data_6DBV
# 
_entry.id   6DBV 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.320 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   6DBV         
WWPDB D_1000234341 
EMDB  EMD-7851     
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.details 
_pdbx_database_related.db_id 
_pdbx_database_related.content_type 
EMDB .                                                                                       EMD-7843 'other EM volume'      
EMDB .                                                                                       EMD-7844 'other EM volume'      
EMDB .                                                                                       EMD-7845 'other EM volume'      
EMDB .                                                                                       EMD-7846 'other EM volume'      
EMDB .                                                                                       EMD-7847 'other EM volume'      
EMDB .                                                                                       EMD-7848 'other EM volume'      
EMDB .                                                                                       EMD-7849 'other EM volume'      
EMDB .                                                                                       EMD-7850 'other EM volume'      
EMDB 'Cryo-EM structure of RAG in complex with melted 12-RSS and unmelted 23-RSS substrates' EMD-7851 'associated EM volume' 
EMDB .                                                                                       EMD-7852 'other EM volume'      
EMDB .                                                                                       EMD-7853 'other EM volume'      
PDB  .                                                                                       6DBI     unspecified            
PDB  .                                                                                       6DBJ     unspecified            
PDB  .                                                                                       6DBL     unspecified            
PDB  .                                                                                       6DBO     unspecified            
PDB  .                                                                                       6DBQ     unspecified            
PDB  .                                                                                       6DBR     unspecified            
PDB  .                                                                                       6DBU     unspecified            
PDB  .                                                                                       6DBV     unspecified            
PDB  .                                                                                       6DBW     unspecified            
PDB  .                                                                                       6DBX     unspecified            
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.entry_id                        6DBV 
_pdbx_database_status.recvd_initial_deposition_date   2018-05-03 
_pdbx_database_status.SG_entry                        N 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
_audit_author.identifier_ORCID 
'Wu, H.'   1 ? 
'Liao, M.' 2 ? 
'Ru, H.'   3 ? 
'Mi, W.'   4 ? 
# 
_citation.abstract                  ? 
_citation.abstract_id_CAS           ? 
_citation.book_id_ISBN              ? 
_citation.book_publisher            ? 
_citation.book_publisher_city       ? 
_citation.book_title                ? 
_citation.coordinate_linkage        ? 
_citation.country                   US 
_citation.database_id_Medline       ? 
_citation.details                   ? 
_citation.id                        primary 
_citation.journal_abbrev            'Nat. Struct. Mol. Biol.' 
_citation.journal_id_ASTM           ? 
_citation.journal_id_CSD            ? 
_citation.journal_id_ISSN           1545-9985 
_citation.journal_full              ? 
_citation.journal_issue             ? 
_citation.journal_volume            25 
_citation.language                  ? 
_citation.page_first                732 
_citation.page_last                 742 
_citation.title                     'DNA melting initiates the RAG catalytic pathway.' 
_citation.year                      2018 
_citation.database_id_CSD           ? 
_citation.pdbx_database_id_DOI      10.1038/s41594-018-0098-5 
_citation.pdbx_database_id_PubMed   30061602 
_citation.unpublished_flag          ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Ru, H.'       1 ?                   
primary 'Mi, W.'       2 ?                   
primary 'Zhang, P.'    3 ?                   
primary 'Alt, F.W.'    4 ?                   
primary 'Schatz, D.G.' 5 0000-0002-5669-1176 
primary 'Liao, M.'     6 ?                   
primary 'Wu, H.'       7 0000-0002-7281-8579 
# 
_cell.angle_alpha                  90.00 
_cell.angle_alpha_esd              ? 
_cell.angle_beta                   90.00 
_cell.angle_beta_esd               ? 
_cell.angle_gamma                  90.00 
_cell.angle_gamma_esd              ? 
_cell.entry_id                     6DBV 
_cell.details                      ? 
_cell.formula_units_Z              ? 
_cell.length_a                     1 
_cell.length_a_esd                 ? 
_cell.length_b                     1 
_cell.length_b_esd                 ? 
_cell.length_c                     1 
_cell.length_c_esd                 ? 
_cell.volume                       ? 
_cell.volume_esd                   ? 
_cell.Z_PDB                        1 
_cell.reciprocal_angle_alpha       ? 
_cell.reciprocal_angle_beta        ? 
_cell.reciprocal_angle_gamma       ? 
_cell.reciprocal_angle_alpha_esd   ? 
_cell.reciprocal_angle_beta_esd    ? 
_cell.reciprocal_angle_gamma_esd   ? 
_cell.reciprocal_length_a          ? 
_cell.reciprocal_length_b          ? 
_cell.reciprocal_length_c          ? 
_cell.reciprocal_length_a_esd      ? 
_cell.reciprocal_length_b_esd      ? 
_cell.reciprocal_length_c_esd      ? 
_cell.pdbx_unique_axis             ? 
# 
_symmetry.entry_id                         6DBV 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                1 
_symmetry.space_group_name_Hall            ? 
_symmetry.space_group_name_H-M             'P 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'Recombination activating gene 1 - MBP chimera' 131188.062 1 2.3.2.27 ? ? ? 
2 polymer     man 'Recombination activating gene 2'               59435.930  2 ?        ? ? ? 
3 polymer     man 'Recombination activating gene 1 - MBP chimera' 131160.047 1 2.3.2.27 ? ? ? 
4 polymer     syn 'Forward strand of 12-RSS substrate DNA'        15364.879  1 ?        ? ? ? 
5 polymer     syn 'Reverse strand of 12-RSS substrate DNA'        15439.880  1 ?        ? ? ? 
6 polymer     syn 'Forward strand of 23-RSS substrate DNA'        18731.996  1 ?        ? ? ? 
7 polymer     syn 'Reverse strand of 23-RSS substrate DNA'        18870.094  1 ?        ? ? ? 
8 non-polymer syn 'ZINC ION'                                      65.409     2 ?        ? ? ? 
9 non-polymer syn 'CALCIUM ION'                                   40.078     4 ?        ? ? ? 
# 
loop_
_entity_name_com.entity_id 
_entity_name_com.name 
1 'MBP,MMBP,Maltodextrin-binding protein,RAG-1' 
2 'V(D)J recombination-activating protein 2'    
3 'MBP,MMBP,Maltodextrin-binding protein'       
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)'        no no 
;MGSSHHHHHHGTKTEEGKLVIWINGDKGYNGLAEVGKKFEKDTGIKVTVEHPDKLEEKFPQVAATGDGPDIIFWAHDRFG
GYAQSGLLAEITPDKAFQDKLYPFTWDAVRYNGKLIAYPIAVEALSLIYNKDLLPNPPKTWEEIPALDKELKAKGKSALM
FNLQEPYFTWPLIAADGGYAFKYENGKYDIKDVGVDNAGAKAGLTFLVDLIKNKHMNADTDYSIAEAAFNKGETAMTING
PWAWSNIDTSKVNYGVTVLPTFKGQPSKPFVGVLSAGINAASPNKELAKEFLENYLLTDEGLEAVNKDKPLGAVALKSYE
EELAKDPRIAATMENAQKGEIMPNIPQMSAFWYAVRTAVINAASGRQTVDEALKDAQTGTDYDIPTTLEVLFQGPLGSRC
QRDHLSTKLIPTEVPADLIRAVTCQVCDHLLSDPVQSPCRHLFCRLCIIRYTHALGPNCPTCNQHLNPSHLIKPAKFFLA
TLSSLPLLCPSEECSDWVRLDSFREHCLNHYREKESQEEQTPSEQNLDGYLPVNKGGRPRQHLLSLTRRAQKHRLRDLKN
QVKTFAEKEEGGDVKSVCLTLFLLALRAGNEHRQADELEAMMQGRGFGLHPAVCLAIRVNTFLSCSQYHKMYRTVKATSG
RQIFQPLHTLRNAEKELLPGFHQFEWQPALKNVSTSWDVGIIDGLSGWTVSVDDVPADTISRRFRYDVALVSALKDLEED
IMEGLRERALDDSMCTSGFTVVVKESCDGMGDVSEKHGSGPAVPEKAVRFSFTIMSISIRLEGEDDGITIFQEQKPNSEL
SCRPLCLMFVDESDHETLTAILGPVVAERKAMMESRLIISVGGLLRSFRFFFRGTGYDEKMVREMEGLEASGSTYICTLC
DSTRAEASQNMVLHSITRSHDENLERYEIWRKNPFSESADELRDRVKGVSAKPFMETQPTLDALHCDIGNATEFYKIFQD
EIGEVYQKPNPSREERRRWRSTLDKQLRKKMKLKPVMRMNGNYARRLMTREAVEAVCELVPSEERREALLKLMDLYLQMK
PVWRSTCPSRDCPDQLCQYSYNSQQFADLLSSMFKYRYDGKITNYLHKTLAHVPEIVERDGSIGAWASEGNESGNKLFRR
FRKMNARQSKTFELEDILKHHWLYTSKYLQKFMEAHKNS
;
;MGSSHHHHHHGTKTEEGKLVIWINGDKGYNGLAEVGKKFEKDTGIKVTVEHPDKLEEKFPQVAATGDGPDIIFWAHDRFG
GYAQSGLLAEITPDKAFQDKLYPFTWDAVRYNGKLIAYPIAVEALSLIYNKDLLPNPPKTWEEIPALDKELKAKGKSALM
FNLQEPYFTWPLIAADGGYAFKYENGKYDIKDVGVDNAGAKAGLTFLVDLIKNKHMNADTDYSIAEAAFNKGETAMTING
PWAWSNIDTSKVNYGVTVLPTFKGQPSKPFVGVLSAGINAASPNKELAKEFLENYLLTDEGLEAVNKDKPLGAVALKSYE
EELAKDPRIAATMENAQKGEIMPNIPQMSAFWYAVRTAVINAASGRQTVDEALKDAQTGTDYDIPTTLEVLFQGPLGSRC
QRDHLSTKLIPTEVPADLIRAVTCQVCDHLLSDPVQSPCRHLFCRLCIIRYTHALGPNCPTCNQHLNPSHLIKPAKFFLA
TLSSLPLLCPSEECSDWVRLDSFREHCLNHYREKESQEEQTPSEQNLDGYLPVNKGGRPRQHLLSLTRRAQKHRLRDLKN
QVKTFAEKEEGGDVKSVCLTLFLLALRAGNEHRQADELEAMMQGRGFGLHPAVCLAIRVNTFLSCSQYHKMYRTVKATSG
RQIFQPLHTLRNAEKELLPGFHQFEWQPALKNVSTSWDVGIIDGLSGWTVSVDDVPADTISRRFRYDVALVSALKDLEED
IMEGLRERALDDSMCTSGFTVVVKESCDGMGDVSEKHGSGPAVPEKAVRFSFTIMSISIRLEGEDDGITIFQEQKPNSEL
SCRPLCLMFVDESDHETLTAILGPVVAERKAMMESRLIISVGGLLRSFRFFFRGTGYDEKMVREMEGLEASGSTYICTLC
DSTRAEASQNMVLHSITRSHDENLERYEIWRKNPFSESADELRDRVKGVSAKPFMETQPTLDALHCDIGNATEFYKIFQD
EIGEVYQKPNPSREERRRWRSTLDKQLRKKMKLKPVMRMNGNYARRLMTREAVEAVCELVPSEERREALLKLMDLYLQMK
PVWRSTCPSRDCPDQLCQYSYNSQQFADLLSSMFKYRYDGKITNYLHKTLAHVPEIVERDGSIGAWASEGNESGNKLFRR
FRKMNARQSKTFELEDILKHHWLYTSKYLQKFMEAHKNS
;
A   ? 
2 'polypeptide(L)'        no no 
;GGSMSLQPLTAVNCGSLVQPGFSLLDLEGDVYLFGQKGWPKRSCPTGIFGVRIKKGELKLRAISFSNNSSYLPPLRCPAI
AHFEAQDGKPECYLIHGGRTPNNELSSSLYMLSVDSRGCNRKVTLRCEEKELVGDVPSARYGHTLSVINSRGKTACVLFG
GRSYMPPTERTTQNWNSVVDCPPQVYLIDLEFGCCTAHTLPELTDGQSFHVALARQDCVYFLGGHILSSDCRPSRLIRLH
VELLLGSPVLTCTILHEGLTITSAIASPIGYHEYIIFGGYQSETQKRMECTYVGLDDVGVHMESREPPQWTSEISHSRTW
FGGSLGKGTALVAIPSEGNPTPPEAYHFYQVSFQKEQDGEATAQGGSQESTDFEDSAPLEDSEELYFGREPHELEYSSDV
EGDTYNEEDEEDESQTGYWIKCCLSCQVDPNIWEPYYSTELTRPAMIFCSRGEGGHWVHAQCMELPESLLLQLSQDNSKY
FCLDHGGLPKQEMTPPKQMLPVKRVPMKMTHRKAPVSLKMTPAKKTFLRRLFD
;
;GGSMSLQPLTAVNCGSLVQPGFSLLDLEGDVYLFGQKGWPKRSCPTGIFGVRIKKGELKLRAISFSNNSSYLPPLRCPAI
AHFEAQDGKPECYLIHGGRTPNNELSSSLYMLSVDSRGCNRKVTLRCEEKELVGDVPSARYGHTLSVINSRGKTACVLFG
GRSYMPPTERTTQNWNSVVDCPPQVYLIDLEFGCCTAHTLPELTDGQSFHVALARQDCVYFLGGHILSSDCRPSRLIRLH
VELLLGSPVLTCTILHEGLTITSAIASPIGYHEYIIFGGYQSETQKRMECTYVGLDDVGVHMESREPPQWTSEISHSRTW
FGGSLGKGTALVAIPSEGNPTPPEAYHFYQVSFQKEQDGEATAQGGSQESTDFEDSAPLEDSEELYFGREPHELEYSSDV
EGDTYNEEDEEDESQTGYWIKCCLSCQVDPNIWEPYYSTELTRPAMIFCSRGEGGHWVHAQCMELPESLLLQLSQDNSKY
FCLDHGGLPKQEMTPPKQMLPVKRVPMKMTHRKAPVSLKMTPAKKTFLRRLFD
;
B,D ? 
3 'polypeptide(L)'        no no 
;MGSSHHHHHHGTKTEEGKLVIWINGDKGYNGLAEVGKKFEKDTGIKVTVEHPDKLEEKFPQVAATGDGPDIIFWAHDRFG
GYAQSGLLAEITPDKAFQDKLYPFTWDAVRYNGKLIAYPIAVEALSLIYNKDLLPNPPKTWEEIPALDKELKAKGKSALM
FNLQEPYFTWPLIAADGGYAFKYENGKYDIKDVGVDNAGAKAGLTFLVDLIKNKHMNADTDYSIAEAAFNKGETAMTING
PWAWSNIDTSKVNYGVTVLPTFKGQPSKPFVGVLSAGINAASPNKELAKEFLENYLLTDEGLEAVNKDKPLGAVALKSYE
EELAKDPRIAATMENAQKGEIMPNIPQMSAFWYAVRTAVINAASGRQTVDEALKDAQTGTDYDIPTTLEVLFQGPLGSRC
QRDHLSTKLIPTEVPADLIRAVTCQVCDHLLSDPVQSPCRHLFCRLCIIRYTHALGPNCPTCNQHLNPSHLIKPAKFFLA
TLSSLPLLCPSEECSDWVRLDSFREHCLNHYREKESQEEQTPSEQNLDGYLPVNKGGRPRQHLLSLTRRAQKHRLRDLKN
QVKTFAEKEEGGDVKSVCLTLFLLALRAGNEHKQADELEAMMQGRGFGLHPAVCLAIRVNTFLSCSQYHKMYRTVKATSG
RQIFQPLHTLRNAEKELLPGFHQFEWQPALKNVSTSWDVGIIDGLSGWTVSVDDVPADTISRRFRYDVALVSALKDLEED
IMEGLRERALDDSMCTSGFTVVVKESCDGMGDVSEKHGSGPAVPEKAVRFSFTIMSISIRLEGEDDGITIFQEQKPNSEL
SCRPLCLMFVDESDHETLTAILGPVVAERKAMMESRLIISVGGLLRSFRFFFRGTGYDEKMVREMEGLEASGSTYICTLC
DSTRAEASQNMVLHSITRSHDENLERYEIWRKNPFSESADELRDRVKGVSAKPFMETQPTLDALHCDIGNATEFYKIFQD
EIGEVYQKPNPSREERRRWRSTLDKQLRKKMKLKPVMRMNGNYARRLMTREAVEAVCELVPSEERREALLKLMDLYLQMK
PVWRSTCPSRDCPDQLCQYSYNSQQFADLLSSMFKYRYDGKITNYLHKTLAHVPEIVERDGSIGAWASEGNESGNKLFRR
FRKMNARQSKTFELEDILKHHWLYTSKYLQKFMEAHKNS
;
;MGSSHHHHHHGTKTEEGKLVIWINGDKGYNGLAEVGKKFEKDTGIKVTVEHPDKLEEKFPQVAATGDGPDIIFWAHDRFG
GYAQSGLLAEITPDKAFQDKLYPFTWDAVRYNGKLIAYPIAVEALSLIYNKDLLPNPPKTWEEIPALDKELKAKGKSALM
FNLQEPYFTWPLIAADGGYAFKYENGKYDIKDVGVDNAGAKAGLTFLVDLIKNKHMNADTDYSIAEAAFNKGETAMTING
PWAWSNIDTSKVNYGVTVLPTFKGQPSKPFVGVLSAGINAASPNKELAKEFLENYLLTDEGLEAVNKDKPLGAVALKSYE
EELAKDPRIAATMENAQKGEIMPNIPQMSAFWYAVRTAVINAASGRQTVDEALKDAQTGTDYDIPTTLEVLFQGPLGSRC
QRDHLSTKLIPTEVPADLIRAVTCQVCDHLLSDPVQSPCRHLFCRLCIIRYTHALGPNCPTCNQHLNPSHLIKPAKFFLA
TLSSLPLLCPSEECSDWVRLDSFREHCLNHYREKESQEEQTPSEQNLDGYLPVNKGGRPRQHLLSLTRRAQKHRLRDLKN
QVKTFAEKEEGGDVKSVCLTLFLLALRAGNEHKQADELEAMMQGRGFGLHPAVCLAIRVNTFLSCSQYHKMYRTVKATSG
RQIFQPLHTLRNAEKELLPGFHQFEWQPALKNVSTSWDVGIIDGLSGWTVSVDDVPADTISRRFRYDVALVSALKDLEED
IMEGLRERALDDSMCTSGFTVVVKESCDGMGDVSEKHGSGPAVPEKAVRFSFTIMSISIRLEGEDDGITIFQEQKPNSEL
SCRPLCLMFVDESDHETLTAILGPVVAERKAMMESRLIISVGGLLRSFRFFFRGTGYDEKMVREMEGLEASGSTYICTLC
DSTRAEASQNMVLHSITRSHDENLERYEIWRKNPFSESADELRDRVKGVSAKPFMETQPTLDALHCDIGNATEFYKIFQD
EIGEVYQKPNPSREERRRWRSTLDKQLRKKMKLKPVMRMNGNYARRLMTREAVEAVCELVPSEERREALLKLMDLYLQMK
PVWRSTCPSRDCPDQLCQYSYNSQQFADLLSSMFKYRYDGKITNYLHKTLAHVPEIVERDGSIGAWASEGNESGNKLFRR
FRKMNARQSKTFELEDILKHHWLYTSKYLQKFMEAHKNS
;
C   ? 
4 polydeoxyribonucleotide no no 
;(DG)(DA)(DT)(DC)(DT)(DG)(DG)(DC)(DC)(DT)(DG)(DT)(DC)(DT)(DT)(DA)(DC)(DA)(DC)(DA)
(DG)(DT)(DG)(DC)(DT)(DA)(DC)(DA)(DG)(DA)(DC)(DT)(DG)(DG)(DA)(DA)(DC)(DA)(DA)(DA)
(DA)(DA)(DC)(DC)(DC)(DT)(DG)(DC)(DA)(DG)
;
GATCTGGCCTGTCTTACACAGTGCTACAGACTGGAACAAAAACCCTGCAG E   ? 
5 polydeoxyribonucleotide no no 
;(DC)(DT)(DG)(DC)(DA)(DG)(DG)(DG)(DT)(DT)(DT)(DT)(DT)(DG)(DT)(DT)(DC)(DC)(DA)(DG)
(DT)(DC)(DT)(DG)(DT)(DA)(DG)(DC)(DA)(DC)(DT)(DG)(DT)(DG)(DT)(DA)(DA)(DG)(DA)(DC)
(DA)(DG)(DG)(DC)(DC)(DA)(DG)(DA)(DT)(DC)
;
CTGCAGGGTTTTTGTTCCAGTCTGTAGCACTGTGTAAGACAGGCCAGATC F   ? 
6 polydeoxyribonucleotide no no 
;(DG)(DA)(DT)(DC)(DT)(DG)(DG)(DC)(DC)(DT)(DG)(DT)(DC)(DT)(DT)(DA)(DC)(DA)(DC)(DA)
(DG)(DT)(DG)(DG)(DT)(DA)(DG)(DT)(DA)(DC)(DT)(DC)(DC)(DA)(DC)(DT)(DG)(DT)(DC)(DT)
(DG)(DG)(DC)(DT)(DG)(DT)(DA)(DC)(DA)(DA)(DA)(DA)(DA)(DC)(DC)(DC)(DT)(DG)(DC)(DA)
(DG)
;
GATCTGGCCTGTCTTACACAGTGGTAGTACTCCACTGTCTGGCTGTACAAAAACCCTGCAG G   ? 
7 polydeoxyribonucleotide no no 
;(DC)(DT)(DG)(DC)(DA)(DG)(DG)(DG)(DT)(DT)(DT)(DT)(DT)(DG)(DT)(DA)(DC)(DA)(DG)(DC)
(DC)(DA)(DG)(DA)(DC)(DA)(DG)(DT)(DG)(DG)(DA)(DG)(DT)(DA)(DC)(DT)(DA)(DC)(DC)(DA)
(DC)(DT)(DG)(DT)(DG)(DT)(DA)(DA)(DG)(DA)(DC)(DA)(DG)(DG)(DC)(DC)(DA)(DG)(DA)(DT)
(DC)
;
CTGCAGGGTTTTTGTACAGCCAGACAGTGGAGTACTACCACTGTGTAAGACAGGCCAGATC H   ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1    MET n 
1 2    GLY n 
1 3    SER n 
1 4    SER n 
1 5    HIS n 
1 6    HIS n 
1 7    HIS n 
1 8    HIS n 
1 9    HIS n 
1 10   HIS n 
1 11   GLY n 
1 12   THR n 
1 13   LYS n 
1 14   THR n 
1 15   GLU n 
1 16   GLU n 
1 17   GLY n 
1 18   LYS n 
1 19   LEU n 
1 20   VAL n 
1 21   ILE n 
1 22   TRP n 
1 23   ILE n 
1 24   ASN n 
1 25   GLY n 
1 26   ASP n 
1 27   LYS n 
1 28   GLY n 
1 29   TYR n 
1 30   ASN n 
1 31   GLY n 
1 32   LEU n 
1 33   ALA n 
1 34   GLU n 
1 35   VAL n 
1 36   GLY n 
1 37   LYS n 
1 38   LYS n 
1 39   PHE n 
1 40   GLU n 
1 41   LYS n 
1 42   ASP n 
1 43   THR n 
1 44   GLY n 
1 45   ILE n 
1 46   LYS n 
1 47   VAL n 
1 48   THR n 
1 49   VAL n 
1 50   GLU n 
1 51   HIS n 
1 52   PRO n 
1 53   ASP n 
1 54   LYS n 
1 55   LEU n 
1 56   GLU n 
1 57   GLU n 
1 58   LYS n 
1 59   PHE n 
1 60   PRO n 
1 61   GLN n 
1 62   VAL n 
1 63   ALA n 
1 64   ALA n 
1 65   THR n 
1 66   GLY n 
1 67   ASP n 
1 68   GLY n 
1 69   PRO n 
1 70   ASP n 
1 71   ILE n 
1 72   ILE n 
1 73   PHE n 
1 74   TRP n 
1 75   ALA n 
1 76   HIS n 
1 77   ASP n 
1 78   ARG n 
1 79   PHE n 
1 80   GLY n 
1 81   GLY n 
1 82   TYR n 
1 83   ALA n 
1 84   GLN n 
1 85   SER n 
1 86   GLY n 
1 87   LEU n 
1 88   LEU n 
1 89   ALA n 
1 90   GLU n 
1 91   ILE n 
1 92   THR n 
1 93   PRO n 
1 94   ASP n 
1 95   LYS n 
1 96   ALA n 
1 97   PHE n 
1 98   GLN n 
1 99   ASP n 
1 100  LYS n 
1 101  LEU n 
1 102  TYR n 
1 103  PRO n 
1 104  PHE n 
1 105  THR n 
1 106  TRP n 
1 107  ASP n 
1 108  ALA n 
1 109  VAL n 
1 110  ARG n 
1 111  TYR n 
1 112  ASN n 
1 113  GLY n 
1 114  LYS n 
1 115  LEU n 
1 116  ILE n 
1 117  ALA n 
1 118  TYR n 
1 119  PRO n 
1 120  ILE n 
1 121  ALA n 
1 122  VAL n 
1 123  GLU n 
1 124  ALA n 
1 125  LEU n 
1 126  SER n 
1 127  LEU n 
1 128  ILE n 
1 129  TYR n 
1 130  ASN n 
1 131  LYS n 
1 132  ASP n 
1 133  LEU n 
1 134  LEU n 
1 135  PRO n 
1 136  ASN n 
1 137  PRO n 
1 138  PRO n 
1 139  LYS n 
1 140  THR n 
1 141  TRP n 
1 142  GLU n 
1 143  GLU n 
1 144  ILE n 
1 145  PRO n 
1 146  ALA n 
1 147  LEU n 
1 148  ASP n 
1 149  LYS n 
1 150  GLU n 
1 151  LEU n 
1 152  LYS n 
1 153  ALA n 
1 154  LYS n 
1 155  GLY n 
1 156  LYS n 
1 157  SER n 
1 158  ALA n 
1 159  LEU n 
1 160  MET n 
1 161  PHE n 
1 162  ASN n 
1 163  LEU n 
1 164  GLN n 
1 165  GLU n 
1 166  PRO n 
1 167  TYR n 
1 168  PHE n 
1 169  THR n 
1 170  TRP n 
1 171  PRO n 
1 172  LEU n 
1 173  ILE n 
1 174  ALA n 
1 175  ALA n 
1 176  ASP n 
1 177  GLY n 
1 178  GLY n 
1 179  TYR n 
1 180  ALA n 
1 181  PHE n 
1 182  LYS n 
1 183  TYR n 
1 184  GLU n 
1 185  ASN n 
1 186  GLY n 
1 187  LYS n 
1 188  TYR n 
1 189  ASP n 
1 190  ILE n 
1 191  LYS n 
1 192  ASP n 
1 193  VAL n 
1 194  GLY n 
1 195  VAL n 
1 196  ASP n 
1 197  ASN n 
1 198  ALA n 
1 199  GLY n 
1 200  ALA n 
1 201  LYS n 
1 202  ALA n 
1 203  GLY n 
1 204  LEU n 
1 205  THR n 
1 206  PHE n 
1 207  LEU n 
1 208  VAL n 
1 209  ASP n 
1 210  LEU n 
1 211  ILE n 
1 212  LYS n 
1 213  ASN n 
1 214  LYS n 
1 215  HIS n 
1 216  MET n 
1 217  ASN n 
1 218  ALA n 
1 219  ASP n 
1 220  THR n 
1 221  ASP n 
1 222  TYR n 
1 223  SER n 
1 224  ILE n 
1 225  ALA n 
1 226  GLU n 
1 227  ALA n 
1 228  ALA n 
1 229  PHE n 
1 230  ASN n 
1 231  LYS n 
1 232  GLY n 
1 233  GLU n 
1 234  THR n 
1 235  ALA n 
1 236  MET n 
1 237  THR n 
1 238  ILE n 
1 239  ASN n 
1 240  GLY n 
1 241  PRO n 
1 242  TRP n 
1 243  ALA n 
1 244  TRP n 
1 245  SER n 
1 246  ASN n 
1 247  ILE n 
1 248  ASP n 
1 249  THR n 
1 250  SER n 
1 251  LYS n 
1 252  VAL n 
1 253  ASN n 
1 254  TYR n 
1 255  GLY n 
1 256  VAL n 
1 257  THR n 
1 258  VAL n 
1 259  LEU n 
1 260  PRO n 
1 261  THR n 
1 262  PHE n 
1 263  LYS n 
1 264  GLY n 
1 265  GLN n 
1 266  PRO n 
1 267  SER n 
1 268  LYS n 
1 269  PRO n 
1 270  PHE n 
1 271  VAL n 
1 272  GLY n 
1 273  VAL n 
1 274  LEU n 
1 275  SER n 
1 276  ALA n 
1 277  GLY n 
1 278  ILE n 
1 279  ASN n 
1 280  ALA n 
1 281  ALA n 
1 282  SER n 
1 283  PRO n 
1 284  ASN n 
1 285  LYS n 
1 286  GLU n 
1 287  LEU n 
1 288  ALA n 
1 289  LYS n 
1 290  GLU n 
1 291  PHE n 
1 292  LEU n 
1 293  GLU n 
1 294  ASN n 
1 295  TYR n 
1 296  LEU n 
1 297  LEU n 
1 298  THR n 
1 299  ASP n 
1 300  GLU n 
1 301  GLY n 
1 302  LEU n 
1 303  GLU n 
1 304  ALA n 
1 305  VAL n 
1 306  ASN n 
1 307  LYS n 
1 308  ASP n 
1 309  LYS n 
1 310  PRO n 
1 311  LEU n 
1 312  GLY n 
1 313  ALA n 
1 314  VAL n 
1 315  ALA n 
1 316  LEU n 
1 317  LYS n 
1 318  SER n 
1 319  TYR n 
1 320  GLU n 
1 321  GLU n 
1 322  GLU n 
1 323  LEU n 
1 324  ALA n 
1 325  LYS n 
1 326  ASP n 
1 327  PRO n 
1 328  ARG n 
1 329  ILE n 
1 330  ALA n 
1 331  ALA n 
1 332  THR n 
1 333  MET n 
1 334  GLU n 
1 335  ASN n 
1 336  ALA n 
1 337  GLN n 
1 338  LYS n 
1 339  GLY n 
1 340  GLU n 
1 341  ILE n 
1 342  MET n 
1 343  PRO n 
1 344  ASN n 
1 345  ILE n 
1 346  PRO n 
1 347  GLN n 
1 348  MET n 
1 349  SER n 
1 350  ALA n 
1 351  PHE n 
1 352  TRP n 
1 353  TYR n 
1 354  ALA n 
1 355  VAL n 
1 356  ARG n 
1 357  THR n 
1 358  ALA n 
1 359  VAL n 
1 360  ILE n 
1 361  ASN n 
1 362  ALA n 
1 363  ALA n 
1 364  SER n 
1 365  GLY n 
1 366  ARG n 
1 367  GLN n 
1 368  THR n 
1 369  VAL n 
1 370  ASP n 
1 371  GLU n 
1 372  ALA n 
1 373  LEU n 
1 374  LYS n 
1 375  ASP n 
1 376  ALA n 
1 377  GLN n 
1 378  THR n 
1 379  GLY n 
1 380  THR n 
1 381  ASP n 
1 382  TYR n 
1 383  ASP n 
1 384  ILE n 
1 385  PRO n 
1 386  THR n 
1 387  THR n 
1 388  LEU n 
1 389  GLU n 
1 390  VAL n 
1 391  LEU n 
1 392  PHE n 
1 393  GLN n 
1 394  GLY n 
1 395  PRO n 
1 396  LEU n 
1 397  GLY n 
1 398  SER n 
1 399  ARG n 
1 400  CYS n 
1 401  GLN n 
1 402  ARG n 
1 403  ASP n 
1 404  HIS n 
1 405  LEU n 
1 406  SER n 
1 407  THR n 
1 408  LYS n 
1 409  LEU n 
1 410  ILE n 
1 411  PRO n 
1 412  THR n 
1 413  GLU n 
1 414  VAL n 
1 415  PRO n 
1 416  ALA n 
1 417  ASP n 
1 418  LEU n 
1 419  ILE n 
1 420  ARG n 
1 421  ALA n 
1 422  VAL n 
1 423  THR n 
1 424  CYS n 
1 425  GLN n 
1 426  VAL n 
1 427  CYS n 
1 428  ASP n 
1 429  HIS n 
1 430  LEU n 
1 431  LEU n 
1 432  SER n 
1 433  ASP n 
1 434  PRO n 
1 435  VAL n 
1 436  GLN n 
1 437  SER n 
1 438  PRO n 
1 439  CYS n 
1 440  ARG n 
1 441  HIS n 
1 442  LEU n 
1 443  PHE n 
1 444  CYS n 
1 445  ARG n 
1 446  LEU n 
1 447  CYS n 
1 448  ILE n 
1 449  ILE n 
1 450  ARG n 
1 451  TYR n 
1 452  THR n 
1 453  HIS n 
1 454  ALA n 
1 455  LEU n 
1 456  GLY n 
1 457  PRO n 
1 458  ASN n 
1 459  CYS n 
1 460  PRO n 
1 461  THR n 
1 462  CYS n 
1 463  ASN n 
1 464  GLN n 
1 465  HIS n 
1 466  LEU n 
1 467  ASN n 
1 468  PRO n 
1 469  SER n 
1 470  HIS n 
1 471  LEU n 
1 472  ILE n 
1 473  LYS n 
1 474  PRO n 
1 475  ALA n 
1 476  LYS n 
1 477  PHE n 
1 478  PHE n 
1 479  LEU n 
1 480  ALA n 
1 481  THR n 
1 482  LEU n 
1 483  SER n 
1 484  SER n 
1 485  LEU n 
1 486  PRO n 
1 487  LEU n 
1 488  LEU n 
1 489  CYS n 
1 490  PRO n 
1 491  SER n 
1 492  GLU n 
1 493  GLU n 
1 494  CYS n 
1 495  SER n 
1 496  ASP n 
1 497  TRP n 
1 498  VAL n 
1 499  ARG n 
1 500  LEU n 
1 501  ASP n 
1 502  SER n 
1 503  PHE n 
1 504  ARG n 
1 505  GLU n 
1 506  HIS n 
1 507  CYS n 
1 508  LEU n 
1 509  ASN n 
1 510  HIS n 
1 511  TYR n 
1 512  ARG n 
1 513  GLU n 
1 514  LYS n 
1 515  GLU n 
1 516  SER n 
1 517  GLN n 
1 518  GLU n 
1 519  GLU n 
1 520  GLN n 
1 521  THR n 
1 522  PRO n 
1 523  SER n 
1 524  GLU n 
1 525  GLN n 
1 526  ASN n 
1 527  LEU n 
1 528  ASP n 
1 529  GLY n 
1 530  TYR n 
1 531  LEU n 
1 532  PRO n 
1 533  VAL n 
1 534  ASN n 
1 535  LYS n 
1 536  GLY n 
1 537  GLY n 
1 538  ARG n 
1 539  PRO n 
1 540  ARG n 
1 541  GLN n 
1 542  HIS n 
1 543  LEU n 
1 544  LEU n 
1 545  SER n 
1 546  LEU n 
1 547  THR n 
1 548  ARG n 
1 549  ARG n 
1 550  ALA n 
1 551  GLN n 
1 552  LYS n 
1 553  HIS n 
1 554  ARG n 
1 555  LEU n 
1 556  ARG n 
1 557  ASP n 
1 558  LEU n 
1 559  LYS n 
1 560  ASN n 
1 561  GLN n 
1 562  VAL n 
1 563  LYS n 
1 564  THR n 
1 565  PHE n 
1 566  ALA n 
1 567  GLU n 
1 568  LYS n 
1 569  GLU n 
1 570  GLU n 
1 571  GLY n 
1 572  GLY n 
1 573  ASP n 
1 574  VAL n 
1 575  LYS n 
1 576  SER n 
1 577  VAL n 
1 578  CYS n 
1 579  LEU n 
1 580  THR n 
1 581  LEU n 
1 582  PHE n 
1 583  LEU n 
1 584  LEU n 
1 585  ALA n 
1 586  LEU n 
1 587  ARG n 
1 588  ALA n 
1 589  GLY n 
1 590  ASN n 
1 591  GLU n 
1 592  HIS n 
1 593  ARG n 
1 594  GLN n 
1 595  ALA n 
1 596  ASP n 
1 597  GLU n 
1 598  LEU n 
1 599  GLU n 
1 600  ALA n 
1 601  MET n 
1 602  MET n 
1 603  GLN n 
1 604  GLY n 
1 605  ARG n 
1 606  GLY n 
1 607  PHE n 
1 608  GLY n 
1 609  LEU n 
1 610  HIS n 
1 611  PRO n 
1 612  ALA n 
1 613  VAL n 
1 614  CYS n 
1 615  LEU n 
1 616  ALA n 
1 617  ILE n 
1 618  ARG n 
1 619  VAL n 
1 620  ASN n 
1 621  THR n 
1 622  PHE n 
1 623  LEU n 
1 624  SER n 
1 625  CYS n 
1 626  SER n 
1 627  GLN n 
1 628  TYR n 
1 629  HIS n 
1 630  LYS n 
1 631  MET n 
1 632  TYR n 
1 633  ARG n 
1 634  THR n 
1 635  VAL n 
1 636  LYS n 
1 637  ALA n 
1 638  THR n 
1 639  SER n 
1 640  GLY n 
1 641  ARG n 
1 642  GLN n 
1 643  ILE n 
1 644  PHE n 
1 645  GLN n 
1 646  PRO n 
1 647  LEU n 
1 648  HIS n 
1 649  THR n 
1 650  LEU n 
1 651  ARG n 
1 652  ASN n 
1 653  ALA n 
1 654  GLU n 
1 655  LYS n 
1 656  GLU n 
1 657  LEU n 
1 658  LEU n 
1 659  PRO n 
1 660  GLY n 
1 661  PHE n 
1 662  HIS n 
1 663  GLN n 
1 664  PHE n 
1 665  GLU n 
1 666  TRP n 
1 667  GLN n 
1 668  PRO n 
1 669  ALA n 
1 670  LEU n 
1 671  LYS n 
1 672  ASN n 
1 673  VAL n 
1 674  SER n 
1 675  THR n 
1 676  SER n 
1 677  TRP n 
1 678  ASP n 
1 679  VAL n 
1 680  GLY n 
1 681  ILE n 
1 682  ILE n 
1 683  ASP n 
1 684  GLY n 
1 685  LEU n 
1 686  SER n 
1 687  GLY n 
1 688  TRP n 
1 689  THR n 
1 690  VAL n 
1 691  SER n 
1 692  VAL n 
1 693  ASP n 
1 694  ASP n 
1 695  VAL n 
1 696  PRO n 
1 697  ALA n 
1 698  ASP n 
1 699  THR n 
1 700  ILE n 
1 701  SER n 
1 702  ARG n 
1 703  ARG n 
1 704  PHE n 
1 705  ARG n 
1 706  TYR n 
1 707  ASP n 
1 708  VAL n 
1 709  ALA n 
1 710  LEU n 
1 711  VAL n 
1 712  SER n 
1 713  ALA n 
1 714  LEU n 
1 715  LYS n 
1 716  ASP n 
1 717  LEU n 
1 718  GLU n 
1 719  GLU n 
1 720  ASP n 
1 721  ILE n 
1 722  MET n 
1 723  GLU n 
1 724  GLY n 
1 725  LEU n 
1 726  ARG n 
1 727  GLU n 
1 728  ARG n 
1 729  ALA n 
1 730  LEU n 
1 731  ASP n 
1 732  ASP n 
1 733  SER n 
1 734  MET n 
1 735  CYS n 
1 736  THR n 
1 737  SER n 
1 738  GLY n 
1 739  PHE n 
1 740  THR n 
1 741  VAL n 
1 742  VAL n 
1 743  VAL n 
1 744  LYS n 
1 745  GLU n 
1 746  SER n 
1 747  CYS n 
1 748  ASP n 
1 749  GLY n 
1 750  MET n 
1 751  GLY n 
1 752  ASP n 
1 753  VAL n 
1 754  SER n 
1 755  GLU n 
1 756  LYS n 
1 757  HIS n 
1 758  GLY n 
1 759  SER n 
1 760  GLY n 
1 761  PRO n 
1 762  ALA n 
1 763  VAL n 
1 764  PRO n 
1 765  GLU n 
1 766  LYS n 
1 767  ALA n 
1 768  VAL n 
1 769  ARG n 
1 770  PHE n 
1 771  SER n 
1 772  PHE n 
1 773  THR n 
1 774  ILE n 
1 775  MET n 
1 776  SER n 
1 777  ILE n 
1 778  SER n 
1 779  ILE n 
1 780  ARG n 
1 781  LEU n 
1 782  GLU n 
1 783  GLY n 
1 784  GLU n 
1 785  ASP n 
1 786  ASP n 
1 787  GLY n 
1 788  ILE n 
1 789  THR n 
1 790  ILE n 
1 791  PHE n 
1 792  GLN n 
1 793  GLU n 
1 794  GLN n 
1 795  LYS n 
1 796  PRO n 
1 797  ASN n 
1 798  SER n 
1 799  GLU n 
1 800  LEU n 
1 801  SER n 
1 802  CYS n 
1 803  ARG n 
1 804  PRO n 
1 805  LEU n 
1 806  CYS n 
1 807  LEU n 
1 808  MET n 
1 809  PHE n 
1 810  VAL n 
1 811  ASP n 
1 812  GLU n 
1 813  SER n 
1 814  ASP n 
1 815  HIS n 
1 816  GLU n 
1 817  THR n 
1 818  LEU n 
1 819  THR n 
1 820  ALA n 
1 821  ILE n 
1 822  LEU n 
1 823  GLY n 
1 824  PRO n 
1 825  VAL n 
1 826  VAL n 
1 827  ALA n 
1 828  GLU n 
1 829  ARG n 
1 830  LYS n 
1 831  ALA n 
1 832  MET n 
1 833  MET n 
1 834  GLU n 
1 835  SER n 
1 836  ARG n 
1 837  LEU n 
1 838  ILE n 
1 839  ILE n 
1 840  SER n 
1 841  VAL n 
1 842  GLY n 
1 843  GLY n 
1 844  LEU n 
1 845  LEU n 
1 846  ARG n 
1 847  SER n 
1 848  PHE n 
1 849  ARG n 
1 850  PHE n 
1 851  PHE n 
1 852  PHE n 
1 853  ARG n 
1 854  GLY n 
1 855  THR n 
1 856  GLY n 
1 857  TYR n 
1 858  ASP n 
1 859  GLU n 
1 860  LYS n 
1 861  MET n 
1 862  VAL n 
1 863  ARG n 
1 864  GLU n 
1 865  MET n 
1 866  GLU n 
1 867  GLY n 
1 868  LEU n 
1 869  GLU n 
1 870  ALA n 
1 871  SER n 
1 872  GLY n 
1 873  SER n 
1 874  THR n 
1 875  TYR n 
1 876  ILE n 
1 877  CYS n 
1 878  THR n 
1 879  LEU n 
1 880  CYS n 
1 881  ASP n 
1 882  SER n 
1 883  THR n 
1 884  ARG n 
1 885  ALA n 
1 886  GLU n 
1 887  ALA n 
1 888  SER n 
1 889  GLN n 
1 890  ASN n 
1 891  MET n 
1 892  VAL n 
1 893  LEU n 
1 894  HIS n 
1 895  SER n 
1 896  ILE n 
1 897  THR n 
1 898  ARG n 
1 899  SER n 
1 900  HIS n 
1 901  ASP n 
1 902  GLU n 
1 903  ASN n 
1 904  LEU n 
1 905  GLU n 
1 906  ARG n 
1 907  TYR n 
1 908  GLU n 
1 909  ILE n 
1 910  TRP n 
1 911  ARG n 
1 912  LYS n 
1 913  ASN n 
1 914  PRO n 
1 915  PHE n 
1 916  SER n 
1 917  GLU n 
1 918  SER n 
1 919  ALA n 
1 920  ASP n 
1 921  GLU n 
1 922  LEU n 
1 923  ARG n 
1 924  ASP n 
1 925  ARG n 
1 926  VAL n 
1 927  LYS n 
1 928  GLY n 
1 929  VAL n 
1 930  SER n 
1 931  ALA n 
1 932  LYS n 
1 933  PRO n 
1 934  PHE n 
1 935  MET n 
1 936  GLU n 
1 937  THR n 
1 938  GLN n 
1 939  PRO n 
1 940  THR n 
1 941  LEU n 
1 942  ASP n 
1 943  ALA n 
1 944  LEU n 
1 945  HIS n 
1 946  CYS n 
1 947  ASP n 
1 948  ILE n 
1 949  GLY n 
1 950  ASN n 
1 951  ALA n 
1 952  THR n 
1 953  GLU n 
1 954  PHE n 
1 955  TYR n 
1 956  LYS n 
1 957  ILE n 
1 958  PHE n 
1 959  GLN n 
1 960  ASP n 
1 961  GLU n 
1 962  ILE n 
1 963  GLY n 
1 964  GLU n 
1 965  VAL n 
1 966  TYR n 
1 967  GLN n 
1 968  LYS n 
1 969  PRO n 
1 970  ASN n 
1 971  PRO n 
1 972  SER n 
1 973  ARG n 
1 974  GLU n 
1 975  GLU n 
1 976  ARG n 
1 977  ARG n 
1 978  ARG n 
1 979  TRP n 
1 980  ARG n 
1 981  SER n 
1 982  THR n 
1 983  LEU n 
1 984  ASP n 
1 985  LYS n 
1 986  GLN n 
1 987  LEU n 
1 988  ARG n 
1 989  LYS n 
1 990  LYS n 
1 991  MET n 
1 992  LYS n 
1 993  LEU n 
1 994  LYS n 
1 995  PRO n 
1 996  VAL n 
1 997  MET n 
1 998  ARG n 
1 999  MET n 
1 1000 ASN n 
1 1001 GLY n 
1 1002 ASN n 
1 1003 TYR n 
1 1004 ALA n 
1 1005 ARG n 
1 1006 ARG n 
1 1007 LEU n 
1 1008 MET n 
1 1009 THR n 
1 1010 ARG n 
1 1011 GLU n 
1 1012 ALA n 
1 1013 VAL n 
1 1014 GLU n 
1 1015 ALA n 
1 1016 VAL n 
1 1017 CYS n 
1 1018 GLU n 
1 1019 LEU n 
1 1020 VAL n 
1 1021 PRO n 
1 1022 SER n 
1 1023 GLU n 
1 1024 GLU n 
1 1025 ARG n 
1 1026 ARG n 
1 1027 GLU n 
1 1028 ALA n 
1 1029 LEU n 
1 1030 LEU n 
1 1031 LYS n 
1 1032 LEU n 
1 1033 MET n 
1 1034 ASP n 
1 1035 LEU n 
1 1036 TYR n 
1 1037 LEU n 
1 1038 GLN n 
1 1039 MET n 
1 1040 LYS n 
1 1041 PRO n 
1 1042 VAL n 
1 1043 TRP n 
1 1044 ARG n 
1 1045 SER n 
1 1046 THR n 
1 1047 CYS n 
1 1048 PRO n 
1 1049 SER n 
1 1050 ARG n 
1 1051 ASP n 
1 1052 CYS n 
1 1053 PRO n 
1 1054 ASP n 
1 1055 GLN n 
1 1056 LEU n 
1 1057 CYS n 
1 1058 GLN n 
1 1059 TYR n 
1 1060 SER n 
1 1061 TYR n 
1 1062 ASN n 
1 1063 SER n 
1 1064 GLN n 
1 1065 GLN n 
1 1066 PHE n 
1 1067 ALA n 
1 1068 ASP n 
1 1069 LEU n 
1 1070 LEU n 
1 1071 SER n 
1 1072 SER n 
1 1073 MET n 
1 1074 PHE n 
1 1075 LYS n 
1 1076 TYR n 
1 1077 ARG n 
1 1078 TYR n 
1 1079 ASP n 
1 1080 GLY n 
1 1081 LYS n 
1 1082 ILE n 
1 1083 THR n 
1 1084 ASN n 
1 1085 TYR n 
1 1086 LEU n 
1 1087 HIS n 
1 1088 LYS n 
1 1089 THR n 
1 1090 LEU n 
1 1091 ALA n 
1 1092 HIS n 
1 1093 VAL n 
1 1094 PRO n 
1 1095 GLU n 
1 1096 ILE n 
1 1097 VAL n 
1 1098 GLU n 
1 1099 ARG n 
1 1100 ASP n 
1 1101 GLY n 
1 1102 SER n 
1 1103 ILE n 
1 1104 GLY n 
1 1105 ALA n 
1 1106 TRP n 
1 1107 ALA n 
1 1108 SER n 
1 1109 GLU n 
1 1110 GLY n 
1 1111 ASN n 
1 1112 GLU n 
1 1113 SER n 
1 1114 GLY n 
1 1115 ASN n 
1 1116 LYS n 
1 1117 LEU n 
1 1118 PHE n 
1 1119 ARG n 
1 1120 ARG n 
1 1121 PHE n 
1 1122 ARG n 
1 1123 LYS n 
1 1124 MET n 
1 1125 ASN n 
1 1126 ALA n 
1 1127 ARG n 
1 1128 GLN n 
1 1129 SER n 
1 1130 LYS n 
1 1131 THR n 
1 1132 PHE n 
1 1133 GLU n 
1 1134 LEU n 
1 1135 GLU n 
1 1136 ASP n 
1 1137 ILE n 
1 1138 LEU n 
1 1139 LYS n 
1 1140 HIS n 
1 1141 HIS n 
1 1142 TRP n 
1 1143 LEU n 
1 1144 TYR n 
1 1145 THR n 
1 1146 SER n 
1 1147 LYS n 
1 1148 TYR n 
1 1149 LEU n 
1 1150 GLN n 
1 1151 LYS n 
1 1152 PHE n 
1 1153 MET n 
1 1154 GLU n 
1 1155 ALA n 
1 1156 HIS n 
1 1157 LYS n 
1 1158 ASN n 
1 1159 SER n 
2 1    GLY n 
2 2    GLY n 
2 3    SER n 
2 4    MET n 
2 5    SER n 
2 6    LEU n 
2 7    GLN n 
2 8    PRO n 
2 9    LEU n 
2 10   THR n 
2 11   ALA n 
2 12   VAL n 
2 13   ASN n 
2 14   CYS n 
2 15   GLY n 
2 16   SER n 
2 17   LEU n 
2 18   VAL n 
2 19   GLN n 
2 20   PRO n 
2 21   GLY n 
2 22   PHE n 
2 23   SER n 
2 24   LEU n 
2 25   LEU n 
2 26   ASP n 
2 27   LEU n 
2 28   GLU n 
2 29   GLY n 
2 30   ASP n 
2 31   VAL n 
2 32   TYR n 
2 33   LEU n 
2 34   PHE n 
2 35   GLY n 
2 36   GLN n 
2 37   LYS n 
2 38   GLY n 
2 39   TRP n 
2 40   PRO n 
2 41   LYS n 
2 42   ARG n 
2 43   SER n 
2 44   CYS n 
2 45   PRO n 
2 46   THR n 
2 47   GLY n 
2 48   ILE n 
2 49   PHE n 
2 50   GLY n 
2 51   VAL n 
2 52   ARG n 
2 53   ILE n 
2 54   LYS n 
2 55   LYS n 
2 56   GLY n 
2 57   GLU n 
2 58   LEU n 
2 59   LYS n 
2 60   LEU n 
2 61   ARG n 
2 62   ALA n 
2 63   ILE n 
2 64   SER n 
2 65   PHE n 
2 66   SER n 
2 67   ASN n 
2 68   ASN n 
2 69   SER n 
2 70   SER n 
2 71   TYR n 
2 72   LEU n 
2 73   PRO n 
2 74   PRO n 
2 75   LEU n 
2 76   ARG n 
2 77   CYS n 
2 78   PRO n 
2 79   ALA n 
2 80   ILE n 
2 81   ALA n 
2 82   HIS n 
2 83   PHE n 
2 84   GLU n 
2 85   ALA n 
2 86   GLN n 
2 87   ASP n 
2 88   GLY n 
2 89   LYS n 
2 90   PRO n 
2 91   GLU n 
2 92   CYS n 
2 93   TYR n 
2 94   LEU n 
2 95   ILE n 
2 96   HIS n 
2 97   GLY n 
2 98   GLY n 
2 99   ARG n 
2 100  THR n 
2 101  PRO n 
2 102  ASN n 
2 103  ASN n 
2 104  GLU n 
2 105  LEU n 
2 106  SER n 
2 107  SER n 
2 108  SER n 
2 109  LEU n 
2 110  TYR n 
2 111  MET n 
2 112  LEU n 
2 113  SER n 
2 114  VAL n 
2 115  ASP n 
2 116  SER n 
2 117  ARG n 
2 118  GLY n 
2 119  CYS n 
2 120  ASN n 
2 121  ARG n 
2 122  LYS n 
2 123  VAL n 
2 124  THR n 
2 125  LEU n 
2 126  ARG n 
2 127  CYS n 
2 128  GLU n 
2 129  GLU n 
2 130  LYS n 
2 131  GLU n 
2 132  LEU n 
2 133  VAL n 
2 134  GLY n 
2 135  ASP n 
2 136  VAL n 
2 137  PRO n 
2 138  SER n 
2 139  ALA n 
2 140  ARG n 
2 141  TYR n 
2 142  GLY n 
2 143  HIS n 
2 144  THR n 
2 145  LEU n 
2 146  SER n 
2 147  VAL n 
2 148  ILE n 
2 149  ASN n 
2 150  SER n 
2 151  ARG n 
2 152  GLY n 
2 153  LYS n 
2 154  THR n 
2 155  ALA n 
2 156  CYS n 
2 157  VAL n 
2 158  LEU n 
2 159  PHE n 
2 160  GLY n 
2 161  GLY n 
2 162  ARG n 
2 163  SER n 
2 164  TYR n 
2 165  MET n 
2 166  PRO n 
2 167  PRO n 
2 168  THR n 
2 169  GLU n 
2 170  ARG n 
2 171  THR n 
2 172  THR n 
2 173  GLN n 
2 174  ASN n 
2 175  TRP n 
2 176  ASN n 
2 177  SER n 
2 178  VAL n 
2 179  VAL n 
2 180  ASP n 
2 181  CYS n 
2 182  PRO n 
2 183  PRO n 
2 184  GLN n 
2 185  VAL n 
2 186  TYR n 
2 187  LEU n 
2 188  ILE n 
2 189  ASP n 
2 190  LEU n 
2 191  GLU n 
2 192  PHE n 
2 193  GLY n 
2 194  CYS n 
2 195  CYS n 
2 196  THR n 
2 197  ALA n 
2 198  HIS n 
2 199  THR n 
2 200  LEU n 
2 201  PRO n 
2 202  GLU n 
2 203  LEU n 
2 204  THR n 
2 205  ASP n 
2 206  GLY n 
2 207  GLN n 
2 208  SER n 
2 209  PHE n 
2 210  HIS n 
2 211  VAL n 
2 212  ALA n 
2 213  LEU n 
2 214  ALA n 
2 215  ARG n 
2 216  GLN n 
2 217  ASP n 
2 218  CYS n 
2 219  VAL n 
2 220  TYR n 
2 221  PHE n 
2 222  LEU n 
2 223  GLY n 
2 224  GLY n 
2 225  HIS n 
2 226  ILE n 
2 227  LEU n 
2 228  SER n 
2 229  SER n 
2 230  ASP n 
2 231  CYS n 
2 232  ARG n 
2 233  PRO n 
2 234  SER n 
2 235  ARG n 
2 236  LEU n 
2 237  ILE n 
2 238  ARG n 
2 239  LEU n 
2 240  HIS n 
2 241  VAL n 
2 242  GLU n 
2 243  LEU n 
2 244  LEU n 
2 245  LEU n 
2 246  GLY n 
2 247  SER n 
2 248  PRO n 
2 249  VAL n 
2 250  LEU n 
2 251  THR n 
2 252  CYS n 
2 253  THR n 
2 254  ILE n 
2 255  LEU n 
2 256  HIS n 
2 257  GLU n 
2 258  GLY n 
2 259  LEU n 
2 260  THR n 
2 261  ILE n 
2 262  THR n 
2 263  SER n 
2 264  ALA n 
2 265  ILE n 
2 266  ALA n 
2 267  SER n 
2 268  PRO n 
2 269  ILE n 
2 270  GLY n 
2 271  TYR n 
2 272  HIS n 
2 273  GLU n 
2 274  TYR n 
2 275  ILE n 
2 276  ILE n 
2 277  PHE n 
2 278  GLY n 
2 279  GLY n 
2 280  TYR n 
2 281  GLN n 
2 282  SER n 
2 283  GLU n 
2 284  THR n 
2 285  GLN n 
2 286  LYS n 
2 287  ARG n 
2 288  MET n 
2 289  GLU n 
2 290  CYS n 
2 291  THR n 
2 292  TYR n 
2 293  VAL n 
2 294  GLY n 
2 295  LEU n 
2 296  ASP n 
2 297  ASP n 
2 298  VAL n 
2 299  GLY n 
2 300  VAL n 
2 301  HIS n 
2 302  MET n 
2 303  GLU n 
2 304  SER n 
2 305  ARG n 
2 306  GLU n 
2 307  PRO n 
2 308  PRO n 
2 309  GLN n 
2 310  TRP n 
2 311  THR n 
2 312  SER n 
2 313  GLU n 
2 314  ILE n 
2 315  SER n 
2 316  HIS n 
2 317  SER n 
2 318  ARG n 
2 319  THR n 
2 320  TRP n 
2 321  PHE n 
2 322  GLY n 
2 323  GLY n 
2 324  SER n 
2 325  LEU n 
2 326  GLY n 
2 327  LYS n 
2 328  GLY n 
2 329  THR n 
2 330  ALA n 
2 331  LEU n 
2 332  VAL n 
2 333  ALA n 
2 334  ILE n 
2 335  PRO n 
2 336  SER n 
2 337  GLU n 
2 338  GLY n 
2 339  ASN n 
2 340  PRO n 
2 341  THR n 
2 342  PRO n 
2 343  PRO n 
2 344  GLU n 
2 345  ALA n 
2 346  TYR n 
2 347  HIS n 
2 348  PHE n 
2 349  TYR n 
2 350  GLN n 
2 351  VAL n 
2 352  SER n 
2 353  PHE n 
2 354  GLN n 
2 355  LYS n 
2 356  GLU n 
2 357  GLN n 
2 358  ASP n 
2 359  GLY n 
2 360  GLU n 
2 361  ALA n 
2 362  THR n 
2 363  ALA n 
2 364  GLN n 
2 365  GLY n 
2 366  GLY n 
2 367  SER n 
2 368  GLN n 
2 369  GLU n 
2 370  SER n 
2 371  THR n 
2 372  ASP n 
2 373  PHE n 
2 374  GLU n 
2 375  ASP n 
2 376  SER n 
2 377  ALA n 
2 378  PRO n 
2 379  LEU n 
2 380  GLU n 
2 381  ASP n 
2 382  SER n 
2 383  GLU n 
2 384  GLU n 
2 385  LEU n 
2 386  TYR n 
2 387  PHE n 
2 388  GLY n 
2 389  ARG n 
2 390  GLU n 
2 391  PRO n 
2 392  HIS n 
2 393  GLU n 
2 394  LEU n 
2 395  GLU n 
2 396  TYR n 
2 397  SER n 
2 398  SER n 
2 399  ASP n 
2 400  VAL n 
2 401  GLU n 
2 402  GLY n 
2 403  ASP n 
2 404  THR n 
2 405  TYR n 
2 406  ASN n 
2 407  GLU n 
2 408  GLU n 
2 409  ASP n 
2 410  GLU n 
2 411  GLU n 
2 412  ASP n 
2 413  GLU n 
2 414  SER n 
2 415  GLN n 
2 416  THR n 
2 417  GLY n 
2 418  TYR n 
2 419  TRP n 
2 420  ILE n 
2 421  LYS n 
2 422  CYS n 
2 423  CYS n 
2 424  LEU n 
2 425  SER n 
2 426  CYS n 
2 427  GLN n 
2 428  VAL n 
2 429  ASP n 
2 430  PRO n 
2 431  ASN n 
2 432  ILE n 
2 433  TRP n 
2 434  GLU n 
2 435  PRO n 
2 436  TYR n 
2 437  TYR n 
2 438  SER n 
2 439  THR n 
2 440  GLU n 
2 441  LEU n 
2 442  THR n 
2 443  ARG n 
2 444  PRO n 
2 445  ALA n 
2 446  MET n 
2 447  ILE n 
2 448  PHE n 
2 449  CYS n 
2 450  SER n 
2 451  ARG n 
2 452  GLY n 
2 453  GLU n 
2 454  GLY n 
2 455  GLY n 
2 456  HIS n 
2 457  TRP n 
2 458  VAL n 
2 459  HIS n 
2 460  ALA n 
2 461  GLN n 
2 462  CYS n 
2 463  MET n 
2 464  GLU n 
2 465  LEU n 
2 466  PRO n 
2 467  GLU n 
2 468  SER n 
2 469  LEU n 
2 470  LEU n 
2 471  LEU n 
2 472  GLN n 
2 473  LEU n 
2 474  SER n 
2 475  GLN n 
2 476  ASP n 
2 477  ASN n 
2 478  SER n 
2 479  LYS n 
2 480  TYR n 
2 481  PHE n 
2 482  CYS n 
2 483  LEU n 
2 484  ASP n 
2 485  HIS n 
2 486  GLY n 
2 487  GLY n 
2 488  LEU n 
2 489  PRO n 
2 490  LYS n 
2 491  GLN n 
2 492  GLU n 
2 493  MET n 
2 494  THR n 
2 495  PRO n 
2 496  PRO n 
2 497  LYS n 
2 498  GLN n 
2 499  MET n 
2 500  LEU n 
2 501  PRO n 
2 502  VAL n 
2 503  LYS n 
2 504  ARG n 
2 505  VAL n 
2 506  PRO n 
2 507  MET n 
2 508  LYS n 
2 509  MET n 
2 510  THR n 
2 511  HIS n 
2 512  ARG n 
2 513  LYS n 
2 514  ALA n 
2 515  PRO n 
2 516  VAL n 
2 517  SER n 
2 518  LEU n 
2 519  LYS n 
2 520  MET n 
2 521  THR n 
2 522  PRO n 
2 523  ALA n 
2 524  LYS n 
2 525  LYS n 
2 526  THR n 
2 527  PHE n 
2 528  LEU n 
2 529  ARG n 
2 530  ARG n 
2 531  LEU n 
2 532  PHE n 
2 533  ASP n 
3 1    MET n 
3 2    GLY n 
3 3    SER n 
3 4    SER n 
3 5    HIS n 
3 6    HIS n 
3 7    HIS n 
3 8    HIS n 
3 9    HIS n 
3 10   HIS n 
3 11   GLY n 
3 12   THR n 
3 13   LYS n 
3 14   THR n 
3 15   GLU n 
3 16   GLU n 
3 17   GLY n 
3 18   LYS n 
3 19   LEU n 
3 20   VAL n 
3 21   ILE n 
3 22   TRP n 
3 23   ILE n 
3 24   ASN n 
3 25   GLY n 
3 26   ASP n 
3 27   LYS n 
3 28   GLY n 
3 29   TYR n 
3 30   ASN n 
3 31   GLY n 
3 32   LEU n 
3 33   ALA n 
3 34   GLU n 
3 35   VAL n 
3 36   GLY n 
3 37   LYS n 
3 38   LYS n 
3 39   PHE n 
3 40   GLU n 
3 41   LYS n 
3 42   ASP n 
3 43   THR n 
3 44   GLY n 
3 45   ILE n 
3 46   LYS n 
3 47   VAL n 
3 48   THR n 
3 49   VAL n 
3 50   GLU n 
3 51   HIS n 
3 52   PRO n 
3 53   ASP n 
3 54   LYS n 
3 55   LEU n 
3 56   GLU n 
3 57   GLU n 
3 58   LYS n 
3 59   PHE n 
3 60   PRO n 
3 61   GLN n 
3 62   VAL n 
3 63   ALA n 
3 64   ALA n 
3 65   THR n 
3 66   GLY n 
3 67   ASP n 
3 68   GLY n 
3 69   PRO n 
3 70   ASP n 
3 71   ILE n 
3 72   ILE n 
3 73   PHE n 
3 74   TRP n 
3 75   ALA n 
3 76   HIS n 
3 77   ASP n 
3 78   ARG n 
3 79   PHE n 
3 80   GLY n 
3 81   GLY n 
3 82   TYR n 
3 83   ALA n 
3 84   GLN n 
3 85   SER n 
3 86   GLY n 
3 87   LEU n 
3 88   LEU n 
3 89   ALA n 
3 90   GLU n 
3 91   ILE n 
3 92   THR n 
3 93   PRO n 
3 94   ASP n 
3 95   LYS n 
3 96   ALA n 
3 97   PHE n 
3 98   GLN n 
3 99   ASP n 
3 100  LYS n 
3 101  LEU n 
3 102  TYR n 
3 103  PRO n 
3 104  PHE n 
3 105  THR n 
3 106  TRP n 
3 107  ASP n 
3 108  ALA n 
3 109  VAL n 
3 110  ARG n 
3 111  TYR n 
3 112  ASN n 
3 113  GLY n 
3 114  LYS n 
3 115  LEU n 
3 116  ILE n 
3 117  ALA n 
3 118  TYR n 
3 119  PRO n 
3 120  ILE n 
3 121  ALA n 
3 122  VAL n 
3 123  GLU n 
3 124  ALA n 
3 125  LEU n 
3 126  SER n 
3 127  LEU n 
3 128  ILE n 
3 129  TYR n 
3 130  ASN n 
3 131  LYS n 
3 132  ASP n 
3 133  LEU n 
3 134  LEU n 
3 135  PRO n 
3 136  ASN n 
3 137  PRO n 
3 138  PRO n 
3 139  LYS n 
3 140  THR n 
3 141  TRP n 
3 142  GLU n 
3 143  GLU n 
3 144  ILE n 
3 145  PRO n 
3 146  ALA n 
3 147  LEU n 
3 148  ASP n 
3 149  LYS n 
3 150  GLU n 
3 151  LEU n 
3 152  LYS n 
3 153  ALA n 
3 154  LYS n 
3 155  GLY n 
3 156  LYS n 
3 157  SER n 
3 158  ALA n 
3 159  LEU n 
3 160  MET n 
3 161  PHE n 
3 162  ASN n 
3 163  LEU n 
3 164  GLN n 
3 165  GLU n 
3 166  PRO n 
3 167  TYR n 
3 168  PHE n 
3 169  THR n 
3 170  TRP n 
3 171  PRO n 
3 172  LEU n 
3 173  ILE n 
3 174  ALA n 
3 175  ALA n 
3 176  ASP n 
3 177  GLY n 
3 178  GLY n 
3 179  TYR n 
3 180  ALA n 
3 181  PHE n 
3 182  LYS n 
3 183  TYR n 
3 184  GLU n 
3 185  ASN n 
3 186  GLY n 
3 187  LYS n 
3 188  TYR n 
3 189  ASP n 
3 190  ILE n 
3 191  LYS n 
3 192  ASP n 
3 193  VAL n 
3 194  GLY n 
3 195  VAL n 
3 196  ASP n 
3 197  ASN n 
3 198  ALA n 
3 199  GLY n 
3 200  ALA n 
3 201  LYS n 
3 202  ALA n 
3 203  GLY n 
3 204  LEU n 
3 205  THR n 
3 206  PHE n 
3 207  LEU n 
3 208  VAL n 
3 209  ASP n 
3 210  LEU n 
3 211  ILE n 
3 212  LYS n 
3 213  ASN n 
3 214  LYS n 
3 215  HIS n 
3 216  MET n 
3 217  ASN n 
3 218  ALA n 
3 219  ASP n 
3 220  THR n 
3 221  ASP n 
3 222  TYR n 
3 223  SER n 
3 224  ILE n 
3 225  ALA n 
3 226  GLU n 
3 227  ALA n 
3 228  ALA n 
3 229  PHE n 
3 230  ASN n 
3 231  LYS n 
3 232  GLY n 
3 233  GLU n 
3 234  THR n 
3 235  ALA n 
3 236  MET n 
3 237  THR n 
3 238  ILE n 
3 239  ASN n 
3 240  GLY n 
3 241  PRO n 
3 242  TRP n 
3 243  ALA n 
3 244  TRP n 
3 245  SER n 
3 246  ASN n 
3 247  ILE n 
3 248  ASP n 
3 249  THR n 
3 250  SER n 
3 251  LYS n 
3 252  VAL n 
3 253  ASN n 
3 254  TYR n 
3 255  GLY n 
3 256  VAL n 
3 257  THR n 
3 258  VAL n 
3 259  LEU n 
3 260  PRO n 
3 261  THR n 
3 262  PHE n 
3 263  LYS n 
3 264  GLY n 
3 265  GLN n 
3 266  PRO n 
3 267  SER n 
3 268  LYS n 
3 269  PRO n 
3 270  PHE n 
3 271  VAL n 
3 272  GLY n 
3 273  VAL n 
3 274  LEU n 
3 275  SER n 
3 276  ALA n 
3 277  GLY n 
3 278  ILE n 
3 279  ASN n 
3 280  ALA n 
3 281  ALA n 
3 282  SER n 
3 283  PRO n 
3 284  ASN n 
3 285  LYS n 
3 286  GLU n 
3 287  LEU n 
3 288  ALA n 
3 289  LYS n 
3 290  GLU n 
3 291  PHE n 
3 292  LEU n 
3 293  GLU n 
3 294  ASN n 
3 295  TYR n 
3 296  LEU n 
3 297  LEU n 
3 298  THR n 
3 299  ASP n 
3 300  GLU n 
3 301  GLY n 
3 302  LEU n 
3 303  GLU n 
3 304  ALA n 
3 305  VAL n 
3 306  ASN n 
3 307  LYS n 
3 308  ASP n 
3 309  LYS n 
3 310  PRO n 
3 311  LEU n 
3 312  GLY n 
3 313  ALA n 
3 314  VAL n 
3 315  ALA n 
3 316  LEU n 
3 317  LYS n 
3 318  SER n 
3 319  TYR n 
3 320  GLU n 
3 321  GLU n 
3 322  GLU n 
3 323  LEU n 
3 324  ALA n 
3 325  LYS n 
3 326  ASP n 
3 327  PRO n 
3 328  ARG n 
3 329  ILE n 
3 330  ALA n 
3 331  ALA n 
3 332  THR n 
3 333  MET n 
3 334  GLU n 
3 335  ASN n 
3 336  ALA n 
3 337  GLN n 
3 338  LYS n 
3 339  GLY n 
3 340  GLU n 
3 341  ILE n 
3 342  MET n 
3 343  PRO n 
3 344  ASN n 
3 345  ILE n 
3 346  PRO n 
3 347  GLN n 
3 348  MET n 
3 349  SER n 
3 350  ALA n 
3 351  PHE n 
3 352  TRP n 
3 353  TYR n 
3 354  ALA n 
3 355  VAL n 
3 356  ARG n 
3 357  THR n 
3 358  ALA n 
3 359  VAL n 
3 360  ILE n 
3 361  ASN n 
3 362  ALA n 
3 363  ALA n 
3 364  SER n 
3 365  GLY n 
3 366  ARG n 
3 367  GLN n 
3 368  THR n 
3 369  VAL n 
3 370  ASP n 
3 371  GLU n 
3 372  ALA n 
3 373  LEU n 
3 374  LYS n 
3 375  ASP n 
3 376  ALA n 
3 377  GLN n 
3 378  THR n 
3 379  GLY n 
3 380  THR n 
3 381  ASP n 
3 382  TYR n 
3 383  ASP n 
3 384  ILE n 
3 385  PRO n 
3 386  THR n 
3 387  THR n 
3 388  LEU n 
3 389  GLU n 
3 390  VAL n 
3 391  LEU n 
3 392  PHE n 
3 393  GLN n 
3 394  GLY n 
3 395  PRO n 
3 396  LEU n 
3 397  GLY n 
3 398  SER n 
3 399  ARG n 
3 400  CYS n 
3 401  GLN n 
3 402  ARG n 
3 403  ASP n 
3 404  HIS n 
3 405  LEU n 
3 406  SER n 
3 407  THR n 
3 408  LYS n 
3 409  LEU n 
3 410  ILE n 
3 411  PRO n 
3 412  THR n 
3 413  GLU n 
3 414  VAL n 
3 415  PRO n 
3 416  ALA n 
3 417  ASP n 
3 418  LEU n 
3 419  ILE n 
3 420  ARG n 
3 421  ALA n 
3 422  VAL n 
3 423  THR n 
3 424  CYS n 
3 425  GLN n 
3 426  VAL n 
3 427  CYS n 
3 428  ASP n 
3 429  HIS n 
3 430  LEU n 
3 431  LEU n 
3 432  SER n 
3 433  ASP n 
3 434  PRO n 
3 435  VAL n 
3 436  GLN n 
3 437  SER n 
3 438  PRO n 
3 439  CYS n 
3 440  ARG n 
3 441  HIS n 
3 442  LEU n 
3 443  PHE n 
3 444  CYS n 
3 445  ARG n 
3 446  LEU n 
3 447  CYS n 
3 448  ILE n 
3 449  ILE n 
3 450  ARG n 
3 451  TYR n 
3 452  THR n 
3 453  HIS n 
3 454  ALA n 
3 455  LEU n 
3 456  GLY n 
3 457  PRO n 
3 458  ASN n 
3 459  CYS n 
3 460  PRO n 
3 461  THR n 
3 462  CYS n 
3 463  ASN n 
3 464  GLN n 
3 465  HIS n 
3 466  LEU n 
3 467  ASN n 
3 468  PRO n 
3 469  SER n 
3 470  HIS n 
3 471  LEU n 
3 472  ILE n 
3 473  LYS n 
3 474  PRO n 
3 475  ALA n 
3 476  LYS n 
3 477  PHE n 
3 478  PHE n 
3 479  LEU n 
3 480  ALA n 
3 481  THR n 
3 482  LEU n 
3 483  SER n 
3 484  SER n 
3 485  LEU n 
3 486  PRO n 
3 487  LEU n 
3 488  LEU n 
3 489  CYS n 
3 490  PRO n 
3 491  SER n 
3 492  GLU n 
3 493  GLU n 
3 494  CYS n 
3 495  SER n 
3 496  ASP n 
3 497  TRP n 
3 498  VAL n 
3 499  ARG n 
3 500  LEU n 
3 501  ASP n 
3 502  SER n 
3 503  PHE n 
3 504  ARG n 
3 505  GLU n 
3 506  HIS n 
3 507  CYS n 
3 508  LEU n 
3 509  ASN n 
3 510  HIS n 
3 511  TYR n 
3 512  ARG n 
3 513  GLU n 
3 514  LYS n 
3 515  GLU n 
3 516  SER n 
3 517  GLN n 
3 518  GLU n 
3 519  GLU n 
3 520  GLN n 
3 521  THR n 
3 522  PRO n 
3 523  SER n 
3 524  GLU n 
3 525  GLN n 
3 526  ASN n 
3 527  LEU n 
3 528  ASP n 
3 529  GLY n 
3 530  TYR n 
3 531  LEU n 
3 532  PRO n 
3 533  VAL n 
3 534  ASN n 
3 535  LYS n 
3 536  GLY n 
3 537  GLY n 
3 538  ARG n 
3 539  PRO n 
3 540  ARG n 
3 541  GLN n 
3 542  HIS n 
3 543  LEU n 
3 544  LEU n 
3 545  SER n 
3 546  LEU n 
3 547  THR n 
3 548  ARG n 
3 549  ARG n 
3 550  ALA n 
3 551  GLN n 
3 552  LYS n 
3 553  HIS n 
3 554  ARG n 
3 555  LEU n 
3 556  ARG n 
3 557  ASP n 
3 558  LEU n 
3 559  LYS n 
3 560  ASN n 
3 561  GLN n 
3 562  VAL n 
3 563  LYS n 
3 564  THR n 
3 565  PHE n 
3 566  ALA n 
3 567  GLU n 
3 568  LYS n 
3 569  GLU n 
3 570  GLU n 
3 571  GLY n 
3 572  GLY n 
3 573  ASP n 
3 574  VAL n 
3 575  LYS n 
3 576  SER n 
3 577  VAL n 
3 578  CYS n 
3 579  LEU n 
3 580  THR n 
3 581  LEU n 
3 582  PHE n 
3 583  LEU n 
3 584  LEU n 
3 585  ALA n 
3 586  LEU n 
3 587  ARG n 
3 588  ALA n 
3 589  GLY n 
3 590  ASN n 
3 591  GLU n 
3 592  HIS n 
3 593  LYS n 
3 594  GLN n 
3 595  ALA n 
3 596  ASP n 
3 597  GLU n 
3 598  LEU n 
3 599  GLU n 
3 600  ALA n 
3 601  MET n 
3 602  MET n 
3 603  GLN n 
3 604  GLY n 
3 605  ARG n 
3 606  GLY n 
3 607  PHE n 
3 608  GLY n 
3 609  LEU n 
3 610  HIS n 
3 611  PRO n 
3 612  ALA n 
3 613  VAL n 
3 614  CYS n 
3 615  LEU n 
3 616  ALA n 
3 617  ILE n 
3 618  ARG n 
3 619  VAL n 
3 620  ASN n 
3 621  THR n 
3 622  PHE n 
3 623  LEU n 
3 624  SER n 
3 625  CYS n 
3 626  SER n 
3 627  GLN n 
3 628  TYR n 
3 629  HIS n 
3 630  LYS n 
3 631  MET n 
3 632  TYR n 
3 633  ARG n 
3 634  THR n 
3 635  VAL n 
3 636  LYS n 
3 637  ALA n 
3 638  THR n 
3 639  SER n 
3 640  GLY n 
3 641  ARG n 
3 642  GLN n 
3 643  ILE n 
3 644  PHE n 
3 645  GLN n 
3 646  PRO n 
3 647  LEU n 
3 648  HIS n 
3 649  THR n 
3 650  LEU n 
3 651  ARG n 
3 652  ASN n 
3 653  ALA n 
3 654  GLU n 
3 655  LYS n 
3 656  GLU n 
3 657  LEU n 
3 658  LEU n 
3 659  PRO n 
3 660  GLY n 
3 661  PHE n 
3 662  HIS n 
3 663  GLN n 
3 664  PHE n 
3 665  GLU n 
3 666  TRP n 
3 667  GLN n 
3 668  PRO n 
3 669  ALA n 
3 670  LEU n 
3 671  LYS n 
3 672  ASN n 
3 673  VAL n 
3 674  SER n 
3 675  THR n 
3 676  SER n 
3 677  TRP n 
3 678  ASP n 
3 679  VAL n 
3 680  GLY n 
3 681  ILE n 
3 682  ILE n 
3 683  ASP n 
3 684  GLY n 
3 685  LEU n 
3 686  SER n 
3 687  GLY n 
3 688  TRP n 
3 689  THR n 
3 690  VAL n 
3 691  SER n 
3 692  VAL n 
3 693  ASP n 
3 694  ASP n 
3 695  VAL n 
3 696  PRO n 
3 697  ALA n 
3 698  ASP n 
3 699  THR n 
3 700  ILE n 
3 701  SER n 
3 702  ARG n 
3 703  ARG n 
3 704  PHE n 
3 705  ARG n 
3 706  TYR n 
3 707  ASP n 
3 708  VAL n 
3 709  ALA n 
3 710  LEU n 
3 711  VAL n 
3 712  SER n 
3 713  ALA n 
3 714  LEU n 
3 715  LYS n 
3 716  ASP n 
3 717  LEU n 
3 718  GLU n 
3 719  GLU n 
3 720  ASP n 
3 721  ILE n 
3 722  MET n 
3 723  GLU n 
3 724  GLY n 
3 725  LEU n 
3 726  ARG n 
3 727  GLU n 
3 728  ARG n 
3 729  ALA n 
3 730  LEU n 
3 731  ASP n 
3 732  ASP n 
3 733  SER n 
3 734  MET n 
3 735  CYS n 
3 736  THR n 
3 737  SER n 
3 738  GLY n 
3 739  PHE n 
3 740  THR n 
3 741  VAL n 
3 742  VAL n 
3 743  VAL n 
3 744  LYS n 
3 745  GLU n 
3 746  SER n 
