925 101.894 1.00 71.84  ?  611  PHE C CZ    1 
ATOM   8166  N  N     . THR C 1 740  ? 100.609 115.531 108.080 1.00 39.64  ?  612  THR C N     1 
ATOM   8167  C  CA    . THR C 1 740  ? 100.707 115.122 109.482 1.00 35.28  ?  612  THR C CA    1 
ATOM   8168  C  C     . THR C 1 740  ? 102.134 115.359 109.963 1.00 32.87  ?  612  THR C C     1 
ATOM   8169  O  O     . THR C 1 740  ? 103.051 114.637 109.557 1.00 34.18  ?  612  THR C O     1 
ATOM   8170  C  CB    . THR C 1 740  ? 100.309 113.652 109.645 1.00 40.45  ?  612  THR C CB    1 
ATOM   8171  O  OG1   . THR C 1 740  ? 98.892  113.514 109.479 1.00 46.85  ?  612  THR C OG1   1 
ATOM   8172  C  CG2   . THR C 1 740  ? 100.705 113.126 111.018 1.00 34.89  ?  612  THR C CG2   1 
ATOM   8173  N  N     . VAL C 1 741  ? 102.319 116.356 110.833 1.00 27.72  ?  613  VAL C N     1 
ATOM   8174  C  CA    . VAL C 1 741  ? 103.631 116.742 111.353 1.00 20.14  ?  613  VAL C CA    1 
ATOM   8175  C  C     . VAL C 1 741  ? 103.729 116.345 112.820 1.00 17.67  ?  613  VAL C C     1 
ATOM   8176  O  O     . VAL C 1 741  ? 102.869 116.714 113.630 1.00 17.98  ?  613  VAL C O     1 
ATOM   8177  C  CB    . VAL C 1 741  ? 103.885 118.253 111.204 1.00 21.54  ?  613  VAL C CB    1 
ATOM   8178  C  CG1   . VAL C 1 741  ? 104.973 118.690 112.172 1.00 21.18  ?  613  VAL C CG1   1 
ATOM   8179  C  CG2   . VAL C 1 741  ? 104.287 118.602 109.787 1.00 25.39  ?  613  VAL C CG2   1 
ATOM   8180  N  N     . VAL C 1 742  ? 104.800 115.632 113.167 1.00 19.38  ?  614  VAL C N     1 
ATOM   8181  C  CA    . VAL C 1 742  ? 105.119 115.302 114.551 1.00 13.87  ?  614  VAL C CA    1 
ATOM   8182  C  C     . VAL C 1 742  ? 106.164 116.293 115.050 1.00 10.79  ?  614  VAL C C     1 
ATOM   8183  O  O     . VAL C 1 742  ? 107.176 116.537 114.376 1.00 12.32  ?  614  VAL C O     1 
ATOM   8184  C  CB    . VAL C 1 742  ? 105.617 113.852 114.676 1.00 15.97  ?  614  VAL C CB    1 
ATOM   8185  C  CG1   . VAL C 1 742  ? 105.640 113.414 116.134 1.00 15.64  ?  614  VAL C CG1   1 
ATOM   8186  C  CG2   . VAL C 1 742  ? 104.740 112.919 113.850 1.00 17.88  ?  614  VAL C CG2   1 
ATOM   8187  N  N     . VAL C 1 743  ? 105.920 116.876 116.224 1.00 8.68   ?  615  VAL C N     1 
ATOM   8188  C  CA    . VAL C 1 743  ? 106.793 117.890 116.805 1.00 7.65   ?  615  VAL C CA    1 
ATOM   8189  C  C     . VAL C 1 743  ? 107.309 117.368 118.137 1.00 7.99   ?  615  VAL C C     1 
ATOM   8190  O  O     . VAL C 1 743  ? 106.516 117.063 119.037 1.00 8.21   ?  615  VAL C O     1 
ATOM   8191  C  CB    . VAL C 1 743  ? 106.061 119.227 117.003 1.00 11.19  ?  615  VAL C CB    1 
ATOM   8192  C  CG1   . VAL C 1 743  ? 106.902 120.174 117.848 1.00 13.09  ?  615  VAL C CG1   1 
ATOM   8193  C  CG2   . VAL C 1 743  ? 105.712 119.851 115.662 1.00 13.70  ?  615  VAL C CG2   1 
ATOM   8194  N  N     . LYS C 1 744  ? 108.631 117.272 118.270 1.00 7.91   ?  616  LYS C N     1 
ATOM   8195  C  CA    . LYS C 1 744  ? 109.256 116.864 119.522 1.00 7.24   ?  616  LYS C CA    1 
ATOM   8196  C  C     . LYS C 1 744  ? 109.743 118.115 120.234 1.00 6.18   ?  616  LYS C C     1 
ATOM   8197  O  O     . LYS C 1 744  ? 110.655 118.794 119.753 1.00 7.89   ?  616  LYS C O     1 
ATOM   8198  C  CB    . LYS C 1 744  ? 110.418 115.906 119.281 1.00 8.62   ?  616  LYS C CB    1 
ATOM   8199  C  CG    . LYS C 1 744  ? 111.326 115.762 120.491 1.00 11.15  ?  616  LYS C CG    1 
ATOM   8200  C  CD    . LYS C 1 744  ? 112.638 115.090 120.132 1.00 13.90  ?  616  LYS C CD    1 
ATOM   8201  C  CE    . LYS C 1 744  ? 113.520 116.013 119.306 1.00 16.10  ?  616  LYS C CE    1 
ATOM   8202  N  NZ    . LYS C 1 744  ? 114.825 115.385 118.962 1.00 18.46  ?  616  LYS C NZ    1 
ATOM   8203  N  N     . GLU C 1 745  ? 109.143 118.423 121.372 1.00 6.65   ?  617  GLU C N     1 
ATOM   8204  C  CA    . GLU C 1 745  ? 109.631 119.547 122.148 1.00 8.81   ?  617  GLU C CA    1 
ATOM   8205  C  C     . GLU C 1 745  ? 110.617 119.065 123.208 1.00 7.64   ?  617  GLU C C     1 
ATOM   8206  O  O     . GLU C 1 745  ? 110.742 117.868 123.481 1.00 8.25   ?  617  GLU C O     1 
ATOM   8207  C  CB    . GLU C 1 745  ? 108.471 120.308 122.783 1.00 9.28   ?  617  GLU C CB    1 
ATOM   8208  C  CG    . GLU C 1 745  ? 107.425 119.426 123.417 1.00 16.21  ?  617  GLU C CG    1 
ATOM   8209  C  CD    . GLU C 1 745  ? 106.159 120.189 123.733 1.00 30.58  ?  617  GLU C CD    1 
ATOM   8210  O  OE1   . GLU C 1 745  ? 106.052 121.365 123.324 1.00 21.52  ?  617  GLU C OE1   1 
ATOM   8211  O  OE2   . GLU C 1 745  ? 105.273 119.616 124.398 1.00 125.24 -1 617  GLU C OE2   1 
ATOM   8212  N  N     . SER C 1 746  ? 111.330 120.022 123.802 1.00 8.78   ?  618  SER C N     1 
ATOM   8213  C  CA    . SER C 1 746  ? 112.355 119.723 124.799 1.00 9.57   ?  618  SER C CA    1 
ATOM   8214  C  C     . SER C 1 746  ? 112.694 120.990 125.567 1.00 9.67   ?  618  SER C C     1 
ATOM   8215  O  O     . SER C 1 746  ? 113.122 121.983 124.972 1.00 9.33   ?  618  SER C O     1 
ATOM   8216  C  CB    . SER C 1 746  ? 113.607 119.154 124.136 1.00 9.21   ?  618  SER C CB    1 
ATOM   8217  O  OG    . SER C 1 746  ? 114.550 118.756 125.114 1.00 13.32  ?  618  SER C OG    1 
ATOM   8218  N  N     . CYS C 1 747  ? 112.530 120.952 126.882 1.00 10.52  ?  619  CYS C N     1 
ATOM   8219  C  CA    . CYS C 1 747  ? 112.917 122.056 127.742 1.00 10.63  ?  619  CYS C CA    1 
ATOM   8220  C  C     . CYS C 1 747  ? 113.963 121.573 128.731 1.00 13.92  ?  619  CYS C C     1 
ATOM   8221  O  O     . CYS C 1 747  ? 113.957 120.411 129.149 1.00 14.79  ?  619  CYS C O     1 
ATOM   8222  C  CB    . CYS C 1 747  ? 111.717 122.629 128.498 1.00 13.78  ?  619  CYS C CB    1 
ATOM   8223  S  SG    . CYS C 1 747  ? 112.151 123.582 129.971 1.00 22.82  ?  619  CYS C SG    1 
ATOM   8224  N  N     . ASP C 1 748  ? 114.866 122.471 129.103 1.00 14.30  ?  620  ASP C N     1 
ATOM   8225  C  CA    . ASP C 1 748  ? 115.866 122.123 130.097 1.00 22.23  ?  620  ASP C CA    1 
ATOM   8226  C  C     . ASP C 1 748  ? 116.389 123.399 130.733 1.00 17.42  ?  620  ASP C C     1 
ATOM   8227  O  O     . ASP C 1 748  ? 116.172 124.512 130.238 1.00 13.29  ?  620  ASP C O     1 
ATOM   8228  C  CB    . ASP C 1 748  ? 117.009 121.305 129.483 1.00 35.62  ?  620  ASP C CB    1 
ATOM   8229  C  CG    . ASP C 1 748  ? 117.953 120.735 130.531 1.00 56.18  ?  620  ASP C CG    1 
ATOM   8230  O  OD1   . ASP C 1 748  ? 117.716 120.954 131.740 1.00 47.14  ?  620  ASP C OD1   1 
ATOM   8231  O  OD2   . ASP C 1 748  ? 118.941 120.078 130.146 1.00 129.12 -1 620  ASP C OD2   1 
ATOM   8232  N  N     . GLY C 1 749  ? 117.062 123.211 131.861 1.00 21.25  ?  621  GLY C N     1 
ATOM   8233  C  CA    . GLY C 1 749  ? 117.815 124.264 132.505 1.00 18.35  ?  621  GLY C CA    1 
ATOM   8234  C  C     . GLY C 1 749  ? 119.280 124.172 132.116 1.00 17.61  ?  621  GLY C C     1 
ATOM   8235  O  O     . GLY C 1 749  ? 119.850 123.084 132.021 1.00 24.30  ?  621  GLY C O     1 
ATOM   8236  N  N     . MET C 1 750  ? 119.867 125.333 131.876 1.00 14.43  ?  622  MET C N     1 
ATOM   8237  C  CA    . MET C 1 750  ? 121.280 125.486 131.596 1.00 18.67  ?  622  MET C CA    1 
ATOM   8238  C  C     . MET C 1 750  ? 121.890 126.320 132.709 1.00 19.04  ?  622  MET C C     1 
ATOM   8239  O  O     . MET C 1 750  ? 121.384 127.402 133.032 1.00 22.31  ?  622  MET C O     1 
ATOM   8240  C  CB    . MET C 1 750  ? 121.480 126.148 130.242 1.00 20.75  ?  622  MET C CB    1 
ATOM   8241  C  CG    . MET C 1 750  ? 122.828 126.770 130.034 1.00 23.96  ?  622  MET C CG    1 
ATOM   8242  S  SD    . MET C 1 750  ? 123.282 126.552 128.311 1.00 41.36  ?  622  MET C SD    1 
ATOM   8243  C  CE    . MET C 1 750  ? 121.685 126.755 127.517 1.00 18.24  ?  622  MET C CE    1 
ATOM   8244  N  N     . GLY C 1 751  ? 122.964 125.812 133.294 1.00 34.26  ?  623  GLY C N     1 
ATOM   8245  C  CA    . GLY C 1 751  ? 123.529 126.388 134.493 1.00 54.60  ?  623  GLY C CA    1 
ATOM   8246  C  C     . GLY C 1 751  ? 124.676 127.335 134.203 1.00 62.23  ?  623  GLY C C     1 
ATOM   8247  O  O     . GLY C 1 751  ? 125.413 127.167 133.233 1.00 58.41  ?  623  GLY C O     1 
ATOM   8248  N  N     . ASP C 1 752  ? 124.788 128.356 135.053 1.00 74.60  ?  624  ASP C N     1 
ATOM   8249  C  CA    . ASP C 1 752  ? 125.990 129.177 135.190 1.00 92.13  ?  624  ASP C CA    1 
ATOM   8250  C  C     . ASP C 1 752  ? 126.530 129.648 133.836 1.00 90.54  ?  624  ASP C C     1 
ATOM   8251  O  O     . ASP C 1 752  ? 127.573 129.193 133.369 1.00 94.78  ?  624  ASP C O     1 
ATOM   8252  C  CB    . ASP C 1 752  ? 127.075 128.416 135.958 1.00 111.43 ?  624  ASP C CB    1 
ATOM   8253  C  CG    . ASP C 1 752  ? 126.841 128.411 137.455 1.00 125.02 ?  624  ASP C CG    1 
ATOM   8254  O  OD1   . ASP C 1 752  ? 125.819 127.846 137.899 1.00 123.37 ?  624  ASP C OD1   1 
ATOM   8255  O  OD2   . ASP C 1 752  ? 127.678 128.977 138.189 1.00 169.08 -1 624  ASP C OD2   1 
ATOM   8256  N  N     . VAL C 1 753  ? 125.770 130.536 133.185 1.00 82.60  ?  625  VAL C N     1 
ATOM   8257  C  CA    . VAL C 1 753  ? 126.321 131.251 132.036 1.00 86.64  ?  625  VAL C CA    1 
ATOM   8258  C  C     . VAL C 1 753  ? 127.674 131.830 132.425 1.00 89.23  ?  625  VAL C C     1 
ATOM   8259  O  O     . VAL C 1 753  ? 127.806 132.506 133.451 1.00 89.37  ?  625  VAL C O     1 
ATOM   8260  C  CB    . VAL C 1 753  ? 125.347 132.341 131.546 1.00 82.85  ?  625  VAL C CB    1 
ATOM   8261  C  CG1   . VAL C 1 753  ? 124.184 131.721 130.787 1.00 66.04  ?  625  VAL C CG1   1 
ATOM   8262  C  CG2   . VAL C 1 753  ? 124.831 133.171 132.710 1.00 80.00  ?  625  VAL C CG2   1 
ATOM   8263  N  N     . SER C 1 754  ? 128.695 131.533 131.624 1.00 85.40  ?  626  SER C N     1 
ATOM   8264  C  CA    . SER C 1 754  ? 130.081 131.811 132.001 1.00 88.63  ?  626  SER C CA    1 
ATOM   8265  C  C     . SER C 1 754  ? 130.412 133.269 131.704 1.00 109.66 ?  626  SER C C     1 
ATOM   8266  O  O     . SER C 1 754  ? 130.711 133.630 130.564 1.00 114.09 ?  626  SER C O     1 
ATOM   8267  C  CB    . SER C 1 754  ? 131.030 130.873 131.264 1.00 81.62  ?  626  SER C CB    1 
ATOM   8268  O  OG    . SER C 1 754  ? 130.874 130.992 129.861 1.00 76.99  ?  626  SER C OG    1 
ATOM   8269  N  N     . GLU C 1 755  ? 130.365 134.110 132.735 1.00 124.76 ?  627  GLU C N     1 
ATOM   8270  C  CA    . GLU C 1 755  ? 130.818 135.492 132.627 1.00 142.41 ?  627  GLU C CA    1 
ATOM   8271  C  C     . GLU C 1 755  ? 131.158 136.005 134.019 1.00 151.91 ?  627  GLU C C     1 
ATOM   8272  O  O     . GLU C 1 755  ? 130.890 135.350 135.029 1.00 152.29 ?  627  GLU C O     1 
ATOM   8273  C  CB    . GLU C 1 755  ? 129.769 136.388 131.959 1.00 143.18 ?  627  GLU C CB    1 
ATOM   8274  C  CG    . GLU C 1 755  ? 130.245 137.032 130.663 1.00 163.59 ?  627  GLU C CG    1 
ATOM   8275  C  CD    . GLU C 1 755  ? 131.399 137.999 130.872 1.00 173.08 ?  627  GLU C CD    1 
ATOM   8276  O  OE1   . GLU C 1 755  ? 131.478 138.616 131.956 1.00 154.01 ?  627  GLU C OE1   1 
ATOM   8277  O  OE2   . GLU C 1 755  ? 132.231 138.141 129.951 1.00 212.69 -1 627  GLU C OE2   1 
ATOM   8278  N  N     . LYS C 1 756  ? 131.758 137.192 134.058 1.00 147.47 ?  628  LYS C N     1 
ATOM   8279  C  CA    . LYS C 1 756  ? 132.097 137.838 135.321 1.00 140.21 ?  628  LYS C CA    1 
ATOM   8280  C  C     . LYS C 1 756  ? 130.924 138.667 135.835 1.00 134.51 ?  628  LYS C C     1 
ATOM   8281  O  O     . LYS C 1 756  ? 131.105 139.591 136.628 1.00 127.91 ?  628  LYS C O     1 
ATOM   8282  C  CB    . LYS C 1 756  ? 133.333 138.726 135.165 1.00 128.85 ?  628  LYS C CB    1 
ATOM   8283  C  CG    . LYS C 1 756  ? 134.632 138.108 135.663 1.00 131.31 ?  628  LYS C CG    1 
ATOM   8284  C  CD    . LYS C 1 756  ? 135.008 136.874 134.861 1.00 135.62 ?  628  LYS C CD    1 
ATOM   8285  C  CE    . LYS C 1 756  ? 136.340 136.299 135.319 1.00 127.35 ?  628  LYS C CE    1 
ATOM   8286  N  NZ    . LYS C 1 756  ? 136.309 135.892 136.750 1.00 116.37 ?  628  LYS C NZ    1 
ATOM   8287  N  N     . PRO C 1 764  ? 121.732 136.796 136.582 1.00 59.67  ?  636  PRO C N     1 
ATOM   8288  C  CA    . PRO C 1 764  ? 122.287 136.216 135.354 1.00 58.51  ?  636  PRO C CA    1 
ATOM   8289  C  C     . PRO C 1 764  ? 123.239 135.054 135.621 1.00 60.22  ?  636  PRO C C     1 
ATOM   8290  O  O     . PRO C 1 764  ? 124.412 135.126 135.255 1.00 61.11  ?  636  PRO C O     1 
ATOM   8291  C  CB    . PRO C 1 764  ? 123.030 137.395 134.722 1.00 57.92  ?  636  PRO C CB    1 
ATOM   8292  C  CG    . PRO C 1 764  ? 123.432 138.233 135.881 1.00 61.64  ?  636  PRO C CG    1 
ATOM   8293  C  CD    . PRO C 1 764  ? 122.285 138.135 136.853 1.00 67.63  ?  636  PRO C CD    1 
ATOM   8294  N  N     . GLU C 1 765  ? 122.741 134.007 136.277 1.00 56.09  ?  637  GLU C N     1 
ATOM   8295  C  CA    . GLU C 1 765  ? 123.515 132.789 136.489 1.00 54.21  ?  637  GLU C CA    1 
ATOM   8296  C  C     . GLU C 1 765  ? 122.874 131.592 135.802 1.00 46.81  ?  637  GLU C C     1 
ATOM   8297  O  O     . GLU C 1 765  ? 123.513 130.953 134.961 1.00 57.33  ?  637  GLU C O     1 
ATOM   8298  C  CB    . GLU C 1 765  ? 123.681 132.531 137.994 1.00 70.27  ?  637  GLU C CB    1 
ATOM   8299  C  CG    . GLU C 1 765  ? 125.007 131.886 138.373 1.00 88.60  ?  637  GLU C CG    1 
ATOM   8300  C  CD    . GLU C 1 765  ? 125.394 132.140 139.820 1.00 108.45 ?  637  GLU C CD    1 
ATOM   8301  O  OE1   . GLU C 1 765  ? 126.358 132.901 140.052 1.00 98.12  ?  637  GLU C OE1   1 
ATOM   8302  O  OE2   . GLU C 1 765  ? 124.741 131.580 140.726 1.00 138.43 -1 637  GLU C OE2   1 
ATOM   8303  N  N     . LYS C 1 766  ? 121.618 131.290 136.109 1.00 34.55  ?  638  LYS C N     1 
ATOM   8304  C  CA    . LYS C 1 766  ? 120.931 130.158 135.513 1.00 29.89  ?  638  LYS C CA    1 
ATOM   8305  C  C     . LYS C 1 766  ? 120.217 130.598 134.236 1.00 27.96  ?  638  LYS C C     1 
ATOM   8306  O  O     . LYS C 1 766  ? 120.242 131.771 133.853 1.00 21.71  ?  638  LYS C O     1 
ATOM   8307  C  CB    . LYS C 1 766  ? 119.955 129.553 136.518 1.00 31.09  ?  638  LYS C CB    1 
ATOM   8308  C  CG    . LYS C 1 766  ? 120.520 129.430 137.922 1.00 34.64  ?  638  LYS C CG    1 
ATOM   8309  C  CD    . LYS C 1 766  ? 121.735 128.519 137.953 1.00 42.33  ?  638  LYS C CD    1 
ATOM   8310  C  CE    . LYS C 1 766  ? 121.332 127.062 137.818 1.00 39.53  ?  638  LYS C CE    1 
ATOM   8311  N  NZ    . LYS C 1 766  ? 120.552 126.600 138.998 1.00 45.46  ?  638  LYS C NZ    1 
ATOM   8312  N  N     . ALA C 1 767  ? 119.570 129.644 133.569 1.00 21.37  ?  639  ALA C N     1 
ATOM   8313  C  CA    . ALA C 1 767  ? 118.784 129.927 132.374 1.00 10.81  ?  639  ALA C CA    1 
ATOM   8314  C  C     . ALA C 1 767  ? 117.953 128.696 132.048 1.00 8.53   ?  639  ALA C C     1 
ATOM   8315  O  O     . ALA C 1 767  ? 118.295 127.582 132.443 1.00 10.97  ?  639  ALA C O     1 
ATOM   8316  C  CB    . ALA C 1 767  ? 119.674 130.303 131.183 1.00 11.58  ?  639  ALA C CB    1 
ATOM   8317  N  N     . VAL C 1 768  ? 116.856 128.906 131.328 1.00 3.41   ?  640  VAL C N     1 
ATOM   8318  C  CA    . VAL C 1 768  ? 116.024 127.818 130.828 1.00 5.43   ?  640  VAL C CA    1 
ATOM   8319  C  C     . VAL C 1 768  ? 115.828 128.033 129.336 1.00 7.80   ?  640  VAL C C     1 
ATOM   8320  O  O     . VAL C 1 768  ? 115.682 129.175 128.886 1.00 10.30  ?  640  VAL C O     1 
ATOM   8321  C  CB    . VAL C 1 768  ? 114.664 127.751 131.552 1.00 4.87   ?  640  VAL C CB    1 
ATOM   8322  C  CG1   . VAL C 1 768  ? 113.801 126.649 130.966 1.00 4.66   ?  640  VAL C CG1   1 
ATOM   8323  C  CG2   . VAL C 1 768  ? 114.856 127.541 133.038 1.00 8.62   ?  640  VAL C CG2   1 
ATOM   8324  N  N     . ARG C 1 769  ? 115.829 126.945 128.563 1.00 7.46   ?  641  ARG C N     1 
ATOM   8325  C  CA    . ARG C 1 769  ? 115.757 127.069 127.107 1.00 4.82   ?  641  ARG C CA    1 
ATOM   8326  C  C     . ARG C 1 769  ? 114.766 126.058 126.545 1.00 6.18   ?  641  ARG C C     1 
ATOM   8327  O  O     . ARG C 1 769  ? 115.016 124.849 126.582 1.00 9.45   ?  641  ARG C O     1 
ATOM   8328  C  CB    . ARG C 1 769  ? 117.138 126.893 126.481 1.00 5.10   ?  641  ARG C CB    1 
ATOM   8329  C  CG    . ARG C 1 769  ? 117.130 126.919 124.974 1.00 6.45   ?  641  ARG C CG    1 
ATOM   8330  C  CD    . ARG C 1 769  ? 118.512 127.218 124.448 1.00 6.40   ?  641  ARG C CD    1 
ATOM   8331  N  NE    . ARG C 1 769  ? 119.502 126.373 125.100 1.00 9.14   ?  641  ARG C NE    1 
ATOM   8332  C  CZ    . ARG C 1 769  ? 119.729 125.109 124.766 1.00 11.23  ?  641  ARG C CZ    1 
ATOM   8333  N  NH1   . ARG C 1 769  ? 120.645 124.405 125.411 1.00 18.59  ?  641  ARG C NH1   1 
ATOM   8334  N  NH2   . ARG C 1 769  ? 119.031 124.549 123.787 1.00 10.08  ?  641  ARG C NH2   1 
ATOM   8335  N  N     . PHE C 1 770  ? 113.653 126.559 126.008 1.00 4.22   ?  642  PHE C N     1 
ATOM   8336  C  CA    . PHE C 1 770  ? 112.606 125.731 125.420 1.00 4.82   ?  642  PHE C CA    1 
ATOM   8337  C  C     . PHE C 1 770  ? 112.840 125.624 123.915 1.00 5.47   ?  642  PHE C C     1 
ATOM   8338  O  O     . PHE C 1 770  ? 112.871 126.646 123.221 1.00 6.82   ?  642  PHE C O     1 
ATOM   8339  C  CB    . PHE C 1 770  ? 111.235 126.344 125.711 1.00 4.32   ?  642  PHE C CB    1 
ATOM   8340  C  CG    . PHE C 1 770  ? 110.094 125.398 125.517 1.00 4.44   ?  642  PHE C CG    1 
ATOM   8341  C  CD1   . PHE C 1 770  ? 109.679 124.580 126.549 1.00 5.48   ?  642  PHE C CD1   1 
ATOM   8342  C  CD2   . PHE C 1 770  ? 109.431 125.327 124.305 1.00 4.78   ?  642  PHE C CD2   1 
ATOM   8343  C  CE1   . PHE C 1 770  ? 108.632 123.703 126.378 1.00 5.65   ?  642  PHE C CE1   1 
ATOM   8344  C  CE2   . PHE C 1 770  ? 108.381 124.452 124.128 1.00 6.18   ?  642  PHE C CE2   1 
ATOM   8345  C  CZ    . PHE C 1 770  ? 107.981 123.639 125.166 1.00 6.43   ?  642  PHE C CZ    1 
ATOM   8346  N  N     . SER C 1 771  ? 112.999 124.398 123.405 1.00 5.94   ?  643  SER C N     1 
ATOM   8347  C  CA    . SER C 1 771  ? 113.327 124.183 122.001 1.00 6.05   ?  643  SER C CA    1 
ATOM   8348  C  C     . SER C 1 771  ? 112.502 123.040 121.429 1.00 6.05   ?  643  SER C C     1 
ATOM   8349  O  O     . SER C 1 771  ? 112.375 121.987 122.055 1.00 7.02   ?  643  SER C O     1 
ATOM   8350  C  CB    . SER C 1 771  ? 114.811 123.851 121.818 1.00 8.23   ?  643  SER C CB    1 