3 747  CYS n 
3 748  ASP n 
3 749  GLY n 
3 750  MET n 
3 751  GLY n 
3 752  ASP n 
3 753  VAL n 
3 754  SER n 
3 755  GLU n 
3 756  LYS n 
3 757  HIS n 
3 758  GLY n 
3 759  SER n 
3 760  GLY n 
3 761  PRO n 
3 762  ALA n 
3 763  VAL n 
3 764  PRO n 
3 765  GLU n 
3 766  LYS n 
3 767  ALA n 
3 768  VAL n 
3 769  ARG n 
3 770  PHE n 
3 771  SER n 
3 772  PHE n 
3 773  THR n 
3 774  ILE n 
3 775  MET n 
3 776  SER n 
3 777  ILE n 
3 778  SER n 
3 779  ILE n 
3 780  ARG n 
3 781  LEU n 
3 782  GLU n 
3 783  GLY n 
3 784  GLU n 
3 785  ASP n 
3 786  ASP n 
3 787  GLY n 
3 788  ILE n 
3 789  THR n 
3 790  ILE n 
3 791  PHE n 
3 792  GLN n 
3 793  GLU n 
3 794  GLN n 
3 795  LYS n 
3 796  PRO n 
3 797  ASN n 
3 798  SER n 
3 799  GLU n 
3 800  LEU n 
3 801  SER n 
3 802  CYS n 
3 803  ARG n 
3 804  PRO n 
3 805  LEU n 
3 806  CYS n 
3 807  LEU n 
3 808  MET n 
3 809  PHE n 
3 810  VAL n 
3 811  ASP n 
3 812  GLU n 
3 813  SER n 
3 814  ASP n 
3 815  HIS n 
3 816  GLU n 
3 817  THR n 
3 818  LEU n 
3 819  THR n 
3 820  ALA n 
3 821  ILE n 
3 822  LEU n 
3 823  GLY n 
3 824  PRO n 
3 825  VAL n 
3 826  VAL n 
3 827  ALA n 
3 828  GLU n 
3 829  ARG n 
3 830  LYS n 
3 831  ALA n 
3 832  MET n 
3 833  MET n 
3 834  GLU n 
3 835  SER n 
3 836  ARG n 
3 837  LEU n 
3 838  ILE n 
3 839  ILE n 
3 840  SER n 
3 841  VAL n 
3 842  GLY n 
3 843  GLY n 
3 844  LEU n 
3 845  LEU n 
3 846  ARG n 
3 847  SER n 
3 848  PHE n 
3 849  ARG n 
3 850  PHE n 
3 851  PHE n 
3 852  PHE n 
3 853  ARG n 
3 854  GLY n 
3 855  THR n 
3 856  GLY n 
3 857  TYR n 
3 858  ASP n 
3 859  GLU n 
3 860  LYS n 
3 861  MET n 
3 862  VAL n 
3 863  ARG n 
3 864  GLU n 
3 865  MET n 
3 866  GLU n 
3 867  GLY n 
3 868  LEU n 
3 869  GLU n 
3 870  ALA n 
3 871  SER n 
3 872  GLY n 
3 873  SER n 
3 874  THR n 
3 875  TYR n 
3 876  ILE n 
3 877  CYS n 
3 878  THR n 
3 879  LEU n 
3 880  CYS n 
3 881  ASP n 
3 882  SER n 
3 883  THR n 
3 884  ARG n 
3 885  ALA n 
3 886  GLU n 
3 887  ALA n 
3 888  SER n 
3 889  GLN n 
3 890  ASN n 
3 891  MET n 
3 892  VAL n 
3 893  LEU n 
3 894  HIS n 
3 895  SER n 
3 896  ILE n 
3 897  THR n 
3 898  ARG n 
3 899  SER n 
3 900  HIS n 
3 901  ASP n 
3 902  GLU n 
3 903  ASN n 
3 904  LEU n 
3 905  GLU n 
3 906  ARG n 
3 907  TYR n 
3 908  GLU n 
3 909  ILE n 
3 910  TRP n 
3 911  ARG n 
3 912  LYS n 
3 913  ASN n 
3 914  PRO n 
3 915  PHE n 
3 916  SER n 
3 917  GLU n 
3 918  SER n 
3 919  ALA n 
3 920  ASP n 
3 921  GLU n 
3 922  LEU n 
3 923  ARG n 
3 924  ASP n 
3 925  ARG n 
3 926  VAL n 
3 927  LYS n 
3 928  GLY n 
3 929  VAL n 
3 930  SER n 
3 931  ALA n 
3 932  LYS n 
3 933  PRO n 
3 934  PHE n 
3 935  MET n 
3 936  GLU n 
3 937  THR n 
3 938  GLN n 
3 939  PRO n 
3 940  THR n 
3 941  LEU n 
3 942  ASP n 
3 943  ALA n 
3 944  LEU n 
3 945  HIS n 
3 946  CYS n 
3 947  ASP n 
3 948  ILE n 
3 949  GLY n 
3 950  ASN n 
3 951  ALA n 
3 952  THR n 
3 953  GLU n 
3 954  PHE n 
3 955  TYR n 
3 956  LYS n 
3 957  ILE n 
3 958  PHE n 
3 959  GLN n 
3 960  ASP n 
3 961  GLU n 
3 962  ILE n 
3 963  GLY n 
3 964  GLU n 
3 965  VAL n 
3 966  TYR n 
3 967  GLN n 
3 968  LYS n 
3 969  PRO n 
3 970  ASN n 
3 971  PRO n 
3 972  SER n 
3 973  ARG n 
3 974  GLU n 
3 975  GLU n 
3 976  ARG n 
3 977  ARG n 
3 978  ARG n 
3 979  TRP n 
3 980  ARG n 
3 981  SER n 
3 982  THR n 
3 983  LEU n 
3 984  ASP n 
3 985  LYS n 
3 986  GLN n 
3 987  LEU n 
3 988  ARG n 
3 989  LYS n 
3 990  LYS n 
3 991  MET n 
3 992  LYS n 
3 993  LEU n 
3 994  LYS n 
3 995  PRO n 
3 996  VAL n 
3 997  MET n 
3 998  ARG n 
3 999  MET n 
3 1000 ASN n 
3 1001 GLY n 
3 1002 ASN n 
3 1003 TYR n 
3 1004 ALA n 
3 1005 ARG n 
3 1006 ARG n 
3 1007 LEU n 
3 1008 MET n 
3 1009 THR n 
3 1010 ARG n 
3 1011 GLU n 
3 1012 ALA n 
3 1013 VAL n 
3 1014 GLU n 
3 1015 ALA n 
3 1016 VAL n 
3 1017 CYS n 
3 1018 GLU n 
3 1019 LEU n 
3 1020 VAL n 
3 1021 PRO n 
3 1022 SER n 
3 1023 GLU n 
3 1024 GLU n 
3 1025 ARG n 
3 1026 ARG n 
3 1027 GLU n 
3 1028 ALA n 
3 1029 LEU n 
3 1030 LEU n 
3 1031 LYS n 
3 1032 LEU n 
3 1033 MET n 
3 1034 ASP n 
3 1035 LEU n 
3 1036 TYR n 
3 1037 LEU n 
3 1038 GLN n 
3 1039 MET n 
3 1040 LYS n 
3 1041 PRO n 
3 1042 VAL n 
3 1043 TRP n 
3 1044 ARG n 
3 1045 SER n 
3 1046 THR n 
3 1047 CYS n 
3 1048 PRO n 
3 1049 SER n 
3 1050 ARG n 
3 1051 ASP n 
3 1052 CYS n 
3 1053 PRO n 
3 1054 ASP n 
3 1055 GLN n 
3 1056 LEU n 
3 1057 CYS n 
3 1058 GLN n 
3 1059 TYR n 
3 1060 SER n 
3 1061 TYR n 
3 1062 ASN n 
3 1063 SER n 
3 1064 GLN n 
3 1065 GLN n 
3 1066 PHE n 
3 1067 ALA n 
3 1068 ASP n 
3 1069 LEU n 
3 1070 LEU n 
3 1071 SER n 
3 1072 SER n 
3 1073 MET n 
3 1074 PHE n 
3 1075 LYS n 
3 1076 TYR n 
3 1077 ARG n 
3 1078 TYR n 
3 1079 ASP n 
3 1080 GLY n 
3 1081 LYS n 
3 1082 ILE n 
3 1083 THR n 
3 1084 ASN n 
3 1085 TYR n 
3 1086 LEU n 
3 1087 HIS n 
3 1088 LYS n 
3 1089 THR n 
3 1090 LEU n 
3 1091 ALA n 
3 1092 HIS n 
3 1093 VAL n 
3 1094 PRO n 
3 1095 GLU n 
3 1096 ILE n 
3 1097 VAL n 
3 1098 GLU n 
3 1099 ARG n 
3 1100 ASP n 
3 1101 GLY n 
3 1102 SER n 
3 1103 ILE n 
3 1104 GLY n 
3 1105 ALA n 
3 1106 TRP n 
3 1107 ALA n 
3 1108 SER n 
3 1109 GLU n 
3 1110 GLY n 
3 1111 ASN n 
3 1112 GLU n 
3 1113 SER n 
3 1114 GLY n 
3 1115 ASN n 
3 1116 LYS n 
3 1117 LEU n 
3 1118 PHE n 
3 1119 ARG n 
3 1120 ARG n 
3 1121 PHE n 
3 1122 ARG n 
3 1123 LYS n 
3 1124 MET n 
3 1125 ASN n 
3 1126 ALA n 
3 1127 ARG n 
3 1128 GLN n 
3 1129 SER n 
3 1130 LYS n 
3 1131 THR n 
3 1132 PHE n 
3 1133 GLU n 
3 1134 LEU n 
3 1135 GLU n 
3 1136 ASP n 
3 1137 ILE n 
3 1138 LEU n 
3 1139 LYS n 
3 1140 HIS n 
3 1141 HIS n 
3 1142 TRP n 
3 1143 LEU n 
3 1144 TYR n 
3 1145 THR n 
3 1146 SER n 
3 1147 LYS n 
3 1148 TYR n 
3 1149 LEU n 
3 1150 GLN n 
3 1151 LYS n 
3 1152 PHE n 
3 1153 MET n 
3 1154 GLU n 
3 1155 ALA n 
3 1156 HIS n 
3 1157 LYS n 
3 1158 ASN n 
3 1159 SER n 
4 1    DG  n 
4 2    DA  n 
4 3    DT  n 
4 4    DC  n 
4 5    DT  n 
4 6    DG  n 
4 7    DG  n 
4 8    DC  n 
4 9    DC  n 
4 10   DT  n 
4 11   DG  n 
4 12   DT  n 
4 13   DC  n 
4 14   DT  n 
4 15   DT  n 
4 16   DA  n 
4 17   DC  n 
4 18   DA  n 
4 19   DC  n 
4 20   DA  n 
4 21   DG  n 
4 22   DT  n 
4 23   DG  n 
4 24   DC  n 
4 25   DT  n 
4 26   DA  n 
4 27   DC  n 
4 28   DA  n 
4 29   DG  n 
4 30   DA  n 
4 31   DC  n 
4 32   DT  n 
4 33   DG  n 
4 34   DG  n 
4 35   DA  n 
4 36   DA  n 
4 37   DC  n 
4 38   DA  n 
4 39   DA  n 
4 40   DA  n 
4 41   DA  n 
4 42   DA  n 
4 43   DC  n 
4 44   DC  n 
4 45   DC  n 
4 46   DT  n 
4 47   DG  n 
4 48   DC  n 
4 49   DA  n 
4 50   DG  n 
5 1    DC  n 
5 2    DT  n 
5 3    DG  n 
5 4    DC  n 
5 5    DA  n 
5 6    DG  n 
5 7    DG  n 
5 8    DG  n 
5 9    DT  n 
5 10   DT  n 
5 11   DT  n 
5 12   DT  n 
5 13   DT  n 
5 14   DG  n 
5 15   DT  n 
5 16   DT  n 
5 17   DC  n 
5 18   DC  n 
5 19   DA  n 
5 20   DG  n 
5 21   DT  n 
5 22   DC  n 
5 23   DT  n 
5 24   DG  n 
5 25   DT  n 
5 26   DA  n 
5 27   DG  n 
5 28   DC  n 
5 29   DA  n 
5 30   DC  n 
5 31   DT  n 
5 32   DG  n 
5 33   DT  n 
5 34   DG  n 
5 35   DT  n 
5 36   DA  n 
5 37   DA  n 
5 38   DG  n 
5 39   DA  n 
5 40   DC  n 
5 41   DA  n 
5 42   DG  n 
5 43   DG  n 
5 44   DC  n 
5 45   DC  n 
5 46   DA  n 
5 47   DG  n 
5 48   DA  n 
5 49   DT  n 
5 50   DC  n 
6 1    DG  n 
6 2    DA  n 
6 3    DT  n 
6 4    DC  n 
6 5    DT  n 
6 6    DG  n 
6 7    DG  n 
6 8    DC  n 
6 9    DC  n 
6 10   DT  n 
6 11   DG  n 
6 12   DT  n 
6 13   DC  n 
6 14   DT  n 
6 15   DT  n 
6 16   DA  n 
6 17   DC  n 
6 18   DA  n 
6 19   DC  n 
6 20   DA  n 
6 21   DG  n 
6 22   DT  n 
6 23   DG  n 
6 24   DG  n 
6 25   DT  n 
6 26   DA  n 
6 27   DG  n 
6 28   DT  n 
6 29   DA  n 
6 30   DC  n 
6 31   DT  n 
6 32   DC  n 
6 33   DC  n 
6 34   DA  n 
6 35   DC  n 
6 36   DT  n 
6 37   DG  n 
6 38   DT  n 
6 39   DC  n 
6 40   DT  n 
6 41   DG  n 
6 42   DG  n 
6 43   DC  n 
6 44   DT  n 
6 45   DG  n 
6 46   DT  n 
6 47   DA  n 
6 48   DC  n 
6 49   DA  n 
6 50   DA  n 
6 51   DA  n 
6 52   DA  n 
6 53   DA  n 
6 54   DC  n 
6 55   DC  n 
6 56   DC  n 
6 57   DT  n 
6 58   DG  n 
6 59   DC  n 
6 60   DA  n 
6 61   DG  n 
7 1    DC  n 
7 2    DT  n 
7 3    DG  n 
7 4    DC  n 
7 5    DA  n 
7 6    DG  n 
7 7    DG  n 
7 8    DG  n 
7 9    DT  n 
7 10   DT  n 
7 11   DT  n 
7 12   DT  n 
7 13   DT  n 
7 14   DG  n 
7 15   DT  n 
7 16   DA  n 
7 17   DC  n 
7 18   DA  n 
7 19   DG  n 
7 20   DC  n 
7 21   DC  n 
7 22   DA  n 
7 23   DG  n 
7 24   DA  n 
7 25   DC  n 
7 26   DA  n 
7 27   DG  n 
7 28   DT  n 
7 29   DG  n 
7 30   DG  n 
7 31   DA  n 
7 32   DG  n 
7 33   DT  n 
7 34   DA  n 
7 35   DC  n 
7 36   DT  n 
7 37   DA  n 
7 38   DC  n 
7 39   DC  n 
7 40   DA  n 
7 41   DC  n 
7 42   DT  n 
7 43   DG  n 
7 44   DT  n 
7 45   DG  n 
7 46   DT  n 
7 47   DA  n 
7 48   DA  n 
7 49   DG  n 
7 50   DA  n 
7 51   DC  n 
7 52   DA  n 
7 53   DG  n 
7 54   DG  n 
7 55   DC  n 
7 56   DC  n 
7 57   DA  n 
7 58   DG  n 
7 59   DA  n 
7 60   DT  n 
7 61   DC  n 
# 
loop_
_entity_src_gen.entity_id 
_entity_src_gen.pdbx_src_id 
_entity_src_gen.pdbx_alt_source_flag 
_entity_src_gen.pdbx_seq_type 
_entity_src_gen.pdbx_beg_seq_num 
_entity_src_gen.pdbx_end_seq_num 
_entity_src_gen.gene_src_common_name 
_entity_src_gen.gene_src_genus 
_entity_src_gen.pdbx_gene_src_gene 
_entity_src_gen.gene_src_species 
_entity_src_gen.gene_src_strain 
_entity_src_gen.gene_src_tissue 
_entity_src_gen.gene_src_tissue_fraction 
_entity_src_gen.gene_src_details 
_entity_src_gen.pdbx_gene_src_fragment 
_entity_src_gen.pdbx_gene_src_scientific_name 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 
_entity_src_gen.pdbx_gene_src_variant 
_entity_src_gen.pdbx_gene_src_cell_line 
_entity_src_gen.pdbx_gene_src_atcc 
_entity_src_gen.pdbx_gene_src_organ 
_entity_src_gen.pdbx_gene_src_organelle 
_entity_src_gen.pdbx_gene_src_cell 
_entity_src_gen.pdbx_gene_src_cellular_location 
_entity_src_gen.host_org_common_name 
_entity_src_gen.pdbx_host_org_scientific_name 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 
_entity_src_gen.host_org_genus 
_entity_src_gen.pdbx_host_org_gene 
_entity_src_gen.pdbx_host_org_organ 
_entity_src_gen.host_org_species 
_entity_src_gen.pdbx_host_org_tissue 
_entity_src_gen.pdbx_host_org_tissue_fraction 
_entity_src_gen.pdbx_host_org_strain 
_entity_src_gen.pdbx_host_org_variant 
_entity_src_gen.pdbx_host_org_cell_line 
_entity_src_gen.pdbx_host_org_atcc 
_entity_src_gen.pdbx_host_org_culture_collection 
_entity_src_gen.pdbx_host_org_cell 
_entity_src_gen.pdbx_host_org_organelle 
_entity_src_gen.pdbx_host_org_cellular_location 
_entity_src_gen.pdbx_host_org_vector_type 
_entity_src_gen.pdbx_host_org_vector 
_entity_src_gen.host_org_details 
_entity_src_gen.expression_system_id 
_entity_src_gen.plasmid_name 
_entity_src_gen.plasmid_details 
_entity_src_gen.pdbx_description 
1 1 sample 'Biological sequence' 1   398  ?         ? 'malE, b4034, JW3994' ? K12 ? ? ? ? 'Escherichia coli' 83333 ? ? ? ? ? ? ? ? 
'Spodoptera frugiperda' 7108 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
1 2 sample 'Biological sequence' 399 1159 Zebrafish ? rag1                  ? ?   ? ? ? ? 'Danio rerio'      7955  ? ? ? ? ? ? ? ? 
'Spodoptera frugiperda' 7108 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
2 1 sample 'Biological sequence' 1   533  Zebrafish ? rag2                  ? ?   ? ? ? ? 'Danio rerio'      7955  ? ? ? ? ? ? ? ? 
'Spodoptera frugiperda' 7108 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
3 1 sample 'Biological sequence' 1   398  ?         ? 'malE, b4034, JW3994' ? K12 ? ? ? ? 'Escherichia coli' 83333 ? ? ? ? ? ? ? ? 
'Spodoptera frugiperda' 7108 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
3 2 sample ?                     ?   ?    Zebrafish ? rag1                  ? ?   ? ? ? ? 'Danio rerio'      7955  ? ? ? ? ? ? ? ? 
'Spodoptera frugiperda' 7108 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
# 
loop_
_pdbx_entity_src_syn.entity_id 
_pdbx_entity_src_syn.pdbx_src_id 
_pdbx_entity_src_syn.pdbx_alt_source_flag 
_pdbx_entity_src_syn.pdbx_beg_seq_num 
_pdbx_entity_src_syn.pdbx_end_seq_num 
_pdbx_entity_src_syn.organism_scientific 
_pdbx_entity_src_syn.organism_common_name 
_pdbx_entity_src_syn.ncbi_taxonomy_id 
_pdbx_entity_src_syn.details 
4 1 sample 1 50 'Danio rerio' ? 7955 ? 
5 1 sample 1 50 'Danio rerio' ? 7955 ? 
6 1 sample 1 61 'Danio rerio' ? 7955 ? 
7 1 sample 1 61 'Danio rerio' ? 7955 ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_db_isoform 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
1 UNP MALE_ECOLI   P0AEX9 ? 1 
;EEGKLVIWINGDKGYNGLAEVGKKFEKDTGIKVTVEHPDKLEEKFPQVAATGDGPDIIFWAHDRFGGYAQSGLLAEITPD
KAFQDKLYPFTWDAVRYNGKLIAYPIAVEALSLIYNKDLLPNPPKTWEEIPALDKELKAKGKSALMFNLQEPYFTWPLIA
ADGGYAFKYENGKYDIKDVGVDNAGAKAGLTFLVDLIKNKHMNADTDYSIAEAAFNKGETAMTINGPWAWSNIDTSKVNY
GVTVLPTFKGQPSKPFVGVLSAGINAASPNKELAKEFLENYLLTDEGLEAVNKDKPLGAVALKSYEEELAKDPRIAATME
NAQKGEIMPNIPQMSAFWYAVRTAVINAASGRQTVDEALKDAQT
;
29  
2 UNP RAG1_DANRE   O13033 ? 1 
;RCQRDHLSTKLIPTEVPADLIRAVTCQVCDHLLSDPVQSPCRHLFCRLCIIRYTHALGPNCPTCNQHLNPSHLIKPAKFF
LATLSSLPLLCPSEECSDWVRLDSFREHCLNHYREKESQEEQTPSEQNLDGYLPVNKGGRPRQHLLSLTRRAQKHRLRDL
KNQVKTFAEKEEGGDVKSVCLTLFLLALRAGNEHKQADELEAMMQGRGFGLHPAVCLAIRVNTFLSCSQYHKMYRTVKAT
SGRQIFQPLHTLRNAEKELLPGFHQFEWQPALKNVSTSWDVGIIDGLSGWTVSVDDVPADTISRRFRYDVALVSALKDLE
EDIMEGLRERALDDSMCTSGFTVVVKESCDGMGDVSEKHGSGPAVPEKAVRFSFTIMSISIRLEGEDDGITIFQEQKPNS
ELSCRPLCLMFVDESDHETLTAILGPVVAERKAMMESRLIISVGGLLRSFRFFFRGTGYDEKMVREMEGLEASGSTYICT
LCDSTRAEASQNMVLHSITRSHDENLERYEIWRKNPFSESADELRDRVKGVSAKPFMETQPTLDALHCDIGNATEFYKIF
QDEIGEVYQKPNPSREERRRWRSTLDKQLRKKMKLKPVMRMNGNYARRLMTREAVEAVCELVPSEERREALLKLMDLYLQ
MKPVWRSTCPSRDCPDQLCQYSYNSQQFADLLSSMFKYRYDGKITNYLHKTLAHVPEIVERDGSIGAWASEGNESGNKLF
RRFRKMNARQSKTFELEDILKHHWLYTSKYLQKFMEAHKNS
;
271 
3 UNP Q1RLW7_DANRE Q1RLW7 ? 2 
;MSLQPLTAVNCGSLVQPGFSLLDLEGDVYLFGQKGWPKRSCPTGIFGVRIKKGELKLRAISFSNNSSYLPPLRCPAIAHF
EAQDGKPECYLIHGGRTPNNELSSSLYMLSVDSRGCNRKVTLRCEEKELVGDVPSARYGHTLSVINSRGKTACVLFGGRS
YMPPTERTTQNWNSVVDCPPQVYLIDLEFGCCTAHTLPELTDGQSFHVALARQDCVYFLGGHILSSDCRPSRLIRLHVEL
LLGSPVLTCTILHEGLTITSAIASPIGYHEYIIFGGYQSETQKRMECTYVGLDDVGVHMESREPPQWTSEISHSRTWFGG
SLGKGTALVAIPSEGNPTPPEAYHFYQVSFQKEQDGEATAQGGSQESTDFEDSAPLEDSEELYFGREPHELEYSSDVEGD
TYNEEDEEDESQTGYWIKCCLSCQVDPNIWEPYYSTELTRPAMIFCSRGEGGHWVHAQCMELPESLLLQLSQDNSKYFCL
DHGGLPKQEMTPPKQMLPVKRVPMKMTHRKAPVSLKMTPAKKTFLRRLFD
;
1   
4 UNP MALE_ECOLI   P0AEX9 ? 3 
;EEGKLVIWINGDKGYNGLAEVGKKFEKDTGIKVTVEHPDKLEEKFPQVAATGDGPDIIFWAHDRFGGYAQSGLLAEITPD
KAFQDKLYPFTWDAVRYNGKLIAYPIAVEALSLIYNKDLLPNPPKTWEEIPALDKELKAKGKSALMFNLQEPYFTWPLIA
ADGGYAFKYENGKYDIKDVGVDNAGAKAGLTFLVDLIKNKHMNADTDYSIAEAAFNKGETAMTINGPWAWSNIDTSKVNY
GVTVLPTFKGQPSKPFVGVLSAGINAASPNKELAKEFLENYLLTDEGLEAVNKDKPLGAVALKSYEEELAKDPRIAATME
NAQKGEIMPNIPQMSAFWYAVRTAVINAASGRQTVDEALKDAQT
;
29  
5 UNP RAG1_DANRE   O13033 ? 3 
;RCQRDHLSTKLIPTEVPADLIRAVTCQVCDHLLSDPVQSPCRHLFCRLCIIRYTHALGPNCPTCNQHLNPSHLIKPAKFF
LATLSSLPLLCPSEECSDWVRLDSFREHCLNHYREKESQEEQTPSEQNLDGYLPVNKGGRPRQHLLSLTRRAQKHRLRDL
KNQVKTFAEKEEGGDVKSVCLTLFLLALRAGNEHKQADELEAMMQGRGFGLHPAVCLAIRVNTFLSCSQYHKMYRTVKAT
SGRQIFQPLHTLRNAEKELLPGFHQFEWQPALKNVSTSWDVGIIDGLSGWTVSVDDVPADTISRRFRYDVALVSALKDLE
EDIMEGLRERALDDSMCTSGFTVVVKESCDGMGDVSEKHGSGPAVPEKAVRFSFTIMSISIRLEGEDDGITIFQEQKPNS
ELSCRPLCLMFVDESDHETLTAILGPVVAERKAMMESRLIISVGGLLRSFRFFFRGTGYDEKMVREMEGLEASGSTYICT
LCDSTRAEASQNMVLHSITRSHDENLERYEIWRKNPFSESADELRDRVKGVSAKPFMETQPTLDALHCDIGNATEFYKIF
QDEIGEVYQKPNPSREERRRWRSTLDKQLRKKMKLKPVMRMNGNYARRLMTREAVEAVCELVPSEERREALLKLMDLYLQ
MKPVWRSTCPSRDCPDQLCQYSYNSQQFADLLSSMFKYRYDGKITNYLHKTLAHVPEIVERDGSIGAWASEGNESGNKLF
RRFRKMNARQSKTFELEDILKHHWLYTSKYLQKFMEAHKNS
;
271 
6 PDB 6DBV         6DBV   ? 4 ? 1   
7 PDB 6DBV         6DBV   ? 5 ? 1   
8 PDB 6DBV         6DBV   ? 6 ? 1   
9 PDB 6DBV         6DBV   ? 7 ? 1   
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1  1 6DBV A 15  ? 378  ? P0AEX9 29  ? 392  ? -113 250  
2  2 6DBV A 399 ? 1159 ? O13033 271 ? 1031 ? 271  1031 
3  3 6DBV B 4   ? 533  ? Q1RLW7 1   ? 530  ? 1    530  
4  4 6DBV C 15  ? 378  ? P0AEX9 29  ? 392  ? -113 250  
5  5 6DBV C 399 ? 1159 ? O13033 271 ? 1031 ? 271  1031 
6  3 6DBV D 4   ? 533  ? Q1RLW7 1   ? 530  ? 1    530  
7  6 6DBV E 1   ? 50   ? 6DBV   1   ? 50   ? 1    50   
8  7 6DBV F 1   ? 50   ? 6DBV   1   ? 50   ? 1    50   
9  8 6DBV G 1   ? 61   ? 6DBV   1   ? 61   ? 1    61   
10 9 6DBV H 1   ? 61   ? 6DBV   1   ? 61   ? 1    61   
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 6DBV MET A 1   ? UNP P0AEX9 ?   ?   'initiating methionine' -127 1  
1 6DBV GLY A 2   ? UNP P0AEX9 ?   ?   'expression tag'        -126 2  
1 6DBV SER A 3   ? UNP P0AEX9 ?   ?   'expression tag'        -125 3  
1 6DBV SER A 4   ? UNP P0AEX9 ?   ?   'expression tag'        -124 4  
1 6DBV HIS A 5   ? UNP P0AEX9 ?   ?   'expression tag'        -123 5  
1 6DBV HIS A 6   ? UNP P0AEX9 ?   ?   'expression tag'        -122 6  
1 6DBV HIS A 7   ? UNP P0AEX9 ?   ?   'expression tag'        -121 7  
1 6DBV HIS A 8   ? UNP P0AEX9 ?   ?   'expression tag'        -120 8  
1 6DBV HIS A 9   ? UNP P0AEX9 ?   ?   'expression tag'        -119 9  
1 6DBV HIS A 10  ? UNP P0AEX9 ?   ?   'expression tag'        -118 10 
1 6DBV GLY A 11  ? UNP P0AEX9 ?   ?   'expression tag'        -117 11 
1 6DBV THR A 12  ? UNP P0AEX9 ?   ?   'expression tag'        -116 12 
1 6DBV LYS A 13  ? UNP P0AEX9 ?   ?   'expression tag'        -115 13 
1 6DBV THR A 14  ? UNP P0AEX9 ?   ?   'expression tag'        -114 14 
1 6DBV GLY A 379 ? UNP P0AEX9 ?   ?   linker                  251  15 
1 6DBV THR A 380 ? UNP P0AEX9 ?   ?   linker                  252  16 
1 6DBV ASP A 381 ? UNP P0AEX9 ?   ?   linker                  253  17 
1 6DBV TYR A 382 ? UNP P0AEX9 ?   ?   linker                  254  18 
1 6DBV ASP A 383 ? UNP P0AEX9 ?   ?   linker                  255  19 
1 6DBV ILE A 384 ? UNP P0AEX9 ?   ?   linker                  256  20 
1 6DBV PRO A 385 ? UNP P0AEX9 ?   ?   linker                  257  21 
1 6DBV THR A 386 ? UNP P0AEX9 ?   ?   linker                  258  22 
1 6DBV THR A 387 ? UNP P0AEX9 ?   ?   linker                  259  23 
1 6DBV LEU A 388 ? UNP P0AEX9 ?   ?   linker                  260  24 
1 6DBV GLU A 389 ? UNP P0AEX9 ?   ?   linker                  261  25 
1 6DBV VAL A 390 ? UNP P0AEX9 ?   ?   linker                  262  26 
1 6DBV LEU A 391 ? UNP P0AEX9 ?   ?   linker                  263  27 
1 6DBV PHE A 392 ? UNP P0AEX9 ?   ?   linker                  264  28 
1 6DBV GLN A 393 ? UNP P0AEX9 ?   ?   linker                  265  29 
1 6DBV GLY A 394 ? UNP P0AEX9 ?   ?   linker                  266  30 
1 6DBV PRO A 395 ? UNP P0AEX9 ?   ?   linker                  267  31 
1 6DBV LEU A 396 ? UNP P0AEX9 ?   ?   linker                  268  32 
1 6DBV GLY A 397 ? UNP P0AEX9 ?   ?   linker                  269  33 
1 6DBV SER A 398 ? UNP P0AEX9 ?   ?   linker                  270  34 
2 6DBV ARG A 593 ? UNP O13033 LYS 465 conflict                465  35 
3 6DBV GLY B 1   ? UNP Q1RLW7 ?   ?   'expression tag'        -2   36 
3 6DBV GLY B 2   ? UNP Q1RLW7 ?   ?   'expression tag'        -1   37 
3 6DBV SER B 3   ? UNP Q1RLW7 ?   ?   'expression tag'        0    38 
4 6DBV MET C 1   ? UNP P0AEX9 ?   ?   'initiating methionine' -127 39 
4 6DBV GLY C 2   ? UNP P0AEX9 ?   ?   'expression tag'        -126 40 
4 6DBV SER C 3   ? UNP P0AEX9 ?   ?   'expression tag'        -125 41 
4 6DBV SER C 4   ? UNP P0AEX9 ?   ?   'expression tag'        -124 42 
4 6DBV HIS C 5   ? UNP P0AEX9 ?   ?   'expression tag'        -123 43 
4 6DBV HIS C 6   ? UNP P0AEX9 ?   ?   'expression tag'        -122 44 
4 6DBV HIS C 7   ? UNP P0AEX9 ?   ?   'expression tag'        -121 45 
4 6DBV HIS C 8   ? UNP P0AEX9 ?   ?   'expression tag'        -120 46 
4 6DBV HIS C 9   ? UNP P0AEX9 ?   ?   'expression tag'        -119 47 
4 6DBV HIS C 10  ? UNP P0AEX9 ?   ?   'expression tag'        -118 48 
4 6DBV GLY C 11  ? UNP P0AEX9 ?   ?   'expression tag'        -117 49 
4 6DBV THR C 12  ? UNP P0AEX9 ?   ?   'expression tag'        -116 50 
4 6DBV LYS C 13  ? UNP P0AEX9 ?   ?   'expression tag'        -115 51 
4 6DBV THR C 14  ? UNP P0AEX9 ?   ?   'expression tag'        -114 52 
4 6DBV GLY C 379 ? UNP P0AEX9 ?   ?   linker                  251  53 
4 6DBV THR C 380 ? UNP P0AEX9 ?   ?   linker                  252  54 
4 6DBV ASP C 381 ? UNP P0AEX9 ?   ?   linker                  253  55 
4 6DBV TYR C 382 ? UNP P0AEX9 ?   ?   linker                  254  56 
4 6DBV ASP C 383 ? UNP P0AEX9 ?   ?   linker                  255  57 
4 6DBV ILE C 384 ? UNP P0AEX9 ?   ?   linker                  256  58 
4 6DBV PRO C 385 ? UNP P0AEX9 ?   ?   linker                  257  59 
4 6DBV THR C 386 ? UNP P0AEX9 ?   ?   linker                  258  60 
4 6DBV THR C 387 ? UNP P0AEX9 ?   ?   linker                  259  61 
4 6DBV LEU C 388 ? UNP P0AEX9 ?   ?   linker                  260  62 
4 6DBV GLU C 389 ? UNP P0AEX9 ?   ?   linker                  261  63 
4 6DBV VAL C 390 ? UNP P0AEX9 ?   ?   linker                  262  64 
4 6DBV LEU C 391 ? UNP P0AEX9 ?   ?   linker                  263  65 
4 6DBV PHE C 392 ? UNP P0AEX9 ?   ?   linker                  264  66 
4 6DBV GLN C 393 ? UNP P0AEX9 ?   ?   linker                  265  67 
4 6DBV GLY C 394 ? UNP P0AEX9 ?   ?   linker                  266  68 
4 6DBV PRO C 395 ? UNP P0AEX9 ?   ?   linker                  267  69 
4 6DBV LEU C 396 ? UNP P0AEX9 ?   ?   linker                  268  70 
4 6DBV GLY C 397 ? UNP P0AEX9 ?   ?   linker                  269  71 
4 6DBV SER C 398 ? UNP P0AEX9 ?   ?   linker                  270  72 
6 6DBV GLY D 1   ? UNP Q1RLW7 ?   ?   'expression tag'        -2   73 
6 6DBV GLY D 2   ? UNP Q1RLW7 ?   ?   'expression tag'        -1   74 
6 6DBV SER D 3   ? UNP Q1RLW7 ?   ?   'expression tag'        0    75 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                              ? 'C3 H7 N O2'      89.093  
ARG 'L-peptide linking' y ARGININE                             ? 'C6 H15 N4 O2 1'  175.209 
ASN 'L-peptide linking' y ASPARAGINE                           ? 'C4 H8 N2 O3'     132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                      ? 'C4 H7 N O4'      133.103 
CA  non-polymer         . 'CALCIUM ION'                        ? 'Ca 2'            40.078  
CYS 'L-peptide linking' y CYSTEINE                             ? 'C3 H7 N O2 S'    121.158 
DA  'DNA linking'       y "2'-DEOXYADENOSINE-5'-MONOPHOSPHATE" ? 'C10 H14 N5 O6 P' 331.222 
DC  'DNA linking'       y "2'-DEOXYCYTIDINE-5'-MONOPHOSPHATE"  ? 'C9 H14 N3 O7 P'  307.197 
DG  'DNA linking'       y "2'-DEOXYGUANOSINE-5'-MONOPHOSPHATE" ? 'C10 H14 N5 O7 P' 347.221 
DT  'DNA linking'       y "THYMIDINE-5'-MONOPHOSPHATE"         ? 'C10 H15 N2 O8 P' 322.208 
GLN 'L-peptide linking' y GLUTAMINE                            ? 'C5 H10 N2 O3'    146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                      ? 'C5 H9 N O4'      147.129 
GLY 'peptide linking'   y GLYCINE                              ? 'C2 H5 N O2'      75.067  
HIS 'L-peptide linking' y HISTIDINE                            ? 'C6 H10 N3 O2 1'  156.162 
ILE 'L-peptide linking' y ISOLEUCINE                           ? 'C6 H13 N O2'     131.173 
LEU 'L-peptide linking' y LEUCINE                              ? 'C6 H13 N O2'     131.173 
LYS 'L-peptide linking' y LYSINE                               ? 'C6 H15 N2 O2 1'  147.195 
MET 'L-peptide linking' y METHIONINE                           ? 'C5 H11 N O2 S'   149.211 
PHE 'L-peptide linking' y PHENYLALANINE                        ? 'C9 H11 N O2'     165.189 
PRO 'L-peptide linking' y PROLINE                              ? 'C5 H9 N O2'      115.130 
SER 'L-peptide linking' y SERINE                               ? 'C3 H7 N O3'      105.093 
THR 'L-peptide linking' y THREONINE                            ? 'C4 H9 N O3'      119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                           ? 'C11 H12 N2 O2'   204.225 
TYR 'L-peptide linking' y TYROSINE                             ? 'C9 H11 N O3'     181.189 
VAL 'L-peptide linking' y VALINE                               ? 'C5 H11 N O2'     117.146 
ZN  non-polymer         . 'ZINC ION'                           ? 'Zn 2'            65.409  
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.entry_id                   6DBV 
_exptl.crystals_number            ? 
_exptl.details                    ? 
_exptl.method                     'ELECTRON MICROSCOPY' 
_exptl.method_details             ? 
# 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.B_iso_max                                ? 
_refine.B_iso_mean                               ? 
_refine.B_iso_min                                ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.details                                  ? 
_refine.diff_density_max                         ? 
_refine.diff_density_max_esd                     ? 
_refine.diff_density_min                         ? 
_refine.diff_density_min_esd                     ? 
_refine.diff_density_rms                         ? 
_refine.diff_density_rms_esd                     ? 
_refine.entry_id                                 6DBV 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.ls_abs_structure_details                 ? 
_refine.ls_abs_structure_Flack                   ? 
_refine.ls_abs_structure_Flack_esd               ? 
_refine.ls_abs_structure_Rogers                  ? 
_refine.ls_abs_structure_Rogers_esd              ? 
_refine.ls_d_res_high                            4.291 
_refine.ls_d_res_low                             237.696 
_refine.ls_extinction_coef                       ? 
_refine.ls_extinction_coef_esd                   ? 
_refine.ls_extinction_expression                 ? 
_refine.ls_extinction_method                     ? 
_refine.ls_goodness_of_fit_all                   ? 
_refine.ls_goodness_of_fit_all_esd               ? 
_refine.ls_goodness_of_fit_obs                   ? 
_refine.ls_goodness_of_fit_obs_esd               ? 
_refine.ls_hydrogen_treatment                    ? 
_refine.ls_matrix_type                           ? 
_refine.ls_number_constraints                    ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_reflns_all                     ? 
_refine.ls_number_reflns_obs                     356123 
_refine.ls_number_reflns_R_free                  2032 
_refine.ls_number_reflns_R_work                  ? 
_refine.ls_number_restraints                     ? 
_refine.ls_percent_reflns_obs                    99.91 
_refine.ls_percent_reflns_R_free                 0.57 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_obs                          0.4344 
_refine.ls_R_factor_R_free                       0.4331 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_R_factor_R_work                       0.4344 
_refine.ls_R_Fsqd_factor_obs                     ? 
_refine.ls_R_I_factor_obs                        ? 
_refine.ls_redundancy_reflns_all                 ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.ls_restrained_S_all                      ? 
_refine.ls_restrained_S_obs                      ? 
_refine.ls_shift_over_esd_max                    ? 
_refine.ls_shift_over_esd_mean                   ? 
_refine.ls_structure_factor_coef                 ? 
_refine.ls_weighting_details                     ? 
_refine.ls_weighting_scheme                      ? 
_refine.ls_wR_factor_all                         ? 
_refine.ls_wR_factor_obs                         ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.occupancy_max                            ? 
_refine.occupancy_min                            ? 
_refine.solvent_model_details                    'FLAT BULK SOLVENT MODEL' 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.ls_R_factor_gt                           ? 
_refine.ls_goodness_of_fit_gt                    ? 
_refine.ls_goodness_of_fit_ref                   ? 
_refine.ls_shift_over_su_max                     ? 
_refine.ls_shift_over_su_max_lt                  ? 
_refine.ls_shift_over_su_mean                    ? 
_refine.ls_shift_over_su_mean_lt                 ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          0.03 
_refine.pdbx_ls_sigma_Fsqd                       ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_ls_cross_valid_method               ? 
_refine.pdbx_method_to_determine_struct          ? 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_stereochemistry_target_values       MLHL 
_refine.pdbx_R_Free_selection_details            ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.pdbx_solvent_vdw_probe_radii             1.11 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             0.90 
_refine.pdbx_real_space_R                        ? 
_refine.pdbx_density_correlation                 ? 
_refine.pdbx_pd_number_of_powder_patterns        ? 
_refine.pdbx_pd_number_of_points                 ? 
_refine.pdbx_pd_meas_number_of_points            ? 
_refine.pdbx_pd_proc_ls_prof_R_factor            ? 
_refine.pdbx_pd_proc_ls_prof_wR_factor           ? 
_refine.pdbx_pd_Marquardt_correlation_coeff      ? 
_refine.pdbx_pd_Fsqrd_R_factor                   ? 
_refine.pdbx_pd_ls_matrix_band_width             ? 
_refine.pdbx_overall_phase_error                 56.19 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_diffrn_id                           ? 
_refine.overall_SU_B                             ? 
_refine.overall_SU_ML                            1.26 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_average_fsc_overall                 ? 
_refine.pdbx_average_fsc_work                    ? 
_refine.pdbx_average_fsc_free                    ? 
# 
loop_
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.criterion 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.number 
_refine_ls_restr.rejects 
_refine_ls_restr.type 
_refine_ls_restr.weight 
_refine_ls_restr.pdbx_restraint_function 
'X-RAY DIFFRACTION' ? 0.006  ? 20836 ? f_bond_d           ? ? 
'X-RAY DIFFRACTION' ? 0.842  ? 29104 ? f_angle_d          ? ? 
'X-RAY DIFFRACTION' ? 19.064 ? 11759 ? f_dihedral_angle_d ? ? 
'X-RAY DIFFRACTION' ? 0.047  ? 3187  ? f_chiral_restr     ? ? 
'X-RAY DIFFRACTION' ? 0.005  ? 2985  ? f_plane_restr      ? ? 
# 
_struct.entry_id                     6DBV 
_struct.title                        'Cryo-EM structure of RAG in complex with 12-RSS and 23-RSS substrate DNAs' 
_struct.pdbx_descriptor              
;Maltose-binding periplasmic protein,V(D)J recombination-activating protein 1, Recombination activating gene 2, Maltose-binding periplasmic protein/DNA Complex
;
_struct.pdbx_model_details           ? 
_struct.pdbx_formula_weight          ? 
_struct.pdbx_formula_weight_method   ? 
_struct.pdbx_model_type_details      ? 
_struct.pdbx_CASP_flag               N 
# 
_struct_keywords.entry_id        6DBV 
_struct_keywords.text            'V(D)J recombination, RAG complex, Melted RSS, Unmelted RSS, Recombination-DNA complex' 
_struct_keywords.pdbx_keywords   Recombination/DNA 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
D N N 2 ? 
E N N 4 ? 
F N N 5 ? 
G N N 6 ? 
H N N 7 ? 
I N N 8 ? 
J N N 9 ? 
K N N 9 ? 
L N N 8 ? 
M N N 9 ? 
N N N 9 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  AA1 THR A 547  ? GLU A 570  ? THR A 419  GLU A 442  1 ? 24 
HELX_P HELX_P2  AA2 VAL A 574  ? ALA A 588  ? VAL A 446  ALA A 460  1 ? 15 
HELX_P HELX_P3  AA3 GLU A 591  ? MET A 602  ? GLU A 463  MET A 474  1 ? 12 
HELX_P HELX_P4  AA4 HIS A 610  ? ASN A 620  ? HIS A 482  ASN A 492  1 ? 11 
HELX_P HELX_P5  AA5 SER A 624  ? THR A 638  ? SER A 496  THR A 510  1 ? 15 
HELX_P HELX_P6  AA6 PRO A 646  ? ARG A 651  ? PRO A 518  ARG A 523  1 ? 6  
HELX_P HELX_P7  AA7 ARG A 705  ? ARG A 728  ? ARG A 577  ARG A 600  1 ? 24 
HELX_P HELX_P8  AA8 SER A 798  ? CYS A 802  ? SER A 670  CYS A 674  5 ? 5  
HELX_P HELX_P9  AA9 ASP A 814  ? MET A 833  ? ASP A 686  MET A 705  1 ? 20 
HELX_P HELX_P10 AB1 ASP A 858  ? GLY A 867  ? ASP A 730  GLY A 739  1 ? 10 
HELX_P HELX_P11 AB2 ALA A 885  ? ASN A 890  ? ALA A 757  ASN A 762  1 ? 6  
HELX_P HELX_P12 AB3 SER A 899  ? ASN A 913  ? SER A 771  ASN A 785  1 ? 15 
HELX_P HELX_P13 AB4 SER A 918  ? VAL A 926  ? SER A 790  VAL A 798  1 ? 9  
HELX_P HELX_P14 AB5 ALA A 943  ? GLY A 963  ? ALA A 815  GLY A 835  1 ? 21 
HELX_P HELX_P15 AB6 SER A 972  ? LYS A 990  ? SER A 844  LYS A 862  1 ? 19 
HELX_P HELX_P16 AB7 ASN A 1000 ? LEU A 1007 ? ASN A 872  LEU A 879  1 ? 8  
HELX_P HELX_P17 AB8 THR A 1009 ? GLU A 1018 ? THR A 881  GLU A 890  1 ? 10 
HELX_P HELX_P18 AB9 SER A 1022 ? LYS A 1040 ? SER A 894  LYS A 912  1 ? 19 
HELX_P HELX_P19 AC1 LYS A 1040 ? SER A 1045 ? LYS A 912  SER A 917  1 ? 6  
HELX_P HELX_P20 AC2 CYS A 1047 ? CYS A 1052 ? CYS A 919  CYS A 924  1 ? 6  
HELX_P HELX_P21 AC3 CYS A 1052 ? GLN A 1058 ? CYS A 924  GLN A 930  1 ? 7  
HELX_P HELX_P22 AC4 GLN A 1058 ? LYS A 1075 ? GLN A 930  LYS A 947  1 ? 18 
HELX_P HELX_P23 AC5 THR A 1083 ? HIS A 1092 ? THR A 955  HIS A 964  1 ? 10 
HELX_P HELX_P24 AC6 HIS A 1092 ? ASP A 1100 ? HIS A 964  ASP A 972  1 ? 9  
HELX_P HELX_P25 AC7 SER A 1108 ? ASN A 1115 ? SER A 980  ASN A 987  1 ? 8  
HELX_P HELX_P26 AC8 ASN A 1115 ? ASN A 1125 ? ASN A 987  ASN A 997  1 ? 11 
HELX_P HELX_P27 AC9 SER A 1129 ? SER A 1146 ? SER A 1001 SER A 1018 1 ? 18 
HELX_P HELX_P28 AD1 SER A 1146 ? ALA A 1155 ? SER A 1018 ALA A 1027 1 ? 10 
HELX_P HELX_P29 AD2 PRO B 166  ? ARG B 170  ? PRO B 163  ARG B 167  5 ? 5  
HELX_P HELX_P30 AD3 THR B 171  ? TRP B 175  ? THR B 168  TRP B 172  5 ? 5  
HELX_P HELX_P31 AD4 THR B 311  ? HIS B 316  ? THR B 308  HIS B 313  1 ? 6  
HELX_P HELX_P32 AD5 THR C 547  ? GLU C 569  ? THR C 419  GLU C 441  1 ? 23 
HELX_P HELX_P33 AD6 ASP C 573  ? ARG C 587  ? ASP C 445  ARG C 459  1 ? 15 
HELX_P HELX_P34 AD7 ALA C 588  ? ASN C 590  ? ALA C 460  ASN C 462  5 ? 3  
HELX_P HELX_P35 AD8 GLU C 591  ? MET C 601  ? GLU C 463  MET C 473  1 ? 11 
HELX_P HELX_P36 AD9 HIS C 610  ? ASN C 620  ? HIS C 482  ASN C 492  1 ? 11 
HELX_P HELX_P37 AE1 SER C 624  ? SER C 639  ? SER C 496  SER C 511  1 ? 16 
HELX_P HELX_P38 AE2 PRO C 646  ? LYS C 655  ? PRO C 518  LYS C 527  1 ? 10 
HELX_P HELX_P39 AE3 ARG C 705  ? ARG C 728  ? ARG C 577  ARG C 600  1 ? 24 
HELX_P HELX_P40 AE4 SER C 798  ? CYS C 802  ? SER C 670  CYS C 674  5 ? 5  
HELX_P HELX_P41 AE5 ASP C 814  ? ALA C 831  ? ASP C 686  ALA C 703  1 ? 18 
HELX_P HELX_P42 AE6 ASP C 858  ? MET C 865  ? ASP C 730  MET C 737  1 ? 8  
HELX_P HELX_P43 AE7 THR C 883  ? ASN C 890  ? THR C 755  ASN C 762  1 ? 8  
HELX_P HELX_P44 AE8 SER C 899  ? ASN C 913  ? SER C 771  ASN C 785  1 ? 15 
HELX_P HELX_P45 AE9 SER C 918  ? LYS C 927  ? SER C 790  LYS C 799  1 ? 10 
HELX_P HELX_P46 AF1 ASP C 947  ? GLY C 963  ? ASP C 819  GLY C 835  1 ? 17 
HELX_P HELX_P47 AF2 SER C 972  ? MET C 991  ? SER C 844  MET C 863  1 ? 20 
HELX_P HELX_P48 AF3 ASN C 1000 ? MET C 1008 ? ASN C 872  MET C 880  1 ? 9  
HELX_P HELX_P49 AF4 THR C 1009 ? CYS C 1017 ? THR C 881  CYS C 889  1 ? 9  
HELX_P HELX_P50 AF5 SER C 1022 ? SER C 1045 ? SER C 894  SER C 917  1 ? 24 
HELX_P HELX_P51 AF6 CYS C 1052 ? GLN C 1058 ? CYS C 924  GLN C 930  1 ? 7  
HELX_P HELX_P52 AF7 GLN C 1058 ? PHE C 1074 ? GLN C 930  PHE C 946  1 ? 17 
HELX_P HELX_P53 AF8 THR C 1083 ? ASP C 1100 ? THR C 955  ASP C 972  1 ? 18 
HELX_P HELX_P54 AF9 ILE C 1103 ? ALA C 1107 ? ILE C 975  ALA C 979  5 ? 5  
HELX_P HELX_P55 AG1 SER C 1108 ? ALA C 1126 ? SER C 980  ALA C 998  1 ? 19 
HELX_P HELX_P56 AG2 SER C 1129 ? THR C 1145 ? SER C 1001 THR C 1017 1 ? 17 
HELX_P HELX_P57 AG3 SER C 1146 ? PHE C 1152 ? SER C 1018 PHE C 1024 1 ? 7  
HELX_P HELX_P58 AG4 THR D 311  ? SER D 317  ? THR D 308  SER D 314  1 ? 7  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
metalc1   metalc ?    ? A ASP 748  OD2   ? ? ? 1_555 J CA  .    CA  ? ? A ASP 620 A CA  1102 1_555 ? ? ? ? ? ? ? 2.559 ? 
metalc2   metalc ?    ? A CYS 877  SG    ? ? ? 1_555 I ZN  .    ZN  ? ? A CYS 749 A ZN  1101 1_555 ? ? ? ? ? ? ? 2.366 ? 
metalc3   metalc ?    ? A HIS 1087 NE2   ? ? ? 1_555 I ZN  .    ZN  ? ? A HIS 959 A ZN  1101 1_555 ? ? ? ? ? ? ? 2.166 ? 
metalc4   metalc ?    ? A HIS 1092 NE2   ? ? ? 1_555 I ZN  .    ZN  ? ? A HIS 964 A ZN  1101 1_555 ? ? ? ? ? ? ? 2.175 ? 
metalc5   metalc ?    ? A GLU 1112 OE1   ? ? ? 1_555 K CA  .    CA  ? ? A GLU 984 A CA  1103 1_555 ? ? ? ? ? ? ? 2.745 ? 
metalc6   metalc ?    ? A GLU 1112 OE2   ? ? ? 1_555 J CA  .    CA  ? ? A GLU 984 A CA  1102 1_555 ? ? ? ? ? ? ? 2.463 ? 
metalc7   metalc ?    ? A GLU 1112 OE2   ? ? ? 1_555 K CA  .    CA  ? ? A GLU 984 A CA  1103 1_555 ? ? ? ? ? ? ? 2.409 ? 
metalc8   metalc ?    ? C ASP 748  OD1   ? ? ? 1_555 N CA  .    CA  ? ? C ASP 620 C CA  1103 1_555 ? ? ? ? ? ? ? 2.812 ? 
metalc9   metalc ?    ? C ASP 748  OD2   ? ? ? 1_555 M CA  .    CA  ? ? C ASP 620 C CA  1102 1_555 ? ? ? ? ? ? ? 2.444 ? 
metalc10  metalc ?    ? C ASP 748  OD2   ? ? ? 1_555 N CA  .    CA  ? ? C ASP 620 C CA  1103 1_555 ? ? ? ? ? ? ? 2.538 ? 
covale1   covale none ? C ARG 803  NH2   ? ? ? 1_555 C TRP 1142 CZ2 ? ? C ARG 675 C TRP 1014 1_555 ? ? ? ? ? ? ? 1.582 ? 
covale2   covale none ? C ARG 803  NH2   ? ? ? 1_555 C TRP 1142 CH2 ? ? C ARG 675 C TRP 1014 1_555 ? ? ? ? ? ? ? 1.293 ? 
metalc11  metalc ?    ? C SER 895  N     ? ? ? 1_555 L ZN  .    ZN  ? ? C SER 767 C ZN  1101 1_555 ? ? ? ? ? ? ? 2.203 ? 
metalc12  metalc ?    ? C SER 895  O     ? ? ? 1_555 L ZN  .    ZN  ? ? C SER 767 C ZN  1101 1_555 ? ? ? ? ? ? ? 2.380 ? 
metalc13  metalc ?    ? C GLU 1112 OE1   ? ? ? 1_555 M CA  .    CA  ? ? C GLU 984 C CA  1102 1_555 ? ? ? ? ? ? ? 3.169 ? 
metalc14  metalc ?    ? C GLU 1112 OE2   ? ? ? 1_555 M CA  .    CA  ? ? C GLU 984 C CA  1102 1_555 ? ? ? ? ? ? ? 3.069 ? 
metalc15  metalc ?    ? E DC  17   OP1   ? ? ? 1_555 J CA  .    CA  ? ? E DC  17  A CA  1102 1_555 ? ? ? ? ? ? ? 2.534 ? 
metalc16  metalc ?    ? E DC  17   OP1   ? ? ? 1_555 K CA  .    CA  ? ? E DC  17  A CA  1103 1_555 ? ? ? ? ? ? ? 3.106 ? 
metalc17  metalc ?    ? E DC  17   OP2   ? ? ? 1_555 J CA  .    CA  ? ? E DC  17  A CA  1102 1_555 ? ? ? ? ? ? ? 2.953 ? 
metalc18  metalc ?    ? E DC  17   OP2   ? ? ? 1_555 K CA  .    CA  ? ? E DC  17  A CA  1103 1_555 ? ? ? ? ? ? ? 2.499 ? 
metalc19  metalc ?    ? E DC  17   "O5'" ? ? ? 1_555 K CA  .    CA  ? ? E DC  17  A CA  1103 1_555 ? ? ? ? ? ? ? 3.059 ? 
hydrog1   hydrog ?    ? E DG  1    N1    ? ? ? 1_555 F DC  50   N3  ? ? E DG  1   F DC  50   1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? 
hydrog2   hydrog ?    ? E DG  1    N2    ? ? ? 1_555 F DC  50   O2  ? ? E DG  1   F DC  50   1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? 
hydrog3   hydrog ?    ? E DG  1    O6    ? ? ? 1_555 F DC  50   N4  ? ? E DG  1   F DC  50   1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? 
hydrog4   hydrog ?    ? E DA  2    N1    ? ? ? 1_555 F DT  49   N3  ? ? E DA  2   F DT  49   1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? 
hydrog5   hydrog ?    ? E DA  2    N6    ? ? ? 1_555 F DT  49   O4  ? ? E DA  2   F DT  49   1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? 
hydrog6   hydrog ?    ? E DT  3    N3    ? ? ? 1_555 F DA  48   N1  ? ? E DT  3   F DA  48   1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? 
hydrog7   hydrog ?    ? E DT  3    O4    ? ? ? 1_555 F DA  48   N6  ? ? E DT  3   F DA  48   1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? 
hydrog8   hydrog ?    ? E DC  4    N3    ? ? ? 1_555 F DG  47   N1  ? ? E DC  4   F DG  47   1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? 
hydrog9   hydrog ?    ? E DC  4    N4    ? ? ? 1_555 F DG  47   O6  ? ? E DC  4   F DG  47   1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? 
hydrog10  hydrog ?    ? E DC  4    O2    ? ? ? 1_555 F DG  47   N2  ? ? E DC  4   F DG  47   1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? 
hydrog11  hydrog ?    ? E DT  5    N3    ? ? ? 1_555 F DA  46   N1  ? ? E DT  5   F DA  46   1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? 
hydrog12  hydrog ?    ? E DT  5    O4    ? ? ? 1_555 F DA  46   N6  ? ? E DT  5   F DA  46   1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? 
hydrog13  hydrog ?    ? E DG  6    N1    ? ? ? 1_555 F DC  45   N3  ? ? E DG  6   F DC  45   1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? 
hydrog14  hydrog ?    ? E DG  6    N2    ? ? ? 1_555 F DC  45   O2  ? ? E DG  6   F DC  45   1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? 
hydrog15  hydrog ?    ? E DG  6    O6    ? ? ? 1_555 F DC  45   N4  ? ? E DG  6   F DC  45   1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? 
hydrog16  hydrog ?    ? E DG  7    N1    ? ? ? 1_555 F DC  44   N3  ? ? E DG  7   F DC  44   1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? 
hydrog17  hydrog ?    ? E DG  7    N2    ? ? ? 1_555 F DC  44   O2  ? ? E DG  7   F DC  44   1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? 
hydrog18  hydrog ?    ? E DG  7    O6    ? ? ? 1_555 F DC  44   N4  ? ? E DG  7   F DC  44   1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? 
hydrog19  hydrog ?    ? E DC  8    N3    ? ? ? 1_555 F DG  43   N1  ? ? E DC  8   F DG  43   1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? 
hydrog20  hydrog ?    ? E DC  8    N4    ? ? ? 1_555 F DG  43   O6  ? ? E DC  8   F DG  43   1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? 
hydrog21  hydrog ?    ? E DC  8    O2    ? ? ? 1_555 F DG  43   N2  ? ? E DC  8   F DG  43   1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? 
hydrog22  hydrog ?    ? E DC  9    N3    ? ? ? 1_555 F DG  42   N1  ? ? E DC  9   F DG  42   1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? 
hydrog23  hydrog ?    ? E DC  9    N4    ? ? ? 1_555 F DG  42   O6  ? ? E DC  9   F DG  42   1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? 
hydrog24  hydrog ?    ? E DC  9    O2    ? ? ? 1_555 F DG  42   N2  ? ? E DC  9   F DG  42   1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? 
hydrog25  hydrog ?    ? E DT  10   N3    ? ? ? 1_555 F DA  41   N1  ? ? E DT  10  F DA  41   1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? 
hydrog26  hydrog ?    ? E DT  10   O4    ? ? ? 1_555 F DA  41   N6  ? ? E DT  10  F DA  41   1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? 
hydrog27  hydrog ?    ? E DG  11   N1    ? ? ? 1_555 F DA  39   N1  ? ? E DG  11  F DA  39   1_555 ? ? ? ? ? ? TYPE_8_PAIR ?     ? 
hydrog28  hydrog ?    ? E DG  11   O6    ? ? ? 1_555 F DA  39   N6  ? ? E DG  11  F DA  39   1_555 ? ? ? ? ? ? TYPE_8_PAIR ?     ? 
hydrog29  hydrog ?    ? E DG  11   N1    ? ? ? 1_555 F DC  40   N3  ? ? E DG  11  F DC  40   1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? 
hydrog30  hydrog ?    ? E DG  11   N2    ? ? ? 1_555 F DC  40   O2  ? ? E DG  11  F DC  40   1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? 
hydrog31  hydrog ?    ? E DG  11   O6    ? ? ? 1_555 F DC  40   N4  ? ? E DG  11  F DC  40   1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? 
hydrog32  hydrog ?    ? E DT  12   N3    ? ? ? 1_555 F DA  39   N1  ? ? E DT  12  F DA  39   1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? 
hydrog33  hydrog ?    ? E DT  12   O4    ? ? ? 1_555 F DA  39   N6  ? ? E DT  12  F DA  39   1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? 
hydrog34  hydrog ?    ? E DC  13   N3    ? ? ? 1_555 F DG  38   N1  ? ? E DC  13  F DG  38   1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? 
hydrog35  hydrog ?    ? E DC  13   N4    ? ? ? 1_555 F DG  38   O6  ? ? E DC  13  F DG  38   1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? 
hydrog36  hydrog ?    ? E DC  13   O2    ? ? ? 1_555 F DG  38   N2  ? ? E DC  13  F DG  38   1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? 
hydrog37  hydrog ?    ? E DT  14   N3    ? ? ? 1_555 F DA  37   N1  ? ? E DT  14  F DA  37   1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? 
hydrog38  hydrog ?    ? E DT  14   O4    ? ? ? 1_555 F DA  37   N6  ? ? E DT  14  F DA  37   1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? 
hydrog39  hydrog ?    ? E DT  15   N3    ? ? ? 1_555 F DA  36   N1  ? ? E DT  15  F DA  36   1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? 
hydrog40  hydrog ?    ? E DT  15   O4    ? ? ? 1_555 F DA  36   N6  ? ? E DT  15  F DA  36   1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? 
hydrog41  hydrog ?    ? E DA  16   N1    ? ? ? 1_555 F DT  35   N3  ? ? E DA  16  F DT  35   1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? 
hydrog42  hydrog ?    ? E DA  16   N6    ? ? ? 1_555 F DT  35   O4  ? ? E DA  16  F DT  35   1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? 
hydrog43  hydrog ?    ? E DC  17   N4    ? ? ? 1_555 F DG  34   O6  ? ? E DC  17  F DG  34   1_555 ? ? ? ? ? ? 'DC-DG PAIR' ?     
? 
hydrog44  hydrog ?    ? E DA  20   N1    ? ? ? 1_555 F DT  31   N3  ? ? E DA  20  F DT  31   1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? 
hydrog45  hydrog ?    ? E DA  20   N6    ? ? ? 1_555 F DT  31   O4  ? ? E DA  20  F DT  31   1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? 
hydrog46  hydrog ?    ? E DG  21   N1    ? ? ? 1_555 F DA  29   N1  ? ? E DG  21  F DA  29   1_555 ? ? ? ? ? ? TYPE_8_PAIR ?     ? 
hydrog47  hydrog ?    ? E DG  21   O6    ? ? ? 1_555 F DA  29   N6  ? ? E DG  21  F DA  29   1_555 ? ? ? ? ? ? TYPE_8_PAIR ?     ? 
hydrog48  hydrog ?    ? E DG  21   N1    ? ? ? 1_555 F DC  30   N3  ? ? E DG  21  F DC  30   1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? 
hydrog49  hydrog ?    ? E DG  21   N2    ? ? ? 1_555 F DC  30   O2  ? ? E DG  21  F DC  30   1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? 
hydrog50  hydrog ?    ? E DG  21   O6    ? ? ? 1_555 F DC  30   N4  ? ? E DG  21  F DC  30   1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? 
hydrog51  hydrog ?    ? E DT  22   N3    ? ? ? 1_555 F DA  29   N1  ? ? E DT  22  F DA  29   1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? 
hydrog52  hydrog ?    ? E DT  22   O4    ? ? ? 1_555 F DA  29   N6  ? ? E DT  22  F DA  29   1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? 
hydrog53  hydrog ?    ? E DG  23   N1    ? ? ? 1_555 F DC  28   N3  ? ? E DG  23  F DC  28   1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? 
hydrog54  hydrog ?    ? E DG  23   N2    ? ? ? 1_555 F DC  28   O2  ? ? E DG  23  F DC  28   1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? 
hydrog55  hydrog ?    ? E DG  23   O6    ? ? ? 1_555 F DC  28   N4  ? ? E DG  23  F DC  28   1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? 
hydrog56  hydrog ?    ? E DC  24   N3    ? ? ? 1_555 F DG  27   N1  ? ? E DC  24  F DG  27   1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? 
hydrog57  hydrog ?    ? E DC  24   N4    ? ? ? 1_555 F DG  27   O6  ? ? E DC  24  F DG  27   1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? 
hydrog58  hydrog ?    ? E DC  24   O2    ? ? ? 1_555 F DG  27   N2  ? ? E DC  24  F DG  27   1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? 
hydrog59  hydrog ?    ? E DT  25   N3    ? ? ? 1_555 F DA  26   N1  ? ? E DT  25  F DA  26   1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? 
hydrog60  hydrog ?    ? E DT  25   O4    ? ? ? 1_555 F DA  26   N6  ? ? E DT  25  F DA  26   1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? 
hydrog61  hydrog ?    ? E DA  26   N1    ? ? ? 1_555 F DT  25   N3  ? ? E DA  26  F DT  25   1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? 
hydrog62  hydrog ?    ? E DA  26   N6    ? ? ? 1_555 F DT  25   O4  ? ? E DA  26  F DT  25   1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? 
hydrog63  hydrog ?    ? E DC  27   N3    ? ? ? 1_555 F DG  24   N1  ? ? E DC  27  F DG  24   1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? 
hydrog64  hydrog ?    ? E DC  27   N4    ? ? ? 1_555 F DG  24   O6  ? ? E DC  27  F DG  24   1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? 
hydrog65  hydrog ?    ? E DC  27   O2    ? ? ? 1_555 F DG  24   N2  ? ? E DC  27  F DG  24   1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? 
hydrog66  hydrog ?    ? E DA  28   N1    ? ? ? 1_555 F DT  23   N3  ? ? E DA  28  F DT  23   1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? 
hydrog67  hydrog ?    ? E DA  28   N6    ? ? ? 1_555 F DT  23   O4  ? ? E DA  28  F DT  23   1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? 
hydrog68  hydrog ?    ? E DG  29   N1    ? ? ? 1_555 F DC  22   N3  ? ? E DG  29  F DC  22   1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? 
hydrog69  hydrog ?    ? E DG  29   N2    ? ? ? 1_555 F DC  22   O2  ? ? E DG  29  F DC  22   1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? 
hydrog70  hydrog ?    ? E DG  29   O6    ? ? ? 1_555 F DC  22   N4  ? ? E DG  29  F DC  22   1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? 
hydrog71  hydrog ?    ? E DA  30   N1    ? ? ? 1_555 F DT  21   N3  ? ? E DA  30  F DT  21   1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? 
hydrog72  hydrog ?    ? E DA  30   N6    ? ? ? 1_555 F DT  21   O4  ? ? E DA  30  F DT  21   1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? 
hydrog73  hydrog ?    ? E DC  31   N3    ? ? ? 1_555 F DG  20   N2  ? ? E DC  31  F DG  20   1_555 ? ? ? ? ? ? 