ATOM   8351  O  OG    . SER C 1 771  ? 115.149 122.657 122.509 1.00 8.65   ?  643  SER C OG    1 
ATOM   8352  N  N     . PHE C 1 772  ? 111.986 123.228 120.217 1.00 5.76   ?  644  PHE C N     1 
ATOM   8353  C  CA    . PHE C 1 772  ? 111.235 122.180 119.540 1.00 5.82   ?  644  PHE C CA    1 
ATOM   8354  C  C     . PHE C 1 772  ? 111.934 121.795 118.242 1.00 5.09   ?  644  PHE C C     1 
ATOM   8355  O  O     . PHE C 1 772  ? 112.767 122.536 117.716 1.00 5.81   ?  644  PHE C O     1 
ATOM   8356  C  CB    . PHE C 1 772  ? 109.776 122.607 119.274 1.00 5.33   ?  644  PHE C CB    1 
ATOM   8357  C  CG    . PHE C 1 772  ? 109.587 123.455 118.044 1.00 2.20   ?  644  PHE C CG    1 
ATOM   8358  C  CD1   . PHE C 1 772  ? 109.382 122.872 116.804 1.00 3.33   ?  644  PHE C CD1   1 
ATOM   8359  C  CD2   . PHE C 1 772  ? 109.562 124.832 118.136 1.00 1.91   ?  644  PHE C CD2   1 
ATOM   8360  C  CE1   . PHE C 1 772  ? 109.196 123.648 115.683 1.00 4.37   ?  644  PHE C CE1   1 
ATOM   8361  C  CE2   . PHE C 1 772  ? 109.371 125.609 117.014 1.00 1.52   ?  644  PHE C CE2   1 
ATOM   8362  C  CZ    . PHE C 1 772  ? 109.187 125.015 115.788 1.00 2.59   ?  644  PHE C CZ    1 
ATOM   8363  N  N     . THR C 1 773  ? 111.582 120.616 117.729 1.00 8.14   ?  645  THR C N     1 
ATOM   8364  C  CA    . THR C 1 773  ? 112.189 120.079 116.518 1.00 9.97   ?  645  THR C CA    1 
ATOM   8365  C  C     . THR C 1 773  ? 111.143 119.313 115.720 1.00 9.07   ?  645  THR C C     1 
ATOM   8366  O  O     . THR C 1 773  ? 110.396 118.503 116.280 1.00 9.61   ?  645  THR C O     1 
ATOM   8367  C  CB    . THR C 1 773  ? 113.377 119.164 116.856 1.00 11.60  ?  645  THR C CB    1 
ATOM   8368  O  OG1   . THR C 1 773  ? 114.359 119.906 117.591 1.00 8.66   ?  645  THR C OG1   1 
ATOM   8369  C  CG2   . THR C 1 773  ? 114.010 118.606 115.591 1.00 12.01  ?  645  THR C CG2   1 
ATOM   8370  N  N     . ILE C 1 774  ? 111.085 119.585 114.417 1.00 8.25   ?  646  ILE C N     1 
ATOM   8371  C  CA    . ILE C 1 774  ? 110.223 118.820 113.524 1.00 7.87   ?  646  ILE C CA    1 
ATOM   8372  C  C     . ILE C 1 774  ? 110.798 117.417 113.400 1.00 11.57  ?  646  ILE C C     1 
ATOM   8373  O  O     . ILE C 1 774  ? 111.924 117.235 112.923 1.00 15.04  ?  646  ILE C O     1 
ATOM   8374  C  CB    . ILE C 1 774  ? 110.118 119.493 112.151 1.00 6.60   ?  646  ILE C CB    1 
ATOM   8375  C  CG1   . ILE C 1 774  ? 109.862 120.990 112.306 1.00 3.40   ?  646  ILE C CG1   1 
ATOM   8376  C  CG2   . ILE C 1 774  ? 108.997 118.871 111.343 1.00 8.80   ?  646  ILE C CG2   1 
ATOM   8377  C  CD1   . ILE C 1 774  ? 108.564 121.299 112.984 1.00 5.45   ?  646  ILE C CD1   1 
ATOM   8378  N  N     . MET C 1 775  ? 110.038 116.416 113.842 1.00 11.19  ?  647  MET C N     1 
ATOM   8379  C  CA    . MET C 1 775  ? 110.561 115.057 113.849 1.00 13.73  ?  647  MET C CA    1 
ATOM   8380  C  C     . MET C 1 775  ? 110.275 114.328 112.540 1.00 18.41  ?  647  MET C C     1 
ATOM   8381  O  O     . MET C 1 775  ? 111.201 113.863 111.867 1.00 23.65  ?  647  MET C O     1 
ATOM   8382  C  CB    . MET C 1 775  ? 109.988 114.282 115.038 1.00 19.81  ?  647  MET C CB    1 
ATOM   8383  C  CG    . MET C 1 775  ? 111.032 113.931 116.070 1.00 21.51  ?  647  MET C CG    1 
ATOM   8384  S  SD    . MET C 1 775  ? 112.270 112.815 115.386 1.00 36.39  ?  647  MET C SD    1 
ATOM   8385  C  CE    . MET C 1 775  ? 111.235 111.469 114.815 1.00 29.81  ?  647  MET C CE    1 
ATOM   8386  N  N     . SER C 1 776  ? 109.001 114.220 112.167 1.00 21.92  ?  648  SER C N     1 
ATOM   8387  C  CA    . SER C 1 776  ? 108.634 113.492 110.960 1.00 25.28  ?  648  SER C CA    1 
ATOM   8388  C  C     . SER C 1 776  ? 107.336 114.047 110.387 1.00 24.92  ?  648  SER C C     1 
ATOM   8389  O  O     . SER C 1 776  ? 106.385 114.314 111.129 1.00 24.97  ?  648  SER C O     1 
ATOM   8390  C  CB    . SER C 1 776  ? 108.504 111.988 111.246 1.00 27.57  ?  648  SER C CB    1 
ATOM   8391  O  OG    . SER C 1 776  ? 107.469 111.723 112.178 1.00 26.20  ?  648  SER C OG    1 
ATOM   8392  N  N     . ILE C 1 777  ? 107.313 114.223 109.064 1.00 26.59  ?  649  ILE C N     1 
ATOM   8393  C  CA    . ILE C 1 777  ? 106.132 114.660 108.321 1.00 30.73  ?  649  ILE C CA    1 
ATOM   8394  C  C     . ILE C 1 777  ? 105.721 113.565 107.345 1.00 36.58  ?  649  ILE C C     1 
ATOM   8395  O  O     . ILE C 1 777  ? 106.538 113.095 106.542 1.00 37.57  ?  649  ILE C O     1 
ATOM   8396  C  CB    . ILE C 1 777  ? 106.369 115.997 107.586 1.00 28.39  ?  649  ILE C CB    1 
ATOM   8397  C  CG1   . ILE C 1 777  ? 105.278 116.271 106.537 1.00 38.13  ?  649  ILE C CG1   1 
ATOM   8398  C  CG2   . ILE C 1 777  ? 107.720 116.031 106.936 1.00 24.43  ?  649  ILE C CG2   1 
ATOM   8399  C  CD1   . ILE C 1 777  ? 103.883 116.459 107.072 1.00 44.93  ?  649  ILE C CD1   1 
ATOM   8400  N  N     . SER C 1 778  ? 104.448 113.177 107.412 1.00 39.31  ?  650  SER C N     1 
ATOM   8401  C  CA    . SER C 1 778  ? 103.873 112.110 106.608 1.00 45.20  ?  650  SER C CA    1 
ATOM   8402  C  C     . SER C 1 778  ? 102.590 112.602 105.946 1.00 51.07  ?  650  SER C C     1 
ATOM   8403  O  O     . SER C 1 778  ? 102.076 113.679 106.259 1.00 48.89  ?  650  SER C O     1 
ATOM   8404  C  CB    . SER C 1 778  ? 103.601 110.863 107.464 1.00 52.42  ?  650  SER C CB    1 
ATOM   8405  O  OG    . SER C 1 778  ? 102.829 111.183 108.609 1.00 49.90  ?  650  SER C OG    1 
ATOM   8406  N  N     . ILE C 1 779  ? 102.065 111.796 105.024 1.00 57.11  ?  651  ILE C N     1 
ATOM   8407  C  CA    . ILE C 1 779  ? 100.898 112.177 104.240 1.00 62.20  ?  651  ILE C CA    1 
ATOM   8408  C  C     . ILE C 1 779  ? 99.705  111.319 104.646 1.00 79.29  ?  651  ILE C C     1 
ATOM   8409  O  O     . ILE C 1 779  ? 99.844  110.208 105.169 1.00 86.07  ?  651  ILE C O     1 
ATOM   8410  C  CB    . ILE C 1 779  ? 101.155 112.074 102.721 1.00 64.93  ?  651  ILE C CB    1 
ATOM   8411  C  CG1   . ILE C 1 779  ? 100.472 113.232 101.997 1.00 69.37  ?  651  ILE C CG1   1 
ATOM   8412  C  CG2   . ILE C 1 779  ? 100.638 110.758 102.167 1.00 66.69  ?  651  ILE C CG2   1 
ATOM   8413  C  CD1   . ILE C 1 779  ? 101.033 114.578 102.368 1.00 64.34  ?  651  ILE C CD1   1 
ATOM   8414  N  N     . ARG C 1 780  ? 98.511  111.853 104.386 1.00 92.74  ?  652  ARG C N     1 
ATOM   8415  C  CA    . ARG C 1 780  ? 97.258  111.233 104.791 1.00 117.03 ?  652  ARG C CA    1 
ATOM   8416  C  C     . ARG C 1 780  ? 96.304  110.948 103.637 1.00 131.16 ?  652  ARG C C     1 
ATOM   8417  O  O     . ARG C 1 780  ? 95.550  109.977 103.710 1.00 146.00 ?  652  ARG C O     1 
ATOM   8418  C  CB    . ARG C 1 780  ? 96.547  112.119 105.832 1.00 115.42 ?  652  ARG C CB    1 
ATOM   8419  C  CG    . ARG C 1 780  ? 95.200  111.614 106.331 1.00 122.86 ?  652  ARG C CG    1 
ATOM   8420  C  CD    . ARG C 1 780  ? 95.345  110.379 107.200 1.00 135.36 ?  652  ARG C CD    1 
ATOM   8421  N  NE    . ARG C 1 780  ? 94.074  109.985 107.798 1.00 136.71 ?  652  ARG C NE    1 
ATOM   8422  C  CZ    . ARG C 1 780  ? 93.146  109.269 107.171 1.00 139.70 ?  652  ARG C CZ    1 
ATOM   8423  N  NH1   . ARG C 1 780  ? 93.348  108.871 105.923 1.00 149.70 ?  652  ARG C NH1   1 
ATOM   8424  N  NH2   . ARG C 1 780  ? 92.017  108.954 107.790 1.00 135.69 ?  652  ARG C NH2   1 
ATOM   8425  N  N     . LEU C 1 781  ? 96.317  111.751 102.576 1.00 128.08 ?  653  LEU C N     1 
ATOM   8426  C  CA    . LEU C 1 781  ? 95.392  111.528 101.471 1.00 145.79 ?  653  LEU C CA    1 
ATOM   8427  C  C     . LEU C 1 781  ? 95.790  110.285 100.680 1.00 153.10 ?  653  LEU C C     1 
ATOM   8428  O  O     . LEU C 1 781  ? 96.944  110.148 100.260 1.00 143.04 ?  653  LEU C O     1 
ATOM   8429  C  CB    . LEU C 1 781  ? 95.348  112.750 100.555 1.00 136.26 ?  653  LEU C CB    1 
ATOM   8430  C  CG    . LEU C 1 781  ? 94.619  113.983 101.097 1.00 117.19 ?  653  LEU C CG    1 
ATOM   8431  C  CD1   . LEU C 1 781  ? 94.976  115.220 100.289 1.00 99.84  ?  653  LEU C CD1   1 
ATOM   8432  C  CD2   . LEU C 1 781  ? 93.113  113.763 101.102 1.00 119.71 ?  653  LEU C CD2   1 
ATOM   8433  N  N     . GLU C 1 782  ? 94.833  109.382 100.469 1.00 164.16 ?  654  GLU C N     1 
ATOM   8434  C  CA    . GLU C 1 782  ? 93.470  109.541 100.975 1.00 168.03 ?  654  GLU C CA    1 
ATOM   8435  C  C     . GLU C 1 782  ? 92.926  108.227 101.536 1.00 168.38 ?  654  GLU C C     1 
ATOM   8436  O  O     . GLU C 1 782  ? 91.787  108.163 102.001 1.00 166.38 ?  654  GLU C O     1 
ATOM   8437  C  CB    . GLU C 1 782  ? 92.543  110.059 99.871  1.00 173.62 ?  654  GLU C CB    1 
ATOM   8438  C  CG    . GLU C 1 782  ? 92.020  108.980 98.935  1.00 190.31 ?  654  GLU C CG    1 
ATOM   8439  C  CD    . GLU C 1 782  ? 93.126  108.288 98.166  1.00 206.05 ?  654  GLU C CD    1 
ATOM   8440  O  OE1   . GLU C 1 782  ? 93.909  108.987 97.488  1.00 201.54 ?  654  GLU C OE1   1 
ATOM   8441  O  OE2   . GLU C 1 782  ? 93.218  107.045 98.246  1.00 247.26 -1 654  GLU C OE2   1 
ATOM   8442  N  N     . GLY C 1 783  ? 93.747  107.180 101.489 1.00 169.49 ?  655  GLY C N     1 
ATOM   8443  C  CA    . GLY C 1 783  ? 93.334  105.877 101.972 1.00 172.44 ?  655  GLY C CA    1 
ATOM   8444  C  C     . GLY C 1 783  ? 93.478  105.724 103.472 1.00 176.89 ?  655  GLY C C     1 
ATOM   8445  O  O     . GLY C 1 783  ? 93.205  106.664 104.225 1.00 170.96 ?  655  GLY C O     1 
ATOM   8446  N  N     . GLU C 1 784  ? 93.902  104.540 103.919 1.00 183.09 ?  656  GLU C N     1 
ATOM   8447  C  CA    . GLU C 1 784  ? 94.119  104.320 105.345 1.00 185.19 ?  656  GLU C CA    1 
ATOM   8448  C  C     . GLU C 1 784  ? 95.421  104.962 105.813 1.00 178.91 ?  656  GLU C C     1 
ATOM   8449  O  O     . GLU C 1 784  ? 95.457  105.585 106.880 1.00 170.08 ?  656  GLU C O     1 
ATOM   8450  C  CB    . GLU C 1 784  ? 94.113  102.821 105.659 1.00 191.95 ?  656  GLU C CB    1 
ATOM   8451  C  CG    . GLU C 1 784  ? 95.021  101.971 104.775 1.00 194.44 ?  656  GLU C CG    1 
ATOM   8452  C  CD    . GLU C 1 784  ? 94.363  101.561 103.471 1.00 202.50 ?  656  GLU C CD    1 
ATOM   8453  O  OE1   . GLU C 1 784  ? 93.128  101.709 103.354 1.00 199.87 ?  656  GLU C OE1   1 
ATOM   8454  O  OE2   . GLU C 1 784  ? 95.081  101.094 102.563 1.00 225.29 -1 656  GLU C OE2   1 
ATOM   8455  N  N     . ASP C 1 785  ? 96.482  104.815 105.020 1.00 180.08 ?  657  ASP C N     1 
ATOM   8456  C  CA    . ASP C 1 785  ? 97.787  105.451 105.223 1.00 167.38 ?  657  ASP C CA    1 
ATOM   8457  C  C     . ASP C 1 785  ? 98.209  105.453 106.695 1.00 164.42 ?  657  ASP C C     1 
ATOM   8458  O  O     . ASP C 1 785  ? 98.396  106.494 107.326 1.00 158.69 ?  657  ASP C O     1 
ATOM   8459  C  CB    . ASP C 1 785  ? 97.812  106.865 104.634 1.00 158.83 ?  657  ASP C CB    1 
ATOM   8460  C  CG    . ASP C 1 785  ? 96.923  107.836 105.383 1.00 161.71 ?  657  ASP C CG    1 
ATOM   8461  O  OD1   . ASP C 1 785  ? 95.687  107.777 105.223 1.00 163.02 ?  657  ASP C OD1   1 
ATOM   8462  O  OD2   . ASP C 1 785  ? 97.473  108.651 106.152 1.00 186.90 -1 657  ASP C OD2   1 
ATOM   8463  N  N     . ASP C 1 786  ? 98.360  104.241 107.238 1.00 168.36 ?  658  ASP C N     1 
ATOM   8464  C  CA    . ASP C 1 786  ? 98.935  104.101 108.572 1.00 164.56 ?  658  ASP C CA    1 
ATOM   8465  C  C     . ASP C 1 786  ? 100.266 104.834 108.678 1.00 148.42 ?  658  ASP C C     1 
ATOM   8466  O  O     . ASP C 1 786  ? 100.623 105.329 109.753 1.00 140.71 ?  658  ASP C O     1 
ATOM   8467  C  CB    . ASP C 1 786  ? 99.104  102.621 108.919 1.00 174.97 ?  658  ASP C CB    1 
ATOM   8468  C  CG    . ASP C 1 786  ? 99.814  101.843 107.828 1.00 183.64 ?  658  ASP C CG    1 
ATOM   8469  O  OD1   . ASP C 1 786  ? 100.090 102.427 106.759 1.00 170.26 ?  658  ASP C OD1   1 
ATOM   8470  O  OD2   . ASP C 1 786  ? 100.091 100.643 108.038 1.00 222.37 -1 658  ASP C OD2   1 
ATOM   8471  N  N     . GLY C 1 787  ? 101.005 104.920 107.574 1.00 142.64 ?  659  GLY C N     1 
ATOM   8472  C  CA    . GLY C 1 787  ? 102.156 105.794 107.489 1.00 123.32 ?  659  GLY C CA    1 
ATOM   8473  C  C     . GLY C 1 787  ? 102.682 105.939 106.075 1.00 100.82 ?  659  GLY C C     1 
ATOM   8474  O  O     . GLY C 1 787  ? 102.923 104.942 105.389 1.00 97.96  ?  659  GLY C O     1 
ATOM   8475  N  N     . ILE C 1 788  ? 102.857 107.181 105.626 1.00 79.15  ?  660  ILE C N     1 
ATOM   8476  C  CA    . ILE C 1 788  ? 103.521 107.483 104.358 1.00 67.26  ?  660  ILE C CA    1 
ATOM   8477  C  C     . ILE C 1 788  ? 104.597 108.513 104.691 1.00 58.32  ?  660  ILE C C     1 
ATOM   8478  O  O     . ILE C 1 788  ? 104.350 109.722 104.661 1.00 55.83  ?  660  ILE C O     1 
ATOM   8479  C  CB    . ILE C 1 788  ? 102.559 108.014 103.290 1.00 66.15  ?  660  ILE C CB    1 
ATOM   8480  C  CG1   . ILE C 1 788  ? 101.404 107.039 103.062 1.00 76.71  ?  660  ILE C CG1   1 
ATOM   8481  C  CG2   . ILE C 1 788  ? 103.299 108.258 101.984 1.00 64.64  ?  660  ILE C CG2   1 
ATOM   8482  C  CD1   . ILE C 1 788  ? 101.828 105.725 102.450 1.00 83.44  ?  660  ILE C CD1   1 
ATOM   8483  N  N     . THR C 1 789  ? 105.801 108.041 105.001 1.00 55.59  ?  661  THR C N     1 
ATOM   8484  C  CA    . THR C 1 789  ? 106.860 108.925 105.476 1.00 47.28  ?  661  THR C CA    1 
ATOM   8485  C  C     . THR C 1 789  ? 107.321 109.836 104.343 1.00 42.36  ?  661  THR C C     1 
ATOM   8486  O  O     . THR C 1 789  ? 107.989 109.392 103.404 1.00 45.86  ?  661  THR C O     1 
ATOM   8487  C  CB    . THR C 1 789  ? 108.018 108.107 106.049 1.00 50.06  ?  661  THR C CB    1 
ATOM   8488  O  OG1   . THR C 1 789  ? 109.174 108.942 106.206 1.00 43.70  ?  661  THR C OG1   1 
ATOM   8489  C  CG2   . THR C 1 789  ? 108.352 106.904 105.162 1.00 54.70  ?  661  THR C CG2   1 
ATOM   8490  N  N     . ILE C 1 790  ? 106.950 111.114 104.415 1.00 40.12  ?  662  ILE C N     1 
ATOM   8491  C  CA    . ILE C 1 790  ? 107.430 112.066 103.420 1.00 38.72  ?  662  ILE C CA    1 
ATOM   8492  C  C     . ILE C 1 790  ? 108.831 112.540 103.778 1.00 33.82  ?  662  ILE C C     1 
ATOM   8493  O  O     . ILE C 1 790  ? 109.732 112.562 102.931 1.00 36.21  ?  662  ILE C O     1 
ATOM   8494  C  CB    . ILE C 1 790  ? 106.443 113.242 103.271 1.00 43.63  ?  662  ILE C CB    1 
ATOM   8495  C  CG1   . ILE C 1 790  ? 105.502 112.999 102.089 1.00 51.76  ?  662  ILE C CG1   1 
ATOM   8496  C  CG2   . ILE C 1 790  ? 107.182 114.558 103.062 1.00 44.29  ?  662  ILE C CG2   1 
ATOM   8497  C  CD1   . ILE C 1 790  ? 104.760 111.683 102.143 1.00 59.14  ?  662  ILE C CD1   1 
ATOM   8498  N  N     . PHE C 1 791  ? 109.045 112.900 105.040 1.00 31.23  ?  663  PHE C N     1 
ATOM   8499  C  CA    . PHE C 1 791  ? 110.365 113.323 105.491 1.00 27.19  ?  663  PHE C CA    1 
ATOM   8500  C  C     . PHE C 1 791  ? 110.550 112.872 106.928 1.00 26.62  ?  663  PHE C C     1 
ATOM   8501  O  O     . PHE C 1 791  ? 109.811 113.309 107.818 1.00 27.54  ?  663  PHE C O     1 
ATOM   8502  C  CB    . PHE C 1 791  ? 110.535 114.838 105.381 1.00 29.97  ?  663  PHE C CB    1 
ATOM   8503  C  CG    . PHE C 1 791  ? 111.496 115.411 106.383 1.00 28.72  ?  663  PHE C CG    1 
ATOM   8504  C  CD1   . PHE C 1 791  ? 112.853 115.176 106.276 1.00 35.00  ?  663  PHE C CD1   1 
ATOM   8505  C  CD2   . PHE C 1 791  ? 111.036 116.156 107.454 1.00 26.00  ?  663  PHE C CD2   1 
ATOM   8506  C  CE1   . PHE C 1 791  ? 113.733 115.696 107.203 1.00 35.24  ?  663  PHE C CE1   1 
ATOM   8507  C  CE2   . PHE C 1 791  ? 111.910 116.666 108.386 1.00 25.14  ?  663  PHE C CE2   1 
ATOM   8508  C  CZ    . PHE C 1 791  ? 113.259 116.444 108.259 1.00 27.89  ?  663  PHE C CZ    1 
ATOM   8509  N  N     . GLN C 1 792  ? 111.524 111.998 107.148 1.00 24.37  ?  664  GLN C N     1 
ATOM   8510  C  CA    . GLN C 1 792  ? 111.946 111.610 108.487 1.00 27.59  ?  664  GLN C CA    1 
ATOM   8511  C  C     . GLN C 1 792  ? 113.328 112.200 108.720 1.00 27.23  ?  664  GLN C C     1 
ATOM   8512  O  O     . GLN C 1 792  ? 114.301 111.787 108.078 1.00 29.20  ?  664  GLN C O     1 
ATOM   8513  C  CB    . GLN C 1 792  ? 111.960 110.094 108.657 1.00 30.13  ?  664  GLN C CB    1 
ATOM   8514  C  CG    . GLN C 1 792  ? 112.369 109.661 110.057 1.00 36.64  ?  664  GLN C CG    1 
ATOM   8515  C  CD    . GLN C 1 792  ? 112.246 108.168 110.276 1.00 40.22  ?  664  GLN C CD    1 
ATOM   8516  O  OE1   . GLN C 1 792  ? 112.094 107.398 109.328 1.00 39.29  ?  664  GLN C OE1   1 
ATOM   8517  N  NE2   . GLN C 1 792  ? 112.311 107.749 111.536 1.00 34.64  ?  664  GLN C NE2   1 
ATOM   8518  N  N     . GLU C 1 793  ? 113.403 113.179 109.621 1.00 32.76  ?  665  GLU C N     1 
ATOM   8519  C  CA    . GLU C 1 793  ? 114.680 113.750 110.022 1.00 37.19  ?  665  GLU C CA    1 
ATOM   8520  C  C     . GLU C 1 793  ? 115.661 112.642 110.384 1.00 39.28  ?  665  GLU C C     1 
ATOM   8521  O  O     . GLU C 1 793  ? 115.309 111.687 111.081 1.00 38.62  ?  665  GLU C O     1 
ATOM   8522  C  CB    . GLU C 1 793  ? 114.469 114.697 111.207 1.00 35.12  ?  665  GLU C CB    1 
ATOM   8523  C  CG    . GLU C 1 793  ? 115.694 114.891 112.071 1.00 40.45  ?  665  GLU C CG    1 
ATOM   8524  C  CD    . GLU C 1 793  ? 116.830 115.530 111.307 1.00 52.68  ?  665  GLU C CD    1 
ATOM   8525  O  OE1   . GLU C 1 793  ? 116.714 116.720 110.944 1.00 44.99  ?  665  GLU C OE1   1 
ATOM   8526  O  OE2   . GLU C 1 793  ? 117.826 114.826 111.040 1.00 101.00 -1 665  GLU C OE2   1 
ATOM   8527  N  N     . GLN C 1 794  ? 116.892 112.763 109.885 1.00 39.87  ?  666  GLN C N     1 
ATOM   8528  C  CA    . GLN C 1 794  ? 117.890 111.716 110.041 1.00 35.64  ?  666  GLN C CA    1 
ATOM   8529  C  C     . GLN C 1 794  ? 118.821 111.933 111.226 1.00 37.26  ?  666  GLN C C     1 
ATOM   8530  O  O     . GLN C 1 794  ? 119.527 110.996 111.617 1.00 38.66  ?  666  GLN C O     1 
ATOM   8531  C  CB    . GLN C 1 794  ? 118.721 111.587 108.760 1.00 36.19  ?  666  GLN C CB    1 
ATOM   8532  C  CG    . GLN C 1 794  ? 118.904 110.153 108.305 1.00 44.47  ?  666  GLN C CG    1 
ATOM   8533  C  CD    . GLN C 1 794  ? 117.630 109.564 107.733 1.00 46.31  ?  666  GLN C CD    1 
ATOM   8534  O  OE1   . GLN C 1 794  ? 116.684 110.288 107.423 1.00 40.82  ?  666  GLN C OE1   1 
ATOM   8535  N  NE2   . GLN C 1 794  ? 117.595 108.243 107.601 1.00 47.09  ?  666  GLN C NE2   1 