'REVERSED WATSON-CRICK' ?     ? 
hydrog74  hydrog ?    ? E DC  31   O2    ? ? ? 1_555 F DG  20   N1  ? ? E DC  31  F DG  20   1_555 ? ? ? ? ? ? 
'REVERSED WATSON-CRICK' ?     ? 
hydrog75  hydrog ?    ? E DT  32   N3    ? ? ? 1_555 F DA  19   N1  ? ? E DT  32  F DA  19   1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? 
hydrog76  hydrog ?    ? E DT  32   O4    ? ? ? 1_555 F DA  19   N6  ? ? E DT  32  F DA  19   1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? 
hydrog77  hydrog ?    ? E DG  33   N1    ? ? ? 1_555 F DC  18   O2  ? ? E DG  33  F DC  18   1_555 ? ? ? ? ? ? 'DG-DC PAIR' ?     
? 
hydrog78  hydrog ?    ? E DG  34   N1    ? ? ? 1_555 F DC  17   N3  ? ? E DG  34  F DC  17   1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? 
hydrog79  hydrog ?    ? E DG  34   N2    ? ? ? 1_555 F DC  17   O2  ? ? E DG  34  F DC  17   1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? 
hydrog80  hydrog ?    ? E DG  34   O6    ? ? ? 1_555 F DC  17   N4  ? ? E DG  34  F DC  17   1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? 
hydrog81  hydrog ?    ? E DA  35   N1    ? ? ? 1_555 F DT  16   N3  ? ? E DA  35  F DT  16   1_555 ? ? ? ? ? ? 'DA-DT PAIR' ?     
? 
hydrog82  hydrog ?    ? E DC  37   N3    ? ? ? 1_555 F DG  14   N2  ? ? E DC  37  F DG  14   1_555 ? ? ? ? ? ? 
'REVERSED WATSON-CRICK' ?     ? 
hydrog83  hydrog ?    ? E DC  37   O2    ? ? ? 1_555 F DG  14   N1  ? ? E DC  37  F DG  14   1_555 ? ? ? ? ? ? 
'REVERSED WATSON-CRICK' ?     ? 
hydrog84  hydrog ?    ? E DA  38   N1    ? ? ? 1_555 F DT  13   N3  ? ? E DA  38  F DT  13   1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? 
hydrog85  hydrog ?    ? E DA  38   N6    ? ? ? 1_555 F DT  13   O4  ? ? E DA  38  F DT  13   1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? 
hydrog86  hydrog ?    ? E DA  39   N1    ? ? ? 1_555 F DT  12   N3  ? ? E DA  39  F DT  12   1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? 
hydrog87  hydrog ?    ? E DA  39   N6    ? ? ? 1_555 F DT  12   O4  ? ? E DA  39  F DT  12   1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? 
hydrog88  hydrog ?    ? E DA  40   N1    ? ? ? 1_555 F DT  11   N3  ? ? E DA  40  F DT  11   1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? 
hydrog89  hydrog ?    ? E DA  40   N6    ? ? ? 1_555 F DT  11   O4  ? ? E DA  40  F DT  11   1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? 
hydrog90  hydrog ?    ? E DA  41   N1    ? ? ? 1_555 F DT  10   N3  ? ? E DA  41  F DT  10   1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? 
hydrog91  hydrog ?    ? E DA  41   N6    ? ? ? 1_555 F DT  10   O4  ? ? E DA  41  F DT  10   1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? 
hydrog92  hydrog ?    ? E DA  42   N1    ? ? ? 1_555 F DT  9    N3  ? ? E DA  42  F DT  9    1_555 ? ? ? ? ? ? 'DA-DT PAIR' ?     
? 
hydrog93  hydrog ?    ? E DC  43   N3    ? ? ? 1_555 F DG  8    N1  ? ? E DC  43  F DG  8    1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? 
hydrog94  hydrog ?    ? E DC  43   N4    ? ? ? 1_555 F DG  8    O6  ? ? E DC  43  F DG  8    1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? 
hydrog95  hydrog ?    ? E DC  43   O2    ? ? ? 1_555 F DG  8    N2  ? ? E DC  43  F DG  8    1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? 
hydrog96  hydrog ?    ? E DC  44   N3    ? ? ? 1_555 F DG  7    N1  ? ? E DC  44  F DG  7    1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? 
hydrog97  hydrog ?    ? E DC  44   N4    ? ? ? 1_555 F DG  7    O6  ? ? E DC  44  F DG  7    1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? 
hydrog98  hydrog ?    ? E DC  44   O2    ? ? ? 1_555 F DG  7    N2  ? ? E DC  44  F DG  7    1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? 
hydrog99  hydrog ?    ? E DC  45   N3    ? ? ? 1_555 F DG  6    N2  ? ? E DC  45  F DG  6    1_555 ? ? ? ? ? ? 'DC-DG PAIR' ?     
? 
hydrog100 hydrog ?    ? E DT  46   N3    ? ? ? 1_555 F DA  5    N1  ? ? E DT  46  F DA  5    1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? 
hydrog101 hydrog ?    ? E DT  46   O4    ? ? ? 1_555 F DA  5    N6  ? ? E DT  46  F DA  5    1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? 
hydrog102 hydrog ?    ? E DG  47   N1    ? ? ? 1_555 F DC  4    N3  ? ? E DG  47  F DC  4    1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? 
hydrog103 hydrog ?    ? E DG  47   N2    ? ? ? 1_555 F DC  4    O2  ? ? E DG  47  F DC  4    1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? 
hydrog104 hydrog ?    ? E DG  47   O6    ? ? ? 1_555 F DC  4    N4  ? ? E DG  47  F DC  4    1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? 
hydrog105 hydrog ?    ? E DC  48   O2    ? ? ? 1_555 F DG  3    N1  ? ? E DC  48  F DG  3    1_555 ? ? ? ? ? ? 'DC-DG PAIR' ?     
? 
hydrog106 hydrog ?    ? E DG  50   N1    ? ? ? 1_555 F DC  1    N3  ? ? E DG  50  F DC  1    1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? 
hydrog107 hydrog ?    ? E DG  50   N2    ? ? ? 1_555 F DC  1    O2  ? ? E DG  50  F DC  1    1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? 
hydrog108 hydrog ?    ? E DG  50   O6    ? ? ? 1_555 F DC  1    N4  ? ? E DG  50  F DC  1    1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? 
hydrog109 hydrog ?    ? G DG  1    N1    ? ? ? 1_555 H DC  61   N3  ? ? G DG  1   H DC  61   1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? 
hydrog110 hydrog ?    ? G DG  1    N2    ? ? ? 1_555 H DC  61   O2  ? ? G DG  1   H DC  61   1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? 
hydrog111 hydrog ?    ? G DG  1    O6    ? ? ? 1_555 H DC  61   N4  ? ? G DG  1   H DC  61   1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? 
hydrog112 hydrog ?    ? G DA  2    N1    ? ? ? 1_555 H DT  60   N3  ? ? G DA  2   H DT  60   1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? 
hydrog113 hydrog ?    ? G DA  2    N6    ? ? ? 1_555 H DT  60   O4  ? ? G DA  2   H DT  60   1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? 
hydrog114 hydrog ?    ? G DT  3    N3    ? ? ? 1_555 H DA  59   N1  ? ? G DT  3   H DA  59   1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? 
hydrog115 hydrog ?    ? G DT  3    O4    ? ? ? 1_555 H DA  59   N6  ? ? G DT  3   H DA  59   1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? 
hydrog116 hydrog ?    ? G DC  4    N3    ? ? ? 1_555 H DG  58   N1  ? ? G DC  4   H DG  58   1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? 
hydrog117 hydrog ?    ? G DC  4    N4    ? ? ? 1_555 H DG  58   O6  ? ? G DC  4   H DG  58   1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? 
hydrog118 hydrog ?    ? G DC  4    O2    ? ? ? 1_555 H DG  58   N2  ? ? G DC  4   H DG  58   1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? 
hydrog119 hydrog ?    ? G DT  5    N3    ? ? ? 1_555 H DA  57   N1  ? ? G DT  5   H DA  57   1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? 
hydrog120 hydrog ?    ? G DT  5    O4    ? ? ? 1_555 H DA  57   N6  ? ? G DT  5   H DA  57   1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? 
hydrog121 hydrog ?    ? G DG  6    N1    ? ? ? 1_555 H DC  56   N3  ? ? G DG  6   H DC  56   1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? 
hydrog122 hydrog ?    ? G DG  6    N2    ? ? ? 1_555 H DC  56   O2  ? ? G DG  6   H DC  56   1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? 
hydrog123 hydrog ?    ? G DG  6    O6    ? ? ? 1_555 H DC  56   N4  ? ? G DG  6   H DC  56   1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? 
hydrog124 hydrog ?    ? G DG  7    N1    ? ? ? 1_555 H DC  55   N3  ? ? G DG  7   H DC  55   1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? 
hydrog125 hydrog ?    ? G DG  7    N2    ? ? ? 1_555 H DC  55   O2  ? ? G DG  7   H DC  55   1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? 
hydrog126 hydrog ?    ? G DG  7    O6    ? ? ? 1_555 H DC  55   N4  ? ? G DG  7   H DC  55   1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? 
hydrog127 hydrog ?    ? G DC  8    N3    ? ? ? 1_555 H DG  54   N1  ? ? G DC  8   H DG  54   1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? 
hydrog128 hydrog ?    ? G DC  8    N4    ? ? ? 1_555 H DG  54   O6  ? ? G DC  8   H DG  54   1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? 
hydrog129 hydrog ?    ? G DC  8    O2    ? ? ? 1_555 H DG  54   N2  ? ? G DC  8   H DG  54   1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? 
hydrog130 hydrog ?    ? G DC  9    N3    ? ? ? 1_555 H DG  53   N1  ? ? G DC  9   H DG  53   1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? 
hydrog131 hydrog ?    ? G DC  9    N4    ? ? ? 1_555 H DG  53   O6  ? ? G DC  9   H DG  53   1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? 
hydrog132 hydrog ?    ? G DC  9    O2    ? ? ? 1_555 H DG  53   N2  ? ? G DC  9   H DG  53   1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? 
hydrog133 hydrog ?    ? G DT  10   N3    ? ? ? 1_555 H DC  51   N3  ? ? G DT  10  H DC  51   1_555 ? ? ? ? ? ? TYPE_18_PAIR ?     
? 
hydrog134 hydrog ?    ? G DT  10   O4    ? ? ? 1_555 H DC  51   N4  ? ? G DT  10  H DC  51   1_555 ? ? ? ? ? ? TYPE_18_PAIR ?     
? 
hydrog135 hydrog ?    ? G DT  10   N3    ? ? ? 1_555 H DA  52   N1  ? ? G DT  10  H DA  52   1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? 
hydrog136 hydrog ?    ? G DT  10   O4    ? ? ? 1_555 H DA  52   N6  ? ? G DT  10  H DA  52   1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? 
hydrog137 hydrog ?    ? G DG  11   N1    ? ? ? 1_555 H DC  51   N3  ? ? G DG  11  H DC  51   1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? 
hydrog138 hydrog ?    ? G DG  11   N2    ? ? ? 1_555 H DC  51   O2  ? ? G DG  11  H DC  51   1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? 
hydrog139 hydrog ?    ? G DG  11   O6    ? ? ? 1_555 H DC  51   N4  ? ? G DG  11  H DC  51   1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? 
hydrog140 hydrog ?    ? G DT  12   N3    ? ? ? 1_555 H DA  50   N1  ? ? G DT  12  H DA  50   1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? 
hydrog141 hydrog ?    ? G DT  12   O4    ? ? ? 1_555 H DA  50   N6  ? ? G DT  12  H DA  50   1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? 
hydrog142 hydrog ?    ? G DC  13   N3    ? ? ? 1_555 H DG  49   N1  ? ? G DC  13  H DG  49   1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? 
hydrog143 hydrog ?    ? G DC  13   N4    ? ? ? 1_555 H DG  49   O6  ? ? G DC  13  H DG  49   1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? 
hydrog144 hydrog ?    ? G DC  13   O2    ? ? ? 1_555 H DG  49   N2  ? ? G DC  13  H DG  49   1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? 
hydrog145 hydrog ?    ? G DT  14   N3    ? ? ? 1_555 H DA  48   N1  ? ? G DT  14  H DA  48   1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? 
hydrog146 hydrog ?    ? G DT  14   O4    ? ? ? 1_555 H DA  48   N6  ? ? G DT  14  H DA  48   1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? 
hydrog147 hydrog ?    ? G DT  15   N3    ? ? ? 1_555 H DA  47   N1  ? ? G DT  15  H DA  47   1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? 
hydrog148 hydrog ?    ? G DT  15   O4    ? ? ? 1_555 H DA  47   N6  ? ? G DT  15  H DA  47   1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? 
hydrog149 hydrog ?    ? G DA  16   N1    ? ? ? 1_555 H DT  46   N3  ? ? G DA  16  H DT  46   1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? 
hydrog150 hydrog ?    ? G DA  16   N6    ? ? ? 1_555 H DT  46   O4  ? ? G DA  16  H DT  46   1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? 
hydrog151 hydrog ?    ? G DC  17   N3    ? ? ? 1_555 H DG  45   N1  ? ? G DC  17  H DG  45   1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? 
hydrog152 hydrog ?    ? G DC  17   N4    ? ? ? 1_555 H DG  45   O6  ? ? G DC  17  H DG  45   1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? 
hydrog153 hydrog ?    ? G DC  17   O2    ? ? ? 1_555 H DG  45   N2  ? ? G DC  17  H DG  45   1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? 
hydrog154 hydrog ?    ? G DA  18   N1    ? ? ? 1_555 H DT  44   N3  ? ? G DA  18  H DT  44   1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? 
hydrog155 hydrog ?    ? G DA  18   N6    ? ? ? 1_555 H DT  44   O4  ? ? G DA  18  H DT  44   1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? 
hydrog156 hydrog ?    ? G DC  19   N3    ? ? ? 1_555 H DG  43   N1  ? ? G DC  19  H DG  43   1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? 
hydrog157 hydrog ?    ? G DC  19   N4    ? ? ? 1_555 H DG  43   O6  ? ? G DC  19  H DG  43   1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? 
hydrog158 hydrog ?    ? G DC  19   O2    ? ? ? 1_555 H DG  43   N2  ? ? G DC  19  H DG  43   1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? 
hydrog159 hydrog ?    ? G DA  20   N1    ? ? ? 1_555 H DT  42   N3  ? ? G DA  20  H DT  42   1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? 
hydrog160 hydrog ?    ? G DA  20   N6    ? ? ? 1_555 H DT  42   O4  ? ? G DA  20  H DT  42   1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? 
hydrog161 hydrog ?    ? G DG  21   N1    ? ? ? 1_555 H DA  40   N1  ? ? G DG  21  H DA  40   1_555 ? ? ? ? ? ? TYPE_8_PAIR ?     ? 
hydrog162 hydrog ?    ? G DG  21   O6    ? ? ? 1_555 H DA  40   N6  ? ? G DG  21  H DA  40   1_555 ? ? ? ? ? ? TYPE_8_PAIR ?     ? 
hydrog163 hydrog ?    ? G DG  21   N1    ? ? ? 1_555 H DC  41   N3  ? ? G DG  21  H DC  41   1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? 
hydrog164 hydrog ?    ? G DG  21   N2    ? ? ? 1_555 H DC  41   O2  ? ? G DG  21  H DC  41   1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? 
hydrog165 hydrog ?    ? G DG  21   O6    ? ? ? 1_555 H DC  41   N4  ? ? G DG  21  H DC  41   1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? 
hydrog166 hydrog ?    ? G DT  22   N3    ? ? ? 1_555 H DA  40   N1  ? ? G DT  22  H DA  40   1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? 
hydrog167 hydrog ?    ? G DT  22   O4    ? ? ? 1_555 H DA  40   N6  ? ? G DT  22  H DA  40   1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? 
hydrog168 hydrog ?    ? G DG  23   N1    ? ? ? 1_555 H DC  39   N3  ? ? G DG  23  H DC  39   1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? 
hydrog169 hydrog ?    ? G DG  23   N2    ? ? ? 1_555 H DC  39   O2  ? ? G DG  23  H DC  39   1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? 
hydrog170 hydrog ?    ? G DG  23   O6    ? ? ? 1_555 H DC  39   N4  ? ? G DG  23  H DC  39   1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? 
hydrog171 hydrog ?    ? G DG  24   N1    ? ? ? 1_555 H DC  38   O2  ? ? G DG  24  H DC  38   1_555 ? ? ? ? ? ? 
'REVERSED WATSON-CRICK' ?     ? 
hydrog172 hydrog ?    ? G DG  24   N2    ? ? ? 1_555 H DC  38   N3  ? ? G DG  24  H DC  38   1_555 ? ? ? ? ? ? 
'REVERSED WATSON-CRICK' ?     ? 
hydrog173 hydrog ?    ? G DT  25   N3    ? ? ? 1_555 H DA  37   N1  ? ? G DT  25  H DA  37   1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? 
hydrog174 hydrog ?    ? G DT  25   O4    ? ? ? 1_555 H DA  37   N6  ? ? G DT  25  H DA  37   1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? 
hydrog175 hydrog ?    ? G DA  26   N1    ? ? ? 1_555 H DT  36   N3  ? ? G DA  26  H DT  36   1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? 
hydrog176 hydrog ?    ? G DA  26   N6    ? ? ? 1_555 H DT  36   O4  ? ? G DA  26  H DT  36   1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? 
hydrog177 hydrog ?    ? G DG  27   N1    ? ? ? 1_555 H DA  34   N1  ? ? G DG  27  H DA  34   1_555 ? ? ? ? ? ? TYPE_8_PAIR ?     ? 
hydrog178 hydrog ?    ? G DG  27   O6    ? ? ? 1_555 H DA  34   N6  ? ? G DG  27  H DA  34   1_555 ? ? ? ? ? ? TYPE_8_PAIR ?     ? 
hydrog179 hydrog ?    ? G DG  27   N1    ? ? ? 1_555 H DC  35   N3  ? ? G DG  27  H DC  35   1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? 
hydrog180 hydrog ?    ? G DG  27   N2    ? ? ? 1_555 H DC  35   O2  ? ? G DG  27  H DC  35   1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? 
hydrog181 hydrog ?    ? G DG  27   O6    ? ? ? 1_555 H DC  35   N4  ? ? G DG  27  H DC  35   1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? 
hydrog182 hydrog ?    ? G DT  28   N3    ? ? ? 1_555 H DA  34   N1  ? ? G DT  28  H DA  34   1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? 
hydrog183 hydrog ?    ? G DT  28   O4    ? ? ? 1_555 H DA  34   N6  ? ? G DT  28  H DA  34   1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? 
hydrog184 hydrog ?    ? G DA  29   N1    ? ? ? 1_555 H DT  33   N3  ? ? G DA  29  H DT  33   1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? 
hydrog185 hydrog ?    ? G DA  29   N6    ? ? ? 1_555 H DT  33   O4  ? ? G DA  29  H DT  33   1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? 
hydrog186 hydrog ?    ? G DC  30   N3    ? ? ? 1_555 H DG  32   N2  ? ? G DC  30  H DG  32   1_555 ? ? ? ? ? ? 
'REVERSED WATSON-CRICK' ?     ? 
hydrog187 hydrog ?    ? G DC  30   O2    ? ? ? 1_555 H DG  32   N1  ? ? G DC  30  H DG  32   1_555 ? ? ? ? ? ? 
'REVERSED WATSON-CRICK' ?     ? 
hydrog188 hydrog ?    ? G DT  31   N3    ? ? ? 1_555 H DA  31   N1  ? ? G DT  31  H DA  31   1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? 
hydrog189 hydrog ?    ? G DT  31   O4    ? ? ? 1_555 H DA  31   N6  ? ? G DT  31  H DA  31   1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? 
hydrog190 hydrog ?    ? G DC  32   N3    ? ? ? 1_555 H DG  30   N1  ? ? G DC  32  H DG  30   1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? 
hydrog191 hydrog ?    ? G DC  32   N4    ? ? ? 1_555 H DG  30   O6  ? ? G DC  32  H DG  30   1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? 
hydrog192 hydrog ?    ? G DC  32   O2    ? ? ? 1_555 H DG  30   N2  ? ? G DC  32  H DG  30   1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? 
hydrog193 hydrog ?    ? G DC  33   N3    ? ? ? 1_555 H DG  29   N1  ? ? G DC  33  H DG  29   1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? 
hydrog194 hydrog ?    ? G DC  33   N4    ? ? ? 1_555 H DG  29   O6  ? ? G DC  33  H DG  29   1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? 
hydrog195 hydrog ?    ? G DC  33   O2    ? ? ? 1_555 H DG  29   N2  ? ? G DC  33  H DG  29   1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? 
hydrog196 hydrog ?    ? G DA  34   N1    ? ? ? 1_555 H DT  28   N3  ? ? G DA  34  H DT  28   1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? 
hydrog197 hydrog ?    ? G DA  34   N6    ? ? ? 1_555 H DT  28   O4  ? ? G DA  34  H DT  28   1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? 
hydrog198 hydrog ?    ? G DA  34   N1    ? ? ? 1_555 H DG  29   N1  ? ? G DA  34  H DG  29   1_555 ? ? ? ? ? ? TYPE_8_PAIR ?     ? 
hydrog199 hydrog ?    ? G DA  34   N6    ? ? ? 1_555 H DG  29   O6  ? ? G DA  34  H DG  29   1_555 ? ? ? ? ? ? TYPE_8_PAIR ?     ? 
hydrog200 hydrog ?    ? G DC  35   N3    ? ? ? 1_555 H DG  27   N1  ? ? G DC  35  H DG  27   1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? 
hydrog201 hydrog ?    ? G DC  35   N4    ? ? ? 1_555 H DG  27   O6  ? ? G DC  35  H DG  27   1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? 
hydrog202 hydrog ?    ? G DC  35   O2    ? ? ? 1_555 H DG  27   N2  ? ? G DC  35  H DG  27   1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? 
hydrog203 hydrog ?    ? G DT  36   N3    ? ? ? 1_555 H DA  26   N1  ? ? G DT  36  H DA  26   1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? 
hydrog204 hydrog ?    ? G DT  36   O4    ? ? ? 1_555 H DA  26   N6  ? ? G DT  36  H DA  26   1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? 
hydrog205 hydrog ?    ? G DG  37   N1    ? ? ? 1_555 H DC  25   N3  ? ? G DG  37  H DC  25   1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? 
hydrog206 hydrog ?    ? G DG  37   N2    ? ? ? 1_555 H DC  25   O2  ? ? G DG  37  H DC  25   1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? 
hydrog207 hydrog ?    ? G DG  37   O6    ? ? ? 1_555 H DC  25   N4  ? ? G DG  37  H DC  25   1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? 
hydrog208 hydrog ?    ? G DT  38   N3    ? ? ? 1_555 H DA  24   N1  ? ? G DT  38  H DA  24   1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? 
hydrog209 hydrog ?    ? G DT  38   O4    ? ? ? 1_555 H DA  24   N6  ? ? G DT  38  H DA  24   1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? 
hydrog210 hydrog ?    ? G DC  39   N3    ? ? ? 1_555 H DG  23   N1  ? ? G DC  39  H DG  23   1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? 
hydrog211 hydrog ?    ? G DC  39   N4    ? ? ? 1_555 H DG  23   O6  ? ? G DC  39  H DG  23   1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? 
hydrog212 hydrog ?    ? G DC  39   O2    ? ? ? 1_555 H DG  23   N2  ? ? G DC  39  H DG  23   1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? 
hydrog213 hydrog ?    ? G DT  40   N3    ? ? ? 1_555 H DA  22   N1  ? ? G DT  40  H DA  22   1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? 
hydrog214 hydrog ?    ? G DT  40   O4    ? ? ? 1_555 H DA  22   N6  ? ? G DT  40  H DA  22   1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? 
hydrog215 hydrog ?    ? G DG  41   N1    ? ? ? 1_555 H DC  21   N3  ? ? G DG  41  H DC  21   1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? 
hydrog216 hydrog ?    ? G DG  41   N2    ? ? ? 1_555 H DC  21   O2  ? ? G DG  41  H DC  21   1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? 
hydrog217 hydrog ?    ? G DG  41   O6    ? ? ? 1_555 H DC  21   N4  ? ? G DG  41  H DC  21   1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? 
hydrog218 hydrog ?    ? G DG  42   N1    ? ? ? 1_555 H DC  20   N3  ? ? G DG  42  H DC  20   1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? 
hydrog219 hydrog ?    ? G DG  42   N2    ? ? ? 1_555 H DC  20   O2  ? ? G DG  42  H DC  20   1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? 
hydrog220 hydrog ?    ? G DG  42   O6    ? ? ? 1_555 H DC  20   N4  ? ? G DG  42  H DC  20   1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? 
hydrog221 hydrog ?    ? G DC  43   N3    ? ? ? 1_555 H DG  19   N1  ? ? G DC  43  H DG  19   1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? 
hydrog222 hydrog ?    ? G DC  43   N4    ? ? ? 1_555 H DG  19   O6  ? ? G DC  43  H DG  19   1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? 
hydrog223 hydrog ?    ? G DC  43   O2    ? ? ? 1_555 H DG  19   N2  ? ? G DC  43  H DG  19   1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? 
hydrog224 hydrog ?    ? G DT  44   N3    ? ? ? 1_555 H DA  18   N1  ? ? G DT  44  H DA  18   1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? 
hydrog225 hydrog ?    ? G DT  44   O4    ? ? ? 1_555 H DA  18   N6  ? ? G DT  44  H DA  18   1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? 
hydrog226 hydrog ?    ? G DG  45   N1    ? ? ? 1_555 H DC  17   N3  ? ? G DG  45  H DC  17   1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? 
hydrog227 hydrog ?    ? G DG  45   N2    ? ? ? 1_555 H DC  17   O2  ? ? G DG  45  H DC  17   1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? 
hydrog228 hydrog ?    ? G DG  45   O6    ? ? ? 1_555 H DC  17   N4  ? ? G DG  45  H DC  17   1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? 
hydrog229 hydrog ?    ? G DT  46   N3    ? ? ? 1_555 H DA  16   N1  ? ? G DT  46  H DA  16   1_555 ? ? ? ? ? ? 'DT-DA PAIR' ?     
? 
hydrog230 hydrog ?    ? G DA  47   N1    ? ? ? 1_555 H DT  15   N3  ? ? G DA  47  H DT  15   1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? 
hydrog231 hydrog ?    ? G DA  47   N6    ? ? ? 1_555 H DT  15   O4  ? ? G DA  47  H DT  15   1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? 
hydrog232 hydrog ?    ? G DC  48   N3    ? ? ? 1_555 H DG  14   N1  ? ? G DC  48  H DG  14   1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? 
hydrog233 hydrog ?    ? G DC  48   N4    ? ? ? 1_555 H DG  14   O6  ? ? G DC  48  H DG  14   1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? 
hydrog234 hydrog ?    ? G DC  48   O2    ? ? ? 1_555 H DG  14   N2  ? ? G DC  48  H DG  14   1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? 
hydrog235 hydrog ?    ? G DA  49   N1    ? ? ? 1_555 H DT  13   N3  ? ? G DA  49  H DT  13   1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? 
hydrog236 hydrog ?    ? G DA  49   N6    ? ? ? 1_555 H DT  13   O4  ? ? G DA  49  H DT  13   1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? 
hydrog237 hydrog ?    ? G DA  50   N1    ? ? ? 1_555 H DT  12   N3  ? ? G DA  50  H DT  12   1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? 
hydrog238 hydrog ?    ? G DA  50   N6    ? ? ? 1_555 H DT  12   O4  ? ? G DA  50  H DT  12   1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? 
hydrog239 hydrog ?    ? G DA  51   N1    ? ? ? 1_555 H DT  11   N3  ? ? G DA  51  H DT  11   1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? 
hydrog240 hydrog ?    ? G DA  51   N6    ? ? ? 1_555 H DT  11   O4  ? ? G DA  51  H DT  11   1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? 
hydrog241 hydrog ?    ? G DA  52   N1    ? ? ? 1_555 H DT  10   N3  ? ? G DA  52  H DT  10   1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? 
hydrog242 hydrog ?    ? G DA  52   N6    ? ? ? 1_555 H DT  10   O4  ? ? G DA  52  H DT  10   1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? 
hydrog243 hydrog ?    ? G DA  53   N1    ? ? ? 1_555 H DT  9    N3  ? ? G DA  53  H DT  9    1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? 
hydrog244 hydrog ?    ? G DA  53   N6    ? ? ? 1_555 H DT  9    O4  ? ? G DA  53  H DT  9    1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? 
hydrog245 hydrog ?    ? G DC  54   N3    ? ? ? 1_555 H DG  8    N1  ? ? G DC  54  H DG  8    1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? 
hydrog246 hydrog ?    ? G DC  54   N4    ? ? ? 1_555 H DG  8    O6  ? ? G DC  54  H DG  8    1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? 
hydrog247 hydrog ?    ? G DC  54   O2    ? ? ? 1_555 H DG  8    N2  ? ? G DC  54  H DG  8    1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? 
hydrog248 hydrog ?    ? G DC  55   N3    ? ? ? 1_555 H DG  7    N2  ? ? G DC  55  H DG  7    1_555 ? ? ? ? ? ? 'DC-DG PAIR' ?     
? 
hydrog249 hydrog ?    ? G DC  56   N3    ? ? ? 1_555 H DG  6    N2  ? ? G DC  56  H DG  6    1_555 ? ? ? ? ? ? 'DC-DG PAIR' ?     
? 
hydrog250 hydrog ?    ? G DC  56   N3    ? ? ? 1_555 H DG  7    N2  ? ? G DC  56  H DG  7    1_555 ? ? ? ? ? ? 'DC-DG PAIR' ?     
? 
hydrog251 hydrog ?    ? G DT  57   N3    ? ? ? 1_555 H DA  5    N1  ? ? G DT  57  H DA  5    1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? 
hydrog252 hydrog ?    ? G DT  57   O4    ? ? ? 1_555 H DA  5    N6  ? ? G DT  57  H DA  5    1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? 
hydrog253 hydrog ?    ? G DG  58   N1    ? ? ? 1_555 H DC  4    N3  ? ? G DG  58  H DC  4    1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? 
hydrog254 hydrog ?    ? G DG  58   N2    ? ? ? 1_555 H DC  4    O2  ? ? G DG  58  H DC  4    1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? 
hydrog255 hydrog ?    ? G DG  58   O6    ? ? ? 1_555 H DC  4    N4  ? ? G DG  58  H DC  4    1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? 
hydrog256 hydrog ?    ? G DA  60   N1    ? ? ? 1_555 H DT  2    N3  ? ? G DA  60  H DT  2    1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? 
hydrog257 hydrog ?    ? G DA  60   N6    ? ? ? 1_555 H DT  2    O4  ? ? G DA  60  H DT  2    1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? 
hydrog258 hydrog ?    ? G DG  61   N1    ? ? ? 1_555 H DC  1    N3  ? ? G DG  61  H DC  1    1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? 
hydrog259 hydrog ?    ? G DG  61   N2    ? ? ? 1_555 H DC  1    O2  ? ? G DG  61  H DC  1    1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? 
hydrog260 hydrog ?    ? G DG  61   O6    ? ? ? 1_555 H DC  1    N4  ? ? G DG  61  H DC  1    1_555 ? ? ? ? ? ? WATSON-CRICK ?     
? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
metalc ? ? 
covale ? ? 
hydrog ? ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1  GLN 667  A . ? GLN 539 A PRO 668  A ? PRO 540  A 1 -5.12  
2  LEU 781  A . ? LEU 653 A GLU 782  A ? GLU 654  A 1 2.14   
3  ALA 870  A . ? ALA 742 A SER 871  A ? SER 743  A 1 1.70   
4  ARG 1127 A . ? ARG 999 A GLN 1128 A ? GLN 1000 A 1 0.66   
5  ASP 87   B . ? ASP 84  B GLY 88   B ? GLY 85   B 1 -0.05  
6  PRO 90   B . ? PRO 87  B GLU 91   B ? GLU 88   B 1 -3.56  
7  HIS 96   B . ? HIS 93  B GLY 97   B ? GLY 94   B 1 -3.58  
8  ARG 117  B . ? ARG 114 B GLY 118  B ? GLY 115  B 1 -1.67  
9  GLY 118  B . ? GLY 115 B CYS 119  B ? CYS 116  B 1 -2.40  
10 GLY 134  B . ? GLY 131 B ASP 135  B ? ASP 132  B 1 0.52   
11 ARG 151  B . ? ARG 148 B GLY 152  B ? GLY 149  B 1 -8.26  
12 GLU 191  B . ? GLU 188 B PHE 192  B ? PHE 189  B 1 4.41   
13 LEU 245  B . ? LEU 242 B GLY 246  B ? GLY 243  B 1 -5.36  
14 ASN 339  B . ? ASN 336 B PRO 340  B ? PRO 337  B 1 -2.96  
15 PRO 342  B . ? PRO 339 B PRO 343  B ? PRO 340  B 1 3.84   
16 GLN 667  C . ? GLN 539 C PRO 668  C ? PRO 540  C 1 -6.79  
17 LEU 781  C . ? LEU 653 C GLU 782  C ? GLU 654  C 1 5.11   
18 ALA 870  C . ? ALA 742 C SER 871  C ? SER 743  C 1 -2.46  
19 ASP 87   D . ? ASP 84  D GLY 88   D ? GLY 85   D 1 7.99   
20 PRO 90   D . ? PRO 87  D GLU 91   D ? GLU 88   D 1 -3.07  
21 HIS 96   D . ? HIS 93  D GLY 97   D ? GLY 94   D 1 -9.61  
22 ARG 117  D . ? ARG 114 D GLY 118  D ? GLY 115  D 1 -5.37  
23 GLY 118  D . ? GLY 115 D CYS 119  D ? CYS 116  D 1 -1.89  
24 GLY 134  D . ? GLY 131 D ASP 135  D ? ASP 132  D 1 0.00   
25 ARG 151  D . ? ARG 148 D GLY 152  D ? GLY 149  D 1 -12.81 
26 GLU 191  D . ? GLU 188 D PHE 192  D ? PHE 189  D 1 3.23   
27 LEU 245  D . ? LEU 242 D GLY 246  D ? GLY 243  D 1 1.91   
28 ASN 339  D . ? ASN 336 D PRO 340  D ? PRO 337  D 1 -5.56  
29 PRO 342  D . ? PRO 339 D PRO 343  D ? PRO 340  D 1 9.30   
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA1 ? 8 ? 
AA2 ? 6 ? 
AA3 ? 4 ? 
AA4 ? 5 ? 
AA5 ? 4 ? 
AA6 ? 2 ? 
AA7 ? 4 ? 
AA8 ? 2 ? 
AA9 ? 4 ? 
AB1 ? 4 ? 
AB2 ? 7 ? 
AB3 ? 6 ? 
AB4 ? 8 ? 
AB5 ? 4 ? 
AB6 ? 4 ? 
AB7 ? 2 ? 
AB8 ? 4 ? 
AB9 ? 4 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA1 1 2 ? anti-parallel 
AA1 2 3 ? anti-parallel 
AA1 3 4 ? parallel      
AA1 4 5 ? anti-parallel 
AA1 5 6 ? anti-parallel 
AA1 6 7 ? anti-parallel 
AA1 7 8 ? anti-parallel 
AA2 1 2 ? anti-parallel 
AA2 2 3 ? anti-parallel 
AA2 3 4 ? parallel      
AA2 4 5 ? anti-parallel 
AA2 5 6 ? anti-parallel 
AA3 1 2 ? anti-parallel 
AA3 2 3 ? anti-parallel 
AA3 3 4 ? anti-parallel 
AA4 1 2 ? parallel      
AA4 2 3 ? anti-parallel 
AA4 3 4 ? anti-parallel 
AA4 4 5 ? anti-parallel 
AA5 1 2 ? anti-parallel 
AA5 2 3 ? anti-parallel 
AA5 3 4 ? anti-parallel 
AA6 1 2 ? anti-parallel 
AA7 1 2 ? anti-parallel 
AA7 2 3 ? anti-parallel 
AA7 3 4 ? anti-parallel 
AA8 1 2 ? anti-parallel 
AA9 1 2 ? anti-parallel 
AA9 2 3 ? anti-parallel 
AA9 3 4 ? anti-parallel 
AB1 1 2 ? anti-parallel 
AB1 2 3 ? anti-parallel 
AB1 3 4 ? anti-parallel 
AB2 1 2 ? anti-parallel 
AB2 2 3 ? anti-parallel 
AB2 3 4 ? parallel      
AB2 4 5 ? anti-parallel 
AB2 5 6 ? anti-parallel 
AB2 6 7 ? anti-parallel 
AB3 1 2 ? anti-parallel 
AB3 2 3 ? anti-parallel 
AB3 3 4 ? parallel      
AB3 4 5 ? anti-parallel 
AB3 5 6 ? anti-parallel 
AB4 1 2 ? anti-parallel 
AB4 2 3 ? anti-parallel 
AB4 3 4 ? anti-parallel 
AB4 4 5 ? parallel      
AB4 5 6 ? anti-parallel 
AB4 6 7 ? anti-parallel 
AB4 7 8 ? anti-parallel 
AB5 1 2 ? anti-parallel 
AB5 2 3 ? anti-parallel 
AB5 3 4 ? anti-parallel 
AB6 1 2 ? anti-parallel 
AB6 2 3 ? anti-parallel 
AB6 3 4 ? anti-parallel 
AB7 1 2 ? anti-parallel 
AB8 1 2 ? anti-parallel 
AB8 2 3 ? anti-parallel 
AB8 3 4 ? anti-parallel 
AB9 1 2 ? anti-parallel 
AB9 2 3 ? anti-parallel 
AB9 3 4 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA1 1 PHE A 664 ? GLN A 667 ? PHE A 536 GLN A 539 
AA1 2 ARG A 836 ? VAL A 841 ? ARG A 708 VAL A 713 
AA1 3 LEU A 844 ? GLY A 856 ? LEU A 716 GLY A 728 
AA1 4 PHE A 739 ? MET A 750 ? PHE A 611 MET A 622 
AA1 5 ALA A 767 ? ILE A 779 ? ALA A 639 ILE A 651 
AA1 6 ARG A 803 ? MET A 808 ? ARG A 675 MET A 680 
AA1 7 SER A 701 ? ARG A 703 ? SER A 573 ARG A 575 
AA1 8 ILE A 682 ? ASP A 683 ? ILE A 554 ASP A 555 
AA2 1 PHE A 664 ? GLN A 667 ? PHE A 536 GLN A 539 
AA2 2 ARG A 836 ? VAL A 841 ? ARG A 708 VAL A 713 
AA2 3 LEU A 844 ? GLY A 856 ? LEU A 716 GLY A 728 
AA2 4 PHE A 739 ? MET A 750 ? PHE A 611 MET A 622 
AA2 5 ALA A 767 ? ILE A 779 ? ALA A 639 ILE A 651 
AA2 6 ILE A 788 ? GLN A 792 ? ILE A 660 GLN A 664 
AA3 1 SER B 5   ? PRO B 8   ? SER B 2   PRO B 5   
AA3 2 TYR B 346 ? SER B 352 ? TYR B 343 SER B 349 
AA3 3 THR B 329 ? PRO B 335 ? THR B 326 PRO B 332 
AA3 4 PHE B 321 ? GLY B 326 ? PHE B 318 GLY B 323 
AA4 1 THR B 10  ? ALA B 11  ? THR B 7   ALA B 8   
AA4 2 GLU B 57  ? ALA B 62  ? GLU B 54  ALA B 59  
AA4 3 ILE B 48  ? LYS B 54  ? ILE B 45  LYS B 51  
AA4 4 VAL B 31  ? PHE B 34  ? VAL B 28  PHE B 31  
AA4 5 SER B 23  ? ASP B 26  ? SER B 20  ASP B 23  
AA5 1 ALA B 79  ? ALA B 81  ? ALA B 76  ALA B 78  
AA5 2 TYR B 93  ? HIS B 96  ? TYR B 90  HIS B 93  
AA5 3 TYR B 110 ? VAL B 114 ? TYR B 107 VAL B 111 
AA5 4 LEU B 125 ? GLU B 129 ? LEU B 122 GLU B 126 
AA6 1 ARG B 99  ? THR B 100 ? ARG B 96  THR B 97  
AA6 2 GLU B 104 ? LEU B 105 ? GLU B 101 LEU B 102 
AA7 1 THR B 144 ? SER B 150 ? THR B 141 SER B 147 
AA7 2 LYS B 153 ? PHE B 159 ? LYS B 150 PHE B 156 
AA7 3 GLN B 184 ? ILE B 188 ? GLN B 181 ILE B 185 
AA7 4 CYS B 195 ? THR B 199 ? CYS B 192 THR B 196 
AA8 1 ARG B 162 ? SER B 163 ? ARG B 159 SER B 160 
AA8 2 VAL B 179 ? ASP B 180 ? VAL B 176 ASP B 177 
AA9 1 ALA B 212 ? ARG B 215 ? ALA B 209 ARG B 212 
AA9 2 CYS B 218 ? PHE B 221 ? CYS B 215 PHE B 218 
AA9 3 ILE B 237 ? LEU B 243 ? ILE B 234 LEU B 240 
AA9 4 PRO B 248 ? ILE B 254 ? PRO B 245 ILE B 251 
AB1 1 ALA B 266 ? PRO B 268 ? ALA B 263 PRO B 265 
AB1 2 TYR B 274 ? ILE B 276 ? TYR B 271 ILE B 273 
AB1 3 THR B 291 ? LEU B 295 ? THR B 288 LEU B 292 
AB1 4 VAL B 300 ? GLU B 303 ? VAL B 297 GLU B 300 
AB2 1 GLU C 665 ? GLN C 667 ? GLU C 537 GLN C 539 
AB2 2 ARG C 836 ? VAL C 841 ? ARG C 708 VAL C 713 
AB2 3 LEU C 844 ? PHE C 852 ? LEU C 716 PHE C 724 
AB2 4 PHE C 739 ? MET C 750 ? PHE C 611 MET C 622 
AB2 5 ALA C 767 ? ILE C 779 ? ALA C 639 ILE C 651 
AB2 6 ARG C 803 ? MET C 808 ? ARG C 675 MET C 680 
AB2 7 SER C 701 ? ARG C 703 ? SER C 573 ARG C 575 
AB3 1 GLU C 665 ? GLN C 667 ? GLU C 537 GLN C 539 
AB3 2 ARG C 836 ? VAL C 841 ? ARG C 708 VAL C 713 
AB3 3 LEU C 844 ? PHE C 852 ? LEU C 716 PHE C 724 
AB3 4 PHE C 739 ? MET C 750 ? PHE C 611 MET C 622 
AB3 5 ALA C 767 ? ILE C 779 ? ALA C 639 ILE C 651 
AB3 6 PHE C 791 ? GLN C 792 ? PHE C 663 GLN C 664 
AB4 1 SER D 23  ? ASP D 26  ? SER D 20  ASP D 23  
AB4 2 VAL D 31  ? PHE D 34  ? VAL D 28  PHE D 31  
AB4 3 PHE D 49  ? LYS D 54  ? PHE D 46  LYS D 51  
AB4 4 GLU D 57  ? ALA D 62  ? GLU D 54  ALA D 59  
AB4 5 SER D 5   ? ALA D 11  ? SER D 2   ALA D 8   
AB4 6 TYR D 346 ? SER D 352 ? TYR D 343 SER D 349 
AB4 7 THR D 329 ? PRO D 335 ? THR D 326 PRO D 332 
AB4 8 PHE D 321 ? GLY D 326 ? PHE D 318 GLY D 323 
AB5 1 ALA D 79  ? PHE D 83  ? ALA D 76  PHE D 80  
AB5 2 CYS D 92  ? HIS D 96  ? CYS D 89  HIS D 93  
AB5 3 LEU D 109 ? ARG D 117 ? LEU D 106 ARG D 114 
AB5 4 VAL D 123 ? LYS D 130 ? VAL D 120 LYS D 127 
AB6 1 THR D 144 ? SER D 150 ? THR D 141 SER D 147 
AB6 2 LYS D 153 ? PHE D 159 ? LYS D 150 PHE D 156 
AB6 3 VAL D 185 ? ILE D 188 ? VAL D 182 ILE D 185 
AB6 4 THR D 196 ? HIS D 198 ? THR D 193 HIS D 195 
AB7 1 ARG D 162 ? SER D 163 ? ARG D 159 SER D 160 
AB7 2 VAL D 179 ? ASP D 180 ? VAL D 176 ASP D 177 
AB8 1 ALA D 212 ? ARG D 215 ? ALA D 209 ARG D 212 
AB8 2 CYS D 218 ? PHE D 221 ? CYS D 215 PHE D 218 
AB8 3 ILE D 237 ? LEU D 244 ? ILE D 234 LEU D 241 
AB8 4 SER D 247 ? ILE D 254 ? SER D 244 ILE D 251 
AB9 1 ALA D 266 ? PRO D 268 ? ALA D 263 PRO D 265 
AB9 2 GLU D 273 ? ILE D 276 ? GLU D 270 ILE D 273 
AB9 3 THR D 291 ? ASP D 296 ? THR D 288 ASP D 293 
AB9 4 GLY D 299 ? GLU D 303 ? GLY D 296 GLU D 300 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA1 1 2 N GLU A 665 ? N GLU A 537 O ILE A 838 ? O ILE A 710 
AA1 2 3 N VAL A 841 ? N VAL A 713 O LEU A 844 ? O LEU A 716 
AA1 3 4 O GLY A 856 ? O GLY A 728 N CYS A 747 ? N CYS A 619 
AA1 4 5 N MET A 750 ? N MET A 622 O ALA A 767 ? O ALA A 639 
AA1 5 6 N PHE A 770 ? N PHE A 642 O LEU A 805 ? O LEU A 677 
AA1 6 7 O LEU A 807 ? O LEU A 679 N ARG A 702 ? N ARG A 574 
AA1 7 8 O ARG A 703 ? O ARG A 575 N ILE A 682 ? N ILE A 554 
AA2 1 2 N GLU A 665 ? N GLU A 537 O ILE A 838 ? O ILE A 710 
AA2 2 3 N VAL A 841 ? N VAL A 713 O LEU A 844 ? O LEU A 716 
AA2 3 4 O GLY A 856 ? O GLY A 728 N CYS A 747 ? N CYS A 619 
AA2 4 5 N MET A 750 ? N MET A 622 O ALA A 767 ? O ALA A 639 
AA2 5 6 N ILE A 779 ? N ILE A 651 O ILE A 788 ? O ILE A 660 
AA3 1 2 N GLN B 7   ? N GLN B 4   O GLN B 350 ? O GLN B 347 
AA3 2 3 O TYR B 349 ? O TYR B 346 N VAL B 332 ? N VAL B 329 
AA3 3 4 O LEU B 331 ? O LEU B 328 N GLY B 323 ? N GLY B 320 
AA4 1 2 N THR B 10  ? N THR B 7   O LEU B 58  ? O LEU B 55  
AA4 2 3 O LYS B 59  ? O LYS B 56  N ARG B 52  ? N ARG B 49  
AA4 3 4 O PHE B 49  ? O PHE B 46  N LEU B 33  ? N LEU B 30  
AA4 4 5 O PHE B 34  ? O PHE B 31  N SER B 23  ? N SER B 20  
AA5 1 2 N ALA B 81  ? N ALA B 78  O LEU B 94  ? O LEU B 91  
AA5 2 3 N ILE B 95  ? N ILE B 92  O TYR B 110 ? O TYR B 107 
AA5 3 4 N MET B 111 ? N MET B 108 O GLU B 128 ? O GLU B 125 
AA6 1 2 N THR B 100 ? N THR B 97  O GLU B 104 ? O GLU B 101 
AA7 1 2 N THR B 144 ? N THR B 141 O PHE B 159 ? O PHE B 156 
AA7 2 3 N CYS B 156 ? N CYS B 153 O ILE B 188 ? O ILE B 185 
AA7 3 4 N VAL B 185 ? N VAL B 182 O HIS B 198 ? O HIS B 195 
AA8 1 2 N SER B 163 ? N SER B 160 O VAL B 179 ? O VAL B 176 
AA9 1 2 N LEU B 213 ? N LEU B 210 O TYR B 220 ? O TYR B 217 
AA9 2 3 N PHE B 221 ? N PHE B 218 O ILE B 237 ? O ILE B 234 
AA9 3 4 N HIS B 240 ? N HIS B 237 O THR B 251 ? O THR B 248 
AB1 1 2 N SER B 267 ? N SER B 264 O ILE B 275 ? O ILE B 272 
AB1 2 3 N TYR B 274 ? N TYR B 271 O VAL B 293 ? O VAL B 290 
AB1 3 4 N GLY B 294 ? N GLY B 291 O HIS B 301 ? O HIS B 298 
AB2 1 2 N GLN C 667 ? N GLN C 539 O ARG C 836 ? O ARG C 708 
AB2 2 3 N LEU C 837 ? N LEU C 709 O PHE C 848 ? O PHE C 720 
AB2 3 4 O PHE C 851 ? O PHE C 723 N VAL C 741 ? N VAL C 613 
AB2 4 5 N MET C 750 ? N MET C 622 O ALA C 767 ? O ALA C 639 
AB2 5 6 N PHE C 770 ? N PHE C 642 O CYS C 806 ? O CYS C 678 
AB2 6 7 O LEU C 807 ? O LEU C 679 N ARG C 702 ? N ARG C 574 
AB3 1 2 N GLN C 667 ? N GLN C 539 O ARG C 836 ? O ARG C 708 
AB3 2 3 N LEU C 837 ? N LEU C 709 O PHE C 848 ? O PHE C 720 
AB3 3 4 O PHE C 851 ? O PHE C 723 N VAL C 741 ? N VAL C 613 
AB3 4 5 N MET C 750 ? N MET C 622 O ALA C 767 ? O ALA C 639 
AB3 5 6 N ILE C 777 ? N ILE C 649 O PHE C 791 ? O PHE C 663 
AB4 1 2 N LEU D 25  ? N LEU D 22  O TYR D 32  ? O TYR D 29  
AB4 2 3 N LEU D 33  ? N LEU D 30  O PHE D 49  ? O PHE D 46  
AB4 3 4 N ARG D 52  ? N ARG D 49  O LYS D 59  ? O LYS D 56  
AB4 4 5 O LEU D 58  ? O LEU D 55  N THR D 10  ? N THR D 7   
AB4 5 6 N GLN D 7   ? N GLN D 4   O GLN D 350 ? O GLN D 347 
AB4 6 7 O TYR D 349 ? O TYR D 346 N VAL D 332 ? N VAL D 329 
AB4 7 8 O LEU D 331 ? O LEU D 328 N GLY D 323 ? N GLY D 320 
AB5 1 2 N PHE D 83  ? N PHE D 80  O CYS D 92  ? O CYS D 89  
AB5 2 3 N ILE D 95  ? N ILE D 92  O TYR D 110 ? O TYR D 107 
AB5 3 4 N LEU D 109 ? N LEU D 106 O LYS D 130 ? O LYS D 127 
AB6 1 2 N ILE D 148 ? N ILE D 145 O ALA D 155 ? O ALA D 152 
AB6 2 3 N CYS D 156 ? N CYS D 153 O ILE D 188 ? O ILE D 185 
AB6 3 4 N VAL D 185 ? N VAL D 182 O HIS D 198 ? O HIS D 195 
AB7 1 2 N SER D 163 ? N SER D 160 O VAL D 179 ? O VAL D 176 
AB8 1 2 N LEU D 213 ? N LEU D 210 O TYR D 220 ? O TYR D 217 
AB8 2 3 N VAL D 219 ? N VAL D 216 O LEU D 239 ? O LEU D 236 
AB8 3 4 N HIS D 240 ? N HIS D 237 O THR D 251 ? O THR D 248 
AB9 1 2 N SER D 267 ? N SER D 264 O ILE D 275 ? O ILE D 272 
AB9 2 3 N ILE D 276 ? N ILE D 273 O THR D 291 ? O THR D 288 
AB9 3 4 N GLY D 294 ? N GLY D 291 O HIS D 301 ? O HIS D 298 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software A ZN 1101 ? 4 'binding site for residue ZN A 1101' 
AC2 Software A CA 1102 ? 5 'binding site for residue CA A 1102' 
AC3 Software A CA 1103 ? 3 'binding site for residue CA A 1103' 
AC4 Software C ZN 1101 ? 5 'binding site for residue ZN C 1101' 
AC5 Software C CA 1102 ? 4 'binding site for residue CA C 1102' 
AC6 Software C CA 1103 ? 3 'binding site for residue CA C 1103' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 4 CYS A 877  ? CYS A 749  . ? 1_555 ? 