ATOM   8536  N  N     . LYS C 1 795  ? 118.844 113.133 111.801 1.00 39.21  ?  667  LYS C N     1 
ATOM   8537  C  CA    . LYS C 1 795  ? 119.696 113.449 112.949 1.00 35.65  ?  667  LYS C CA    1 
ATOM   8538  C  C     . LYS C 1 795  ? 118.866 114.106 114.047 1.00 32.12  ?  667  LYS C C     1 
ATOM   8539  O  O     . LYS C 1 795  ? 119.126 115.247 114.443 1.00 31.56  ?  667  LYS C O     1 
ATOM   8540  C  CB    . LYS C 1 795  ? 120.848 114.359 112.527 1.00 35.23  ?  667  LYS C CB    1 
ATOM   8541  C  CG    . LYS C 1 795  ? 121.619 113.889 111.304 1.00 35.13  ?  667  LYS C CG    1 
ATOM   8542  C  CD    . LYS C 1 795  ? 122.534 114.990 110.791 1.00 30.84  ?  667  LYS C CD    1 
ATOM   8543  C  CE    . LYS C 1 795  ? 123.510 115.437 111.864 1.00 24.52  ?  667  LYS C CE    1 
ATOM   8544  N  NZ    . LYS C 1 795  ? 124.324 116.605 111.428 1.00 21.62  ?  667  LYS C NZ    1 
ATOM   8545  N  N     . PRO C 1 796  ? 117.862 113.402 114.581 1.00 30.19  ?  668  PRO C N     1 
ATOM   8546  C  CA    . PRO C 1 796  ? 116.966 114.027 115.567 1.00 27.19  ?  668  PRO C CA    1 
ATOM   8547  C  C     . PRO C 1 796  ? 117.640 114.377 116.883 1.00 22.06  ?  668  PRO C C     1 
ATOM   8548  O  O     . PRO C 1 796  ? 116.993 114.977 117.749 1.00 21.82  ?  668  PRO C O     1 
ATOM   8549  C  CB    . PRO C 1 796  ? 115.884 112.961 115.769 1.00 33.30  ?  668  PRO C CB    1 
ATOM   8550  C  CG    . PRO C 1 796  ? 116.602 111.678 115.536 1.00 37.03  ?  668  PRO C CG    1 
ATOM   8551  C  CD    . PRO C 1 796  ? 117.602 111.956 114.444 1.00 33.98  ?  668  PRO C CD    1 
ATOM   8552  N  N     . ASN C 1 797  ? 118.911 114.021 117.061 1.00 22.32  ?  669  ASN C N     1 
ATOM   8553  C  CA    . ASN C 1 797  ? 119.663 114.367 118.257 1.00 26.34  ?  669  ASN C CA    1 
ATOM   8554  C  C     . ASN C 1 797  ? 120.679 115.473 118.035 1.00 27.42  ?  669  ASN C C     1 
ATOM   8555  O  O     . ASN C 1 797  ? 120.961 116.227 118.966 1.00 28.62  ?  669  ASN C O     1 
ATOM   8556  C  CB    . ASN C 1 797  ? 120.392 113.134 118.803 1.00 32.65  ?  669  ASN C CB    1 
ATOM   8557  C  CG    . ASN C 1 797  ? 119.503 111.908 118.854 1.00 32.77  ?  669  ASN C CG    1 
ATOM   8558  O  OD1   . ASN C 1 797  ? 118.800 111.597 117.892 1.00 31.84  ?  669  ASN C OD1   1 
ATOM   8559  N  ND2   . ASN C 1 797  ? 119.535 111.198 119.976 1.00 32.14  ?  669  ASN C ND2   1 
ATOM   8560  N  N     . SER C 1 798  ? 121.242 115.587 116.837 1.00 24.14  ?  670  SER C N     1 
ATOM   8561  C  CA    . SER C 1 798  ? 122.233 116.624 116.592 1.00 21.93  ?  670  SER C CA    1 
ATOM   8562  C  C     . SER C 1 798  ? 121.604 118.004 116.740 1.00 17.47  ?  670  SER C C     1 
ATOM   8563  O  O     . SER C 1 798  ? 120.539 118.280 116.181 1.00 16.79  ?  670  SER C O     1 
ATOM   8564  C  CB    . SER C 1 798  ? 122.842 116.457 115.203 1.00 26.74  ?  670  SER C CB    1 
ATOM   8565  O  OG    . SER C 1 798  ? 124.026 115.679 115.260 1.00 27.70  ?  670  SER C OG    1 
ATOM   8566  N  N     . GLU C 1 799  ? 122.276 118.867 117.506 1.00 23.12  ?  671  GLU C N     1 
ATOM   8567  C  CA    . GLU C 1 799  ? 121.776 120.210 117.780 1.00 21.36  ?  671  GLU C CA    1 
ATOM   8568  C  C     . GLU C 1 799  ? 121.584 121.036 116.517 1.00 17.16  ?  671  GLU C C     1 
ATOM   8569  O  O     . GLU C 1 799  ? 120.922 122.079 116.571 1.00 13.74  ?  671  GLU C O     1 
ATOM   8570  C  CB    . GLU C 1 799  ? 122.736 120.939 118.719 1.00 29.61  ?  671  GLU C CB    1 
ATOM   8571  C  CG    . GLU C 1 799  ? 124.119 121.203 118.121 1.00 39.99  ?  671  GLU C CG    1 
ATOM   8572  C  CD    . GLU C 1 799  ? 124.997 119.961 118.055 1.00 59.74  ?  671  GLU C CD    1 
ATOM   8573  O  OE1   . GLU C 1 799  ? 124.525 118.867 118.436 1.00 40.82  ?  671  GLU C OE1   1 
ATOM   8574  O  OE2   . GLU C 1 799  ? 126.165 120.078 117.630 1.00 159.32 -1 671  GLU C OE2   1 
ATOM   8575  N  N     . LEU C 1 800  ? 122.159 120.603 115.391 1.00 18.98  ?  672  LEU C N     1 
ATOM   8576  C  CA    . LEU C 1 800  ? 121.950 121.300 114.126 1.00 18.04  ?  672  LEU C CA    1 
ATOM   8577  C  C     . LEU C 1 800  ? 120.473 121.461 113.798 1.00 18.33  ?  672  LEU C C     1 
ATOM   8578  O  O     . LEU C 1 800  ? 120.095 122.388 113.072 1.00 14.93  ?  672  LEU C O     1 
ATOM   8579  C  CB    . LEU C 1 800  ? 122.660 120.559 112.993 1.00 22.92  ?  672  LEU C CB    1 
ATOM   8580  C  CG    . LEU C 1 800  ? 124.184 120.672 112.955 1.00 27.60  ?  672  LEU C CG    1 
ATOM   8581  C  CD1   . LEU C 1 800  ? 124.777 119.734 111.909 1.00 26.61  ?  672  LEU C CD1   1 
ATOM   8582  C  CD2   . LEU C 1 800  ? 124.586 122.114 112.685 1.00 21.99  ?  672  LEU C CD2   1 
ATOM   8583  N  N     . SER C 1 801  ? 119.621 120.566 114.307 1.00 16.34  ?  673  SER C N     1 
ATOM   8584  C  CA    . SER C 1 801  ? 118.172 120.698 114.168 1.00 11.58  ?  673  SER C CA    1 
ATOM   8585  C  C     . SER C 1 801  ? 117.564 120.591 115.565 1.00 9.61   ?  673  SER C C     1 
ATOM   8586  O  O     . SER C 1 801  ? 117.079 119.534 115.975 1.00 10.43  ?  673  SER C O     1 
ATOM   8587  C  CB    . SER C 1 801  ? 117.616 119.643 113.213 1.00 13.52  ?  673  SER C CB    1 
ATOM   8588  O  OG    . SER C 1 801  ? 116.201 119.610 113.252 1.00 16.18  ?  673  SER C OG    1 
ATOM   8589  N  N     . CYS C 1 802  ? 117.584 121.709 116.289 1.00 9.69   ?  674  CYS C N     1 
ATOM   8590  C  CA    . CYS C 1 802  ? 116.865 121.837 117.555 1.00 8.76   ?  674  CYS C CA    1 
ATOM   8591  C  C     . CYS C 1 802  ? 116.572 123.322 117.721 1.00 7.52   ?  674  CYS C C     1 
ATOM   8592  O  O     . CYS C 1 802  ? 117.426 124.081 118.190 1.00 6.63   ?  674  CYS C O     1 
ATOM   8593  C  CB    . CYS C 1 802  ? 117.662 121.287 118.728 1.00 10.10  ?  674  CYS C CB    1 
ATOM   8594  S  SG    . CYS C 1 802  ? 116.729 121.276 120.276 1.00 16.78  ?  674  CYS C SG    1 
ATOM   8595  N  N     . ARG C 1 803  ? 115.368 123.720 117.346 1.00 6.56   ?  675  ARG C N     1 
ATOM   8596  C  CA    . ARG C 1 803  ? 115.066 125.126 117.156 1.00 5.66   ?  675  ARG C CA    1 
ATOM   8597  C  C     . ARG C 1 803  ? 114.635 125.754 118.472 1.00 1.73   ?  675  ARG C C     1 
ATOM   8598  O  O     . ARG C 1 803  ? 113.633 125.316 119.055 1.00 5.36   ?  675  ARG C O     1 
ATOM   8599  C  CB    . ARG C 1 803  ? 113.979 125.293 116.116 1.00 6.57   ?  675  ARG C CB    1 
ATOM   8600  C  CG    . ARG C 1 803  ? 113.890 124.130 115.140 1.00 7.10   ?  675  ARG C CG    1 
ATOM   8601  C  CD    . ARG C 1 803  ? 115.024 124.179 114.137 1.00 7.53   ?  675  ARG C CD    1 
ATOM   8602  N  NE    . ARG C 1 803  ? 114.929 125.359 113.286 1.00 9.80   ?  675  ARG C NE    1 
ATOM   8603  C  CZ    . ARG C 1 803  ? 114.103 125.465 112.252 1.00 11.22  ?  675  ARG C CZ    1 
ATOM   8604  N  NH1   . ARG C 1 803  ? 113.306 124.454 111.933 1.00 7.19   ?  675  ARG C NH1   1 
ATOM   8605  N  NH2   . ARG C 1 803  ? 114.080 126.578 111.533 1.00 15.48  ?  675  ARG C NH2   1 
ATOM   8606  N  N     . PRO C 1 804  ? 115.346 126.760 118.969 1.00 0.78   ?  676  PRO C N     1 
ATOM   8607  C  CA    . PRO C 1 804  ? 114.898 127.447 120.178 1.00 1.04   ?  676  PRO C CA    1 
ATOM   8608  C  C     . PRO C 1 804  ? 113.659 128.271 119.893 1.00 8.81   ?  676  PRO C C     1 
ATOM   8609  O  O     . PRO C 1 804  ? 113.461 128.794 118.793 1.00 4.29   ?  676  PRO C O     1 
ATOM   8610  C  CB    . PRO C 1 804  ? 116.088 128.341 120.538 1.00 5.54   ?  676  PRO C CB    1 
ATOM   8611  C  CG    . PRO C 1 804  ? 116.742 128.590 119.232 1.00 3.64   ?  676  PRO C CG    1 
ATOM   8612  C  CD    . PRO C 1 804  ? 116.620 127.304 118.473 1.00 2.17   ?  676  PRO C CD    1 
ATOM   8613  N  N     . LEU C 1 805  ? 112.816 128.376 120.904 1.00 4.56   ?  677  LEU C N     1 
ATOM   8614  C  CA    . LEU C 1 805  ? 111.559 129.077 120.780 1.00 2.55   ?  677  LEU C CA    1 
ATOM   8615  C  C     . LEU C 1 805  ? 111.295 130.002 121.948 1.00 4.31   ?  677  LEU C C     1 
ATOM   8616  O  O     . LEU C 1 805  ? 110.523 130.957 121.797 1.00 5.42   ?  677  LEU C O     1 
ATOM   8617  C  CB    . LEU C 1 805  ? 110.423 128.057 120.642 1.00 1.32   ?  677  LEU C CB    1 
ATOM   8618  C  CG    . LEU C 1 805  ? 108.985 128.537 120.660 1.00 2.51   ?  677  LEU C CG    1 
ATOM   8619  C  CD1   . LEU C 1 805  ? 108.203 127.835 119.577 1.00 3.70   ?  677  LEU C CD1   1 
ATOM   8620  C  CD2   . LEU C 1 805  ? 108.419 128.235 122.022 1.00 2.52   ?  677  LEU C CD2   1 
ATOM   8621  N  N     . CYS C 1 806  ? 111.948 129.784 123.087 1.00 2.54   ?  678  CYS C N     1 
ATOM   8622  C  CA    . CYS C 1 806  ? 111.775 130.619 124.261 1.00 3.10   ?  678  CYS C CA    1 
ATOM   8623  C  C     . CYS C 1 806  ? 113.010 130.543 125.144 1.00 2.27   ?  678  CYS C C     1 
ATOM   8624  O  O     . CYS C 1 806  ? 113.562 129.459 125.358 1.00 4.73   ?  678  CYS C O     1 
ATOM   8625  C  CB    . CYS C 1 806  ? 110.547 130.190 125.057 1.00 3.87   ?  678  CYS C CB    1 
ATOM   8626  S  SG    . CYS C 1 806  ? 110.446 131.030 126.634 1.00 18.51  ?  678  CYS C SG    1 
ATOM   8627  N  N     . LEU C 1 807  ? 113.426 131.695 125.672 1.00 0.95   ?  679  LEU C N     1 
ATOM   8628  C  CA    . LEU C 1 807  ? 114.542 131.768 126.601 1.00 6.44   ?  679  LEU C CA    1 
ATOM   8629  C  C     . LEU C 1 807  ? 114.159 132.622 127.796 1.00 7.45   ?  679  LEU C C     1 
ATOM   8630  O  O     . LEU C 1 807  ? 113.501 133.657 127.646 1.00 10.86  ?  679  LEU C O     1 
ATOM   8631  C  CB    . LEU C 1 807  ? 115.789 132.340 125.939 1.00 1.95   ?  679  LEU C CB    1 
ATOM   8632  C  CG    . LEU C 1 807  ? 116.660 131.264 125.299 1.00 2.42   ?  679  LEU C CG    1 
ATOM   8633  C  CD1   . LEU C 1 807  ? 116.119 130.852 123.948 1.00 4.76   ?  679  LEU C CD1   1 
ATOM   8634  C  CD2   . LEU C 1 807  ? 118.069 131.757 125.176 1.00 8.66   ?  679  LEU C CD2   1 
ATOM   8635  N  N     . MET C 1 808  ? 114.577 132.177 128.982 1.00 9.07   ?  680  MET C N     1 
ATOM   8636  C  CA    . MET C 1 808  ? 114.187 132.798 130.241 1.00 46.51  ?  680  MET C CA    1 
ATOM   8637  C  C     . MET C 1 808  ? 115.353 132.765 131.214 1.00 2.92   ?  680  MET C C     1 
ATOM   8638  O  O     . MET C 1 808  ? 115.955 131.710 131.434 1.00 5.18   ?  680  MET C O     1 
ATOM   8639  C  CB    . MET C 1 808  ? 112.994 132.079 130.866 1.00 8.64   ?  680  MET C CB    1 
ATOM   8640  C  CG    . MET C 1 808  ? 111.786 131.979 129.977 1.00 12.25  ?  680  MET C CG    1 
ATOM   8641  S  SD    . MET C 1 808  ? 110.629 130.855 130.748 1.00 6.71   ?  680  MET C SD    1 
ATOM   8642  C  CE    . MET C 1 808  ? 111.743 129.536 131.175 1.00 5.60   ?  680  MET C CE    1 
ATOM   8643  N  N     . PHE C 1 809  ? 115.646 133.918 131.810 1.00 5.71   ?  681  PHE C N     1 
ATOM   8644  C  CA    . PHE C 1 809  ? 116.703 134.039 132.812 1.00 4.00   ?  681  PHE C CA    1 
ATOM   8645  C  C     . PHE C 1 809  ? 116.145 133.708 134.195 1.00 5.86   ?  681  PHE C C     1 
ATOM   8646  O  O     . PHE C 1 809  ? 116.043 134.552 135.086 1.00 6.99   ?  681  PHE C O     1 
ATOM   8647  C  CB    . PHE C 1 809  ? 117.293 135.440 132.783 1.00 3.40   ?  681  PHE C CB    1 
ATOM   8648  C  CG    . PHE C 1 809  ? 118.536 135.552 131.971 1.00 4.29   ?  681  PHE C CG    1 
ATOM   8649  C  CD1   . PHE C 1 809  ? 119.486 134.550 132.006 1.00 6.29   ?  681  PHE C CD1   1 
ATOM   8650  C  CD2   . PHE C 1 809  ? 118.761 136.660 131.174 1.00 7.20   ?  681  PHE C CD2   1 
ATOM   8651  C  CE1   . PHE C 1 809  ? 120.638 134.649 131.262 1.00 10.72  ?  681  PHE C CE1   1 
ATOM   8652  C  CE2   . PHE C 1 809  ? 119.913 136.764 130.427 1.00 13.32  ?  681  PHE C CE2   1 
ATOM   8653  C  CZ    . PHE C 1 809  ? 120.854 135.756 130.471 1.00 12.91  ?  681  PHE C CZ    1 
ATOM   8654  N  N     . VAL C 1 810  ? 115.767 132.445 134.365 1.00 6.73   ?  682  VAL C N     1 
ATOM   8655  C  CA    . VAL C 1 810  ? 115.216 131.967 135.620 1.00 8.42   ?  682  VAL C CA    1 
ATOM   8656  C  C     . VAL C 1 810  ? 116.031 130.749 136.043 1.00 17.95  ?  682  VAL C C     1 
ATOM   8657  O  O     . VAL C 1 810  ? 117.007 130.382 135.390 1.00 20.33  ?  682  VAL C O     1 
ATOM   8658  C  CB    . VAL C 1 810  ? 113.713 131.627 135.504 1.00 7.18   ?  682  VAL C CB    1 
ATOM   8659  C  CG1   . VAL C 1 810  ? 113.032 131.649 136.872 1.00 10.85  ?  682  VAL C CG1   1 
ATOM   8660  C  CG2   . VAL C 1 810  ? 113.028 132.575 134.541 1.00 7.86   ?  682  VAL C CG2   1 
ATOM   8661  N  N     . ASP C 1 811  ? 115.636 130.133 137.151 1.00 19.21  ?  683  ASP C N     1 
ATOM   8662  C  CA    . ASP C 1 811  ? 116.254 128.903 137.612 1.00 25.50  ?  683  ASP C CA    1 
ATOM   8663  C  C     . ASP C 1 811  ? 115.287 127.740 137.431 1.00 20.47  ?  683  ASP C C     1 
ATOM   8664  O  O     . ASP C 1 811  ? 114.067 127.899 137.534 1.00 19.48  ?  683  ASP C O     1 
ATOM   8665  C  CB    . ASP C 1 811  ? 116.687 129.015 139.075 1.00 32.54  ?  683  ASP C CB    1 
ATOM   8666  C  CG    . ASP C 1 811  ? 117.763 128.012 139.441 1.00 48.33  ?  683  ASP C CG    1 
ATOM   8667  O  OD1   . ASP C 1 811  ? 117.746 126.886 138.901 1.00 39.95  ?  683  ASP C OD1   1 
ATOM   8668  O  OD2   . ASP C 1 811  ? 118.643 128.362 140.255 1.00 160.71 -1 683  ASP C OD2   1 
ATOM   8669  N  N     . GLU C 1 812  ? 115.857 126.565 137.155 1.00 25.71  ?  684  GLU C N     1 
ATOM   8670  C  CA    . GLU C 1 812  ? 115.056 125.383 136.854 1.00 27.70  ?  684  GLU C CA    1 
ATOM   8671  C  C     . GLU C 1 812  ? 114.183 124.971 138.030 1.00 23.34  ?  684  GLU C C     1 
ATOM   8672  O  O     . GLU C 1 812  ? 113.120 124.368 137.834 1.00 25.34  ?  684  GLU C O     1 
ATOM   8673  C  CB    . GLU C 1 812  ? 115.982 124.232 136.459 1.00 40.77  ?  684  GLU C CB    1 
ATOM   8674  C  CG    . GLU C 1 812  ? 115.293 123.008 135.884 1.00 56.15  ?  684  GLU C CG    1 
ATOM   8675  C  CD    . GLU C 1 812  ? 116.257 121.851 135.666 1.00 81.03  ?  684  GLU C CD    1 
ATOM   8676  O  OE1   . GLU C 1 812  ? 116.992 121.498 136.614 1.00 72.25  ?  684  GLU C OE1   1 
ATOM   8677  O  OE2   . GLU C 1 812  ? 116.287 121.299 134.545 1.00 105.08 -1 684  GLU C OE2   1 
ATOM   8678  N  N     . SER C 1 813  ? 114.605 125.298 139.251 1.00 22.04  ?  685  SER C N     1 
ATOM   8679  C  CA    . SER C 1 813  ? 113.976 124.728 140.438 1.00 27.34  ?  685  SER C CA    1 
ATOM   8680  C  C     . SER C 1 813  ? 112.587 125.313 140.678 1.00 28.08  ?  685  SER C C     1 
ATOM   8681  O  O     . SER C 1 813  ? 111.585 124.590 140.644 1.00 28.77  ?  685  SER C O     1 
ATOM   8682  C  CB    . SER C 1 813  ? 114.873 124.952 141.657 1.00 27.60  ?  685  SER C CB    1 
ATOM   8683  O  OG    . SER C 1 813  ? 116.171 124.425 141.443 1.00 29.12  ?  685  SER C OG    1 
ATOM   8684  N  N     . ASP C 1 814  ? 112.505 126.624 140.912 1.00 27.44  ?  686  ASP C N     1 
ATOM   8685  C  CA    . ASP C 1 814  ? 111.272 127.228 141.407 1.00 21.82  ?  686  ASP C CA    1 
ATOM   8686  C  C     . ASP C 1 814  ? 110.144 127.062 140.411 1.00 14.10  ?  686  ASP C C     1 
ATOM   8687  O  O     . ASP C 1 814  ? 110.225 127.517 139.242 1.00 16.73  ?  686  ASP C O     1 
ATOM   8688  C  CB    . ASP C 1 814  ? 111.480 128.703 141.730 1.00 31.65  ?  686  ASP C CB    1 
ATOM   8689  C  CG    . ASP C 1 814  ? 111.742 129.544 140.497 1.00 40.55  ?  686  ASP C CG    1 
ATOM   8690  O  OD1   . ASP C 1 814  ? 112.545 129.122 139.638 1.00 32.38  ?  686  ASP C OD1   1 
ATOM   8691  O  OD2   . ASP C 1 814  ? 111.104 130.612 140.368 1.00 124.46 -1 686  ASP C OD2   1 
ATOM   8692  N  N     . HIS C 1 815  ? 109.085 126.407 140.889 1.00 9.42   ?  687  HIS C N     1 
ATOM   8693  C  CA    . HIS C 1 815  ? 107.918 126.178 140.035 1.00 7.71   ?  687  HIS C CA    1 
ATOM   8694  C  C     . HIS C 1 815  ? 107.093 127.436 139.749 1.00 11.30  ?  687  HIS C C     1 
ATOM   8695  O  O     . HIS C 1 815  ? 106.641 127.626 138.613 1.00 11.68  ?  687  HIS C O     1 
ATOM   8696  C  CB    . HIS C 1 815  ? 107.369 124.785 140.339 1.00 3.77   ?  687  HIS C CB    1 
ATOM   8697  C  CG    . HIS C 1 815  ? 106.060 124.416 139.858 1.00 7.65   ?  687  HIS C CG    1 
ATOM   8698  N  ND1   . HIS C 1 815  ? 105.221 124.558 138.788 1.00 9.32   ?  687  HIS C ND1   1 
ATOM   8699  C  CD2   . HIS C 1 815  ? 106.276 123.063 139.781 1.00 10.81  ?  687  HIS C CD2   1 
ATOM   8700  C  CE1   . HIS C 1 815  ? 104.622 123.434 138.481 1.00 10.01  ?  687  HIS C CE1   1 
ATOM   8701  N  NE2   . HIS C 1 815  ? 105.426 122.488 138.879 1.00 14.88  ?  687  HIS C NE2   1 
ATOM   8702  N  N     . GLU C 1 816  ? 107.287 128.498 140.539 1.00 12.98  ?  688  GLU C N     1 
ATOM   8703  C  CA    . GLU C 1 816  ? 106.478 129.722 140.336 1.00 16.55  ?  688  GLU C CA    1 
ATOM   8704  C  C     . GLU C 1 816  ? 106.791 130.432 139.018 1.00 14.21  ?  688  GLU C C     1 
ATOM   8705  O  O     . GLU C 1 816  ? 105.933 130.497 138.132 1.00 12.75  ?  688  GLU C O     1 
ATOM   8706  C  CB    . GLU C 1 816  ? 106.687 130.635 141.519 1.00 16.49  ?  688  GLU C CB    1 
ATOM   8707  C  CG    . GLU C 1 816  ? 105.428 131.346 141.907 1.00 22.73  ?  688  GLU C CG    1 
ATOM   8708  C  CD    . GLU C 1 816  ? 104.847 132.161 140.770 1.00 31.81  ?  688  GLU C CD    1 
ATOM   8709  O  OE1   . GLU C 1 816  ? 105.616 132.866 140.080 1.00 24.54  ?  688  GLU C OE1   1 
ATOM   8710  O  OE2   . GLU C 1 816  ? 103.618 132.094 140.560 1.00 132.62 -1 688  GLU C OE2   1 
ATOM   8711  N  N     . THR C 1 817  ? 108.002 130.979 138.899 1.00 16.17  ?  689  THR C N     1 
ATOM   8712  C  CA    . THR C 1 817  ? 108.312 131.800 137.735 1.00 11.76  ?  689  THR C CA    1 
ATOM   8713  C  C     . THR C 1 817  ? 108.336 130.970 136.461 1.00 8.01   ?  689  THR C C     1 
ATOM   8714  O  O     . THR C 1 817  ? 107.953 131.462 135.389 1.00 6.05   ?  689  THR C O     1 
ATOM   8715  C  CB    . THR C 1 817  ? 109.651 132.509 137.930 1.00 11.95  ?  689  THR C CB    1 
ATOM   8716  O  OG1   . THR C 1 817  ? 109.718 133.051 139.255 1.00 16.48  ?  689  THR C OG1   1 
ATOM   8717  C  CG2   . THR C 1 817  ? 109.809 133.633 136.918 1.00 7.14   ?  689  THR C CG2   1 
ATOM   8718  N  N     . LEU C 1 818  ? 108.773 129.714 136.563 1.00 10.54  ?  690  LEU C N     1 
ATOM   8719  C  CA    . LEU C 1 818  ? 108.792 128.836 135.401 1.00 6.73   ?  690  LEU C CA    1 
ATOM   8720  C  C     . LEU C 1 818  ? 107.396 128.685 134.811 1.00 6.78   ?  690  LEU C C     1 
ATOM   8721  O  O     . LEU C 1 818  ? 107.197 128.888 133.606 1.00 8.91   ?  690  LEU C O     1 
ATOM   8722  C  CB    . LEU C 1 818  ? 109.374 127.475 135.784 1.00 4.67   ?  690  LEU C CB    1 
ATOM   8723  C  CG    . LEU C 1 818  ? 109.583 126.503 134.622 1.00 5.13   ?  690  LEU C CG    1 
ATOM   8724  C  CD1   . LEU C 1 818  ? 110.482 127.145 133.592 1.00 7.03   ?  690  LEU C CD1   1 
ATOM   8725  C  CD2   . LEU C 1 818  ? 110.180 125.189 135.101 1.00 9.27   ?  690  LEU C CD2   1 
ATOM   8726  N  N     . THR C 1 819  ? 106.408 128.339 135.650 1.00 4.46   ?  691  THR C N     1 
ATOM   8727  C  CA    . THR C 1 819  ? 105.041 128.248 135.140 1.00 12.94  ?  691  THR C CA    1 
ATOM   8728  C  C     . THR C 1 819  ? 104.539 129.607 134.671 1.00 20.84  ?  691  THR C C     1 
ATOM   8729  O  O     . THR C 1 819  ? 103.890 129.709 133.621 1.00 8.05   ?  691  THR C O     1 
ATOM   8730  C  CB    . THR C 1 819  ? 104.102 127.682 136.204 1.00 10.03  ?  691  THR C CB    1 
ATOM   8731  O  OG1   . THR C 1 819  ? 104.645 126.464 136.727 1.00 11.52  ?  691  THR C OG1   1 
ATOM   8732  C  CG2   . THR C 1 819  ? 102.727 127.404 135.606 1.00 20.44  ?  691  THR C CG2   1 
ATOM   8733  N  N     . ALA C 1 820  ? 104.848 130.663 135.430 1.00 11.60  ?  692  ALA C N     1 
ATOM   8734  C  CA    . ALA C 1 820  ? 104.355 131.996 135.099 1.00 9.79   ?  692  ALA C CA    1 
ATOM   8735  C  C     . ALA C 1 820  ? 104.770 132.419 133.696 1.00 8.64   ?  692  ALA C C     1 
ATOM   8736  O  O     . ALA C 1 820  ? 103.999 133.080 132.988 1.00 10.15  ?  692  ALA C O     1 
ATOM   8737  C  CB    . ALA C 1 820  ? 104.856 133.005 136.131 1.00 11.16  ?  692  ALA C CB    1 
ATOM   8738  N  N     . ILE C 1 821  ? 105.981 132.058 133.275 1.00 8.71   ?  693  ILE C N     1 
ATOM   8739  C  CA    . ILE C 1 821  ? 106.435 132.452 131.940 1.00 6.35   ?  693  ILE C CA    1 
ATOM   8740  C  C     . ILE C 1 821  ? 106.040 131.423 130.883 1.00 5.71   ?  693  ILE C C     1 
ATOM   8741  O  O     . ILE C 1 821  ? 105.672 131.793 129.765 1.00 6.20   ?  693  ILE C O     1 
ATOM   8742  C  CB    . ILE C 1 821  ? 107.955 132.708 131.920 1.00 4.84   ?  693  ILE C CB    1 
ATOM   8743  C  CG1   . ILE C 1 821  ? 108.378 133.651 133.047 1.00 5.38   ?  693  ILE C CG1   1 
ATOM   8744  C  CG2   . ILE C 1 821  ? 108.349 133.345 130.595 1.00 3.91   ?  693  ILE C CG2   1 
ATOM   8745  C  CD1   . ILE C 1 821  ? 108.133 135.115 132.751 1.00 6.54   ?  693  ILE C CD1   1 
ATOM   8746  N  N     . LEU C 1 822  ? 106.106 130.122 131.192 1.00 7.51   ?  694  LEU C N     1 
ATOM   8747  C  CA    . LEU C 1 822  ? 105.805 129.113 130.180 1.00 7.10   ?  694  LEU C CA    1 
ATOM   8748  C  C     . LEU C 1 822  ? 104.324 129.033 129.842 1.00 9.81   ?  694  LEU C C     1 
ATOM   8749  O  O     . LEU C 1 822  ? 103.983 128.536 128.762 1.00 10.74  ?  694  LEU C O     1 
ATOM   8750  C  CB    . LEU C 1 822  ? 106.289 127.735 130.635 1.00 6.61   ?  694  LEU C CB    1 
ATOM   8751  C  CG    . LEU C 1 822  ? 107.503 127.160 129.905 1.00 3.50   ?  694  LEU C CG    1 
ATOM   8752  C  CD1   . LEU C 1 822  ? 108.726 127.908 130.341 1.00 3.63   ?  694  LEU C CD1   1 
ATOM   8753  C  CD2   . LEU C 1 822  ? 107.671 125.679 130.191 1.00 3.76   ?  694  LEU C CD2   1 
ATOM   8754  N  N     . GLY C 1 823  ? 103.445 129.498 130.735 1.00 11.06  ?  695  GLY C N     1 
ATOM   8755  C  CA    . GLY C 1 823  ? 102.013 129.404 130.551 1.00 9.06   ?  695  GLY C CA    1 
ATOM   8756  C  C     . GLY C 1 823  ? 101.499 129.662 129.147 1.00 9.63   ?  695  GLY C C     1 
ATOM   8757  O  O     . GLY C 1 823  ? 100.795 128.829 128.567 1.00 10.74  ?  695  GLY C O     1 
ATOM   8758  N  N     . PRO C 1 824  ? 101.816 130.833 128.583 1.00 9.11   ?  696  PRO C N     1 
ATOM   8759  C  CA    . PRO C 1 824  ? 101.380 131.122 127.203 1.00 10.37  ?  696  PRO C CA    1 
ATOM   8760  C  C     . PRO C 1 824  ? 101.736 130.044 126.189 1.00 11.51  ?  696  PRO C C     1 
ATOM   8761  O  O     . PRO C 1 824  ? 100.898 129.684 125.353 1.00 16.91  ?  696  PRO C O     1 
ATOM   8762  C  CB    . PRO C 1 824  ? 102.089 132.448 126.906 1.00 10.28  ?  696  PRO C CB    1 
ATOM   8763  C  CG    . PRO C 1 824  ? 102.154 133.113 128.236 1.00 9.56   ?  696  PRO C CG    1 
ATOM   8764  C  CD    . PRO C 1 824  ? 102.427 132.014 129.222 1.00 7.91   ?  696  PRO C CD    1 
ATOM   8765  N  N     . VAL C 1 825  ? 102.966 129.528 126.233 1.00 9.75   ?  697  VAL C N     1 
ATOM   8766  C  CA    . VAL C 1 825  ? 103.356 128.450 125.327 1.00 9.98   ?  697  VAL C CA    1 
ATOM   8767  C  C     . VAL C 1 825  ? 102.466 127.228 125.533 1.00 14.21  ?  697  VAL C C     1 
ATOM   8768  O  O     . VAL C 1 825  ? 102.061 126.560 124.570 1.00 15.55  ?  697  VAL C O     1 
ATOM   8769  C  CB    . VAL C 1 825  ? 104.845 128.116 125.524 1.00 6.17   ?  697  VAL C CB    1 
ATOM   8770  C  CG1   . VAL C 1 825  ? 105.265 126.978 124.616 1.00 6.26   ?  697  VAL C CG1   1 
ATOM   8771  C  CG2   . VAL C 1 825  ? 105.698 129.351 125.271 1.00 4.92   ?  697  VAL C CG2   1 
ATOM   8772  N  N     . VAL C 1 826  ? 102.147 126.917 126.791 1.00 12.52  ?  698  VAL C N     1 
ATOM   8773  C  CA    . VAL C 1 826  ? 101.271 125.785 127.081 1.00 11.21  ?  698  VAL C CA    1 
ATOM   8774  C  C     . VAL C 1 826  ? 99.886  126.017 126.493 1.00 12.79  ?  698  VAL C C     1 
ATOM   8775  O  O     . VAL C 1 826  ? 99.263  125.096 125.948 1.00 15.75  ?  698  VAL C O     1 
ATOM   8776  C  CB    . VAL C 1 826  ? 101.209 125.535 128.599 1.00 10.98  ?  698  VAL C CB    1 
ATOM   8777  C  CG1   . VAL C 1 826  ? 100.004 124.674 128.956 1.00 11.75  ?  698  VAL C CG1   1 
ATOM   8778  C  CG2   . VAL C 1 826  ? 102.495 124.884 129.074 1.00 12.74  ?  698  VAL C CG2   1 
ATOM   8779  N  N     . ALA C 1 827  ? 99.375  127.245 126.605 1.00 11.75  ?  699  ALA C N     1 
ATOM   8780  C  CA    . ALA C 1 827  ? 98.077  127.554 126.015 1.00 13.93  ?  699  ALA C CA    1 
ATOM   8781  C  C     . ALA C 1 827  ? 98.121  127.409 124.500 1.00 15.10  ?  699  ALA C C     1 
ATOM   8782  O  O     . ALA C 1 827  ? 97.161  126.929 123.884 1.00 15.38  ?  699  ALA C O     1 
ATOM   8783  C  CB    . ALA C 1 827  ? 97.640  128.964 126.411 1.00 14.85  ?  699  ALA C CB    1 
ATOM   8784  N  N     . GLU C 1 828  ? 99.235  127.808 123.886 1.00 18.16  ?  700  GLU C N     1 
ATOM   8785  C  CA    . GLU C 1 828  ? 99.400  127.622 122.447 1.00 20.45  ?  700  GLU C CA    1 
ATOM   8786  C  C     . GLU C 1 828  ? 99.330  126.148 122.080 1.00 20.39  ?  700  GLU C C     1 
ATOM   8787  O  O     . GLU C 1 828  ? 98.656  125.762 121.118 1.00 23.20  ?  700  GLU C O     1 
ATOM   8788  C  CB    . GLU C 1 828  ? 100.730 128.218 121.986 1.00 23.97  ?  700  GLU C CB    1 
ATOM   8789  C  CG    . GLU C 1 828  ? 100.832 129.714 122.178 1.00 38.69  ?  700  GLU C CG    1 
ATOM   8790  C  CD    . GLU C 1 828  ? 99.988  130.486 121.186 1.00 69.77  ?  700  GLU C CD    1 
ATOM   8791  O  OE1   . GLU C 1 828  ? 99.421  129.858 120.266 1.00 56.02  ?  700  GLU C OE1   1 
ATOM   8792  O  OE2   . GLU C 1 828  ? 99.881  131.721 121.333 1.00 183.04 -1 700  GLU C OE2   1 
ATOM   8793  N  N     . ARG C 1 829  ? 100.042 125.312 122.834 1.00 19.82  ?  701  ARG C N     1 
ATOM   8794  C  CA    . ARG C 1 829  ? 99.986  123.871 122.611 1.00 20.52  ?  701  ARG C CA    1 
ATOM   8795  C  C     . ARG C 1 829  ? 98.558  123.351 122.728 1.00 21.93  ?  701  ARG C C     1 
ATOM   8796  O  O     . ARG C 1 829  ? 98.030  122.720 121.804 1.00 24.10  ?  701  ARG C O     1 
ATOM   8797  C  CB    . ARG C 1 829  ? 100.897 123.161 123.607 1.00 17.92  ?  701  ARG C CB    1 
ATOM   8798  C  CG    . ARG C 1 829  ? 102.343 123.102 123.189 1.00 21.29  ?  701  ARG C CG    1 
ATOM   8799  C  CD    . ARG C 1 829  ? 102.611 121.786 122.513 1.00 20.06  ?  701  ARG C CD    1 
ATOM   8800  N  NE    . ARG C 1 829  ? 102.045 120.692 123.294 1.00 20.35  ?  701  ARG C NE    1 
ATOM   8801  C  CZ    . ARG C 1 829  ? 102.565 120.246 124.431 1.00 25.87  ?  701  ARG C CZ    1 
ATOM   8802  N  NH1   . ARG C 1 829  ? 103.660 120.811 124.926 1.00 29.16  ?  701  ARG C NH1   1 
ATOM   8803  N  NH2   . ARG C 1 829  ? 101.988 119.246 125.080 1.00 28.96  ?  701  ARG C NH2   1 
ATOM   8804  N  N     . LYS C 1 830  ? 97.914  123.619 123.868 1.00 24.26  ?  702  LYS C N     1 
ATOM   8805  C  CA    . LYS C 1 830  ? 96.582  123.090 124.143 1.00 28.65  ?  702  LYS C CA    1 
ATOM   8806  C  C     . LYS C 1 830  ? 95.525  123.648 123.198 1.00 28.32  ?  702  LYS C C     1 
ATOM   8807  O  O     . LYS C 1 830  ? 94.430  123.080 123.109 1.00 28.08  ?  702  LYS C O     1 
ATOM   8808  C  CB    . LYS C 1 830  ? 96.200  123.384 125.596 1.00 29.27  ?  702  LYS C CB    1 
ATOM   8809  C  CG    . LYS C 1 830  ? 95.200  122.413 126.209 1.00 32.55  ?  702  LYS C CG    1 
ATOM   8810  C  CD    . LYS C 1 830  ? 95.117  122.592 127.721 1.00 39.08  ?  702  LYS C CD    1 
ATOM   8811  C  CE    . LYS C 1 830  ? 96.499  122.577 128.371 1.00 34.14  ?  702  LYS C CE    1 
ATOM   8812  N  NZ    . LYS C 1 830  ? 97.274  121.343 128.052 1.00 29.86  ?  702  LYS C NZ    1 
ATOM   8813  N  N     . ALA C 1 831  ? 95.820  124.747 122.506 1.00 24.63  ?  703  ALA C N     1 
ATOM   8814  C  CA    . ALA C 1 831  ? 94.915  125.268 121.492 1.00 26.61  ?  703  ALA C CA    1 
ATOM   8815  C  C     . ALA C 1 831  ? 95.217  124.737 120.097 1.00 26.50  ?  703  ALA C C     1 
ATOM   8816  O  O     . ALA C 1 831  ? 94.306  124.654 119.264 1.00 28.52  ?  703  ALA C O     1 
ATOM   8817  C  CB    . ALA C 1 831  ? 94.974  126.799 121.474 1.00 26.53  ?  703  ALA C CB    1 
ATOM   8818  N  N     . MET C 1 832  ? 96.469  124.357 119.829 1.00 26.83  ?  704  MET C N     1 
ATOM   8819  C  CA    . MET C 1 832  ? 96.900  124.107 118.457 1.00 25.71  ?  704  MET C CA    1 
ATOM   8820  C  C     . MET C 1 832  ? 96.569  122.701 117.973 1.00 27.36  ?  704  MET C C     1 
ATOM   8821  O  O     . MET C 1 832  ? 96.348  122.503 116.772 1.00 30.07  ?  704  MET C O     1 
ATOM   8822  C  CB    . MET C 1 832  ? 98.402  124.357 118.338 1.00 20.93  ?  704  MET C CB    1 
ATOM   8823  C  CG    . MET C 1 832  ? 98.916  124.393 116.918 1.00 20.77  ?  704  MET C CG    1 
ATOM   8824  S  SD    . MET C 1 832  ? 100.513 125.219 116.816 1.00 21.94  ?  704  MET C SD    1 
ATOM   8825  C  CE    . MET C 1 832  ? 100.121 126.811 117.543 1.00 17.88  ?  704  MET C CE    1 
ATOM   8826  N  N     . MET C 1 833  ? 96.532  121.717 118.873 1.00 28.06  ?  705  MET C N     1 
ATOM   8827  C  CA    . MET C 1 833  ? 96.206  120.355 118.469 1.00 31.40  ?  705  MET C CA    1 
ATOM   8828  C  C     . MET C 1 833  ? 94.786  120.224 117.938 1.00 39.81  ?  705  MET C C     1 
ATOM   8829  O  O     . MET C 1 833  ? 94.456  119.190 117.345 1.00 42.52  ?  705  MET C O     1 
ATOM   8830  C  CB    . MET C 1 833  ? 96.399  119.406 119.651 1.00 31.06  ?  705  MET C CB    1 
ATOM   8831  C  CG    . MET C 1 833  ? 97.677  119.651 120.427 1.00 29.77  ?  705  MET C CG    1 
ATOM   8832  S  SD    . MET C 1 833  ? 97.835  118.556 121.851 1.00 42.01  ?  705  MET C SD    1 
ATOM   8833  C  CE    . MET C 1 833  ? 96.245  118.785 122.646 1.00 26.93  ?  705  MET C CE    1 
ATOM   8834  N  N     . GLU C 1 834  ? 93.944  121.239 118.136 1.00 42.93  ?  706  GLU C N     1 
ATOM   8835  C  CA    . GLU C 1 834  ? 92.556  121.176 117.696 1.00 51.46  ?  706  GLU C CA    1 
ATOM   8836  C  C     . GLU C 1 834  ? 92.425  121.512 116.216 1.00 47.54  ?  706  GLU C C     1 
ATOM   8837  O  O     . GLU C 1 834  ? 91.968  120.690 115.414 1.00 48.90  ?  706  GLU C O     1 
ATOM   8838  C  CB    . GLU C 1 834  ? 91.702  122.130 118.535 1.00 64.21  ?  706  GLU C CB    1 
ATOM   8839  C  CG    . GLU C 1 834  ? 90.464  121.493 119.134 1.00 92.13  ?  706  GLU C CG    1 
ATOM   8840  C  CD    . GLU C 1 834  ? 90.799  120.425 120.153 1.00 117.17 ?  706  GLU C CD    1 
ATOM   8841  O  OE1   . GLU C 1 834  ? 91.859  120.537 120.805 1.00 94.58  ?  706  GLU C OE1   1 
ATOM   8842  O  OE2   . GLU C 1 834  ? 90.007  119.471 120.297 1.00 217.30 -1 706  GLU C OE2   1 
ATOM   8843  N  N     . SER C 1 835  ? 92.834  122.717 115.838 1.00 50.81  ?  707  SER C N     1 
ATOM   8844  C  CA    . SER C 1 835  ? 92.605  123.221 114.494 1.00 53.64  ?  707  SER C CA    1 
ATOM   8845  C  C     . SER C 1 835  ? 93.632  122.639 113.523 1.00 53.92  ?  707  SER C C     1 
ATOM   8846  O  O     . SER C 1 835  ? 94.408  121.738 113.854 1.00 49.31  ?  707  SER C O     1 
ATOM   8847  C  CB    . SER C 1 835  ? 92.644  124.742 114.501 1.00 51.26  ?  707  SER C CB    1 
ATOM   8848  O  OG    . SER C 1 835  ? 92.800  125.218 113.187 1.00 48.90  ?  707  SER C OG    1 
ATOM   8849  N  N     . ARG C 1 836  ? 93.636  123.155 112.295 1.00 50.05  ?  708  ARG C N     1 
ATOM   8850  C  CA    . ARG C 1 836  ? 94.608  122.767 111.287 1.00 43.66  ?  708  ARG C CA    1 
ATOM   8851  C  C     . ARG C 1 836  ? 95.152  124.018 110.608 1.00 44.53  ?  708  ARG C C     1 
ATOM   8852  O  O     . ARG C 1 836  ? 94.548  125.094 110.655 1.00 46.24  ?  708  ARG C O     1 
ATOM   8853  C  CB    . ARG C 1 836  ? 93.997  121.804 110.260 1.00 45.43  ?  708  ARG C CB    1 
ATOM   8854  C  CG    . ARG C 1 836  ? 93.578  120.461 110.855 1.00 43.79  ?  708  ARG C CG    1 
ATOM   8855  C  CD    . ARG C 1 836  ? 92.835  119.599 109.845 1.00 43.73  ?  708  ARG C CD    1 
ATOM   8856  N  NE    . ARG C 1 836  ? 91.539  120.170 109.486 1.00 55.69  ?  708  ARG C NE    1 
ATOM   8857  C  CZ    . ARG C 1 836  ? 91.334  120.968 108.442 1.00 61.25  ?  708  ARG C CZ    1 
ATOM   8858  N  NH1   . ARG C 1 836  ? 92.343  121.294 107.645 1.00 57.19  ?  708  ARG C NH1   1 
ATOM   8859  N  NH2   . ARG C 1 836  ? 90.121  121.442 108.196 1.00 61.70  ?  708  ARG C NH2   1 
ATOM   8860  N  N     . LEU C 1 837  ? 96.307  123.859 109.968 1.00 44.37  ?  709  LEU C N     1 
ATOM   8861  C  CA    . LEU C 1 837  ? 97.119  124.974 109.498 1.00 46.93  ?  709  LEU C CA    1 
ATOM   8862  C  C     . LEU C 1 837  ? 97.034  125.106 107.982 1.00 46.65  ?  709  LEU C C     1 
ATOM   8863  O  O     . LEU C 1 837  ? 97.020  124.103 107.268 1.00 46.73  ?  709  LEU C O     1 
ATOM   8864  C  CB    . LEU C 1 837  ? 98.574  124.775 109.932 1.00 43.89  ?  709  LEU C CB    1 
ATOM   8865  C  CG    . LEU C 1 837  ? 99.563  125.913 109.705 1.00 41.10  ?  709  LEU C CG    1 
ATOM   8866  C  CD1   . LEU C 1 837  ? 99.109  127.145 110.458 1.00 38.19  ?  709  LEU C CD1   1 
ATOM   8867  C  CD2   . LEU C 1 837  ? 100.949 125.492 110.158 1.00 33.91  ?  709  LEU C CD2   1 
ATOM   8868  N  N     . ILE C 1 838  ? 96.989  126.345 107.489 1.00 44.82  ?  710  ILE C N     1 
ATOM   8869  C  CA    . ILE C 1 838  ? 96.916  126.625 106.055 1.00 43.69  ?  710  ILE C CA    1 
ATOM   8870  C  C     . ILE C 1 838  ? 98.148  127.440 105.673 1.00 42.60  ?  710  ILE C C     1 
ATOM   8871  O  O     . ILE C 1 838  ? 98.303  128.592 106.110 1.00 41.65  ?  710  ILE C O     1 
ATOM   8872  C  CB    . ILE C 1 838  ? 95.621  127.357 105.671 1.00 43.07  ?  710  ILE C CB    1 
ATOM   8873  C  CG1   . ILE C 1 838  ? 94.435  126.390 105.685 1.00 42.57  ?  710  ILE C CG1   1 
ATOM   8874  C  CG2   . ILE C 1 838  ? 95.744  127.979 104.288 1.00 44.44  ?  710  ILE C CG2   1 
ATOM   8875  C  CD1   . ILE C 1 838  ? 94.555  125.249 104.694 1.00 40.10  ?  710  ILE C CD1   1 
ATOM   8876  N  N     . ILE C 1 839  ? 99.017  126.841 104.854 1.00 42.95  ?  711  ILE C N     1 
ATOM   8877  C  CA    . ILE C 1 839  ? 100.298 127.428 104.458 1.00 38.02  ?  711  ILE C CA    1 
ATOM   8878  C  C     . ILE C 1 839  ? 100.499 127.227 102.962 1.00 43.78  ?  711  ILE C C     1 
ATOM   8879  O  O     . ILE C 1 839  ? 100.280 126.127 102.447 1.00 46.86  ?  711  ILE C O     1 
ATOM   8880  C  CB    . ILE C 1 839  ? 101.473 126.810 105.243 1.00 34.97  ?  711  ILE C CB    1 
ATOM   8881  C  CG1   . ILE C 1 839  ? 101.628 127.493 106.596 1.00 41.04  ?  711  ILE C CG1   1 
ATOM   8882  C  CG2   . ILE C 1 839  ? 102.769 126.921 104.457 1.00 33.25  ?  711  ILE C CG2   1 
ATOM   8883  C  CD1   . ILE C 1 839  ? 102.274 128.847 106.480 1.00 38.12  ?  711  ILE C CD1   1 
ATOM   8884  N  N     . SER C 1 840  ? 100.919 128.285 102.266 1.00 42.88  ?  712  SER C N     1 
ATOM   8885  C  CA    . SER C 1 840  ? 101.178 128.222 100.830 1.00 43.15  ?  712  SER C CA    1 
ATOM   8886  C  C     . SER C 1 840  ? 102.629 127.806 100.603 1.00 40.98  ?  712  SER C C     1 
ATOM   8887  O  O     . SER C 1 840  ? 103.556 128.569 100.895 1.00 39.56  ?  712  SER C O     1 
ATOM   8888  C  CB    . SER C 1 840  ? 100.878 129.563 100.166 1.00 39.27  ?  712  SER C CB    1 
ATOM   8889  O  OG    . SER C 1 840  ? 101.894 130.515 100.435 1.00 38.29  ?  712  SER C OG    1 
ATOM   8890  N  N     . VAL C 1 841  ? 102.822 126.598 100.078 1.00 42.43  ?  713  VAL C N     1 
ATOM   8891  C  CA    . VAL C 1 841  ? 104.140 126.053 99.786  1.00 42.33  ?  713  VAL C CA    1 
ATOM   8892  C  C     . VAL C 1 841  ? 104.128 125.497 98.367  1.00 49.77  ?  713  VAL C C     1 
ATOM   8893  O  O     . VAL C 1 841  ? 103.127 124.920 97.925  1.00 51.33  ?  713  VAL C O     1 
ATOM   8894  C  CB    . VAL C 1 841  ? 104.537 124.971 100.813 1.00 37.47  ?  713  VAL C CB    1 
ATOM   8895  C  CG1   . VAL C 1 841  ? 103.432 123.944 100.954 1.00 41.41  ?  713  VAL C CG1   1 
ATOM   8896  C  CG2   . VAL C 1 841  ? 105.810 124.294 100.395 1.00 42.56  ?  713  VAL C CG2   1 
ATOM   8897  N  N     . GLY C 1 842  ? 105.231 125.694 97.649  1.00 50.57  ?  714  GLY C N     1 
ATOM   8898  C  CA    . GLY C 1 842  ? 105.307 125.245 96.262  1.00 45.93  ?  714  GLY C CA    1 
ATOM   8899  C  C     . GLY C 1 842  ? 104.145 125.704 95.412  1.00 50.39  ?  714  GLY C C     1 
ATOM   8900  O  O     . GLY C 1 842  ? 103.633 124.936 94.587  1.00 50.09  ?  714  GLY C O     1 
ATOM   8901  N  N     . GLY C 1 843  ? 103.700 126.947 95.609  1.00 54.68  ?  715  GLY C N     1 
ATOM   8902  C  CA    . GLY C 1 843  ? 102.582 127.497 94.875  1.00 55.31  ?  715  GLY C CA    1 
ATOM   8903  C  C     . GLY C 1 843  ? 101.215 127.031 95.324  1.00 57.72  ?  715  GLY C C     1 
ATOM   8904  O  O     . GLY C 1 843  ? 100.227 127.731 95.071  1.00 55.97  ?  715  GLY C O     1 
ATOM   8905  N  N     . LEU C 1 844  ? 101.119 125.881 95.986  1.00 56.37  ?  716  LEU C N     1 