2  AC1 4 CYS A 880  ? CYS A 752  . ? 1_555 ? 
3  AC1 4 HIS A 1087 ? HIS A 959  . ? 1_555 ? 
4  AC1 4 HIS A 1092 ? HIS A 964  . ? 1_555 ? 
5  AC2 5 ASP A 748  ? ASP A 620  . ? 1_555 ? 
6  AC2 5 HIS A 945  ? HIS A 817  . ? 1_555 ? 
7  AC2 5 GLU A 1112 ? GLU A 984  . ? 1_555 ? 
8  AC2 5 CA  K .    ? CA  A 1103 . ? 1_555 ? 
9  AC2 5 DC  E 17   ? DC  E 17   . ? 1_555 ? 
10 AC3 3 GLU A 1112 ? GLU A 984  . ? 1_555 ? 
11 AC3 3 CA  J .    ? CA  A 1102 . ? 1_555 ? 
12 AC3 3 DC  E 17   ? DC  E 17   . ? 1_555 ? 
13 AC4 5 CYS C 880  ? CYS C 752  . ? 1_555 ? 
14 AC4 5 HIS C 894  ? HIS C 766  . ? 1_555 ? 
15 AC4 5 SER C 895  ? SER C 767  . ? 1_555 ? 
16 AC4 5 ILE C 896  ? ILE C 768  . ? 1_555 ? 
17 AC4 5 HIS C 1092 ? HIS C 964  . ? 1_555 ? 
18 AC5 4 ASP C 748  ? ASP C 620  . ? 1_555 ? 
19 AC5 4 GLY C 749  ? GLY C 621  . ? 1_555 ? 
20 AC5 4 GLU C 1112 ? GLU C 984  . ? 1_555 ? 
21 AC5 4 CA  N .    ? CA  C 1103 . ? 1_555 ? 
22 AC6 3 ASP C 748  ? ASP C 620  . ? 1_555 ? 
23 AC6 3 ASP C 858  ? ASP C 730  . ? 1_555 ? 
24 AC6 3 CA  M .    ? CA  C 1102 . ? 1_555 ? 
# 
_atom_sites.entry_id                    6DBV 
_atom_sites.fract_transf_matrix[1][1]   1.000000 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   1.000000 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   1.000000 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
CA 
N  
O  
P  
S  
ZN 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1     N  N     . GLY A 1 536  ? 193.945 143.004 97.744  1.00 230.24 ?  408  GLY A N     1 
ATOM   2     C  CA    . GLY A 1 536  ? 192.633 143.285 98.296  1.00 235.61 ?  408  GLY A CA    1 
ATOM   3     C  C     . GLY A 1 536  ? 191.975 142.090 98.958  1.00 218.37 ?  408  GLY A C     1 
ATOM   4     O  O     . GLY A 1 536  ? 192.112 141.889 100.164 1.00 214.71 ?  408  GLY A O     1 
ATOM   5     N  N     . GLY A 1 537  ? 191.265 141.288 98.166  1.00 220.16 ?  409  GLY A N     1 
ATOM   6     C  CA    . GLY A 1 537  ? 190.569 140.131 98.695  1.00 217.46 ?  409  GLY A CA    1 
ATOM   7     C  C     . GLY A 1 537  ? 189.157 139.951 98.173  1.00 215.22 ?  409  GLY A C     1 
ATOM   8     O  O     . GLY A 1 537  ? 188.436 140.930 97.952  1.00 217.80 ?  409  GLY A O     1 
ATOM   9     N  N     . ARG A 1 538  ? 188.757 138.695 97.969  1.00 213.28 ?  410  ARG A N     1 
ATOM   10    C  CA    . ARG A 1 538  ? 187.412 138.372 97.501  1.00 210.04 ?  410  ARG A CA    1 
ATOM   11    C  C     . ARG A 1 538  ? 186.424 138.473 98.658  1.00 205.65 ?  410  ARG A C     1 
ATOM   12    O  O     . ARG A 1 538  ? 186.719 137.992 99.756  1.00 200.04 ?  410  ARG A O     1 
ATOM   13    C  CB    . ARG A 1 538  ? 187.384 136.966 96.895  1.00 205.80 ?  410  ARG A CB    1 
ATOM   14    C  CG    . ARG A 1 538  ? 186.141 136.639 96.072  1.00 206.04 ?  410  ARG A CG    1 
ATOM   15    C  CD    . ARG A 1 538  ? 186.123 135.169 95.663  1.00 198.61 ?  410  ARG A CD    1 
ATOM   16    N  NE    . ARG A 1 538  ? 185.029 134.854 94.746  1.00 192.27 ?  410  ARG A NE    1 
ATOM   17    C  CZ    . ARG A 1 538  ? 184.748 133.631 94.306  1.00 185.91 ?  410  ARG A CZ    1 
ATOM   18    N  NH1   . ARG A 1 538  ? 185.487 132.599 94.689  1.00 186.94 ?  410  ARG A NH1   1 
ATOM   19    N  NH2   . ARG A 1 538  ? 183.734 133.441 93.474  1.00 182.64 ?  410  ARG A NH2   1 
ATOM   20    N  N     . PRO A 1 539  ? 185.263 139.097 98.460  1.00 203.19 ?  411  PRO A N     1 
ATOM   21    C  CA    . PRO A 1 539  ? 184.310 139.257 99.568  1.00 197.16 ?  411  PRO A CA    1 
ATOM   22    C  C     . PRO A 1 539  ? 183.858 137.915 100.131 1.00 191.64 ?  411  PRO A C     1 
ATOM   23    O  O     . PRO A 1 539  ? 183.464 137.010 99.392  1.00 186.42 ?  411  PRO A O     1 
ATOM   24    C  CB    . PRO A 1 539  ? 183.146 140.022 98.925  1.00 187.64 ?  411  PRO A CB    1 
ATOM   25    C  CG    . PRO A 1 539  ? 183.764 140.743 97.775  1.00 195.48 ?  411  PRO A CG    1 
ATOM   26    C  CD    . PRO A 1 539  ? 184.833 139.826 97.254  1.00 209.70 ?  411  PRO A CD    1 
ATOM   27    N  N     . ARG A 1 540  ? 183.926 137.795 101.456 1.00 186.48 ?  412  ARG A N     1 
ATOM   28    C  CA    . ARG A 1 540  ? 183.478 136.585 102.136 1.00 178.17 ?  412  ARG A CA    1 
ATOM   29    C  C     . ARG A 1 540  ? 181.958 136.466 102.094 1.00 174.32 ?  412  ARG A C     1 
ATOM   30    O  O     . ARG A 1 540  ? 181.241 137.466 102.192 1.00 172.97 ?  412  ARG A O     1 
ATOM   31    C  CB    . ARG A 1 540  ? 183.948 136.580 103.591 1.00 170.57 ?  412  ARG A CB    1 
ATOM   32    C  CG    . ARG A 1 540  ? 185.447 136.449 103.802 1.00 164.87 ?  412  ARG A CG    1 
ATOM   33    C  CD    . ARG A 1 540  ? 185.748 136.369 105.291 1.00 154.03 ?  412  ARG A CD    1 
ATOM   34    N  NE    . ARG A 1 540  ? 187.128 135.985 105.565 1.00 155.96 ?  412  ARG A NE    1 
ATOM   35    C  CZ    . ARG A 1 540  ? 187.585 135.682 106.775 1.00 153.94 ?  412  ARG A CZ    1 
ATOM   36    N  NH1   . ARG A 1 540  ? 186.768 135.724 107.820 1.00 149.09 ?  412  ARG A NH1   1 
ATOM   37    N  NH2   . ARG A 1 540  ? 188.854 135.336 106.942 1.00 158.01 ?  412  ARG A NH2   1 
ATOM   38    N  N     . GLN A 1 541  ? 181.468 135.240 101.941 1.00 166.92 ?  413  GLN A N     1 
ATOM   39    C  CA    . GLN A 1 541  ? 180.049 134.943 102.058 1.00 161.89 ?  413  GLN A CA    1 
ATOM   40    C  C     . GLN A 1 541  ? 179.749 134.292 103.410 1.00 161.54 ?  413  GLN A C     1 
ATOM   41    O  O     . GLN A 1 541  ? 180.648 133.968 104.190 1.00 156.97 ?  413  GLN A O     1 
ATOM   42    C  CB    . GLN A 1 541  ? 179.603 134.046 100.903 1.00 150.41 ?  413  GLN A CB    1 
ATOM   43    C  CG    . GLN A 1 541  ? 179.791 134.690 99.541  1.00 138.99 ?  413  GLN A CG    1 
ATOM   44    C  CD    . GLN A 1 541  ? 179.191 133.875 98.419  1.00 122.02 ?  413  GLN A CD    1 
ATOM   45    O  OE1   . GLN A 1 541  ? 178.762 132.738 98.618  1.00 121.01 ?  413  GLN A OE1   1 
ATOM   46    N  NE2   . GLN A 1 541  ? 179.158 134.454 97.225  1.00 115.34 ?  413  GLN A NE2   1 
ATOM   47    N  N     . HIS A 1 542  ? 178.459 134.111 103.689 1.00 158.72 ?  414  HIS A N     1 
ATOM   48    C  CA    . HIS A 1 542  ? 178.041 133.453 104.920 1.00 158.95 ?  414  HIS A CA    1 
ATOM   49    C  C     . HIS A 1 542  ? 178.430 131.975 104.891 1.00 159.50 ?  414  HIS A C     1 
ATOM   50    O  O     . HIS A 1 542  ? 178.698 131.397 103.835 1.00 158.17 ?  414  HIS A O     1 
ATOM   51    C  CB    . HIS A 1 542  ? 176.529 133.606 105.117 1.00 162.03 ?  414  HIS A CB    1 
ATOM   52    C  CG    . HIS A 1 542  ? 176.062 133.344 106.517 1.00 164.32 ?  414  HIS A CG    1 
ATOM   53    N  ND1   . HIS A 1 542  ? 175.735 132.084 106.973 1.00 157.81 ?  414  HIS A ND1   1 
ATOM   54    C  CD2   . HIS A 1 542  ? 175.853 134.185 107.558 1.00 163.88 ?  414  HIS A CD2   1 
ATOM   55    C  CE1   . HIS A 1 542  ? 175.349 132.159 108.235 1.00 153.36 ?  414  HIS A CE1   1 
ATOM   56    N  NE2   . HIS A 1 542  ? 175.411 133.423 108.613 1.00 158.39 ?  414  HIS A NE2   1 
ATOM   57    N  N     . LEU A 1 543  ? 178.452 131.357 106.076 1.00 157.93 ?  415  LEU A N     1 
ATOM   58    C  CA    . LEU A 1 543  ? 178.861 129.960 106.206 1.00 156.05 ?  415  LEU A CA    1 
ATOM   59    C  C     . LEU A 1 543  ? 177.793 128.971 105.747 1.00 157.24 ?  415  LEU A C     1 
ATOM   60    O  O     . LEU A 1 543  ? 178.138 127.854 105.340 1.00 149.70 ?  415  LEU A O     1 
ATOM   61    C  CB    . LEU A 1 543  ? 179.243 129.656 107.663 1.00 143.90 ?  415  LEU A CB    1 
ATOM   62    C  CG    . LEU A 1 543  ? 179.678 128.230 108.033 1.00 127.57 ?  415  LEU A CG    1 
ATOM   63    C  CD1   . LEU A 1 543  ? 181.049 127.898 107.469 1.00 124.04 ?  415  LEU A CD1   1 
ATOM   64    C  CD2   . LEU A 1 543  ? 179.650 128.018 109.541 1.00 121.84 ?  415  LEU A CD2   1 
ATOM   65    N  N     . LEU A 1 544  ? 176.512 129.357 105.779 1.00 160.45 ?  416  LEU A N     1 
ATOM   66    C  CA    . LEU A 1 544  ? 175.425 128.411 105.546 1.00 157.25 ?  416  LEU A CA    1 
ATOM   67    C  C     . LEU A 1 544  ? 175.142 128.158 104.064 1.00 158.50 ?  416  LEU A C     1 
ATOM   68    O  O     . LEU A 1 544  ? 174.560 127.119 103.733 1.00 150.93 ?  416  LEU A O     1 
ATOM   69    C  CB    . LEU A 1 544  ? 174.148 128.906 106.241 1.00 148.64 ?  416  LEU A CB    1 
ATOM   70    C  CG    . LEU A 1 544  ? 174.165 128.981 107.774 1.00 134.69 ?  416  LEU A CG    1 
ATOM   71    C  CD1   . LEU A 1 544  ? 172.842 129.504 108.331 1.00 125.82 ?  416  LEU A CD1   1 
ATOM   72    C  CD2   . LEU A 1 544  ? 174.511 127.637 108.385 1.00 125.80 ?  416  LEU A CD2   1 
ATOM   73    N  N     . SER A 1 545  ? 175.544 129.063 103.164 1.00 159.99 ?  417  SER A N     1 
ATOM   74    C  CA    . SER A 1 545  ? 175.297 128.902 101.733 1.00 154.76 ?  417  SER A CA    1 
ATOM   75    C  C     . SER A 1 545  ? 176.451 128.237 100.988 1.00 155.99 ?  417  SER A C     1 
ATOM   76    O  O     . SER A 1 545  ? 176.274 127.851 99.828  1.00 152.50 ?  417  SER A O     1 
ATOM   77    C  CB    . SER A 1 545  ? 174.996 130.264 101.082 1.00 145.80 ?  417  SER A CB    1 
ATOM   78    O  OG    . SER A 1 545  ? 175.999 131.219 101.382 1.00 142.64 ?  417  SER A OG    1 
ATOM   79    N  N     . LEU A 1 546  ? 177.615 128.093 101.619 1.00 157.05 ?  418  LEU A N     1 
ATOM   80    C  CA    . LEU A 1 546  ? 178.806 127.571 100.965 1.00 157.95 ?  418  LEU A CA    1 
ATOM   81    C  C     . LEU A 1 546  ? 178.777 126.044 100.890 1.00 158.03 ?  418  LEU A C     1 
ATOM   82    O  O     . LEU A 1 546  ? 178.013 125.371 101.589 1.00 152.25 ?  418  LEU A O     1 
ATOM   83    C  CB    . LEU A 1 546  ? 180.063 128.026 101.711 1.00 155.84 ?  418  LEU A CB    1 
ATOM   84    C  CG    . LEU A 1 546  ? 180.399 129.520 101.741 1.00 154.06 ?  418  LEU A CG    1 
ATOM   85    C  CD1   . LEU A 1 546  ? 181.277 129.815 102.945 1.00 152.67 ?  418  LEU A CD1   1 
ATOM   86    C  CD2   . LEU A 1 546  ? 181.080 129.966 100.454 1.00 155.62 ?  418  LEU A CD2   1 
ATOM   87    N  N     . THR A 1 547  ? 179.636 125.504 100.023 1.00 161.00 ?  419  THR A N     1 
ATOM   88    C  CA    . THR A 1 547  ? 179.846 124.065 99.924  1.00 161.01 ?  419  THR A CA    1 
ATOM   89    C  C     . THR A 1 547  ? 180.631 123.558 101.136 1.00 159.36 ?  419  THR A C     1 
ATOM   90    O  O     . THR A 1 547  ? 181.129 124.332 101.955 1.00 157.28 ?  419  THR A O     1 
ATOM   91    C  CB    . THR A 1 547  ? 180.587 123.720 98.630  1.00 158.23 ?  419  THR A CB    1 
ATOM   92    O  OG1   . THR A 1 547  ? 181.967 124.086 98.753  1.00 159.94 ?  419  THR A OG1   1 
ATOM   93    C  CG2   . THR A 1 547  ? 179.983 124.466 97.446  1.00 162.03 ?  419  THR A CG2   1 
ATOM   94    N  N     . ARG A 1 548  ? 180.743 122.230 101.250 1.00 160.48 ?  420  ARG A N     1 
ATOM   95    C  CA    . ARG A 1 548  ? 181.476 121.645 102.372 1.00 161.80 ?  420  ARG A CA    1 
ATOM   96    C  C     . ARG A 1 548  ? 182.988 121.835 102.250 1.00 163.57 ?  420  ARG A C     1 
ATOM   97    O  O     . ARG A 1 548  ? 183.680 121.854 103.276 1.00 155.88 ?  420  ARG A O     1 
ATOM   98    C  CB    . ARG A 1 548  ? 181.127 120.159 102.522 1.00 157.98 ?  420  ARG A CB    1 
ATOM   99    C  CG    . ARG A 1 548  ? 179.675 119.917 102.953 1.00 154.07 ?  420  ARG A CG    1 
ATOM   100   C  CD    . ARG A 1 548  ? 179.434 118.491 103.430 1.00 150.37 ?  420  ARG A CD    1 
ATOM   101   N  NE    . ARG A 1 548  ? 179.515 117.535 102.328 1.00 166.79 ?  420  ARG A NE    1 
ATOM   102   C  CZ    . ARG A 1 548  ? 178.478 117.178 101.575 1.00 168.28 ?  420  ARG A CZ    1 
ATOM   103   N  NH1   . ARG A 1 548  ? 177.280 117.696 101.806 1.00 155.01 ?  420  ARG A NH1   1 
ATOM   104   N  NH2   . ARG A 1 548  ? 178.642 116.306 100.592 1.00 185.64 ?  420  ARG A NH2   1 
ATOM   105   N  N     . ARG A 1 549  ? 183.512 122.018 101.031 1.00 166.68 ?  421  ARG A N     1 
ATOM   106   C  CA    . ARG A 1 549  ? 184.940 122.286 100.864 1.00 168.41 ?  421  ARG A CA    1 
ATOM   107   C  C     . ARG A 1 549  ? 185.327 123.609 101.519 1.00 160.98 ?  421  ARG A C     1 
ATOM   108   O  O     . ARG A 1 549  ? 186.214 123.649 102.380 1.00 157.68 ?  421  ARG A O     1 
ATOM   109   C  CB    . ARG A 1 549  ? 185.310 122.283 99.376  1.00 172.75 ?  421  ARG A CB    1 
ATOM   110   C  CG    . ARG A 1 549  ? 186.711 122.830 99.058  1.00 177.27 ?  421  ARG A CG    1 
ATOM   111   C  CD    . ARG A 1 549  ? 187.803 121.793 99.332  1.00 186.73 ?  421  ARG A CD    1 
ATOM   112   N  NE    . ARG A 1 549  ? 189.011 122.004 98.530  1.00 192.05 ?  421  ARG A NE    1 
ATOM   113   C  CZ    . ARG A 1 549  ? 190.152 122.500 99.002  1.00 184.57 ?  421  ARG A CZ    1 
ATOM   114   N  NH1   . ARG A 1 549  ? 190.255 122.833 100.282 1.00 177.51 ?  421  ARG A NH1   1 
ATOM   115   N  NH2   . ARG A 1 549  ? 191.198 122.651 98.201  1.00 181.10 ?  421  ARG A NH2   1 
ATOM   116   N  N     . ALA A 1 550  ? 184.653 124.701 101.143 1.00 160.34 ?  422  ALA A N     1 
ATOM   117   C  CA    . ALA A 1 550  ? 184.975 126.004 101.719 1.00 157.74 ?  422  ALA A CA    1 
ATOM   118   C  C     . ALA A 1 550  ? 184.572 126.099 103.191 1.00 158.28 ?  422  ALA A C     1 
ATOM   119   O  O     . ALA A 1 550  ? 185.274 126.748 103.976 1.00 155.42 ?  422  ALA A O     1 
ATOM   120   C  CB    . ALA A 1 550  ? 184.313 127.118 100.904 1.00 156.10 ?  422  ALA A CB    1 
ATOM   121   N  N     . GLN A 1 551  ? 183.481 125.434 103.591 1.00 157.40 ?  423  GLN A N     1 
ATOM   122   C  CA    . GLN A 1 551  ? 183.075 125.423 104.998 1.00 150.56 ?  423  GLN A CA    1 
ATOM   123   C  C     . GLN A 1 551  ? 184.138 124.772 105.879 1.00 148.21 ?  423  GLN A C     1 
ATOM   124   O  O     . GLN A 1 551  ? 184.563 125.348 106.890 1.00 143.33 ?  423  GLN A O     1 
ATOM   125   C  CB    . GLN A 1 551  ? 181.733 124.694 105.160 1.00 143.77 ?  423  GLN A CB    1 
ATOM   126   C  CG    . GLN A 1 551  ? 180.480 125.497 104.797 1.00 139.99 ?  423  GLN A CG    1 
ATOM   127   C  CD    . GLN A 1 551  ? 179.194 124.687 104.950 1.00 132.35 ?  423  GLN A CD    1 
ATOM   128   O  OE1   . GLN A 1 551  ? 179.229 123.474 105.157 1.00 128.71 ?  423  GLN A OE1   1 
ATOM   129   N  NE2   . GLN A 1 551  ? 178.052 125.360 104.841 1.00 134.03 ?  423  GLN A NE2   1 
ATOM   130   N  N     . LYS A 1 552  ? 184.573 123.559 105.518 1.00 149.79 ?  424  LYS A N     1 
ATOM   131   C  CA    . LYS A 1 552  ? 185.593 122.880 106.315 1.00 142.49 ?  424  LYS A CA    1 
ATOM   132   C  C     . LYS A 1 552  ? 186.951 123.572 106.203 1.00 147.66 ?  424  LYS A C     1 
ATOM   133   O  O     . LYS A 1 552  ? 187.714 123.588 107.175 1.00 139.18 ?  424  LYS A O     1 
ATOM   134   C  CB    . LYS A 1 552  ? 185.685 121.412 105.894 1.00 129.97 ?  424  LYS A CB    1 
ATOM   135   C  CG    . LYS A 1 552  ? 186.172 120.450 106.971 1.00 118.11 ?  424  LYS A CG    1 
ATOM   136   C  CD    . LYS A 1 552  ? 185.702 119.039 106.656 1.00 119.17 ?  424  LYS A CD    1 
ATOM   137   C  CE    . LYS A 1 552  ? 186.052 118.656 105.232 1.00 125.46 ?  424  LYS A CE    1 
ATOM   138   N  NZ    . LYS A 1 552  ? 185.595 117.284 104.904 1.00 150.00 ?  424  LYS A NZ    1 
ATOM   139   N  N     . HIS A 1 553  ? 187.254 124.182 105.048 1.00 154.15 ?  425  HIS A N     1 
ATOM   140   C  CA    . HIS A 1 553  ? 188.484 124.958 104.895 1.00 155.00 ?  425  HIS A CA    1 
ATOM   141   C  C     . HIS A 1 553  ? 188.510 126.152 105.843 1.00 152.66 ?  425  HIS A C     1 
ATOM   142   O  O     . HIS A 1 553  ? 189.554 126.467 106.426 1.00 146.58 ?  425  HIS A O     1 
ATOM   143   C  CB    . HIS A 1 553  ? 188.610 125.410 103.438 1.00 157.22 ?  425  HIS A CB    1 
ATOM   144   C  CG    . HIS A 1 553  ? 189.940 126.000 103.077 1.00 155.66 ?  425  HIS A CG    1 
ATOM   145   N  ND1   . HIS A 1 553  ? 191.138 125.368 103.334 1.00 155.26 ?  425  HIS A ND1   1 
ATOM   146   C  CD2   . HIS A 1 553  ? 190.253 127.160 102.452 1.00 151.58 ?  425  HIS A CD2   1 
ATOM   147   C  CE1   . HIS A 1 553  ? 192.132 126.118 102.892 1.00 155.72 ?  425  HIS A CE1   1 
ATOM   148   N  NE2   . HIS A 1 553  ? 191.622 127.211 102.353 1.00 150.94 ?  425  HIS A NE2   1 
ATOM   149   N  N     . ARG A 1 554  ? 187.369 126.832 106.004 1.00 151.54 ?  426  ARG A N     1 
ATOM   150   C  CA    . ARG A 1 554  ? 187.269 127.961 106.923 1.00 144.59 ?  426  ARG A CA    1 
ATOM   151   C  C     . ARG A 1 554  ? 187.267 127.525 108.383 1.00 142.01 ?  426  ARG A C     1 
ATOM   152   O  O     . ARG A 1 554  ? 187.836 128.220 109.233 1.00 134.72 ?  426  ARG A O     1 
ATOM   153   C  CB    . ARG A 1 554  ? 185.991 128.753 106.640 1.00 139.44 ?  426  ARG A CB    1 
ATOM   154   C  CG    . ARG A 1 554  ? 185.972 129.533 105.338 1.00 138.54 ?  426  ARG A CG    1 
ATOM   155   C  CD    . ARG A 1 554  ? 184.593 130.130 105.120 1.00 137.34 ?  426  ARG A CD    1 
ATOM   156   N  NE    . ARG A 1 554  ? 183.971 130.515 106.384 1.00 135.96 ?  426  ARG A NE    1 
ATOM   157   C  CZ    . ARG A 1 554  ? 182.800 131.135 106.488 1.00 134.76 ?  426  ARG A CZ    1 
ATOM   158   N  NH1   . ARG A 1 554  ? 182.114 131.448 105.399 1.00 137.32 ?  426  ARG A NH1   1 
ATOM   159   N  NH2   . ARG A 1 554  ? 182.317 131.443 107.683 1.00 136.03 ?  426  ARG A NH2   1 
ATOM   160   N  N     . LEU A 1 555  ? 186.633 126.392 108.692 1.00 143.93 ?  427  LEU A N     1 
ATOM   161   C  CA    . LEU A 1 555  ? 186.378 125.993 110.070 1.00 140.35 ?  427  LEU A CA    1 
ATOM   162   C  C     . LEU A 1 555  ? 187.384 124.987 110.622 1.00 138.96 ?  427  LEU A C     1 
ATOM   163   O  O     . LEU A 1 555  ? 187.250 124.595 111.784 1.00 138.68 ?  427  LEU A O     1 
ATOM   164   C  CB    . LEU A 1 555  ? 184.959 125.415 110.180 1.00 137.30 ?  427  LEU A CB    1 
ATOM   165   C  CG    . LEU A 1 555  ? 183.804 126.381 109.893 1.00 131.99 ?  427  LEU A CG    1 
ATOM   166   C  CD1   . LEU A 1 555  ? 182.456 125.780 110.286 1.00 122.05 ?  427  LEU A CD1   1 
ATOM   167   C  CD2   . LEU A 1 555  ? 184.025 127.727 110.573 1.00 136.10 ?  427  LEU A CD2   1 
ATOM   168   N  N     . ARG A 1 556  ? 188.370 124.556 109.826 1.00 137.59 ?  428  ARG A N     1 
ATOM   169   C  CA    . ARG A 1 556  ? 189.310 123.525 110.266 1.00 135.82 ?  428  ARG A CA    1 
ATOM   170   C  C     . ARG A 1 556  ? 190.016 123.874 111.579 1.00 146.05 ?  428  ARG A C     1 
ATOM   171   O  O     . ARG A 1 556  ? 190.325 122.973 112.373 1.00 142.98 ?  428  ARG A O     1 
ATOM   172   C  CB    . ARG A 1 556  ? 190.329 123.266 109.153 1.00 127.78 ?  428  ARG A CB    1 
ATOM   173   C  CG    . ARG A 1 556  ? 191.281 122.113 109.406 1.00 122.01 ?  428  ARG A CG    1 
ATOM   174   C  CD    . ARG A 1 556  ? 191.831 121.576 108.093 1.00 121.35 ?  428  ARG A CD    1 
ATOM   175   N  NE    . ARG A 1 556  ? 193.093 120.861 108.271 1.00 122.76 ?  428  ARG A NE    1 
ATOM   176   C  CZ    . ARG A 1 556  ? 194.294 121.409 108.104 1.00 123.31 ?  428  ARG A CZ    1 
ATOM   177   N  NH1   . ARG A 1 556  ? 194.402 122.684 107.764 1.00 121.69 ?  428  ARG A NH1   1 
ATOM   178   N  NH2   . ARG A 1 556  ? 195.385 120.676 108.284 1.00 125.39 ?  428  ARG A NH2   1 
ATOM   179   N  N     . ASP A 1 557  ? 190.266 125.165 111.840 1.00 155.18 ?  429  ASP A N     1 
ATOM   180   C  CA    . ASP A 1 557  ? 190.886 125.560 113.108 1.00 160.10 ?  429  ASP A CA    1 
ATOM   181   C  C     . ASP A 1 557  ? 190.032 125.137 114.300 1.00 148.94 ?  429  ASP A C     1 
ATOM   182   O  O     . ASP A 1 557  ? 190.510 124.445 115.206 1.00 143.36 ?  429  ASP A O     1 
ATOM   183   C  CB    . ASP A 1 557  ? 191.138 127.072 113.139 1.00 169.76 ?  429  ASP A CB    1 
ATOM   184   C  CG    . ASP A 1 557  ? 192.465 127.468 112.501 1.00 208.97 ?  429  ASP A CG    1 
ATOM   185   O  OD1   . ASP A 1 557  ? 193.423 126.669 112.572 1.00 193.95 ?  429  ASP A OD1   1 
ATOM   186   O  OD2   . ASP A 1 557  ? 192.562 128.586 111.951 1.00 348.60 -1 429  ASP A OD2   1 
ATOM   187   N  N     . LEU A 1 558  ? 188.756 125.538 114.318 1.00 142.73 ?  430  LEU A N     1 
ATOM   188   C  CA    . LEU A 1 558  ? 187.884 125.142 115.419 1.00 139.98 ?  430  LEU A CA    1 
ATOM   189   C  C     . LEU A 1 558  ? 187.525 123.658 115.369 1.00 143.93 ?  430  LEU A C     1 
ATOM   190   O  O     . LEU A 1 558  ? 187.251 123.068 116.419 1.00 140.10 ?  430  LEU A O     1 
ATOM   191   C  CB    . LEU A 1 558  ? 186.616 126.003 115.433 1.00 132.23 ?  430  LEU A CB    1 
ATOM   192   C  CG    . LEU A 1 558  ? 185.627 125.774 116.586 1.00 124.60 ?  430  LEU A CG    1 
ATOM   193   C  CD1   . LEU A 1 558  ? 186.320 125.769 117.937 1.00 118.97 ?  430  LEU A CD1   1 
ATOM   194   C  CD2   . LEU A 1 558  ? 184.524 126.810 116.580 1.00 124.86 ?  430  LEU A CD2   1 
ATOM   195   N  N     . LYS A 1 559  ? 187.555 123.032 114.185 1.00 145.54 ?  431  LYS A N     1 
ATOM   196   C  CA    . LYS A 1 559  ? 187.330 121.590 114.110 1.00 145.24 ?  431  LYS A CA    1 
ATOM   197   C  C     . LYS A 1 559  ? 188.422 120.824 114.848 1.00 144.06 ?  431  LYS A C     1 
ATOM   198   O  O     . LYS A 1 559  ? 188.130 119.919 115.638 1.00 140.37 ?  431  LYS A O     1 
ATOM   199   C  CB    . LYS A 1 559  ? 187.255 121.132 112.651 1.00 137.27 ?  431  LYS A CB    1 
ATOM   200   C  CG    . LYS A 1 559  ? 187.110 119.615 112.497 1.00 131.50 ?  431  LYS A CG    1 
ATOM   201   C  CD    . LYS A 1 559  ? 187.059 119.172 111.041 1.00 123.33 ?  431  LYS A CD    1 
ATOM   202   C  CE    . LYS A 1 559  ? 187.000 117.654 110.943 1.00 114.15 ?  431  LYS A CE    1 
ATOM   203   N  NZ    . LYS A 1 559  ? 186.985 117.194 109.530 1.00 118.95 ?  431  LYS A NZ    1 
ATOM   204   N  N     . ASN A 1 560  ? 189.689 121.186 114.621 1.00 143.21 ?  432  ASN A N     1 
ATOM   205   C  CA    . ASN A 1 560  ? 190.781 120.531 115.340 1.00 143.43 ?  432  ASN A CA    1 
ATOM   206   C  C     . ASN A 1 560  ? 190.866 120.995 116.796 1.00 145.67 ?  432  ASN A C     1 
ATOM   207   O  O     . ASN A 1 560  ? 191.347 120.241 117.652 1.00 143.29 ?  432  ASN A O     1 
ATOM   208   C  CB    . ASN A 1 560  ? 192.104 120.757 114.604 1.00 137.90 ?  432  ASN A CB    1 
ATOM   209   C  CG    . ASN A 1 560  ? 192.173 120.007 113.272 1.00 121.58 ?  432  ASN A CG    1 
ATOM   210   O  OD1   . ASN A 1 560  ? 191.501 118.992 113.077 1.00 115.89 ?  432  ASN A OD1   1 
ATOM   211   N  ND2   . ASN A 1 560  ? 192.984 120.517 112.348 1.00 116.80 ?  432  ASN A ND2   1 
ATOM   212   N  N     . GLN A 1 561  ? 190.394 122.212 117.099 1.00 142.78 ?  433  GLN A N     1 
ATOM   213   C  CA    . GLN A 1 561  ? 190.264 122.651 118.489 1.00 138.65 ?  433  GLN A CA    1 
ATOM   214   C  C     . GLN A 1 561  ? 189.308 121.745 119.263 1.00 142.26 ?  433  GLN A C     1 
ATOM   215   O  O     . GLN A 1 561  ? 189.632 121.262 120.358 1.00 142.26 ?  433  GLN A O     1 
ATOM   216   C  CB    . GLN A 1 561  ? 189.765 124.100 118.524 1.00 131.53 ?  433  GLN A CB    1 
ATOM   217   C  CG    . GLN A 1 561  ? 190.825 125.187 118.322 1.00 128.13 ?  433  GLN A CG    1 
ATOM   218   C  CD    . GLN A 1 561  ? 190.307 126.585 118.661 1.00 119.34 ?  433  GLN A CD    1 
ATOM   219   O  OE1   . GLN A 1 561  ? 189.141 126.759 119.013 1.00 117.12 ?  433  GLN A OE1   1 
ATOM   220   N  NE2   . GLN A 1 561  ? 191.171 127.588 118.528 0.81 111.01 ?  433  GLN A NE2   1 
ATOM   221   N  N     . VAL A 1 562  ? 188.114 121.513 118.703 1.00 142.89 ?  434  VAL A N     1 
ATOM   222   C  CA    . VAL A 1 562  ? 187.149 120.592 119.300 1.00 144.99 ?  434  VAL A CA    1 
ATOM   223   C  C     . VAL A 1 562  ? 187.703 119.171 119.317 1.00 149.27 ?  434  VAL A C     1 
ATOM   224   O  O     . VAL A 1 562  ? 187.463 118.411 120.260 1.00 147.30 ?  434  VAL A O     1 
ATOM   225   C  CB    . VAL A 1 562  ? 185.801 120.671 118.553 1.00 139.50 ?  434  VAL A CB    1 
ATOM   226   C  CG1   . VAL A 1 562  ? 184.829 119.606 119.055 1.00 132.40 ?  434  VAL A CG1   1 
ATOM   227   C  CG2   . VAL A 1 562  ? 185.180 122.059 118.707 1.00 132.30 ?  434  VAL A CG2   1 
ATOM   228   N  N     . LYS A 1 563  ? 188.474 118.798 118.290 1.00 149.10 ?  435  LYS A N     1 
ATOM   229   C  CA    . LYS A 1 563  ? 189.075 117.465 118.249 1.00 148.54 ?  435  LYS A CA    1 
ATOM   230   C  C     . LYS A 1 563  ? 190.003 117.239 119.442 1.00 152.59 ?  435  LYS A C     1 
ATOM   231   O  O     . LYS A 1 563  ? 189.855 116.256 120.187 1.00 156.36 ?  435  LYS A O     1 
ATOM   232   C  CB    . LYS A 1 563  ? 189.833 117.283 116.929 1.00 138.44 ?  435  LYS A CB    1 
ATOM   233   C  CG    . LYS A 1 563  ? 190.028 115.842 116.497 1.00 142.26 ?  435  LYS A CG    1 
ATOM   234   C  CD    . LYS A 1 563  ? 188.699 115.219 116.110 1.00 138.44 ?  435  LYS A CD    1 
ATOM   235   C  CE    . LYS A 1 563  ? 188.842 113.736 115.832 1.00 149.15 ?  435  LYS A CE    1 
ATOM   236   N  NZ    . LYS A 1 563  ? 189.357 113.030 117.034 1.00 160.27 ?  435  LYS A NZ    1 
ATOM   237   N  N     . THR A 1 564  ? 190.956 118.157 119.654 1.00 146.81 ?  436  THR A N     1 
ATOM   238   C  CA    . THR A 1 564  ? 191.903 117.989 120.755 1.00 143.09 ?  436  THR A CA    1 
ATOM   239   C  C     . THR A 1 564  ? 191.208 118.129 122.109 1.00 146.93 ?  436  THR A C     1 
ATOM   240   O  O     . THR A 1 564  ? 191.502 117.365 123.035 1.00 147.91 ?  436  THR A O     1 
ATOM   241   C  CB    . THR A 1 564  ? 193.083 118.969 120.633 1.00 135.51 ?  436  THR A CB    1 
ATOM   242   O  OG1   . THR A 1 564  ? 193.935 118.844 121.779 1.00 131.50 ?  436  THR A OG1   1 
ATOM   243   C  CG2   . THR A 1 564  ? 192.621 120.413 120.536 1.00 135.79 ?  436  THR A CG2   1 
ATOM   244   N  N     . PHE A 1 565  ? 190.246 119.056 122.238 1.00 146.82 ?  437  PHE A N     1 
ATOM   245   C  CA    . PHE A 1 565  ? 189.569 119.219 123.524 1.00 147.27 ?  437  PHE A CA    1 
ATOM   246   C  C     . PHE A 1 565  ? 188.709 117.999 123.862 1.00 152.74 ?  437  PHE A C     1 
ATOM   247   O  O     . PHE A 1 565  ? 188.617 117.602 125.033 1.00 154.45 ?  437  PHE A O     1 
ATOM   248   C  CB    . PHE A 1 565  ? 188.722 120.495 123.525 1.00 141.21 ?  437  PHE A CB    1 
ATOM   249   C  CG    . PHE A 1 565  ? 187.949 120.713 124.804 1.00 140.21 ?  437  PHE A CG    1 
ATOM   250   C  CD1   . PHE A 1 565  ? 188.588 121.118 125.963 1.00 139.53 ?  437  PHE A CD1   1 
ATOM   251   C  CD2   . PHE A 1 565  ? 186.589 120.480 124.853 1.00 138.63 ?  437  PHE A CD2   1 
ATOM   252   C  CE1   . PHE A 1 565  ? 187.876 121.307 127.137 1.00 136.82 ?  437  PHE A CE1   1 
ATOM   253   C  CE2   . PHE A 1 565  ? 185.878 120.665 126.023 1.00 129.57 ?  437  PHE A CE2   1 
ATOM   254   C  CZ    . PHE A 1 565  ? 186.521 121.077 127.161 1.00 130.61 ?  437  PHE A CZ    1 
ATOM   255   N  N     . ALA A 1 566  ? 188.081 117.383 122.853 1.00 150.55 ?  438  ALA A N     1 
ATOM   256   C  CA    . ALA A 1 566  ? 187.253 116.208 123.099 1.00 149.80 ?  438  ALA A CA    1 
ATOM   257   C  C     . ALA A 1 566  ? 188.103 114.991 123.435 1.00 154.92 ?  438  ALA A C     1 
ATOM   258   O  O     . ALA A 1 566  ? 187.734 114.194 124.305 1.00 159.85 ?  438  ALA A O     1 
ATOM   259   C  CB    . ALA A 1 566  ? 186.371 115.924 121.884 1.00 144.78 ?  438  ALA A CB    1 
ATOM   260   N  N     . GLU A 1 567  ? 189.241 114.821 122.753 1.00 154.67 ?  439  GLU A N     1 
ATOM   261   C  CA    . GLU A 1 567  ? 190.163 113.763 123.157 1.00 161.05 ?  439  GLU A CA    1 
ATOM   262   C  C     . GLU A 1 567  ? 190.790 114.039 124.522 1.00 161.97 ?  439  GLU A C     1 
ATOM   263   O  O     . GLU A 1 567  ? 191.281 113.102 125.163 1.00 158.44 ?  439  GLU A O     1 
ATOM   264   C  CB    . GLU A 1 567  ? 191.240 113.570 122.086 1.00 167.58 ?  439  GLU A CB    1 
ATOM   265   C  CG    . GLU A 1 567  ? 190.704 113.030 120.759 1.00 177.41 ?  439  GLU A CG    1 
ATOM   266   C  CD    . GLU A 1 567  ? 191.803 112.729 119.750 1.00 207.09 ?  439  GLU A CD    1 
ATOM   267   O  OE1   . GLU A 1 567  ? 192.991 112.729 120.138 1.00 193.19 ?  439  GLU A OE1   1 
ATOM   268   O  OE2   . GLU A 1 567  ? 191.477 112.492 118.566 1.00 367.45 -1 439  GLU A OE2   1 
ATOM   269   N  N     . LYS A 1 568  ? 190.782 115.301 124.970 1.00 163.42 ?  440  LYS A N     1 
ATOM   270   C  CA    . LYS A 1 568  ? 191.238 115.639 126.318 1.00 165.32 ?  440  LYS A CA    1 
ATOM   271   C  C     . LYS A 1 568  ? 190.218 115.221 127.375 1.00 163.79 ?  440  LYS A C     1 
ATOM   272   O  O     . LYS A 1 568  ? 190.566 114.567 128.366 1.00 158.03 ?  440  LYS A O     1 
ATOM   273   C  CB    . LYS A 1 568  ? 191.498 117.148 126.414 1.00 155.80 ?  440  LYS A CB    1 
ATOM   274   C  CG    . LYS A 1 568  ? 192.775 117.655 125.751 1.00 145.74 ?  440  LYS A CG    1 
ATOM   275   C  CD    . LYS A 1 568  ? 192.824 119.183 125.775 1.00 129.93 ?  440  LYS A CD    1 
ATOM   276   C  CE    . LYS A 1 568  ? 194.061 119.727 125.079 1.00 120.08 ?  440  LYS A CE    1 
ATOM   277   N  NZ    . LYS A 1 568  ? 194.094 121.217 125.098 1.00 106.94 ?  440  LYS A NZ    1 
ATOM   278   N  N     . GLU A 1 569  ? 188.951 115.593 127.181 1.00 167.47 ?  441  GLU A N     1 
ATOM   279   C  CA    . GLU A 1 569  ? 187.927 115.441 128.213 1.00 175.49 ?  441  GLU A CA    1 
ATOM   280   C  C     . GLU A 1 569  ? 187.112 114.157 128.088 1.00 177.74 ?  441  GLU A C     1 
ATOM   281   O  O     . GLU A 1 569  ? 187.006 113.397 129.056 1.00 173.55 ?  441  GLU A O     1 
ATOM   282   C  CB    . GLU A 1 569  ? 186.973 116.644 128.192 1.00 179.54 ?  441  GLU A CB    1 
ATOM   283   C  CG    . GLU A 1 569  ? 187.597 117.988 128.545 1.00 172.83 ?  441  GLU A CG    1 
ATOM   284   C  CD    . GLU A 1 569  ? 187.694 118.217 130.046 1.00 190.47 ?  441  GLU A CD    1 
ATOM   285   O  OE1   . GLU A 1 569  ? 187.192 117.374 130.817 1.00 181.11 ?  441  GLU A OE1   1 
ATOM   286   O  OE2   . GLU A 1 569  ? 188.265 119.251 130.454 1.00 261.43 -1 441  GLU A OE2   1 
ATOM   287   N  N     . GLU A 1 570  ? 186.525 113.899 126.921 1.00 179.60 ?  442  GLU A N     1 
ATOM   288   C  CA    . GLU A 1 570  ? 185.500 112.872 126.778 1.00 185.91 ?  442  GLU A CA    1 
ATOM   289   C  C     . GLU A 1 570  ? 186.037 111.538 126.266 1.00 177.51 ?  442  GLU A C     1 
ATOM   290   O  O     . GLU A 1 570  ? 185.270 110.576 126.172 1.00 175.31 ?  442  GLU A O     1 
ATOM   291   C  CB    . GLU A 1 570  ? 184.386 113.373 125.848 1.00 185.64 ?  442  GLU A CB    1 
ATOM   292   C  CG    . GLU A 1 570  ? 183.675 114.641 126.321 1.00 188.68 ?  442  GLU A CG    1 
ATOM   293   C  CD    . GLU A 1 570  ? 182.940 114.455 127.637 1.00 207.66 ?  442  GLU A CD    1 
ATOM   294   O  OE1   . GLU A 1 570  ? 182.390 113.358 127.862 1.00 190.07 ?  442  GLU A OE1   1 
ATOM   295   O  OE2   . GLU A 1 570  ? 182.900 115.414 128.440 1.00 376.01 -1 442  GLU A OE2   1 
ATOM   296   N  N     . GLY A 1 571  ? 187.323 111.455 125.931 1.00 169.79 ?  443  GLY A N     1 
ATOM   297   C  CA    . GLY A 1 571  ? 187.920 110.185 125.561 1.00 164.19 ?  443  GLY A CA    1 
ATOM   298   C  C     . GLY A 1 571  ? 187.409 109.597 124.260 1.00 163.68 ?  443  GLY A C     1 
ATOM   299   O  O     . GLY A 1 571  ? 186.755 108.550 124.258 1.00 161.43 ?  443  GLY A O     1 
ATOM   300   N  N     . GLY A 1 572  ? 187.689 110.267 123.147 1.00 164.25 ?  444  GLY A N     1 
ATOM   301   C  CA    . GLY A 1 572  ? 187.299 109.762 121.842 1.00 166.51 ?  444  GLY A CA    1 
ATOM   302   C  C     . GLY A 1 572  ? 185.827 109.888 121.511 1.00 169.41 ?  444  GLY A C     1 
ATOM   303   O  O     . GLY A 1 572  ? 185.246 108.959 120.934 1.00 168.37 ?  444  GLY A O     1 
ATOM   304   N  N     . ASP A 1 573  ? 185.203 111.013 121.864 1.00 174.85 ?  445  ASP A N     1 
ATOM   305   C  CA    . ASP A 1 573  ? 183.796 111.271 121.551 1.00 180.71 ?  445  ASP A CA    1 
ATOM   306   C  C     . ASP A 1 573  ? 183.696 112.725 121.080 1.00 174.08 ?  445  ASP A C     1 
ATOM   307   O  O     . ASP A 1 573  ? 183.456 113.625 121.889 1.00 170.54 ?  445  ASP A O     1 
ATOM   308   C  CB    . ASP A 1 573  ? 182.905 110.982 122.776 1.00 189.89 ?  445  ASP A CB    1 
ATOM   309   C  CG    . ASP A 1 573  ? 181.415 111.165 122.494 1.00 200.35 ?  445  ASP A CG    1 
ATOM   310   O  OD1   . ASP A 1 573  ? 181.053 111.531 121.357 1.00 181.99 ?  445  ASP A OD1   1 
ATOM   311   O  OD2   . ASP A 1 573  ? 180.598 110.935 123.414 1.00 329.15 -1 445  ASP A OD2   1 
ATOM   312   N  N     . VAL A 1 574  ? 183.895 112.955 119.776 1.00 169.88 ?  446  VAL A N     1 
ATOM   313   C  CA    . VAL A 1 574  ? 183.727 114.294 119.205 1.00 164.11 ?  446  VAL A CA    1 
ATOM   314   C  C     . VAL A 1 574  ? 182.257 114.565 118.870 1.00 162.95 ?  446  VAL A C     1 
ATOM   315   O  O     . VAL A 1 574  ? 181.796 115.715 118.940 1.00 156.56 ?  446  VAL A O     1 
ATOM   316   C  CB    . VAL A 1 574  ? 184.631 114.464 117.965 1.00 150.98 ?  446  VAL A CB    1 
ATOM   317   C  CG1   . VAL A 1 574  ? 184.555 115.886 117.411 1.00 138.10 ?  446  VAL A CG1   1 
ATOM   318   C  CG2   . VAL A 1 574  ? 186.076 114.095 118.290 1.00 144.43 ?  446  VAL A CG2   1 
ATOM   319   N  N     . LYS A 1 575  ? 181.502 113.517 118.524 1.00 162.65 ?  447  LYS A N     1 
ATOM   320   C  CA    . LYS A 1 575  ? 180.115 113.685 118.096 1.00 155.53 ?  447  LYS A CA    1 
ATOM   321   C  C     . LYS A 1 575  ? 179.234 114.190 119.239 1.00 154.79 ?  447  LYS A C     1 
ATOM   322   O  O     . LYS A 1 575  ? 178.458 115.139 119.062 1.00 147.61 ?  447  LYS A O     1 
ATOM   323   C  CB    . LYS A 1 575  ? 179.590 112.364 117.529 1.00 144.55 ?  447  LYS A CB    1 
ATOM   324   C  CG    . LYS A 1 575  ? 178.104 112.336 117.234 1.00 130.44 ?  447  LYS A CG    1 
ATOM   325   C  CD    . LYS A 1 575  ? 177.734 111.115 116.411 1.00 123.74 ?  447  LYS A CD    1 
ATOM   326   C  CE    . LYS A 1 575  ? 176.233 110.914 116.382 1.00 117.05 ?  447  LYS A CE    1 
ATOM   327   N  NZ    . LYS A 1 575  ? 175.835 110.009 115.276 1.00 124.99 ?  447  LYS A NZ    1 
ATOM   328   N  N     . SER A 1 576  ? 179.354 113.587 120.430 1.00 157.97 ?  448  SER A N     1 
ATOM   329   C  CA    . SER A 1 576  ? 178.583 114.072 121.575 1.00 149.32 ?  448  SER A CA    1 
ATOM   330   C  C     . SER A 1 576  ? 179.060 115.445 122.044 1.00 154.44 ?  448  SER A C     1 
ATOM   331   O  O     . SER A 1 576  ? 178.269 116.209 122.611 1.00 144.92 ?  448  SER A O     1 
ATOM   332   C  CB    . SER A 1 576  ? 178.634 113.066 122.730 1.00 148.74 ?  448  SER A CB    1 
ATOM   333   O  OG    . SER A 1 576  ? 178.311 111.752 122.308 1.00 155.18 ?  448  SER A OG    1 
ATOM   334   N  N     . VAL A 1 577  ? 180.329 115.793 121.793 1.00 159.82 ?  449  VAL A N     1 
ATOM   335   C  CA    . VAL A 1 577  ? 180.828 117.119 122.165 1.00 155.89 ?  449  VAL A CA    1 
ATOM   336   C  C     . VAL A 1 577  ? 180.179 118.198 121.297 1.00 153.15 ?  449  VAL A C     1 
ATOM   337   O  O     . VAL A 1 577  ? 179.648 119.195 121.809 1.00 146.53 ?  449  VAL A O     1 
ATOM   338   C  CB    . VAL A 1 577  ? 182.368 117.164 122.080 1.00 148.24 ?  449  VAL A CB    1 
ATOM   339   C  CG1   . VAL A 1 577  ? 182.863 118.590 121.917 1.00 137.46 ?  449  VAL A CG1   1 
ATOM   340   C  CG2   . VAL A 1 577  ? 182.996 116.531 123.320 1.00 143.26 ?  449  VAL A CG2   1 
ATOM   341   N  N     . CYS A 1 578  ? 180.183 118.008 119.968 1.00 151.44 ?  450  CYS A N     1 
ATOM   342   C  CA    . CYS A 1 578  ? 179.502 118.986 119.118 1.00 143.32 ?  450  CYS A CA    1 
ATOM   343   C  C     . CYS A 1 578  ? 177.981 118.922 119.273 1.00 140.38 ?  450  CYS A C     1 
ATOM   344   O  O     . CYS A 1 578  ? 177.306 119.927 119.018 1.00 132.15 ?  450  CYS A O     1 
ATOM   345   C  CB    . CYS A 1 578  ? 179.915 118.830 117.646 1.00 128.32 ?  450  CYS A CB    1 
ATOM   346   S  SG    . CYS A 1 578  ? 179.882 117.173 116.928 1.00 127.97 ?  450  CYS A SG    1 
ATOM   347   N  N     . LEU A 1 579  ? 177.438 117.800 119.762 1.00 140.27 ?  451  LEU A N     1 
ATOM   348   C  CA    . LEU A 1 579  ? 176.014 117.735 120.091 1.00 132.13 ?  451  LEU A CA    1 
ATOM   349   C  C     . LEU A 1 579  ? 175.672 118.604 121.303 1.00 132.80 ?  451  LEU A C     1 
ATOM   350   O  O     . LEU A 1 579  ? 174.681 119.344 121.285 1.00 127.93 ?  451  LEU A O     1 
ATOM   351   C  CB    . LEU A 1 579  ? 175.606 116.282 120.347 1.00 126.23 ?  451  LEU A CB    1 
ATOM   352   C  CG    . LEU A 1 579  ? 174.169 116.050 120.829 1.00 112.44 ?  451  LEU A CG    1 
ATOM   353   C  CD1   . LEU A 1 579  ? 173.170 116.384 119.738 1.00 107.96 ?  451  LEU A CD1   1 
ATOM   354   C  CD2   . LEU A 1 579  ? 173.949 114.635 121.356 1.00 106.28 ?  451  LEU A CD2   1 
ATOM   355   N  N     . THR A 1 580  ? 176.465 118.505 122.383 1.00 137.01 ?  452  THR A N     1 
ATOM   356   C  CA    . THR A 1 580  ? 176.253 119.368 123.548 1.00 132.13 ?  452  THR A CA    1 
ATOM   357   C  C     . THR A 1 580  ? 176.485 120.838 123.204 1.00 135.95 ?  452  THR A C     1 
ATOM   358   O  O     . THR A 1 580  ? 175.772 121.715 123.715 1.00 131.73 ?  452  THR A O     1 
ATOM   359   C  CB    . THR A 1 580  ? 177.156 118.932 124.714 1.00 124.50 ?  452  THR A CB    1 
ATOM   360   O  OG1   . THR A 1 580  ? 176.857 117.581 125.090 1.00 123.46 ?  452  THR A OG1   1 
ATOM   361   C  CG2   . THR A 1 580  ? 176.971 119.832 125.932 1.00 113.68 ?  452  THR A CG2   1 
ATOM   362   N  N     . LEU A 1 581  ? 177.446 121.125 122.315 1.00 139.83 ?  453  LEU A N     1 
ATOM   363   C  CA    . LEU A 1 581  ? 177.650 122.503 121.864 1.00 138.87 ?  453  LEU A CA    1 
ATOM   364   C  C     . LEU A 1 581  ? 176.440 123.024 121.090 1.00 133.87 ?  453  LEU A C     1 
ATOM   365   O  O     . LEU A 1 581  ? 176.007 124.166 121.298 1.00 128.57 ?  453  LEU A O     1 
ATOM   366   C  CB    . LEU A 1 581  ? 178.912 122.600 121.002 1.00 138.15 ?  453  LEU A CB    1 
ATOM   367   C  CG    . LEU A 1 581  ? 180.282 122.328 121.633 1.00 135.71 ?  453  LEU A CG    1 
ATOM   368   C  CD1   . LEU A 1 581  ? 181.407 122.915 120.779 1.00 128.22 ?  453  LEU A CD1   1 
ATOM   369   C  CD2   . LEU A 1 581  ? 180.349 122.850 123.065 1.00 129.76 ?  453  LEU A CD2   1 
ATOM   370   N  N     . PHE A 1 582  ? 175.886 122.203 120.187 1.00 132.92 ?  454  PHE A N     1 
ATOM   371   C  CA    . PHE A 1 582  ? 174.684 122.593 119.450 1.00 129.98 ?  454  PHE A CA    1 
ATOM   372   C  C     . PHE A 1 582  ? 173.496 122.808 120.390 1.00 131.82 ?  454  PHE A C     1 
ATOM   373   O  O     . PHE A 1 582  ? 172.732 123.770 120.229 1.00 129.52 ?  454  PHE A O     1 
ATOM   374   C  CB    . PHE A 1 582  ? 174.364 121.529 118.391 1.00 121.82 ?  454  PHE A CB    1 
ATOM   375   C  CG    . PHE A 1 582  ? 173.418 121.992 117.311 1.00 121.42 ?  454  PHE A CG    1 
ATOM   376   C  CD1   . PHE A 1 582  ? 173.153 123.335 117.123 1.00 127.67 ?  454  PHE A CD1   1 
ATOM   377   C  CD2   . PHE A 1 582  ? 172.786 121.076 116.488 1.00 116.06 ?  454  PHE A CD2   1 
ATOM   378   C  CE1   . PHE A 1 582  ? 172.279 123.753 116.136 1.00 126.30 ?  454  PHE A CE1   1 
ATOM   379   C  CE2   . PHE A 1 582  ? 171.908 121.492 115.507 1.00 117.26 ?  454  PHE A CE2   1 
ATOM   380   C  CZ    . PHE A 1 582  ? 171.657 122.829 115.330 1.00 122.07 ?  454  PHE A CZ    1 
ATOM   381   N  N     . LEU A 1 583  ? 173.341 121.937 121.395 1.00 130.78 ?  455  LEU A N     1 
ATOM   382   C  CA    . LEU A 1 583  ? 172.229 122.079 122.336 1.00 127.63 ?  455  LEU A CA    1 
ATOM   383   C  C     . LEU A 1 583  ? 172.353 123.357 123.164 1.00 130.61 ?  455  LEU A C     1 
ATOM   384   O  O     . LEU A 1 583  ? 171.357 124.062 123.375 1.00 128.36 ?  455  LEU A O     1 
ATOM   385   C  CB    . LEU A 1 583  ? 172.143 120.846 123.241 1.00 121.71 ?  455  LEU A CB    1 
ATOM   386   C  CG    . LEU A 1 583  ? 171.414 119.608 122.699 1.00 111.11 ?  455  LEU A CG    1 
ATOM   387   C  CD1   . LEU A 1 583  ? 171.558 118.414 123.635 1.00 101.79 ?  455  LEU A CD1   1 
ATOM   388   C  CD2   . LEU A 1 583  ? 169.941 119.920 122.474 1.00 107.81 ?  455  LEU A CD2   1 
ATOM   389   N  N     . LEU A 1 584  ? 173.567 123.686 123.627 1.00 131.53 ?  456  LEU A N     1 
ATOM   390   C  CA    . LEU A 1 584  ? 173.748 124.918 124.395 1.00 127.78 ?  456  LEU A CA    1 
ATOM   391   C  C     . LEU A 1 584  ? 173.546 126.156 123.522 1.00 129.23 ?  456  LEU A C     1 
ATOM   392   O  O     . LEU A 1 584  ? 172.926 127.137 123.958 1.00 129.50 ?  456  LEU A O     1 
ATOM   393   C  CB    . LEU A 1 584  ? 175.133 124.935 125.050 1.00 118.30 ?  456  LEU A CB    1 
ATOM   394   C  CG    . LEU A 1 584  ? 175.379 123.992 126.234 1.00 113.96 ?  456  LEU A CG    1 
ATOM   395   C  CD1   . LEU A 1 584  ? 176.740 124.243 126.872 1.00 109.95 ?  456  LEU A CD1   1 
ATOM   396   C  CD2   . LEU A 1 584  ? 174.274 124.136 127.276 1.00 112.18 ?  456  LEU A CD2   1 
ATOM   397   N  N     . ALA A 1 585  ? 174.038 126.120 122.278 1.00 125.39 ?  457  ALA A N     1 
ATOM   398   C  CA    . ALA A 1 585  ? 173.887 127.269 121.391 1.00 120.78 ?  457  ALA A CA    1 
ATOM   399   C  C     . ALA A 1 585  ? 172.438 127.480 120.967 1.00 123.45 ?  457  ALA A C     1 
ATOM   400   O  O     . ALA A 1 585  ? 172.048 128.610 120.652 1.00 123.89 ?  457  ALA A O     1 
ATOM   401   C  CB    . ALA A 1 585  ? 174.776 127.102 120.161 1.00 114.98 ?  457  ALA A CB    1 
ATOM   402   N  N     . LEU A 1 586  ? 171.632 126.413 120.929 1.00 126.06 ?  458  LEU A N     1 
ATOM   403   C  CA    . LEU A 1 586  ? 170.214 126.581 120.621 1.00 127.62 ?  458  LEU A CA    1 
ATOM   404   C  C     . LEU A 1 586  ? 169.389 126.975 121.843 1.00 135.13 ?  458  LEU A C     1 
ATOM   405   O  O     . LEU A 1 586  ? 168.395 127.693 121.696 1.00 135.68 ?  458  LEU A O     1 
ATOM   406   C  CB    . LEU A 1 586  ? 169.646 125.305 119.996 1.00 121.75 ?  458  LEU A CB    1 
ATOM   407   C  CG    . LEU A 1 586  ? 170.069 125.032 118.552 1.00 116.16 ?  458  LEU A CG    1 
ATOM   408   C  CD1   . LEU A 1 586  ? 169.245 123.901 117.942 1.00 114.39 ?  458  LEU A CD1   1 
ATOM   409   C  CD2   . LEU A 1 586  ? 169.976 126.299 117.707 1.00 105.60 ?  458  LEU A CD2   1 
ATOM   410   N  N     . ARG A 1 587  ? 169.761 126.516 123.045 1.00 137.22 ?  459  ARG A N     1 
ATOM   411   C  CA    . ARG A 1 587  ? 168.992 126.871 124.237 1.00 138.28 ?  459  ARG A CA    1 
ATOM   412   C  C     . ARG A 1 587  ? 169.297 128.278 124.739 1.00 142.49 ?  459  ARG A C     1 
ATOM   413   O  O     . ARG A 1 587  ? 168.419 128.919 125.330 1.00 147.92 ?  459  ARG A O     1 
ATOM   414   C  CB    . ARG A 1 587  ? 169.247 125.865 125.356 1.00 131.67 ?  459  ARG A CB    1 
ATOM   415   C  CG    . ARG A 1 587  ? 168.674 124.498 125.083 1.00 127.87 ?  459  ARG A CG    1 
ATOM   416   C  CD    . ARG A 1 587  ? 168.930 123.573 126.239 1.00 129.03 ?  459  ARG A CD    1 
ATOM   417   N  NE    . ARG A 1 587  ? 168.457 122.225 125.957 1.00 126.48 ?  459  ARG A NE    1 
ATOM   418   C  CZ    . ARG A 1 587  ? 167.188 121.846 126.064 1.00 125.97 ?  459  ARG A CZ    1 
ATOM   419   N  NH1   . ARG A 1 587  ? 166.264 122.720 126.448 1.00 128.21 ?  459  ARG A NH1   1 
ATOM   420   N  NH2   . ARG A 1 587  ? 166.843 120.596 125.785 1.00 123.33 ?  459  ARG A NH2   1 
ATOM   421   N  N     . ALA A 1 588  ? 170.523 128.774 124.528 1.00 139.52 ?  460  ALA A N     1 
ATOM   422   C  CA    . ALA A 1 588  ? 170.836 130.140 124.939 1.00 140.50 ?  460  ALA A CA    1 
ATOM   423   C  C     . ALA A 1 588  ? 169.968 131.160 124.209 1.00 136.63 ?  460  ALA A C     1 
ATOM   424   O  O     . ALA A 1 588  ? 169.741 132.261 124.721 1.00 141.74 ?  460  ALA A O     1 
ATOM   425   C  CB    . ALA A 1 588  ? 172.319 130.429 124.707 1.00 132.38 ?  460  ALA A CB    1 
ATOM   426   N  N     . GLY A 1 589  ? 169.474 130.814 123.025 1.00 137.50 ?  461  GLY A N     1 
ATOM   427   C  CA    . GLY A 1 589  ? 168.610 131.662 122.233 1.00 146.75 ?  461  GLY A CA    1 
ATOM   428   C  C     . GLY A 1 589  ? 167.121 131.406 122.360 1.00 152.28 ?  461  GLY A C     1 
ATOM   429   O  O     . GLY A 1 589  ? 166.356 131.901 121.526 1.00 153.52 ?  461  GLY A O     1 
ATOM   430   N  N     . ASN A 1 590  ? 166.689 130.640 123.367 1.00 147.23 ?  462  ASN A N     1 
ATOM   431   C  CA    . ASN A 1 590  ? 165.271 130.391 123.663 1.00 147.64 ?  462  ASN A CA    1 
ATOM   432   C  C     . ASN A 1 590  ? 164.559 129.662 122.516 1.00 145.42 ?  462  ASN A C     1 
ATOM   433   O  O     . ASN A 1 590  ? 163.326 129.651 122.444 1.00 138.82 ?  462  ASN A O     1 
ATOM   434   C  CB    . ASN A 1 590  ? 164.547 131.704 124.018 1.00 143.48 ?  462  ASN A CB    1 
ATOM   435   C  CG    . ASN A 1 590  ? 163.209 131.485 124.727 1.00 135.63 ?  462  ASN A CG    1 
ATOM   436   O  OD1   . ASN A 1 590  ? 163.159 131.339 125.950 1.00 141.02 ?  462  ASN A OD1   1 
ATOM   437   N  ND2   . ASN A 1 590  ? 162.121 131.492 123.961 1.00 133.90 ?  462  ASN A ND2   1 
ATOM   438   N  N     . GLU A 1 591  ? 165.317 129.027 121.620 1.00 144.19 ?  463  GLU A N     1 
ATOM   439   C  CA    . GLU A 1 591  ? 164.738 128.194 120.562 1.00 131.34 ?  463  GLU A CA    1 
ATOM   440   C  C     . GLU A 1 591  ? 164.719 126.730 120.995 1.00 115.99 ?  463  GLU A C     1 
ATOM   441   O  O     . GLU A 1 591  ? 165.260 125.847 120.326 1.00 111.50 ?  463  GLU A O     1 
ATOM   442   C  CB    . GLU A 1 591  ? 165.509 128.361 119.253 1.00 129.62 ?  463  GLU A CB    1 
ATOM   443   C  CG    . GLU A 1 591  ? 165.393 129.722 118.592 1.00 145.07 ?  463  GLU A CG    1 
ATOM   444   C  CD    . GLU A 1 591  ? 166.645 130.554 118.781 1.00 169.99 ?  463  GLU A CD    1 
ATOM   445   O  OE1   . GLU A 1 591  ? 167.551 130.099 119.511 1.00 152.21 ?  463  GLU A OE1   1 
ATOM   446   O  OE2   . GLU A 1 591  ? 166.722 131.663 118.212 1.00 293.39 -1 463  GLU A OE2   1 
ATOM   447   N  N     . HIS A 1 592  ? 164.074 126.486 122.138 1.00 117.50 ?  464  HIS A N     1 
ATOM   448   C  CA    . HIS A 1 592  ? 164.017 125.140 122.694 1.00 115.70 ?  464  HIS A CA    1 
ATOM   449   C  C     . HIS A 1 592  ? 163.396 124.148 121.719 1.00 115.96 ?  464  HIS A C     1 
ATOM   450   O  O     . HIS A 1 592  ? 163.661 122.946 121.818 1.00 118.63 ?  464  HIS A O     1 
ATOM   451   C  CB    . HIS A 1 592  ? 163.209 125.129 124.000 1.00 127.57 ?  464  HIS A CB    1 
ATOM   452   C  CG    . HIS A 1 592  ? 163.728 126.052 125.065 1.00 132.29 ?  464  HIS A CG    1 
ATOM   453   N  ND1   . HIS A 1 592  ? 163.760 127.422 124.916 1.00 137.07 ?  464  HIS A ND1   1 
ATOM   454   C  CD2   . HIS A 1 592  ? 164.213 125.797 126.304 1.00 144.86 ?  464  HIS A CD2   1 
ATOM   455   C  CE1   . HIS A 1 592  ? 164.249 127.971 126.015 1.00 151.20 ?  464  HIS A CE1   1 
ATOM   456   N  NE2   . HIS A 1 592  ? 164.533 127.007 126.871 1.00 160.35 ?  464  HIS A NE2   1 
ATOM   457   N  N     . ARG A 1 593  ? 162.579 124.630 120.779 1.00 112.80 ?  465  ARG A N     1 
ATOM   458   C  CA    . ARG A 1 593  ? 161.842 123.737 119.889 1.00 109.05 ?  465  ARG A CA    1 
ATOM   459   C  C     . ARG A 1 593  ? 162.779 122.970 118.964 1.00 113.45 ?  465  ARG A C     1 
ATOM   460   O  O     . ARG A 1 593  ? 162.636 121.754 118.779 1.00 120.55 ?  465  ARG A O     1 
ATOM   461   C  CB    . ARG A 1 593  ? 160.819 124.535 119.080 1.00 99.25  ?  465  ARG A CB    1 
ATOM   462   C  CG    . ARG A 1 593  ? 160.064 125.555 119.908 1.00 95.75  ?  465  ARG A CG    1 
ATOM   463   C  CD    . ARG A 1 593  ? 158.918 126.169 119.138 1.00 82.08  ?  465  ARG A CD    1 
ATOM   464   N  NE    . ARG A 1 593  ? 158.176 127.100 119.978 1.00 93.46  ?  465  ARG A NE    1 
ATOM   465   C  CZ    . ARG A 1 593  ? 157.010 127.636 119.648 1.00 100.85 ?  465  ARG A CZ    1 
ATOM   466   N  NH1   . ARG A 1 593  ? 156.439 127.327 118.494 1.00 88.26  ?  465  ARG A NH1   1 
ATOM   467   N  NH2   . ARG A 1 593  ? 156.406 128.469 120.478 1.00 118.45 ?  465  ARG A NH2   1 
ATOM   468   N  N     . GLN A 1 594  ? 163.738 123.667 118.356 1.00 110.34 ?  466  GLN A N     1 
ATOM   469   C  CA    . GLN A 1 594  ? 164.669 122.985 117.467 1.00 112.97 ?  466  GLN A CA    1 
ATOM   470   C  C     . GLN A 1 594  ? 165.588 122.041 118.235 1.00 117.71 ?  466  GLN A C     1 
ATOM   471   O  O     . GLN A 1 594  ? 165.966 120.986 117.713 1.00 118.33 ?  466  GLN A O     1 
ATOM   472   C  CB    . GLN A 1 594  ? 165.467 124.011 116.664 1.00 108.13 ?  466  GLN A CB    1 
ATOM   473   C  CG    . GLN A 1 594  ? 164.654 125.227 116.238 1.00 107.04 ?  466  GLN A CG    1 
ATOM   474   C  CD    . GLN A 1 594  ? 165.224 125.896 115.002 1.00 108.07 ?  466  GLN A CD    1 
ATOM   475   O  OE1   . GLN A 1 594  ? 166.348 125.608 114.596 1.00 105.03 ?  466  GLN A OE1   1 
ATOM   476   N  NE2   . GLN A 1 594  ? 164.441 126.775 114.384 1.00 110.76 ?  466  GLN A NE2   1 
ATOM   477   N  N     . ALA A 1 595  ? 165.923 122.379 119.482 1.00 118.97 ?  467  ALA A N     1 
ATOM   478   C  CA    . ALA A 1 595  ? 166.702 121.467 120.313 1.00 118.27 ?  467  ALA A CA    1 
ATOM   479   C  C     . ALA A 1 595  ? 165.901 120.216 120.666 1.00 118.97 ?  467  ALA A C     1 
ATOM   480   O  O     . ALA A 1 595  ? 166.457 119.112 120.734 1.00 117.52 ?  467  ALA A O     1 
ATOM   481   C  CB    . ALA A 1 595  ? 167.166 122.187 121.579 1.00 115.26 ?  467  ALA A CB    1 
ATOM   482   N  N     . ASP A 1 596  ? 164.589 120.368 120.879 1.00 121.77 ?  468  ASP A N     1 
ATOM   483   C  CA    . ASP A 1 596  ? 163.738 119.211 121.147 1.00 120.19 ?  468  ASP A CA    1 
ATOM   484   C  C     . ASP A 1 596  ? 163.605 118.324 119.916 1.00 116.05 ?  468  ASP A C     1 
ATOM   485   O  O     . ASP A 1 596  ? 163.602 117.094 120.029 1.00 111.83 ?  468  ASP A O     1 
ATOM   486   C  CB    . ASP A 1 596  ? 162.357 119.666 121.615 1.00 128.47 ?  468  ASP A CB    1 
ATOM   487   C  CG    . ASP A 1 596  ? 162.398 120.423 122.929 1.00 149.98 ?  468  ASP A CG    1 
ATOM   488   O  OD1   . ASP A 1 596  ? 163.505 120.646 123.463 1.00 136.75 ?  468  ASP A OD1   1 
ATOM   489   O  OD2   . ASP A 1 596  ? 161.315 120.802 123.426 1.00 273.44 -1 468  ASP A OD2   1 
ATOM   490   N  N     . GLU A 1 597  ? 163.475 118.932 118.735 1.00 118.37 ?  469  GLU A N     1 
ATOM   491   C  CA    . GLU A 1 597  ? 163.453 118.148 117.501 1.00 120.59 ?  469  GLU A CA    1 
ATOM   492   C  C     . GLU A 1 597  ? 164.765 117.406 117.298 1.00 118.44 ?  469  GLU A C     1 
ATOM   493   O  O     . GLU A 1 597  ? 164.778 116.251 116.851 1.00 112.87 ?  469  GLU A O     1 
ATOM   494   C  CB    . GLU A 1 597  ? 163.189 119.056 116.309 1.00 135.66 ?  469  GLU A CB    1 
ATOM   495   C  CG    . GLU A 1 597  ? 161.851 119.734 116.335 1.00 136.89 ?  469  GLU A CG    1 
ATOM   496   C  CD    . GLU A 1 597  ? 161.442 120.211 114.960 1.00 149.03 ?  469  GLU A CD    1 
ATOM   497   O  OE1   . GLU A 1 597  ? 162.303 120.223 114.054 1.00 139.17 ?  469  GLU A OE1   1 
ATOM   498   O  OE2   . GLU A 1 597  ? 160.262 120.578 114.784 1.00 203.59 -1 469  GLU A OE2   1 
ATOM   499   N  N     . LEU A 1 598  ? 165.884 118.069 117.597 1.00 121.15 ?  470  LEU A N     1 
ATOM   500   C  CA    . LEU A 1 598  ? 167.183 117.419 117.498 1.00 119.04 ?  470  LEU A CA    1 
ATOM   501   C  C     . LEU A 1 598  ? 167.270 116.222 118.435 1.00 117.18 ?  470  LEU A C     1 
ATOM   502   O  O     . LEU A 1 598  ? 167.726 115.144 118.036 1.00 113.69 ?  470  LEU A O     1 
ATOM   503   C  CB    . LEU A 1 598  ? 168.286 118.426 117.816 1.00 118.15 ?  470  LEU A CB    1 
ATOM   504   C  CG    . LEU A 1 598  ? 169.717 118.106 117.376 1.00 109.37 ?  470  LEU A CG    1 
ATOM   505   C  CD1   . LEU A 1 598  ? 169.892 118.227 115.873 1.00 105.72 ?  470  LEU A CD1   1 
ATOM   506   C  CD2   . LEU A 1 598  ? 170.731 118.960 118.131 1.00 105.12 ?  470  LEU A CD2   1 
ATOM   507   N  N     . GLU A 1 599  ? 166.832 116.392 119.687 1.00 117.59 ?  471  GLU A N     1 
ATOM   508   C  CA    . GLU A 1 599  ? 166.882 115.294 120.647 1.00 120.50 ?  471  GLU A CA    1 
ATOM   509   C  C     . GLU A 1 599  ? 165.900 114.181 120.297 1.00 109.52 ?  471  GLU A C     1 
ATOM   510   O  O     . GLU A 1 599  ? 166.119 113.026 120.683 1.00 104.83 ?  471  GLU A O     1 
ATOM   511   C  CB    . GLU A 1 599  ? 166.611 115.821 122.061 1.00 129.79 ?  471  GLU A CB    1 
ATOM   512   C  CG    . GLU A 1 599  ? 166.874 114.808 123.169 1.00 151.82 ?  471  GLU A CG    1 
ATOM   513   C  CD    . GLU A 1 599  ? 166.846 115.429 124.557 1.00 187.24 ?  471  GLU A CD    1 
ATOM   514   O  OE1   . GLU A 1 599  ? 166.831 116.675 124.654 1.00 161.29 ?  471  GLU A OE1   1 
ATOM   515   O  OE2   . GLU A 1 599  ? 166.836 114.670 125.552 1.00 363.10 -1 471  GLU A OE2   1 
ATOM   516   N  N     . ALA A 1 600  ? 164.830 114.507 119.573 1.00 104.89 ?  472  ALA A N     1 
ATOM   517   C  CA    . ALA A 1 600  ? 163.915 113.508 119.037 1.00 95.89  ?  472  ALA A CA    1 
ATOM   518   C  C     . ALA A 1 600  ? 164.436 112.868 117.757 1.00 97.54  ?  472  ALA A C     1 