ATOM   8906  C  CA    . LEU C 1 844  ? 99.841  125.334 96.420  1.00 53.09  ?  716  LEU C CA    1 
ATOM   8907  C  C     . LEU C 1 844  ? 99.653  125.611 97.904  1.00 49.76  ?  716  LEU C C     1 
ATOM   8908  O  O     . LEU C 1 844  ? 100.574 125.401 98.700  1.00 50.97  ?  716  LEU C O     1 
ATOM   8909  C  CB    . LEU C 1 844  ? 99.770  123.830 96.149  1.00 50.86  ?  716  LEU C CB    1 
ATOM   8910  C  CG    . LEU C 1 844  ? 99.938  123.390 94.692  1.00 53.07  ?  716  LEU C CG    1 
ATOM   8911  C  CD1   . LEU C 1 844  ? 99.931  121.874 94.573  1.00 68.11  ?  716  LEU C CD1   1 
ATOM   8912  C  CD2   . LEU C 1 844  ? 98.849  123.997 93.826  1.00 58.76  ?  716  LEU C CD2   1 
ATOM   8913  N  N     . LEU C 1 845  ? 98.476  126.101 98.276  1.00 39.66  ?  717  LEU C N     1 
ATOM   8914  C  CA    . LEU C 1 845  ? 98.162  126.233 99.690  1.00 36.72  ?  717  LEU C CA    1 
ATOM   8915  C  C     . LEU C 1 845  ? 97.653  124.894 100.204 1.00 36.31  ?  717  LEU C C     1 
ATOM   8916  O  O     . LEU C 1 845  ? 96.826  124.242 99.556  1.00 38.87  ?  717  LEU C O     1 
ATOM   8917  C  CB    . LEU C 1 845  ? 97.141  127.345 99.929  1.00 36.22  ?  717  LEU C CB    1 
ATOM   8918  C  CG    . LEU C 1 845  ? 95.810  127.348 99.177  1.00 34.32  ?  717  LEU C CG    1 
ATOM   8919  C  CD1   . LEU C 1 845  ? 94.729  126.654 99.991  1.00 37.55  ?  717  LEU C CD1   1 
ATOM   8920  C  CD2   . LEU C 1 845  ? 95.403  128.776 98.843  1.00 31.75  ?  717  LEU C CD2   1 
ATOM   8921  N  N     . ARG C 1 846  ? 98.175  124.469 101.351 1.00 40.79  ?  718  ARG C N     1 
ATOM   8922  C  CA    . ARG C 1 846  ? 97.908  123.137 101.861 1.00 47.74  ?  718  ARG C CA    1 
ATOM   8923  C  C     . ARG C 1 846  ? 97.645  123.199 103.358 1.00 47.78  ?  718  ARG C C     1 
ATOM   8924  O  O     . ARG C 1 846  ? 98.068  124.132 104.055 1.00 43.90  ?  718  ARG C O     1 
ATOM   8925  C  CB    . ARG C 1 846  ? 99.070  122.182 101.555 1.00 47.45  ?  718  ARG C CB    1 
ATOM   8926  C  CG    . ARG C 1 846  ? 99.326  121.987 100.069 1.00 48.84  ?  718  ARG C CG    1 
ATOM   8927  C  CD    . ARG C 1 846  ? 100.710 121.426 99.815  1.00 47.51  ?  718  ARG C CD    1 
ATOM   8928  N  NE    . ARG C 1 846  ? 101.054 121.455 98.397  1.00 47.40  ?  718  ARG C NE    1 
ATOM   8929  C  CZ    . ARG C 1 846  ? 102.296 121.378 97.931  1.00 45.81  ?  718  ARG C CZ    1 
ATOM   8930  N  NH1   . ARG C 1 846  ? 103.315 121.269 98.773  1.00 44.59  ?  718  ARG C NH1   1 
ATOM   8931  N  NH2   . ARG C 1 846  ? 102.522 121.412 96.626  1.00 46.15  ?  718  ARG C NH2   1 
ATOM   8932  N  N     . SER C 1 847  ? 96.937  122.178 103.837 1.00 52.73  ?  719  SER C N     1 
ATOM   8933  C  CA    . SER C 1 847  ? 96.539  122.064 105.231 1.00 51.12  ?  719  SER C CA    1 
ATOM   8934  C  C     . SER C 1 847  ? 97.410  121.038 105.941 1.00 49.66  ?  719  SER C C     1 
ATOM   8935  O  O     . SER C 1 847  ? 97.731  119.980 105.390 1.00 50.62  ?  719  SER C O     1 
ATOM   8936  C  CB    . SER C 1 847  ? 95.065  121.667 105.355 1.00 52.07  ?  719  SER C CB    1 
ATOM   8937  O  OG    . SER C 1 847  ? 94.889  120.270 105.191 1.00 53.16  ?  719  SER C OG    1 
ATOM   8938  N  N     . PHE C 1 848  ? 97.791  121.370 107.166 1.00 47.59  ?  720  PHE C N     1 
ATOM   8939  C  CA    . PHE C 1 848  ? 98.607  120.524 108.017 1.00 41.14  ?  720  PHE C CA    1 
ATOM   8940  C  C     . PHE C 1 848  ? 97.859  120.219 109.304 1.00 38.45  ?  720  PHE C C     1 
ATOM   8941  O  O     . PHE C 1 848  ? 97.069  121.034 109.794 1.00 38.70  ?  720  PHE C O     1 
ATOM   8942  C  CB    . PHE C 1 848  ? 99.944  121.190 108.375 1.00 42.16  ?  720  PHE C CB    1 
ATOM   8943  C  CG    . PHE C 1 848  ? 100.918 121.268 107.238 1.00 40.69  ?  720  PHE C CG    1 
ATOM   8944  C  CD1   . PHE C 1 848  ? 100.745 122.185 106.216 1.00 39.69  ?  720  PHE C CD1   1 
ATOM   8945  C  CD2   . PHE C 1 848  ? 102.023 120.433 107.203 1.00 36.17  ?  720  PHE C CD2   1 
ATOM   8946  C  CE1   . PHE C 1 848  ? 101.650 122.259 105.177 1.00 39.88  ?  720  PHE C CE1   1 
ATOM   8947  C  CE2   . PHE C 1 848  ? 102.929 120.503 106.167 1.00 36.45  ?  720  PHE C CE2   1 
ATOM   8948  C  CZ    . PHE C 1 848  ? 102.743 121.416 105.153 1.00 39.67  ?  720  PHE C CZ    1 
ATOM   8949  N  N     . ARG C 1 849  ? 98.126  119.040 109.844 1.00 38.54  ?  721  ARG C N     1 
ATOM   8950  C  CA    . ARG C 1 849  ? 97.751  118.666 111.196 1.00 37.34  ?  721  ARG C CA    1 
ATOM   8951  C  C     . ARG C 1 849  ? 99.009  118.687 112.059 1.00 28.25  ?  721  ARG C C     1 
ATOM   8952  O  O     . ARG C 1 849  ? 100.106 118.999 111.586 1.00 27.24  ?  721  ARG C O     1 
ATOM   8953  C  CB    . ARG C 1 849  ? 97.074  117.295 111.204 1.00 41.13  ?  721  ARG C CB    1 
ATOM   8954  C  CG    . ARG C 1 849  ? 95.730  117.265 110.489 1.00 45.04  ?  721  ARG C CG    1 
ATOM   8955  C  CD    . ARG C 1 849  ? 94.989  115.979 110.793 1.00 44.52  ?  721  ARG C CD    1 
ATOM   8956  N  NE    . ARG C 1 849  ? 94.862  115.778 112.232 1.00 39.35  ?  721  ARG C NE    1 
ATOM   8957  C  CZ    . ARG C 1 849  ? 94.041  116.478 113.006 1.00 38.10  ?  721  ARG C CZ    1 
ATOM   8958  N  NH1   . ARG C 1 849  ? 93.275  117.423 112.476 1.00 36.70  ?  721  ARG C NH1   1 
ATOM   8959  N  NH2   . ARG C 1 849  ? 93.987  116.235 114.307 1.00 36.01  ?  721  ARG C NH2   1 
ATOM   8960  N  N     . PHE C 1 850  ? 98.854  118.353 113.337 1.00 24.98  ?  722  PHE C N     1 
ATOM   8961  C  CA    . PHE C 1 850  ? 99.992  118.417 114.246 1.00 18.01  ?  722  PHE C CA    1 
ATOM   8962  C  C     . PHE C 1 850  ? 99.783  117.460 115.404 1.00 14.33  ?  722  PHE C C     1 
ATOM   8963  O  O     . PHE C 1 850  ? 98.698  117.423 115.993 1.00 16.79  ?  722  PHE C O     1 
ATOM   8964  C  CB    . PHE C 1 850  ? 100.191 119.838 114.784 1.00 15.26  ?  722  PHE C CB    1 
ATOM   8965  C  CG    . PHE C 1 850  ? 100.970 120.733 113.869 1.00 14.29  ?  722  PHE C CG    1 
ATOM   8966  C  CD1   . PHE C 1 850  ? 102.341 120.598 113.745 1.00 14.36  ?  722  PHE C CD1   1 
ATOM   8967  C  CD2   . PHE C 1 850  ? 100.330 121.718 113.140 1.00 17.41  ?  722  PHE C CD2   1 
ATOM   8968  C  CE1   . PHE C 1 850  ? 103.056 121.429 112.907 1.00 15.70  ?  722  PHE C CE1   1 
ATOM   8969  C  CE2   . PHE C 1 850  ? 101.041 122.548 112.301 1.00 17.49  ?  722  PHE C CE2   1 
ATOM   8970  C  CZ    . PHE C 1 850  ? 102.405 122.403 112.184 1.00 16.13  ?  722  PHE C CZ    1 
ATOM   8971  N  N     . PHE C 1 851  ? 100.822 116.695 115.724 1.00 16.25  ?  723  PHE C N     1 
ATOM   8972  C  CA    . PHE C 1 851  ? 100.900 115.962 116.976 1.00 17.46  ?  723  PHE C CA    1 
ATOM   8973  C  C     . PHE C 1 851  ? 102.120 116.450 117.743 1.00 12.49  ?  723  PHE C C     1 
ATOM   8974  O  O     . PHE C 1 851  ? 103.132 116.839 117.149 1.00 12.79  ?  723  PHE C O     1 
ATOM   8975  C  CB    . PHE C 1 851  ? 100.987 114.448 116.747 1.00 18.66  ?  723  PHE C CB    1 
ATOM   8976  C  CG    . PHE C 1 851  ? 99.814  113.881 116.000 1.00 25.54  ?  723  PHE C CG    1 
ATOM   8977  C  CD1   . PHE C 1 851  ? 98.551  114.432 116.141 1.00 27.82  ?  723  PHE C CD1   1 
ATOM   8978  C  CD2   . PHE C 1 851  ? 99.977  112.802 115.149 1.00 29.18  ?  723  PHE C CD2   1 
ATOM   8979  C  CE1   . PHE C 1 851  ? 97.472  113.918 115.449 1.00 32.76  ?  723  PHE C CE1   1 
ATOM   8980  C  CE2   . PHE C 1 851  ? 98.901  112.281 114.455 1.00 36.13  ?  723  PHE C CE2   1 
ATOM   8981  C  CZ    . PHE C 1 851  ? 97.646  112.840 114.606 1.00 39.00  ?  723  PHE C CZ    1 
ATOM   8982  N  N     . PHE C 1 852  ? 102.015 116.434 119.071 1.00 9.92   ?  724  PHE C N     1 
ATOM   8983  C  CA    . PHE C 1 852  ? 103.053 116.973 119.949 1.00 8.85   ?  724  PHE C CA    1 
ATOM   8984  C  C     . PHE C 1 852  ? 103.457 115.887 120.939 1.00 10.42  ?  724  PHE C C     1 
ATOM   8985  O  O     . PHE C 1 852  ? 102.880 115.767 122.024 1.00 12.97  ?  724  PHE C O     1 
ATOM   8986  C  CB    . PHE C 1 852  ? 102.572 118.236 120.652 1.00 9.20   ?  724  PHE C CB    1 
ATOM   8987  C  CG    . PHE C 1 852  ? 102.541 119.441 119.760 1.00 13.39  ?  724  PHE C CG    1 
ATOM   8988  C  CD1   . PHE C 1 852  ? 103.673 120.218 119.589 1.00 15.30  ?  724  PHE C CD1   1 
ATOM   8989  C  CD2   . PHE C 1 852  ? 101.384 119.794 119.089 1.00 16.30  ?  724  PHE C CD2   1 
ATOM   8990  C  CE1   . PHE C 1 852  ? 103.652 121.325 118.766 1.00 10.63  ?  724  PHE C CE1   1 
ATOM   8991  C  CE2   . PHE C 1 852  ? 101.360 120.902 118.266 1.00 12.90  ?  724  PHE C CE2   1 
ATOM   8992  C  CZ    . PHE C 1 852  ? 102.496 121.668 118.105 1.00 11.04  ?  724  PHE C CZ    1 
ATOM   8993  N  N     . ARG C 1 853  ? 104.453 115.092 120.551 1.00 10.82  ?  725  ARG C N     1 
ATOM   8994  C  CA    . ARG C 1 853  ? 104.986 114.038 121.410 1.00 10.90  ?  725  ARG C CA    1 
ATOM   8995  C  C     . ARG C 1 853  ? 106.096 114.646 122.261 1.00 9.58   ?  725  ARG C C     1 
ATOM   8996  O  O     . ARG C 1 853  ? 107.290 114.485 121.999 1.00 10.87  ?  725  ARG C O     1 
ATOM   8997  C  CB    . ARG C 1 853  ? 105.492 112.870 120.577 1.00 14.61  ?  725  ARG C CB    1 
ATOM   8998  C  CG    . ARG C 1 853  ? 104.481 112.307 119.601 1.00 19.88  ?  725  ARG C CG    1 
ATOM   8999  C  CD    . ARG C 1 853  ? 103.497 111.390 120.300 1.00 33.99  ?  725  ARG C CD    1 
ATOM   9000  N  NE    . ARG C 1 853  ? 102.522 110.832 119.369 1.00 44.58  ?  725  ARG C NE    1 
ATOM   9001  C  CZ    . ARG C 1 853  ? 102.727 109.743 118.634 1.00 47.43  ?  725  ARG C CZ    1 
ATOM   9002  N  NH1   . ARG C 1 853  ? 103.878 109.087 118.720 1.00 39.50  ?  725  ARG C NH1   1 
ATOM   9003  N  NH2   . ARG C 1 853  ? 101.780 109.309 117.814 1.00 45.87  ?  725  ARG C NH2   1 
ATOM   9004  N  N     . GLY C 1 854  ? 105.682 115.379 123.291 1.00 8.42   ?  726  GLY C N     1 
ATOM   9005  C  CA    . GLY C 1 854  ? 106.632 116.003 124.190 1.00 10.11  ?  726  GLY C CA    1 
ATOM   9006  C  C     . GLY C 1 854  ? 107.420 114.952 124.947 1.00 11.22  ?  726  GLY C C     1 
ATOM   9007  O  O     . GLY C 1 854  ? 106.835 114.135 125.677 1.00 16.51  ?  726  GLY C O     1 
ATOM   9008  N  N     . THR C 1 855  ? 108.740 114.947 124.777 1.00 8.55   ?  727  THR C N     1 
ATOM   9009  C  CA    . THR C 1 855  ? 109.592 113.962 125.431 1.00 8.96   ?  727  THR C CA    1 
ATOM   9010  C  C     . THR C 1 855  ? 110.795 114.607 126.098 1.00 10.38  ?  727  THR C C     1 
ATOM   9011  O  O     . THR C 1 855  ? 111.349 114.064 127.061 1.00 11.22  ?  727  THR C O     1 
ATOM   9012  C  CB    . THR C 1 855  ? 110.092 112.929 124.427 1.00 10.01  ?  727  THR C CB    1 
ATOM   9013  O  OG1   . THR C 1 855  ? 111.169 112.191 125.016 1.00 12.68  ?  727  THR C OG1   1 
ATOM   9014  C  CG2   . THR C 1 855  ? 110.603 113.619 123.185 1.00 16.77  ?  727  THR C CG2   1 
ATOM   9015  N  N     . GLY C 1 856  ? 111.202 115.763 125.587 1.00 12.04  ?  728  GLY C N     1 
ATOM   9016  C  CA    . GLY C 1 856  ? 112.497 116.313 125.919 1.00 13.01  ?  728  GLY C CA    1 
ATOM   9017  C  C     . GLY C 1 856  ? 112.568 116.844 127.328 1.00 8.89   ?  728  GLY C C     1 
ATOM   9018  O  O     . GLY C 1 856  ? 112.674 118.053 127.552 1.00 7.59   ?  728  GLY C O     1 
ATOM   9019  N  N     . TYR C 1 857  ? 112.498 115.938 128.293 1.00 9.57   ?  729  TYR C N     1 
ATOM   9020  C  CA    . TYR C 1 857  ? 112.638 116.303 129.688 1.00 11.93  ?  729  TYR C CA    1 
ATOM   9021  C  C     . TYR C 1 857  ? 113.425 115.221 130.404 1.00 16.85  ?  729  TYR C C     1 
ATOM   9022  O  O     . TYR C 1 857  ? 113.280 114.032 130.106 1.00 18.74  ?  729  TYR C O     1 
ATOM   9023  C  CB    . TYR C 1 857  ? 111.280 116.483 130.373 1.00 11.03  ?  729  TYR C CB    1 
ATOM   9024  C  CG    . TYR C 1 857  ? 110.281 117.337 129.626 1.00 8.05   ?  729  TYR C CG    1 
ATOM   9025  C  CD1   . TYR C 1 857  ? 109.445 116.784 128.666 1.00 8.15   ?  729  TYR C CD1   1 
ATOM   9026  C  CD2   . TYR C 1 857  ? 110.154 118.690 129.903 1.00 7.84   ?  729  TYR C CD2   1 
ATOM   9027  C  CE1   . TYR C 1 857  ? 108.521 117.557 127.994 1.00 7.79   ?  729  TYR C CE1   1 
ATOM   9028  C  CE2   . TYR C 1 857  ? 109.234 119.471 129.236 1.00 8.96   ?  729  TYR C CE2   1 
ATOM   9029  C  CZ    . TYR C 1 857  ? 108.419 118.900 128.284 1.00 9.20   ?  729  TYR C CZ    1 
ATOM   9030  O  OH    . TYR C 1 857  ? 107.500 119.677 127.617 1.00 13.45  ?  729  TYR C OH    1 
ATOM   9031  N  N     . ASP C 1 858  ? 114.268 115.645 131.337 1.00 28.02  ?  730  ASP C N     1 
ATOM   9032  C  CA    . ASP C 1 858  ? 114.862 114.711 132.273 1.00 34.39  ?  730  ASP C CA    1 
ATOM   9033  C  C     . ASP C 1 858  ? 113.856 114.381 133.370 1.00 31.97  ?  730  ASP C C     1 
ATOM   9034  O  O     . ASP C 1 858  ? 112.859 115.082 133.566 1.00 30.34  ?  730  ASP C O     1 
ATOM   9035  C  CB    . ASP C 1 858  ? 116.144 115.288 132.872 1.00 49.20  ?  730  ASP C CB    1 
ATOM   9036  C  CG    . ASP C 1 858  ? 116.012 116.758 133.217 1.00 66.46  ?  730  ASP C CG    1 
ATOM   9037  O  OD1   . ASP C 1 858  ? 114.939 117.342 132.952 1.00 51.28  ?  730  ASP C OD1   1 
ATOM   9038  O  OD2   . ASP C 1 858  ? 116.983 117.329 133.754 1.00 134.01 -1 730  ASP C OD2   1 
ATOM   9039  N  N     . GLU C 1 859  ? 114.139 113.295 134.093 1.00 35.77  ?  731  GLU C N     1 
ATOM   9040  C  CA    . GLU C 1 859  ? 113.191 112.751 135.063 1.00 32.93  ?  731  GLU C CA    1 
ATOM   9041  C  C     . GLU C 1 859  ? 112.697 113.811 136.041 1.00 27.51  ?  731  GLU C C     1 
ATOM   9042  O  O     . GLU C 1 859  ? 111.504 113.859 136.368 1.00 27.27  ?  731  GLU C O     1 
ATOM   9043  C  CB    . GLU C 1 859  ? 113.842 111.597 135.826 1.00 46.50  ?  731  GLU C CB    1 
ATOM   9044  C  CG    . GLU C 1 859  ? 114.593 110.608 134.943 1.00 71.27  ?  731  GLU C CG    1 
ATOM   9045  C  CD    . GLU C 1 859  ? 116.023 111.044 134.658 1.00 98.63  ?  731  GLU C CD    1 
ATOM   9046  O  OE1   . GLU C 1 859  ? 116.366 112.207 134.962 1.00 77.44  ?  731  GLU C OE1   1 
ATOM   9047  O  OE2   . GLU C 1 859  ? 116.805 110.227 134.127 1.00 174.54 -1 731  GLU C OE2   1 
ATOM   9048  N  N     . LYS C 1 860  ? 113.602 114.667 136.521 1.00 28.26  ?  732  LYS C N     1 
ATOM   9049  C  CA    . LYS C 1 860  ? 113.231 115.678 137.507 1.00 16.10  ?  732  LYS C CA    1 
ATOM   9050  C  C     . LYS C 1 860  ? 112.145 116.603 136.972 1.00 16.82  ?  732  LYS C C     1 
ATOM   9051  O  O     . LYS C 1 860  ? 111.105 116.804 137.614 1.00 18.74  ?  732  LYS C O     1 
ATOM   9052  C  CB    . LYS C 1 860  ? 114.468 116.478 137.908 1.00 13.08  ?  732  LYS C CB    1 
ATOM   9053  C  CG    . LYS C 1 860  ? 114.208 117.570 138.921 1.00 17.25  ?  732  LYS C CG    1 
ATOM   9054  C  CD    . LYS C 1 860  ? 115.510 118.250 139.289 1.00 12.58  ?  732  LYS C CD    1 
ATOM   9055  C  CE    . LYS C 1 860  ? 115.297 119.376 140.276 1.00 9.08   ?  732  LYS C CE    1 
ATOM   9056  N  NZ    . LYS C 1 860  ? 116.598 119.995 140.641 1.00 10.82  ?  732  LYS C NZ    1 
ATOM   9057  N  N     . MET C 1 861  ? 112.376 117.185 135.794 1.00 16.56  ?  733  MET C N     1 
ATOM   9058  C  CA    . MET C 1 861  ? 111.361 118.045 135.202 1.00 17.39  ?  733  MET C CA    1 
ATOM   9059  C  C     . MET C 1 861  ? 110.123 117.254 134.813 1.00 16.31  ?  733  MET C C     1 
ATOM   9060  O  O     . MET C 1 861  ? 109.007 117.780 134.888 1.00 18.01  ?  733  MET C O     1 
ATOM   9061  C  CB    . MET C 1 861  ? 111.933 118.775 133.992 1.00 16.94  ?  733  MET C CB    1 
ATOM   9062  C  CG    . MET C 1 861  ? 110.952 119.718 133.332 1.00 18.24  ?  733  MET C CG    1 
ATOM   9063  S  SD    . MET C 1 861  ? 111.700 121.306 132.940 1.00 23.63  ?  733  MET C SD    1 
ATOM   9064  C  CE    . MET C 1 861  ? 112.125 121.877 134.582 1.00 24.68  ?  733  MET C CE    1 
ATOM   9065  N  N     . VAL C 1 862  ? 110.299 115.996 134.397 1.00 18.07  ?  734  VAL C N     1 
ATOM   9066  C  CA    . VAL C 1 862  ? 109.152 115.132 134.121 1.00 20.43  ?  734  VAL C CA    1 
ATOM   9067  C  C     . VAL C 1 862  ? 108.220 115.103 135.322 1.00 20.65  ?  734  VAL C C     1 
ATOM   9068  O  O     . VAL C 1 862  ? 107.004 115.281 135.196 1.00 21.52  ?  734  VAL C O     1 
ATOM   9069  C  CB    . VAL C 1 862  ? 109.620 113.714 133.746 1.00 22.18  ?  734  VAL C CB    1 
ATOM   9070  C  CG1   . VAL C 1 862  ? 108.468 112.730 133.868 1.00 22.89  ?  734  VAL C CG1   1 
ATOM   9071  C  CG2   . VAL C 1 862  ? 110.182 113.694 132.341 1.00 25.90  ?  734  VAL C CG2   1 
ATOM   9072  N  N     . ARG C 1 863  ? 108.784 114.887 136.511 1.00 25.58  ?  735  ARG C N     1 
ATOM   9073  C  CA    . ARG C 1 863  ? 107.965 114.843 137.718 1.00 30.03  ?  735  ARG C CA    1 
ATOM   9074  C  C     . ARG C 1 863  ? 107.381 116.212 138.034 1.00 25.55  ?  735  ARG C C     1 
ATOM   9075  O  O     . ARG C 1 863  ? 106.184 116.334 138.322 1.00 26.68  ?  735  ARG C O     1 
ATOM   9076  C  CB    . ARG C 1 863  ? 108.790 114.333 138.899 1.00 37.82  ?  735  ARG C CB    1 
ATOM   9077  C  CG    . ARG C 1 863  ? 109.290 112.911 138.749 1.00 42.93  ?  735  ARG C CG    1 
ATOM   9078  C  CD    . ARG C 1 863  ? 108.296 111.894 139.274 1.00 39.85  ?  735  ARG C CD    1 
ATOM   9079  N  NE    . ARG C 1 863  ? 108.846 110.545 139.195 1.00 46.19  ?  735  ARG C NE    1 
ATOM   9080  C  CZ    . ARG C 1 863  ? 109.875 110.117 139.921 1.00 50.95  ?  735  ARG C CZ    1 
ATOM   9081  N  NH1   . ARG C 1 863  ? 110.464 110.930 140.788 1.00 53.04  ?  735  ARG C NH1   1 
ATOM   9082  N  NH2   . ARG C 1 863  ? 110.315 108.874 139.780 1.00 53.60  ?  735  ARG C NH2   1 
ATOM   9083  N  N     . GLU C 1 864  ? 108.215 117.257 137.990 1.00 22.07  ?  736  GLU C N     1 
ATOM   9084  C  CA    . GLU C 1 864  ? 107.742 118.589 138.359 1.00 18.71  ?  736  GLU C CA    1 
ATOM   9085  C  C     . GLU C 1 864  ? 106.570 119.025 137.494 1.00 19.16  ?  736  GLU C C     1 
ATOM   9086  O  O     . GLU C 1 864  ? 105.628 119.661 137.982 1.00 20.18  ?  736  GLU C O     1 
ATOM   9087  C  CB    . GLU C 1 864  ? 108.873 119.606 138.258 1.00 21.44  ?  736  GLU C CB    1 
ATOM   9088  C  CG    . GLU C 1 864  ? 109.578 119.859 139.568 1.00 30.18  ?  736  GLU C CG    1 
ATOM   9089  C  CD    . GLU C 1 864  ? 110.466 121.078 139.505 1.00 51.24  ?  736  GLU C CD    1 
ATOM   9090  O  OE1   . GLU C 1 864  ? 110.377 121.823 138.506 1.00 43.31  ?  736  GLU C OE1   1 