ATOM   519   O  O     . ALA A 1 600  ? 163.844 111.894 117.281 1.00 90.58  ?  472  ALA A O     1 
ATOM   520   C  CB    . ALA A 1 600  ? 162.549 114.142 118.774 1.00 88.52  ?  472  ALA A CB    1 
ATOM   521   N  N     . MET A 1 601  ? 165.487 113.432 117.159 1.00 103.64 ?  473  MET A N     1 
ATOM   522   C  CA    . MET A 1 601  ? 166.178 112.765 116.059 1.00 103.03 ?  473  MET A CA    1 
ATOM   523   C  C     . MET A 1 601  ? 167.295 111.859 116.567 1.00 99.15  ?  473  MET A C     1 
ATOM   524   O  O     . MET A 1 601  ? 167.417 110.711 116.127 1.00 94.54  ?  473  MET A O     1 
ATOM   525   C  CB    . MET A 1 601  ? 166.746 113.801 115.087 1.00 103.15 ?  473  MET A CB    1 
ATOM   526   C  CG    . MET A 1 601  ? 167.495 113.204 113.902 1.00 103.38 ?  473  MET A CG    1 
ATOM   527   S  SD    . MET A 1 601  ? 168.142 114.458 112.777 1.00 113.02 ?  473  MET A SD    1 
ATOM   528   C  CE    . MET A 1 601  ? 169.292 115.325 113.835 1.00 105.77 ?  473  MET A CE    1 
ATOM   529   N  N     . MET A 1 602  ? 168.122 112.360 117.486 1.00 103.34 ?  474  MET A N     1 
ATOM   530   C  CA    . MET A 1 602  ? 169.210 111.581 118.081 1.00 102.89 ?  474  MET A CA    1 
ATOM   531   C  C     . MET A 1 602  ? 168.602 110.540 119.007 1.00 101.85 ?  474  MET A C     1 
ATOM   532   O  O     . MET A 1 602  ? 168.348 110.793 120.185 1.00 99.62  ?  474  MET A O     1 
ATOM   533   C  CB    . MET A 1 602  ? 170.193 112.480 118.827 1.00 100.85 ?  474  MET A CB    1 
ATOM   534   C  CG    . MET A 1 602  ? 170.766 113.649 118.029 1.00 100.11 ?  474  MET A CG    1 
ATOM   535   S  SD    . MET A 1 602  ? 171.766 113.147 116.607 1.00 102.73 ?  474  MET A SD    1 
ATOM   536   C  CE    . MET A 1 602  ? 173.050 112.183 117.410 1.00 107.73 ?  474  MET A CE    1 
ATOM   537   N  N     . GLN A 1 603  ? 168.376 109.348 118.457 1.00 102.37 ?  475  GLN A N     1 
ATOM   538   C  CA    . GLN A 1 603  ? 167.765 108.240 119.184 1.00 104.51 ?  475  GLN A CA    1 
ATOM   539   C  C     . GLN A 1 603  ? 166.407 108.655 119.744 1.00 100.77 ?  475  GLN A C     1 
ATOM   540   O  O     . GLN A 1 603  ? 166.105 108.464 120.924 1.00 93.27  ?  475  GLN A O     1 
ATOM   541   C  CB    . GLN A 1 603  ? 168.690 107.731 120.294 1.00 106.74 ?  475  GLN A CB    1 
ATOM   542   C  CG    . GLN A 1 603  ? 170.151 107.576 119.876 1.00 106.94 ?  475  GLN A CG    1 
ATOM   543   C  CD    . GLN A 1 603  ? 171.061 107.239 121.043 1.00 103.37 ?  475  GLN A CD    1 
ATOM   544   O  OE1   . GLN A 1 603  ? 170.595 106.953 122.147 1.00 100.02 ?  475  GLN A OE1   1 
ATOM   545   N  NE2   . GLN A 1 603  ? 172.369 107.283 120.806 1.00 100.47 ?  475  GLN A NE2   1 
ATOM   546   N  N     . GLY A 1 604  ? 165.577 109.228 118.876 1.00 126.90 ?  476  GLY A N     1 
ATOM   547   C  CA    . GLY A 1 604  ? 164.292 109.744 119.315 1.00 93.90  ?  476  GLY A CA    1 
ATOM   548   C  C     . GLY A 1 604  ? 163.319 108.623 119.646 1.00 80.45  ?  476  GLY A C     1 
ATOM   549   O  O     . GLY A 1 604  ? 163.289 107.582 118.989 1.00 75.52  ?  476  GLY A O     1 
ATOM   550   N  N     . ARG A 1 605  ? 162.512 108.860 120.688 1.00 78.03  ?  477  ARG A N     1 
ATOM   551   C  CA    . ARG A 1 605  ? 161.589 107.846 121.194 1.00 77.61  ?  477  ARG A CA    1 
ATOM   552   C  C     . ARG A 1 605  ? 160.729 107.236 120.092 1.00 73.46  ?  477  ARG A C     1 
ATOM   553   O  O     . ARG A 1 605  ? 160.700 106.011 119.924 1.00 69.67  ?  477  ARG A O     1 
ATOM   554   C  CB    . ARG A 1 605  ? 160.719 108.436 122.309 1.00 69.12  ?  477  ARG A CB    1 
ATOM   555   C  CG    . ARG A 1 605  ? 161.338 109.592 123.109 1.00 67.98  ?  477  ARG A CG    1 
ATOM   556   C  CD    . ARG A 1 605  ? 162.485 109.100 123.998 1.00 72.08  ?  477  ARG A CD    1 
ATOM   557   N  NE    . ARG A 1 605  ? 163.797 109.149 123.358 1.00 73.78  ?  477  ARG A NE    1 
ATOM   558   C  CZ    . ARG A 1 605  ? 164.900 108.591 123.852 1.00 71.06  ?  477  ARG A CZ    1 
ATOM   559   N  NH1   . ARG A 1 605  ? 166.043 108.691 123.189 1.00 77.43  ?  477  ARG A NH1   1 
ATOM   560   N  NH2   . ARG A 1 605  ? 164.866 107.928 125.002 1.00 64.46  ?  477  ARG A NH2   1 
ATOM   561   N  N     . GLY A 1 606  ? 160.026 108.064 119.327 1.00 67.24  ?  478  GLY A N     1 
ATOM   562   C  CA    . GLY A 1 606  ? 159.156 107.506 118.308 1.00 65.69  ?  478  GLY A CA    1 
ATOM   563   C  C     . GLY A 1 606  ? 158.918 108.337 117.064 1.00 62.51  ?  478  GLY A C     1 
ATOM   564   O  O     . GLY A 1 606  ? 158.488 109.491 117.126 1.00 55.17  ?  478  GLY A O     1 
ATOM   565   N  N     . PHE A 1 607  ? 159.238 107.728 115.921 1.00 68.19  ?  479  PHE A N     1 
ATOM   566   C  CA    . PHE A 1 607  ? 158.708 108.167 114.636 1.00 67.56  ?  479  PHE A CA    1 
ATOM   567   C  C     . PHE A 1 607  ? 157.201 107.937 114.571 1.00 64.33  ?  479  PHE A C     1 
ATOM   568   O  O     . PHE A 1 607  ? 156.433 108.848 114.241 1.00 53.34  ?  479  PHE A O     1 
ATOM   569   C  CB    . PHE A 1 607  ? 159.438 107.431 113.506 1.00 70.43  ?  479  PHE A CB    1 
ATOM   570   C  CG    . PHE A 1 607  ? 159.864 106.013 113.861 1.00 76.96  ?  479  PHE A CG    1 
ATOM   571   C  CD1   . PHE A 1 607  ? 158.969 104.955 113.788 1.00 73.52  ?  479  PHE A CD1   1 
ATOM   572   C  CD2   . PHE A 1 607  ? 161.170 105.742 114.243 1.00 78.22  ?  479  PHE A CD2   1 
ATOM   573   C  CE1   . PHE A 1 607  ? 159.365 103.659 114.108 1.00 69.16  ?  479  PHE A CE1   1 
ATOM   574   C  CE2   . PHE A 1 607  ? 161.566 104.446 114.560 1.00 77.99  ?  479  PHE A CE2   1 
ATOM   575   C  CZ    . PHE A 1 607  ? 160.663 103.410 114.490 1.00 72.97  ?  479  PHE A CZ    1 
ATOM   576   N  N     . GLY A 1 608  ? 156.760 106.716 114.899 1.00 66.97  ?  480  GLY A N     1 
ATOM   577   C  CA    . GLY A 1 608  ? 155.356 106.376 114.943 1.00 58.92  ?  480  GLY A CA    1 
ATOM   578   C  C     . GLY A 1 608  ? 154.954 105.910 116.335 1.00 55.59  ?  480  GLY A C     1 
ATOM   579   O  O     . GLY A 1 608  ? 155.792 105.507 117.148 1.00 54.08  ?  480  GLY A O     1 
ATOM   580   N  N     . LEU A 1 609  ? 153.648 105.939 116.587 1.00 51.80  ?  481  LEU A N     1 
ATOM   581   C  CA    . LEU A 1 609  ? 153.091 105.758 117.920 1.00 50.84  ?  481  LEU A CA    1 
ATOM   582   C  C     . LEU A 1 609  ? 152.649 104.315 118.145 1.00 46.24  ?  481  LEU A C     1 
ATOM   583   O  O     . LEU A 1 609  ? 152.373 103.564 117.207 1.00 43.58  ?  481  LEU A O     1 
ATOM   584   C  CB    . LEU A 1 609  ? 151.905 106.709 118.141 1.00 43.80  ?  481  LEU A CB    1 
ATOM   585   C  CG    . LEU A 1 609  ? 152.268 108.189 118.237 1.00 40.45  ?  481  LEU A CG    1 
ATOM   586   C  CD1   . LEU A 1 609  ? 151.048 109.079 118.453 1.00 32.33  ?  481  LEU A CD1   1 
ATOM   587   C  CD2   . LEU A 1 609  ? 153.271 108.374 119.341 1.00 38.12  ?  481  LEU A CD2   1 
ATOM   588   N  N     . HIS A 1 610  ? 152.585 103.940 119.415 1.00 41.66  ?  482  HIS A N     1 
ATOM   589   C  CA    . HIS A 1 610  ? 152.066 102.632 119.768 1.00 37.05  ?  482  HIS A CA    1 
ATOM   590   C  C     . HIS A 1 610  ? 150.554 102.610 119.554 1.00 35.42  ?  482  HIS A C     1 
ATOM   591   O  O     . HIS A 1 610  ? 149.887 103.623 119.768 1.00 35.66  ?  482  HIS A O     1 
ATOM   592   C  CB    . HIS A 1 610  ? 152.411 102.301 121.219 1.00 36.15  ?  482  HIS A CB    1 
ATOM   593   C  CG    . HIS A 1 610  ? 152.146 100.879 121.592 1.00 44.23  ?  482  HIS A CG    1 
ATOM   594   N  ND1   . HIS A 1 610  ? 150.884 100.412 121.894 1.00 44.52  ?  482  HIS A ND1   1 
ATOM   595   C  CD2   . HIS A 1 610  ? 152.976 99.814  121.680 1.00 48.38  ?  482  HIS A CD2   1 
ATOM   596   C  CE1   . HIS A 1 610  ? 150.953 99.123  122.175 1.00 49.12  ?  482  HIS A CE1   1 
ATOM   597   N  NE2   . HIS A 1 610  ? 152.211 98.736  122.052 1.00 51.89  ?  482  HIS A NE2   1 
ATOM   598   N  N     . PRO A 1 611  ? 149.990 101.489 119.099 1.00 34.87  ?  483  PRO A N     1 
ATOM   599   C  CA    . PRO A 1 611  ? 148.538 101.455 118.853 1.00 33.42  ?  483  PRO A CA    1 
ATOM   600   C  C     . PRO A 1 611  ? 147.695 101.832 120.058 1.00 36.56  ?  483  PRO A C     1 
ATOM   601   O  O     . PRO A 1 611  ? 146.562 102.307 119.896 1.00 37.48  ?  483  PRO A O     1 
ATOM   602   C  CB    . PRO A 1 611  ? 148.295 100.002 118.424 1.00 33.42  ?  483  PRO A CB    1 
ATOM   603   C  CG    . PRO A 1 611  ? 149.513 99.256  118.856 1.00 33.69  ?  483  PRO A CG    1 
ATOM   604   C  CD    . PRO A 1 611  ? 150.632 100.221 118.726 1.00 38.11  ?  483  PRO A CD    1 
ATOM   605   N  N     . ALA A 1 612  ? 148.220 101.643 121.267 1.00 37.67  ?  484  ALA A N     1 
ATOM   606   C  CA    . ALA A 1 612  ? 147.448 101.922 122.472 1.00 42.44  ?  484  ALA A CA    1 
ATOM   607   C  C     . ALA A 1 612  ? 147.104 103.407 122.587 1.00 44.62  ?  484  ALA A C     1 
ATOM   608   O  O     . ALA A 1 612  ? 145.925 103.790 122.583 1.00 43.19  ?  484  ALA A O     1 
ATOM   609   C  CB    . ALA A 1 612  ? 148.231 101.444 123.693 1.00 43.26  ?  484  ALA A CB    1 
ATOM   610   N  N     . VAL A 1 613  ? 148.128 104.258 122.712 1.00 41.87  ?  485  VAL A N     1 
ATOM   611   C  CA    . VAL A 1 613  ? 147.897 105.695 122.826 1.00 36.73  ?  485  VAL A CA    1 
ATOM   612   C  C     . VAL A 1 613  ? 147.127 106.206 121.617 1.00 35.13  ?  485  VAL A C     1 
ATOM   613   O  O     . VAL A 1 613  ? 146.406 107.210 121.699 1.00 38.71  ?  485  VAL A O     1 
ATOM   614   C  CB    . VAL A 1 613  ? 149.239 106.428 123.009 1.00 34.39  ?  485  VAL A CB    1 
ATOM   615   C  CG1   . VAL A 1 613  ? 149.009 107.874 123.390 1.00 33.03  ?  485  VAL A CG1   1 
ATOM   616   C  CG2   . VAL A 1 613  ? 150.092 105.740 124.066 1.00 37.23  ?  485  VAL A CG2   1 
ATOM   617   N  N     . CYS A 1 614  ? 147.253 105.521 120.482 1.00 38.35  ?  486  CYS A N     1 
ATOM   618   C  CA    . CYS A 1 614  ? 146.457 105.869 119.313 1.00 43.74  ?  486  CYS A CA    1 
ATOM   619   C  C     . CYS A 1 614  ? 144.973 105.688 119.590 1.00 39.10  ?  486  CYS A C     1 
ATOM   620   O  O     . CYS A 1 614  ? 144.165 106.589 119.340 1.00 36.65  ?  486  CYS A O     1 
ATOM   621   C  CB    . CYS A 1 614  ? 146.879 105.014 118.124 1.00 51.88  ?  486  CYS A CB    1 
ATOM   622   S  SG    . CYS A 1 614  ? 145.760 105.164 116.719 1.00 107.54 ?  486  CYS A SG    1 
ATOM   623   N  N     . LEU A 1 615  ? 144.591 104.498 120.057 1.00 39.62  ?  487  LEU A N     1 
ATOM   624   C  CA    . LEU A 1 615  ? 143.200 104.278 120.431 1.00 48.74  ?  487  LEU A CA    1 
ATOM   625   C  C     . LEU A 1 615  ? 142.755 105.313 121.451 1.00 150.70 ?  487  LEU A C     1 
ATOM   626   O  O     . LEU A 1 615  ? 141.627 105.824 121.395 1.00 50.99  ?  487  LEU A O     1 
ATOM   627   C  CB    . LEU A 1 615  ? 143.032 102.869 120.986 1.00 48.74  ?  487  LEU A CB    1 
ATOM   628   C  CG    . LEU A 1 615  ? 141.644 102.524 121.522 1.00 52.20  ?  487  LEU A CG    1 
ATOM   629   C  CD1   . LEU A 1 615  ? 140.652 102.432 120.387 1.00 101.53 ?  487  LEU A CD1   1 
ATOM   630   C  CD2   . LEU A 1 615  ? 141.653 101.240 122.340 1.00 45.70  ?  487  LEU A CD2   1 
ATOM   631   N  N     . ALA A 1 616  ? 143.645 105.639 122.385 1.00 47.62  ?  488  ALA A N     1 
ATOM   632   C  CA    . ALA A 1 616  ? 143.346 106.649 123.392 1.00 39.62  ?  488  ALA A CA    1 
ATOM   633   C  C     . ALA A 1 616  ? 142.925 107.965 122.749 1.00 33.63  ?  488  ALA A C     1 
ATOM   634   O  O     . ALA A 1 616  ? 141.831 108.480 123.007 1.00 34.99  ?  488  ALA A O     1 
ATOM   635   C  CB    . ALA A 1 616  ? 144.562 106.845 124.290 1.00 42.12  ?  488  ALA A CB    1 
ATOM   636   N  N     . ILE A 1 617  ? 143.804 108.532 121.919 1.00 33.60  ?  489  ILE A N     1 
ATOM   637   C  CA    . ILE A 1 617  ? 143.481 109.772 121.218 1.00 33.89  ?  489  ILE A CA    1 
ATOM   638   C  C     . ILE A 1 617  ? 142.185 109.615 120.442 1.00 32.51  ?  489  ILE A C     1 
ATOM   639   O  O     . ILE A 1 617  ? 141.331 110.510 120.435 1.00 31.14  ?  489  ILE A O     1 
ATOM   640   C  CB    . ILE A 1 617  ? 144.637 110.186 120.287 1.00 34.50  ?  489  ILE A CB    1 
ATOM   641   C  CG1   . ILE A 1 617  ? 145.915 110.476 121.080 1.00 38.54  ?  489  ILE A CG1   1 
ATOM   642   C  CG2   . ILE A 1 617  ? 144.265 111.418 119.483 1.00 26.12  ?  489  ILE A CG2   1 
ATOM   643   C  CD1   . ILE A 1 617  ? 147.098 110.970 120.228 1.00 32.90  ?  489  ILE A CD1   1 
ATOM   644   N  N     . ARG A 1 618  ? 142.012 108.457 119.794 1.00 32.60  ?  490  ARG A N     1 
ATOM   645   C  CA    . ARG A 1 618  ? 140.831 108.223 118.968 1.00 33.12  ?  490  ARG A CA    1 
ATOM   646   C  C     . ARG A 1 618  ? 139.550 108.422 119.763 1.00 30.51  ?  490  ARG A C     1 
ATOM   647   O  O     . ARG A 1 618  ? 138.612 109.076 119.292 1.00 28.26  ?  490  ARG A O     1 
ATOM   648   C  CB    . ARG A 1 618  ? 140.885 106.808 118.393 1.00 37.72  ?  490  ARG A CB    1 
ATOM   649   C  CG    . ARG A 1 618  ? 139.532 106.100 118.294 1.00 32.88  ?  490  ARG A CG    1 
ATOM   650   C  CD    . ARG A 1 618  ? 138.698 106.459 117.076 1.00 21.99  ?  490  ARG A CD    1 
ATOM   651   N  NE    . ARG A 1 618  ? 137.437 105.721 117.139 1.00 21.42  ?  490  ARG A NE    1 
ATOM   652   C  CZ    . ARG A 1 618  ? 137.334 104.393 117.187 1.00 21.83  ?  490  ARG A CZ    1 
ATOM   653   N  NH1   . ARG A 1 618  ? 138.416 103.627 117.189 1.00 22.48  ?  490  ARG A NH1   1 
ATOM   654   N  NH2   . ARG A 1 618  ? 136.132 103.829 117.250 1.00 25.87  ?  490  ARG A NH2   1 
ATOM   655   N  N     . VAL A 1 619  ? 139.487 107.864 120.969 1.00 31.84  ?  491  VAL A N     1 
ATOM   656   C  CA    . VAL A 1 619  ? 138.271 107.988 121.767 1.00 27.90  ?  491  VAL A CA    1 
ATOM   657   C  C     . VAL A 1 619  ? 138.284 109.243 122.613 1.00 23.86  ?  491  VAL A C     1 
ATOM   658   O  O     . VAL A 1 619  ? 137.284 109.953 122.678 1.00 22.17  ?  491  VAL A O     1 
ATOM   659   C  CB    . VAL A 1 619  ? 138.066 106.742 122.642 1.00 37.04  ?  491  VAL A CB    1 
ATOM   660   C  CG1   . VAL A 1 619  ? 137.700 105.560 121.780 1.00 73.06  ?  491  VAL A CG1   1 
ATOM   661   C  CG2   . VAL A 1 619  ? 139.297 106.449 123.472 1.00 87.30  ?  491  VAL A CG2   1 
ATOM   662   N  N     . ASN A 1 620  ? 139.403 109.553 123.247 1.00 26.28  ?  492  ASN A N     1 
ATOM   663   C  CA    . ASN A 1 620  ? 139.409 110.607 124.248 1.00 24.96  ?  492  ASN A CA    1 
ATOM   664   C  C     . ASN A 1 620  ? 139.154 111.992 123.653 1.00 23.27  ?  492  ASN A C     1 
ATOM   665   O  O     . ASN A 1 620  ? 139.297 112.990 124.368 1.00 21.92  ?  492  ASN A O     1 
ATOM   666   C  CB    . ASN A 1 620  ? 140.741 110.584 125.001 1.00 21.64  ?  492  ASN A CB    1 
ATOM   667   C  CG    . ASN A 1 620  ? 140.655 111.216 126.366 1.00 21.78  ?  492  ASN A CG    1 
ATOM   668   O  OD1   . ASN A 1 620  ? 140.475 110.527 127.369 1.00 22.37  ?  492  ASN A OD1   1 
ATOM   669   N  ND2   . ASN A 1 620  ? 140.793 112.536 126.417 1.00 17.38  ?  492  ASN A ND2   1 
ATOM   670   N  N     . THR A 1 621  ? 138.810 112.086 122.365 1.00 22.08  ?  493  THR A N     1 
ATOM   671   C  CA    . THR A 1 621  ? 138.442 113.358 121.759 1.00 18.69  ?  493  THR A CA    1 
ATOM   672   C  C     . THR A 1 621  ? 137.169 113.289 120.928 1.00 21.35  ?  493  THR A C     1 
ATOM   673   O  O     . THR A 1 621  ? 136.859 114.255 120.225 1.00 23.20  ?  493  THR A O     1 
ATOM   674   C  CB    . THR A 1 621  ? 139.566 113.900 120.874 1.00 17.13  ?  493  THR A CB    1 
ATOM   675   O  OG1   . THR A 1 621  ? 139.176 115.185 120.381 1.00 17.51  ?  493  THR A OG1   1 
ATOM   676   C  CG2   . THR A 1 621  ? 139.764 112.999 119.695 1.00 22.23  ?  493  THR A CG2   1 
ATOM   677   N  N     . PHE A 1 622  ? 136.441 112.181 120.969 1.00 22.28  ?  494  PHE A N     1 
ATOM   678   C  CA    . PHE A 1 622  ? 135.146 112.072 120.310 1.00 21.90  ?  494  PHE A CA    1 
ATOM   679   C  C     . PHE A 1 622  ? 135.266 112.228 118.795 1.00 17.05  ?  494  PHE A C     1 
ATOM   680   O  O     . PHE A 1 622  ? 134.510 112.968 118.167 1.00 17.04  ?  494  PHE A O     1 
ATOM   681   C  CB    . PHE A 1 622  ? 134.154 113.081 120.895 1.00 25.23  ?  494  PHE A CB    1 
ATOM   682   C  CG    . PHE A 1 622  ? 134.227 113.203 122.389 1.00 31.74  ?  494  PHE A CG    1 
ATOM   683   C  CD1   . PHE A 1 622  ? 133.985 112.120 123.194 1.00 27.10  ?  494  PHE A CD1   1 
ATOM   684   C  CD2   . PHE A 1 622  ? 134.535 114.408 122.981 1.00 46.43  ?  494  PHE A CD2   1 
ATOM   685   C  CE1   . PHE A 1 622  ? 134.049 112.234 124.562 1.00 33.97  ?  494  PHE A CE1   1 
ATOM   686   C  CE2   . PHE A 1 622  ? 134.596 114.524 124.349 1.00 48.94  ?  494  PHE A CE2   1 
ATOM   687   C  CZ    . PHE A 1 622  ? 134.354 113.433 125.135 1.00 43.25  ?  494  PHE A CZ    1 
ATOM   688   N  N     . LEU A 1 623  ? 136.229 111.546 118.199 1.00 16.61  ?  495  LEU A N     1 
ATOM   689   C  CA    . LEU A 1 623  ? 136.375 111.602 116.757 1.00 14.43  ?  495  LEU A CA    1 
ATOM   690   C  C     . LEU A 1 623  ? 135.655 110.439 116.100 1.00 13.62  ?  495  LEU A C     1 
ATOM   691   O  O     . LEU A 1 623  ? 135.504 109.362 116.684 1.00 14.77  ?  495  LEU A O     1 
ATOM   692   C  CB    . LEU A 1 623  ? 137.845 111.595 116.362 1.00 16.32  ?  495  LEU A CB    1 
ATOM   693   C  CG    . LEU A 1 623  ? 138.254 113.056 116.306 1.00 16.34  ?  495  LEU A CG    1 
ATOM   694   C  CD1   . LEU A 1 623  ? 139.733 113.217 115.980 1.00 14.31  ?  495  LEU A CD1   1 
ATOM   695   C  CD2   . LEU A 1 623  ? 137.360 113.799 115.354 1.00 16.68  ?  495  LEU A CD2   1 
ATOM   696   N  N     . SER A 1 624  ? 135.211 110.664 114.868 1.00 15.05  ?  496  SER A N     1 
ATOM   697   C  CA    . SER A 1 624  ? 134.588 109.587 114.120 1.00 19.57  ?  496  SER A CA    1 
ATOM   698   C  C     . SER A 1 624  ? 135.654 108.665 113.546 1.00 21.89  ?  496  SER A C     1 
ATOM   699   O  O     . SER A 1 624  ? 136.838 109.002 113.462 1.00 21.96  ?  496  SER A O     1 
ATOM   700   C  CB    . SER A 1 624  ? 133.705 110.126 112.988 1.00 19.93  ?  496  SER A CB    1 
ATOM   701   O  OG    . SER A 1 624  ? 134.371 110.082 111.735 1.00 16.27  ?  496  SER A OG    1 
ATOM   702   N  N     . CYS A 1 625  ? 135.214 107.478 113.143 1.00 25.68  ?  497  CYS A N     1 
ATOM   703   C  CA    . CYS A 1 625  ? 136.116 106.553 112.477 1.00 24.18  ?  497  CYS A CA    1 
ATOM   704   C  C     . CYS A 1 625  ? 136.445 107.066 111.082 1.00 22.39  ?  497  CYS A C     1 
ATOM   705   O  O     . CYS A 1 625  ? 137.600 107.017 110.643 1.00 23.88  ?  497  CYS A O     1 
ATOM   706   C  CB    . CYS A 1 625  ? 135.483 105.164 112.446 1.00 30.95  ?  497  CYS A CB    1 
ATOM   707   S  SG    . CYS A 1 625  ? 135.115 104.519 114.115 1.00 36.56  ?  497  CYS A SG    1 
ATOM   708   N  N     . SER A 1 626  ? 135.438 107.589 110.380 1.00 22.25  ?  498  SER A N     1 
ATOM   709   C  CA    . SER A 1 626  ? 135.684 108.317 109.141 1.00 21.40  ?  498  SER A CA    1 
ATOM   710   C  C     . SER A 1 626  ? 136.681 109.446 109.359 1.00 21.06  ?  498  SER A C     1 
ATOM   711   O  O     . SER A 1 626  ? 137.634 109.622 108.588 1.00 23.52  ?  498  SER A O     1 
ATOM   712   C  CB    . SER A 1 626  ? 134.369 108.881 108.611 1.00 23.44  ?  498  SER A CB    1 
ATOM   713   O  OG    . SER A 1 626  ? 133.850 109.855 109.502 1.00 21.33  ?  498  SER A OG    1 
ATOM   714   N  N     . GLN A 1 627  ? 136.431 110.254 110.388 1.00 18.69  ?  499  GLN A N     1 
ATOM   715   C  CA    . GLN A 1 627  ? 137.332 111.334 110.769 1.00 23.76  ?  499  GLN A CA    1 
ATOM   716   C  C     . GLN A 1 627  ? 138.765 110.843 110.918 1.00 18.55  ?  499  GLN A C     1 
ATOM   717   O  O     . GLN A 1 627  ? 139.702 111.393 110.321 1.00 16.89  ?  499  GLN A O     1 
ATOM   718   C  CB    . GLN A 1 627  ? 136.842 111.940 112.082 1.00 18.56  ?  499  GLN A CB    1 
ATOM   719   C  CG    . GLN A 1 627  ? 135.675 112.876 111.957 1.00 18.52  ?  499  GLN A CG    1 
ATOM   720   C  CD    . GLN A 1 627  ? 136.060 114.268 112.364 1.00 17.06  ?  499  GLN A CD    1 
ATOM   721   O  OE1   . GLN A 1 627  ? 137.233 114.635 112.298 1.00 15.95  ?  499  GLN A OE1   1 
ATOM   722   N  NE2   . GLN A 1 627  ? 135.080 115.063 112.776 1.00 16.92  ?  499  GLN A NE2   1 
ATOM   723   N  N     . TYR A 1 628  ? 138.949 109.831 111.766 1.00 17.77  ?  500  TYR A N     1 
ATOM   724   C  CA    . TYR A 1 628  ? 140.288 109.340 112.055 1.00 17.70  ?  500  TYR A CA    1 
ATOM   725   C  C     . TYR A 1 628  ? 140.965 108.827 110.792 1.00 20.92  ?  500  TYR A C     1 
ATOM   726   O  O     . TYR A 1 628  ? 142.139 109.119 110.553 1.00 18.67  ?  500  TYR A O     1 
ATOM   727   C  CB    . TYR A 1 628  ? 140.229 108.255 113.133 1.00 14.53  ?  500  TYR A CB    1 
ATOM   728   C  CG    . TYR A 1 628  ? 141.589 107.736 113.541 1.00 16.27  ?  500  TYR A CG    1 
ATOM   729   C  CD1   . TYR A 1 628  ? 142.371 108.410 114.457 1.00 15.69  ?  500  TYR A CD1   1 
ATOM   730   C  CD2   . TYR A 1 628  ? 142.092 106.575 112.990 1.00 16.76  ?  500  TYR A CD2   1 
ATOM   731   C  CE1   . TYR A 1 628  ? 143.616 107.938 114.812 1.00 19.40  ?  500  TYR A CE1   1 
ATOM   732   C  CE2   . TYR A 1 628  ? 143.328 106.099 113.339 1.00 21.15  ?  500  TYR A CE2   1 
ATOM   733   C  CZ    . TYR A 1 628  ? 144.088 106.783 114.249 1.00 21.21  ?  500  TYR A CZ    1 
ATOM   734   O  OH    . TYR A 1 628  ? 145.325 106.311 114.600 1.00 32.89  ?  500  TYR A OH    1 
ATOM   735   N  N     . HIS A 1 629  ? 140.232 108.082 109.961 1.00 24.44  ?  501  HIS A N     1 
ATOM   736   C  CA    . HIS A 1 629  ? 140.807 107.553 108.724 1.00 20.07  ?  501  HIS A CA    1 
ATOM   737   C  C     . HIS A 1 629  ? 141.242 108.667 107.780 1.00 14.53  ?  501  HIS A C     1 
ATOM   738   O  O     . HIS A 1 629  ? 142.307 108.582 107.151 1.00 28.17  ?  501  HIS A O     1 
ATOM   739   C  CB    . HIS A 1 629  ? 139.793 106.634 108.044 1.00 22.98  ?  501  HIS A CB    1 
ATOM   740   C  CG    . HIS A 1 629  ? 140.247 106.079 106.729 1.00 20.96  ?  501  HIS A CG    1 
ATOM   741   N  ND1   . HIS A 1 629  ? 141.444 105.415 106.570 1.00 23.91  ?  501  HIS A ND1   1 
ATOM   742   C  CD2   . HIS A 1 629  ? 139.659 106.099 105.507 1.00 23.67  ?  501  HIS A CD2   1 
ATOM   743   C  CE1   . HIS A 1 629  ? 141.570 105.045 105.308 1.00 28.25  ?  501  HIS A CE1   1 
ATOM   744   N  NE2   . HIS A 1 629  ? 140.502 105.448 104.642 1.00 26.46  ?  501  HIS A NE2   1 
ATOM   745   N  N     . LYS A 1 630  ? 140.412 109.704 107.641 1.00 29.15  ?  502  LYS A N     1 
ATOM   746   C  CA    . LYS A 1 630  ? 140.772 110.833 106.791 1.00 19.90  ?  502  LYS A CA    1 
ATOM   747   C  C     . LYS A 1 630  ? 142.037 111.510 107.300 1.00 19.08  ?  502  LYS A C     1 
ATOM   748   O  O     . LYS A 1 630  ? 143.008 111.688 106.550 1.00 20.12  ?  502  LYS A O     1 
ATOM   749   C  CB    . LYS A 1 630  ? 139.608 111.823 106.730 1.00 19.01  ?  502  LYS A CB    1 
ATOM   750   C  CG    . LYS A 1 630  ? 139.720 112.898 105.645 1.00 15.91  ?  502  LYS A CG    1 
ATOM   751   C  CD    . LYS A 1 630  ? 138.363 113.294 105.083 1.00 10.75  ?  502  LYS A CD    1 
ATOM   752   C  CE    . LYS A 1 630  ? 137.440 113.775 106.183 1.00 18.38  ?  502  LYS A CE    1 
ATOM   753   N  NZ    . LYS A 1 630  ? 136.102 114.095 105.635 1.00 12.24  ?  502  LYS A NZ    1 
ATOM   754   N  N     . MET A 1 631  ? 142.028 111.913 108.577 1.00 23.20  ?  503  MET A N     1 
ATOM   755   C  CA    . MET A 1 631  ? 143.212 112.507 109.190 1.00 20.72  ?  503  MET A CA    1 
ATOM   756   C  C     . MET A 1 631  ? 144.429 111.627 108.983 1.00 18.49  ?  503  MET A C     1 
ATOM   757   O  O     . MET A 1 631  ? 145.543 112.120 108.759 1.00 19.08  ?  503  MET A O     1 
ATOM   758   C  CB    . MET A 1 631  ? 142.986 112.702 110.683 1.00 18.19  ?  503  MET A CB    1 
ATOM   759   C  CG    . MET A 1 631  ? 144.225 113.207 111.419 1.00 21.48  ?  503  MET A CG    1 
ATOM   760   S  SD    . MET A 1 631  ? 144.170 112.903 113.199 1.00 18.26  ?  503  MET A SD    1 
ATOM   761   C  CE    . MET A 1 631  ? 142.553 113.545 113.610 1.00 14.15  ?  503  MET A CE    1 
ATOM   762   N  N     . TYR A 1 632  ? 144.226 110.314 109.062 1.00 18.38  ?  504  TYR A N     1 
ATOM   763   C  CA    . TYR A 1 632  ? 145.322 109.363 108.972 1.00 21.60  ?  504  TYR A CA    1 
ATOM   764   C  C     . TYR A 1 632  ? 145.961 109.403 107.595 1.00 24.17  ?  504  TYR A C     1 
ATOM   765   O  O     . TYR A 1 632  ? 147.175 109.604 107.463 1.00 25.30  ?  504  TYR A O     1 
ATOM   766   C  CB    . TYR A 1 632  ? 144.806 107.960 109.277 1.00 23.53  ?  504  TYR A CB    1 
ATOM   767   C  CG    . TYR A 1 632  ? 145.862 106.891 109.157 1.00 29.77  ?  504  TYR A CG    1 
ATOM   768   C  CD1   . TYR A 1 632  ? 146.660 106.549 110.236 1.00 32.99  ?  504  TYR A CD1   1 
ATOM   769   C  CD2   . TYR A 1 632  ? 146.056 106.219 107.966 1.00 33.02  ?  504  TYR A CD2   1 
ATOM   770   C  CE1   . TYR A 1 632  ? 147.625 105.576 110.124 1.00 35.50  ?  504  TYR A CE1   1 
ATOM   771   C  CE2   . TYR A 1 632  ? 147.023 105.246 107.845 1.00 42.02  ?  504  TYR A CE2   1 
ATOM   772   C  CZ    . TYR A 1 632  ? 147.803 104.926 108.927 1.00 39.49  ?  504  TYR A CZ    1 
ATOM   773   O  OH    . TYR A 1 632  ? 148.760 103.951 108.808 1.00 40.71  ?  504  TYR A OH    1 
ATOM   774   N  N     . ARG A 1 633  ? 145.152 109.180 106.556 1.00 24.19  ?  505  ARG A N     1 
ATOM   775   C  CA    . ARG A 1 633  ? 145.651 109.312 105.193 1.00 24.50  ?  505  ARG A CA    1 
ATOM   776   C  C     . ARG A 1 633  ? 146.383 110.637 105.011 1.00 22.63  ?  505  ARG A C     1 
ATOM   777   O  O     . ARG A 1 633  ? 147.519 110.677 104.511 1.00 23.89  ?  505  ARG A O     1 
ATOM   778   C  CB    . ARG A 1 633  ? 144.503 109.202 104.196 1.00 24.00  ?  505  ARG A CB    1 
ATOM   779   C  CG    . ARG A 1 633  ? 144.797 109.846 102.841 1.00 33.32  ?  505  ARG A CG    1 
ATOM   780   C  CD    . ARG A 1 633  ? 143.624 109.684 101.922 1.00 29.90  ?  505  ARG A CD    1 
ATOM   781   N  NE    . ARG A 1 633  ? 143.296 108.270 101.810 1.00 38.19  ?  505  ARG A NE    1 
ATOM   782   C  CZ    . ARG A 1 633  ? 142.111 107.802 101.447 1.00 48.23  ?  505  ARG A CZ    1 
ATOM   783   N  NH1   . ARG A 1 633  ? 141.917 106.493 101.385 1.00 62.99  ?  505  ARG A NH1   1 
ATOM   784   N  NH2   . ARG A 1 633  ? 141.118 108.636 101.168 1.00 42.28  ?  505  ARG A NH2   1 
ATOM   785   N  N     . THR A 1 634  ? 145.750 111.731 105.447 1.00 22.93  ?  506  THR A N     1 
ATOM   786   C  CA    . THR A 1 634  ? 146.310 113.060 105.237 1.00 24.15  ?  506  THR A CA    1 
ATOM   787   C  C     . THR A 1 634  ? 147.697 113.175 105.836 1.00 25.01  ?  506  THR A C     1 
ATOM   788   O  O     . THR A 1 634  ? 148.670 113.479 105.137 1.00 27.52  ?  506  THR A O     1 
ATOM   789   C  CB    . THR A 1 634  ? 145.396 114.115 105.848 1.00 23.80  ?  506  THR A CB    1 
ATOM   790   O  OG1   . THR A 1 634  ? 144.034 113.873 105.461 1.00 21.63  ?  506  THR A OG1   1 
ATOM   791   C  CG2   . THR A 1 634  ? 145.818 115.512 105.406 1.00 24.65  ?  506  THR A CG2   1 
ATOM   792   N  N     . VAL A 1 635  ? 147.795 112.965 107.146 1.00 21.96  ?  507  VAL A N     1 
ATOM   793   C  CA    . VAL A 1 635  ? 149.069 113.163 107.811 1.00 23.54  ?  507  VAL A CA    1 
ATOM   794   C  C     . VAL A 1 635  ? 150.104 112.185 107.272 1.00 28.63  ?  507  VAL A C     1 
ATOM   795   O  O     . VAL A 1 635  ? 151.293 112.517 107.192 1.00 31.36  ?  507  VAL A O     1 
ATOM   796   C  CB    . VAL A 1 635  ? 148.886 113.063 109.338 1.00 22.36  ?  507  VAL A CB    1 
ATOM   797   C  CG1   . VAL A 1 635  ? 148.467 111.658 109.760 1.00 23.13  ?  507  VAL A CG1   1 
ATOM   798   C  CG2   . VAL A 1 635  ? 150.144 113.514 110.071 1.00 26.06  ?  507  VAL A CG2   1 
ATOM   799   N  N     . LYS A 1 636  ? 149.680 110.990 106.842 1.00 27.50  ?  508  LYS A N     1 
ATOM   800   C  CA    . LYS A 1 636  ? 150.641 110.048 106.276 1.00 30.28  ?  508  LYS A CA    1 
ATOM   801   C  C     . LYS A 1 636  ? 151.207 110.564 104.961 1.00 32.06  ?  508  LYS A C     1 
ATOM   802   O  O     . LYS A 1 636  ? 152.342 110.232 104.595 1.00 29.27  ?  508  LYS A O     1 
ATOM   803   C  CB    . LYS A 1 636  ? 149.992 108.674 106.081 1.00 30.68  ?  508  LYS A CB    1 
ATOM   804   C  CG    . LYS A 1 636  ? 150.949 107.598 105.576 1.00 35.75  ?  508  LYS A CG    1 
ATOM   805   C  CD    . LYS A 1 636  ? 150.508 106.195 105.969 1.00 34.32  ?  508  LYS A CD    1 
ATOM   806   C  CE    . LYS A 1 636  ? 151.342 105.150 105.244 1.00 40.97  ?  508  LYS A CE    1 
ATOM   807   N  NZ    . LYS A 1 636  ? 151.118 105.201 103.771 1.00 44.37  ?  508  LYS A NZ    1 
ATOM   808   N  N     . ALA A 1 637  ? 150.425 111.359 104.231 1.00 32.46  ?  509  ALA A N     1 
ATOM   809   C  CA    . ALA A 1 637  ? 150.963 112.021 103.049 1.00 31.81  ?  509  ALA A CA    1 
ATOM   810   C  C     . ALA A 1 637  ? 152.071 112.999 103.422 1.00 33.24  ?  509  ALA A C     1 
ATOM   811   O  O     . ALA A 1 637  ? 153.131 113.026 102.787 1.00 34.41  ?  509  ALA A O     1 
ATOM   812   C  CB    . ALA A 1 637  ? 149.843 112.741 102.301 1.00 33.76  ?  509  ALA A CB    1 
ATOM   813   N  N     . THR A 1 638  ? 151.841 113.813 104.450 1.00 32.36  ?  510  THR A N     1 
ATOM   814   C  CA    . THR A 1 638  ? 152.759 114.888 104.816 1.00 34.09  ?  510  THR A CA    1 
ATOM   815   C  C     . THR A 1 638  ? 153.917 114.324 105.630 1.00 36.63  ?  510  THR A C     1 
ATOM   816   O  O     . THR A 1 638  ? 153.735 113.936 106.785 1.00 35.40  ?  510  THR A O     1 
ATOM   817   C  CB    . THR A 1 638  ? 152.020 115.963 105.606 1.00 34.56  ?  510  THR A CB    1 
ATOM   818   O  OG1   . THR A 1 638  ? 151.317 115.350 106.696 1.00 32.25  ?  510  THR A OG1   1 
ATOM   819   C  CG2   . THR A 1 638  ? 151.025 116.687 104.730 1.00 34.30  ?  510  THR A CG2   1 
ATOM   820   N  N     . SER A 1 639  ? 155.108 114.272 105.031 1.00 41.69  ?  511  SER A N     1 
ATOM   821   C  CA    . SER A 1 639  ? 156.345 113.796 105.652 1.00 51.36  ?  511  SER A CA    1 
ATOM   822   C  C     . SER A 1 639  ? 156.197 112.398 106.237 1.00 49.09  ?  511  SER A C     1 
ATOM   823   O  O     . SER A 1 639  ? 157.071 111.939 106.985 1.00 45.11  ?  511  SER A O     1 
ATOM   824   C  CB    . SER A 1 639  ? 156.853 114.774 106.728 1.00 49.43  ?  511  SER A CB    1 
ATOM   825   O  OG    . SER A 1 639  ? 156.076 114.712 107.911 1.00 47.17  ?  511  SER A OG    1 
ATOM   826   N  N     . GLY A 1 640  ? 155.113 111.710 105.909 1.00 46.69  ?  512  GLY A N     1 
ATOM   827   C  CA    . GLY A 1 640  ? 154.699 110.583 106.697 1.00 44.80  ?  512  GLY A CA    1 
ATOM   828   C  C     . GLY A 1 640  ? 155.520 109.325 106.567 1.00 49.09  ?  512  GLY A C     1 
ATOM   829   O  O     . GLY A 1 640  ? 155.417 108.582 105.588 1.00 48.69  ?  512  GLY A O     1 
ATOM   830   N  N     . ARG A 1 641  ? 156.336 109.078 107.580 1.00 49.76  ?  513  ARG A N     1 
ATOM   831   C  CA    . ARG A 1 641  ? 156.536 107.723 108.049 1.00 60.20  ?  513  ARG A CA    1 
ATOM   832   C  C     . ARG A 1 641  ? 155.314 107.430 108.906 1.00 60.18  ?  513  ARG A C     1 
ATOM   833   O  O     . ARG A 1 641  ? 155.087 108.116 109.905 1.00 57.33  ?  513  ARG A O     1 
ATOM   834   C  CB    . ARG A 1 641  ? 157.843 107.605 108.832 1.00 63.54  ?  513  ARG A CB    1 
ATOM   835   C  CG    . ARG A 1 641  ? 157.924 106.458 109.844 1.00 73.76  ?  513  ARG A CG    1 
ATOM   836   C  CD    . ARG A 1 641  ? 157.489 105.105 109.262 1.00 79.92  ?  513  ARG A CD    1 
ATOM   837   N  NE    . ARG A 1 641  ? 158.082 104.792 107.961 1.00 86.30  ?  513  ARG A NE    1 
ATOM   838   C  CZ    . ARG A 1 641  ? 158.963 103.817 107.743 1.00 85.31  ?  513  ARG A CZ    1 
ATOM   839   N  NH1   . ARG A 1 641  ? 159.336 103.015 108.731 1.00 81.15  ?  513  ARG A NH1   1 
ATOM   840   N  NH2   . ARG A 1 641  ? 159.436 103.614 106.520 1.00 86.42  ?  513  ARG A NH2   1 
ATOM   841   N  N     . GLN A 1 642  ? 154.515 106.445 108.493 1.00 63.25  ?  514  GLN A N     1 
ATOM   842   C  CA    . GLN A 1 642  ? 153.165 106.228 109.010 1.00 55.91  ?  514  GLN A CA    1 
ATOM   843   C  C     . GLN A 1 642  ? 153.128 106.387 110.525 1.00 52.67  ?  514  GLN A C     1 
ATOM   844   O  O     . GLN A 1 642  ? 153.718 105.586 111.260 1.00 50.66  ?  514  GLN A O     1 
ATOM   845   C  CB    . GLN A 1 642  ? 152.668 104.835 108.575 1.00 47.26  ?  514  GLN A CB    1 
ATOM   846   C  CG    . GLN A 1 642  ? 151.679 104.148 109.501 1.00 37.43  ?  514  GLN A CG    1 
ATOM   847   C  CD    . GLN A 1 642  ? 152.218 102.858 110.101 1.00 36.34  ?  514  GLN A CD    1 
ATOM   848   O  OE1   . GLN A 1 642  ? 152.844 102.047 109.416 1.00 38.86  ?  514  GLN A OE1   1 
ATOM   849   N  NE2   . GLN A 1 642  ? 151.973 102.665 111.387 1.00 38.17  ?  514  GLN A NE2   1 
ATOM   850   N  N     . ILE A 1 643  ? 152.452 107.438 110.996 1.00 44.29  ?  515  ILE A N     1 
ATOM   851   C  CA    . ILE A 1 643  ? 152.559 107.876 112.385 1.00 40.74  ?  515  ILE A CA    1 
ATOM   852   C  C     . ILE A 1 643  ? 151.448 107.247 113.206 1.00 39.32  ?  515  ILE A C     1 
ATOM   853   O  O     . ILE A 1 643  ? 151.703 106.470 114.133 1.00 39.56  ?  515  ILE A O     1 
ATOM   854   C  CB    . ILE A 1 643  ? 152.513 109.412 112.501 1.00 38.14  ?  515  ILE A CB    1 
ATOM   855   C  CG1   . ILE A 1 643  ? 153.833 110.020 112.034 1.00 39.81  ?  515  ILE A CG1   1 
ATOM   856   C  CG2   . ILE A 1 643  ? 152.233 109.831 113.939 1.00 32.22  ?  515  ILE A CG2   1 
ATOM   857   C  CD1   . ILE A 1 643  ? 154.035 111.452 112.464 1.00 41.97  ?  515  ILE A CD1   1 
ATOM   858   N  N     . PHE A 1 644  ? 150.210 107.573 112.870 1.00 32.34  ?  516  PHE A N     1 
ATOM   859   C  CA    . PHE A 1 644  ? 149.099 107.001 113.602 1.00 27.34  ?  516  PHE A CA    1 
ATOM   860   C  C     . PHE A 1 644  ? 148.905 105.543 113.191 1.00 31.58  ?  516  PHE A C     1 
ATOM   861   O  O     . PHE A 1 644  ? 149.531 105.043 112.252 1.00 37.77  ?  516  PHE A O     1 
ATOM   862   C  CB    . PHE A 1 644  ? 147.831 107.821 113.364 1.00 27.72  ?  516  PHE A CB    1 
ATOM   863   C  CG    . PHE A 1 644  ? 147.874 109.205 113.969 1.00 29.30  ?  516  PHE A CG    1 
ATOM   864   C  CD1   . PHE A 1 644  ? 148.911 109.581 114.797 1.00 28.20  ?  516  PHE A CD1   1 
ATOM   865   C  CD2   . PHE A 1 644  ? 146.872 110.124 113.718 1.00 24.66  ?  516  PHE A CD2   1 
ATOM   866   C  CE1   . PHE A 1 644  ? 148.945 110.838 115.353 1.00 25.35  ?  516  PHE A CE1   1 
ATOM   867   C  CE2   . PHE A 1 644  ? 146.907 111.384 114.278 1.00 23.26  ?  516  PHE A CE2   1 
ATOM   868   C  CZ    . PHE A 1 644  ? 147.941 111.736 115.093 1.00 23.57  ?  516  PHE A CZ    1 
ATOM   869   N  N     . GLN A 1 645  ? 148.094 104.875 113.903 1.00 32.66  ?  517  GLN A N     1 
ATOM   870   C  CA    . GLN A 1 645  ? 147.928 103.562 113.324 1.00 31.10  ?  517  GLN A CA    1 
ATOM   871   C  C     . GLN A 1 645  ? 146.680 103.526 112.467 1.00 28.89  ?  517  GLN A C     1 
ATOM   872   O  O     . GLN A 1 645  ? 145.716 104.242 112.730 1.00 29.36  ?  517  GLN A O     1 
ATOM   873   C  CB    . GLN A 1 645  ? 147.837 102.493 114.411 1.00 37.53  ?  517  GLN A CB    1 
ATOM   874   C  CG    . GLN A 1 645  ? 148.933 102.602 115.435 1.00 44.15  ?  517  GLN A CG    1 
ATOM   875   C  CD    . GLN A 1 645  ? 150.299 102.405 114.838 1.00 49.08  ?  517  GLN A CD    1 
ATOM   876   O  OE1   . GLN A 1 645  ? 150.487 101.557 113.967 1.00 46.67  ?  517  GLN A OE1   1 
ATOM   877   N  NE2   . GLN A 1 645  ? 151.264 103.201 115.286 1.00 47.54  ?  517  GLN A NE2   1 
ATOM   878   N  N     . PRO A 1 646  ? 146.700 102.729 111.416 1.00 28.61  ?  518  PRO A N     1 
ATOM   879   C  CA    . PRO A 1 646  ? 145.499 102.577 110.598 1.00 27.46  ?  518  PRO A CA    1 
ATOM   880   C  C     . PRO A 1 646  ? 144.335 102.069 111.430 1.00 31.63  ?  518  PRO A C     1 
ATOM   881   O  O     . PRO A 1 646  ? 144.502 101.295 112.376 1.00 34.00  ?  518  PRO A O     1 
ATOM   882   C  CB    . PRO A 1 646  ? 145.928 101.569 109.530 1.00 40.50  ?  518  PRO A CB    1 
ATOM   883   C  CG    . PRO A 1 646  ? 147.071 100.839 110.160 1.00 47.20  ?  518  PRO A CG    1 
ATOM   884   C  CD    . PRO A 1 646  ? 147.790 101.839 110.987 1.00 41.09  ?  518  PRO A CD    1 
ATOM   885   N  N     . LEU A 1 647  ? 143.147 102.558 111.075 1.00 27.10  ?  519  LEU A N     1 
ATOM   886   C  CA    . LEU A 1 647  ? 141.931 102.256 111.820 1.00 24.96  ?  519  LEU A CA    1 
ATOM   887   C  C     . LEU A 1 647  ? 141.790 100.765 112.085 1.00 33.22  ?  519  LEU A C     1 
ATOM   888   O  O     . LEU A 1 647  ? 141.389 100.357 113.179 1.00 36.61  ?  519  LEU A O     1 
ATOM   889   C  CB    . LEU A 1 647  ? 140.724 102.766 111.038 1.00 19.04  ?  519  LEU A CB    1 
ATOM   890   C  CG    . LEU A 1 647  ? 139.464 103.089 111.828 1.00 24.50  ?  519  LEU A CG    1 
ATOM   891   C  CD1   . LEU A 1 647  ? 138.616 104.050 111.033 1.00 29.36  ?  519  LEU A CD1   1 
ATOM   892   C  CD2   . LEU A 1 647  ? 138.691 101.833 112.133 1.00 35.02  ?  519  LEU A CD2   1 
ATOM   893   N  N     . HIS A 1 648  ? 142.111 99.941  111.089 1.00 34.02  ?  520  HIS A N     1 
ATOM   894   C  CA    . HIS A 1 648  ? 141.873 98.508  111.191 1.00 35.51  ?  520  HIS A CA    1 
ATOM   895   C  C     . HIS A 1 648  ? 142.492 97.909  112.442 1.00 38.29  ?  520  HIS A C     1 
ATOM   896   O  O     . HIS A 1 648  ? 141.921 96.984  113.027 1.00 43.48  ?  520  HIS A O     1 
ATOM   897   C  CB    . HIS A 1 648  ? 142.441 97.810  109.963 1.00 38.77  ?  520  HIS A CB    1 
ATOM   898   C  CG    . HIS A 1 648  ? 143.918 97.577  110.043 1.00 49.59  ?  520  HIS A CG    1 
ATOM   899   N  ND1   . HIS A 1 648  ? 144.470 96.517  110.733 1.00 54.92  ?  520  HIS A ND1   1 
ATOM   900   C  CD2   . HIS A 1 648  ? 144.959 98.292  109.555 1.00 52.11  ?  520  HIS A CD2   1 
ATOM   901   C  CE1   . HIS A 1 648  ? 145.786 96.578  110.646 1.00 60.92  ?  520  HIS A CE1   1 
ATOM   902   N  NE2   . HIS A 1 648  ? 146.108 97.645  109.936 1.00 61.11  ?  520  HIS A NE2   1 
ATOM   903   N  N     . THR A 1 649  ? 143.653 98.415  112.865 1.00 40.78  ?  521  THR A N     1 
ATOM   904   C  CA    . THR A 1 649  ? 144.412 97.769  113.928 1.00 43.70  ?  521  THR A CA    1 
ATOM   905   C  C     . THR A 1 649  ? 143.836 98.036  115.312 1.00 47.37  ?  521  THR A C     1 
ATOM   906   O  O     . THR A 1 649  ? 144.134 97.286  116.247 1.00 48.57  ?  521  THR A O     1 
ATOM   907   C  CB    . THR A 1 649  ? 145.877 98.215  113.883 1.00 43.66  ?  521  THR A CB    1 
ATOM   908   O  OG1   . THR A 1 649  ? 146.687 97.253  114.569 1.00 46.44  ?  521  THR A OG1   1 
ATOM   909   C  CG2   . THR A 1 649  ? 146.048 99.546  114.562 1.00 41.58  ?  521  THR A CG2   1 
ATOM   910   N  N     . LEU A 1 650  ? 143.004 99.068  115.456 1.00 47.02  ?  522  LEU A N     1 
ATOM   911   C  CA    . LEU A 1 650  ? 142.345 99.320  116.731 1.00 47.77  ?  522  LEU A CA    1 
ATOM   912   C  C     . LEU A 1 650  ? 141.272 98.278  116.999 1.00 52.19  ?  522  LEU A C     1 
ATOM   913   O  O     . LEU A 1 650  ? 141.100 97.830  118.138 1.00 53.39  ?  522  LEU A O     1 
ATOM   914   C  CB    . LEU A 1 650  ? 141.730 100.717 116.730 1.00 42.25  ?  522  LEU A CB    1 
ATOM   915   C  CG    . LEU A 1 650  ? 142.709 101.840 116.420 1.00 39.36  ?  522  LEU A CG    1 
ATOM   916   C  CD1   . LEU A 1 650  ? 141.997 103.178 116.379 1.00 37.44  ?  522  LEU A CD1   1 
ATOM   917   C  CD2   . LEU A 1 650  ? 143.818 101.843 117.439 1.00 46.69  ?  522  LEU A CD2   1 
ATOM   918   N  N     . ARG A 1 651  ? 140.547 97.877  115.952 1.00 53.88  ?  523  ARG A N     1 
ATOM   919   C  CA    . ARG A 1 651  ? 139.422 96.961  116.086 1.00 61.83  ?  523  ARG A CA    1 
ATOM   920   C  C     . ARG A 1 651  ? 139.830 95.602  116.644 1.00 72.84  ?  523  ARG A C     1 
ATOM   921   O  O     . ARG A 1 651  ? 138.961 94.845  117.092 1.00 79.89  ?  523  ARG A O     1 
ATOM   922   C  CB    . ARG A 1 651  ? 138.749 96.788  114.723 1.00 64.38  ?  523  ARG A CB    1 
ATOM   923   C  CG    . ARG A 1 651  ? 138.327 98.091  114.058 1.00 58.27  ?  523  ARG A CG    1 
ATOM   924   C  CD    . ARG A 1 651  ? 137.696 97.812  112.703 1.00 65.98  ?  523  ARG A CD    1 
ATOM   925   N  NE    . ARG A 1 651  ? 137.026 98.985  112.151 1.00 68.40  ?  523  ARG A NE    1 
ATOM   926   C  CZ    . ARG A 1 651  ? 135.875 99.464  112.612 1.00 75.36  ?  523  ARG A CZ    1 
ATOM   927   N  NH1   . ARG A 1 651  ? 135.274 98.884  113.646 1.00 80.08  ?  523  ARG A NH1   1 
ATOM   928   N  NH2   . ARG A 1 651  ? 135.327 100.532 112.047 1.00 67.89  ?  523  ARG A NH2   1 
ATOM   929   N  N     . ASN A 1 652  ? 141.120 95.260  116.598 1.00 67.68  ?  524  ASN A N     1 
ATOM   930   C  CA    . ASN A 1 652  ? 141.657 94.117  117.331 1.00 66.23  ?  524  ASN A CA    1 
ATOM   931   C  C     . ASN A 1 652  ? 142.774 94.540  118.283 1.00 63.57  ?  524  ASN A C     1 
ATOM   932   O  O     . ASN A 1 652  ? 143.552 93.694  118.740 1.00 59.20  ?  524  ASN A O     1 
ATOM   933   C  CB    . ASN A 1 652  ? 142.129 93.009  116.377 1.00 60.91  ?  524  ASN A CB    1 
ATOM   934   C  CG    . ASN A 1 652  ? 143.457 93.320  115.705 1.00 63.96  ?  524  ASN A CG    1 
ATOM   935   O  OD1   . ASN A 1 652  ? 143.485 93.873  114.605 1.00 63.30  ?  524  ASN A OD1   1 
ATOM   936   N  ND2   . ASN A 1 652  ? 144.561 92.944  116.350 1.00 60.74  ?  524  ASN A ND2   1 
ATOM   937   N  N     . ALA A 1 653  ? 142.859 95.839  118.595 1.00 60.55  ?  525  ALA A N     1 
ATOM   938   C  CA    . ALA A 1 653  ? 143.738 96.343  119.644 1.00 57.47  ?  525  ALA A CA    1 
ATOM   939   C  C     . ALA A 1 653  ? 143.029 96.536  120.977 1.00 53.68  ?  525  ALA A C     1 
ATOM   940   O  O     . ALA A 1 653  ? 143.703 96.628  122.009 1.00 48.73  ?  525  ALA A O     1 
ATOM   941   C  CB    . ALA A 1 653  ? 144.372 97.675  119.227 1.00 49.90  ?  525  ALA A CB    1 
ATOM   942   N  N     . GLU A 1 654  ? 141.698 96.613  120.981 1.00 52.70  ?  526  GLU A N     1 
ATOM   943   C  CA    . GLU A 1 654  ? 140.936 96.736  122.217 1.00 48.10  ?  526  GLU A CA    1 
ATOM   944   C  C     . GLU A 1 654  ? 140.551 95.390  122.810 1.00 46.78  ?  526  GLU A C     1 
ATOM   945   O  O     . GLU A 1 654  ? 140.145 95.343  123.976 1.00 40.74  ?  526  GLU A O     1 
ATOM   946   C  CB    . GLU A 1 654  ? 139.649 97.531  121.987 1.00 55.26  ?  526  GLU A CB    1 
ATOM   947   C  CG    . GLU A 1 654  ? 138.501 96.665  121.507 1.00 63.16  ?  526  GLU A CG    1 
ATOM   948   C  CD    . GLU A 1 654  ? 138.823 95.893  120.256 1.00 83.06  ?  526  GLU A CD    1 
ATOM   949   O  OE1   . GLU A 1 654  ? 139.303 96.511  119.277 1.00 74.97  ?  526  GLU A OE1   1 
ATOM   950   O  OE2   . GLU A 1 654  ? 138.624 94.660  120.267 1.00 208.87 -1 526  GLU A OE2   1 
ATOM   951   N  N     . LYS A 1 655  ? 140.661 94.301  122.037 1.00 50.08  ?  527  LYS A N     1 
ATOM   952   C  CA    . LYS A 1 655  ? 140.381 92.962  122.551 1.00 50.76  ?  527  LYS A CA    1 
ATOM   953   C  C     . LYS A 1 655  ? 141.163 92.681  123.817 1.00 41.97  ?  527  LYS A C     1 
ATOM   954   O  O     . LYS A 1 655  ? 140.865 91.712  124.518 1.00 36.81  ?  527  LYS A O     1 
ATOM   955   C  CB    . LYS A 1 655  ? 140.718 91.895  121.491 1.00 54.09  ?  527  LYS A CB    1 
ATOM   956   C  CG    . LYS A 1 655  ? 139.944 92.002  120.175 1.00 65.95  ?  527  LYS A CG    1 
ATOM   957   C  CD    . LYS A 1 655  ? 139.002 90.816  119.938 1.00 73.67  ?  527  LYS A CD    1 
ATOM   958   C  CE    . LYS A 1 655  ? 138.582 90.758  118.469 1.00 81.95  ?  527  LYS A CE    1 
ATOM   959   N  NZ    . LYS A 1 655  ? 139.753 90.795  117.543 1.00 69.87  ?  527  LYS A NZ    1 
ATOM   960   N  N     . GLU A 1 656  ? 142.161 93.507  124.105 1.00 43.22  ?  528  GLU A N     1 
ATOM   961   C  CA    . GLU A 1 656  ? 142.942 93.467  125.326 1.00 39.84  ?  528  GLU A CA    1 
ATOM   962   C  C     . GLU A 1 656  ? 142.375 94.369  126.420 1.00 34.76  ?  528  GLU A C     1 
ATOM   963   O  O     . GLU A 1 656  ? 142.763 94.226  127.587 1.00 35.74  ?  528  GLU A O     1 
ATOM   964   C  CB    . GLU A 1 656  ? 144.384 93.870  124.992 1.00 58.54  ?  528  GLU A CB    1 
ATOM   965   C  CG    . GLU A 1 656  ? 145.446 93.440  125.972 1.00 90.11  ?  528  GLU A CG    1 
ATOM   966   C  CD    . GLU A 1 656  ? 146.831 93.921  125.554 1.00 149.35 ?  528  GLU A CD    1 
ATOM   967   O  OE1   . GLU A 1 656  ? 146.992 94.347  124.389 1.00 131.80 ?  528  GLU A OE1   1 
ATOM   968   O  OE2   . GLU A 1 656  ? 147.760 93.869  126.387 1.00 319.01 -1 528  GLU A OE2   1 
ATOM   969   N  N     . LEU A 1 657  ? 141.463 95.283  126.081 1.00 26.74  ?  529  LEU A N     1 
ATOM   970   C  CA    . LEU A 1 657  ? 140.898 96.230  127.041 1.00 19.50  ?  529  LEU A CA    1 
ATOM   971   C  C     . LEU A 1 657  ? 139.427 96.016  127.360 1.00 19.96  ?  529  LEU A C     1 
ATOM   972   O  O     . LEU A 1 657  ? 139.021 96.215  128.505 1.00 17.95  ?  529  LEU A O     1 
ATOM   973   C  CB    . LEU A 1 657  ? 141.087 97.657  126.544 1.00 17.52  ?  529  LEU A CB    1 
ATOM   974   C  CG    . LEU A 1 657  ? 142.561 98.001  126.606 1.00 15.72  ?  529  LEU A CG    1 
ATOM   975   C  CD1   . LEU A 1 657  ? 142.751 99.379  126.083 1.00 19.62  ?  529  LEU A CD1   1 
ATOM   976   C  CD2   . LEU A 1 657  ? 143.062 97.889  128.020 1.00 17.26  ?  529  LEU A CD2   1 
ATOM   977   N  N     . LEU A 1 658  ? 138.607 95.638  126.387 1.00 22.27  ?  530  LEU A N     1 
ATOM   978   C  CA    . LEU A 1 658  ? 137.186 95.383  126.607 1.00 19.88  ?  530  LEU A CA    1 
ATOM   979   C  C     . LEU A 1 658  ? 136.961 94.192  127.535 1.00 21.70  ?  530  LEU A C     1 
ATOM   980   O  O     . LEU A 1 658  ? 137.912 93.491  127.892 1.00 22.97  ?  530  LEU A O     1 
ATOM   981   C  CB    . LEU A 1 658  ? 136.497 95.142  125.265 1.00 24.77  ?  530  LEU A CB    1 
ATOM   982   C  CG    . LEU A 1 658  ? 136.103 96.416  124.529 1.00 27.78  ?  530  LEU A CG    1 
ATOM   983   C  CD1   . LEU A 1 658  ? 135.269 96.122  123.284 1.00 38.12  ?  530  LEU A CD1   1 
ATOM   984   C  CD2   . LEU A 1 658  ? 135.376 97.324  125.485 1.00 30.83  ?  530  LEU A CD2   1 
ATOM   985   N  N     . PRO A 1 659  ? 135.721 93.916  127.928 1.00 16.96  ?  531  PRO A N     1 
ATOM   986   C  CA    . PRO A 1 659  ? 135.444 92.707  128.713 1.00 14.59  ?  531  PRO A CA    1 
ATOM   987   C  C     . PRO A 1 659  ? 135.716 91.424  127.949 1.00 15.56  ?  531  PRO A C     1 
ATOM   988   O  O     . PRO A 1 659  ? 135.950 91.414  126.743 1.00 16.70  ?  531  PRO A O     1 
ATOM   989   C  CB    . PRO A 1 659  ? 133.956 92.838  129.040 1.00 16.55  ?  531  PRO A CB    1 
ATOM   990   C  CG    . PRO A 1 659  ? 133.704 94.292  128.970 1.00 17.46  ?  531  PRO A CG    1 
ATOM   991   C  CD    . PRO A 1 659  ? 134.560 94.821  127.900 1.00 14.69  ?  531  PRO A CD    1 
ATOM   992   N  N     . GLY A 1 660  ? 135.724 90.330  128.697 1.00 18.55  ?  532  GLY A N     1 
ATOM   993   C  CA    . GLY A 1 660  ? 135.749 88.999  128.134 1.00 21.91  ?  532  GLY A CA    1 
ATOM   994   C  C     . GLY A 1 660  ? 137.029 88.649  127.407 1.00 24.67  ?  532  GLY A C     1 
ATOM   995   O  O     . GLY A 1 660  ? 137.001 88.294  126.225 1.00 22.62  ?  532  GLY A O     1 
ATOM   996   N  N     . PHE A 1 661  ? 138.166 88.770  128.081 1.00 21.26  ?  533  PHE A N     1 
ATOM   997   C  CA    . PHE A 1 661  ? 139.426 88.407  127.442 1.00 19.81  ?  533  PHE A CA    1 
ATOM   998   C  C     . PHE A 1 661  ? 140.408 87.683  128.351 1.00 22.88  ?  533  PHE A C     1 
ATOM   999   O  O     . PHE A 1 661  ? 141.283 86.981  127.834 1.00 21.15  ?  533  PHE A O     1 
ATOM   1000  C  CB    . PHE A 1 661  ? 140.107 89.652  126.876 1.00 18.82  ?  533  PHE A CB    1 
ATOM   1001  C  CG    . PHE A 1 661  ? 141.328 89.359  126.061 1.00 19.93  ?  533  PHE A CG    1 
ATOM   1002  C  CD1   . PHE A 1 661  ? 141.236 88.560  124.945 1.00 19.42  ?  533  PHE A CD1   1 
ATOM   1003  C  CD2   . PHE A 1 661  ? 142.556 89.894  126.388 1.00 24.49  ?  533  PHE A CD2   1 
ATOM   1004  C  CE1   . PHE A 1 661  ? 142.339 88.292  124.184 1.00 23.64  ?  533  PHE A CE1   1 
ATOM   1005  C  CE2   . PHE A 1 661  ? 143.664 89.623  125.623 1.00 27.02  ?  533  PHE A CE2   1 
ATOM   1006  C  CZ    . PHE A 1 661  ? 143.552 88.823  124.525 1.00 28.94  ?  533  PHE A CZ    1 
ATOM   1007  N  N     . HIS A 1 662  ? 140.306 87.806  129.672 1.00 26.54  ?  534  HIS A N     1 
ATOM   1008  C  CA    . HIS A 1 662  ? 141.272 87.236  130.606 1.00 26.41  ?  534  HIS A CA    1 
ATOM   1009  C  C     . HIS A 1 662  ? 140.634 86.086  131.373 1.00 23.98  ?  534  HIS A C     1 
ATOM   1010  O  O     . HIS A 1 662  ? 139.698 86.297  132.151 1.00 23.82  ?  534  HIS A O     1 
ATOM   1011  C  CB    . HIS A 1 662  ? 141.785 88.300  131.571 1.00 23.77  ?  534  HIS A CB    1 
ATOM   1012  C  CG    . HIS A 1 662  ? 142.270 89.540  130.893 1.00 24.44  ?  534  HIS A CG    1 
ATOM   1013  N  ND1   . HIS A 1 662  ? 143.161 89.507  129.841 1.00 21.00  ?  534  HIS A ND1   1 
ATOM   1014  C  CD2   . HIS A 1 662  ? 141.981 90.844  131.107 1.00 23.26  ?  534  HIS A CD2   1 
ATOM   1015  C  CE1   . HIS A 1 662  ? 143.410 90.742  129.446 1.00 21.10  ?  534  HIS A CE1   1 
ATOM   1016  N  NE2   . HIS A 1 662  ? 142.708 91.571  130.198 1.00 20.43  ?  534  HIS A NE2   1 
ATOM   1017  N  N     . GLN A 1 663  ? 141.157 84.879  131.170 1.00 26.85  ?  535  GLN A N     1 
ATOM   1018  C  CA    . GLN A 1 663  ? 140.635 83.709  131.861 1.00 29.97  ?  535  GLN A CA    1 
ATOM   1019  C  C     . GLN A 1 663  ? 140.738 83.894  133.375 1.00 36.76  ?  535  GLN A C     1 
ATOM   1020  O  O     . GLN A 1 663  ? 141.538 84.686  133.883 1.00 36.80  ?  535  GLN A O     1 
ATOM   1021  C  CB    . GLN A 1 663  ? 141.379 82.447  131.418 1.00 34.87  ?  535  GLN A CB    1 
ATOM   1022  C  CG    . GLN A 1 663  ? 140.609 81.153  131.685 1.00 41.20  ?  535  GLN A CG    1 
ATOM   1023  C  CD    . GLN A 1 663  ? 141.246 79.936  131.034 1.00 53.37  ?  535  GLN A CD    1 
ATOM   1024  O  OE1   . GLN A 1 663  ? 141.877 80.035  129.977 1.00 52.92  ?  535  GLN A OE1   1 
ATOM   1025  N  NE2   . GLN A 1 663  ? 141.076 78.772  131.662 1.00 59.37  ?  535  GLN A NE2   1 
ATOM   1026  N  N     . PHE A 1 664  ? 139.903 83.154  134.095 1.00 39.52  ?  536  PHE A N     1 
ATOM   1027  C  CA    . PHE A 1 664  ? 139.776 83.261  135.544 1.00 41.38  ?  536  PHE A CA    1 
ATOM   1028  C  C     . PHE A 1 664  ? 138.916 82.097  136.028 1.00 40.73  ?  536  PHE A C     1 
ATOM   1029  O  O     . PHE A 1 664  ? 138.446 81.277  135.232 1.00 36.20  ?  536  PHE A O     1 
ATOM   1030  C  CB    . PHE A 1 664  ? 139.160 84.595  135.942 1.00 36.55  ?  536  PHE A CB    1 
ATOM   1031  C  CG    . PHE A 1 664  ? 137.772 84.801  135.416 1.00 32.76  ?  536  PHE A CG    1 
ATOM   1032  C  CD1   . PHE A 1 664  ? 136.676 84.319  136.107 1.00 29.67  ?  536  PHE A CD1   1 
ATOM   1033  C  CD2   . PHE A 1 664  ? 137.563 85.468  134.230 1.00 27.47  ?  536  PHE A CD2   1 
ATOM   1034  C  CE1   . PHE A 1 664  ? 135.405 84.507  135.625 1.00 30.96  ?  536  PHE A CE1   1 
ATOM   1035  C  CE2   . PHE A 1 664  ? 136.291 85.664  133.754 1.00 28.11  ?  536  PHE A CE2   1 
ATOM   1036  C  CZ    . PHE A 1 664  ? 135.214 85.183  134.449 1.00 29.78  ?  536  PHE A CZ    1 
ATOM   1037  N  N     . GLU A 1 665  ? 138.698 82.041  137.337 1.00 35.56  ?  537  GLU A N     1 
ATOM   1038  C  CA    . GLU A 1 665  ? 137.728 81.094  137.894 1.00 34.58  ?  537  GLU A CA    1 
ATOM   1039  C  C     . GLU A 1 665  ? 137.452 81.489  139.341 1.00 38.10  ?  537  GLU A C     1 
ATOM   1040  O  O     . GLU A 1 665  ? 137.905 82.541  139.806 1.00 38.28  ?  537  GLU A O     1 
ATOM   1041  C  CB    . GLU A 1 665  ? 138.219 79.652  137.773 1.00 50.77  ?  537  GLU A CB    1 
ATOM   1042  C  CG    . GLU A 1 665  ? 139.501 79.350  138.527 1.00 70.66  ?  537  GLU A CG    1 
ATOM   1043  C  CD    . GLU A 1 665  ? 139.988 77.923  138.302 1.00 117.36 ?  537  GLU A CD    1 
ATOM   1044  O  OE1   . GLU A 1 665  ? 139.757 77.383  137.203 1.00 108.04 ?  537  GLU A OE1   1 
ATOM   1045  O  OE2   . GLU A 1 665  ? 140.589 77.339  139.231 1.00 232.97 -1 537  GLU A OE2   1 
ATOM   1046  N  N     . TRP A 1 666  ? 136.690 80.650  140.052 1.00 41.56  ?  538  TRP A N     1 
ATOM   1047  C  CA    . TRP A 1 666  ? 136.271 80.919  141.425 1.00 36.00  ?  538  TRP A CA    1 
ATOM   1048  C  C     . TRP A 1 666  ? 136.322 79.641  142.249 1.00 34.61  ?  538  TRP A C     1 
ATOM   1049  O  O     . TRP A 1 666  ? 136.228 78.528  141.726 1.00 38.04  ?  538  TRP A O     1 
ATOM   1050  C  CB    . TRP A 1 666  ? 134.842 81.485  141.506 1.00 28.62  ?  538  TRP A CB    1 
ATOM   1051  C  CG    . TRP A 1 666  ? 134.564 82.543  140.511 1.00 32.00  ?  538  TRP A CG    1 
ATOM   1052  C  CD1   . TRP A 1 666  ? 134.365 82.370  139.173 1.00 37.37  ?  538  TRP A CD1   1 
ATOM   1053  C  CD2   . TRP A 1 666  ? 134.433 83.941  140.760 1.00 30.69  ?  538  TRP A CD2   1 
ATOM   1054  N  NE1   . TRP A 1 666  ? 134.135 83.576  138.568 1.00 37.04  ?  538  TRP A NE1   1 
ATOM   1055  C  CE2   . TRP A 1 666  ? 134.170 84.559  139.521 1.00 30.91  ?  538  TRP A CE2   1 
ATOM   1056  C  CE3   . TRP A 1 666  ? 134.518 84.734  141.905 1.00 31.60  ?  538  TRP A CE3   1 
ATOM   1057  C  CZ2   . TRP A 1 666  ? 133.983 85.925  139.399 1.00 27.37  ?  538  TRP A CZ2   1 
ATOM   1058  C  CZ3   . TRP A 1 666  ? 134.339 86.086  141.779 1.00 31.93  ?  538  TRP A CZ3   1 
ATOM   1059  C  CH2   . TRP A 1 666  ? 134.079 86.672  140.537 1.00 22.96  ?  538  TRP A CH2   1 
ATOM   1060  N  N     . GLN A 1 667  ? 136.476 79.820  143.558 1.00 30.33  ?  539  GLN A N     1 
ATOM   1061  C  CA    . GLN A 1 667  ? 136.213 78.713  144.472 1.00 35.60  ?  539  GLN A CA    1 
ATOM   1062  C  C     . GLN A 1 667  ? 135.373 79.225  145.642 1.00 32.19  ?  539  GLN A C     1 
ATOM   1063  O  O     . GLN A 1 667  ? 135.734 80.220  146.288 1.00 31.27  ?  539  GLN A O     1 
ATOM   1064  C  CB    . GLN A 1 667  ? 137.509 78.024  144.943 1.00 30.71  ?  539  GLN A CB    1 
ATOM   1065  C  CG    . GLN A 1 667  ? 138.476 78.878  145.752 1.00 39.19  ?  539  GLN A CG    1 
ATOM   1066  C  CD    . GLN A 1 667  ? 139.403 79.709  144.884 1.00 40.14  ?  539  GLN A CD    1 
ATOM   1067  O  OE1   . GLN A 1 667  ? 139.134 79.933  143.702 1.00 37.14  ?  539  GLN A OE1   1 
ATOM   1068  N  NE2   . GLN A 1 667  ? 140.491 80.191  145.477 1.00 40.98  ?  539  GLN A NE2   1 
ATOM   1069  N  N     . PRO A 1 668  ? 134.201 78.621  145.892 1.00 30.46  ?  540  PRO A N     1 
ATOM   1070  C  CA    . PRO A 1 668  ? 133.631 77.569  145.040 1.00 34.65  ?  540  PRO A CA    1 
ATOM   1071  C  C     . PRO A 1 668  ? 133.171 78.067  143.672 1.00 31.71  ?  540  PRO A C     1 
ATOM   1072  O  O     . PRO A 1 668  ? 133.212 79.275  143.445 1.00 28.47  ?  540  PRO A O     1 
ATOM   1073  C  CB    . PRO A 1 668  ? 132.443 77.075  145.868 1.00 32.60  ?  540  PRO A CB    1 
ATOM   1074  C  CG    . PRO A 1 668  ? 132.039 78.254  146.671 1.00 29.11  ?  540  PRO A CG    1 
ATOM   1075  C  CD    . PRO A 1 668  ? 133.331 78.921  147.044 1.00 25.24  ?  540  PRO A CD    1 
ATOM   1076  N  N     . ALA A 1 669  ? 132.782 77.165  142.773 1.00 31.53  ?  541  ALA A N     1 
ATOM   1077  C  CA    . ALA A 1 669  ? 132.219 77.596  141.500 1.00 29.92  ?  541  ALA A CA    1 
ATOM   1078  C  C     . ALA A 1 669  ? 131.017 78.503  141.751 1.00 34.09  ?  541  ALA A C     1 
ATOM   1079  O  O     . ALA A 1 669  ? 130.293 78.347  142.738 1.00 27.82  ?  541  ALA A O     1 
ATOM   1080  C  CB    . ALA A 1 669  ? 131.798 76.383  140.667 1.00 29.04  ?  541  ALA A CB    1 
ATOM   1081  N  N     . LEU A 1 670  ? 130.790 79.453  140.843 1.00 28.80  ?  542  LEU A N     1 
ATOM   1082  C  CA    . LEU A 1 670  ? 129.745 80.452  141.051 1.00 32.57  ?  542  LEU A CA    1 
ATOM   1083  C  C     . LEU A 1 670  ? 128.361 79.868  140.847 1.00 33.97  ?  542  LEU A C     1 
ATOM   1084  O  O     . LEU A 1 670  ? 128.107 79.161  139.868 1.00 32.58  ?  542  LEU A O     1 
ATOM   1085  C  CB    . LEU A 1 670  ? 129.921 81.653  140.126 1.00 32.49  ?  542  LEU A CB    1 
ATOM   1086  C  CG    . LEU A 1 670  ? 131.140 82.538  140.347 1.00 32.79  ?  542  LEU A CG    1 
ATOM   1087  C  CD1   . LEU A 1 670  ? 130.920 83.879  139.678 1.00 25.47  ?  542  LEU A CD1   1 
ATOM   1088  C  CD2   . LEU A 1 670  ? 131.386 82.709  141.826 1.00 31.06  ?  542  LEU A CD2   1 
ATOM   1089  N  N     . LYS A 1 671  ? 127.461 80.203  141.761 1.00 33.62  ?  543  LYS A N     1 
ATOM   1090  C  CA    . LYS A 1 671  ? 126.116 79.658  141.751 1.00 36.54  ?  543  LYS A CA    1 
ATOM   1091  C  C     . LYS A 1 671  ? 125.227 80.437  140.792 1.00 28.75  ?  543  LYS A C     1 
ATOM   1092  O  O     . LYS A 1 671  ? 125.203 81.671  140.810 1.00 28.24  ?  543  LYS A O     1 
ATOM   1093  C  CB    . LYS A 1 671  ? 125.543 79.659  143.170 1.00 34.33  ?  543  LYS A CB    1 
ATOM   1094  C  CG    . LYS A 1 671  ? 126.232 78.634  144.089 1.00 39.21  ?  543  LYS A CG    1 
ATOM   1095  C  CD    . LYS A 1 671  ? 126.145 78.990  145.571 1.00 38.98  ?  543  LYS A CD    1 
ATOM   1096  C  CE    . LYS A 1 671  ? 126.929 77.996  146.435 1.00 34.40  ?  543  LYS A CE    1 
ATOM   1097  N  NZ    . LYS A 1 671  ? 126.994 78.420  147.864 1.00 28.23  ?  543  LYS A NZ    1 
ATOM   1098  N  N     . ASN A 1 672  ? 124.524 79.700  139.935 1.00 32.18  ?  544  ASN A N     1 
ATOM   1099  C  CA    . ASN A 1 672  ? 123.497 80.212  139.036 1.00 30.30  ?  544  ASN A CA    1 
ATOM   1100  C  C     . ASN A 1 672  ? 124.040 81.146  137.960 1.00 27.55  ?  544  ASN A C     1 
ATOM   1101  O  O     . ASN A 1 672  ? 123.265 81.818  137.281 1.00 28.01  ?  544  ASN A O     1 
ATOM   1102  C  CB    . ASN A 1 672  ? 122.386 80.897  139.836 1.00 28.46  ?  544  ASN A CB    1 
ATOM   1103  C  CG    . ASN A 1 672  ? 121.954 80.078  141.037 1.00 35.02  ?  544  ASN A CG    1 
ATOM   1104  O  OD1   . ASN A 1 672  ? 122.437 78.968  141.257 1.00 33.46  ?  544  ASN A OD1   1 
ATOM   1105  N  ND2   . ASN A 1 672  ? 121.052 80.639  141.837 1.00 39.63  ?  544  ASN A ND2   1 
ATOM   1106  N  N     . VAL A 1 673  ? 125.356 81.185  137.772 1.00 29.27  ?  545  VAL A N     1 
ATOM   1107  C  CA    . VAL A 1 673  ? 125.987 82.035  136.771 1.00 26.39  ?  545  VAL A CA    1 
ATOM   1108  C  C     . VAL A 1 673  ? 126.946 81.170  135.964 1.00 36.12  ?  545  VAL A C     1 
ATOM   1109  O  O     . VAL A 1 673  ? 127.887 80.598  136.529 1.00 34.54  ?  545  VAL A O     1 
ATOM   1110  C  CB    . VAL A 1 673  ? 126.739 83.214  137.405 1.00 26.88  ?  545  VAL A CB    1 
ATOM   1111  C  CG1   . VAL A 1 673  ? 127.024 84.267  136.371 1.00 27.55  ?  545  VAL A CG1   1 
ATOM   1112  C  CG2   . VAL A 1 673  ? 125.958 83.777  138.576 1.00 30.68  ?  545  VAL A CG2   1 
ATOM   1113  N  N     . SER A 1 674  ? 126.721 81.092  134.648 1.00 35.19  ?  546  SER A N     1 
ATOM   1114  C  CA    . SER A 1 674  ? 127.452 80.151  133.800 1.00 37.45  ?  546  SER A CA    1 
ATOM   1115  C  C     . SER A 1 674  ? 128.958 80.342  133.924 1.00 40.46  ?  546  SER A C     1 
ATOM   1116  O  O     . SER A 1 674  ? 129.461 81.466  133.942 1.00 36.64  ?  546  SER A O     1 
ATOM   1117  C  CB    . SER A 1 674  ? 127.030 80.308  132.336 1.00 36.16  ?  546  SER A CB    1 
ATOM   1118  O  OG    . SER A 1 674  ? 127.698 81.390  131.716 1.00 35.67  ?  546  SER A OG    1 
ATOM   1119  N  N     . THR A 1 675  ? 129.680 79.231  134.004 1.00 40.21  ?  547  THR A N     1 
ATOM   1120  C  CA    . THR A 1 675  ? 131.123 79.279  134.179 1.00 46.12  ?  547  THR A CA    1 
ATOM   1121  C  C     . THR A 1 675  ? 131.865 79.612  132.882 1.00 40.07  ?  547  THR A C     1 
ATOM   1122  O  O     . THR A 1 675  ? 133.100 79.566  132.857 1.00 41.71  ?  547  THR A O     1 
ATOM   1123  C  CB    . THR A 1 675  ? 131.623 77.951  134.769 1.00 49.99  ?  547  THR A CB    1 
ATOM   1124  O  OG1   . THR A 1 675  ? 133.057 77.930  134.791 1.00 55.03  ?  547  THR A OG1   1 
ATOM   1125  C  CG2   . THR A 1 675  ? 131.111 76.769  133.965 1.00 47.05  ?  547  THR A CG2   1 
ATOM   1126  N  N     . SER A 1 676  ? 131.146 79.956  131.816 1.00 37.08  ?  548  SER A N     1 
ATOM   1127  C  CA    . SER A 1 676  ? 131.759 80.391  130.567 1.00 35.75  ?  548  SER A CA    1 
ATOM   1128  C  C     . SER A 1 676  ? 132.145 81.861  130.683 1.00 35.13  ?  548  SER A C     1 
ATOM   1129  O  O     . SER A 1 676  ? 131.311 82.692  131.052 1.00 32.01  ?  548  SER A O     1 
ATOM   1130  C  CB    . SER A 1 676  ? 130.793 80.162  129.407 1.00 39.75  ?  548  SER A CB    1 
ATOM   1131  O  OG    . SER A 1 676  ? 131.447 80.235  128.154 1.00 38.07  ?  548  SER A OG    1 
ATOM   1132  N  N     . TRP A 1 677  ? 133.400 82.185  130.362 1.00 31.75  ?  549  TRP A N     1 
ATOM   1133  C  CA    . TRP A 1 677  ? 133.972 83.498  130.645 1.00 27.00  ?  549  TRP A CA    1 
ATOM   1134  C  C     . TRP A 1 677  ? 134.289 84.345  129.424 1.00 29.08  ?  549  TRP A C     1 
ATOM   1135  O  O     . TRP A 1 677  ? 134.141 85.563  129.493 1.00 27.08  ?  549  TRP A O     1 
ATOM   1136  C  CB    . TRP A 1 677  ? 135.267 83.347  131.459 1.00 31.75  ?  549  TRP A CB    1 
ATOM   1137  C  CG    . TRP A 1 677  ? 136.385 82.643  130.742 1.00 32.02  ?  549  TRP A CG    1 
ATOM   1138  C  CD1   . TRP A 1 677  ? 136.617 81.304  130.724 1.00 34.45  ?  549  TRP A CD1   1 
ATOM   1139  C  CD2   . TRP A 1 677  ? 137.425 83.241  129.956 1.00 27.47  ?  549  TRP A CD2   1 
ATOM   1140  N  NE1   . TRP A 1 677  ? 137.728 81.025  129.973 1.00 36.82  ?  549  TRP A NE1   1 
ATOM   1141  C  CE2   . TRP A 1 677  ? 138.242 82.197  129.488 1.00 27.95  ?  549  TRP A CE2   1 
ATOM   1142  C  CE3   . TRP A 1 677  ? 137.738 84.552  129.601 1.00 30.55  ?  549  TRP A CE3   1 
ATOM   1143  C  CZ2   . TRP A 1 677  ? 139.345 82.417  128.687 1.00 32.27  ?  549  TRP A CZ2   1 
ATOM   1144  C  CZ3   . TRP A 1 677  ? 138.833 84.771  128.804 1.00 31.08  ?  549  TRP A CZ3   1 
ATOM   1145  C  CH2   . TRP A 1 677  ? 139.631 83.707  128.357 1.00 33.07  ?  549  TRP A CH2   1 
ATOM   1146  N  N     . ASP A 1 678  ? 134.701 83.743  128.306 1.00 32.98  ?  550  ASP A N     1 
ATOM   1147  C  CA    . ASP A 1 678  ? 135.280 84.523  127.217 1.00 38.07  ?  550  ASP A CA    1 
ATOM   1148  C  C     . ASP A 1 678  ? 134.273 85.432  126.528 1.00 34.06  ?  550  ASP A C     1 
ATOM   1149  O  O     . ASP A 1 678  ? 134.683 86.295  125.747 1.00 32.50  ?  550  ASP A O     1 
ATOM   1150  C  CB    . ASP A 1 678  ? 135.929 83.605  126.168 1.00 53.55  ?  550  ASP A CB    1 
ATOM   1151  C  CG    . ASP A 1 678  ? 134.909 82.880  125.293 1.00 89.56  ?  550  ASP A CG    1 
ATOM   1152  O  OD1   . ASP A 1 678  ? 133.793 82.581  125.772 1.00 64.37  ?  550  ASP A OD1   1 
ATOM   1153  O  OD2   . ASP A 1 678  ? 135.224 82.619  124.111 1.00 229.03 -1 550  ASP A OD2   1 
ATOM   1154  N  N     . VAL A 1 679  ? 132.982 85.270  126.804 1.00 28.12  ?  551  VAL A N     1 
ATOM   1155  C  CA    . VAL A 1 679  ? 131.982 86.137  126.204 1.00 21.47  ?  551  VAL A CA    1 
ATOM   1156  C  C     . VAL A 1 679  ? 132.177 87.570  126.687 1.00 20.42  ?  551  VAL A C     1 
ATOM   1157  O  O     . VAL A 1 679  ? 132.826 87.834  127.700 1.00 21.75  ?  551  VAL A O     1 
ATOM   1158  C  CB    . VAL A 1 679  ? 130.568 85.627  126.531 1.00 23.86  ?  551  VAL A CB    1 
ATOM   1159  C  CG1   . VAL A 1 679  ? 130.295 84.325  125.796 1.00 27.15  ?  551  VAL A CG1   1 
ATOM   1160  C  CG2   . VAL A 1 679  ? 130.392 85.439  128.025 1.00 26.31  ?  551  VAL A CG2   1 
ATOM   1161  N  N     . GLY A 1 680  ? 131.612 88.507  125.932 1.00 21.03  ?  552  GLY A N     1 
ATOM   1162  C  CA    . GLY A 1 680  ? 131.635 89.912  126.287 1.00 18.34  ?  552  GLY A CA    1 
ATOM   1163  C  C     . GLY A 1 680  ? 130.256 90.542  126.347 1.00 16.63  ?  552  GLY A C     1 
ATOM   1164  O  O     . GLY A 1 680  ? 129.398 90.081  127.101 1.00 17.37  ?  552  GLY A O     1 
ATOM   1165  N  N     . ILE A 1 681  ? 130.030 91.586  125.544 1.00 14.04  ?  553  ILE A N     1 
ATOM   1166  C  CA    . ILE A 1 681  ? 128.766 92.315  125.567 1.00 15.76  ?  553  ILE A CA    1 
ATOM   1167  C  C     . ILE A 1 681  ? 127.610 91.381  125.253 1.00 14.81  ?  553  ILE A C     1 
ATOM   1168  O  O     . ILE A 1 681  ? 127.701 90.533  124.360 1.00 14.71  ?  553  ILE A O     1 
ATOM   1169  C  CB    . ILE A 1 681  ? 128.824 93.458  124.544 1.00 11.81  ?  553  ILE A CB    1 
ATOM   1170  C  CG1   . ILE A 1 681  ? 130.118 94.249  124.698 1.00 15.22  ?  553  ILE A CG1   1 
ATOM   1171  C  CG2   . ILE A 1 681  ? 127.607 94.342  124.666 1.00 11.72  ?  553  ILE A CG2   1 
ATOM   1172  C  CD1   . ILE A 1 681  ? 131.171 93.935  123.633 1.00 27.74  ?  553  ILE A CD1   1 
ATOM   1173  N  N     . ILE A 1 682  ? 126.509 91.527  125.983 1.00 16.47  ?  554  ILE A N     1 
ATOM   1174  C  CA    . ILE A 1 682  ? 125.331 90.687  125.786 1.00 19.72  ?  554  ILE A CA    1 
ATOM   1175  C  C     . ILE A 1 682  ? 124.095 91.571  125.836 1.00 22.37  ?  554  ILE A C     1 
ATOM   1176  O  O     . ILE A 1 682  ? 124.012 92.491  126.656 1.00 20.81  ?  554  ILE A O     1 
ATOM   1177  C  CB    . ILE A 1 682  ? 125.264 89.552  126.833 1.00 21.17  ?  554  ILE A CB    1 
ATOM   1178  C  CG1   . ILE A 1 682  ? 126.430 88.579  126.632 1.00 25.12  ?  554  ILE A CG1   1 
ATOM   1179  C  CG2   . ILE A 1 682  ? 123.955 88.807  126.751 1.00 24.16  ?  554  ILE A CG2   1 
ATOM   1180  C  CD1   . ILE A 1 682  ? 126.427 87.357  127.544 1.00 18.23  ?  554  ILE A CD1   1 
ATOM   1181  N  N     . ASP A 1 683  ? 123.148 91.309  124.936 1.00 30.23  ?  555  ASP A N     1 
ATOM   1182  C  CA    . ASP A 1 683  ? 121.865 91.999  124.956 1.00 30.69  ?  555  ASP A CA    1 
ATOM   1183  C  C     . ASP A 1 683  ? 121.174 91.813  126.303 1.00 29.79  ?  555  ASP A C     1 
ATOM   1184  O  O     . ASP A 1 683  ? 121.219 90.737  126.900 1.00 35.18  ?  555  ASP A O     1 
ATOM   1185  C  CB    . ASP A 1 683  ? 120.980 91.492  123.810 1.00 47.88  ?  555  ASP A CB    1 
ATOM   1186  C  CG    . ASP A 1 683  ? 121.040 89.971  123.631 1.00 106.47 ?  555  ASP A CG    1 
ATOM   1187  O  OD1   . ASP A 1 683  ? 121.754 89.289  124.392 1.00 94.20  ?  555  ASP A OD1   1 
ATOM   1188  O  OD2   . ASP A 1 683  ? 120.365 89.451  122.710 1.00 322.13 -1 555  ASP A OD2   1 
ATOM   1189  N  N     . GLY A 1 684  ? 120.550 92.878  126.792 1.00 28.07  ?  556  GLY A N     1 
ATOM   1190  C  CA    . GLY A 1 684  ? 120.088 92.952  128.163 1.00 23.10  ?  556  GLY A CA    1 
ATOM   1191  C  C     . GLY A 1 684  ? 118.763 92.303  128.506 1.00 18.93  ?  556  GLY A C     1 
ATOM   1192  O  O     . GLY A 1 684  ? 118.258 92.513  129.610 1.00 21.63  ?  556  GLY A O     1 
ATOM   1193  N  N     . LEU A 1 685  ? 118.165 91.528  127.610 1.00 17.32  ?  557  LEU A N     1 
ATOM   1194  C  CA    . LEU A 1 685  ? 116.880 90.914  127.924 1.00 16.18  ?  557  LEU A CA    1 
ATOM   1195  C  C     . LEU A 1 685  ? 117.028 89.621  128.707 1.00 16.86  ?  557  LEU A C     1 
ATOM   1196  O  O     . LEU A 1 685  ? 116.135 89.272  129.485 1.00 17.88  ?  557  LEU A O     1 
ATOM   1197  C  CB    . LEU A 1 685  ? 116.099 90.631  126.646 1.00 19.74  ?  557  LEU A CB    1 
ATOM   1198  C  CG    . LEU A 1 685  ? 115.765 91.842  125.793 1.00 17.67  ?  557  LEU A CG    1 
ATOM   1199  C  CD1   . LEU A 1 685  ? 115.457 93.011  126.707 1.00 18.48  ?  557  LEU A CD1   1 
ATOM   1200  C  CD2   . LEU A 1 685  ? 116.877 92.174  124.814 1.00 20.91  ?  557  LEU A CD2   1 
ATOM   1201  N  N     . SER A 1 686  ? 118.134 88.908  128.508 1.00 19.14  ?  558  SER A N     1 
ATOM   1202  C  CA    . SER A 1 686  ? 118.351 87.560  129.038 1.00 23.07  ?  558  SER A CA    1 
ATOM   1203  C  C     . SER A 1 686  ? 117.235 86.605  128.622 1.00 22.81  ?  558  SER A C     1 
ATOM   1204  O  O     . SER A 1 686  ? 116.552 86.008  129.456 1.00 22.24  ?  558  SER A O     1 
ATOM   1205  C  CB    . SER A 1 686  ? 118.515 87.574  130.559 1.00 21.86  ?  558  SER A CB    1 
ATOM   1206  O  OG    . SER A 1 686  ? 118.509 86.253  131.073 1.00 21.10  ?  558  SER A OG    1 
ATOM   1207  N  N     . GLY A 1 687  ? 117.048 86.470  127.311 1.00 24.49  ?  559  GLY A N     1 
ATOM   1208  C  CA    . GLY A 1 687  ? 116.145 85.474  126.773 1.00 26.02  ?  559  GLY A CA    1 
ATOM   1209  C  C     . GLY A 1 687  ? 114.693 85.717  127.115 1.00 21.04  ?  559  GLY A C     1 
ATOM   1210  O  O     . GLY A 1 687  ? 114.048 84.881  127.747 1.00 20.97  ?  559  GLY A O     1 
ATOM   1211  N  N     . TRP A 1 688  ? 114.165 86.872  126.736 1.00 19.65  ?  560  TRP A N     1 
ATOM   1212  C  CA    . TRP A 1 688  ? 112.761 87.164  126.989 1.00 21.95  ?  560  TRP A CA    1 
ATOM   1213  C  C     . TRP A 1 688  ? 111.938 86.471  125.918 1.00 23.69  ?  560  TRP A C     1 
ATOM   1214  O  O     . TRP A 1 688  ? 111.981 86.862  124.747 1.00 26.29  ?  560  TRP A O     1 
ATOM   1215  C  CB    . TRP A 1 688  ? 112.515 88.667  126.991 1.00 23.98  ?  560  TRP A CB    1 
ATOM   1216  C  CG    . TRP A 1 688  ? 111.598 89.090  128.058 1.00 26.80  ?  560  TRP A CG    1 
ATOM   1217  C  CD1   . TRP A 1 688  ? 110.965 88.287  128.952 1.00 25.58  ?  560  TRP A CD1   1 
ATOM   1218  C  CD2   . TRP A 1 688  ? 111.217 90.428  128.372 1.00 28.59  ?  560  TRP A CD2   1 
ATOM   1219  N  NE1   . TRP A 1 688  ? 110.197 89.038  129.797 1.00 23.07  ?  560  TRP A NE1   1 
ATOM   1220  C  CE2   . TRP A 1 688  ? 110.336 90.358  129.465 1.00 29.50  ?  560  TRP A CE2   1 
ATOM   1221  C  CE3   . TRP A 1 688  ? 111.530 91.678  127.833 1.00 30.86  ?  560  TRP A CE3   1 
ATOM   1222  C  CZ2   . TRP A 1 688  ? 109.765 91.481  130.030 1.00 25.43  ?  560  TRP A CZ2   1 
ATOM   1223  C  CZ3   . TRP A 1 688  ? 110.965 92.790  128.392 1.00 25.24  ?  560  TRP A CZ3   1 
ATOM   1224  C  CH2   . TRP A 1 688  ? 110.089 92.689  129.482 1.00 29.63  ?  560  TRP A CH2   1 
ATOM   1225  N  N     . THR A 1 689  ? 111.199 85.441  126.315 1.00 24.72  ?  561  THR A N     1 
ATOM   1226  C  CA    . THR A 1 689  ? 110.420 84.665  125.361 1.00 27.33  ?  561  THR A CA    1 
ATOM   1227  C  C     . THR A 1 689  ? 109.515 85.593  124.555 1.00 26.43  ?  561  THR A C     1 
ATOM   1228  O  O     . THR A 1 689  ? 108.616 86.233  125.103 1.00 29.95  ?  561  THR A O     1 
ATOM   1229  C  CB    . THR A 1 689  ? 109.619 83.590  126.098 1.00 26.58  ?  561  THR A CB    1 
ATOM   1230  O  OG1   . THR A 1 689  ? 108.779 84.206  127.081 1.00 30.30  ?  561  THR A OG1   1 
ATOM   1231  C  CG2   . THR A 1 689  ? 110.560 82.615  126.800 1.00 21.03  ?  561  THR A CG2   1 
ATOM   1232  N  N     . VAL A 1 690  ? 109.770 85.668  123.248 1.00 25.95  ?  562  VAL A N     1 
ATOM   1233  C  CA    . VAL A 1 690  ? 109.320 86.772  122.401 1.00 30.47  ?  562  VAL A CA    1 
ATOM   1234  C  C     . VAL A 1 690  ? 107.823 86.687  122.120 1.00 37.01  ?  562  VAL A C     1 
ATOM   1235  O  O     . VAL A 1 690  ? 107.274 87.506  121.373 1.00 39.50  ?  562  VAL A O     1 
ATOM   1236  C  CB    . VAL A 1 690  ? 110.121 86.802  121.083 1.00 32.40  ?  562  VAL A CB    1 
ATOM   1237  C  CG1   . VAL A 1 690  ? 109.600 85.747  120.107 1.00 37.41  ?  562  VAL A CG1   1 
ATOM   1238  C  CG2   . VAL A 1 690  ? 110.122 88.198  120.459 1.00 29.94  ?  562  VAL A CG2   1 
ATOM   1239  N  N     . SER A 1 691  ? 107.154 85.696  122.705 1.00 38.84  ?  563  SER A N     1 
ATOM   1240  C  CA    . SER A 1 691  ? 105.731 85.484  122.454 1.00 45.51  ?  563  SER A CA    1 
ATOM   1241  C  C     . SER A 1 691  ? 104.929 86.771  122.626 1.00 44.66  ?  563  SER A C     1 
ATOM   1242  O  O     . SER A 1 691  ? 105.041 87.456  123.644 1.00 45.29  ?  563  SER A O     1 
ATOM   1243  C  CB    . SER A 1 691  ? 105.209 84.394  123.392 1.00 58.47  ?  563  SER A CB    1 
ATOM   1244  O  OG    . SER A 1 691  ? 105.617 84.633  124.722 1.00 61.33  ?  563  SER A OG    1 
ATOM   1245  N  N     . VAL A 1 692  ? 104.108 87.084  121.622 1.00 46.39  ?  564  VAL A N     1 
ATOM   1246  C  CA    . VAL A 1 692  ? 103.478 88.399  121.544 1.00 47.33  ?  564  VAL A CA    1 
ATOM   1247  C  C     . VAL A 1 692  ? 102.413 88.548  122.618 1.00 41.72  ?  564  VAL A C     1 
ATOM   1248  O  O     . VAL A 1 692  ? 102.469 89.457  123.452 1.00 43.03  ?  564  VAL A O     1 
ATOM   1249  C  CB    . VAL A 1 692  ? 102.878 88.622  120.147 1.00 57.08  ?  564  VAL A CB    1 
ATOM   1250  C  CG1   . VAL A 1 692  ? 101.982 89.844  120.151 1.00 54.33  ?  564  VAL A CG1   1 
ATOM   1251  C  CG2   . VAL A 1 692  ? 103.973 88.776  119.110 1.00 67.01  ?  564  VAL A CG2   1 
ATOM   1252  N  N     . ASP A 1 693  ? 101.421 87.659  122.599 1.00 49.76  ?  565  ASP A N     1 
ATOM   1253  C  CA    . ASP A 1 693  ? 100.300 87.744  123.528 1.00 53.55  ?  565  ASP A CA    1 
ATOM   1254  C  C     . ASP A 1 693  ? 100.738 87.805  124.981 1.00 56.37  ?  565  ASP A C     1 
ATOM   1255  O  O     . ASP A 1 693  ? 100.027 88.372  125.816 1.00 59.94  ?  565  ASP A O     1 
ATOM   1256  C  CB    . ASP A 1 693  ? 99.376  86.550  123.318 1.00 72.42  ?  565  ASP A CB    1 
ATOM   1257  C  CG    . ASP A 1 693  ? 100.117 85.223  123.370 1.00 95.32  ?  565  ASP A CG    1 
ATOM   1258  O  OD1   . ASP A 1 693  ? 101.355 85.231  123.550 1.00 82.41  ?  565  ASP A OD1   1 
ATOM   1259  O  OD2   . ASP A 1 693  ? 99.451  84.170  123.251 1.00 179.74 -1 565  ASP A OD2   1 
ATOM   1260  N  N     . ASP A 1 694  ? 101.899 87.245  125.300 1.00 61.93  ?  566  ASP A N     1 
ATOM   1261  C  CA    . ASP A 1 694  ? 102.393 87.231  126.671 1.00 62.21  ?  566  ASP A CA    1 
ATOM   1262  C  C     . ASP A 1 694  ? 102.847 88.647  127.046 1.00 48.20  ?  566  ASP A C     1 
ATOM   1263  O  O     . ASP A 1 694  ? 102.608 89.618  126.323 1.00 48.19  ?  566  ASP A O     1 
ATOM   1264  C  CB    . ASP A 1 694  ? 103.524 86.214  126.821 1.00 78.01  ?  566  ASP A CB    1 
ATOM   1265  C  CG    . ASP A 1 694  ? 103.110 84.782  126.443 1.00 100.74 ?  566  ASP A CG    1 
ATOM   1266  O  OD1   . ASP A 1 694  ? 101.899 84.489  126.359 1.00 86.02  ?  566  ASP A OD1   1 
ATOM   1267  O  OD2   . ASP A 1 694  ? 104.014 83.933  126.254 1.00 224.02 -1 566  ASP A OD2   1 
ATOM   1268  N  N     . VAL A 1 695  ? 103.503 88.782  128.196 1.00 40.76  ?  567  VAL A N     1 
ATOM   1269  C  CA    . VAL A 1 695  ? 104.101 90.075  128.556 1.00 33.56  ?  567  VAL A CA    1 
ATOM   1270  C  C     . VAL A 1 695  ? 105.080 90.500  127.465 1.00 33.78  ?  567  VAL A C     1 
ATOM   1271  O  O     . VAL A 1 695  ? 105.965 89.714  127.085 1.00 32.48  ?  567  VAL A O     1 
ATOM   1272  C  CB    . VAL A 1 695  ? 104.791 89.987  129.931 1.00 33.80  ?  567  VAL A CB    1 
ATOM   1273  C  CG1   . VAL A 1 695  ? 105.657 88.738  130.042 1.00 25.86  ?  567  VAL A CG1   1 
ATOM   1274  C  CG2   . VAL A 1 695  ? 105.612 91.241  130.201 1.00 33.97  ?  567  VAL A CG2   1 
ATOM   1275  N  N     . PRO A 1 696  ? 104.968 91.710  126.924 1.00 27.42  ?  568  PRO A N     1 
ATOM   1276  C  CA    . PRO A 1 696  ? 105.691 92.050  125.689 1.00 28.98  ?  568  PRO A CA    1 
ATOM   1277  C  C     . PRO A 1 696  ? 107.207 92.053  125.844 1.00 36.59  ?  568  PRO A C     1 
ATOM   1278  O  O     . PRO A 1 696  ? 107.745 92.165  126.948 1.00 35.65  ?  568  PRO A O     1 
ATOM   1279  C  CB    . PRO A 1 696  ? 105.169 93.454  125.358 1.00 30.38  ?  568  PRO A CB    1 
ATOM   1280  C  CG    . PRO A 1 696  ? 103.856 93.552  126.086 1.00 27.30  ?  568  PRO A CG    1 
ATOM   1281  C  CD    . PRO A 1 696  ? 104.045 92.776  127.340 1.00 23.29  ?  568  PRO A CD    1 
ATOM   1282  N  N     . ALA A 1 697  ? 107.897 91.901  124.705 1.00 34.53  ?  569  ALA A N     1 
ATOM   1283  C  CA    . ALA A 1 697  ? 109.358 92.018  124.628 1.00 35.23  ?  569  ALA A CA    1 
ATOM   1284  C  C     . ALA A 1 697  ? 109.708 93.333  123.932 1.00 48.22  ?  569  ALA A C     1 
ATOM   1285  O  O     . ALA A 1 697  ? 110.044 93.375  122.747 1.00 50.63  ?  569  ALA A O     1 
ATOM   1286  C  CB    . ALA A 1 697  ? 109.958 90.824  123.891 1.00 30.10  ?  569  ALA A CB    1 
ATOM   1287  N  N     . ASP A 1 698  ? 109.654 94.422  124.700 1.00 57.66  ?  570  ASP A N     1 
ATOM   1288  C  CA    . ASP A 1 698  ? 109.632 95.777  124.152 1.00 73.03  ?  570  ASP A CA    1 
ATOM   1289  C  C     . ASP A 1 698  ? 110.757 96.687  124.644 1.00 59.35  ?  570  ASP A C     1 
ATOM   1290  O  O     . ASP A 1 698  ? 110.668 97.904  124.463 1.00 66.69  ?  570  ASP A O     1 
ATOM   1291  C  CB    . ASP A 1 698  ? 108.286 96.440  124.477 1.00 104.80 ?  570  ASP A CB    1 
ATOM   1292  C  CG    . ASP A 1 698  ? 107.923 97.561  123.503 1.00 168.41 ?  570  ASP A CG    1 
ATOM   1293  O  OD1   . ASP A 1 698  ? 108.668 97.763  122.520 1.00 168.41 ?  570  ASP A OD1   1 
ATOM   1294  O  OD2   . ASP A 1 698  ? 106.904 98.253  123.732 1.00 212.63 -1 570  ASP A OD2   1 
ATOM   1295  N  N     . THR A 1 699  ? 111.803 96.164  125.266 1.00 43.58  ?  571  THR A N     1 
ATOM   1296  C  CA    . THR A 1 699  ? 112.839 97.011  125.843 1.00 36.25  ?  571  THR A CA    1 
ATOM   1297  C  C     . THR A 1 699  ? 114.157 96.777  125.122 1.00 29.07  ?  571  THR A C     1 
ATOM   1298  O  O     . THR A 1 699  ? 114.504 95.640  124.801 1.00 37.45  ?  571  THR A O     1 
ATOM   1299  C  CB    . THR A 1 699  ? 112.982 96.724  127.342 1.00 31.66  ?  571  THR A CB    1 
ATOM   1300  O  OG1   . THR A 1 699  ? 111.804 97.171  128.021 1.00 32.62  ?  571  THR A OG1   1 
ATOM   1301  C  CG2   . THR A 1 699  ? 114.170 97.444  127.922 1.00 30.55  ?  571  THR A CG2   1 
ATOM   1302  N  N     . ILE A 1 700  ? 114.888 97.852  124.854 1.00 25.56  ?  572  ILE A N     1 
ATOM   1303  C  CA    . ILE A 1 700  ? 116.223 97.767  124.279 1.00 23.05  ?  572  ILE A CA    1 
ATOM   1304  C  C     . ILE A 1 700  ? 117.223 98.083  125.376 1.00 24.97  ?  572  ILE A C     1 
ATOM   1305  O  O     . ILE A 1 700  ? 117.130 99.132  126.022 1.00 27.93  ?  572  ILE A O     1 
ATOM   1306  C  CB    . ILE A 1 700  ? 116.392 98.721  123.086 1.00 31.08  ?  572  ILE A CB    1 
ATOM   1307  C  CG1   . ILE A 1 700  ? 115.565 98.231  121.898 1.00 41.62  ?  572  ILE A CG1   1 
ATOM   1308  C  CG2   . ILE A 1 700  ? 117.839 98.813  122.692 1.00 39.92  ?  572  ILE A CG2   1 
ATOM   1309  C  CD1   . ILE A 1 700  ? 115.811 98.996  120.596 1.00 51.73  ?  572  ILE A CD1   1 
ATOM   1310  N  N     . SER A 1 701  ? 118.173 97.179  125.588 1.00 26.31  ?  573  SER A N     1 
ATOM   1311  C  CA    . SER A 1 701  ? 119.103 97.300  126.698 1.00 26.24  ?  573  SER A CA    1 
ATOM   1312  C  C     . SER A 1 701  ? 120.339 96.476  126.401 1.00 21.88  ?  573  SER A C     1 
ATOM   1313  O  O     . SER A 1 701  ? 120.284 95.491  125.662 1.00 23.75  ?  573  SER A O     1 
ATOM   1314  C  CB    . SER A 1 701  ? 118.462 96.836  128.010 1.00 26.91  ?  573  SER A CB    1 
ATOM   1315  O  OG    . SER A 1 701  ? 118.214 95.444  127.994 1.00 25.30  ?  573  SER A OG    1 
ATOM   1316  N  N     . ARG A 1 702  ? 121.452 96.883  126.992 1.00 23.26  ?  574  ARG A N     1 
ATOM   1317  C  CA    . ARG A 1 702  ? 122.673 96.103  126.871 1.00 21.77  ?  574  ARG A CA    1 
ATOM   1318  C  C     . ARG A 1 702  ? 123.401 96.127  128.207 1.00 21.49  ?  574  ARG A C     1 
ATOM   1319  O  O     . ARG A 1 702  ? 123.170 96.998  129.052 1.00 23.39  ?  574  ARG A O     1 
ATOM   1320  C  CB    . ARG A 1 702  ? 123.582 96.627  125.755 1.00 25.53  ?  574  ARG A CB    1 
ATOM   1321  C  CG    . ARG A 1 702  ? 122.940 96.577  124.373 1.00 24.22  ?  574  ARG A CG    1 
ATOM   1322  C  CD    . ARG A 1 702  ? 122.876 95.168  123.813 1.00 23.66  ?  574  ARG A CD    1 
ATOM   1323  N  NE    . ARG A 1 702  ? 122.521 95.157  122.398 1.00 27.42  ?  574  ARG A NE    1 
ATOM   1324  C  CZ    . ARG A 1 702  ? 121.340 94.763  121.938 1.00 23.36  ?  574  ARG A CZ    1 
ATOM   1325  N  NH1   . ARG A 1 702  ? 120.403 94.369  122.793 1.00 24.00  ?  574  ARG A NH1   1 
ATOM   1326  N  NH2   . ARG A 1 702  ? 121.080 94.777  120.635 1.00 30.05  ?  574  ARG A NH2   1 
ATOM   1327  N  N     . ARG A 1 703  ? 124.283 95.155  128.396 1.00 18.96  ?  575  ARG A N     1 
ATOM   1328  C  CA    . ARG A 1 703  ? 124.969 94.988  129.671 1.00 15.92  ?  575  ARG A CA    1 
ATOM   1329  C  C     . ARG A 1 703  ? 126.088 93.976  129.487 1.00 14.31  ?  575  ARG A C     1 
ATOM   1330  O  O     . ARG A 1 703  ? 126.289 93.422  128.402 1.00 15.69  ?  575  ARG A O     1 
ATOM   1331  C  CB    . ARG A 1 703  ? 124.013 94.516  130.765 1.00 15.30  ?  575  ARG A CB    1 
ATOM   1332  C  CG    . ARG A 1 703  ? 123.690 93.028  130.689 1.00 13.71  ?  575  ARG A CG    1 
ATOM   1333  C  CD    . ARG A 1 703  ? 122.873 92.601  131.882 1.00 16.53  ?  575  ARG A CD    1 
ATOM   1334  N  NE    . ARG A 1 703  ? 122.621 91.164  131.935 1.00 18.09  ?  575  ARG A NE    1 
ATOM   1335  C  CZ    . ARG A 1 703  ? 123.529 90.262  132.282 1.00 19.55  ?  575  ARG A CZ    1 
ATOM   1336  N  NH1   . ARG A 1 703  ? 124.753 90.652  132.621 1.00 20.22  ?  575  ARG A NH1   1 
ATOM   1337  N  NH2   . ARG A 1 703  ? 123.205 88.975  132.306 1.00 19.11  ?  575  ARG A NH2   1 
ATOM   1338  N  N     . PHE A 1 704  ? 126.807 93.741  130.574 1.00 12.93  ?  576  PHE A N     1 
ATOM   1339  C  CA    . PHE A 1 704  ? 127.862 92.757  130.681 1.00 12.21  ?  576  PHE A CA    1 
ATOM   1340  C  C     . PHE A 1 704  ? 127.433 91.675  131.658 1.00 12.63  ?  576  PHE A C     1 
ATOM   1341  O  O     . PHE A 1 704  ? 126.381 91.753  132.294 1.00 15.36  ?  576  PHE A O     1 
ATOM   1342  C  CB    . PHE A 1 704  ? 129.174 93.399  131.175 1.00 14.14  ?  576  PHE A CB    1 
ATOM   1343  C  CG    . PHE A 1 704  ? 129.754 94.467  130.262 1.00 15.40  ?  576  PHE A CG    1 
ATOM   1344  C  CD1   . PHE A 1 704  ? 129.475 94.487  128.916 1.00 19.35  ?  576  PHE A CD1   1 
ATOM   1345  C  CD2   . PHE A 1 704  ? 130.613 95.432  130.757 1.00 15.16  ?  576  PHE A CD2   1 
ATOM   1346  C  CE1   . PHE A 1 704  ? 130.040 95.439  128.106 1.00 12.92  ?  576  PHE A CE1   1 
ATOM   1347  C  CE2   . PHE A 1 704  ? 131.161 96.388  129.935 1.00 26.18  ?  576  PHE A CE2   1 
ATOM   1348  C  CZ    . PHE A 1 704  ? 130.874 96.387  128.623 1.00 27.55  ?  576  PHE A CZ    1 
ATOM   1349  N  N     . ARG A 1 705  ? 128.255 90.644  131.753 1.00 17.05  ?  577  ARG A N     1 
ATOM   1350  C  CA    . ARG A 1 705  ? 128.297 89.842  132.962 1.00 19.60  ?  577  ARG A CA    1 
ATOM   1351  C  C     . ARG A 1 705  ? 129.131 90.607  133.977 1.00 22.47  ?  577  ARG A C     1 
ATOM   1352  O  O     . ARG A 1 705  ? 130.311 90.885  133.733 1.00 21.87  ?  577  ARG A O     1 
ATOM   1353  C  CB    . ARG A 1 705  ? 128.878 88.457  132.687 1.00 23.68  ?  577  ARG A CB    1 
ATOM   1354  C  CG    . ARG A 1 705  ? 127.943 87.580  131.883 1.00 19.72  ?  577  ARG A CG    1 
ATOM   1355  C  CD    . ARG A 1 705  ? 128.518 86.214  131.668 1.00 22.07  ?  577  ARG A CD    1 
ATOM   1356  N  NE    . ARG A 1 705  ? 128.752 85.544  132.935 1.00 27.11  ?  577  ARG A NE    1 
ATOM   1357  C  CZ    . ARG A 1 705  ? 129.057 84.260  133.046 1.00 37.15  ?  577  ARG A CZ    1 
ATOM   1358  N  NH1   . ARG A 1 705  ? 129.174 83.502  131.962 1.00 37.25  ?  577  ARG A NH1   1 
ATOM   1359  N  NH2   . ARG A 1 705  ? 129.261 83.737  134.245 1.00 38.55  ?  577  ARG A NH2   1 
ATOM   1360  N  N     . TYR A 1 706  ? 128.490 90.987  135.083 1.00 21.61  ?  578  TYR A N     1 
ATOM   1361  C  CA    . TYR A 1 706  ? 129.124 91.763  136.142 1.00 22.76  ?  578  TYR A CA    1 
ATOM   1362  C  C     . TYR A 1 706  ? 130.532 91.283  136.448 1.00 21.28  ?  578  TYR A C     1 
ATOM   1363  O  O     . TYR A 1 706  ? 131.472 92.078  136.542 1.00 20.08  ?  578  TYR A O     1 
ATOM   1364  C  CB    . TYR A 1 706  ? 128.274 91.669  137.408 1.00 26.94  ?  578  TYR A CB    1 
ATOM   1365  C  CG    . TYR A 1 706  ? 128.446 92.831  138.342 1.00 27.50  ?  578  TYR A CG    1 
ATOM   1366  C  CD1   . TYR A 1 706  ? 129.498 92.866  139.238 1.00 29.61  ?  578  TYR A CD1   1 
ATOM   1367  C  CD2   . TYR A 1 706  ? 127.527 93.861  138.370 1.00 24.89  ?  578  TYR A CD2   1 
ATOM   1368  C  CE1   . TYR A 1 706  ? 129.662 93.920  140.101 1.00 25.70  ?  578  TYR A CE1   1 
ATOM   1369  C  CE2   . TYR A 1 706  ? 127.679 94.921  139.231 1.00 27.70  ?  578  TYR A CE2   1 
ATOM   1370  C  CZ    . TYR A 1 706  ? 128.747 94.944  140.097 1.00 31.38  ?  578  TYR A CZ    1 
ATOM   1371  O  OH    . TYR A 1 706  ? 128.906 95.994  140.964 1.00 32.36  ?  578  TYR A OH    1 
ATOM   1372  N  N     . ASP A 1 707  ? 130.674 89.971  136.638 1.00 23.72  ?  579  ASP A N     1 
ATOM   1373  C  CA    . ASP A 1 707  ? 131.963 89.396  136.996 1.00 23.44  ?  579  ASP A CA    1 
ATOM   1374  C  C     . ASP A 1 707  ? 133.013 89.669  135.930 1.00 26.54  ?  579  ASP A C     1 
ATOM   1375  O  O     . ASP A 1 707  ? 134.170 89.971  136.249 1.00 26.20  ?  579  ASP A O     1 
ATOM   1376  C  CB    . ASP A 1 707  ? 131.813 87.892  137.239 1.00 33.53  ?  579  ASP A CB    1 
ATOM   1377  C  CG    . ASP A 1 707  ? 131.549 87.103  135.960 1.00 46.23  ?  579  ASP A CG    1 
ATOM   1378  O  OD1   . ASP A 1 707  ? 130.888 87.636  135.043 1.00 32.58  ?  579  ASP A OD1   1 
ATOM   1379  O  OD2   . ASP A 1 707  ? 132.028 85.953  135.866 1.00 193.44 -1 579  ASP A OD2   1 
ATOM   1380  N  N     . VAL A 1 708  ? 132.635 89.552  134.658 1.00 24.96  ?  580  VAL A N     1 
ATOM   1381  C  CA    . VAL A 1 708  ? 133.585 89.812  133.585 1.00 23.91  ?  580  VAL A CA    1 
ATOM   1382  C  C     . VAL A 1 708  ? 134.012 91.275  133.614 1.00 21.92  ?  580  VAL A C     1 
ATOM   1383  O  O     . VAL A 1 708  ? 135.183 91.607  133.386 1.00 20.99  ?  580  VAL A O     1 
ATOM   1384  C  CB    . VAL A 1 708  ? 132.969 89.406  132.234 1.00 20.94  ?  580  VAL A CB    1 
ATOM   1385  C  CG1   . VAL A 1 708  ? 133.908 89.708  131.116 1.00 15.07  ?  580  VAL A CG1   1 
ATOM   1386  C  CG2   . VAL A 1 708  ? 132.621 87.925  132.233 1.00 22.74  ?  580  VAL A CG2   1 
ATOM   1387  N  N     . ALA A 1 709  ? 133.075 92.164  133.950 1.00 19.92  ?  581  ALA A N     1 
ATOM   1388  C  CA    . ALA A 1 709  ? 133.395 93.579  134.110 1.00 16.89  ?  581  ALA A CA    1 
ATOM   1389  C  C     . ALA A 1 709  ? 134.420 93.783  135.213 1.00 16.04  ?  581  ALA A C     1 
ATOM   1390  O  O     . ALA A 1 709  ? 135.425 94.485  135.037 1.00 16.99  ?  581  ALA A O     1 
ATOM   1391  C  CB    . ALA A 1 709  ? 132.119 94.359  134.419 1.00 19.74  ?  581  ALA A CB    1 
ATOM   1392  N  N     . LEU A 1 710  ? 134.155 93.193  136.374 1.00 15.15  ?  582  LEU A N     1 
ATOM   1393  C  CA    . LEU A 1 710  ? 135.053 93.326  137.508 1.00 14.70  ?  582  LEU A CA    1 
ATOM   1394  C  C     . LEU A 1 710  ? 136.445 92.819  137.162 1.00 16.03  ?  582  LEU A C     1 
ATOM   1395  O  O     . LEU A 1 710  ? 137.448 93.449  137.507 1.00 16.53  ?  582  LEU A O     1 
ATOM   1396  C  CB    . LEU A 1 710  ? 134.486 92.558  138.696 1.00 15.39  ?  582  LEU A CB    1 
ATOM   1397  C  CG    . LEU A 1 710  ? 133.240 93.126  139.367 1.00 20.20  ?  582  LEU A CG    1 
ATOM   1398  C  CD1   . LEU A 1 710  ? 133.183 92.689  140.825 1.00 21.03  ?  582  LEU A CD1   1 
ATOM   1399  C  CD2   . LEU A 1 710  ? 133.195 94.627  139.235 1.00 23.83  ?  582  LEU A CD2   1 
ATOM   1400  N  N     . VAL A 1 711  ? 136.525 91.645  136.527 1.00 16.24  ?  583  VAL A N     1 
ATOM   1401  C  CA    . VAL A 1 711  ? 137.835 91.067  136.248 1.00 16.03  ?  583  VAL A CA    1 
ATOM   1402  C  C     . VAL A 1 711  ? 138.564 91.898  135.209 1.00 18.95  ?  583  VAL A C     1 
ATOM   1403  O  O     . VAL A 1 711  ? 139.787 92.051  135.273 1.00 21.68  ?  583  VAL A O     1 
ATOM   1404  C  CB    . VAL A 1 711  ? 137.745 89.584  135.826 1.00 21.33  ?  583  VAL A CB    1 
ATOM   1405  C  CG1   . VAL A 1 711  ? 137.204 88.720  136.957 1.00 26.31  ?  583  VAL A CG1   1 
ATOM   1406  C  CG2   . VAL A 1 711  ? 136.936 89.396  134.564 1.00 22.74  ?  583  VAL A CG2   1 
ATOM   1407  N  N     . SER A 1 712  ? 137.836 92.460  134.245 1.00 18.12  ?  584  SER A N     1 
ATOM   1408  C  CA    . SER A 1 712  ? 138.463 93.417  133.346 1.00 18.94  ?  584  SER A CA    1 
ATOM   1409  C  C     . SER A 1 712  ? 139.054 94.578  134.136 1.00 21.06  ?  584  SER A C     1 
ATOM   1410  O  O     . SER A 1 712  ? 140.208 94.964  133.931 1.00 25.15  ?  584  SER A O     1 
ATOM   1411  C  CB    . SER A 1 712  ? 137.440 93.906  132.326 1.00 17.62  ?  584  SER A CB    1 
ATOM   1412  O  OG    . SER A 1 712  ? 137.986 94.884  131.460 1.00 22.22  ?  584  SER A OG    1 
ATOM   1413  N  N     . ALA A 1 713  ? 138.282 95.112  135.083 1.00 18.69  ?  585  ALA A N     1 
ATOM   1414  C  CA    . ALA A 1 713  ? 138.735 96.257  135.868 1.00 19.64  ?  585  ALA A CA    1 
ATOM   1415  C  C     . ALA A 1 713  ? 139.974 95.927  136.693 1.00 23.58  ?  585  ALA A C     1 
ATOM   1416  O  O     . ALA A 1 713  ? 140.927 96.717  136.756 1.00 32.31  ?  585  ALA A O     1 
ATOM   1417  C  CB    . ALA A 1 713  ? 137.599 96.729  136.766 1.00 17.30  ?  585  ALA A CB    1 
ATOM   1418  N  N     . LEU A 1 714  ? 139.977 94.762  137.335 1.00 21.05  ?  586  LEU A N     1 
ATOM   1419  C  CA    . LEU A 1 714  ? 141.100 94.392  138.190 1.00 22.78  ?  586  LEU A CA    1 
ATOM   1420  C  C     . LEU A 1 714  ? 142.342 94.065  137.356 1.00 33.74  ?  586  LEU A C     1 
ATOM   1421  O  O     . LEU A 1 714  ? 143.436 94.572  137.632 1.00 38.65  ?  586  LEU A O     1 
ATOM   1422  C  CB    . LEU A 1 714  ? 140.707 93.215  139.091 1.00 23.32  ?  586  LEU A CB    1 
ATOM   1423  C  CG    . LEU A 1 714  ? 141.475 92.962  140.398 1.00 29.70  ?  586  LEU A CG    1 
ATOM   1424  C  CD1   . LEU A 1 714  ? 140.599 92.346  141.488 1.00 29.46  ?  586  LEU A CD1   1 
ATOM   1425  C  CD2   . LEU A 1 714  ? 142.692 92.090  140.157 1.00 33.96  ?  586  LEU A CD2   1 
ATOM   1426  N  N     . LYS A 1 715  ? 142.203 93.207  136.336 1.00 31.50  ?  587  LYS A N     1 
ATOM   1427  C  CA    . LYS A 1 715  ? 143.328 92.916  135.448 1.00 34.34  ?  587  LYS A CA    1 
ATOM   1428  C  C     . LYS A 1 715  ? 143.820 94.171  134.755 1.00 35.47  ?  587  LYS A C     1 
ATOM   1429  O  O     . LYS A 1 715  ? 144.965 94.225  134.294 1.00 36.24  ?  587  LYS A O     1 
ATOM   1430  C  CB    . LYS A 1 715  ? 142.927 91.874  134.404 1.00 31.43  ?  587  LYS A CB    1 
ATOM   1431  C  CG    . LYS A 1 715  ? 144.097 91.289  133.618 1.00 30.42  ?  587  LYS A CG    1 
ATOM   1432  C  CD    . LYS A 1 715  ? 144.125 89.772  133.679 1.00 32.63  ?  587  LYS A CD    1 
ATOM   1433  C  CE    . LYS A 1 715  ? 145.230 89.229  132.793 1.00 32.18  ?  587  LYS A CE    1 
ATOM   1434  N  NZ    . LYS A 1 715  ? 145.164 89.812  131.425 1.00 24.70  ?  587  LYS A NZ    1 
ATOM   1435  N  N     . ASP A 1 716  ? 142.957 95.174  134.655 1.00 37.15  ?  588  ASP A N     1 
ATOM   1436  C  CA    . ASP A 1 716  ? 143.361 96.473  134.157 1.00 41.71  ?  588  ASP A CA    1 
ATOM   1437  C  C     . ASP A 1 716  ? 144.244 97.192  135.169 1.00 38.17  ?  588  ASP A C     1 
ATOM   1438  O  O     . ASP A 1 716  ? 145.329 97.675  134.830 1.00 46.28  ?  588  ASP A O     1 
ATOM   1439  C  CB    . ASP A 1 716  ? 142.099 97.269  133.836 1.00 41.09  ?  588  ASP A CB    1 
ATOM   1440  C  CG    . ASP A 1 716  ? 142.397 98.620  133.261 1.00 65.86  ?  588  ASP A CG    1 
ATOM   1441  O  OD1   . ASP A 1 716  ? 142.619 99.557  134.056 1.00 214.07 -1 588  ASP A OD1   1 
ATOM   1442  O  OD2   . ASP A 1 716  ? 142.400 98.750  132.019 1.00 57.64  ?  588  ASP A OD2   1 
ATOM   1443  N  N     . LEU A 1 717  ? 143.813 97.243  136.423 1.00 36.54  ?  589  LEU A N     1 
ATOM   1444  C  CA    . LEU A 1 717  ? 144.610 97.898  137.454 1.00 44.22  ?  589  LEU A CA    1 
ATOM   1445  C  C     . LEU A 1 717  ? 145.844 97.098  137.844 1.00 51.19  ?  589  LEU A C     1 
ATOM   1446  O  O     . LEU A 1 717  ? 146.620 97.569  138.687 1.00 59.14  ?  589  LEU A O     1 
ATOM   1447  C  CB    . LEU A 1 717  ? 143.749 98.160  138.692 1.00 39.51  ?  589  LEU A CB    1 
ATOM   1448  C  CG    . LEU A 1 717  ? 142.500 99.018  138.501 1.00 37.14  ?  589  LEU A CG    1 
ATOM   1449  C  CD1   . LEU A 1 717  ? 142.084 99.669  139.810 1.00 32.42  ?  589  LEU A CD1   1 
ATOM   1450  C  CD2   . LEU A 1 717  ? 142.722 100.067 137.440 1.00 48.90  ?  589  LEU A CD2   1 
ATOM   1451  N  N     . GLU A 1 718  ? 146.018 95.907  137.257 1.00 55.62  ?  590  GLU A N     1 
ATOM   1452  C  CA    . GLU A 1 718  ? 147.149 95.021  137.548 1.00 72.12  ?  590  GLU A CA    1 
ATOM   1453  C  C     . GLU A 1 718  ? 148.451 95.785  137.781 1.00 79.19  ?  590  GLU A C     1 
ATOM   1454  O  O     . GLU A 1 718  ? 149.156 95.566  138.777 1.00 81.52  ?  590  GLU A O     1 
ATOM   1455  C  CB    . GLU A 1 718  ? 147.322 94.040  136.378 1.00 78.76  ?  590  GLU A CB    1 
ATOM   1456  C  CG    . GLU A 1 718  ? 147.891 92.673  136.750 1.00 94.93  ?  590  GLU A CG    1 
ATOM   1457  C  CD    . GLU A 1 718  ? 149.382 92.669  137.056 1.00 131.04 ?  590  GLU A CD    1 
ATOM   1458  O  OE1   . GLU A 1 718  ? 149.975 93.762  137.162 1.00 131.75 ?  590  GLU A OE1   1 
ATOM   1459  O  OE2   . GLU A 1 718  ? 149.948 91.561  137.178 1.00 188.17 -1 590  GLU A OE2   1 
ATOM   1460  N  N     . GLU A 1 719  ? 148.781 96.693  136.858 1.00 73.72  ?  591  GLU A N     1 
ATOM   1461  C  CA    . GLU A 1 719  ? 149.986 97.501  137.004 1.00 80.81  ?  591  GLU A CA    1 
ATOM   1462  C  C     . GLU A 1 719  ? 150.008 98.242  138.335 1.00 74.72  ?  591  GLU A C     1 
ATOM   1463  O  O     . GLU A 1 719  ? 150.968 98.135  139.106 1.00 79.42  ?  591  GLU A O     1 
ATOM   1464  C  CB    . GLU A 1 719  ? 150.102 98.488  135.838 1.00 89.52  ?  591  GLU A CB    1 
ATOM   1465  C  CG    . GLU A 1 719  ? 150.926 99.737  136.165 1.00 103.89 ?  591  GLU A CG    1 
ATOM   1466  C  CD    . GLU A 1 719  ? 152.413 99.587  135.873 1.00 129.66 ?  591  GLU A CD    1 
ATOM   1467  O  OE1   . GLU A 1 719  ? 152.854 98.460  135.570 1.00 121.99 ?  591  GLU A OE1   1 
ATOM   1468  O  OE2   . GLU A 1 719  ? 153.135 100.605 135.956 1.00 214.11 -1 591  GLU A OE2   1 
ATOM   1469  N  N     . ASP A 1 720  ? 148.950 99.005  138.620 1.00 72.58  ?  592  ASP A N     1 
ATOM   1470  C  CA    . ASP A 1 720  ? 148.961 99.855  139.804 1.00 75.23  ?  592  ASP A CA    1 
ATOM   1471  C  C     . ASP A 1 720  ? 148.936 99.027  141.080 1.00 70.50  ?  592  ASP A C     1 
ATOM   1472  O  O     . ASP A 1 720  ? 149.539 99.414  142.086 1.00 72.26  ?  592  ASP A O     1 
ATOM   1473  C  CB    . ASP A 1 720  ? 147.780 100.822 139.756 1.00 78.84  ?  592  ASP A CB    1 
ATOM   1474  C  CG    . ASP A 1 720  ? 147.707 101.590 138.442 1.00 96.04  ?  592  ASP A CG    1 
ATOM   1475  O  OD1   . ASP A 1 720  ? 148.521 101.313 137.539 1.00 90.69  ?  592  ASP A OD1   1 
ATOM   1476  O  OD2   . ASP A 1 720  ? 146.837 102.481 138.316 1.00 179.36 -1 592  ASP A OD2   1 
ATOM   1477  N  N     . ILE A 1 721  ? 148.263 97.877  141.059 1.00 64.15  ?  593  ILE A N     1 
ATOM   1478  C  CA    . ILE A 1 721  ? 148.210 97.068  142.271 1.00 64.82  ?  593  ILE A CA    1 
ATOM   1479  C  C     . ILE A 1 721  ? 149.576 96.460  142.557 1.00 66.09  ?  593  ILE A C     1 
ATOM   1480  O  O     . ILE A 1 721  ? 150.022 96.417  143.711 1.00 68.72  ?  593  ILE A O     1 
ATOM   1481  C  CB    . ILE A 1 721  ? 147.100 96.005  142.181 1.00 61.69  ?  593  ILE A CB    1 
ATOM   1482  C  CG1   . ILE A 1 721  ? 147.416 94.929  141.145 1.00 66.53  ?  593  ILE A CG1   1 
ATOM   1483  C  CG2   . ILE A 1 721  ? 145.783 96.668  141.827 1.00 59.43  ?  593  ILE A CG2   1 
ATOM   1484  C  CD1   . ILE A 1 721  ? 147.871 93.604  141.743 1.00 73.72  ?  593  ILE A CD1   1 
ATOM   1485  N  N     . MET A 1 722  ? 150.283 96.017  141.512 1.00 68.17  ?  594  MET A N     1 
ATOM   1486  C  CA    . MET A 1 722  ? 151.630 95.494  141.726 1.00 72.66  ?  594  MET A CA    1 
ATOM   1487  C  C     . MET A 1 722  ? 152.592 96.595  142.149 1.00 74.21  ?  594  MET A C     1 
ATOM   1488  O  O     . MET A 1 722  ? 153.457 96.381  143.010 1.00 78.46  ?  594  MET A O     1 
ATOM   1489  C  CB    . MET A 1 722  ? 152.136 94.802  140.466 1.00 78.56  ?  594  MET A CB    1 
ATOM   1490  C  CG    . MET A 1 722  ? 151.486 93.463  140.190 1.00 92.18  ?  594  MET A CG    1 
ATOM   1491  S  SD    . MET A 1 722  ? 151.724 92.336  141.577 1.00 84.50  ?  594  MET A SD    1 
ATOM   1492  C  CE    . MET A 1 722  ? 153.513 92.335  141.717 1.00 82.74  ?  594  MET A CE    1 
ATOM   1493  N  N     . GLU A 1 723  ? 152.456 97.780  141.553 1.00 74.20  ?  595  GLU A N     1 
ATOM   1494  C  CA    . GLU A 1 723  ? 153.282 98.915  141.947 1.00 78.62  ?  595  GLU A CA    1 
ATOM   1495  C  C     . GLU A 1 723  ? 153.065 99.277  143.408 1.00 79.61  ?  595  GLU A C     1 
ATOM   1496  O  O     . GLU A 1 723  ? 154.021 99.584  144.128 1.00 83.42  ?  595  GLU A O     1 
ATOM   1497  C  CB    . GLU A 1 723  ? 152.980 100.109 141.039 1.00 84.71  ?  595  GLU A CB    1 
ATOM   1498  C  CG    . GLU A 1 723  ? 153.401 101.457 141.594 1.00 98.03  ?  595  GLU A CG    1 
ATOM   1499  C  CD    . GLU A 1 723  ? 152.275 102.166 142.323 1.00 118.93 ?  595  GLU A CD    1 
ATOM   1500  O  OE1   . GLU A 1 723  ? 151.160 101.607 142.399 1.00 99.55  ?  595  GLU A OE1   1 
ATOM   1501  O  OE2   . GLU A 1 723  ? 152.509 103.279 142.838 1.00 238.91 -1 595  GLU A OE2   1 
ATOM   1502  N  N     . GLY A 1 724  ? 151.813 99.253  143.864 1.00 76.06  ?  596  GLY A N     1 
ATOM   1503  C  CA    . GLY A 1 724  ? 151.542 99.582  145.251 1.00 74.72  ?  596  GLY A CA    1 
ATOM   1504  C  C     . GLY A 1 724  ? 152.039 98.521  146.208 1.00 68.57  ?  596  GLY A C     1 
ATOM   1505  O  O     . GLY A 1 724  ? 152.556 98.838  147.284 1.00 70.73  ?  596  GLY A O     1 
ATOM   1506  N  N     . LEU A 1 725  ? 151.868 97.248  145.841 1.00 72.54  ?  597  LEU A N     1 
ATOM   1507  C  CA    . LEU A 1 725  ? 152.461 96.170  146.625 1.00 76.86  ?  597  LEU A CA    1 
ATOM   1508  C  C     . LEU A 1 725  ? 153.967 96.365  146.763 1.00 81.34  ?  597  LEU A C     1 
ATOM   1509  O  O     . LEU A 1 725  ? 154.534 96.148  147.842 1.00 80.25  ?  597  LEU A O     1 
ATOM   1510  C  CB    . LEU A 1 725  ? 152.145 94.816  145.979 1.00 80.62  ?  597  LEU A CB    1 
ATOM   1511  C  CG    . LEU A 1 725  ? 151.972 93.545  146.832 1.00 86.31  ?  597  LEU A CG    1 
ATOM   1512  C  CD1   . LEU A 1 725  ? 151.493 92.349  146.003 1.00 81.83  ?  597  LEU A CD1   1 
ATOM   1513  C  CD2   . LEU A 1 725  ? 153.256 93.191  147.549 1.00 98.20  ?  597  LEU A CD2   1 
ATOM   1514  N  N     . ARG A 1 726  ? 154.633 96.769  145.675 1.00 84.20  ?  598  ARG A N     1 
ATOM   1515  C  CA    . ARG A 1 726  ? 156.061 97.066  145.747 1.00 86.85  ?  598  ARG A CA    1 
ATOM   1516  C  C     . ARG A 1 726  ? 156.327 98.276  146.631 1.00 78.31  ?  598  ARG A C     1 
ATOM   1517  O  O     . ARG A 1 726  ? 157.352 98.341  147.319 1.00 79.06  ?  598  ARG A O     1 
ATOM   1518  C  CB    . ARG A 1 726  ? 156.633 97.304  144.347 1.00 88.77  ?  598  ARG A CB    1 
ATOM   1519  C  CG    . ARG A 1 726  ? 156.537 96.114  143.397 1.00 91.92  ?  598  ARG A CG    1 
ATOM   1520  C  CD    . ARG A 1 726  ? 157.187 96.412  142.052 1.00 86.27  ?  598  ARG A CD    1 
ATOM   1521  N  NE    . ARG A 1 726  ? 158.592 96.766  142.216 1.00 93.18  ?  598  ARG A NE    1 
ATOM   1522  C  CZ    . ARG A 1 726  ? 159.569 95.884  142.392 1.00 94.37  ?  598  ARG A CZ    1 
ATOM   1523  N  NH1   . ARG A 1 726  ? 159.299 94.583  142.429 1.00 96.90  ?  598  ARG A NH1   1 
ATOM   1524  N  NH2   . ARG A 1 726  ? 160.818 96.304  142.541 1.00 90.00  ?  598  ARG A NH2   1 
ATOM   1525  N  N     . GLU A 1 727  ? 155.423 99.251  146.602 1.00 77.81  ?  599  GLU A N     1 
ATOM   1526  C  CA    . GLU A 1 727  ? 155.579 100.451 147.412 1.00 78.69  ?  599  GLU A CA    1 
ATOM   1527  C  C     . GLU A 1 727  ? 155.399 100.145 148.894 1.00 76.31  ?  599  GLU A C     1 
ATOM   1528  O  O     . GLU A 1 727  ? 156.140 100.664 149.734 1.00 76.26  ?  599  GLU A O     1 
ATOM   1529  C  CB    . GLU A 1 727  ? 154.589 101.511 146.934 1.00 85.79  ?  599  GLU A CB    1 
ATOM   1530  C  CG    . GLU A 1 727  ? 154.782 102.890 147.524 1.00 94.28  ?  599  GLU A CG    1 
ATOM   1531  C  CD    . GLU A 1 727  ? 153.968 103.100 148.783 1.00 113.36 ?  599  GLU A CD    1 
ATOM   1532  O  OE1   . GLU A 1 727  ? 153.215 102.181 149.171 1.00 94.78  ?  599  GLU A OE1   1 
ATOM   1533  O  OE2   . GLU A 1 727  ? 154.079 104.194 149.375 1.00 191.95 -1 599  GLU A OE2   1 
ATOM   1534  N  N     . ARG A 1 728  ? 154.427 99.302  149.240 1.00 72.73  ?  600  ARG A N     1 
ATOM   1535  C  CA    . ARG A 1 728  ? 154.276 98.887  150.630 1.00 65.18  ?  600  ARG A CA    1 
ATOM   1536  C  C     . ARG A 1 728  ? 155.364 97.924  151.075 1.00 70.32  ?  600  ARG A C     1 
ATOM   1537  O  O     . ARG A 1 728  ? 155.327 97.453  152.217 1.00 69.08  ?  600  ARG A O     1 
ATOM   1538  C  CB    . ARG A 1 728  ? 152.896 98.260  150.843 1.00 63.14  ?  600  ARG A CB    1 
ATOM   1539  C  CG    . ARG A 1 728  ? 152.448 98.207  152.301 1.00 63.48  ?  600  ARG A CG    1 
ATOM   1540  C  CD    . ARG A 1 728  ? 152.895 99.439  153.064 1.00 65.15  ?  600  ARG A CD    1 
ATOM   1541  N  NE    . ARG A 1 728  ? 152.241 100.650 152.581 1.00 68.60  ?  600  ARG A NE    1 
ATOM   1542  C  CZ    . ARG A 1 728  ? 151.148 101.179 153.123 1.00 65.27  ?  600  ARG A CZ    1 
ATOM   1543  N  NH1   . ARG A 1 728  ? 150.590 100.614 154.186 1.00 59.67  ?  600  ARG A NH1   1 
ATOM   1544  N  NH2   . ARG A 1 728  ? 150.623 102.286 152.611 1.00 60.77  ?  600  ARG A NH2   1 
ATOM   1545  N  N     . ALA A 1 729  ? 156.318 97.615  150.200 1.00 79.45  ?  601  ALA A N     1 
ATOM   1546  C  CA    . ALA A 1 729  ? 157.476 96.774  150.482 1.00 88.56  ?  601  ALA A CA    1 
ATOM   1547  C  C     . ALA A 1 729  ? 157.098 95.353  150.867 1.00 90.40  ?  601  ALA A C     1 
ATOM   1548  O  O     . ALA A 1 729  ? 157.957 94.591  151.323 1.00 95.51  ?  601  ALA A O     1 
ATOM   1549  C  CB    . ALA A 1 729  ? 158.367 97.388  151.569 1.00 93.29  ?  601  ALA A CB    1 
ATOM   1550  N  N     . LEU A 1 730  ? 155.839 94.973  150.696 1.00 84.41  ?  602  LEU A N     1 
ATOM   1551  C  CA    . LEU A 1 730  ? 155.425 93.631  151.045 1.00 91.72  ?  602  LEU A CA    1 
ATOM   1552  C  C     . LEU A 1 730  ? 156.014 92.626  150.057 1.00 101.53 ?  602  LEU A C     1 
ATOM   1553  O  O     . LEU A 1 730  ? 156.381 92.958  148.927 1.00 100.19 ?  602  LEU A O     1 
ATOM   1554  C  CB    . LEU A 1 730  ? 153.899 93.533  151.058 1.00 93.83  ?  602  LEU A CB    1 
ATOM   1555  C  CG    . LEU A 1 730  ? 153.280 92.247  151.621 1.00 105.44 ?  602  LEU A CG    1 
ATOM   1556  C  CD1   . LEU A 1 730  ? 153.931 91.862  152.940 1.00 114.04 ?  602  LEU A CD1   1 
ATOM   1557  C  CD2   . LEU A 1 730  ? 151.769 92.327  151.765 1.00 99.70  ?  602  LEU A CD2   1 
ATOM   1558  N  N     . ASP A 1 731  ? 156.124 91.385  150.513 1.00 116.54 ?  603  ASP A N     1 
ATOM   1559  C  CA    . ASP A 1 731  ? 156.480 90.287  149.628 1.00 127.11 ?  603  ASP A CA    1 
ATOM   1560  C  C     . ASP A 1 731  ? 155.471 90.200  148.484 1.00 126.58 ?  603  ASP A C     1 
ATOM   1561  O  O     . ASP A 1 731  ? 154.289 90.519  148.639 1.00 121.34 ?  603  ASP A O     1 
ATOM   1562  C  CB    . ASP A 1 731  ? 156.523 88.980  150.435 1.00 142.52 ?  603  ASP A CB    1 
ATOM   1563  C  CG    . ASP A 1 731  ? 156.227 87.748  149.602 1.00 152.46 ?  603  ASP A CG    1 
ATOM   1564  O  OD1   . ASP A 1 731  ? 156.665 87.666  148.436 1.00 149.61 ?  603  ASP A OD1   1 
ATOM   1565  O  OD2   . ASP A 1 731  ? 155.538 86.855  150.131 1.00 187.50 -1 603  ASP A OD2   1 
ATOM   1566  N  N     . ASP A 1 732  ? 155.957 89.768  147.319 1.00 129.93 ?  604  ASP A N     1 
ATOM   1567  C  CA    . ASP A 1 732  ? 155.155 89.723  146.106 1.00 127.09 ?  604  ASP A CA    1 
ATOM   1568  C  C     . ASP A 1 732  ? 154.787 88.315  145.661 1.00 127.23 ?  604  ASP A C     1 
ATOM   1569  O  O     . ASP A 1 732  ? 153.779 88.153  144.969 1.00 116.49 ?  604  ASP A O     1 
ATOM   1570  C  CB    . ASP A 1 732  ? 155.897 90.426  144.958 1.00 132.16 ?  604  ASP A CB    1 
ATOM   1571  C  CG    . ASP A 1 732  ? 156.672 91.652  145.423 1.00 133.52 ?  604  ASP A CG    1 
ATOM   1572  O  OD1   . ASP A 1 732  ? 156.135 92.427  146.239 1.00 116.51 ?  604  ASP A OD1   1 
ATOM   1573  O  OD2   . ASP A 1 732  ? 157.825 91.833  144.982 1.00 190.10 -1 604  ASP A OD2   1 
ATOM   1574  N  N     . SER A 1 733  ? 155.574 87.302  146.034 1.00 134.46 ?  605  SER A N     1 
ATOM   1575  C  CA    . SER A 1 733  ? 155.261 85.922  145.670 1.00 136.42 ?  605  SER A CA    1 
ATOM   1576  C  C     . SER A 1 733  ? 154.246 85.307  146.629 1.00 142.90 ?  605  SER A C     1 
ATOM   1577  O  O     . SER A 1 733  ? 153.153 84.909  146.212 1.00 137.17 ?  605  SER A O     1 
ATOM   1578  C  CB    . SER A 1 733  ? 156.540 85.078  145.627 1.00 132.25 ?  605  SER A CB    1 
ATOM   1579  O  OG    . SER A 1 733  ? 157.354 85.401  144.510 1.00 122.59 ?  605  SER A OG    1 
ATOM   1580  N  N     . MET A 1 734  ? 154.584 85.220  147.915 1.00 151.47 ?  606  MET A N     1 
ATOM   1581  C  CA    . MET A 1 734  ? 153.638 84.756  148.924 1.00 157.90 ?  606  MET A CA    1 
ATOM   1582  C  C     . MET A 1 734  ? 152.693 85.913  149.264 1.00 146.93 ?  606  MET A C     1 
ATOM   1583  O  O     . MET A 1 734  ? 152.704 86.957  148.606 1.00 138.90 ?  606  MET A O     1 
ATOM   1584  C  CB    . MET A 1 734  ? 154.379 84.204  150.143 1.00 174.63 ?  606  MET A CB    1 