ATOM   9091  O  OE2   . GLU C 1 864  ? 111.249 121.296 140.452 1.00 138.22 -1 736  GLU C OE2   1 
ATOM   9092  N  N     . MET C 1 865  ? 106.609 118.697 136.204 1.00 20.77  ?  737  MET C N     1 
ATOM   9093  C  CA    . MET C 1 865  ? 105.482 119.001 135.336 1.00 21.08  ?  737  MET C CA    1 
ATOM   9094  C  C     . MET C 1 865  ? 104.337 118.024 135.545 1.00 23.51  ?  737  MET C C     1 
ATOM   9095  O  O     . MET C 1 865  ? 103.169 118.409 135.426 1.00 22.84  ?  737  MET C O     1 
ATOM   9096  C  CB    . MET C 1 865  ? 105.926 118.982 133.874 1.00 25.34  ?  737  MET C CB    1 
ATOM   9097  C  CG    . MET C 1 865  ? 107.057 119.947 133.562 1.00 30.42  ?  737  MET C CG    1 
ATOM   9098  S  SD    . MET C 1 865  ? 106.627 121.657 133.939 1.00 40.03  ?  737  MET C SD    1 
ATOM   9099  C  CE    . MET C 1 865  ? 108.163 122.505 133.585 1.00 27.83  ?  737  MET C CE    1 
ATOM   9100  N  N     . GLU C 1 866  ? 104.651 116.771 135.867 1.00 22.43  ?  738  GLU C N     1 
ATOM   9101  C  CA    . GLU C 1 866  ? 103.628 115.749 136.008 1.00 23.10  ?  738  GLU C CA    1 
ATOM   9102  C  C     . GLU C 1 866  ? 102.962 115.783 137.375 1.00 25.30  ?  738  GLU C C     1 
ATOM   9103  O  O     . GLU C 1 866  ? 101.852 115.261 137.525 1.00 30.20  ?  738  GLU C O     1 
ATOM   9104  C  CB    . GLU C 1 866  ? 104.236 114.370 135.751 1.00 26.76  ?  738  GLU C CB    1 
ATOM   9105  C  CG    . GLU C 1 866  ? 103.198 113.296 135.548 1.00 41.87  ?  738  GLU C CG    1 
ATOM   9106  C  CD    . GLU C 1 866  ? 102.046 113.793 134.700 1.00 57.23  ?  738  GLU C CD    1 
ATOM   9107  O  OE1   . GLU C 1 866  ? 102.205 113.876 133.464 1.00 46.10  ?  738  GLU C OE1   1 
ATOM   9108  O  OE2   . GLU C 1 866  ? 100.986 114.122 135.274 1.00 188.83 -1 738  GLU C OE2   1 
ATOM   9109  N  N     . GLY C 1 867  ? 103.610 116.385 138.373 1.00 27.97  ?  739  GLY C N     1 
ATOM   9110  C  CA    . GLY C 1 867  ? 103.023 116.610 139.675 1.00 26.29  ?  739  GLY C CA    1 
ATOM   9111  C  C     . GLY C 1 867  ? 103.545 115.686 140.755 1.00 26.32  ?  739  GLY C C     1 
ATOM   9112  O  O     . GLY C 1 867  ? 103.499 116.046 141.939 1.00 25.60  ?  739  GLY C O     1 
ATOM   9113  N  N     . LEU C 1 868  ? 104.034 114.508 140.379 1.00 28.57  ?  740  LEU C N     1 
ATOM   9114  C  CA    . LEU C 1 868  ? 104.549 113.570 141.362 1.00 31.84  ?  740  LEU C CA    1 
ATOM   9115  C  C     . LEU C 1 868  ? 105.733 114.177 142.110 1.00 33.61  ?  740  LEU C C     1 
ATOM   9116  O  O     . LEU C 1 868  ? 106.419 115.081 141.624 1.00 30.02  ?  740  LEU C O     1 
ATOM   9117  C  CB    . LEU C 1 868  ? 104.966 112.266 140.686 1.00 32.19  ?  740  LEU C CB    1 
ATOM   9118  C  CG    . LEU C 1 868  ? 103.901 111.632 139.791 1.00 30.91  ?  740  LEU C CG    1 
ATOM   9119  C  CD1   . LEU C 1 868  ? 104.391 110.315 139.213 1.00 29.05  ?  740  LEU C CD1   1 
ATOM   9120  C  CD2   . LEU C 1 868  ? 102.606 111.437 140.564 1.00 32.64  ?  740  LEU C CD2   1 
ATOM   9121  N  N     . GLU C 1 869  ? 105.961 113.668 143.317 1.00 38.67  ?  741  GLU C N     1 
ATOM   9122  C  CA    . GLU C 1 869  ? 107.101 114.090 144.112 1.00 42.67  ?  741  GLU C CA    1 
ATOM   9123  C  C     . GLU C 1 869  ? 108.404 113.741 143.393 1.00 44.67  ?  741  GLU C C     1 
ATOM   9124  O  O     . GLU C 1 869  ? 108.429 113.018 142.393 1.00 45.38  ?  741  GLU C O     1 
ATOM   9125  C  CB    . GLU C 1 869  ? 107.058 113.437 145.493 1.00 52.10  ?  741  GLU C CB    1 
ATOM   9126  C  CG    . GLU C 1 869  ? 107.017 111.908 145.479 1.00 62.68  ?  741  GLU C CG    1 
ATOM   9127  C  CD    . GLU C 1 869  ? 105.632 111.336 145.215 1.00 72.96  ?  741  GLU C CD    1 
ATOM   9128  O  OE1   . GLU C 1 869  ? 104.916 111.875 144.346 1.00 55.86  ?  741  GLU C OE1   1 
ATOM   9129  O  OE2   . GLU C 1 869  ? 105.262 110.339 145.871 1.00 154.52 -1 741  GLU C OE2   1 
ATOM   9130  N  N     . ALA C 1 870  ? 109.503 114.270 143.922 1.00 48.02  ?  742  ALA C N     1 
ATOM   9131  C  CA    . ALA C 1 870  ? 110.802 114.117 143.286 1.00 52.89  ?  742  ALA C CA    1 
ATOM   9132  C  C     . ALA C 1 870  ? 111.879 114.345 144.336 1.00 64.95  ?  742  ALA C C     1 
ATOM   9133  O  O     . ALA C 1 870  ? 111.712 115.187 145.222 1.00 74.16  ?  742  ALA C O     1 
ATOM   9134  C  CB    . ALA C 1 870  ? 110.963 115.100 142.119 1.00 51.51  ?  742  ALA C CB    1 
ATOM   9135  N  N     . SER C 1 871  ? 112.977 113.598 144.236 1.00 67.01  ?  743  SER C N     1 
ATOM   9136  C  CA    . SER C 1 871  ? 113.176 112.620 143.169 1.00 69.22  ?  743  SER C CA    1 
ATOM   9137  C  C     . SER C 1 871  ? 113.250 111.197 143.715 1.00 69.99  ?  743  SER C C     1 
ATOM   9138  O  O     . SER C 1 871  ? 112.633 110.283 143.166 1.00 63.38  ?  743  SER C O     1 
ATOM   9139  C  CB    . SER C 1 871  ? 114.446 112.950 142.381 1.00 79.66  ?  743  SER C CB    1 
ATOM   9140  O  OG    . SER C 1 871  ? 114.694 111.979 141.381 1.00 85.12  ?  743  SER C OG    1 
ATOM   9141  N  N     . GLY C 1 872  ? 113.999 111.016 144.802 1.00 71.28  ?  744  GLY C N     1 
ATOM   9142  C  CA    . GLY C 1 872  ? 114.162 109.707 145.408 1.00 67.44  ?  744  GLY C CA    1 
ATOM   9143  C  C     . GLY C 1 872  ? 112.906 109.244 146.114 1.00 57.54  ?  744  GLY C C     1 
ATOM   9144  O  O     . GLY C 1 872  ? 112.919 108.939 147.311 1.00 61.33  ?  744  GLY C O     1 
ATOM   9145  N  N     . SER C 1 873  ? 111.812 109.182 145.363 1.00 52.18  ?  745  SER C N     1 
ATOM   9146  C  CA    . SER C 1 873  ? 110.500 108.877 145.910 1.00 47.42  ?  745  SER C CA    1 
ATOM   9147  C  C     . SER C 1 873  ? 110.384 107.381 146.182 1.00 43.59  ?  745  SER C C     1 
ATOM   9148  O  O     . SER C 1 873  ? 111.337 106.611 146.039 1.00 48.05  ?  745  SER C O     1 
ATOM   9149  C  CB    . SER C 1 873  ? 109.414 109.349 144.949 1.00 53.15  ?  745  SER C CB    1 
ATOM   9150  O  OG    . SER C 1 873  ? 109.745 110.605 144.388 1.00 54.42  ?  745  SER C OG    1 
ATOM   9151  N  N     . THR C 1 874  ? 109.188 106.960 146.581 1.00 44.93  ?  746  THR C N     1 
ATOM   9152  C  CA    . THR C 1 874  ? 108.859 105.553 146.700 1.00 48.71  ?  746  THR C CA    1 
ATOM   9153  C  C     . THR C 1 874  ? 107.933 105.088 145.585 1.00 53.34  ?  746  THR C C     1 
ATOM   9154  O  O     . THR C 1 874  ? 107.686 103.883 145.462 1.00 57.92  ?  746  THR C O     1 
ATOM   9155  C  CB    . THR C 1 874  ? 108.224 105.282 148.073 1.00 51.82  ?  746  THR C CB    1 
ATOM   9156  O  OG1   . THR C 1 874  ? 108.907 106.062 149.063 1.00 53.91  ?  746  THR C OG1   1 
ATOM   9157  C  CG2   . THR C 1 874  ? 108.351 103.815 148.448 1.00 54.93  ?  746  THR C CG2   1 
ATOM   9158  N  N     . TYR C 1 875  ? 107.426 106.012 144.766 1.00 52.48  ?  747  TYR C N     1 
ATOM   9159  C  CA    . TYR C 1 875  ? 106.664 105.680 143.565 1.00 53.39  ?  747  TYR C CA    1 
ATOM   9160  C  C     . TYR C 1 875  ? 107.593 105.828 142.365 1.00 54.32  ?  747  TYR C C     1 
ATOM   9161  O  O     . TYR C 1 875  ? 107.561 106.815 141.629 1.00 53.05  ?  747  TYR C O     1 
ATOM   9162  C  CB    . TYR C 1 875  ? 105.434 106.564 143.455 1.00 49.09  ?  747  TYR C CB    1 
ATOM   9163  C  CG    . TYR C 1 875  ? 104.366 106.111 144.399 1.00 52.12  ?  747  TYR C CG    1 
ATOM   9164  C  CD1   . TYR C 1 875  ? 104.398 106.480 145.735 1.00 56.42  ?  747  TYR C CD1   1 
ATOM   9165  C  CD2   . TYR C 1 875  ? 103.358 105.264 143.973 1.00 55.26  ?  747  TYR C CD2   1 
ATOM   9166  C  CE1   . TYR C 1 875  ? 103.434 106.047 146.612 1.00 66.00  ?  747  TYR C CE1   1 
ATOM   9167  C  CE2   . TYR C 1 875  ? 102.393 104.821 144.842 1.00 59.57  ?  747  TYR C CE2   1 
ATOM   9168  C  CZ    . TYR C 1 875  ? 102.432 105.218 146.160 1.00 68.68  ?  747  TYR C CZ    1 
ATOM   9169  O  OH    . TYR C 1 875  ? 101.466 104.779 147.030 1.00 78.26  ?  747  TYR C OH    1 
ATOM   9170  N  N     . ILE C 1 876  ? 108.427 104.804 142.170 1.00 55.62  ?  748  ILE C N     1 
ATOM   9171  C  CA    . ILE C 1 876  ? 109.545 104.901 141.234 1.00 54.32  ?  748  ILE C CA    1 
ATOM   9172  C  C     . ILE C 1 876  ? 109.045 105.158 139.817 1.00 48.48  ?  748  ILE C C     1 
ATOM   9173  O  O     . ILE C 1 876  ? 109.400 106.161 139.186 1.00 49.48  ?  748  ILE C O     1 
ATOM   9174  C  CB    . ILE C 1 876  ? 110.413 103.633 141.301 1.00 60.24  ?  748  ILE C CB    1 
ATOM   9175  C  CG1   . ILE C 1 876  ? 109.537 102.390 141.497 1.00 63.20  ?  748  ILE C CG1   1 
ATOM   9176  C  CG2   . ILE C 1 876  ? 111.445 103.758 142.408 1.00 58.67  ?  748  ILE C CG2   1 
ATOM   9177  C  CD1   . ILE C 1 876  ? 110.300 101.081 141.437 1.00 69.74  ?  748  ILE C CD1   1 
ATOM   9178  N  N     . CYS C 1 877  ? 108.215 104.257 139.300 1.00 43.27  ?  749  CYS C N     1 
ATOM   9179  C  CA    . CYS C 1 877  ? 107.866 104.295 137.889 1.00 42.65  ?  749  CYS C CA    1 
ATOM   9180  C  C     . CYS C 1 877  ? 107.120 105.576 137.536 1.00 43.44  ?  749  CYS C C     1 
ATOM   9181  O  O     . CYS C 1 877  ? 106.397 106.151 138.355 1.00 42.81  ?  749  CYS C O     1 
ATOM   9182  C  CB    . CYS C 1 877  ? 107.010 103.092 137.515 1.00 43.57  ?  749  CYS C CB    1 
ATOM   9183  S  SG    . CYS C 1 877  ? 106.629 103.029 135.755 1.00 42.97  ?  749  CYS C SG    1 
ATOM   9184  N  N     . THR C 1 878  ? 107.312 106.021 136.296 1.00 42.40  ?  750  THR C N     1 
ATOM   9185  C  CA    . THR C 1 878  ? 106.569 107.140 135.739 1.00 39.05  ?  750  THR C CA    1 
ATOM   9186  C  C     . THR C 1 878  ? 105.414 106.687 134.853 1.00 39.02  ?  750  THR C C     1 
ATOM   9187  O  O     . THR C 1 878  ? 104.624 107.527 134.409 1.00 37.61  ?  750  THR C O     1 
ATOM   9188  C  CB    . THR C 1 878  ? 107.513 108.051 134.935 1.00 33.62  ?  750  THR C CB    1 
ATOM   9189  O  OG1   . THR C 1 878  ? 108.805 108.072 135.555 1.00 31.33  ?  750  THR C OG1   1 
ATOM   9190  C  CG2   . THR C 1 878  ? 106.980 109.472 134.891 1.00 33.84  ?  750  THR C CG2   1 
ATOM   9191  N  N     . LEU C 1 879  ? 105.288 105.382 134.607 1.00 42.35  ?  751  LEU C N     1 
ATOM   9192  C  CA    . LEU C 1 879  ? 104.292 104.824 133.699 1.00 45.96  ?  751  LEU C CA    1 
ATOM   9193  C  C     . LEU C 1 879  ? 103.333 103.871 134.393 1.00 51.74  ?  751  LEU C C     1 
ATOM   9194  O  O     . LEU C 1 879  ? 102.116 103.971 134.195 1.00 55.17  ?  751  LEU C O     1 
ATOM   9195  C  CB    . LEU C 1 879  ? 104.989 104.100 132.533 1.00 42.09  ?  751  LEU C CB    1 
ATOM   9196  C  CG    . LEU C 1 879  ? 106.145 104.826 131.837 1.00 39.14  ?  751  LEU C CG    1 
ATOM   9197  C  CD1   . LEU C 1 879  ? 107.478 104.568 132.530 1.00 38.28  ?  751  LEU C CD1   1 
ATOM   9198  C  CD2   . LEU C 1 879  ? 106.226 104.416 130.384 1.00 40.44  ?  751  LEU C CD2   1 
ATOM   9199  N  N     . CYS C 1 880  ? 103.843 102.933 135.187 1.00 54.21  ?  752  CYS C N     1 
ATOM   9200  C  CA    . CYS C 1 880  ? 103.000 102.039 135.965 1.00 59.14  ?  752  CYS C CA    1 
ATOM   9201  C  C     . CYS C 1 880  ? 102.658 102.721 137.289 1.00 55.41  ?  752  CYS C C     1 
ATOM   9202  O  O     . CYS C 1 880  ? 102.898 103.917 137.474 1.00 56.51  ?  752  CYS C O     1 
ATOM   9203  C  CB    . CYS C 1 880  ? 103.692 100.690 136.164 1.00 66.19  ?  752  CYS C CB    1 
ATOM   9204  S  SG    . CYS C 1 880  ? 102.742 99.480  137.124 1.00 64.74  ?  752  CYS C SG    1 
ATOM   9205  N  N     . ASP C 1 881  ? 102.079 101.972 138.226 1.00 51.53  ?  753  ASP C N     1 
ATOM   9206  C  CA    . ASP C 1 881  ? 101.775 102.499 139.551 1.00 52.06  ?  753  ASP C CA    1 
ATOM   9207  C  C     . ASP C 1 881  ? 102.565 101.788 140.641 1.00 50.51  ?  753  ASP C C     1 
ATOM   9208  O  O     . ASP C 1 881  ? 102.262 101.959 141.829 1.00 54.55  ?  753  ASP C O     1 
ATOM   9209  C  CB    . ASP C 1 881  ? 100.273 102.399 139.837 1.00 63.50  ?  753  ASP C CB    1 
ATOM   9210  C  CG    . ASP C 1 881  ? 99.434  103.109 138.790 1.00 75.94  ?  753  ASP C CG    1 
ATOM   9211  O  OD1   . ASP C 1 881  ? 99.591  102.792 137.593 1.00 69.55  ?  753  ASP C OD1   1 
ATOM   9212  O  OD2   . ASP C 1 881  ? 98.621  103.985 139.159 1.00 118.01 -1 753  ASP C OD2   1 
ATOM   9213  N  N     . SER C 1 882  ? 103.573 101.007 140.268 1.00 54.35  ?  754  SER C N     1 
ATOM   9214  C  CA    . SER C 1 882  ? 104.288 100.195 141.239 1.00 68.16  ?  754  SER C CA    1 
ATOM   9215  C  C     . SER C 1 882  ? 105.190 101.050 142.119 1.00 63.80  ?  754  SER C C     1 
ATOM   9216  O  O     . SER C 1 882  ? 105.771 102.044 141.671 1.00 57.96  ?  754  SER C O     1 
ATOM   9217  C  CB    . SER C 1 882  ? 105.113 99.125  140.527 1.00 76.38  ?  754  SER C CB    1 
ATOM   9218  O  OG    . SER C 1 882  ? 104.294 98.338  139.684 1.00 74.59  ?  754  SER C OG    1 
ATOM   9219  N  N     . THR C 1 883  ? 105.293 100.655 143.384 1.00 70.14  ?  755  THR C N     1 
ATOM   9220  C  CA    . THR C 1 883  ? 106.234 101.233 144.328 1.00 65.40  ?  755  THR C CA    1 
ATOM   9221  C  C     . THR C 1 883  ? 107.552 100.468 144.236 1.00 65.33  ?  755  THR C C     1 
ATOM   9222  O  O     . THR C 1 883  ? 107.798 99.718  143.287 1.00 71.60  ?  755  THR C O     1 
ATOM   9223  C  CB    . THR C 1 883  ? 105.670 101.198 145.747 1.00 68.61  ?  755  THR C CB    1 
ATOM   9224  O  OG1   . THR C 1 883  ? 105.668 99.847  146.227 1.00 71.89  ?  755  THR C OG1   1 
ATOM   9225  C  CG2   . THR C 1 883  ? 104.250 101.744 145.775 1.00 74.87  ?  755  THR C CG2   1 
ATOM   9226  N  N     . ARG C 1 884  ? 108.425 100.665 145.224 1.00 56.93  ?  756  ARG C N     1 
ATOM   9227  C  CA    . ARG C 1 884  ? 109.698 99.952  145.242 1.00 53.20  ?  756  ARG C CA    1 
ATOM   9228  C  C     . ARG C 1 884  ? 109.486 98.444  145.319 1.00 64.10  ?  756  ARG C C     1 
ATOM   9229  O  O     . ARG C 1 884  ? 110.017 97.685  144.499 1.00 71.12  ?  756  ARG C O     1 
ATOM   9230  C  CB    . ARG C 1 884  ? 110.540 100.438 146.420 1.00 45.34  ?  756  ARG C CB    1 
ATOM   9231  C  CG    . ARG C 1 884  ? 112.015 100.516 146.124 1.00 42.88  ?  756  ARG C CG    1 
ATOM   9232  C  CD    . ARG C 1 884  ? 112.282 101.568 145.073 1.00 41.78  ?  756  ARG C CD    1 
ATOM   9233  N  NE    . ARG C 1 884  ? 113.638 102.094 145.164 1.00 41.57  ?  756  ARG C NE    1 
ATOM   9234  C  CZ    . ARG C 1 884  ? 114.011 103.039 146.019 1.00 40.64  ?  756  ARG C CZ    1 
ATOM   9235  N  NH1   . ARG C 1 884  ? 115.268 103.462 146.036 1.00 40.53  ?  756  ARG C NH1   1 
ATOM   9236  N  NH2   . ARG C 1 884  ? 113.127 103.564 146.857 1.00 40.27  ?  756  ARG C NH2   1 
ATOM   9237  N  N     . ALA C 1 885  ? 108.687 97.995  146.288 1.00 67.17  ?  757  ALA C N     1 
ATOM   9238  C  CA    . ALA C 1 885  ? 108.585 96.569  146.580 1.00 76.91  ?  757  ALA C CA    1 
ATOM   9239  C  C     . ALA C 1 885  ? 107.866 95.815  145.467 1.00 76.28  ?  757  ALA C C     1 
ATOM   9240  O  O     . ALA C 1 885  ? 108.440 94.924  144.835 1.00 84.62  ?  757  ALA C O     1 
ATOM   9241  C  CB    . ALA C 1 885  ? 107.873 96.365  147.917 1.00 80.58  ?  757  ALA C CB    1 
ATOM   9242  N  N     . GLU C 1 886  ? 106.605 96.170  145.204 1.00 71.15  ?  758  GLU C N     1 
ATOM   9243  C  CA    . GLU C 1 886  ? 105.771 95.410  144.273 1.00 69.48  ?  758  GLU C CA    1 
ATOM   9244  C  C     . GLU C 1 886  ? 106.410 95.251  142.901 1.00 68.86  ?  758  GLU C C     1 
ATOM   9245  O  O     . GLU C 1 886  ? 106.066 94.313  142.173 1.00 75.16  ?  758  GLU C O     1 
ATOM   9246  C  CB    . GLU C 1 886  ? 104.414 96.090  144.128 1.00 76.58  ?  758  GLU C CB    1 
ATOM   9247  C  CG    . GLU C 1 886  ? 104.532 97.574  143.865 1.00 85.52  ?  758  GLU C CG    1 
ATOM   9248  C  CD    . GLU C 1 886  ? 103.204 98.294  143.946 1.00 104.53 ?  758  GLU C CD    1 
ATOM   9249  O  OE1   . GLU C 1 886  ? 102.159 97.614  143.991 1.00 104.42 ?  758  GLU C OE1   1 
ATOM   9250  O  OE2   . GLU C 1 886  ? 103.206 99.544  143.961 1.00 156.23 -1 758  GLU C OE2   1 
ATOM   9251  N  N     . ALA C 1 887  ? 107.315 96.151  142.526 1.00 70.63  ?  759  ALA C N     1 
ATOM   9252  C  CA    . ALA C 1 887  ? 108.131 95.947  141.343 1.00 76.83  ?  759  ALA C CA    1 
ATOM   9253  C  C     . ALA C 1 887  ? 109.424 95.207  141.650 1.00 88.12  ?  759  ALA C C     1 
ATOM   9254  O  O     . ALA C 1 887  ? 109.990 94.592  140.740 1.00 90.31  ?  759  ALA C O     1 
ATOM   9255  C  CB    . ALA C 1 887  ? 108.452 97.287  140.673 1.00 73.18  ?  759  ALA C CB    1 
ATOM   9256  N  N     . SER C 1 888  ? 109.897 95.249  142.905 1.00 90.77  ?  760  SER C N     1 
ATOM   9257  C  CA    . SER C 1 888  ? 111.146 94.573  143.248 1.00 98.87  ?  760  SER C CA    1 
ATOM   9258  C  C     . SER C 1 888  ? 110.946 93.098  143.227 1.00 103.65 ?  760  SER C C     1 
ATOM   9259  O  O     . SER C 1 888  ? 111.768 92.311  142.759 1.00 99.02  ?  760  SER C O     1 
ATOM   9260  C  CB    . SER C 1 888  ? 111.655 95.000  144.615 1.00 97.10  ?  760  SER C CB    1 
ATOM   9261  O  OG    . SER C 1 888  ? 112.958 94.482  144.830 1.00 99.12  ?  760  SER C OG    1 
ATOM   9262  N  N     . GLN C 1 889  ? 109.823 92.708  143.733 1.00 104.31 ?  761  GLN C N     1 
ATOM   9263  C  CA    . GLN C 1 889  ? 109.596 91.309  143.821 1.00 111.17 ?  761  GLN C CA    1 
ATOM   9264  C  C     . GLN C 1 889  ? 109.440 90.677  142.423 1.00 107.14 ?  761  GLN C C     1 
ATOM   9265  O  O     . GLN C 1 889  ? 110.187 89.765  142.038 1.00 106.17 ?  761  GLN C O     1 
ATOM   9266  C  CB    . GLN C 1 889  ? 108.403 90.939  144.663 1.00 114.51 ?  761  GLN C CB    1 
ATOM   9267  C  CG    . GLN C 1 889  ? 108.049 90.825  146.027 1.00 116.03 ?  761  GLN C CG    1 
ATOM   9268  C  CD    . GLN C 1 889  ? 109.062 89.965  146.634 1.00 118.41 ?  761  GLN C CD    1 
ATOM   9269  O  OE1   . GLN C 1 889  ? 109.092 89.712  147.755 1.00 115.45 ?  761  GLN C OE1   1 
ATOM   9270  N  NE2   . GLN C 1 889  ? 110.254 90.644  146.265 1.00 116.59 ?  761  GLN C NE2   1 
ATOM   9271  N  N     . ASN C 1 890  ? 108.386 91.059  141.693 1.00 103.53 ?  762  ASN C N     1 
ATOM   9272  C  CA    . ASN C 1 890  ? 108.213 90.693  140.279 1.00 101.66 ?  762  ASN C CA    1 
ATOM   9273  C  C     . ASN C 1 890  ? 108.574 91.901  139.423 1.00 92.24  ?  762  ASN C C     1 
ATOM   9274  O  O     . ASN C 1 890  ? 107.986 92.972  139.588 1.00 90.67  ?  762  ASN C O     1 
ATOM   9275  C  CB    . ASN C 1 890  ? 106.780 90.234  139.979 1.00 102.58 ?  762  ASN C CB    1 