ATOM   1585  C  CG    . MET A 1 734  ? 155.042 82.831  149.948 1.00 180.25 ?  606  MET A CG    1 
ATOM   1586  S  SD    . MET A 1 734  ? 153.899 81.516  149.451 1.00 161.96 ?  606  MET A SD    1 
ATOM   1587  C  CE    . MET A 1 734  ? 155.012 80.128  149.238 1.00 136.39 ?  606  MET A CE    1 
ATOM   1588  N  N     . CYS A 1 735  ? 151.868 85.738  150.297 1.00 142.77 ?  607  CYS A N     1 
ATOM   1589  C  CA    . CYS A 1 735  ? 150.773 86.654  150.647 1.00 129.22 ?  607  CYS A CA    1 
ATOM   1590  C  C     . CYS A 1 735  ? 150.048 87.175  149.402 1.00 116.89 ?  607  CYS A C     1 
ATOM   1591  O  O     . CYS A 1 735  ? 149.810 88.374  149.235 1.00 107.55 ?  607  CYS A O     1 
ATOM   1592  C  CB    . CYS A 1 735  ? 151.262 87.810  151.531 1.00 130.16 ?  607  CYS A CB    1 
ATOM   1593  S  SG    . CYS A 1 735  ? 152.521 88.912  150.841 1.00 132.96 ?  607  CYS A SG    1 
ATOM   1594  N  N     . THR A 1 736  ? 149.692 86.244  148.518 1.00 111.26 ?  608  THR A N     1 
ATOM   1595  C  CA    . THR A 1 736  ? 148.957 86.528  147.289 1.00 96.83  ?  608  THR A CA    1 
ATOM   1596  C  C     . THR A 1 736  ? 147.660 85.728  147.227 1.00 85.99  ?  608  THR A C     1 
ATOM   1597  O  O     . THR A 1 736  ? 147.302 85.172  146.185 1.00 79.02  ?  608  THR A O     1 
ATOM   1598  C  CB    . THR A 1 736  ? 149.810 86.245  146.052 1.00 93.10  ?  608  THR A CB    1 
ATOM   1599  O  OG1   . THR A 1 736  ? 150.421 84.951  146.167 1.00 102.77 ?  608  THR A OG1   1 
ATOM   1600  C  CG2   . THR A 1 736  ? 150.884 87.297  145.876 1.00 98.27  ?  608  THR A CG2   1 
ATOM   1601  N  N     . SER A 1 737  ? 146.944 85.646  148.351 1.00 82.93  ?  609  SER A N     1 
ATOM   1602  C  CA    . SER A 1 737  ? 145.663 84.956  148.381 1.00 73.70  ?  609  SER A CA    1 
ATOM   1603  C  C     . SER A 1 737  ? 144.602 85.645  149.231 1.00 69.85  ?  609  SER A C     1 
ATOM   1604  O  O     . SER A 1 737  ? 143.519 85.077  149.400 1.00 69.21  ?  609  SER A O     1 
ATOM   1605  C  CB    . SER A 1 737  ? 145.849 83.514  148.882 1.00 90.15  ?  609  SER A CB    1 
ATOM   1606  O  OG    . SER A 1 737  ? 144.618 82.810  148.906 1.00 105.99 ?  609  SER A OG    1 
ATOM   1607  N  N     . GLY A 1 738  ? 144.862 86.836  149.769 1.00 69.78  ?  610  GLY A N     1 
ATOM   1608  C  CA    . GLY A 1 738  ? 143.941 87.440  150.715 1.00 63.71  ?  610  GLY A CA    1 
ATOM   1609  C  C     . GLY A 1 738  ? 143.595 88.903  150.505 1.00 50.23  ?  610  GLY A C     1 
ATOM   1610  O  O     . GLY A 1 738  ? 143.369 89.625  151.480 1.00 50.62  ?  610  GLY A O     1 
ATOM   1611  N  N     . PHE A 1 739  ? 143.535 89.357  149.256 1.00 47.33  ?  611  PHE A N     1 
ATOM   1612  C  CA    . PHE A 1 739  ? 143.158 90.738  148.987 1.00 41.04  ?  611  PHE A CA    1 
ATOM   1613  C  C     . PHE A 1 739  ? 141.652 90.935  149.137 1.00 36.87  ?  611  PHE A C     1 
ATOM   1614  O  O     . PHE A 1 739  ? 140.854 90.032  148.884 1.00 37.60  ?  611  PHE A O     1 
ATOM   1615  C  CB    . PHE A 1 739  ? 143.585 91.139  147.579 1.00 40.19  ?  611  PHE A CB    1 
ATOM   1616  C  CG    . PHE A 1 739  ? 145.040 90.921  147.296 1.00 47.14  ?  611  PHE A CG    1 
ATOM   1617  C  CD1   . PHE A 1 739  ? 146.005 91.481  148.104 1.00 50.22  ?  611  PHE A CD1   1 
ATOM   1618  C  CD2   . PHE A 1 739  ? 145.440 90.163  146.210 1.00 50.29  ?  611  PHE A CD2   1 
ATOM   1619  C  CE1   . PHE A 1 739  ? 147.346 91.289  147.836 1.00 63.05  ?  611  PHE A CE1   1 
ATOM   1620  C  CE2   . PHE A 1 739  ? 146.779 89.969  145.940 1.00 72.80  ?  611  PHE A CE2   1 
ATOM   1621  C  CZ    . PHE A 1 739  ? 147.730 90.532  146.754 1.00 76.22  ?  611  PHE A CZ    1 
ATOM   1622  N  N     . THR A 1 740  ? 141.266 92.141  149.542 1.00 34.51  ?  612  THR A N     1 
ATOM   1623  C  CA    . THR A 1 740  ? 139.866 92.522  149.708 1.00 29.20  ?  612  THR A CA    1 
ATOM   1624  C  C     . THR A 1 740  ? 139.637 93.810  148.933 1.00 25.41  ?  612  THR A C     1 
ATOM   1625  O  O     . THR A 1 740  ? 140.238 94.841  149.247 1.00 25.31  ?  612  THR A O     1 
ATOM   1626  C  CB    . THR A 1 740  ? 139.520 92.703  151.185 1.00 34.99  ?  612  THR A CB    1 
ATOM   1627  O  OG1   . THR A 1 740  ? 139.717 91.466  151.880 1.00 36.62  ?  612  THR A OG1   1 
ATOM   1628  C  CG2   . THR A 1 740  ? 138.090 93.154  151.357 1.00 36.12  ?  612  THR A CG2   1 
ATOM   1629  N  N     . VAL A 1 741  ? 138.789 93.753  147.916 1.00 24.68  ?  613  VAL A N     1 
ATOM   1630  C  CA    . VAL A 1 741  ? 138.543 94.885  147.035 1.00 23.41  ?  613  VAL A CA    1 
ATOM   1631  C  C     . VAL A 1 741  ? 137.108 95.333  147.271 1.00 19.74  ?  613  VAL A C     1 
ATOM   1632  O  O     . VAL A 1 741  ? 136.170 94.565  147.032 1.00 21.34  ?  613  VAL A O     1 
ATOM   1633  C  CB    . VAL A 1 741  ? 138.771 94.502  145.565 1.00 23.34  ?  613  VAL A CB    1 
ATOM   1634  C  CG1   . VAL A 1 741  ? 138.193 95.538  144.646 1.00 22.71  ?  613  VAL A CG1   1 
ATOM   1635  C  CG2   . VAL A 1 741  ? 140.240 94.270  145.281 1.00 21.33  ?  613  VAL A CG2   1 
ATOM   1636  N  N     . VAL A 1 742  ? 136.928 96.559  147.754 1.00 16.61  ?  614  VAL A N     1 
ATOM   1637  C  CA    . VAL A 1 742  ? 135.601 97.125  147.960 1.00 17.18  ?  614  VAL A CA    1 
ATOM   1638  C  C     . VAL A 1 742  ? 135.324 98.101  146.830 1.00 12.75  ?  614  VAL A C     1 
ATOM   1639  O  O     . VAL A 1 742  ? 136.141 98.990  146.543 1.00 14.37  ?  614  VAL A O     1 
ATOM   1640  C  CB    . VAL A 1 742  ? 135.482 97.807  149.332 1.00 21.50  ?  614  VAL A CB    1 
ATOM   1641  C  CG1   . VAL A 1 742  ? 134.043 98.129  149.631 1.00 20.94  ?  614  VAL A CG1   1 
ATOM   1642  C  CG2   . VAL A 1 742  ? 136.046 96.908  150.419 1.00 27.37  ?  614  VAL A CG2   1 
ATOM   1643  N  N     . VAL A 1 743  ? 134.171 97.931  146.189 1.00 12.40  ?  615  VAL A N     1 
ATOM   1644  C  CA    . VAL A 1 743  ? 133.825 98.634  144.962 1.00 13.84  ?  615  VAL A CA    1 
ATOM   1645  C  C     . VAL A 1 743  ? 132.352 99.003  145.038 1.00 11.56  ?  615  VAL A C     1 
ATOM   1646  O  O     . VAL A 1 743  ? 131.512 98.164  145.382 1.00 13.27  ?  615  VAL A O     1 
ATOM   1647  C  CB    . VAL A 1 743  ? 134.112 97.772  143.720 1.00 21.51  ?  615  VAL A CB    1 
ATOM   1648  C  CG1   . VAL A 1 743  ? 133.548 98.419  142.484 1.00 22.91  ?  615  VAL A CG1   1 
ATOM   1649  C  CG2   . VAL A 1 743  ? 135.592 97.540  143.573 1.00 21.50  ?  615  VAL A CG2   1 
ATOM   1650  N  N     . LYS A 1 744  ? 132.048 100.263 144.732 1.00 14.17  ?  616  LYS A N     1 
ATOM   1651  C  CA    . LYS A 1 744  ? 130.717 100.831 144.880 1.00 14.11  ?  616  LYS A CA    1 
ATOM   1652  C  C     . LYS A 1 744  ? 129.980 100.806 143.554 1.00 12.90  ?  616  LYS A C     1 
ATOM   1653  O  O     . LYS A 1 744  ? 130.536 101.161 142.513 1.00 17.78  ?  616  LYS A O     1 
ATOM   1654  C  CB    . LYS A 1 744  ? 130.796 102.273 145.389 1.00 14.18  ?  616  LYS A CB    1 
ATOM   1655  C  CG    . LYS A 1 744  ? 129.627 103.156 144.983 1.00 14.34  ?  616  LYS A CG    1 
ATOM   1656  C  CD    . LYS A 1 744  ? 130.078 104.591 144.790 1.00 13.41  ?  616  LYS A CD    1 
ATOM   1657  C  CE    . LYS A 1 744  ? 131.107 104.672 143.690 1.00 14.83  ?  616  LYS A CE    1 
ATOM   1658  N  NZ    . LYS A 1 744  ? 131.681 106.030 143.514 1.00 16.71  ?  616  LYS A NZ    1 
ATOM   1659  N  N     . GLU A 1 745  ? 128.728 100.382 143.604 1.00 14.02  ?  617  GLU A N     1 
ATOM   1660  C  CA    . GLU A 1 745  ? 127.822 100.450 142.475 1.00 16.15  ?  617  GLU A CA    1 
ATOM   1661  C  C     . GLU A 1 745  ? 126.903 101.642 142.648 1.00 12.46  ?  617  GLU A C     1 
ATOM   1662  O  O     . GLU A 1 745  ? 126.784 102.214 143.730 1.00 16.62  ?  617  GLU A O     1 
ATOM   1663  C  CB    . GLU A 1 745  ? 127.011 99.161  142.365 1.00 23.26  ?  617  GLU A CB    1 
ATOM   1664  C  CG    . GLU A 1 745  ? 126.249 98.812  143.632 1.00 27.78  ?  617  GLU A CG    1 
ATOM   1665  C  CD    . GLU A 1 745  ? 125.756 97.366  143.664 1.00 52.90  ?  617  GLU A CD    1 
ATOM   1666  O  OE1   . GLU A 1 745  ? 125.943 96.627  142.675 1.00 39.76  ?  617  GLU A OE1   1 
ATOM   1667  O  OE2   . GLU A 1 745  ? 125.194 96.953  144.700 1.00 187.66 -1 617  GLU A OE2   1 
ATOM   1668  N  N     . SER A 1 746  ? 126.239 102.009 141.565 1.00 14.27  ?  618  SER A N     1 
ATOM   1669  C  CA    . SER A 1 746  ? 125.420 103.208 141.574 1.00 12.96  ?  618  SER A CA    1 
ATOM   1670  C  C     . SER A 1 746  ? 124.549 103.175 140.335 1.00 15.33  ?  618  SER A C     1 
ATOM   1671  O  O     . SER A 1 746  ? 124.885 102.531 139.336 1.00 21.78  ?  618  SER A O     1 
ATOM   1672  C  CB    . SER A 1 746  ? 126.281 104.480 141.594 1.00 16.25  ?  618  SER A CB    1 
ATOM   1673  O  OG    . SER A 1 746  ? 125.656 105.524 140.879 1.00 16.56  ?  618  SER A OG    1 
ATOM   1674  N  N     . CYS A 1 747  ? 123.432 103.882 140.402 1.00 14.93  ?  619  CYS A N     1 
ATOM   1675  C  CA    . CYS A 1 747  ? 122.505 103.832 139.289 1.00 16.29  ?  619  CYS A CA    1 
ATOM   1676  C  C     . CYS A 1 747  ? 121.579 105.025 139.364 1.00 18.65  ?  619  CYS A C     1 
ATOM   1677  O  O     . CYS A 1 747  ? 120.944 105.259 140.392 1.00 20.46  ?  619  CYS A O     1 
ATOM   1678  C  CB    . CYS A 1 747  ? 121.675 102.554 139.318 1.00 17.13  ?  619  CYS A CB    1 
ATOM   1679  S  SG    . CYS A 1 747  ? 120.171 102.719 138.402 1.00 15.68  ?  619  CYS A SG    1 
ATOM   1680  N  N     . ASP A 1 748  ? 121.490 105.754 138.267 1.00 20.74  ?  620  ASP A N     1 
ATOM   1681  C  CA    . ASP A 1 748  ? 120.570 106.872 138.162 1.00 26.19  ?  620  ASP A CA    1 
ATOM   1682  C  C     . ASP A 1 748  ? 120.205 107.003 136.698 1.00 29.40  ?  620  ASP A C     1 
ATOM   1683  O  O     . ASP A 1 748  ? 120.851 106.423 135.822 1.00 28.09  ?  620  ASP A O     1 
ATOM   1684  C  CB    . ASP A 1 748  ? 121.179 108.175 138.681 1.00 48.83  ?  620  ASP A CB    1 
ATOM   1685  C  CG    . ASP A 1 748  ? 120.163 109.297 138.765 1.00 70.90  ?  620  ASP A CG    1 
ATOM   1686  O  OD1   . ASP A 1 748  ? 118.986 109.066 138.411 1.00 62.53  ?  620  ASP A OD1   1 
ATOM   1687  O  OD2   . ASP A 1 748  ? 120.539 110.417 139.155 1.00 123.78 -1 620  ASP A OD2   1 
ATOM   1688  N  N     . GLY A 1 749  ? 119.169 107.796 136.440 1.00 34.96  ?  621  GLY A N     1 
ATOM   1689  C  CA    . GLY A 1 749  ? 118.537 107.823 135.146 1.00 31.63  ?  621  GLY A CA    1 
ATOM   1690  C  C     . GLY A 1 749  ? 118.993 108.975 134.277 1.00 32.07  ?  621  GLY A C     1 
ATOM   1691  O  O     . GLY A 1 749  ? 119.903 109.733 134.595 1.00 31.89  ?  621  GLY A O     1 
ATOM   1692  N  N     . MET A 1 750  ? 118.326 109.074 133.139 1.00 34.54  ?  622  MET A N     1 
ATOM   1693  C  CA    . MET A 1 750  ? 118.548 110.148 132.184 1.00 39.98  ?  622  MET A CA    1 
ATOM   1694  C  C     . MET A 1 750  ? 117.231 110.331 131.443 1.00 52.43  ?  622  MET A C     1 
ATOM   1695  O  O     . MET A 1 750  ? 116.850 109.473 130.643 1.00 52.98  ?  622  MET A O     1 
ATOM   1696  C  CB    . MET A 1 750  ? 119.683 109.814 131.233 1.00 39.05  ?  622  MET A CB    1 
ATOM   1697  C  CG    . MET A 1 750  ? 120.008 110.948 130.293 1.00 58.35  ?  622  MET A CG    1 
ATOM   1698  S  SD    . MET A 1 750  ? 120.755 112.292 131.239 1.00 83.28  ?  622  MET A SD    1 
ATOM   1699  C  CE    . MET A 1 750  ? 121.330 113.395 129.948 1.00 63.54  ?  622  MET A CE    1 
ATOM   1700  N  N     . GLY A 1 751  ? 116.539 111.426 131.730 1.00 68.30  ?  623  GLY A N     1 
ATOM   1701  C  CA    . GLY A 1 751  ? 115.225 111.632 131.173 1.00 87.37  ?  623  GLY A CA    1 
ATOM   1702  C  C     . GLY A 1 751  ? 115.235 112.318 129.821 1.00 110.35 ?  623  GLY A C     1 
ATOM   1703  O  O     . GLY A 1 751  ? 116.210 112.958 129.432 1.00 111.25 ?  623  GLY A O     1 
ATOM   1704  N  N     . ASP A 1 752  ? 114.114 112.150 129.114 1.00 116.27 ?  624  ASP A N     1 
ATOM   1705  C  CA    . ASP A 1 752  ? 113.764 112.860 127.883 1.00 131.42 ?  624  ASP A CA    1 
ATOM   1706  C  C     . ASP A 1 752  ? 114.921 113.049 126.898 1.00 144.70 ?  624  ASP A C     1 
ATOM   1707  O  O     . ASP A 1 752  ? 115.347 114.180 126.648 1.00 161.93 ?  624  ASP A O     1 
ATOM   1708  C  CB    . ASP A 1 752  ? 113.100 114.215 128.210 1.00 156.34 ?  624  ASP A CB    1 
ATOM   1709  C  CG    . ASP A 1 752  ? 113.862 115.035 129.251 1.00 182.82 ?  624  ASP A CG    1 
ATOM   1710  O  OD1   . ASP A 1 752  ? 113.601 114.866 130.467 1.00 240.88 -1 624  ASP A OD1   1 
ATOM   1711  O  OD2   . ASP A 1 752  ? 114.701 115.870 128.851 1.00 173.04 ?  624  ASP A OD2   1 
ATOM   1712  N  N     . VAL A 1 753  ? 115.431 111.955 126.333 1.00 116.32 ?  625  VAL A N     1 
ATOM   1713  C  CA    . VAL A 1 753  ? 116.445 112.004 125.282 1.00 111.60 ?  625  VAL A CA    1 
ATOM   1714  C  C     . VAL A 1 753  ? 115.733 111.926 123.934 1.00 125.06 ?  625  VAL A C     1 
ATOM   1715  O  O     . VAL A 1 753  ? 114.928 111.014 123.707 1.00 121.36 ?  625  VAL A O     1 
ATOM   1716  C  CB    . VAL A 1 753  ? 117.461 110.860 125.429 1.00 95.83  ?  625  VAL A CB    1 
ATOM   1717  C  CG1   . VAL A 1 753  ? 118.551 110.968 124.369 1.00 91.56  ?  625  VAL A CG1   1 
ATOM   1718  C  CG2   . VAL A 1 753  ? 118.046 110.837 126.826 1.00 83.91  ?  625  VAL A CG2   1 
ATOM   1719  N  N     . SER A 1 754  ? 116.021 112.880 123.038 1.00 130.23 ?  626  SER A N     1 
ATOM   1720  C  CA    . SER A 1 754  ? 115.415 112.886 121.707 1.00 127.68 ?  626  SER A CA    1 
ATOM   1721  C  C     . SER A 1 754  ? 115.839 111.641 120.942 1.00 136.05 ?  626  SER A C     1 
ATOM   1722  O  O     . SER A 1 754  ? 116.983 111.546 120.489 1.00 133.61 ?  626  SER A O     1 
ATOM   1723  C  CB    . SER A 1 754  ? 115.803 114.150 120.929 1.00 112.14 ?  626  SER A CB    1 
ATOM   1724  O  OG    . SER A 1 754  ? 117.141 114.086 120.470 1.00 103.70 ?  626  SER A OG    1 
ATOM   1725  N  N     . GLU A 1 755  ? 114.925 110.690 120.781 1.00 148.72 ?  627  GLU A N     1 
ATOM   1726  C  CA    . GLU A 1 755  ? 115.311 109.366 120.323 1.00 161.37 ?  627  GLU A CA    1 
ATOM   1727  C  C     . GLU A 1 755  ? 115.349 109.306 118.800 1.00 174.82 ?  627  GLU A C     1 
ATOM   1728  O  O     . GLU A 1 755  ? 114.517 109.898 118.106 1.00 169.38 ?  627  GLU A O     1 
ATOM   1729  C  CB    . GLU A 1 755  ? 114.359 108.301 120.878 1.00 160.03 ?  627  GLU A CB    1 
ATOM   1730  C  CG    . GLU A 1 755  ? 114.895 106.883 120.761 1.00 146.29 ?  627  GLU A CG    1 
ATOM   1731  C  CD    . GLU A 1 755  ? 113.973 105.845 121.376 1.00 147.10 ?  627  GLU A CD    1 
ATOM   1732  O  OE1   . GLU A 1 755  ? 112.775 106.141 121.578 1.00 152.15 ?  627  GLU A OE1   1 
ATOM   1733  O  OE2   . GLU A 1 755  ? 114.460 104.739 121.684 1.00 173.01 -1 627  GLU A OE2   1 
ATOM   1734  N  N     . LYS A 1 756  ? 116.334 108.572 118.288 1.00 187.87 ?  628  LYS A N     1 
ATOM   1735  C  CA    . LYS A 1 756  ? 116.542 108.406 116.850 1.00 173.87 ?  628  LYS A CA    1 
ATOM   1736  C  C     . LYS A 1 756  ? 116.084 107.034 116.354 1.00 146.65 ?  628  LYS A C     1 
ATOM   1737  O  O     . LYS A 1 756  ? 116.781 106.030 116.508 1.00 130.51 ?  628  LYS A O     1 
ATOM   1738  C  CB    . LYS A 1 756  ? 118.023 108.629 116.495 1.00 171.11 ?  628  LYS A CB    1 
ATOM   1739  C  CG    . LYS A 1 756  ? 119.030 108.176 117.549 1.00 183.08 ?  628  LYS A CG    1 
ATOM   1740  C  CD    . LYS A 1 756  ? 120.443 108.024 116.969 1.00 120.23 ?  628  LYS A CD    1 
ATOM   1741  C  CE    . LYS A 1 756  ? 120.899 109.267 116.188 1.00 87.03  ?  628  LYS A CE    1 
ATOM   1742  N  NZ    . LYS A 1 756  ? 122.125 109.025 115.366 1.00 51.64  ?  628  LYS A NZ    1 
ATOM   1743  N  N     . VAL A 1 763  ? 107.970 102.956 123.411 1.00 154.43 ?  635  VAL A N     1 
ATOM   1744  C  CA    . VAL A 1 763  ? 109.139 103.184 124.249 1.00 154.87 ?  635  VAL A CA    1 
ATOM   1745  C  C     . VAL A 1 763  ? 109.391 104.688 124.391 1.00 168.83 ?  635  VAL A C     1 
ATOM   1746  O  O     . VAL A 1 763  ? 109.361 105.423 123.403 1.00 158.32 ?  635  VAL A O     1 
ATOM   1747  C  CB    . VAL A 1 763  ? 110.375 102.451 123.684 1.00 141.86 ?  635  VAL A CB    1 
ATOM   1748  C  CG1   . VAL A 1 763  ? 111.566 102.610 124.607 1.00 127.51 ?  635  VAL A CG1   1 
ATOM   1749  C  CG2   . VAL A 1 763  ? 110.068 100.975 123.474 1.00 141.03 ?  635  VAL A CG2   1 
ATOM   1750  N  N     . PRO A 1 764  ? 109.623 105.144 125.635 1.00 160.83 ?  636  PRO A N     1 
ATOM   1751  C  CA    . PRO A 1 764  ? 109.772 106.586 125.893 1.00 158.62 ?  636  PRO A CA    1 
ATOM   1752  C  C     . PRO A 1 764  ? 111.140 107.170 125.555 1.00 135.85 ?  636  PRO A C     1 
ATOM   1753  O  O     . PRO A 1 764  ? 111.998 106.514 124.956 1.00 128.69 ?  636  PRO A O     1 
ATOM   1754  C  CB    . PRO A 1 764  ? 109.494 106.696 127.398 1.00 162.05 ?  636  PRO A CB    1 
ATOM   1755  C  CG    . PRO A 1 764  ? 109.875 105.367 127.948 1.00 148.99 ?  636  PRO A CG    1 
ATOM   1756  C  CD    . PRO A 1 764  ? 109.546 104.361 126.881 1.00 157.21 ?  636  PRO A CD    1 
ATOM   1757  N  N     . GLU A 1 765  ? 111.325 108.435 125.946 1.00 115.72 ?  637  GLU A N     1 
ATOM   1758  C  CA    . GLU A 1 765  ? 112.544 109.192 125.689 1.00 95.87  ?  637  GLU A CA    1 
ATOM   1759  C  C     . GLU A 1 765  ? 113.605 108.953 126.752 1.00 84.85  ?  637  GLU A C     1 
ATOM   1760  O  O     . GLU A 1 765  ? 114.801 109.016 126.453 1.00 78.21  ?  637  GLU A O     1 
ATOM   1761  C  CB    . GLU A 1 765  ? 112.207 110.684 125.638 1.00 102.64 ?  637  GLU A CB    1 
ATOM   1762  C  CG    . GLU A 1 765  ? 110.879 111.016 124.965 1.00 108.61 ?  637  GLU A CG    1 
ATOM   1763  C  CD    . GLU A 1 765  ? 110.175 112.206 125.608 1.00 108.93 ?  637  GLU A CD    1 
ATOM   1764  O  OE1   . GLU A 1 765  ? 110.720 112.763 126.583 1.00 104.88 ?  637  GLU A OE1   1 
ATOM   1765  O  OE2   . GLU A 1 765  ? 109.085 112.595 125.128 1.00 139.47 -1 637  GLU A OE2   1 
ATOM   1766  N  N     . LYS A 1 766  ? 113.188 108.687 127.986 1.00 82.37  ?  638  LYS A N     1 
ATOM   1767  C  CA    . LYS A 1 766  ? 114.101 108.583 129.112 1.00 65.33  ?  638  LYS A CA    1 
ATOM   1768  C  C     . LYS A 1 766  ? 114.980 107.343 128.980 1.00 46.03  ?  638  LYS A C     1 
ATOM   1769  O  O     . LYS A 1 766  ? 114.838 106.534 128.061 1.00 48.88  ?  638  LYS A O     1 
ATOM   1770  C  CB    . LYS A 1 766  ? 113.323 108.548 130.422 1.00 64.68  ?  638  LYS A CB    1 
ATOM   1771  C  CG    . LYS A 1 766  ? 112.359 109.698 130.580 1.00 79.64  ?  638  LYS A CG    1 
ATOM   1772  C  CD    . LYS A 1 766  ? 111.732 109.690 131.955 1.00 96.96  ?  638  LYS A CD    1 
ATOM   1773  C  CE    . LYS A 1 766  ? 110.695 110.789 132.096 1.00 119.09 ?  638  LYS A CE    1 
ATOM   1774  N  NZ    . LYS A 1 766  ? 109.968 110.692 133.392 1.00 147.73 ?  638  LYS A NZ    1 
ATOM   1775  N  N     . ALA A 1 767  ? 115.893 107.187 129.930 1.00 36.77  ?  639  ALA A N     1 
ATOM   1776  C  CA    . ALA A 1 767  ? 116.822 106.069 129.929 1.00 29.94  ?  639  ALA A CA    1 
ATOM   1777  C  C     . ALA A 1 767  ? 117.457 105.990 131.307 1.00 30.29  ?  639  ALA A C     1 
ATOM   1778  O  O     . ALA A 1 767  ? 117.517 106.985 132.039 1.00 38.28  ?  639  ALA A O     1 
ATOM   1779  C  CB    . ALA A 1 767  ? 117.896 106.234 128.848 1.00 35.74  ?  639  ALA A CB    1 
ATOM   1780  N  N     . VAL A 1 768  ? 117.943 104.799 131.649 1.00 23.24  ?  640  VAL A N     1 
ATOM   1781  C  CA    . VAL A 1 768  ? 118.592 104.558 132.931 1.00 16.73  ?  640  VAL A CA    1 
ATOM   1782  C  C     . VAL A 1 768  ? 119.946 103.916 132.675 1.00 16.13  ?  640  VAL A C     1 
ATOM   1783  O  O     . VAL A 1 768  ? 120.050 102.958 131.898 1.00 18.93  ?  640  VAL A O     1 
ATOM   1784  C  CB    . VAL A 1 768  ? 117.737 103.670 133.850 1.00 14.55  ?  640  VAL A CB    1 
ATOM   1785  C  CG1   . VAL A 1 768  ? 118.530 103.271 135.063 1.00 21.43  ?  640  VAL A CG1   1 
ATOM   1786  C  CG2   . VAL A 1 768  ? 116.488 104.408 134.259 1.00 26.02  ?  640  VAL A CG2   1 
ATOM   1787  N  N     . ARG A 1 769  ? 120.980 104.454 133.321 1.00 17.09  ?  641  ARG A N     1 
ATOM   1788  C  CA    . ARG A 1 769  ? 122.351 103.981 133.198 1.00 18.41  ?  641  ARG A CA    1 
ATOM   1789  C  C     . ARG A 1 769  ? 122.801 103.435 134.544 1.00 22.20  ?  641  ARG A C     1 
ATOM   1790  O  O     . ARG A 1 769  ? 122.463 103.996 135.590 1.00 22.47  ?  641  ARG A O     1 
ATOM   1791  C  CB    . ARG A 1 769  ? 123.282 105.114 132.765 1.00 16.47  ?  641  ARG A CB    1 
ATOM   1792  C  CG    . ARG A 1 769  ? 124.611 104.648 132.222 1.00 16.77  ?  641  ARG A CG    1 
ATOM   1793  C  CD    . ARG A 1 769  ? 125.252 105.745 131.420 1.00 15.39  ?  641  ARG A CD    1 
ATOM   1794  N  NE    . ARG A 1 769  ? 125.254 106.964 132.207 1.00 18.37  ?  641  ARG A NE    1 
ATOM   1795  C  CZ    . ARG A 1 769  ? 126.240 107.309 133.021 1.00 19.09  ?  641  ARG A CZ    1 
ATOM   1796  N  NH1   . ARG A 1 769  ? 126.158 108.434 133.720 1.00 27.08  ?  641  ARG A NH1   1 
ATOM   1797  N  NH2   . ARG A 1 769  ? 127.310 106.529 133.135 1.00 15.27  ?  641  ARG A NH2   1 
ATOM   1798  N  N     . PHE A 1 770  ? 123.556 102.339 134.523 1.00 28.29  ?  642  PHE A N     1 
ATOM   1799  C  CA    . PHE A 1 770  ? 123.935 101.625 135.736 1.00 61.83  ?  642  PHE A CA    1 
ATOM   1800  C  C     . PHE A 1 770  ? 125.436 101.411 135.664 1.00 84.41  ?  642  PHE A C     1 
ATOM   1801  O  O     . PHE A 1 770  ? 125.913 100.679 134.790 1.00 30.42  ?  642  PHE A O     1 
ATOM   1802  C  CB    . PHE A 1 770  ? 123.195 100.290 135.829 1.00 27.03  ?  642  PHE A CB    1 
ATOM   1803  C  CG    . PHE A 1 770  ? 123.381 99.566  137.126 1.00 14.13  ?  642  PHE A CG    1 
ATOM   1804  C  CD1   . PHE A 1 770  ? 124.511 98.821  137.371 1.00 24.95  ?  642  PHE A CD1   1 
ATOM   1805  C  CD2   . PHE A 1 770  ? 122.400 99.605  138.092 1.00 25.25  ?  642  PHE A CD2   1 
ATOM   1806  C  CE1   . PHE A 1 770  ? 124.655 98.156  138.560 1.00 22.61  ?  642  PHE A CE1   1 
ATOM   1807  C  CE2   . PHE A 1 770  ? 122.549 98.946  139.279 1.00 20.47  ?  642  PHE A CE2   1 
ATOM   1808  C  CZ    . PHE A 1 770  ? 123.677 98.220  139.508 1.00 20.89  ?  642  PHE A CZ    1 
ATOM   1809  N  N     . SER A 1 771  ? 126.172 102.044 136.572 1.00 31.55  ?  643  SER A N     1 
ATOM   1810  C  CA    . SER A 1 771  ? 127.626 102.012 136.566 1.00 31.02  ?  643  SER A CA    1 
ATOM   1811  C  C     . SER A 1 771  ? 128.145 101.674 137.960 1.00 50.25  ?  643  SER A C     1 
ATOM   1812  O  O     . SER A 1 771  ? 127.384 101.540 138.919 1.00 26.76  ?  643  SER A O     1 
ATOM   1813  C  CB    . SER A 1 771  ? 128.214 103.352 136.075 1.00 41.51  ?  643  SER A CB    1 
ATOM   1814  O  OG    . SER A 1 771  ? 128.622 104.173 137.147 1.00 29.48  ?  643  SER A OG    1 
ATOM   1815  N  N     . PHE A 1 772  ? 129.462 101.519 138.056 1.00 45.38  ?  644  PHE A N     1 
ATOM   1816  C  CA    . PHE A 1 772  ? 130.144 101.278 139.317 1.00 23.32  ?  644  PHE A CA    1 
ATOM   1817  C  C     . PHE A 1 772  ? 131.554 101.832 139.199 1.00 22.90  ?  644  PHE A C     1 
ATOM   1818  O  O     . PHE A 1 772  ? 132.001 102.208 138.117 1.00 22.26  ?  644  PHE A O     1 
ATOM   1819  C  CB    . PHE A 1 772  ? 130.180 99.795  139.667 1.00 26.64  ?  644  PHE A CB    1 
ATOM   1820  C  CG    . PHE A 1 772  ? 131.164 99.002  138.858 1.00 54.35  ?  644  PHE A CG    1 
ATOM   1821  C  CD1   . PHE A 1 772  ? 130.836 98.528  137.613 1.00 25.23  ?  644  PHE A CD1   1 
ATOM   1822  C  CD2   . PHE A 1 772  ? 132.422 98.739  139.345 1.00 33.76  ?  644  PHE A CD2   1 
ATOM   1823  C  CE1   . PHE A 1 772  ? 131.740 97.793  136.888 1.00 19.21  ?  644  PHE A CE1   1 
ATOM   1824  C  CE2   . PHE A 1 772  ? 133.319 98.016  138.614 1.00 26.59  ?  644  PHE A CE2   1 
ATOM   1825  C  CZ    . PHE A 1 772  ? 132.975 97.544  137.389 1.00 24.22  ?  644  PHE A CZ    1 
ATOM   1826  N  N     . THR A 1 773  ? 132.264 101.868 140.324 1.00 28.04  ?  645  THR A N     1 
ATOM   1827  C  CA    . THR A 1 773  ? 133.638 102.358 140.354 1.00 28.38  ?  645  THR A CA    1 
ATOM   1828  C  C     . THR A 1 773  ? 134.392 101.676 141.483 1.00 23.02  ?  645  THR A C     1 
ATOM   1829  O  O     . THR A 1 773  ? 133.875 101.562 142.598 1.00 25.92  ?  645  THR A O     1 
ATOM   1830  C  CB    . THR A 1 773  ? 133.684 103.883 140.521 1.00 22.73  ?  645  THR A CB    1 
ATOM   1831  O  OG1   . THR A 1 773  ? 133.049 104.510 139.401 1.00 17.79  ?  645  THR A OG1   1 
ATOM   1832  C  CG2   . THR A 1 773  ? 135.119 104.373 140.621 1.00 20.90  ?  645  THR A CG2   1 
ATOM   1833  N  N     . ILE A 1 774  ? 135.597 101.205 141.171 1.00 36.87  ?  646  ILE A N     1 
ATOM   1834  C  CA    . ILE A 1 774  ? 136.461 100.614 142.177 1.00 18.74  ?  646  ILE A CA    1 
ATOM   1835  C  C     . ILE A 1 774  ? 136.919 101.701 143.131 1.00 27.56  ?  646  ILE A C     1 
ATOM   1836  O  O     . ILE A 1 774  ? 137.315 102.790 142.703 1.00 34.63  ?  646  ILE A O     1 
ATOM   1837  C  CB    . ILE A 1 774  ? 137.649 99.922  141.503 1.00 12.97  ?  646  ILE A CB    1 
ATOM   1838  C  CG1   . ILE A 1 774  ? 137.147 98.788  140.612 1.00 16.36  ?  646  ILE A CG1   1 
ATOM   1839  C  CG2   . ILE A 1 774  ? 138.618 99.420  142.543 1.00 23.45  ?  646  ILE A CG2   1 
ATOM   1840  C  CD1   . ILE A 1 774  ? 138.235 97.899  140.053 1.00 27.94  ?  646  ILE A CD1   1 
ATOM   1841  N  N     . MET A 1 775  ? 136.852 101.420 144.429 1.00 22.43  ?  647  MET A N     1 
ATOM   1842  C  CA    . MET A 1 775  ? 137.186 102.402 145.449 1.00 20.42  ?  647  MET A CA    1 
ATOM   1843  C  C     . MET A 1 775  ? 138.440 102.022 146.221 1.00 21.98  ?  647  MET A C     1 
ATOM   1844  O  O     . MET A 1 775  ? 139.402 102.793 146.264 1.00 25.62  ?  647  MET A O     1 
ATOM   1845  C  CB    . MET A 1 775  ? 136.016 102.571 146.416 1.00 24.30  ?  647  MET A CB    1 
ATOM   1846  C  CG    . MET A 1 775  ? 134.893 103.431 145.880 1.00 28.95  ?  647  MET A CG    1 
ATOM   1847  S  SD    . MET A 1 775  ? 135.295 105.183 145.946 1.00 25.35  ?  647  MET A SD    1 
ATOM   1848  C  CE    . MET A 1 775  ? 135.436 105.430 147.718 1.00 24.10  ?  647  MET A CE    1 
ATOM   1849  N  N     . SER A 1 776  ? 138.459 100.835 146.819 1.00 24.73  ?  648  SER A N     1 
ATOM   1850  C  CA    . SER A 1 776  ? 139.563 100.447 147.677 1.00 24.60  ?  648  SER A CA    1 
ATOM   1851  C  C     . SER A 1 776  ? 139.990 99.020  147.354 1.00 22.34  ?  648  SER A C     1 
ATOM   1852  O  O     . SER A 1 776  ? 139.162 98.169  147.018 1.00 18.64  ?  648  SER A O     1 
ATOM   1853  C  CB    . SER A 1 776  ? 139.171 100.589 149.160 1.00 23.04  ?  648  SER A CB    1 
ATOM   1854  O  OG    . SER A 1 776  ? 137.958 99.917  149.436 1.00 24.40  ?  648  SER A OG    1 
ATOM   1855  N  N     . ILE A 1 777  ? 141.299 98.772  147.448 1.00 25.51  ?  649  ILE A N     1 
ATOM   1856  C  CA    . ILE A 1 777  ? 141.854 97.427  147.352 1.00 22.57  ?  649  ILE A CA    1 
ATOM   1857  C  C     . ILE A 1 777  ? 142.907 97.294  148.443 1.00 26.35  ?  649  ILE A C     1 
ATOM   1858  O  O     . ILE A 1 777  ? 143.883 98.052  148.458 1.00 27.59  ?  649  ILE A O     1 
ATOM   1859  C  CB    . ILE A 1 777  ? 142.437 97.139  145.955 1.00 21.35  ?  649  ILE A CB    1 
ATOM   1860  C  CG1   . ILE A 1 777  ? 143.288 95.877  145.949 1.00 33.41  ?  649  ILE A CG1   1 
ATOM   1861  C  CG2   . ILE A 1 777  ? 143.225 98.298  145.448 1.00 19.11  ?  649  ILE A CG2   1 
ATOM   1862  C  CD1   . ILE A 1 777  ? 143.768 95.489  144.567 1.00 43.36  ?  649  ILE A CD1   1 
ATOM   1863  N  N     . SER A 1 778  ? 142.692 96.362  149.376 1.00 27.41  ?  650  SER A N     1 
ATOM   1864  C  CA    . SER A 1 778  ? 143.499 96.218  150.584 1.00 36.39  ?  650  SER A CA    1 
ATOM   1865  C  C     . SER A 1 778  ? 143.921 94.760  150.748 1.00 39.25  ?  650  SER A C     1 
ATOM   1866  O  O     . SER A 1 778  ? 143.556 93.890  149.950 1.00 39.31  ?  650  SER A O     1 
ATOM   1867  C  CB    . SER A 1 778  ? 142.729 96.701  151.824 1.00 37.03  ?  650  SER A CB    1 
ATOM   1868  O  OG    . SER A 1 778  ? 141.498 96.018  151.975 1.00 32.99  ?  650  SER A OG    1 
ATOM   1869  N  N     . ILE A 1 779  ? 144.673 94.485  151.809 1.00 42.13  ?  651  ILE A N     1 
ATOM   1870  C  CA    . ILE A 1 779  ? 145.202 93.149  152.047 1.00 46.12  ?  651  ILE A CA    1 
ATOM   1871  C  C     . ILE A 1 779  ? 145.185 92.883  153.544 1.00 51.39  ?  651  ILE A C     1 
ATOM   1872  O  O     . ILE A 1 779  ? 145.549 93.751  154.343 1.00 55.12  ?  651  ILE A O     1 
ATOM   1873  C  CB    . ILE A 1 779  ? 146.626 92.994  151.473 1.00 49.00  ?  651  ILE A CB    1 
ATOM   1874  C  CG1   . ILE A 1 779  ? 147.233 91.649  151.867 1.00 64.93  ?  651  ILE A CG1   1 
ATOM   1875  C  CG2   . ILE A 1 779  ? 147.517 94.122  151.953 1.00 47.40  ?  651  ILE A CG2   1 
ATOM   1876  C  CD1   . ILE A 1 779  ? 146.450 90.474  151.348 1.00 65.24  ?  651  ILE A CD1   1 
ATOM   1877  N  N     . ARG A 1 780  ? 144.748 91.682  153.924 1.00 65.74  ?  652  ARG A N     1 
ATOM   1878  C  CA    . ARG A 1 780  ? 144.775 91.232  155.307 1.00 79.41  ?  652  ARG A CA    1 
ATOM   1879  C  C     . ARG A 1 780  ? 145.883 90.227  155.596 1.00 98.29  ?  652  ARG A C     1 
ATOM   1880  O  O     . ARG A 1 780  ? 146.221 90.024  156.766 1.00 109.41 ?  652  ARG A O     1 
ATOM   1881  C  CB    . ARG A 1 780  ? 143.425 90.605  155.688 1.00 82.67  ?  652  ARG A CB    1 
ATOM   1882  C  CG    . ARG A 1 780  ? 143.183 90.522  157.185 1.00 90.76  ?  652  ARG A CG    1 
ATOM   1883  C  CD    . ARG A 1 780  ? 142.055 89.569  157.516 1.00 87.39  ?  652  ARG A CD    1 
ATOM   1884  N  NE    . ARG A 1 780  ? 141.878 89.465  158.957 1.00 93.98  ?  652  ARG A NE    1 
ATOM   1885  C  CZ    . ARG A 1 780  ? 142.716 88.811  159.754 1.00 100.06 ?  652  ARG A CZ    1 
ATOM   1886  N  NH1   . ARG A 1 780  ? 143.777 88.204  159.238 1.00 106.51 ?  652  ARG A NH1   1 
ATOM   1887  N  NH2   . ARG A 1 780  ? 142.495 88.758  161.061 1.00 101.36 ?  652  ARG A NH2   1 
ATOM   1888  N  N     . LEU A 1 781  ? 146.461 89.611  154.566 1.00 102.39 ?  653  LEU A N     1 
ATOM   1889  C  CA    . LEU A 1 781  ? 147.479 88.583  154.758 1.00 122.22 ?  653  LEU A CA    1 
ATOM   1890  C  C     . LEU A 1 781  ? 148.733 89.160  155.414 1.00 119.52 ?  653  LEU A C     1 
ATOM   1891  O  O     . LEU A 1 781  ? 149.070 90.334  155.242 1.00 111.24 ?  653  LEU A O     1 
ATOM   1892  C  CB    . LEU A 1 781  ? 147.827 87.926  153.413 1.00 120.17 ?  653  LEU A CB    1 
ATOM   1893  C  CG    . LEU A 1 781  ? 146.833 86.892  152.860 1.00 110.47 ?  653  LEU A CG    1 
ATOM   1894  C  CD1   . LEU A 1 781  ? 147.395 86.142  151.656 1.00 97.59  ?  653  LEU A CD1   1 
ATOM   1895  C  CD2   . LEU A 1 781  ? 146.401 85.909  153.940 1.00 121.97 ?  653  LEU A CD2   1 
ATOM   1896  N  N     . GLU A 1 782  ? 149.433 88.318  156.174 1.00 133.50 ?  654  GLU A N     1 
ATOM   1897  C  CA    . GLU A 1 782  ? 149.070 86.911  156.346 1.00 143.62 ?  654  GLU A CA    1 
ATOM   1898  C  C     . GLU A 1 782  ? 148.074 86.677  157.480 1.00 146.32 ?  654  GLU A C     1 
ATOM   1899  O  O     . GLU A 1 782  ? 147.569 85.567  157.639 1.00 150.42 ?  654  GLU A O     1 
ATOM   1900  C  CB    . GLU A 1 782  ? 150.331 86.072  156.567 1.00 156.53 ?  654  GLU A CB    1 
ATOM   1901  C  CG    . GLU A 1 782  ? 151.278 86.653  157.599 1.00 176.65 ?  654  GLU A CG    1 
ATOM   1902  C  CD    . GLU A 1 782  ? 150.962 86.195  159.006 1.00 205.64 ?  654  GLU A CD    1 
ATOM   1903  O  OE1   . GLU A 1 782  ? 150.128 85.279  159.165 1.00 195.11 ?  654  GLU A OE1   1 
ATOM   1904  O  OE2   . GLU A 1 782  ? 151.537 86.764  159.954 1.00 307.69 -1 654  GLU A OE2   1 
ATOM   1905  N  N     . GLY A 1 783  ? 147.782 87.720  158.247 1.00 143.74 ?  655  GLY A N     1 
ATOM   1906  C  CA    . GLY A 1 783  ? 146.824 87.649  159.326 1.00 145.95 ?  655  GLY A CA    1 
ATOM   1907  C  C     . GLY A 1 783  ? 147.315 88.422  160.529 1.00 155.55 ?  655  GLY A C     1 
ATOM   1908  O  O     . GLY A 1 783  ? 148.261 89.202  160.444 1.00 159.90 ?  655  GLY A O     1 
ATOM   1909  N  N     . GLU A 1 784  ? 146.638 88.203  161.661 1.00 158.87 ?  656  GLU A N     1 
ATOM   1910  C  CA    . GLU A 1 784  ? 146.913 88.864  162.938 1.00 170.15 ?  656  GLU A CA    1 
ATOM   1911  C  C     . GLU A 1 784  ? 146.729 90.376  162.851 1.00 164.62 ?  656  GLU A C     1 
ATOM   1912  O  O     . GLU A 1 784  ? 146.962 91.096  163.829 1.00 162.49 ?  656  GLU A O     1 
ATOM   1913  C  CB    . GLU A 1 784  ? 148.319 88.536  163.451 1.00 184.55 ?  656  GLU A CB    1 
ATOM   1914  C  CG    . GLU A 1 784  ? 148.546 87.073  163.798 1.00 195.33 ?  656  GLU A CG    1 
ATOM   1915  C  CD    . GLU A 1 784  ? 149.042 86.261  162.624 1.00 208.94 ?  656  GLU A CD    1 
ATOM   1916  O  OE1   . GLU A 1 784  ? 149.602 86.856  161.680 1.00 199.43 ?  656  GLU A OE1   1 
ATOM   1917  O  OE2   . GLU A 1 784  ? 148.872 85.024  162.649 1.00 254.01 -1 656  GLU A OE2   1 
ATOM   1918  N  N     . ASP A 1 785  ? 146.297 90.861  161.692 1.00 151.18 ?  657  ASP A N     1 
ATOM   1919  C  CA    . ASP A 1 785  ? 146.048 92.274  161.468 1.00 147.99 ?  657  ASP A CA    1 
ATOM   1920  C  C     . ASP A 1 785  ? 144.713 92.440  160.760 1.00 134.62 ?  657  ASP A C     1 
ATOM   1921  O  O     . ASP A 1 785  ? 144.252 91.551  160.040 1.00 125.21 ?  657  ASP A O     1 
ATOM   1922  C  CB    . ASP A 1 785  ? 147.165 92.933  160.637 1.00 152.86 ?  657  ASP A CB    1 
ATOM   1923  C  CG    . ASP A 1 785  ? 148.496 92.991  161.373 1.00 166.28 ?  657  ASP A CG    1 
ATOM   1924  O  OD1   . ASP A 1 785  ? 148.492 93.162  162.612 1.00 160.70 ?  657  ASP A OD1   1 
ATOM   1925  O  OD2   . ASP A 1 785  ? 149.549 92.879  160.710 1.00 199.35 -1 657  ASP A OD2   1 
ATOM   1926  N  N     . ASP A 1 786  ? 144.103 93.605  160.972 1.00 137.25 ?  658  ASP A N     1 
ATOM   1927  C  CA    . ASP A 1 786  ? 142.838 93.924  160.322 1.00 130.31 ?  658  ASP A CA    1 
ATOM   1928  C  C     . ASP A 1 786  ? 142.998 94.023  158.808 1.00 115.59 ?  658  ASP A C     1 
ATOM   1929  O  O     . ASP A 1 786  ? 142.175 93.488  158.054 1.00 106.51 ?  658  ASP A O     1 
ATOM   1930  C  CB    . ASP A 1 786  ? 142.279 95.225  160.898 1.00 145.32 ?  658  ASP A CB    1 
ATOM   1931  C  CG    . ASP A 1 786  ? 143.365 96.243  161.209 1.00 156.02 ?  658  ASP A CG    1 
ATOM   1932  O  OD1   . ASP A 1 786  ? 144.547 95.964  160.923 1.00 145.39 ?  658  ASP A OD1   1 
ATOM   1933  O  OD2   . ASP A 1 786  ? 143.031 97.332  161.725 1.00 204.86 -1 658  ASP A OD2   1 
ATOM   1934  N  N     . GLY A 1 787  ? 144.037 94.709  158.345 1.00 111.66 ?  659  GLY A N     1 
ATOM   1935  C  CA    . GLY A 1 787  ? 144.285 94.844  156.922 1.00 93.17  ?  659  GLY A CA    1 
ATOM   1936  C  C     . GLY A 1 787  ? 145.220 95.993  156.625 1.00 76.32  ?  659  GLY A C     1 
ATOM   1937  O  O     . GLY A 1 787  ? 145.513 96.831  157.478 1.00 78.50  ?  659  GLY A O     1 
ATOM   1938  N  N     . ILE A 1 788  ? 145.690 96.019  155.377 1.00 58.24  ?  660  ILE A N     1 
ATOM   1939  C  CA    . ILE A 1 788  ? 146.550 97.083  154.859 1.00 49.60  ?  660  ILE A CA    1 
ATOM   1940  C  C     . ILE A 1 788  ? 145.984 97.546  153.524 1.00 36.28  ?  660  ILE A C     1 
ATOM   1941  O  O     . ILE A 1 788  ? 145.858 96.744  152.592 1.00 39.15  ?  660  ILE A O     1 
ATOM   1942  C  CB    . ILE A 1 788  ? 148.008 96.624  154.686 1.00 49.22  ?  660  ILE A CB    1 
ATOM   1943  C  CG1   . ILE A 1 788  ? 148.622 96.213  156.025 1.00 66.39  ?  660  ILE A CG1   1 
ATOM   1944  C  CG2   . ILE A 1 788  ? 148.829 97.708  154.025 1.00 46.14  ?  660  ILE A CG2   1 
ATOM   1945  C  CD1   . ILE A 1 788  ? 148.689 97.323  157.041 1.00 61.24  ?  660  ILE A CD1   1 
ATOM   1946  N  N     . THR A 1 789  ? 145.649 98.832  153.428 1.00 33.75  ?  661  THR A N     1 
ATOM   1947  C  CA    . THR A 1 789  ? 145.173 99.382  152.166 1.00 25.22  ?  661  THR A CA    1 
ATOM   1948  C  C     . THR A 1 789  ? 146.314 99.381  151.156 1.00 25.80  ?  661  THR A C     1 
ATOM   1949  O  O     . THR A 1 789  ? 147.379 99.960  151.401 1.00 29.11  ?  661  THR A O     1 
ATOM   1950  C  CB    . THR A 1 789  ? 144.618 100.795 152.352 1.00 21.35  ?  661  THR A CB    1 
ATOM   1951  O  OG1   . THR A 1 789  ? 144.467 101.428 151.074 1.00 23.55  ?  661  THR A OG1   1 
ATOM   1952  C  CG2   . THR A 1 789  ? 145.530 101.645 153.210 1.00 31.68  ?  661  THR A CG2   1 
ATOM   1953  N  N     . ILE A 1 790  ? 146.101 98.699  150.033 1.00 28.46  ?  662  ILE A N     1 
ATOM   1954  C  CA    . ILE A 1 790  ? 147.075 98.718  148.943 1.00 31.36  ?  662  ILE A CA    1 
ATOM   1955  C  C     . ILE A 1 790  ? 146.907 99.974  148.105 1.00 26.62  ?  662  ILE A C     1 
ATOM   1956  O  O     . ILE A 1 790  ? 147.835 100.776 147.954 1.00 31.16  ?  662  ILE A O     1 
ATOM   1957  C  CB    . ILE A 1 790  ? 146.942 97.454  148.071 1.00 37.00  ?  662  ILE A CB    1 
ATOM   1958  C  CG1   . ILE A 1 790  ? 146.791 96.199  148.939 1.00 42.15  ?  662  ILE A CG1   1 
ATOM   1959  C  CG2   . ILE A 1 790  ? 148.134 97.332  147.118 1.00 43.58  ?  662  ILE A CG2   1 
ATOM   1960  C  CD1   . ILE A 1 790  ? 146.708 94.893  148.153 1.00 37.66  ?  662  ILE A CD1   1 
ATOM   1961  N  N     . PHE A 1 791  ? 145.712 100.154 147.550 1.00 27.25  ?  663  PHE A N     1 
ATOM   1962  C  CA    . PHE A 1 791  ? 145.399 101.292 146.691 1.00 28.64  ?  663  PHE A CA    1 
ATOM   1963  C  C     . PHE A 1 791  ? 143.998 101.772 147.040 1.00 28.24  ?  663  PHE A C     1 
ATOM   1964  O  O     . PHE A 1 791  ? 143.021 101.044 146.837 1.00 30.42  ?  663  PHE A O     1 
ATOM   1965  C  CB    . PHE A 1 791  ? 145.498 100.910 145.210 1.00 34.28  ?  663  PHE A CB    1 
ATOM   1966  C  CG    . PHE A 1 791  ? 144.541 101.661 144.291 1.00 35.74  ?  663  PHE A CG    1 
ATOM   1967  C  CD1   . PHE A 1 791  ? 144.584 103.032 144.175 1.00 34.75  ?  663  PHE A CD1   1 
ATOM   1968  C  CD2   . PHE A 1 791  ? 143.623 100.970 143.514 1.00 32.12  ?  663  PHE A CD2   1 
ATOM   1969  C  CE1   . PHE A 1 791  ? 143.718 103.692 143.312 1.00 31.99  ?  663  PHE A CE1   1 
ATOM   1970  C  CE2   . PHE A 1 791  ? 142.760 101.635 142.661 1.00 25.11  ?  663  PHE A CE2   1 
ATOM   1971  C  CZ    . PHE A 1 791  ? 142.810 102.986 142.562 1.00 28.30  ?  663  PHE A CZ    1 
ATOM   1972  N  N     . GLN A 1 792  ? 143.905 102.978 147.590 1.00 28.40  ?  664  GLN A N     1 
ATOM   1973  C  CA    . GLN A 1 792  ? 142.646 103.701 147.689 1.00 30.13  ?  664  GLN A CA    1 
ATOM   1974  C  C     . GLN A 1 792  ? 142.568 104.656 146.511 1.00 29.47  ?  664  GLN A C     1 
ATOM   1975  O  O     . GLN A 1 792  ? 143.522 105.394 146.247 1.00 30.48  ?  664  GLN A O     1 
ATOM   1976  C  CB    . GLN A 1 792  ? 142.544 104.482 149.002 1.00 34.92  ?  664  GLN A CB    1 
ATOM   1977  C  CG    . GLN A 1 792  ? 141.371 105.466 149.064 1.00 30.51  ?  664  GLN A CG    1 
ATOM   1978  C  CD    . GLN A 1 792  ? 141.337 106.275 150.352 1.00 28.64  ?  664  GLN A CD    1 
ATOM   1979  O  OE1   . GLN A 1 792  ? 142.350 106.423 151.035 1.00 30.91  ?  664  GLN A OE1   1 
ATOM   1980  N  NE2   . GLN A 1 792  ? 140.166 106.820 150.679 1.00 21.51  ?  664  GLN A NE2   1 
ATOM   1981  N  N     . GLU A 1 793  ? 141.461 104.609 145.777 1.00 28.02  ?  665  GLU A N     1 
ATOM   1982  C  CA    . GLU A 1 793  ? 141.259 105.556 144.690 1.00 38.32  ?  665  GLU A CA    1 
ATOM   1983  C  C     . GLU A 1 793  ? 141.360 106.984 145.219 1.00 41.00  ?  665  GLU A C     1 
ATOM   1984  O  O     . GLU A 1 793  ? 140.954 107.276 146.348 1.00 37.18  ?  665  GLU A O     1 
ATOM   1985  C  CB    . GLU A 1 793  ? 139.894 105.311 144.033 1.00 33.35  ?  665  GLU A CB    1 
ATOM   1986  C  CG    . GLU A 1 793  ? 139.338 106.484 143.250 1.00 43.40  ?  665  GLU A CG    1 
ATOM   1987  C  CD    . GLU A 1 793  ? 140.276 106.965 142.163 1.00 51.91  ?  665  GLU A CD    1 
ATOM   1988  O  OE1   . GLU A 1 793  ? 140.901 106.115 141.494 1.00 46.36  ?  665  GLU A OE1   1 
ATOM   1989  O  OE2   . GLU A 1 793  ? 140.415 108.203 142.028 1.00 135.77 -1 665  GLU A OE2   1 
ATOM   1990  N  N     . GLN A 1 794  ? 141.920 107.875 144.400 1.00 41.17  ?  666  GLN A N     1 
ATOM   1991  C  CA    . GLN A 1 794  ? 142.179 109.247 144.819 1.00 41.99  ?  666  GLN A CA    1 
ATOM   1992  C  C     . GLN A 1 794  ? 141.060 110.218 144.459 1.00 41.04  ?  666  GLN A C     1 
ATOM   1993  O  O     . GLN A 1 794  ? 140.848 111.198 145.183 1.00 36.74  ?  666  GLN A O     1 
ATOM   1994  C  CB    . GLN A 1 794  ? 143.497 109.744 144.206 1.00 42.43  ?  666  GLN A CB    1 
ATOM   1995  C  CG    . GLN A 1 794  ? 144.733 109.538 145.081 1.00 43.81  ?  666  GLN A CG    1 
ATOM   1996  C  CD    . GLN A 1 794  ? 144.797 108.159 145.695 1.00 44.56  ?  666  GLN A CD    1 
ATOM   1997  O  OE1   . GLN A 1 794  ? 144.932 108.005 146.909 1.00 42.79  ?  666  GLN A OE1   1 
ATOM   1998  N  NE2   . GLN A 1 794  ? 144.747 107.141 144.845 1.00 42.12  ?  666  GLN A NE2   1 
ATOM   1999  N  N     . LYS A 1 795  ? 140.325 109.964 143.376 1.00 37.90  ?  667  LYS A N     1 
ATOM   2000  C  CA    . LYS A 1 795  ? 139.339 110.914 142.850 1.00 30.33  ?  667  LYS A CA    1 
ATOM   2001  C  C     . LYS A 1 795  ? 138.140 110.162 142.281 1.00 25.33  ?  667  LYS A C     1 
ATOM   2002  O  O     . LYS A 1 795  ? 137.864 110.217 141.084 1.00 25.88  ?  667  LYS A O     1 
ATOM   2003  C  CB    . LYS A 1 795  ? 139.979 111.812 141.790 1.00 30.57  ?  667  LYS A CB    1 
ATOM   2004  C  CG    . LYS A 1 795  ? 140.849 112.932 142.339 1.00 34.16  ?  667  LYS A CG    1 
ATOM   2005  C  CD    . LYS A 1 795  ? 141.646 113.594 141.219 1.00 31.62  ?  667  LYS A CD    1 
ATOM   2006  C  CE    . LYS A 1 795  ? 140.734 114.018 140.083 1.00 29.13  ?  667  LYS A CE    1 
ATOM   2007  N  NZ    . LYS A 1 795  ? 141.472 114.561 138.912 1.00 26.74  ?  667  LYS A NZ    1 
ATOM   2008  N  N     . PRO A 1 796  ? 137.393 109.453 143.125 1.00 26.83  ?  668  PRO A N     1 
ATOM   2009  C  CA    . PRO A 1 796  ? 136.239 108.697 142.622 1.00 21.26  ?  668  PRO A CA    1 
ATOM   2010  C  C     . PRO A 1 796  ? 135.112 109.580 142.171 1.00 17.11  ?  668  PRO A C     1 
ATOM   2011  O  O     . PRO A 1 796  ? 134.203 109.100 141.489 1.00 15.88  ?  668  PRO A O     1 
ATOM   2012  C  CB    . PRO A 1 796  ? 135.821 107.867 143.833 1.00 24.93  ?  668  PRO A CB    1 
ATOM   2013  C  CG    . PRO A 1 796  ? 136.177 108.737 144.967 1.00 27.23  ?  668  PRO A CG    1 
ATOM   2014  C  CD    . PRO A 1 796  ? 137.448 109.441 144.591 1.00 24.48  ?  668  PRO A CD    1 
ATOM   2015  N  N     . ASN A 1 797  ? 135.136 110.854 142.553 1.00 20.37  ?  669  ASN A N     1 
ATOM   2016  C  CA    . ASN A 1 797  ? 134.080 111.772 142.159 1.00 27.36  ?  669  ASN A CA    1 
ATOM   2017  C  C     . ASN A 1 797  ? 134.108 112.024 140.660 1.00 26.51  ?  669  ASN A C     1 
ATOM   2018  O  O     . ASN A 1 797  ? 133.071 111.956 139.997 1.00 28.41  ?  669  ASN A O     1 
ATOM   2019  C  CB    . ASN A 1 797  ? 134.228 113.088 142.921 1.00 31.98  ?  669  ASN A CB    1 
ATOM   2020  C  CG    . ASN A 1 797  ? 133.499 113.086 144.252 1.00 32.54  ?  669  ASN A CG    1 
ATOM   2021  O  OD1   . ASN A 1 797  ? 133.351 112.043 144.898 1.00 30.17  ?  669  ASN A OD1   1 
ATOM   2022  N  ND2   . ASN A 1 797  ? 133.008 114.255 144.654 1.00 34.68  ?  669  ASN A ND2   1 
ATOM   2023  N  N     . SER A 1 798  ? 135.283 112.316 140.106 1.00 27.75  ?  670  SER A N     1 
ATOM   2024  C  CA    . SER A 1 798  ? 135.373 112.561 138.673 1.00 26.93  ?  670  SER A CA    1 
ATOM   2025  C  C     . SER A 1 798  ? 134.967 111.316 137.897 1.00 25.66  ?  670  SER A C     1 
ATOM   2026  O  O     . SER A 1 798  ? 135.355 110.197 138.240 1.00 23.97  ?  670  SER A O     1 
ATOM   2027  C  CB    . SER A 1 798  ? 136.791 112.994 138.287 1.00 27.90  ?  670  SER A CB    1 
ATOM   2028  O  OG    . SER A 1 798  ? 137.150 114.225 138.899 1.00 26.98  ?  670  SER A OG    1 
ATOM   2029  N  N     . GLU A 1 799  ? 134.182 111.525 136.837 1.00 26.70  ?  671  GLU A N     1 
ATOM   2030  C  CA    . GLU A 1 799  ? 133.663 110.430 136.029 1.00 26.29  ?  671  GLU A CA    1 
ATOM   2031  C  C     . GLU A 1 799  ? 134.763 109.650 135.342 1.00 18.45  ?  671  GLU A C     1 
ATOM   2032  O  O     . GLU A 1 799  ? 134.520 108.533 134.877 1.00 15.50  ?  671  GLU A O     1 
ATOM   2033  C  CB    . GLU A 1 799  ? 132.708 110.956 134.962 1.00 31.04  ?  671  GLU A CB    1 
ATOM   2034  C  CG    . GLU A 1 799  ? 133.354 111.842 133.900 1.00 31.36  ?  671  GLU A CG    1 
ATOM   2035  C  CD    . GLU A 1 799  ? 133.627 113.254 134.378 1.00 46.97  ?  671  GLU A CD    1 
ATOM   2036  O  OE1   . GLU A 1 799  ? 134.331 113.428 135.395 1.00 30.97  ?  671  GLU A OE1   1 
ATOM   2037  O  OE2   . GLU A 1 799  ? 133.124 114.193 133.720 1.00 224.51 -1 671  GLU A OE2   1 
ATOM   2038  N  N     . LEU A 1 800  ? 135.958 110.223 135.257 1.00 24.87  ?  672  LEU A N     1 
ATOM   2039  C  CA    . LEU A 1 800  ? 137.098 109.503 134.719 1.00 18.30  ?  672  LEU A CA    1 
ATOM   2040  C  C     . LEU A 1 800  ? 137.280 108.152 135.390 1.00 16.56  ?  672  LEU A C     1 
ATOM   2041  O  O     . LEU A 1 800  ? 138.000 107.303 134.860 1.00 18.59  ?  672  LEU A O     1 
ATOM   2042  C  CB    . LEU A 1 800  ? 138.358 110.361 134.877 1.00 24.56  ?  672  LEU A CB    1 
ATOM   2043  C  CG    . LEU A 1 800  ? 138.265 111.770 134.283 1.00 23.89  ?  672  LEU A CG    1 
ATOM   2044  C  CD1   . LEU A 1 800  ? 139.588 112.547 134.392 1.00 16.27  ?  672  LEU A CD1   1 
ATOM   2045  C  CD2   . LEU A 1 800  ? 137.810 111.679 132.843 1.00 21.45  ?  672  LEU A CD2   1 
ATOM   2046  N  N     . SER A 1 801  ? 136.643 107.934 136.543 1.00 15.61  ?  673  SER A N     1 
ATOM   2047  C  CA    . SER A 1 801  ? 136.469 106.606 137.120 1.00 13.78  ?  673  SER A CA    1 
ATOM   2048  C  C     . SER A 1 801  ? 134.976 106.453 137.407 1.00 14.43  ?  673  SER A C     1 
ATOM   2049  O  O     . SER A 1 801  ? 134.509 106.695 138.520 1.00 17.27  ?  673  SER A O     1 
ATOM   2050  C  CB    . SER A 1 801  ? 137.319 106.417 138.371 1.00 16.56  ?  673  SER A CB    1 
ATOM   2051  O  OG    . SER A 1 801  ? 138.622 105.959 138.044 1.00 24.59  ?  673  SER A OG    1 
ATOM   2052  N  N     . CYS A 1 802  ? 134.225 106.060 136.377 1.00 14.28  ?  674  CYS A N     1 
ATOM   2053  C  CA    . CYS A 1 802  ? 132.834 105.631 136.525 1.00 15.20  ?  674  CYS A CA    1 
ATOM   2054  C  C     . CYS A 1 802  ? 132.563 104.656 135.383 1.00 13.67  ?  674  CYS A C     1 
ATOM   2055  O  O     . CYS A 1 802  ? 132.167 105.078 134.293 1.00 23.49  ?  674  CYS A O     1 
ATOM   2056  C  CB    . CYS A 1 802  ? 131.886 106.823 136.481 1.00 20.88  ?  674  CYS A CB    1 
ATOM   2057  S  SG    . CYS A 1 802  ? 130.132 106.427 136.689 1.00 25.24  ?  674  CYS A SG    1 
ATOM   2058  N  N     . ARG A 1 803  ? 132.737 103.379 135.646 1.00 14.29  ?  675  ARG A N     1 
ATOM   2059  C  CA    . ARG A 1 803  ? 132.665 102.427 134.552 1.00 13.56  ?  675  ARG A CA    1 
ATOM   2060  C  C     . ARG A 1 803  ? 131.239 101.937 134.382 1.00 13.10  ?  675  ARG A C     1 
ATOM   2061  O  O     . ARG A 1 803  ? 130.667 101.379 135.321 1.00 19.47  ?  675  ARG A O     1 
ATOM   2062  C  CB    . ARG A 1 803  ? 133.600 101.255 134.791 1.00 15.82  ?  675  ARG A CB    1 
ATOM   2063  C  CG    . ARG A 1 803  ? 134.943 101.620 135.423 1.00 21.25  ?  675  ARG A CG    1 
ATOM   2064  C  CD    . ARG A 1 803  ? 136.120 101.467 134.453 1.00 23.65  ?  675  ARG A CD    1 
ATOM   2065  N  NE    . ARG A 1 803  ? 137.393 101.807 135.094 1.00 24.82  ?  675  ARG A NE    1 
ATOM   2066  C  CZ    . ARG A 1 803  ? 138.046 101.019 135.949 1.00 24.29  ?  675  ARG A CZ    1 
ATOM   2067  N  NH1   . ARG A 1 803  ? 137.543 99.836  136.282 1.00 23.56  ?  675  ARG A NH1   1 
ATOM   2068  N  NH2   . ARG A 1 803  ? 139.200 101.423 136.480 1.00 29.52  ?  675  ARG A NH2   1 
ATOM   2069  N  N     . PRO A 1 804  ? 130.643 102.118 133.211 1.00 15.24  ?  676  PRO A N     1 
ATOM   2070  C  CA    . PRO A 1 804  ? 129.264 101.685 133.012 1.00 20.99  ?  676  PRO A CA    1 
ATOM   2071  C  C     . PRO A 1 804  ? 129.169 100.184 132.825 1.00 45.87  ?  676  PRO A C     1 
ATOM   2072  O  O     . PRO A 1 804  ? 130.045 99.534  132.256 1.00 18.75  ?  676  PRO A O     1 
ATOM   2073  C  CB    . PRO A 1 804  ? 128.853 102.427 131.741 1.00 19.26  ?  676  PRO A CB    1 
ATOM   2074  C  CG    . PRO A 1 804  ? 130.099 102.472 130.983 1.00 24.61  ?  676  PRO A CG    1 
ATOM   2075  C  CD    . PRO A 1 804  ? 131.221 102.652 131.969 1.00 22.90  ?  676  PRO A CD    1 
ATOM   2076  N  N     . LEU A 1 805  ? 128.073 99.644  133.316 1.00 25.59  ?  677  LEU A N     1 
ATOM   2077  C  CA    . LEU A 1 805  ? 127.870 98.210  133.339 1.00 117.67 ?  677  LEU A CA    1 
ATOM   2078  C  C     . LEU A 1 805  ? 126.534 97.789  132.763 1.00 23.36  ?  677  LEU A C     1 
ATOM   2079  O  O     . LEU A 1 805  ? 126.388 96.620  132.389 1.00 20.59  ?  677  LEU A O     1 
ATOM   2080  C  CB    . LEU A 1 805  ? 128.003 97.689  134.776 1.00 35.87  ?  677  LEU A CB    1 
ATOM   2081  C  CG    . LEU A 1 805  ? 127.901 96.204  135.075 1.00 19.71  ?  677  LEU A CG    1 
ATOM   2082  C  CD1   . LEU A 1 805  ? 128.958 95.814  136.092 1.00 20.40  ?  677  LEU A CD1   1 
ATOM   2083  C  CD2   . LEU A 1 805  ? 126.541 95.905  135.611 1.00 18.93  ?  677  LEU A CD2   1 
ATOM   2084  N  N     . CYS A 1 806  ? 125.567 98.692  132.652 1.00 21.62  ?  678  CYS A N     1 
ATOM   2085  C  CA    . CYS A 1 806  ? 124.342 98.365  131.940 1.00 22.30  ?  678  CYS A CA    1 
ATOM   2086  C  C     . CYS A 1 806  ? 123.629 99.641  131.519 1.00 23.62  ?  678  CYS A C     1 
ATOM   2087  O  O     . CYS A 1 806  ? 123.790 100.697 132.137 1.00 25.99  ?  678  CYS A O     1 
ATOM   2088  C  CB    . CYS A 1 806  ? 123.413 97.507  132.800 1.00 16.44  ?  678  CYS A CB    1 
ATOM   2089  S  SG    . CYS A 1 806  ? 121.748 97.405  132.150 1.00 66.71  ?  678  CYS A SG    1 
ATOM   2090  N  N     . LEU A 1 807  ? 122.833 99.527  130.461 1.00 27.34  ?  679  LEU A N     1 
ATOM   2091  C  CA    . LEU A 1 807  ? 122.020 100.628 129.970 1.00 25.58  ?  679  LEU A CA    1 
ATOM   2092  C  C     . LEU A 1 807  ? 120.675 100.093 129.512 1.00 26.36  ?  679  LEU A C     1 
ATOM   2093  O  O     . LEU A 1 807  ? 120.607 99.039  128.866 1.00 194.75 ?  679  LEU A O     1 
ATOM   2094  C  CB    . LEU A 1 807  ? 122.696 101.375 128.818 1.00 23.81  ?  679  LEU A CB    1 
ATOM   2095  C  CG    . LEU A 1 807  ? 123.941 102.168 129.184 1.00 22.40  ?  679  LEU A CG    1 
ATOM   2096  C  CD1   . LEU A 1 807  ? 125.179 101.318 129.076 1.00 19.93  ?  679  LEU A CD1   1 
ATOM   2097  C  CD2   . LEU A 1 807  ? 124.069 103.391 128.312 1.00 15.26  ?  679  LEU A CD2   1 
ATOM   2098  N  N     . MET A 1 808  ? 119.613 100.830 129.848 1.00 27.89  ?  680  MET A N     1 
ATOM   2099  C  CA    . MET A 1 808  ? 118.243 100.416 129.565 1.00 24.01  ?  680  MET A CA    1 
ATOM   2100  C  C     . MET A 1 808  ? 117.443 101.616 129.088 1.00 23.19  ?  680  MET A C     1 
ATOM   2101  O  O     . MET A 1 808  ? 117.356 102.623 129.796 1.00 23.63  ?  680  MET A O     1 
ATOM   2102  C  CB    . MET A 1 808  ? 117.581 99.818  130.805 1.00 19.19  ?  680  MET A CB    1 
ATOM   2103  C  CG    . MET A 1 808  ? 118.204 98.548  131.313 1.00 26.22  ?  680  MET A CG    1 
ATOM   2104  S  SD    . MET A 1 808  ? 117.734 98.256  133.029 1.00 36.12  ?  680  MET A SD    1 
ATOM   2105  C  CE    . MET A 1 808  ? 118.324 99.763  133.797 1.00 32.01  ?  680  MET A CE    1 
ATOM   2106  N  N     . PHE A 1 809  ? 116.855 101.507 127.896 1.00 22.36  ?  681  PHE A N     1 
ATOM   2107  C  CA    . PHE A 1 809  ? 116.023 102.569 127.330 1.00 25.85  ?  681  PHE A CA    1 
ATOM   2108  C  C     . PHE A 1 809  ? 114.620 102.490 127.933 1.00 29.00  ?  681  PHE A C     1 
ATOM   2109  O  O     . PHE A 1 809  ? 113.630 102.183 127.269 1.00 37.10  ?  681  PHE A O     1 
ATOM   2110  C  CB    . PHE A 1 809  ? 115.990 102.463 125.811 1.00 27.49  ?  681  PHE A CB    1 
ATOM   2111  C  CG    . PHE A 1 809  ? 116.820 103.502 125.107 1.00 27.26  ?  681  PHE A CG    1 
ATOM   2112  C  CD1   . PHE A 1 809  ? 118.167 103.321 124.923 1.00 33.50  ?  681  PHE A CD1   1 
ATOM   2113  C  CD2   . PHE A 1 809  ? 116.250 104.672 124.649 1.00 40.18  ?  681  PHE A CD2   1 
ATOM   2114  C  CE1   . PHE A 1 809  ? 118.918 104.276 124.284 1.00 33.80  ?  681  PHE A CE1   1 
ATOM   2115  C  CE2   . PHE A 1 809  ? 117.002 105.620 124.007 1.00 47.59  ?  681  PHE A CE2   1 
ATOM   2116  C  CZ    . PHE A 1 809  ? 118.334 105.422 123.831 1.00 41.24  ?  681  PHE A CZ    1 