ATOM   9276  C  CG    . ASN C 1 890  ? 106.642 89.540  138.637 1.00 97.78  ?  762  ASN C CG    1 
ATOM   9277  O  OD1   . ASN C 1 890  ? 107.277 89.923  137.655 1.00 91.58  ?  762  ASN C OD1   1 
ATOM   9278  N  ND2   . ASN C 1 890  ? 105.802 88.512  138.589 1.00 98.21  ?  762  ASN C ND2   1 
ATOM   9279  N  N     . MET C 1 891  ? 109.535 91.729  138.514 1.00 78.35  ?  763  MET C N     1 
ATOM   9280  C  CA    . MET C 1 891  ? 110.085 92.869  137.786 1.00 72.38  ?  763  MET C CA    1 
ATOM   9281  C  C     . MET C 1 891  ? 109.353 93.139  136.472 1.00 72.04  ?  763  MET C C     1 
ATOM   9282  O  O     . MET C 1 891  ? 108.806 94.229  136.275 1.00 73.20  ?  763  MET C O     1 
ATOM   9283  C  CB    . MET C 1 891  ? 111.582 92.648  137.538 1.00 67.79  ?  763  MET C CB    1 
ATOM   9284  C  CG    . MET C 1 891  ? 112.385 92.469  138.817 1.00 73.07  ?  763  MET C CG    1 
ATOM   9285  S  SD    . MET C 1 891  ? 114.167 92.555  138.564 1.00 72.07  ?  763  MET C SD    1 
ATOM   9286  C  CE    . MET C 1 891  ? 114.747 92.424  140.252 1.00 78.18  ?  763  MET C CE    1 
ATOM   9287  N  N     . VAL C 1 892  ? 109.314 92.155  135.580 1.00 69.71  ?  764  VAL C N     1 
ATOM   9288  C  CA    . VAL C 1 892  ? 109.057 92.403  134.166 1.00 68.91  ?  764  VAL C CA    1 
ATOM   9289  C  C     . VAL C 1 892  ? 107.585 92.201  133.801 1.00 68.34  ?  764  VAL C C     1 
ATOM   9290  O  O     . VAL C 1 892  ? 107.252 92.102  132.621 1.00 62.70  ?  764  VAL C O     1 
ATOM   9291  C  CB    . VAL C 1 892  ? 109.959 91.538  133.280 1.00 72.68  ?  764  VAL C CB    1 
ATOM   9292  C  CG1   . VAL C 1 892  ? 111.406 91.937  133.464 1.00 69.82  ?  764  VAL C CG1   1 
ATOM   9293  C  CG2   . VAL C 1 892  ? 109.755 90.087  133.623 1.00 86.24  ?  764  VAL C CG2   1 
ATOM   9294  N  N     . LEU C 1 893  ? 106.699 92.138  134.785 1.00 75.58  ?  765  LEU C N     1 
ATOM   9295  C  CA    . LEU C 1 893  ? 105.273 91.964  134.529 1.00 84.09  ?  765  LEU C CA    1 
ATOM   9296  C  C     . LEU C 1 893  ? 104.544 93.221  134.997 1.00 84.36  ?  765  LEU C C     1 
ATOM   9297  O  O     . LEU C 1 893  ? 104.119 93.316  136.149 1.00 85.11  ?  765  LEU C O     1 
ATOM   9298  C  CB    . LEU C 1 893  ? 104.738 90.716  135.221 1.00 95.08  ?  765  LEU C CB    1 
ATOM   9299  C  CG    . LEU C 1 893  ? 103.321 90.314  134.808 1.00 97.33  ?  765  LEU C CG    1 
ATOM   9300  C  CD1   . LEU C 1 893  ? 103.182 90.331  133.292 1.00 91.09  ?  765  LEU C CD1   1 
ATOM   9301  C  CD2   . LEU C 1 893  ? 102.953 88.950  135.371 1.00 90.54  ?  765  LEU C CD2   1 
ATOM   9302  N  N     . HIS C 1 894  ? 104.404 94.187  134.089 1.00 71.48  ?  766  HIS C N     1 
ATOM   9303  C  CA    . HIS C 1 894  ? 103.634 95.396  134.348 1.00 59.02  ?  766  HIS C CA    1 
ATOM   9304  C  C     . HIS C 1 894  ? 103.121 95.943  133.025 1.00 57.26  ?  766  HIS C C     1 
ATOM   9305  O  O     . HIS C 1 894  ? 103.628 95.604  131.953 1.00 57.87  ?  766  HIS C O     1 
ATOM   9306  C  CB    . HIS C 1 894  ? 104.461 96.463  135.078 1.00 57.83  ?  766  HIS C CB    1 
ATOM   9307  C  CG    . HIS C 1 894  ? 104.878 96.065  136.459 1.00 64.06  ?  766  HIS C CG    1 
ATOM   9308  N  ND1   . HIS C 1 894  ? 106.019 95.333  136.710 1.00 65.01  ?  766  HIS C ND1   1 
ATOM   9309  C  CD2   . HIS C 1 894  ? 104.287 96.263  137.660 1.00 65.83  ?  766  HIS C CD2   1 
ATOM   9310  C  CE1   . HIS C 1 894  ? 106.124 95.118  138.010 1.00 65.50  ?  766  HIS C CE1   1 
ATOM   9311  N  NE2   . HIS C 1 894  ? 105.086 95.673  138.608 1.00 65.46  ?  766  HIS C NE2   1 
ATOM   9312  N  N     . SER C 1 895  ? 102.103 96.796  133.114 1.00 64.46  ?  767  SER C N     1 
ATOM   9313  C  CA    . SER C 1 895  ? 101.515 97.446  131.954 1.00 73.10  ?  767  SER C CA    1 
ATOM   9314  C  C     . SER C 1 895  ? 101.563 98.958  132.134 1.00 74.20  ?  767  SER C C     1 
ATOM   9315  O  O     . SER C 1 895  ? 101.503 99.465  133.258 1.00 72.22  ?  767  SER C O     1 
ATOM   9316  C  CB    . SER C 1 895  ? 100.064 96.993  131.736 1.00 75.72  ?  767  SER C CB    1 
ATOM   9317  O  OG    . SER C 1 895  ? 99.235  97.397  132.813 1.00 75.12  ?  767  SER C OG    1 
ATOM   9318  N  N     . ILE C 1 896  ? 101.679 99.675  131.015 1.00 70.25  ?  768  ILE C N     1 
ATOM   9319  C  CA    . ILE C 1 896  ? 101.681 101.133 131.061 1.00 68.10  ?  768  ILE C CA    1 
ATOM   9320  C  C     . ILE C 1 896  ? 100.310 101.624 131.500 1.00 74.43  ?  768  ILE C C     1 
ATOM   9321  O  O     . ILE C 1 896  ? 99.282  101.265 130.910 1.00 75.24  ?  768  ILE C O     1 
ATOM   9322  C  CB    . ILE C 1 896  ? 102.069 101.724 129.698 1.00 60.70  ?  768  ILE C CB    1 
ATOM   9323  C  CG1   . ILE C 1 896  ? 103.587 101.752 129.535 1.00 55.09  ?  768  ILE C CG1   1 
ATOM   9324  C  CG2   . ILE C 1 896  ? 101.505 103.134 129.541 1.00 55.89  ?  768  ILE C CG2   1 
ATOM   9325  C  CD1   . ILE C 1 896  ? 104.042 102.602 128.371 1.00 57.80  ?  768  ILE C CD1   1 
ATOM   9326  N  N     . THR C 1 897  ? 100.286 102.434 132.554 1.00 71.61  ?  769  THR C N     1 
ATOM   9327  C  CA    . THR C 1 897  ? 99.050  103.030 133.040 1.00 71.07  ?  769  THR C CA    1 
ATOM   9328  C  C     . THR C 1 897  ? 99.073  104.549 132.981 1.00 72.78  ?  769  THR C C     1 
ATOM   9329  O  O     . THR C 1 897  ? 98.172  105.146 132.382 1.00 77.33  ?  769  THR C O     1 
ATOM   9330  C  CB    . THR C 1 897  ? 98.766  102.562 134.477 1.00 72.31  ?  769  THR C CB    1 
ATOM   9331  O  OG1   . THR C 1 897  ? 99.900  102.843 135.306 1.00 67.03  ?  769  THR C OG1   1 
ATOM   9332  C  CG2   . THR C 1 897  ? 98.478  101.066 134.507 1.00 71.00  ?  769  THR C CG2   1 
ATOM   9333  N  N     . ARG C 1 898  ? 100.106 105.181 133.547 1.00 67.48  ?  770  ARG C N     1 
ATOM   9334  C  CA    . ARG C 1 898  ? 100.117 106.624 133.783 1.00 61.45  ?  770  ARG C CA    1 
ATOM   9335  C  C     . ARG C 1 898  ? 99.775  107.420 132.530 1.00 62.32  ?  770  ARG C C     1 
ATOM   9336  O  O     . ARG C 1 898  ? 100.343 107.197 131.457 1.00 64.21  ?  770  ARG C O     1 
ATOM   9337  C  CB    . ARG C 1 898  ? 101.487 107.058 134.308 1.00 49.36  ?  770  ARG C CB    1 
ATOM   9338  C  CG    . ARG C 1 898  ? 101.716 106.758 135.776 1.00 45.33  ?  770  ARG C CG    1 
ATOM   9339  C  CD    . ARG C 1 898  ? 100.934 107.715 136.657 1.00 46.18  ?  770  ARG C CD    1 
ATOM   9340  N  NE    . ARG C 1 898  ? 101.001 107.340 138.066 1.00 51.74  ?  770  ARG C NE    1 
ATOM   9341  C  CZ    . ARG C 1 898  ? 102.121 107.324 138.780 1.00 52.46  ?  770  ARG C CZ    1 
ATOM   9342  N  NH1   . ARG C 1 898  ? 103.273 107.661 138.216 1.00 46.92  ?  770  ARG C NH1   1 
ATOM   9343  N  NH2   . ARG C 1 898  ? 102.092 106.971 140.058 1.00 52.20  ?  770  ARG C NH2   1 
ATOM   9344  N  N     . SER C 1 899  ? 98.834  108.350 132.682 1.00 63.33  ?  771  SER C N     1 
ATOM   9345  C  CA    . SER C 1 899  ? 98.471  109.289 131.634 1.00 60.47  ?  771  SER C CA    1 
ATOM   9346  C  C     . SER C 1 899  ? 98.321  110.673 132.244 1.00 55.14  ?  771  SER C C     1 
ATOM   9347  O  O     . SER C 1 899  ? 98.180  110.828 133.460 1.00 59.91  ?  771  SER C O     1 
ATOM   9348  C  CB    . SER C 1 899  ? 97.169  108.894 130.924 1.00 66.46  ?  771  SER C CB    1 
ATOM   9349  O  OG    . SER C 1 899  ? 96.447  110.046 130.520 1.00 59.87  ?  771  SER C OG    1 
ATOM   9350  N  N     . HIS C 1 900  ? 98.347  111.682 131.377 1.00 48.39  ?  772  HIS C N     1 
ATOM   9351  C  CA    . HIS C 1 900  ? 98.224  113.057 131.843 1.00 49.66  ?  772  HIS C CA    1 
ATOM   9352  C  C     . HIS C 1 900  ? 96.833  113.328 132.406 1.00 52.99  ?  772  HIS C C     1 
ATOM   9353  O  O     . HIS C 1 900  ? 96.691  113.844 133.523 1.00 57.38  ?  772  HIS C O     1 
ATOM   9354  C  CB    . HIS C 1 900  ? 98.543  114.019 130.701 1.00 44.81  ?  772  HIS C CB    1 
ATOM   9355  C  CG    . HIS C 1 900  ? 98.226  115.448 131.010 1.00 44.48  ?  772  HIS C CG    1 
ATOM   9356  N  ND1   . HIS C 1 900  ? 99.133  116.301 131.603 1.00 37.35  ?  772  HIS C ND1   1 
ATOM   9357  C  CD2   . HIS C 1 900  ? 97.100  116.175 130.813 1.00 50.18  ?  772  HIS C CD2   1 
ATOM   9358  C  CE1   . HIS C 1 900  ? 98.582  117.492 131.751 1.00 34.23  ?  772  HIS C CE1   1 
ATOM   9359  N  NE2   . HIS C 1 900  ? 97.348  117.442 131.282 1.00 43.48  ?  772  HIS C NE2   1 
ATOM   9360  N  N     . ASP C 1 901  ? 95.793  112.987 131.643 1.00 56.86  ?  773  ASP C N     1 
ATOM   9361  C  CA    . ASP C 1 901  ? 94.436  113.314 132.066 1.00 69.38  ?  773  ASP C CA    1 
ATOM   9362  C  C     . ASP C 1 901  ? 94.056  112.568 133.341 1.00 72.43  ?  773  ASP C C     1 
ATOM   9363  O  O     . ASP C 1 901  ? 93.444  113.143 134.251 1.00 70.66  ?  773  ASP C O     1 
ATOM   9364  C  CB    . ASP C 1 901  ? 93.452  113.005 130.939 1.00 87.13  ?  773  ASP C CB    1 
ATOM   9365  C  CG    . ASP C 1 901  ? 92.062  113.521 131.229 1.00 125.45 ?  773  ASP C CG    1 
ATOM   9366  O  OD1   . ASP C 1 901  ? 91.868  114.755 131.213 1.00 116.68 ?  773  ASP C OD1   1 
ATOM   9367  O  OD2   . ASP C 1 901  ? 91.163  112.692 131.476 1.00 200.83 -1 773  ASP C OD2   1 
ATOM   9368  N  N     . GLU C 1 902  ? 94.419  111.289 133.435 1.00 73.41  ?  774  GLU C N     1 
ATOM   9369  C  CA    . GLU C 1 902  ? 94.152  110.559 134.666 1.00 73.61  ?  774  GLU C CA    1 
ATOM   9370  C  C     . GLU C 1 902  ? 95.011  111.054 135.820 1.00 65.11  ?  774  GLU C C     1 
ATOM   9371  O  O     . GLU C 1 902  ? 94.625  110.881 136.978 1.00 62.73  ?  774  GLU C O     1 
ATOM   9372  C  CB    . GLU C 1 902  ? 94.375  109.065 134.461 1.00 80.16  ?  774  GLU C CB    1 
ATOM   9373  C  CG    . GLU C 1 902  ? 95.828  108.710 134.325 1.00 89.13  ?  774  GLU C CG    1 
ATOM   9374  C  CD    . GLU C 1 902  ? 96.041  107.321 133.793 1.00 108.26 ?  774  GLU C CD    1 
ATOM   9375  O  OE1   . GLU C 1 902  ? 95.080  106.523 133.783 1.00 106.49 ?  774  GLU C OE1   1 
ATOM   9376  O  OE2   . GLU C 1 902  ? 97.176  107.037 133.375 1.00 155.09 -1 774  GLU C OE2   1 
ATOM   9377  N  N     . ASN C 1 903  ? 96.158  111.678 135.538 1.00 56.84  ?  775  ASN C N     1 
ATOM   9378  C  CA    . ASN C 1 903  ? 96.929  112.299 136.610 1.00 49.01  ?  775  ASN C CA    1 
ATOM   9379  C  C     . ASN C 1 903  ? 96.233  113.551 137.123 1.00 42.79  ?  775  ASN C C     1 
ATOM   9380  O  O     . ASN C 1 903  ? 96.230  113.816 138.331 1.00 42.38  ?  775  ASN C O     1 
ATOM   9381  C  CB    . ASN C 1 903  ? 98.344  112.618 136.132 1.00 48.70  ?  775  ASN C CB    1 
ATOM   9382  C  CG    . ASN C 1 903  ? 99.308  111.475 136.378 1.00 52.67  ?  775  ASN C CG    1 
ATOM   9383  O  OD1   . ASN C 1 903  ? 99.144  110.704 137.325 1.00 50.98  ?  775  ASN C OD1   1 
ATOM   9384  N  ND2   . ASN C 1 903  ? 100.314 111.352 135.522 1.00 57.16  ?  775  ASN C ND2   1 
ATOM   9385  N  N     . LEU C 1 904  ? 95.631  114.329 136.220 1.00 43.38  ?  776  LEU C N     1 
ATOM   9386  C  CA    . LEU C 1 904  ? 94.734  115.397 136.652 1.00 40.67  ?  776  LEU C CA    1 
ATOM   9387  C  C     . LEU C 1 904  ? 93.632  114.841 137.548 1.00 47.17  ?  776  LEU C C     1 
ATOM   9388  O  O     . LEU C 1 904  ? 93.352  115.380 138.628 1.00 44.18  ?  776  LEU C O     1 
ATOM   9389  C  CB    . LEU C 1 904  ? 94.140  116.101 135.428 1.00 41.53  ?  776  LEU C CB    1 
ATOM   9390  C  CG    . LEU C 1 904  ? 93.589  117.525 135.568 1.00 41.23  ?  776  LEU C CG    1 
ATOM   9391  C  CD1   . LEU C 1 904  ? 92.330  117.637 136.433 1.00 46.98  ?  776  LEU C CD1   1 
ATOM   9392  C  CD2   . LEU C 1 904  ? 94.694  118.396 136.130 1.00 34.70  ?  776  LEU C CD2   1 
ATOM   9393  N  N     . GLU C 1 905  ? 92.992  113.759 137.099 1.00 61.94  ?  777  GLU C N     1 
ATOM   9394  C  CA    . GLU C 1 905  ? 91.925  113.134 137.879 1.00 68.95  ?  777  GLU C CA    1 
ATOM   9395  C  C     . GLU C 1 905  ? 92.408  112.742 139.272 1.00 56.51  ?  777  GLU C C     1 
ATOM   9396  O  O     . GLU C 1 905  ? 91.753  113.036 140.282 1.00 55.83  ?  777  GLU C O     1 
ATOM   9397  C  CB    . GLU C 1 905  ? 91.389  111.910 137.136 1.00 84.11  ?  777  GLU C CB    1 
ATOM   9398  C  CG    . GLU C 1 905  ? 90.245  111.223 137.849 1.00 100.22 ?  777  GLU C CG    1 
ATOM   9399  C  CD    . GLU C 1 905  ? 89.181  112.204 138.291 1.00 121.11 ?  777  GLU C CD    1 
ATOM   9400  O  OE1   . GLU C 1 905  ? 88.689  112.077 139.432 1.00 106.84 ?  777  GLU C OE1   1 
ATOM   9401  O  OE2   . GLU C 1 905  ? 88.843  113.111 137.500 1.00 179.08 -1 777  GLU C OE2   1 
ATOM   9402  N  N     . ARG C 1 906  ? 93.551  112.057 139.340 1.00 51.35  ?  778  ARG C N     1 
ATOM   9403  C  CA    . ARG C 1 906  ? 94.107  111.640 140.621 1.00 46.76  ?  778  ARG C CA    1 
ATOM   9404  C  C     . ARG C 1 906  ? 94.426  112.838 141.507 1.00 39.52  ?  778  ARG C C     1 
ATOM   9405  O  O     . ARG C 1 906  ? 94.221  112.789 142.724 1.00 38.42  ?  778  ARG C O     1 
ATOM   9406  C  CB    . ARG C 1 906  ? 95.359  110.792 140.397 1.00 49.26  ?  778  ARG C CB    1 
ATOM   9407  C  CG    . ARG C 1 906  ? 95.100  109.317 140.120 1.00 45.42  ?  778  ARG C CG    1 
ATOM   9408  C  CD    . ARG C 1 906  ? 96.414  108.574 139.921 1.00 41.35  ?  778  ARG C CD    1 
ATOM   9409  N  NE    . ARG C 1 906  ? 96.220  107.139 139.738 1.00 41.71  ?  778  ARG C NE    1 
ATOM   9410  C  CZ    . ARG C 1 906  ? 95.896  106.575 138.580 1.00 46.28  ?  778  ARG C CZ    1 
ATOM   9411  N  NH1   . ARG C 1 906  ? 95.722  107.328 137.502 1.00 54.51  ?  778  ARG C NH1   1 
ATOM   9412  N  NH2   . ARG C 1 906  ? 95.741  105.261 138.499 1.00 47.95  ?  778  ARG C NH2   1 
ATOM   9413  N  N     . TYR C 1 907  ? 94.942  113.921 140.925 1.00 32.71  ?  779  TYR C N     1 
ATOM   9414  C  CA    . TYR C 1 907  ? 95.187  115.108 141.736 1.00 24.86  ?  779  TYR C CA    1 
ATOM   9415  C  C     . TYR C 1 907  ? 93.889  115.648 142.310 1.00 31.94  ?  779  TYR C C     1 
ATOM   9416  O  O     . TYR C 1 907  ? 93.856  116.133 143.447 1.00 36.24  ?  779  TYR C O     1 
ATOM   9417  C  CB    . TYR C 1 907  ? 95.885  116.193 140.924 1.00 22.09  ?  779  TYR C CB    1 
ATOM   9418  C  CG    . TYR C 1 907  ? 95.934  117.513 141.660 1.00 18.94  ?  779  TYR C CG    1 
ATOM   9419  C  CD1   . TYR C 1 907  ? 96.895  117.749 142.630 1.00 14.15  ?  779  TYR C CD1   1 
ATOM   9420  C  CD2   . TYR C 1 907  ? 95.008  118.515 141.395 1.00 24.53  ?  779  TYR C CD2   1 
ATOM   9421  C  CE1   . TYR C 1 907  ? 96.942  118.948 143.306 1.00 13.43  ?  779  TYR C CE1   1 
ATOM   9422  C  CE2   . TYR C 1 907  ? 95.046  119.715 142.068 1.00 21.19  ?  779  TYR C CE2   1 
ATOM   9423  C  CZ    . TYR C 1 907  ? 96.016  119.927 143.019 1.00 15.97  ?  779  TYR C CZ    1 
ATOM   9424  O  OH    . TYR C 1 907  ? 96.056  121.125 143.689 1.00 14.13  ?  779  TYR C OH    1 
ATOM   9425  N  N     . GLU C 1 908  ? 92.815  115.604 141.523 1.00 37.49  ?  780  GLU C N     1 
ATOM   9426  C  CA    . GLU C 1 908  ? 91.515  116.002 142.053 1.00 45.10  ?  780  GLU C CA    1 
ATOM   9427  C  C     . GLU C 1 908  ? 91.110  115.114 143.223 1.00 45.90  ?  780  GLU C C     1 
ATOM   9428  O  O     . GLU C 1 908  ? 90.613  115.601 144.250 1.00 47.50  ?  780  GLU C O     1 
ATOM   9429  C  CB    . GLU C 1 908  ? 90.460  115.963 140.949 1.00 54.79  ?  780  GLU C CB    1 
ATOM   9430  C  CG    . GLU C 1 908  ? 90.212  117.319 140.335 1.00 65.95  ?  780  GLU C CG    1 
ATOM   9431  C  CD    . GLU C 1 908  ? 89.773  118.334 141.372 1.00 89.99  ?  780  GLU C CD    1 
ATOM   9432  O  OE1   . GLU C 1 908  ? 88.987  117.966 142.272 1.00 74.31  ?  780  GLU C OE1   1 
ATOM   9433  O  OE2   . GLU C 1 908  ? 90.234  119.491 141.303 1.00 165.00 -1 780  GLU C OE2   1 
ATOM   9434  N  N     . ILE C 1 909  ? 91.336  113.805 143.084 1.00 44.94  ?  781  ILE C N     1 
ATOM   9435  C  CA    . ILE C 1 909  ? 90.996  112.855 144.141 1.00 46.08  ?  781  ILE C CA    1 
ATOM   9436  C  C     . ILE C 1 909  ? 91.841  113.102 145.391 1.00 45.13  ?  781  ILE C C     1 
ATOM   9437  O  O     . ILE C 1 909  ? 91.390  112.852 146.517 1.00 46.78  ?  781  ILE C O     1 
ATOM   9438  C  CB    . ILE C 1 909  ? 91.139  111.415 143.603 1.00 49.50  ?  781  ILE C CB    1 
ATOM   9439  C  CG1   . ILE C 1 909  ? 89.876  111.020 142.831 1.00 55.66  ?  781  ILE C CG1   1 
ATOM   9440  C  CG2   . ILE C 1 909  ? 91.432  110.419 144.721 1.00 48.70  ?  781  ILE C CG2   1 
ATOM   9441  C  CD1   . ILE C 1 909  ? 89.756  109.535 142.552 1.00 57.85  ?  781  ILE C CD1   1 
ATOM   9442  N  N     . TRP C 1 910  ? 93.063  113.609 145.221 1.00 36.87  ?  782  TRP C N     1 
ATOM   9443  C  CA    . TRP C 1 910  ? 93.877  113.988 146.376 1.00 34.29  ?  782  TRP C CA    1 
ATOM   9444  C  C     . TRP C 1 910  ? 93.331  115.246 147.039 1.00 35.39  ?  782  TRP C C     1 
ATOM   9445  O  O     . TRP C 1 910  ? 93.118  115.277 148.258 1.00 39.95  ?  782  TRP C O     1 
ATOM   9446  C  CB    . TRP C 1 910  ? 95.336  114.204 145.961 1.00 33.90  ?  782  TRP C CB    1 
ATOM   9447  C  CG    . TRP C 1 910  ? 96.106  115.140 146.881 1.00 28.71  ?  782  TRP C CG    1 
ATOM   9448  C  CD1   . TRP C 1 910  ? 96.142  116.508 146.827 1.00 24.70  ?  782  TRP C CD1   1 
ATOM   9449  C  CD2   . TRP C 1 910  ? 96.947  114.765 147.979 1.00 24.08  ?  782  TRP C CD2   1 
ATOM   9450  N  NE1   . TRP C 1 910  ? 96.945  117.003 147.824 1.00 23.51  ?  782  TRP C NE1   1 
ATOM   9451  C  CE2   . TRP C 1 910  ? 97.454  115.954 148.544 1.00 18.58  ?  782  TRP C CE2   1 
ATOM   9452  C  CE3   . TRP C 1 910  ? 97.321  113.541 148.540 1.00 22.65  ?  782  TRP C CE3   1 
ATOM   9453  C  CZ2   . TRP C 1 910  ? 98.312  115.953 149.639 1.00 19.41  ?  782  TRP C CZ2   1 
ATOM   9454  C  CZ3   . TRP C 1 910  ? 98.172  113.543 149.626 1.00 25.39  ?  782  TRP C CZ3   1 
ATOM   9455  C  CH2   . TRP C 1 910  ? 98.658  114.740 150.164 1.00 22.20  ?  782  TRP C CH2   1 
ATOM   9456  N  N     . ARG C 1 911  ? 93.112  116.299 146.246 1.00 37.94  ?  783  ARG C N     1 
ATOM   9457  C  CA    . ARG C 1 911  ? 92.732  117.596 146.802 1.00 35.67  ?  783  ARG C CA    1 
ATOM   9458  C  C     . ARG C 1 911  ? 91.407  117.510 147.547 1.00 41.93  ?  783  ARG C C     1 
ATOM   9459  O  O     . ARG C 1 911  ? 91.298  117.957 148.695 1.00 42.28  ?  783  ARG C O     1 
ATOM   9460  C  CB    . ARG C 1 911  ? 92.648  118.645 145.693 1.00 40.73  ?  783  ARG C CB    1 
ATOM   9461  C  CG    . ARG C 1 911  ? 92.287  120.039 146.193 1.00 36.67  ?  783  ARG C CG    1 
ATOM   9462  C  CD    . ARG C 1 911  ? 92.040  121.005 145.043 1.00 35.40  ?  783  ARG C CD    1 
ATOM   9463  N  NE    . ARG C 1 911  ? 90.681  120.872 144.530 1.00 41.11  ?  783  ARG C NE    1 
ATOM   9464  C  CZ    . ARG C 1 911  ? 89.629  121.501 145.043 1.00 45.22  ?  783  ARG C CZ    1 
ATOM   9465  N  NH1   . ARG C 1 911  ? 89.782  122.310 146.082 1.00 40.51  ?  783  ARG C NH1   1 
ATOM   9466  N  NH2   . ARG C 1 911  ? 88.425  121.320 144.519 1.00 53.65  ?  783  ARG C NH2   1 
ATOM   9467  N  N     . LYS C 1 912  ? 90.381  116.946 146.905 1.00 46.74  ?  784  LYS C N     1 
ATOM   9468  C  CA    . LYS C 1 912  ? 89.091  116.861 147.581 1.00 51.19  ?  784  LYS C CA    1 
ATOM   9469  C  C     . LYS C 1 912  ? 89.099  115.816 148.692 1.00 53.69  ?  784  LYS C C     1 
ATOM   9470  O  O     . LYS C 1 912  ? 88.328  115.938 149.652 1.00 53.31  ?  784  LYS C O     1 
ATOM   9471  C  CB    . LYS C 1 912  ? 87.984  116.558 146.575 1.00 54.38  ?  784  LYS C CB    1 
ATOM   9472  C  CG    . LYS C 1 912  ? 86.605  117.005 147.026 1.00 54.69  ?  784  LYS C CG    1 
ATOM   9473  C  CD    . LYS C 1 912  ? 85.974  117.905 145.985 1.00 61.75  ?  784  LYS C CD    1 
ATOM   9474  C  CE    . LYS C 1 912  ? 85.973  117.230 144.624 1.00 62.74  ?  784  LYS C CE    1 
ATOM   9475  N  NZ    . LYS C 1 912  ? 85.501  118.142 143.550 1.00 64.63  ?  784  LYS C NZ    1 
ATOM   9476  N  N     . ASN C 1 913  ? 89.965  114.808 148.591 1.00 51.70  ?  785  ASN C N     1 
ATOM   9477  C  CA    . ASN C 1 913  ? 90.006  113.689 149.527 1.00 47.83  ?  785  ASN C CA    1 
ATOM   9478  C  C     . ASN C 1 913  ? 88.599  113.146 149.783 1.00 52.98  ?  785  ASN C C     1 
ATOM   9479  O  O     . ASN C 1 913  ? 88.108  113.183 150.921 1.00 56.50  ?  785  ASN C O     1 
ATOM   9480  C  CB    . ASN C 1 913  ? 90.679  114.090 150.833 1.00 42.09  ?  785  ASN C CB    1 
ATOM   9481  C  CG    . ASN C 1 913  ? 91.103  112.890 151.671 1.00 47.27  ?  785  ASN C CG    1 
ATOM   9482  O  OD1   . ASN C 1 913  ? 90.442  111.851 151.680 1.00 53.04  ?  785  ASN C OD1   1 
ATOM   9483  N  ND2   . ASN C 1 913  ? 92.212  113.034 152.385 1.00 45.93  ?  785  ASN C ND2   1 
ATOM   9484  N  N     . PRO C 1 914  ? 87.923  112.627 148.755 1.00 59.27  ?  786  PRO C N     1 
ATOM   9485  C  CA    . PRO C 1 914  ? 86.497  112.310 148.896 1.00 69.62  ?  786  PRO C CA    1 
ATOM   9486  C  C     . PRO C 1 914  ? 86.237  111.061 149.723 1.00 76.09  ?  786  PRO C C     1 
ATOM   9487  O  O     . PRO C 1 914  ? 85.104  110.573 149.778 1.00 80.69  ?  786  PRO C O     1 
ATOM   9488  C  CB    . PRO C 1 914  ? 86.041  112.130 147.444 1.00 71.39  ?  786  PRO C CB    1 
ATOM   9489  C  CG    . PRO C 1 914  ? 87.251  111.624 146.747 1.00 66.12  ?  786  PRO C CG    1 
ATOM   9490  C  CD    . PRO C 1 914  ? 88.442  112.255 147.426 1.00 59.16  ?  786  PRO C CD    1 
ATOM   9491  N  N     . PHE C 1 915  ? 87.277  110.534 150.371 1.00 67.67  ?  787  PHE C N     1 
ATOM   9492  C  CA    . PHE C 1 915  ? 87.133  109.350 151.206 1.00 71.17  ?  787  PHE C CA    1 
ATOM   9493  C  C     . PHE C 1 915  ? 87.715  109.545 152.601 1.00 68.17  ?  787  PHE C C     1 
ATOM   9494  O  O     . PHE C 1 915  ? 87.798  108.575 153.363 1.00 68.64  ?  787  PHE C O     1 
ATOM   9495  C  CB    . PHE C 1 915  ? 87.771  108.136 150.524 1.00 75.62  ?  787  PHE C CB    1 
ATOM   9496  C  CG    . PHE C 1 915  ? 87.095  107.749 149.240 1.00 78.14  ?  787  PHE C CG    1 
ATOM   9497  C  CD1   . PHE C 1 915  ? 87.371  108.426 148.064 1.00 75.21  ?  787  PHE C CD1   1 
ATOM   9498  C  CD2   . PHE C 1 915  ? 86.167  106.722 149.212 1.00 79.41  ?  787  PHE C CD2   1 
ATOM   9499  C  CE1   . PHE C 1 915  ? 86.744  108.080 146.883 1.00 74.13  ?  787  PHE C CE1   1 
ATOM   9500  C  CE2   . PHE C 1 915  ? 85.537  106.370 148.033 1.00 74.41  ?  787  PHE C CE2   1 
ATOM   9501  C  CZ    . PHE C 1 915  ? 85.825  107.051 146.867 1.00 74.26  ?  787  PHE C CZ    1 
ATOM   9502  N  N     . SER C 1 916  ? 88.114  110.769 152.951 1.00 67.27  ?  788  SER C N     1 
ATOM   9503  C  CA    . SER C 1 916  ? 88.529  111.143 154.303 1.00 68.34  ?  788  SER C CA    1 
ATOM   9504  C  C     . SER C 1 916  ? 89.645  110.259 154.849 1.00 61.52  ?  788  SER C C     1 
ATOM   9505  O  O     . SER C 1 916  ? 89.812  110.146 156.068 1.00 60.64  ?  788  SER C O     1 
ATOM   9506  C  CB    . SER C 1 916  ? 87.339  111.135 155.270 1.00 70.01  ?  788  SER C CB    1 
ATOM   9507  O  OG    . SER C 1 916  ? 86.813  109.829 155.430 1.00 73.89  ?  788  SER C OG    1 
ATOM   9508  N  N     . GLU C 1 917  ? 90.414  109.626 153.973 1.00 58.11  ?  789  GLU C N     1 
ATOM   9509  C  CA    . GLU C 1 917  ? 91.531  108.814 154.421 1.00 55.85  ?  789  GLU C CA    1 
ATOM   9510  C  C     . GLU C 1 917  ? 92.639  109.701 154.985 1.00 54.04  ?  789  GLU C C     1 
ATOM   9511  O  O     . GLU C 1 917  ? 92.667  110.918 154.776 1.00 54.84  ?  789  GLU C O     1 
ATOM   9512  C  CB    . GLU C 1 917  ? 92.049  107.958 153.269 1.00 71.65  ?  789  GLU C CB    1 
ATOM   9513  C  CG    . GLU C 1 917  ? 90.946  107.178 152.571 1.00 85.88  ?  789  GLU C CG    1 
ATOM   9514  C  CD    . GLU C 1 917  ? 91.336  106.719 151.181 1.00 104.32 ?  789  GLU C CD    1 
ATOM   9515  O  OE1   . GLU C 1 917  ? 92.544  106.725 150.865 1.00 93.51  ?  789  GLU C OE1   1 
ATOM   9516  O  OE2   . GLU C 1 917  ? 90.433  106.338 150.407 1.00 148.37 -1 789  GLU C OE2   1 
ATOM   9517  N  N     . SER C 1 918  ? 93.559  109.073 155.714 1.00 58.60  ?  790  SER C N     1 
ATOM   9518  C  CA    . SER C 1 918  ? 94.632  109.808 156.365 1.00 55.01  ?  790  SER C CA    1 
ATOM   9519  C  C     . SER C 1 918  ? 95.633  110.310 155.325 1.00 48.96  ?  790  SER C C     1 
ATOM   9520  O  O     . SER C 1 918  ? 95.474  110.108 154.116 1.00 51.09  ?  790  SER C O     1 
ATOM   9521  C  CB    . SER C 1 918  ? 95.311  108.931 157.414 1.00 60.70  ?  790  SER C CB    1 
ATOM   9522  O  OG    . SER C 1 918  ? 96.229  108.030 156.818 1.00 61.38  ?  790  SER C OG    1 
ATOM   9523  N  N     . ALA C 1 919  ? 96.680  110.984 155.807 1.00 47.22  ?  791  ALA C N     1 
ATOM   9524  C  CA    . ALA C 1 919  ? 97.703  111.514 154.911 1.00 50.11  ?  791  ALA C CA    1 
ATOM   9525  C  C     . ALA C 1 919  ? 98.353  110.399 154.101 1.00 53.72  ?  791  ALA C C     1 
ATOM   9526  O  O     . ALA C 1 919  ? 98.232  110.352 152.870 1.00 56.62  ?  791  ALA C O     1 
ATOM   9527  C  CB    . ALA C 1 919  ? 98.756  112.282 155.714 1.00 45.62  ?  791  ALA C CB    1 
ATOM   9528  N  N     . ASP C 1 920  ? 99.043  109.481 154.783 1.00 57.59  ?  792  ASP C N     1 
ATOM   9529  C  CA    . ASP C 1 920  ? 99.705  108.388 154.080 1.00 62.47  ?  792  ASP C CA    1 
ATOM   9530  C  C     . ASP C 1 920  ? 98.698  107.476 153.394 1.00 61.66  ?  792  ASP C C     1 
ATOM   9531  O  O     . ASP C 1 920  ? 98.993  106.915 152.331 1.00 64.99  ?  792  ASP C O     1 
ATOM   9532  C  CB    . ASP C 1 920  ? 100.581 107.592 155.047 1.00 78.72  ?  792  ASP C CB    1 
ATOM   9533  C  CG    . ASP C 1 920  ? 101.782 108.383 155.527 1.00 104.69 ?  792  ASP C CG    1 
ATOM   9534  O  OD1   . ASP C 1 920  ? 101.876 109.581 155.188 1.00 90.79  ?  792  ASP C OD1   1 
ATOM   9535  O  OD2   . ASP C 1 920  ? 102.638 107.807 156.233 1.00 179.39 -1 792  ASP C OD2   1 
ATOM   9536  N  N     . GLU C 1 921  ? 97.499  107.343 153.963 1.00 59.93  ?  793  GLU C N     1 
ATOM   9537  C  CA    . GLU C 1 921  ? 96.481  106.497 153.350 1.00 67.35  ?  793  GLU C CA    1 
ATOM   9538  C  C     . GLU C 1 921  ? 96.107  107.004 151.961 1.00 67.83  ?  793  GLU C C     1 
ATOM   9539  O  O     . GLU C 1 921  ? 96.082  106.234 150.994 1.00 70.56  ?  793  GLU C O     1 
ATOM   9540  C  CB    . GLU C 1 921  ? 95.251  106.426 154.254 1.00 74.32  ?  793  GLU C CB    1 
ATOM   9541  C  CG    . GLU C 1 921  ? 94.796  105.011 154.544 1.00 87.98  ?  793  GLU C CG    1 
ATOM   9542  C  CD    . GLU C 1 921  ? 94.333  104.291 153.299 1.00 105.66 ?  793  GLU C CD    1 
ATOM   9543  O  OE1   . GLU C 1 921  ? 93.658  104.925 152.466 1.00 95.84  ?  793  GLU C OE1   1 
ATOM   9544  O  OE2   . GLU C 1 921  ? 94.651  103.094 153.149 1.00 168.92 -1 793  GLU C OE2   1 
ATOM   9545  N  N     . LEU C 1 922  ? 95.822  108.303 151.838 1.00 64.71  ?  794  LEU C N     1 
ATOM   9546  C  CA    . LEU C 1 922  ? 95.486  108.854 150.528 1.00 62.75  ?  794  LEU C CA    1 
ATOM   9547  C  C     . LEU C 1 922  ? 96.709  108.908 149.624 1.00 56.87  ?  794  LEU C C     1 
ATOM   9548  O  O     . LEU C 1 922  ? 96.617  108.604 148.427 1.00 56.58  ?  794  LEU C O     1 
ATOM   9549  C  CB    . LEU C 1 922  ? 94.870  110.246 150.671 1.00 62.43  ?  794  LEU C CB    1 
ATOM   9550  C  CG    . LEU C 1 922  ? 94.458  110.901 149.346 1.00 57.85  ?  794  LEU C CG    1 
ATOM   9551  C  CD1   . LEU C 1 922  ? 93.584  109.964 148.524 1.00 65.47  ?  794  LEU C CD1   1 
ATOM   9552  C  CD2   . LEU C 1 922  ? 93.751  112.226 149.575 1.00 48.09  ?  794  LEU C CD2   1 
ATOM   9553  N  N     . ARG C 1 923  ? 97.860  109.300 150.179 1.00 54.74  ?  795  ARG C N     1 
ATOM   9554  C  CA    . ARG C 1 923  ? 99.108  109.284 149.424 1.00 54.08  ?  795  ARG C CA    1 
ATOM   9555  C  C     . ARG C 1 923  ? 99.338  107.935 148.757 1.00 56.44  ?  795  ARG C C     1 
ATOM   9556  O  O     . ARG C 1 923  ? 99.887  107.862 147.651 1.00 54.92  ?  795  ARG C O     1 
ATOM   9557  C  CB    . ARG C 1 923  ? 100.269 109.623 150.355 1.00 52.90  ?  795  ARG C CB    1 
ATOM   9558  C  CG    . ARG C 1 923  ? 101.616 109.712 149.685 1.00 41.32  ?  795  ARG C CG    1 
ATOM   9559  C  CD    . ARG C 1 923  ? 102.596 110.386 150.614 1.00 43.15  ?  795  ARG C CD    1 
ATOM   9560  N  NE    . ARG C 1 923  ? 103.873 110.629 149.962 1.00 49.76  ?  795  ARG C NE    1 
ATOM   9561  C  CZ    . ARG C 1 923  ? 104.864 109.748 149.941 1.00 58.99  ?  795  ARG C CZ    1 
ATOM   9562  N  NH1   . ARG C 1 923  ? 106.003 110.044 149.331 1.00 66.46  ?  795  ARG C NH1   1 
ATOM   9563  N  NH2   . ARG C 1 923  ? 104.715 108.569 150.530 1.00 55.35  ?  795  ARG C NH2   1 
ATOM   9564  N  N     . ASP C 1 924  ? 98.928  106.852 149.421 1.00 66.14  ?  796  ASP C N     1 
ATOM   9565  C  CA    . ASP C 1 924  ? 99.007  105.535 148.802 1.00 79.03  ?  796  ASP C CA    1 
ATOM   9566  C  C     . ASP C 1 924  ? 97.850  105.298 147.837 1.00 70.32  ?  796  ASP C C     1 
ATOM   9567  O  O     . ASP C 1 924  ? 98.041  104.692 146.776 1.00 73.60  ?  796  ASP C O     1 
ATOM   9568  C  CB    . ASP C 1 924  ? 99.034  104.446 149.875 1.00 95.83  ?  796  ASP C CB    1 
ATOM   9569  C  CG    . ASP C 1 924  ? 98.970  103.047 149.288 1.00 124.71 ?  796  ASP C CG    1 
ATOM   9570  O  OD1   . ASP C 1 924  ? 100.011 102.556 148.802 1.00 118.39 ?  796  ASP C OD1   1 
ATOM   9571  O  OD2   . ASP C 1 924  ? 97.879  102.439 149.305 1.00 185.80 -1 796  ASP C OD2   1 
ATOM   9572  N  N     . ARG C 1 925  ? 96.648  105.763 148.187 1.00 61.21  ?  797  ARG C N     1 
ATOM   9573  C  CA    . ARG C 1 925  ? 95.492  105.529 147.327 1.00 53.33  ?  797  ARG C CA    1 
ATOM   9574  C  C     . ARG C 1 925  ? 95.653  106.193 145.967 1.00 48.43  ?  797  ARG C C     1 
ATOM   9575  O  O     . ARG C 1 925  ? 95.181  105.664 144.953 1.00 48.65  ?  797  ARG C O     1 
ATOM   9576  C  CB    . ARG C 1 925  ? 94.221  106.037 148.000 1.00 52.09  ?  797  ARG C CB    1 
ATOM   9577  C  CG    . ARG C 1 925  ? 93.061  106.168 147.040 1.00 51.66  ?  797  ARG C CG    1 
ATOM   9578  C  CD    . ARG C 1 925  ? 91.787  106.482 147.759 1.00 65.77  ?  797  ARG C CD    1 
ATOM   9579  N  NE    . ARG C 1 925  ? 90.633  105.977 147.030 1.00 72.15  ?  797  ARG C NE    1 
ATOM   9580  C  CZ    . ARG C 1 925  ? 89.445  105.769 147.582 1.00 81.86  ?  797  ARG C CZ    1 
ATOM   9581  N  NH1   . ARG C 1 925  ? 89.265  106.024 148.870 1.00 91.45  ?  797  ARG C NH1   1 
ATOM   9582  N  NH2   . ARG C 1 925  ? 88.443  105.304 146.852 1.00 79.83  ?  797  ARG C NH2   1 
ATOM   9583  N  N     . VAL C 1 926  ? 96.326  107.345 145.924 1.00 54.39  ?  798  VAL C N     1 
ATOM   9584  C  CA    . VAL C 1 926  ? 96.402  108.154 144.716 1.00 55.98  ?  798  VAL C CA    1 
ATOM   9585  C  C     . VAL C 1 926  ? 97.702  107.950 143.954 1.00 52.37  ?  798  VAL C C     1 
ATOM   9586  O  O     . VAL C 1 926  ? 97.871  108.522 142.867 1.00 46.65  ?  798  VAL C O     1 
ATOM   9587  C  CB    . VAL C 1 926  ? 96.207  109.643 145.062 1.00 59.11  ?  798  VAL C CB    1 
ATOM   9588  C  CG1   . VAL C 1 926  ? 97.533  110.281 145.462 1.00 55.43  ?  798  VAL C CG1   1 
ATOM   9589  C  CG2   . VAL C 1 926  ? 95.576  110.367 143.904 1.00 56.82  ?  798  VAL C CG2   1 
ATOM   9590  N  N     . LYS C 1 927  ? 98.620  107.144 144.486 1.00 52.23  ?  799  LYS C N     1 
ATOM   9591  C  CA    . LYS C 1 927  ? 99.920  106.892 143.868 1.00 47.01  ?  799  LYS C CA    1 
ATOM   9592  C  C     . LYS C 1 927  ? 100.726 108.187 143.744 1.00 37.95  ?  799  LYS C C     1 
ATOM   9593  O  O     . LYS C 1 927  ? 101.089 108.633 142.653 1.00 38.20  ?  799  LYS C O     1 
ATOM   9594  C  CB    . LYS C 1 927  ? 99.768  106.188 142.512 1.00 52.97  ?  799  LYS C CB    1 
ATOM   9595  C  CG    . LYS C 1 927  ? 99.547  104.677 142.610 1.00 67.98  ?  799  LYS C CG    1 
ATOM   9596  C  CD    . LYS C 1 927  ? 98.147  104.325 143.113 1.00 70.21  ?  799  LYS C CD    1 
ATOM   9597  C  CE    . LYS C 1 927  ? 97.926  102.817 143.176 1.00 65.37  ?  799  LYS C CE    1 
ATOM   9598  N  NZ    . LYS C 1 927  ? 98.850  102.145 144.131 1.00 57.93  ?  799  LYS C NZ    1 
ATOM   9599  N  N     . GLY C 1 928  ? 100.984 108.796 144.903 1.00 42.15  ?  800  GLY C N     1 
ATOM   9600  C  CA    . GLY C 1 928  ? 101.903 109.909 145.024 1.00 45.32  ?  800  GLY C CA    1 
ATOM   9601  C  C     . GLY C 1 928  ? 101.504 111.189 144.327 1.00 38.98  ?  800  GLY C C     1 
ATOM   9602  O  O     . GLY C 1 928  ? 102.253 112.168 144.401 1.00 37.93  ?  800  GLY C O     1 
ATOM   9603  N  N     . VAL C 1 929  ? 100.358 111.225 143.655 1.00 33.79  ?  801  VAL C N     1 
ATOM   9604  C  CA    . VAL C 1 929  ? 99.925  112.447 142.987 1.00 28.89  ?  801  VAL C CA    1 
ATOM   9605  C  C     . VAL C 1 929  ? 99.616  113.499 144.045 1.00 21.94  ?  801  VAL C C     1 
ATOM   9606  O  O     . VAL C 1 929  ? 98.739  113.305 144.894 1.00 27.88  ?  801  VAL C O     1 
ATOM   9607  C  CB    . VAL C 1 929  ? 98.705  112.178 142.101 1.00 35.47  ?  801  VAL C CB    1 
ATOM   9608  C  CG1   . VAL C 1 929  ? 98.333  113.428 141.340 1.00 31.67  ?  801  VAL C CG1   1 
ATOM   9609  C  CG2   . VAL C 1 929  ? 98.983  111.017 141.155 1.00 43.27  ?  801  VAL C CG2   1 
ATOM   9610  N  N     . SER C 1 930  ? 100.339 114.622 144.002 1.00 19.17  ?  802  SER C N     1 
ATOM   9611  C  CA    . SER C 1 930  ? 100.147 115.658 145.010 1.00 23.30  ?  802  SER C CA    1 
ATOM   9612  C  C     . SER C 1 930  ? 100.117 117.081 144.471 1.00 20.28  ?  802  SER C C     1 
ATOM   9613  O  O     . SER C 1 930  ? 99.905  118.007 145.261 1.00 18.37  ?  802  SER C O     1 
ATOM   9614  C  CB    . SER C 1 930  ? 101.242 115.566 146.086 1.00 24.72  ?  802  SER C CB    1 
ATOM   9615  O  OG    . SER C 1 930  ? 101.138 116.641 147.006 1.00 17.28  ?  802  SER C OG    1 
ATOM   9616  N  N     . ALA C 1 931  ? 100.322 117.296 143.175 1.00 19.28  ?  803  ALA C N     1 
ATOM   9617  C  CA    . ALA C 1 931  ? 100.375 118.649 142.643 1.00 11.80  ?  803  ALA C CA    1 
ATOM   9618  C  C     . ALA C 1 931  ? 99.767  118.654 141.252 1.00 10.61  ?  803  ALA C C     1 
ATOM   9619  O  O     . ALA C 1 931  ? 100.029 117.752 140.453 1.00 12.42  ?  803  ALA C O     1 
ATOM   9620  C  CB    . ALA C 1 931  ? 101.811 119.177 142.598 1.00 10.12  ?  803  ALA C CB    1 
ATOM   9621  N  N     . LYS C 1 932  ? 98.963  119.671 140.973 1.00 8.67   ?  804  LYS C N     1 
ATOM   9622  C  CA    . LYS C 1 932  ? 98.238  119.740 139.714 1.00 11.46  ?  804  LYS C CA    1 
ATOM   9623  C  C     . LYS C 1 932  ? 99.210  119.804 138.543 1.00 11.24  ?  804  LYS C C     1 
ATOM   9624  O  O     . LYS C 1 932  ? 99.887  120.823 138.351 1.00 12.40  ?  804  LYS C O     1 
ATOM   9625  C  CB    . LYS C 1 932  ? 97.306  120.951 139.707 1.00 11.83  ?  804  LYS C CB    1 
ATOM   9626  C  CG    . LYS C 1 932  ? 96.660  121.239 138.367 1.00 16.13  ?  804  LYS C CG    1 
ATOM   9627  C  CD    . LYS C 1 932  ? 95.794  122.479 138.454 1.00 19.05  ?  804  LYS C CD    1 
ATOM   9628  C  CE    . LYS C 1 932  ? 94.948  122.653 137.209 1.00 22.89  ?  804  LYS C CE    1 
ATOM   9629  N  NZ    . LYS C 1 932  ? 93.952  123.744 137.393 1.00 35.19  ?  804  LYS C NZ    1 
ATOM   9630  N  N     . PRO C 1 933  ? 99.309  118.748 137.742 1.00 11.84  ?  805  PRO C N     1 
ATOM   9631  C  CA    . PRO C 1 933  ? 100.177 118.812 136.567 1.00 11.64  ?  805  PRO C CA    1 
ATOM   9632  C  C     . PRO C 1 933  ? 99.589  119.767 135.550 1.00 10.16  ?  805  PRO C C     1 
ATOM   9633  O  O     . PRO C 1 933  ? 98.375  119.982 135.496 1.00 10.17  ?  805  PRO C O     1 
ATOM   9634  C  CB    . PRO C 1 933  ? 100.184 117.374 136.039 1.00 19.41  ?  805  PRO C CB    1 
ATOM   9635  C  CG    . PRO C 1 933  ? 99.000  116.706 136.653 1.00 19.37  ?  805  PRO C CG    1 
ATOM   9636  C  CD    . PRO C 1 933  ? 98.398  117.592 137.701 1.00 16.08  ?  805  PRO C CD    1 
ATOM   9637  N  N     . PHE C 1 934  ? 100.462 120.357 134.741 1.00 13.56  ?  806  PHE C N     1 
ATOM   9638  C  CA    . PHE C 1 934  ? 99.992  121.352 133.793 1.00 16.61  ?  806  PHE C CA    1 
ATOM   9639  C  C     . PHE C 1 934  ? 100.627 121.280 132.412 1.00 19.41  ?  806  PHE C C     1 
ATOM   9640  O  O     . PHE C 1 934  ? 100.285 122.111 131.564 1.00 22.05  ?  806  PHE C O     1 
ATOM   9641  C  CB    . PHE C 1 934  ? 100.199 122.761 134.367 1.00 14.55  ?  806  PHE C CB    1 
ATOM   9642  C  CG    . PHE C 1 934  ? 101.591 123.283 134.197 1.00 12.75  ?  806  PHE C CG    1 
ATOM   9643  C  CD1   . PHE C 1 934  ? 102.628 122.785 134.962 1.00 13.12  ?  806  PHE C CD1   1 
ATOM   9644  C  CD2   . PHE C 1 934  ? 101.861 124.273 133.269 1.00 12.85  ?  806  PHE C CD2   1 
ATOM   9645  C  CE1   . PHE C 1 934  ? 103.903 123.270 134.809 1.00 14.06  ?  806  PHE C CE1   1 
ATOM   9646  C  CE