ATOM   2117  N  N     . VAL A 1 810  ? 114.547 102.771 129.232 1.00 30.32  ?  682  VAL A N     1 
ATOM   2118  C  CA    . VAL A 1 810  ? 113.282 102.764 129.960 1.00 37.81  ?  682  VAL A CA    1 
ATOM   2119  C  C     . VAL A 1 810  ? 113.321 103.847 131.036 1.00 45.75  ?  682  VAL A C     1 
ATOM   2120  O  O     . VAL A 1 810  ? 114.280 104.623 131.114 1.00 42.02  ?  682  VAL A O     1 
ATOM   2121  C  CB    . VAL A 1 810  ? 112.993 101.377 130.557 1.00 37.58  ?  682  VAL A CB    1 
ATOM   2122  C  CG1   . VAL A 1 810  ? 112.383 100.470 129.496 1.00 37.75  ?  682  VAL A CG1   1 
ATOM   2123  C  CG2   . VAL A 1 810  ? 114.250 100.772 131.119 1.00 35.29  ?  682  VAL A CG2   1 
ATOM   2124  N  N     . ASP A 1 811  ? 112.267 103.925 131.845 1.00 60.08  ?  683  ASP A N     1 
ATOM   2125  C  CA    . ASP A 1 811  ? 112.062 104.993 132.817 1.00 75.52  ?  683  ASP A CA    1 
ATOM   2126  C  C     . ASP A 1 811  ? 112.321 104.486 134.239 1.00 72.66  ?  683  ASP A C     1 
ATOM   2127  O  O     . ASP A 1 811  ? 112.220 103.288 134.516 1.00 68.58  ?  683  ASP A O     1 
ATOM   2128  C  CB    . ASP A 1 811  ? 110.631 105.542 132.668 1.00 93.21  ?  683  ASP A CB    1 
ATOM   2129  C  CG    . ASP A 1 811  ? 110.269 106.620 133.688 1.00 111.62 ?  683  ASP A CG    1 
ATOM   2130  O  OD1   . ASP A 1 811  ? 110.307 106.356 134.908 1.00 91.17  ?  683  ASP A OD1   1 
ATOM   2131  O  OD2   . ASP A 1 811  ? 109.910 107.739 133.253 1.00 248.96 -1 683  ASP A OD2   1 
ATOM   2132  N  N     . GLU A 1 812  ? 112.674 105.419 135.138 1.00 68.82  ?  684  GLU A N     1 
ATOM   2133  C  CA    . GLU A 1 812  ? 112.974 105.107 136.535 1.00 57.38  ?  684  GLU A CA    1 
ATOM   2134  C  C     . GLU A 1 812  ? 111.767 104.613 137.306 1.00 57.01  ?  684  GLU A C     1 
ATOM   2135  O  O     . GLU A 1 812  ? 111.936 104.038 138.385 1.00 60.01  ?  684  GLU A O     1 
ATOM   2136  C  CB    . GLU A 1 812  ? 113.507 106.344 137.253 1.00 54.08  ?  684  GLU A CB    1 
ATOM   2137  C  CG    . GLU A 1 812  ? 114.832 106.851 136.753 1.00 66.60  ?  684  GLU A CG    1 
ATOM   2138  C  CD    . GLU A 1 812  ? 115.154 108.230 137.300 1.00 81.40  ?  684  GLU A CD    1 
ATOM   2139  O  OE1   . GLU A 1 812  ? 114.210 108.944 137.708 1.00 67.27  ?  684  GLU A OE1   1 
ATOM   2140  O  OE2   . GLU A 1 812  ? 116.349 108.594 137.334 1.00 161.43 -1 684  GLU A OE2   1 
ATOM   2141  N  N     . SER A 1 813  ? 110.561 104.861 136.802 1.00 64.38  ?  685  SER A N     1 
ATOM   2142  C  CA    . SER A 1 813  ? 109.342 104.543 137.531 1.00 65.60  ?  685  SER A CA    1 
ATOM   2143  C  C     . SER A 1 813  ? 108.771 103.168 137.189 1.00 65.12  ?  685  SER A C     1 
ATOM   2144  O  O     . SER A 1 813  ? 108.195 102.519 138.071 1.00 58.42  ?  685  SER A O     1 
ATOM   2145  C  CB    . SER A 1 813  ? 108.283 105.625 137.282 1.00 66.31  ?  685  SER A CB    1 
ATOM   2146  O  OG    . SER A 1 813  ? 108.825 106.927 137.440 1.00 60.92  ?  685  SER A OG    1 
ATOM   2147  N  N     . ASP A 1 814  ? 108.940 102.682 135.953 1.00 69.61  ?  686  ASP A N     1 
ATOM   2148  C  CA    . ASP A 1 814  ? 108.286 101.443 135.515 1.00 56.18  ?  686  ASP A CA    1 
ATOM   2149  C  C     . ASP A 1 814  ? 108.937 100.279 136.247 1.00 37.44  ?  686  ASP A C     1 
ATOM   2150  O  O     . ASP A 1 814  ? 109.759 99.534  135.711 1.00 36.27  ?  686  ASP A O     1 
ATOM   2151  C  CB    . ASP A 1 814  ? 108.379 101.256 134.004 1.00 65.60  ?  686  ASP A CB    1 
ATOM   2152  C  CG    . ASP A 1 814  ? 109.752 101.599 133.453 1.00 83.26  ?  686  ASP A CG    1 
ATOM   2153  O  OD1   . ASP A 1 814  ? 110.631 100.712 133.417 1.00 64.63  ?  686  ASP A OD1   1 
ATOM   2154  O  OD2   . ASP A 1 814  ? 109.952 102.757 133.031 1.00 240.98 -1 686  ASP A OD2   1 
ATOM   2155  N  N     . HIS A 1 815  ? 108.528 100.123 137.501 1.00 31.22  ?  687  HIS A N     1 
ATOM   2156  C  CA    . HIS A 1 815  ? 109.171 99.162  138.380 1.00 27.15  ?  687  HIS A CA    1 
ATOM   2157  C  C     . HIS A 1 815  ? 109.233 97.785  137.743 1.00 23.56  ?  687  HIS A C     1 
ATOM   2158  O  O     . HIS A 1 815  ? 110.257 97.096  137.823 1.00 23.57  ?  687  HIS A O     1 
ATOM   2159  C  CB    . HIS A 1 815  ? 108.429 99.111  139.707 1.00 22.67  ?  687  HIS A CB    1 
ATOM   2160  C  CG    . HIS A 1 815  ? 109.319 98.836  140.873 1.00 27.70  ?  687  HIS A CG    1 
ATOM   2161  N  ND1   . HIS A 1 815  ? 108.873 98.233  142.030 1.00 17.01  ?  687  HIS A ND1   1 
ATOM   2162  C  CD2   . HIS A 1 815  ? 110.635 99.092  141.056 1.00 21.76  ?  687  HIS A CD2   1 
ATOM   2163  C  CE1   . HIS A 1 815  ? 109.884 98.125  142.873 1.00 23.77  ?  687  HIS A CE1   1 
ATOM   2164  N  NE2   . HIS A 1 815  ? 110.962 98.641  142.308 1.00 19.45  ?  687  HIS A NE2   1 
ATOM   2165  N  N     . GLU A 1 816  ? 108.143 97.370  137.098 1.00 28.24  ?  688  GLU A N     1 
ATOM   2166  C  CA    . GLU A 1 816  ? 108.123 96.079  136.424 1.00 29.64  ?  688  GLU A CA    1 
ATOM   2167  C  C     . GLU A 1 816  ? 109.272 95.937  135.440 1.00 28.60  ?  688  GLU A C     1 
ATOM   2168  O  O     . GLU A 1 816  ? 110.087 95.013  135.545 1.00 29.50  ?  688  GLU A O     1 
ATOM   2169  C  CB    . GLU A 1 816  ? 106.790 95.869  135.716 1.00 41.55  ?  688  GLU A CB    1 
ATOM   2170  C  CG    . GLU A 1 816  ? 105.742 95.255  136.613 1.00 65.61  ?  688  GLU A CG    1 
ATOM   2171  C  CD    . GLU A 1 816  ? 104.885 94.252  135.867 1.00 90.54  ?  688  GLU A CD    1 
ATOM   2172  O  OE1   . GLU A 1 816  ? 105.424 93.612  134.941 1.00 83.49  ?  688  GLU A OE1   1 
ATOM   2173  O  OE2   . GLU A 1 816  ? 103.708 94.048  136.238 1.00 102.25 -1 688  GLU A OE2   1 
ATOM   2174  N  N     . THR A 1 817  ? 109.330 96.830  134.455 1.00 29.82  ?  689  THR A N     1 
ATOM   2175  C  CA    . THR A 1 817  ? 110.371 96.730  133.441 1.00 28.40  ?  689  THR A CA    1 
ATOM   2176  C  C     . THR A 1 817  ? 111.760 96.807  134.062 1.00 29.51  ?  689  THR A C     1 
ATOM   2177  O  O     . THR A 1 817  ? 112.673 96.070  133.658 1.00 30.19  ?  689  THR A O     1 
ATOM   2178  C  CB    . THR A 1 817  ? 110.166 97.826  132.398 1.00 30.12  ?  689  THR A CB    1 
ATOM   2179  O  OG1   . THR A 1 817  ? 108.758 97.986  132.150 1.00 30.93  ?  689  THR A OG1   1 
ATOM   2180  C  CG2   . THR A 1 817  ? 110.864 97.492  131.105 1.00 27.91  ?  689  THR A CG2   1 
ATOM   2181  N  N     . LEU A 1 818  ? 111.928 97.659  135.075 1.00 29.65  ?  690  LEU A N     1 
ATOM   2182  C  CA    . LEU A 1 818  ? 113.250 97.838  135.662 1.00 27.63  ?  690  LEU A CA    1 
ATOM   2183  C  C     . LEU A 1 818  ? 113.727 96.558  136.339 1.00 29.45  ?  690  LEU A C     1 
ATOM   2184  O  O     . LEU A 1 818  ? 114.828 96.070  136.057 1.00 26.97  ?  690  LEU A O     1 
ATOM   2185  C  CB    . LEU A 1 818  ? 113.240 99.007  136.645 1.00 28.22  ?  690  LEU A CB    1 
ATOM   2186  C  CG    . LEU A 1 818  ? 114.611 99.341  137.242 1.00 16.59  ?  690  LEU A CG    1 
ATOM   2187  C  CD1   . LEU A 1 818  ? 115.623 99.555  136.149 1.00 14.19  ?  690  LEU A CD1   1 
ATOM   2188  C  CD2   . LEU A 1 818  ? 114.571 100.548 138.154 1.00 20.73  ?  690  LEU A CD2   1 
ATOM   2189  N  N     . THR A 1 819  ? 112.915 96.001  137.248 1.00 30.53  ?  691  THR A N     1 
ATOM   2190  C  CA    . THR A 1 819  ? 113.308 94.758  137.911 1.00 28.37  ?  691  THR A CA    1 
ATOM   2191  C  C     . THR A 1 819  ? 113.478 93.633  136.904 1.00 24.19  ?  691  THR A C     1 
ATOM   2192  O  O     . THR A 1 819  ? 114.395 92.810  137.028 1.00 24.29  ?  691  THR A O     1 
ATOM   2193  C  CB    . THR A 1 819  ? 112.282 94.346  138.973 1.00 26.21  ?  691  THR A CB    1 
ATOM   2194  O  OG1   . THR A 1 819  ? 111.000 94.136  138.358 1.00 26.48  ?  691  THR A OG1   1 
ATOM   2195  C  CG2   . THR A 1 819  ? 112.150 95.386  140.076 1.00 26.56  ?  691  THR A CG2   1 
ATOM   2196  N  N     . ALA A 1 820  ? 112.591 93.571  135.908 1.00 26.49  ?  692  ALA A N     1 
ATOM   2197  C  CA    . ALA A 1 820  ? 112.678 92.519  134.907 1.00 27.94  ?  692  ALA A CA    1 
ATOM   2198  C  C     . ALA A 1 820  ? 114.016 92.555  134.192 1.00 31.88  ?  692  ALA A C     1 
ATOM   2199  O  O     . ALA A 1 820  ? 114.586 91.507  133.870 1.00 30.77  ?  692  ALA A O     1 
ATOM   2200  C  CB    . ALA A 1 820  ? 111.537 92.657  133.905 1.00 30.23  ?  692  ALA A CB    1 
ATOM   2201  N  N     . ILE A 1 821  ? 114.536 93.747  133.927 1.00 114.95 ?  693  ILE A N     1 
ATOM   2202  C  CA    . ILE A 1 821  ? 115.850 93.753  133.307 1.00 23.62  ?  693  ILE A CA    1 
ATOM   2203  C  C     . ILE A 1 821  ? 116.942 93.520  134.345 1.00 23.90  ?  693  ILE A C     1 
ATOM   2204  O  O     . ILE A 1 821  ? 117.958 92.888  134.042 1.00 24.93  ?  693  ILE A O     1 
ATOM   2205  C  CB    . ILE A 1 821  ? 116.079 95.052  132.530 1.00 22.01  ?  693  ILE A CB    1 
ATOM   2206  C  CG1   . ILE A 1 821  ? 114.961 95.269  131.519 1.00 26.28  ?  693  ILE A CG1   1 
ATOM   2207  C  CG2   . ILE A 1 821  ? 117.375 94.971  131.783 1.00 24.19  ?  693  ILE A CG2   1 
ATOM   2208  C  CD1   . ILE A 1 821  ? 114.810 94.148  130.539 1.00 31.56  ?  693  ILE A CD1   1 
ATOM   2209  N  N     . LEU A 1 822  ? 116.748 93.975  135.585 1.00 25.58  ?  694  LEU A N     1 
ATOM   2210  C  CA    . LEU A 1 822  ? 117.852 94.027  136.544 1.00 26.08  ?  694  LEU A CA    1 
ATOM   2211  C  C     . LEU A 1 822  ? 118.097 92.719  137.289 1.00 23.75  ?  694  LEU A C     1 
ATOM   2212  O  O     . LEU A 1 822  ? 119.186 92.542  137.846 1.00 23.04  ?  694  LEU A O     1 
ATOM   2213  C  CB    . LEU A 1 822  ? 117.610 95.147  137.560 1.00 21.66  ?  694  LEU A CB    1 
ATOM   2214  C  CG    . LEU A 1 822  ? 118.572 96.325  137.449 1.00 17.94  ?  694  LEU A CG    1 
ATOM   2215  C  CD1   . LEU A 1 822  ? 118.527 96.902  136.075 1.00 18.78  ?  694  LEU A CD1   1 
ATOM   2216  C  CD2   . LEU A 1 822  ? 118.280 97.398  138.470 1.00 15.68  ?  694  LEU A CD2   1 
ATOM   2217  N  N     . GLY A 1 823  ? 117.119 91.817  137.327 1.00 20.73  ?  695  GLY A N     1 
ATOM   2218  C  CA    . GLY A 1 823  ? 117.278 90.520  137.954 1.00 16.39  ?  695  GLY A CA    1 
ATOM   2219  C  C     . GLY A 1 823  ? 118.642 89.879  137.776 1.00 16.87  ?  695  GLY A C     1 
ATOM   2220  O  O     . GLY A 1 823  ? 119.256 89.417  138.739 1.00 18.20  ?  695  GLY A O     1 
ATOM   2221  N  N     . PRO A 1 824  ? 119.133 89.813  136.534 1.00 17.02  ?  696  PRO A N     1 
ATOM   2222  C  CA    . PRO A 1 824  ? 120.513 89.355  136.306 1.00 18.99  ?  696  PRO A CA    1 
ATOM   2223  C  C     . PRO A 1 824  ? 121.547 90.030  137.190 1.00 23.43  ?  696  PRO A C     1 
ATOM   2224  O  O     . PRO A 1 824  ? 122.337 89.357  137.862 1.00 28.93  ?  696  PRO A O     1 
ATOM   2225  C  CB    . PRO A 1 824  ? 120.754 89.709  134.832 1.00 15.71  ?  696  PRO A CB    1 
ATOM   2226  C  CG    . PRO A 1 824  ? 119.436 89.618  134.223 1.00 16.98  ?  696  PRO A CG    1 
ATOM   2227  C  CD    . PRO A 1 824  ? 118.397 89.954  135.264 1.00 15.51  ?  696  PRO A CD    1 
ATOM   2228  N  N     . VAL A 1 825  ? 121.550 91.365  137.172 1.00 21.35  ?  697  VAL A N     1 
ATOM   2229  C  CA    . VAL A 1 825  ? 122.575 92.135  137.875 1.00 27.81  ?  697  VAL A CA    1 
ATOM   2230  C  C     . VAL A 1 825  ? 122.533 91.851  139.370 1.00 27.06  ?  697  VAL A C     1 
ATOM   2231  O  O     . VAL A 1 825  ? 123.559 91.553  139.998 1.00 26.24  ?  697  VAL A O     1 
ATOM   2232  C  CB    . VAL A 1 825  ? 122.395 93.638  137.595 1.00 26.18  ?  697  VAL A CB    1 
ATOM   2233  C  CG1   . VAL A 1 825  ? 123.354 94.457  138.431 1.00 24.83  ?  697  VAL A CG1   1 
ATOM   2234  C  CG2   . VAL A 1 825  ? 122.595 93.941  136.131 1.00 26.96  ?  697  VAL A CG2   1 
ATOM   2235  N  N     . VAL A 1 826  ? 121.348 91.975  139.963 1.00 25.73  ?  698  VAL A N     1 
ATOM   2236  C  CA    . VAL A 1 826  ? 121.207 91.736  141.392 1.00 27.35  ?  698  VAL A CA    1 
ATOM   2237  C  C     . VAL A 1 826  ? 121.653 90.322  141.733 1.00 24.50  ?  698  VAL A C     1 
ATOM   2238  O  O     . VAL A 1 826  ? 122.403 90.098  142.691 1.00 23.91  ?  698  VAL A O     1 
ATOM   2239  C  CB    . VAL A 1 826  ? 119.752 91.988  141.821 1.00 24.20  ?  698  VAL A CB    1 
ATOM   2240  C  CG1   . VAL A 1 826  ? 119.457 91.337  143.162 1.00 27.15  ?  698  VAL A CG1   1 
ATOM   2241  C  CG2   . VAL A 1 826  ? 119.466 93.471  141.863 1.00 21.95  ?  698  VAL A CG2   1 
ATOM   2242  N  N     . ALA A 1 827  ? 121.206 89.347  140.939 1.00 23.79  ?  699  ALA A N     1 
ATOM   2243  C  CA    . ALA A 1 827  ? 121.498 87.957  141.254 1.00 26.15  ?  699  ALA A CA    1 
ATOM   2244  C  C     . ALA A 1 827  ? 122.994 87.676  141.219 1.00 25.22  ?  699  ALA A C     1 
ATOM   2245  O  O     . ALA A 1 827  ? 123.515 86.941  142.067 1.00 25.99  ?  699  ALA A O     1 
ATOM   2246  C  CB    . ALA A 1 827  ? 120.758 87.043  140.286 1.00 25.30  ?  699  ALA A CB    1 
ATOM   2247  N  N     . GLU A 1 828  ? 123.700 88.226  140.231 1.00 24.03  ?  700  GLU A N     1 
ATOM   2248  C  CA    . GLU A 1 828  ? 125.126 87.933  140.156 1.00 30.81  ?  700  GLU A CA    1 
ATOM   2249  C  C     . GLU A 1 828  ? 125.908 88.726  141.190 1.00 25.25  ?  700  GLU A C     1 
ATOM   2250  O  O     . GLU A 1 828  ? 126.904 88.229  141.728 1.00 25.03  ?  700  GLU A O     1 
ATOM   2251  C  CB    . GLU A 1 828  ? 125.659 88.158  138.736 1.00 41.20  ?  700  GLU A CB    1 
ATOM   2252  C  CG    . GLU A 1 828  ? 125.463 89.533  138.103 1.00 51.03  ?  700  GLU A CG    1 
ATOM   2253  C  CD    . GLU A 1 828  ? 125.716 89.500  136.584 1.00 81.82  ?  700  GLU A CD    1 
ATOM   2254  O  OE1   . GLU A 1 828  ? 125.637 88.402  135.990 1.00 57.12  ?  700  GLU A OE1   1 
ATOM   2255  O  OE2   . GLU A 1 828  ? 125.985 90.561  135.975 1.00 203.65 -1 700  GLU A OE2   1 
ATOM   2256  N  N     . ARG A 1 829  ? 125.460 89.938  141.512 1.00 24.56  ?  701  ARG A N     1 
ATOM   2257  C  CA    . ARG A 1 829  ? 126.012 90.613  142.679 1.00 26.12  ?  701  ARG A CA    1 
ATOM   2258  C  C     . ARG A 1 829  ? 125.865 89.743  143.920 1.00 23.20  ?  701  ARG A C     1 
ATOM   2259  O  O     . ARG A 1 829  ? 126.751 89.711  144.781 1.00 23.22  ?  701  ARG A O     1 
ATOM   2260  C  CB    . ARG A 1 829  ? 125.312 91.952  142.887 1.00 30.90  ?  701  ARG A CB    1 
ATOM   2261  C  CG    . ARG A 1 829  ? 126.184 93.019  143.531 1.00 33.07  ?  701  ARG A CG    1 
ATOM   2262  C  CD    . ARG A 1 829  ? 125.370 93.913  144.441 1.00 34.16  ?  701  ARG A CD    1 
ATOM   2263  N  NE    . ARG A 1 829  ? 124.939 93.217  145.654 1.00 37.03  ?  701  ARG A NE    1 
ATOM   2264  C  CZ    . ARG A 1 829  ? 124.042 93.693  146.512 1.00 38.43  ?  701  ARG A CZ    1 
ATOM   2265  N  NH1   . ARG A 1 829  ? 123.464 94.868  146.289 1.00 40.32  ?  701  ARG A NH1   1 
ATOM   2266  N  NH2   . ARG A 1 829  ? 123.719 92.988  147.587 1.00 36.78  ?  701  ARG A NH2   1 
ATOM   2267  N  N     . LYS A 1 830  ? 124.736 89.046  144.029 1.00 22.95  ?  702  LYS A N     1 
ATOM   2268  C  CA    . LYS A 1 830  ? 124.489 88.166  145.163 1.00 24.15  ?  702  LYS A CA    1 
ATOM   2269  C  C     . LYS A 1 830  ? 125.480 87.010  145.169 1.00 30.24  ?  702  LYS A C     1 
ATOM   2270  O  O     . LYS A 1 830  ? 126.195 86.783  146.151 1.00 32.35  ?  702  LYS A O     1 
ATOM   2271  C  CB    . LYS A 1 830  ? 123.049 87.653  145.095 1.00 22.02  ?  702  LYS A CB    1 
ATOM   2272  C  CG    . LYS A 1 830  ? 122.585 86.816  146.271 1.00 27.31  ?  702  LYS A CG    1 
ATOM   2273  C  CD    . LYS A 1 830  ? 122.330 87.664  147.508 1.00 23.64  ?  702  LYS A CD    1 
ATOM   2274  C  CE    . LYS A 1 830  ? 121.434 88.864  147.201 1.00 16.64  ?  702  LYS A CE    1 
ATOM   2275  N  NZ    . LYS A 1 830  ? 120.047 88.486  146.801 1.00 22.43  ?  702  LYS A NZ    1 
ATOM   2276  N  N     . ALA A 1 831  ? 125.539 86.272  144.063 1.00 30.11  ?  703  ALA A N     1 
ATOM   2277  C  CA    . ALA A 1 831  ? 126.459 85.144  143.973 1.00 30.03  ?  703  ALA A CA    1 
ATOM   2278  C  C     . ALA A 1 831  ? 127.911 85.563  144.159 1.00 29.27  ?  703  ALA A C     1 
ATOM   2279  O  O     . ALA A 1 831  ? 128.743 84.726  144.521 1.00 26.44  ?  703  ALA A O     1 
ATOM   2280  C  CB    . ALA A 1 831  ? 126.303 84.437  142.625 1.00 31.27  ?  703  ALA A CB    1 
ATOM   2281  N  N     . MET A 1 832  ? 128.236 86.830  143.910 1.00 24.11  ?  704  MET A N     1 
ATOM   2282  C  CA    . MET A 1 832  ? 129.617 87.271  144.029 1.00 25.23  ?  704  MET A CA    1 
ATOM   2283  C  C     . MET A 1 832  ? 130.102 87.203  145.476 1.00 29.15  ?  704  MET A C     1 
ATOM   2284  O  O     . MET A 1 832  ? 131.132 86.587  145.770 1.00 36.61  ?  704  MET A O     1 
ATOM   2285  C  CB    . MET A 1 832  ? 129.729 88.688  143.477 1.00 23.25  ?  704  MET A CB    1 
ATOM   2286  C  CG    . MET A 1 832  ? 131.120 89.293  143.512 1.00 28.70  ?  704  MET A CG    1 
ATOM   2287  S  SD    . MET A 1 832  ? 132.202 88.906  142.112 1.00 24.07  ?  704  MET A SD    1 
ATOM   2288  C  CE    . MET A 1 832  ? 131.026 88.334  140.890 1.00 24.88  ?  704  MET A CE    1 
ATOM   2289  N  N     . MET A 1 833  ? 129.350 87.800  146.404 1.00 32.17  ?  705  MET A N     1 
ATOM   2290  C  CA    . MET A 1 833  ? 129.835 88.020  147.767 1.00 35.50  ?  705  MET A CA    1 
ATOM   2291  C  C     . MET A 1 833  ? 130.189 86.737  148.504 1.00 38.44  ?  705  MET A C     1 
ATOM   2292  O  O     . MET A 1 833  ? 130.807 86.814  149.567 1.00 39.45  ?  705  MET A O     1 
ATOM   2293  C  CB    . MET A 1 833  ? 128.784 88.796  148.559 1.00 33.09  ?  705  MET A CB    1 
ATOM   2294  C  CG    . MET A 1 833  ? 128.084 89.869  147.743 1.00 30.36  ?  705  MET A CG    1 
ATOM   2295  S  SD    . MET A 1 833  ? 127.937 91.428  148.628 1.00 33.81  ?  705  MET A SD    1 
ATOM   2296  C  CE    . MET A 1 833  ? 127.185 90.850  150.155 1.00 46.06  ?  705  MET A CE    1 
ATOM   2297  N  N     . GLU A 1 834  ? 129.818 85.572  147.974 1.00 44.76  ?  706  GLU A N     1 
ATOM   2298  C  CA    . GLU A 1 834  ? 130.112 84.306  148.640 1.00 55.78  ?  706  GLU A CA    1 
ATOM   2299  C  C     . GLU A 1 834  ? 131.517 83.798  148.321 1.00 48.17  ?  706  GLU A C     1 
ATOM   2300  O  O     . GLU A 1 834  ? 132.392 83.764  149.194 1.00 45.41  ?  706  GLU A O     1 
ATOM   2301  C  CB    . GLU A 1 834  ? 129.064 83.268  148.232 1.00 63.21  ?  706  GLU A CB    1 
ATOM   2302  C  CG    . GLU A 1 834  ? 127.675 83.607  148.709 1.00 81.35  ?  706  GLU A CG    1 
ATOM   2303  C  CD    . GLU A 1 834  ? 127.583 83.599  150.216 1.00 121.32 ?  706  GLU A CD    1 
ATOM   2304  O  OE1   . GLU A 1 834  ? 128.029 82.608  150.834 1.00 113.80 ?  706  GLU A OE1   1 
ATOM   2305  O  OE2   . GLU A 1 834  ? 127.102 84.601  150.783 1.00 260.50 -1 706  GLU A OE2   1 
ATOM   2306  N  N     . SER A 1 835  ? 131.756 83.428  147.065 1.00 41.94  ?  707  SER A N     1 
ATOM   2307  C  CA    . SER A 1 835  ? 132.974 82.728  146.684 1.00 35.11  ?  707  SER A CA    1 
ATOM   2308  C  C     . SER A 1 835  ? 134.165 83.683  146.692 1.00 33.81  ?  707  SER A C     1 
ATOM   2309  O  O     . SER A 1 835  ? 134.068 84.862  147.036 1.00 32.72  ?  707  SER A O     1 
ATOM   2310  C  CB    . SER A 1 835  ? 132.806 82.085  145.305 1.00 33.22  ?  707  SER A CB    1 
ATOM   2311  O  OG    . SER A 1 835  ? 134.051 81.741  144.715 1.00 27.69  ?  707  SER A OG    1 
ATOM   2312  N  N     . ARG A 1 836  ? 135.313 83.159  146.302 1.00 30.42  ?  708  ARG A N     1 
ATOM   2313  C  CA    . ARG A 1 836  ? 136.494 83.967  146.069 1.00 28.38  ?  708  ARG A CA    1 
ATOM   2314  C  C     . ARG A 1 836  ? 136.954 83.750  144.632 1.00 28.94  ?  708  ARG A C     1 
ATOM   2315  O  O     . ARG A 1 836  ? 136.601 82.755  143.985 1.00 29.58  ?  708  ARG A O     1 
ATOM   2316  C  CB    . ARG A 1 836  ? 137.602 83.618  147.065 1.00 32.99  ?  708  ARG A CB    1 
ATOM   2317  C  CG    . ARG A 1 836  ? 137.114 83.513  148.505 1.00 32.67  ?  708  ARG A CG    1 
ATOM   2318  C  CD    . ARG A 1 836  ? 138.226 83.136  149.473 1.00 43.24  ?  708  ARG A CD    1 
ATOM   2319  N  NE    . ARG A 1 836  ? 139.082 82.082  148.939 1.00 50.04  ?  708  ARG A NE    1 
ATOM   2320  C  CZ    . ARG A 1 836  ? 140.354 82.254  148.588 1.00 54.99  ?  708  ARG A CZ    1 
ATOM   2321  N  NH1   . ARG A 1 836  ? 141.062 81.237  148.107 1.00 59.31  ?  708  ARG A NH1   1 
ATOM   2322  N  NH2   . ARG A 1 836  ? 140.918 83.445  148.730 1.00 57.03  ?  708  ARG A NH2   1 
ATOM   2323  N  N     . LEU A 1 837  ? 137.783 84.678  144.163 1.00 29.36  ?  709  LEU A N     1 
ATOM   2324  C  CA    . LEU A 1 837  ? 138.085 84.875  142.751 1.00 31.97  ?  709  LEU A CA    1 
ATOM   2325  C  C     . LEU A 1 837  ? 139.568 84.653  142.476 1.00 37.15  ?  709  LEU A C     1 
ATOM   2326  O  O     . LEU A 1 837  ? 140.416 85.241  143.150 1.00 37.10  ?  709  LEU A O     1 
ATOM   2327  C  CB    . LEU A 1 837  ? 137.691 86.292  142.343 1.00 29.53  ?  709  LEU A CB    1 
ATOM   2328  C  CG    . LEU A 1 837  ? 137.964 86.707  140.910 1.00 28.96  ?  709  LEU A CG    1 
ATOM   2329  C  CD1   . LEU A 1 837  ? 137.408 85.694  139.942 1.00 29.95  ?  709  LEU A CD1   1 
ATOM   2330  C  CD2   . LEU A 1 837  ? 137.375 88.067  140.660 1.00 24.39  ?  709  LEU A CD2   1 
ATOM   2331  N  N     . ILE A 1 838  ? 139.878 83.829  141.474 1.00 41.55  ?  710  ILE A N     1 
ATOM   2332  C  CA    . ILE A 1 838  ? 141.250 83.509  141.088 1.00 41.49  ?  710  ILE A CA    1 
ATOM   2333  C  C     . ILE A 1 838  ? 141.501 84.071  139.697 1.00 36.70  ?  710  ILE A C     1 
ATOM   2334  O  O     . ILE A 1 838  ? 140.776 83.744  138.741 1.00 35.64  ?  710  ILE A O     1 
ATOM   2335  C  CB    . ILE A 1 838  ? 141.517 81.994  141.120 1.00 44.62  ?  710  ILE A CB    1 
ATOM   2336  C  CG1   . ILE A 1 838  ? 141.658 81.491  142.560 1.00 46.41  ?  710  ILE A CG1   1 
ATOM   2337  C  CG2   . ILE A 1 838  ? 142.754 81.645  140.318 1.00 48.80  ?  710  ILE A CG2   1 
ATOM   2338  C  CD1   . ILE A 1 838  ? 142.150 80.043  142.676 1.00 48.86  ?  710  ILE A CD1   1 
ATOM   2339  N  N     . ILE A 1 839  ? 142.538 84.908  139.592 1.00 39.42  ?  711  ILE A N     1 
ATOM   2340  C  CA    . ILE A 1 839  ? 142.975 85.498  138.334 1.00 42.62  ?  711  ILE A CA    1 
ATOM   2341  C  C     . ILE A 1 839  ? 144.472 85.240  138.182 1.00 91.95  ?  711  ILE A C     1 
ATOM   2342  O  O     . ILE A 1 839  ? 145.163 84.870  139.131 1.00 60.55  ?  711  ILE A O     1 
ATOM   2343  C  CB    . ILE A 1 839  ? 142.697 87.013  138.267 1.00 40.85  ?  711  ILE A CB    1 
ATOM   2344  C  CG1   . ILE A 1 839  ? 141.394 87.356  138.973 1.00 35.29  ?  711  ILE A CG1   1 
ATOM   2345  C  CG2   . ILE A 1 839  ? 142.621 87.481  136.837 1.00 32.35  ?  711  ILE A CG2   1 
ATOM   2346  C  CD1   . ILE A 1 839  ? 140.193 86.979  138.203 1.00 32.29  ?  711  ILE A CD1   1 
ATOM   2347  N  N     . SER A 1 840  ? 144.974 85.466  136.968 1.00 53.78  ?  712  SER A N     1 
ATOM   2348  C  CA    . SER A 1 840  ? 146.405 85.464  136.685 1.00 53.45  ?  712  SER A CA    1 
ATOM   2349  C  C     . SER A 1 840  ? 146.886 86.912  136.703 1.00 55.27  ?  712  SER A C     1 
ATOM   2350  O  O     . SER A 1 840  ? 146.619 87.673  135.770 1.00 53.42  ?  712  SER A O     1 
ATOM   2351  C  CB    . SER A 1 840  ? 146.696 84.783  135.351 1.00 52.06  ?  712  SER A CB    1 
ATOM   2352  O  OG    . SER A 1 840  ? 146.364 85.618  134.263 1.00 50.97  ?  712  SER A OG    1 
ATOM   2353  N  N     . VAL A 1 841  ? 147.593 87.281  137.769 1.00 64.27  ?  713  VAL A N     1 
ATOM   2354  C  CA    . VAL A 1 841  ? 147.946 88.663  138.076 1.00 66.19  ?  713  VAL A CA    1 
ATOM   2355  C  C     . VAL A 1 841  ? 149.296 88.669  138.785 1.00 72.72  ?  713  VAL A C     1 
ATOM   2356  O  O     . VAL A 1 841  ? 149.586 87.797  139.611 1.00 72.35  ?  713  VAL A O     1 
ATOM   2357  C  CB    . VAL A 1 841  ? 146.823 89.333  138.897 1.00 62.72  ?  713  VAL A CB    1 
ATOM   2358  C  CG1   . VAL A 1 841  ? 146.708 88.690  140.235 1.00 57.55  ?  713  VAL A CG1   1 
ATOM   2359  C  CG2   . VAL A 1 841  ? 147.128 90.791  139.122 1.00 69.48  ?  713  VAL A CG2   1 
ATOM   2360  N  N     . GLY A 1 842  ? 150.139 89.636  138.426 1.00 80.98  ?  714  GLY A N     1 
ATOM   2361  C  CA    . GLY A 1 842  ? 151.507 89.651  138.914 1.00 90.02  ?  714  GLY A CA    1 
ATOM   2362  C  C     . GLY A 1 842  ? 152.278 88.401  138.564 1.00 89.24  ?  714  GLY A C     1 
ATOM   2363  O  O     . GLY A 1 842  ? 153.158 87.985  139.324 1.00 85.14  ?  714  GLY A O     1 
ATOM   2364  N  N     . GLY A 1 843  ? 151.960 87.781  137.429 1.00 89.08  ?  715  GLY A N     1 
ATOM   2365  C  CA    . GLY A 1 843  ? 152.545 86.520  137.041 1.00 89.33  ?  715  GLY A CA    1 
ATOM   2366  C  C     . GLY A 1 843  ? 152.015 85.308  137.775 1.00 86.11  ?  715  GLY A C     1 
ATOM   2367  O  O     . GLY A 1 843  ? 152.249 84.181  137.319 1.00 87.87  ?  715  GLY A O     1 
ATOM   2368  N  N     . LEU A 1 844  ? 151.293 85.491  138.879 1.00 79.05  ?  716  LEU A N     1 
ATOM   2369  C  CA    . LEU A 1 844  ? 150.881 84.377  139.717 1.00 69.24  ?  716  LEU A CA    1 
ATOM   2370  C  C     . LEU A 1 844  ? 149.364 84.333  139.844 1.00 62.67  ?  716  LEU A C     1 
ATOM   2371  O  O     . LEU A 1 844  ? 148.661 85.316  139.600 1.00 64.69  ?  716  LEU A O     1 
ATOM   2372  C  CB    . LEU A 1 844  ? 151.533 84.458  141.109 1.00 72.62  ?  716  LEU A CB    1 
ATOM   2373  C  CG    . LEU A 1 844  ? 153.067 84.409  141.118 1.00 83.44  ?  716  LEU A CG    1 
ATOM   2374  C  CD1   . LEU A 1 844  ? 153.652 84.319  142.529 1.00 100.59 ?  716  LEU A CD1   1 
ATOM   2375  C  CD2   . LEU A 1 844  ? 153.560 83.252  140.269 1.00 84.97  ?  716  LEU A CD2   1 
ATOM   2376  N  N     . LEU A 1 845  ? 148.863 83.162  140.216 1.00 61.49  ?  717  LEU A N     1 
ATOM   2377  C  CA    . LEU A 1 845  ? 147.429 82.965  140.392 1.00 60.72  ?  717  LEU A CA    1 
ATOM   2378  C  C     . LEU A 1 845  ? 147.041 83.505  141.766 1.00 59.14  ?  717  LEU A C     1 
ATOM   2379  O  O     . LEU A 1 845  ? 147.396 82.924  142.799 1.00 58.73  ?  717  LEU A O     1 
ATOM   2380  C  CB    . LEU A 1 845  ? 147.073 81.487  140.226 1.00 58.56  ?  717  LEU A CB    1 
ATOM   2381  C  CG    . LEU A 1 845  ? 146.814 80.929  138.809 1.00 47.56  ?  717  LEU A CG    1 
ATOM   2382  C  CD1   . LEU A 1 845  ? 147.883 81.313  137.797 1.00 46.29  ?  717  LEU A CD1   1 
ATOM   2383  C  CD2   . LEU A 1 845  ? 146.654 79.411  138.833 1.00 39.41  ?  717  LEU A CD2   1 
ATOM   2384  N  N     . ARG A 1 846  ? 146.321 84.623  141.782 1.00 54.34  ?  718  ARG A N     1 
ATOM   2385  C  CA    . ARG A 1 846  ? 146.007 85.338  143.009 1.00 54.37  ?  718  ARG A CA    1 
ATOM   2386  C  C     . ARG A 1 846  ? 144.503 85.360  143.251 1.00 52.82  ?  718  ARG A C     1 
ATOM   2387  O  O     . ARG A 1 846  ? 143.696 85.248  142.315 1.00 49.20  ?  718  ARG A O     1 
ATOM   2388  C  CB    . ARG A 1 846  ? 146.541 86.771  142.970 1.00 53.85  ?  718  ARG A CB    1 
ATOM   2389  C  CG    . ARG A 1 846  ? 148.025 86.884  142.712 1.00 55.62  ?  718  ARG A CG    1 
ATOM   2390  C  CD    . ARG A 1 846  ? 148.530 88.241  143.138 1.00 61.01  ?  718  ARG A CD    1 
ATOM   2391  N  NE    . ARG A 1 846  ? 149.924 88.459  142.766 1.00 69.42  ?  718  ARG A NE    1 
ATOM   2392  C  CZ    . ARG A 1 846  ? 150.642 89.512  143.141 1.00 73.27  ?  718  ARG A CZ    1 
ATOM   2393  N  NH1   . ARG A 1 846  ? 150.095 90.446  143.901 1.00 72.99  ?  718  ARG A NH1   1 
ATOM   2394  N  NH2   . ARG A 1 846  ? 151.909 89.628  142.763 1.00 79.76  ?  718  ARG A NH2   1 
ATOM   2395  N  N     . SER A 1 847  ? 144.146 85.540  144.524 1.00 55.99  ?  719  SER A N     1 
ATOM   2396  C  CA    . SER A 1 847  ? 142.794 85.405  145.044 1.00 52.87  ?  719  SER A CA    1 
ATOM   2397  C  C     . SER A 1 847  ? 142.219 86.760  145.462 1.00 44.40  ?  719  SER A C     1 
ATOM   2398  O  O     . SER A 1 847  ? 142.945 87.710  145.765 1.00 43.71  ?  719  SER A O     1 
ATOM   2399  C  CB    . SER A 1 847  ? 142.780 84.439  146.235 1.00 53.12  ?  719  SER A CB    1 
ATOM   2400  O  OG    . SER A 1 847  ? 141.591 84.547  146.989 1.00 50.44  ?  719  SER A OG    1 
ATOM   2401  N  N     . PHE A 1 848  ? 140.886 86.835  145.473 1.00 42.06  ?  720  PHE A N     1 
ATOM   2402  C  CA    . PHE A 1 848  ? 140.158 88.062  145.792 1.00 36.14  ?  720  PHE A CA    1 
ATOM   2403  C  C     . PHE A 1 848  ? 138.808 87.751  146.431 1.00 35.99  ?  720  PHE A C     1 
ATOM   2404  O  O     . PHE A 1 848  ? 138.138 86.795  146.041 1.00 36.86  ?  720  PHE A O     1 
ATOM   2405  C  CB    . PHE A 1 848  ? 139.953 88.921  144.537 1.00 31.16  ?  720  PHE A CB    1 
ATOM   2406  C  CG    . PHE A 1 848  ? 141.214 89.538  144.019 1.00 34.68  ?  720  PHE A CG    1 
ATOM   2407  C  CD1   . PHE A 1 848  ? 141.748 90.657  144.629 1.00 34.40  ?  720  PHE A CD1   1 
ATOM   2408  C  CD2   . PHE A 1 848  ? 141.890 88.986  142.956 1.00 31.97  ?  720  PHE A CD2   1 
ATOM   2409  C  CE1   . PHE A 1 848  ? 142.904 91.230  144.160 1.00 31.32  ?  720  PHE A CE1   1 
ATOM   2410  C  CE2   . PHE A 1 848  ? 143.053 89.554  142.498 1.00 38.41  ?  720  PHE A CE2   1 
ATOM   2411  C  CZ    . PHE A 1 848  ? 143.558 90.674  143.105 1.00 32.19  ?  720  PHE A CZ    1 
ATOM   2412  N  N     . ARG A 1 849  ? 138.431 88.548  147.427 1.00 29.53  ?  721  ARG A N     1 
ATOM   2413  C  CA    . ARG A 1 849  ? 137.091 88.577  147.995 1.00 25.09  ?  721  ARG A CA    1 
ATOM   2414  C  C     . ARG A 1 849  ? 136.434 89.896  147.603 1.00 24.74  ?  721  ARG A C     1 
ATOM   2415  O  O     . ARG A 1 849  ? 137.052 90.745  146.961 1.00 24.35  ?  721  ARG A O     1 
ATOM   2416  C  CB    . ARG A 1 849  ? 137.143 88.400  149.512 1.00 22.32  ?  721  ARG A CB    1 
ATOM   2417  C  CG    . ARG A 1 849  ? 137.750 87.085  149.954 1.00 22.93  ?  721  ARG A CG    1 
ATOM   2418  C  CD    . ARG A 1 849  ? 137.552 86.873  151.431 1.00 20.06  ?  721  ARG A CD    1 
ATOM   2419  N  NE    . ARG A 1 849  ? 136.150 87.048  151.771 1.00 24.76  ?  721  ARG A NE    1 
ATOM   2420  C  CZ    . ARG A 1 849  ? 135.201 86.198  151.406 1.00 29.22  ?  721  ARG A CZ    1 
ATOM   2421  N  NH1   . ARG A 1 849  ? 135.512 85.129  150.685 1.00 29.91  ?  721  ARG A NH1   1 
ATOM   2422  N  NH2   . ARG A 1 849  ? 133.942 86.423  151.751 1.00 31.16  ?  721  ARG A NH2   1 
ATOM   2423  N  N     . PHE A 1 850  ? 135.172 90.075  147.986 1.00 22.78  ?  722  PHE A N     1 
ATOM   2424  C  CA    . PHE A 1 850  ? 134.481 91.311  147.641 1.00 27.59  ?  722  PHE A CA    1 
ATOM   2425  C  C     . PHE A 1 850  ? 133.422 91.683  148.673 1.00 35.18  ?  722  PHE A C     1 
ATOM   2426  O  O     . PHE A 1 850  ? 132.836 90.821  149.334 1.00 35.17  ?  722  PHE A O     1 
ATOM   2427  C  CB    . PHE A 1 850  ? 133.825 91.221  146.263 1.00 22.90  ?  722  PHE A CB    1 
ATOM   2428  C  CG    . PHE A 1 850  ? 134.766 91.473  145.117 1.00 21.19  ?  722  PHE A CG    1 
ATOM   2429  C  CD1   . PHE A 1 850  ? 135.075 92.763  144.734 1.00 21.13  ?  722  PHE A CD1   1 
ATOM   2430  C  CD2   . PHE A 1 850  ? 135.316 90.431  144.409 1.00 27.17  ?  722  PHE A CD2   1 
ATOM   2431  C  CE1   . PHE A 1 850  ? 135.914 93.003  143.673 1.00 17.91  ?  722  PHE A CE1   1 
ATOM   2432  C  CE2   . PHE A 1 850  ? 136.157 90.672  143.349 1.00 23.92  ?  722  PHE A CE2   1 
ATOM   2433  C  CZ    . PHE A 1 850  ? 136.452 91.961  142.987 1.00 27.94  ?  722  PHE A CZ    1 
ATOM   2434  N  N     . PHE A 1 851  ? 133.200 92.994  148.807 1.00 30.71  ?  723  PHE A N     1 
ATOM   2435  C  CA    . PHE A 1 851  ? 132.059 93.573  149.505 1.00 31.07  ?  723  PHE A CA    1 
ATOM   2436  C  C     . PHE A 1 851  ? 131.532 94.703  148.635 1.00 26.04  ?  723  PHE A C     1 
ATOM   2437  O  O     . PHE A 1 851  ? 132.266 95.250  147.807 1.00 23.74  ?  723  PHE A O     1 
ATOM   2438  C  CB    . PHE A 1 851  ? 132.423 94.103  150.903 1.00 29.73  ?  723  PHE A CB    1 
ATOM   2439  C  CG    . PHE A 1 851  ? 133.127 93.095  151.771 1.00 42.90  ?  723  PHE A CG    1 
ATOM   2440  C  CD1   . PHE A 1 851  ? 132.470 91.964  152.217 1.00 54.44  ?  723  PHE A CD1   1 
ATOM   2441  C  CD2   . PHE A 1 851  ? 134.440 93.286  152.155 1.00 46.32  ?  723  PHE A CD2   1 
ATOM   2442  C  CE1   . PHE A 1 851  ? 133.118 91.043  153.019 1.00 67.98  ?  723  PHE A CE1   1 
ATOM   2443  C  CE2   . PHE A 1 851  ? 135.088 92.365  152.958 1.00 56.03  ?  723  PHE A CE2   1 
ATOM   2444  C  CZ    . PHE A 1 851  ? 134.423 91.248  153.386 1.00 77.67  ?  723  PHE A CZ    1 
ATOM   2445  N  N     . PHE A 1 852  ? 130.250 95.033  148.791 1.00 20.11  ?  724  PHE A N     1 
ATOM   2446  C  CA    . PHE A 1 852  ? 129.605 95.992  147.900 1.00 22.41  ?  724  PHE A CA    1 
ATOM   2447  C  C     . PHE A 1 852  ? 128.922 97.096  148.693 1.00 20.93  ?  724  PHE A C     1 
ATOM   2448  O  O     . PHE A 1 852  ? 128.157 96.822  149.623 1.00 20.88  ?  724  PHE A O     1 
ATOM   2449  C  CB    . PHE A 1 852  ? 128.602 95.286  146.985 1.00 21.13  ?  724  PHE A CB    1 
ATOM   2450  C  CG    . PHE A 1 852  ? 129.245 94.619  145.817 1.00 27.91  ?  724  PHE A CG    1 
ATOM   2451  C  CD1   . PHE A 1 852  ? 130.125 93.574  146.004 1.00 26.84  ?  724  PHE A CD1   1 
ATOM   2452  C  CD2   . PHE A 1 852  ? 129.037 95.082  144.540 1.00 25.13  ?  724  PHE A CD2   1 
ATOM   2453  C  CE1   . PHE A 1 852  ? 130.739 92.978  144.933 1.00 27.74  ?  724  PHE A CE1   1 
ATOM   2454  C  CE2   . PHE A 1 852  ? 129.651 94.490  143.471 1.00 24.48  ?  724  PHE A CE2   1 
ATOM   2455  C  CZ    . PHE A 1 852  ? 130.499 93.443  143.665 1.00 36.80  ?  724  PHE A CZ    1 
ATOM   2456  N  N     . ARG A 1 853  ? 129.204 98.340  148.323 1.00 16.98  ?  725  ARG A N     1 
ATOM   2457  C  CA    . ARG A 1 853  ? 128.672 99.519  148.999 1.00 14.99  ?  725  ARG A CA    1 
ATOM   2458  C  C     . ARG A 1 853  ? 127.725 100.211 148.030 1.00 13.00  ?  725  ARG A C     1 
ATOM   2459  O  O     . ARG A 1 853  ? 128.170 100.814 147.051 1.00 14.04  ?  725  ARG A O     1 
ATOM   2460  C  CB    . ARG A 1 853  ? 129.794 100.459 149.430 1.00 13.76  ?  725  ARG A CB    1 
ATOM   2461  C  CG    . ARG A 1 853  ? 130.784 99.784  150.348 1.00 15.40  ?  725  ARG A CG    1 
ATOM   2462  C  CD    . ARG A 1 853  ? 130.162 99.415  151.680 1.00 16.47  ?  725  ARG A CD    1 
ATOM   2463  N  NE    . ARG A 1 853  ? 131.142 98.755  152.540 1.00 18.59  ?  725  ARG A NE    1 
ATOM   2464  C  CZ    . ARG A 1 853  ? 132.205 99.346  153.077 1.00 20.72  ?  725  ARG A CZ    1 
ATOM   2465  N  NH1   . ARG A 1 853  ? 132.440 100.628 152.845 1.00 16.10  ?  725  ARG A NH1   1 
ATOM   2466  N  NH2   . ARG A 1 853  ? 133.038 98.638  153.841 1.00 15.28  ?  725  ARG A NH2   1 
ATOM   2467  N  N     . GLY A 1 854  ? 126.427 100.121 148.296 1.00 13.76  ?  726  GLY A N     1 
ATOM   2468  C  CA    . GLY A 1 854  ? 125.435 100.763 147.454 1.00 15.48  ?  726  GLY A CA    1 
ATOM   2469  C  C     . GLY A 1 854  ? 125.069 102.155 147.927 1.00 17.67  ?  726  GLY A C     1 
ATOM   2470  O  O     . GLY A 1 854  ? 124.231 102.319 148.820 1.00 20.62  ?  726  GLY A O     1 
ATOM   2471  N  N     . THR A 1 855  ? 125.685 103.165 147.317 1.00 23.82  ?  727  THR A N     1 
ATOM   2472  C  CA    . THR A 1 855  ? 125.580 104.551 147.753 1.00 17.90  ?  727  THR A CA    1 
ATOM   2473  C  C     . THR A 1 855  ? 124.928 105.451 146.719 1.00 15.73  ?  727  THR A C     1 
ATOM   2474  O  O     . THR A 1 855  ? 123.937 106.113 147.018 1.00 19.35  ?  727  THR A O     1 
ATOM   2475  C  CB    . THR A 1 855  ? 126.982 105.110 148.081 1.00 18.36  ?  727  THR A CB    1 
ATOM   2476  O  OG1   . THR A 1 855  ? 127.570 105.675 146.895 1.00 18.23  ?  727  THR A OG1   1 
ATOM   2477  C  CG2   . THR A 1 855  ? 127.905 104.027 148.616 1.00 17.40  ?  727  THR A CG2   1 
ATOM   2478  N  N     . GLY A 1 856  ? 125.442 105.460 145.503 1.00 14.97  ?  728  GLY A N     1 
ATOM   2479  C  CA    . GLY A 1 856  ? 125.135 106.470 144.523 1.00 21.32  ?  728  GLY A CA    1 
ATOM   2480  C  C     . GLY A 1 856  ? 123.740 106.422 143.944 1.00 18.46  ?  728  GLY A C     1 
ATOM   2481  O  O     . GLY A 1 856  ? 123.540 106.009 142.798 1.00 16.27  ?  728  GLY A O     1 
ATOM   2482  N  N     . TYR A 1 857  ? 122.758 106.822 144.739 1.00 20.26  ?  729  TYR A N     1 
ATOM   2483  C  CA    . TYR A 1 857  ? 121.405 106.958 144.241 1.00 21.55  ?  729  TYR A CA    1 
ATOM   2484  C  C     . TYR A 1 857  ? 120.810 108.218 144.855 1.00 22.51  ?  729  TYR A C     1 
ATOM   2485  O  O     . TYR A 1 857  ? 121.040 108.517 146.026 1.00 20.78  ?  729  TYR A O     1 
ATOM   2486  C  CB    . TYR A 1 857  ? 120.531 105.752 144.608 1.00 20.45  ?  729  TYR A CB    1 
ATOM   2487  C  CG    . TYR A 1 857  ? 121.221 104.405 144.622 1.00 11.75  ?  729  TYR A CG    1 
ATOM   2488  C  CD1   . TYR A 1 857  ? 121.977 104.023 145.712 1.00 34.74  ?  729  TYR A CD1   1 
ATOM   2489  C  CD2   . TYR A 1 857  ? 121.122 103.525 143.561 1.00 14.89  ?  729  TYR A CD2   1 
ATOM   2490  C  CE1   . TYR A 1 857  ? 122.603 102.806 145.760 1.00 13.39  ?  729  TYR A CE1   1 
ATOM   2491  C  CE2   . TYR A 1 857  ? 121.759 102.297 143.595 1.00 10.38  ?  729  TYR A CE2   1 
ATOM   2492  C  CZ    . TYR A 1 857  ? 122.500 101.945 144.704 1.00 15.81  ?  729  TYR A CZ    1 
ATOM   2493  O  OH    . TYR A 1 857  ? 123.149 100.735 144.790 1.00 14.70  ?  729  TYR A OH    1 
ATOM   2494  N  N     . ASP A 1 858  ? 120.054 108.959 144.055 1.00 25.12  ?  730  ASP A N     1 
ATOM   2495  C  CA    . ASP A 1 858  ? 119.183 109.974 144.617 1.00 31.58  ?  730  ASP A CA    1 
ATOM   2496  C  C     . ASP A 1 858  ? 118.089 109.313 145.444 1.00 26.92  ?  730  ASP A C     1 
ATOM   2497  O  O     . ASP A 1 858  ? 117.738 108.151 145.238 1.00 25.21  ?  730  ASP A O     1 
ATOM   2498  C  CB    . ASP A 1 858  ? 118.518 110.784 143.520 1.00 49.87  ?  730  ASP A CB    1 
ATOM   2499  C  CG    . ASP A 1 858  ? 117.983 109.908 142.417 1.00 69.06  ?  730  ASP A CG    1 
ATOM   2500  O  OD1   . ASP A 1 858  ? 118.558 108.825 142.193 1.00 56.76  ?  730  ASP A OD1   1 
ATOM   2501  O  OD2   . ASP A 1 858  ? 116.937 110.263 141.832 1.00 153.91 -1 730  ASP A OD2   1 
ATOM   2502  N  N     . GLU A 1 859  ? 117.518 110.089 146.361 1.00 29.86  ?  731  GLU A N     1 
ATOM   2503  C  CA    . GLU A 1 859  ? 116.588 109.533 147.337 1.00 32.26  ?  731  GLU A CA    1 
ATOM   2504  C  C     . GLU A 1 859  ? 115.473 108.739 146.666 1.00 28.77  ?  731  GLU A C     1 
ATOM   2505  O  O     . GLU A 1 859  ? 115.298 107.544 146.933 1.00 25.86  ?  731  GLU A O     1 
ATOM   2506  C  CB    . GLU A 1 859  ? 116.013 110.659 148.197 1.00 47.31  ?  731  GLU A CB    1 
ATOM   2507  C  CG    . GLU A 1 859  ? 115.289 110.173 149.442 1.00 67.90  ?  731  GLU A CG    1 
ATOM   2508  C  CD    . GLU A 1 859  ? 116.229 109.697 150.531 1.00 102.82 ?  731  GLU A CD    1 
ATOM   2509  O  OE1   . GLU A 1 859  ? 115.740 109.138 151.536 1.00 68.16  ?  731  GLU A OE1   1 
ATOM   2510  O  OE2   . GLU A 1 859  ? 117.455 109.902 150.396 1.00 211.52 -1 731  GLU A OE2   1 
ATOM   2511  N  N     . LYS A 1 860  ? 114.719 109.400 145.783 1.00 29.93  ?  732  LYS A N     1 
ATOM   2512  C  CA    . LYS A 1 860  ? 113.576 108.789 145.107 1.00 27.59  ?  732  LYS A CA    1 
ATOM   2513  C  C     . LYS A 1 860  ? 113.849 107.353 144.697 1.00 24.79  ?  732  LYS A C     1 
ATOM   2514  O  O     . LYS A 1 860  ? 113.046 106.448 144.953 1.00 24.61  ?  732  LYS A O     1 
ATOM   2515  C  CB    . LYS A 1 860  ? 113.203 109.623 143.878 1.00 26.89  ?  732  LYS A CB    1 
ATOM   2516  C  CG    . LYS A 1 860  ? 112.195 108.945 142.967 1.00 21.14  ?  732  LYS A CG    1 
ATOM   2517  C  CD    . LYS A 1 860  ? 111.922 109.764 141.726 1.00 19.08  ?  732  LYS A CD    1 
ATOM   2518  C  CE    . LYS A 1 860  ? 110.943 109.050 140.816 1.00 18.61  ?  732  LYS A CE    1 
ATOM   2519  N  NZ    . LYS A 1 860  ? 110.729 109.801 139.556 1.00 17.83  ?  732  LYS A NZ    1 
ATOM   2520  N  N     . MET A 1 861  ? 114.988 107.134 144.051 1.00 26.66  ?  733  MET A N     1 
ATOM   2521  C  CA    . MET A 1 861  ? 115.358 105.788 143.650 1.00 25.93  ?  733  MET A CA    1 
ATOM   2522  C  C     . MET A 1 861  ? 115.506 104.863 144.847 1.00 25.03  ?  733  MET A C     1 
ATOM   2523  O  O     . MET A 1 861  ? 114.998 103.738 144.838 1.00 27.12  ?  733  MET A O     1 
ATOM   2524  C  CB    . MET A 1 861  ? 116.643 105.843 142.841 1.00 31.50  ?  733  MET A CB    1 
ATOM   2525  C  CG    . MET A 1 861  ? 117.157 104.496 142.422 1.00 28.66  ?  733  MET A CG    1 
ATOM   2526  S  SD    . MET A 1 861  ? 117.645 104.519 140.698 1.00 58.55  ?  733  MET A SD    1 
ATOM   2527  C  CE    . MET A 1 861  ? 116.054 104.895 139.968 1.00 55.11  ?  733  MET A CE    1 
ATOM   2528  N  N     . VAL A 1 862  ? 116.229 105.312 145.874 1.00 22.68  ?  734  VAL A N     1 
ATOM   2529  C  CA    . VAL A 1 862  ? 116.460 104.482 147.054 1.00 21.58  ?  734  VAL A CA    1 
ATOM   2530  C  C     . VAL A 1 862  ? 115.137 104.017 147.629 1.00 22.08  ?  734  VAL A C     1 
ATOM   2531  O  O     . VAL A 1 862  ? 114.941 102.832 147.924 1.00 24.27  ?  734  VAL A O     1 
ATOM   2532  C  CB    . VAL A 1 862  ? 117.256 105.262 148.112 1.00 23.89  ?  734  VAL A CB    1 
ATOM   2533  C  CG1   . VAL A 1 862  ? 117.574 104.373 149.314 1.00 21.09  ?  734  VAL A CG1   1 
ATOM   2534  C  CG2   . VAL A 1 862  ? 118.499 105.884 147.526 1.00 25.92  ?  734  VAL A CG2   1 
ATOM   2535  N  N     . ARG A 1 863  ? 114.214 104.957 147.807 1.00 25.23  ?  735  ARG A N     1 
ATOM   2536  C  CA    . ARG A 1 863  ? 112.895 104.617 148.316 1.00 30.97  ?  735  ARG A CA    1 
ATOM   2537  C  C     . ARG A 1 863  ? 112.220 103.591 147.412 1.00 29.08  ?  735  ARG A C     1 
ATOM   2538  O  O     . ARG A 1 863  ? 111.841 102.499 147.857 1.00 27.11  ?  735  ARG A O     1 
ATOM   2539  C  CB    . ARG A 1 863  ? 112.053 105.887 148.435 1.00 30.86  ?  735  ARG A CB    1 
ATOM   2540  C  CG    . ARG A 1 863  ? 112.868 107.146 148.741 1.00 29.77  ?  735  ARG A CG    1 
ATOM   2541  C  CD    . ARG A 1 863  ? 112.013 108.318 149.210 1.00 32.29  ?  735  ARG A CD    1 
ATOM   2542  N  NE    . ARG A 1 863  ? 111.809 108.256 150.646 1.00 31.55  ?  735  ARG A NE    1 
ATOM   2543  C  CZ    . ARG A 1 863  ? 110.867 107.526 151.221 1.00 31.63  ?  735  ARG A CZ    1 
ATOM   2544  N  NH1   . ARG A 1 863  ? 110.044 106.805 150.475 1.00 30.61  ?  735  ARG A NH1   1 
ATOM   2545  N  NH2   . ARG A 1 863  ? 110.754 107.518 152.540 1.00 33.73  ?  735  ARG A NH2   1 
ATOM   2546  N  N     . GLU A 1 864  ? 112.090 103.922 146.120 1.00 28.59  ?  736  GLU A N     1 
ATOM   2547  C  CA    . GLU A 1 864  ? 111.380 103.055 145.184 1.00 27.15  ?  736  GLU A CA    1 
ATOM   2548  C  C     . GLU A 1 864  ? 112.029 101.688 145.045 1.00 23.29  ?  736  GLU A C     1 
ATOM   2549  O  O     . GLU A 1 864  ? 111.407 100.762 144.517 1.00 22.47  ?  736  GLU A O     1 
ATOM   2550  C  CB    . GLU A 1 864  ? 111.275 103.729 143.813 1.00 32.30  ?  736  GLU A CB    1 
ATOM   2551  C  CG    . GLU A 1 864  ? 110.329 103.015 142.853 1.00 39.92  ?  736  GLU A CG    1 
ATOM   2552  C  CD    . GLU A 1 864  ? 110.120 103.752 141.533 1.00 67.27  ?  736  GLU A CD    1 
ATOM   2553  O  OE1   . GLU A 1 864  ? 110.628 104.883 141.369 1.00 63.51  ?  736  GLU A OE1   1 
ATOM   2554  O  OE2   . GLU A 1 864  ? 109.455 103.179 140.640 1.00 102.66 -1 736  GLU A OE2   1 
ATOM   2555  N  N     . MET A 1 865  ? 113.264 101.547 145.484 1.00 22.32  ?  737  MET A N     1 
ATOM   2556  C  CA    . MET A 1 865  ? 113.938 100.269 145.439 1.00 20.54  ?  737  MET A CA    1 
ATOM   2557  C  C     . MET A 1 865  ? 114.154 99.664  146.812 1.00 17.26  ?  737  MET A C     1 
ATOM   2558  O  O     . MET A 1 865  ? 114.518 98.489  146.903 1.00 19.69  ?  737  MET A O     1 
ATOM   2559  C  CB    . MET A 1 865  ? 115.278 100.418 144.720 1.00 22.34  ?  737  MET A CB    1 
ATOM   2560  C  CG    . MET A 1 865  ? 115.100 100.969 143.323 1.00 23.07  ?  737  MET A CG    1 
ATOM   2561  S  SD    . MET A 1 865  ? 116.283 100.250 142.181 1.00 35.59  ?  737  MET A SD    1 
ATOM   2562  C  CE    . MET A 1 865  ? 117.813 100.675 143.018 1.00 24.59  ?  737  MET A CE    1 
ATOM   2563  N  N     . GLU A 1 866  ? 113.917 100.415 147.878 1.00 20.45  ?  738  GLU A N     1 
ATOM   2564  C  CA    . GLU A 1 866  ? 113.862 99.840  149.209 1.00 24.35  ?  738  GLU A CA    1 
ATOM   2565  C  C     . GLU A 1 866  ? 112.436 99.601  149.663 1.00 27.22  ?  738  GLU A C     1 
ATOM   2566  O  O     . GLU A 1 866  ? 112.224 99.147  150.787 1.00 33.26  ?  738  GLU A O     1 
ATOM   2567  C  CB    . GLU A 1 866  ? 114.593 100.729 150.223 1.00 40.99  ?  738  GLU A CB    1 
ATOM   2568  C  CG    . GLU A 1 866  ? 115.166 99.928  151.406 1.00 76.22  ?  738  GLU A CG    1 
ATOM   2569  C  CD    . GLU A 1 866  ? 114.979 100.598 152.773 1.00 116.64 ?  738  GLU A CD    1 
ATOM   2570  O  OE1   . GLU A 1 866  ? 114.787 101.834 152.829 1.00 104.55 ?  738  GLU A OE1   1 
ATOM   2571  O  OE2   . GLU A 1 866  ? 115.018 99.871  153.797 1.00 213.73 -1 738  GLU A OE2   1 
ATOM   2572  N  N     . GLY A 1 867  ? 111.455 99.882  148.817 1.00 27.37  ?  739  GLY A N     1 
ATOM   2573  C  CA    . GLY A 1 867  ? 110.087 99.549  149.156 1.00 26.77  ?  739  GLY A CA    1 
ATOM   2574  C  C     . GLY A 1 867  ? 109.411 100.511 150.099 1.00 27.44  ?  739  GLY A C     1 
ATOM   2575  O  O     . GLY A 1 867  ? 108.552 100.102 150.888 1.00 25.26  ?  739  GLY A O     1 
ATOM   2576  N  N     . LEU A 1 868  ? 109.764 101.782 150.029 1.00 32.35  ?  740  LEU A N     1 
ATOM   2577  C  CA    . LEU A 1 868  ? 109.194 102.802 150.883 1.00 35.83  ?  740  LEU A CA    1 
ATOM   2578  C  C     . LEU A 1 868  ? 108.092 103.551 150.138 1.00 36.65  ?  740  LEU A C     1 
ATOM   2579  O  O     . LEU A 1 868  ? 107.603 103.133 149.084 1.00 36.59  ?  740  LEU A O     1 
ATOM   2580  C  CB    . LEU A 1 868  ? 110.290 103.756 151.368 1.00 35.71  ?  740  LEU A CB    1 
ATOM   2581  C  CG    . LEU A 1 868  ? 111.506 103.087 152.021 1.00 40.41  ?  740  LEU A CG    1 
ATOM   2582  C  CD1   . LEU A 1 868  ? 112.572 104.106 152.439 1.00 52.86  ?  740  LEU A CD1   1 
ATOM   2583  C  CD2   . LEU A 1 868  ? 111.073 102.225 153.203 1.00 48.65  ?  740  LEU A CD2   1 
ATOM   2584  N  N     . GLU A 1 869  ? 107.683 104.662 150.723 1.00 38.93  ?  741  GLU A N     1 
ATOM   2585  C  CA    . GLU A 1 869  ? 106.680 105.563 150.172 1.00 38.68  ?  741  GLU A CA    1 
ATOM   2586  C  C     . GLU A 1 869  ? 107.374 106.869 149.815 1.00 29.72  ?  741  GLU A C     1 
ATOM   2587  O  O     . GLU A 1 869  ? 107.540 107.747 150.666 1.00 32.64  ?  741  GLU A O     1 
ATOM   2588  C  CB    . GLU A 1 869  ? 105.545 105.777 151.172 1.00 50.06  ?  741  GLU A CB    1 
ATOM   2589  C  CG    . GLU A 1 869  ? 104.924 104.504 151.766 1.00 63.58  ?  741  GLU A CG    1 
ATOM   2590  C  CD    . GLU A 1 869  ? 105.704 103.909 152.939 1.00 72.47  ?  741  GLU A CD    1 
ATOM   2591  O  OE1   . GLU A 1 869  ? 105.397 104.264 154.099 1.00 64.79  ?  741  GLU A OE1   1 
ATOM   2592  O  OE2   . GLU A 1 869  ? 106.560 103.014 152.698 1.00 124.32 -1 741  GLU A OE2   1 
ATOM   2593  N  N     . ALA A 1 870  ? 107.787 106.991 148.561 1.00 27.35  ?  742  ALA A N     1 
ATOM   2594  C  CA    . ALA A 1 870  ? 108.424 108.212 148.099 1.00 26.77  ?  742  ALA A CA    1 
ATOM   2595  C  C     . ALA A 1 870  ? 107.362 109.260 147.797 1.00 29.66  ?  742  ALA A C     1 
ATOM   2596  O  O     . ALA A 1 870  ? 106.320 108.954 147.215 1.00 29.24  ?  742  ALA A O     1 
ATOM   2597  C  CB    . ALA A 1 870  ? 109.254 107.945 146.843 1.00 29.33  ?  742  ALA A CB    1 
ATOM   2598  N  N     . SER A 1 871  ? 107.628 110.497 148.194 1.00 31.53  ?  743  SER A N     1 
ATOM   2599  C  CA    . SER A 1 871  ? 108.886 110.824 148.846 1.00 27.58  ?  743  SER A CA    1 
ATOM   2600  C  C     . SER A 1 871  ? 108.716 111.685 150.093 1.00 29.36  ?  743  SER A C     1 
ATOM   2601  O  O     . SER A 1 871  ? 109.596 111.711 150.952 1.00 31.24  ?  743  SER A O     1 
ATOM   2602  C  CB    . SER A 1 871  ? 109.802 111.530 147.852 1.00 27.23  ?  743  SER A CB    1 
ATOM   2603  O  OG    . SER A 1 871  ? 110.877 112.154 148.524 1.00 28.71  ?  743  SER A OG    1 
ATOM   2604  N  N     . GLY A 1 872  ? 107.590 112.393 150.184 1.00 26.25  ?  744  GLY A N     1 
ATOM   2605  C  CA    . GLY A 1 872  ? 107.380 113.308 151.288 1.00 24.30  ?  744  GLY A CA    1 
ATOM   2606  C  C     . GLY A 1 872  ? 106.299 112.891 152.261 1.00 23.76  ?  744  GLY A C     1 
ATOM   2607  O  O     . GLY A 1 872  ? 105.667 113.744 152.888 1.00 30.98  ?  744  GLY A O     1 
ATOM   2608  N  N     . SER A 1 873  ? 106.088 111.592 152.415 1.00 26.43  ?  745  SER A N     1 
ATOM   2609  C  CA    . SER A 1 873  ? 105.045 111.087 153.293 1.00 31.91  ?  745  SER A CA    1 
ATOM   2610  C  C     . SER A 1 873  ? 105.533 111.055 154.742 1.00 28.11  ?  745  SER A C     1 
ATOM   2611  O  O     . SER A 1 873  ? 106.613 111.552 155.075 1.00 28.84  ?  745  SER A O     1 
ATOM   2612  C  CB    . SER A 1 873  ? 104.586 109.707 152.838 1.00 37.87  ?  745  SER A CB    1 
ATOM   2613  O  OG    . SER A 1 873  ? 103.225 109.495 153.179 1.00 39.28  ?  745  SER A OG    1 
ATOM   2614  N  N     . THR A 1 874  ? 104.721 110.450 155.617 1.00 28.47  ?  746  THR A N     1 
ATOM   2615  C  CA    . THR A 1 874  ? 104.982 110.466 157.054 1.00 30.29  ?  746  THR A CA    1 
ATOM   2616  C  C     . THR A 1 874  ? 106.384 109.987 157.376 1.00 30.59  ?  746  THR A C     1 
ATOM   2617  O  O     . THR A 1 874  ? 107.137 110.666 158.083 1.00 34.80  ?  746  THR A O     1 
ATOM   2618  C  CB    . THR A 1 874  ? 103.952 109.592 157.772 1.00 37.95  ?  746  THR A CB    1 
ATOM   2619  O  OG1   . THR A 1 874  ? 102.628 110.015 157.411 1.00 38.10  ?  746  THR A OG1   1 
ATOM   2620  C  CG2   . THR A 1 874  ? 104.112 109.673 159.290 1.00 36.85  ?  746  THR A CG2   1 
ATOM   2621  N  N     . TYR A 1 875  ? 106.758 108.832 156.850 1.00 27.77  ?  747  TYR A N     1 
ATOM   2622  C  CA    . TYR A 1 875  ? 108.088 108.298 157.068 1.00 27.69  ?  747  TYR A CA    1 
ATOM   2623  C  C     . TYR A 1 875  ? 109.026 108.974 156.083 1.00 30.72  ?  747  TYR A C     1 
ATOM   2624  O  O     . TYR A 1 875  ? 108.799 108.930 154.870 1.00 30.71  ?  747  TYR A O     1 
ATOM   2625  C  CB    . TYR A 1 875  ? 108.091 106.782 156.902 1.00 29.30  ?  747  TYR A CB    1 
ATOM   2626  C  CG    . TYR A 1 875  ? 107.217 106.108 157.923 1.00 27.05  ?  747  TYR A CG    1 
ATOM   2627  C  CD1   . TYR A 1 875  ? 107.711 105.764 159.171 1.00 36.09  ?  747  TYR A CD1   1 
ATOM   2628  C  CD2   . TYR A 1 875  ? 105.891 105.847 157.653 1.00 29.18  ?  747  TYR A CD2   1 
ATOM   2629  C  CE1   . TYR A 1 875  ? 106.905 105.163 160.114 1.00 42.41  ?  747  TYR A CE1   1 
ATOM   2630  C  CE2   . TYR A 1 875  ? 105.079 105.245 158.583 1.00 39.16  ?  747  TYR A CE2   1 
ATOM   2631  C  CZ    . TYR A 1 875  ? 105.587 104.904 159.814 1.00 43.35  ?  747  TYR A CZ    1 
ATOM   2632  O  OH    . TYR A 1 875  ? 104.772 104.298 160.743 1.00 47.82  ?  747  TYR A OH    1 
ATOM   2633  N  N     . ILE A 1 876  ? 110.059 109.626 156.612 1.00 33.68  ?  748  ILE A N     1 
ATOM   2634  C  CA    . ILE A 1 876  ? 110.982 110.436 155.829 1.00 32.13  ?  748  ILE A CA    1 
ATOM   2635  C  C     . ILE A 1 876  ? 112.413 109.937 155.958 1.00 30.46  ?  748  ILE A C     1 
ATOM   2636  O  O     . ILE A 1 876  ? 113.113 109.757 154.959 1.00 31.58  ?  748  ILE A O     1 
ATOM   2637  C  CB    . ILE A 1 876  ? 110.885 111.927 156.217 1.00 27.03  ?  748  ILE A CB    1 
ATOM   2638  C  CG1   . ILE A 1 876  ? 110.660 112.065 157.723 1.00 31.75  ?  748  ILE A CG1   1 
ATOM   2639  C  CG2   . ILE A 1 876  ? 109.786 112.597 155.442 1.00 29.85  ?  748  ILE A CG2   1 
ATOM   2640  C  CD1   . ILE A 1 876  ? 110.680 113.491 158.222 1.00 35.98  ?  748  ILE A CD1   1 
ATOM   2641  N  N     . CYS A 1 877  ? 112.869 109.715 157.182 1.00 34.10  ?  749  CYS A N     1 
ATOM   2642  C  CA    . CYS A 1 877  ? 114.251 109.310 157.367 1.00 41.20  ?  749  CYS A CA    1 
ATOM   2643  C  C     . CYS A 1 877  ? 114.460 107.917 156.803 1.00 42.55  ?  749  CYS A C     1 
ATOM   2644  O  O     . CYS A 1 877  ? 113.875 106.941 157.283 1.00 38.80  ?  749  CYS A O     1 
ATOM   2645  C  CB    . CYS A 1 877  ? 114.644 109.336 158.837 1.00 47.17  ?  749  CYS A CB    1 
ATOM   2646  S  SG    . CYS A 1 877  ? 116.416 109.038 159.072 1.00 45.82  ?  749  CYS A SG    1 
ATOM   2647  N  N     . THR A 1 878  ? 115.327 107.824 155.813 1.00 39.30  ?  750  THR A N     1 
ATOM   2648  C  CA    . THR A 1 878  ? 115.708 106.532 155.288 1.00 33.85  ?  750  THR A CA    1 
ATOM   2649  C  C     . THR A 1 878  ? 116.517 105.727 156.287 1.00 34.01  ?  750  THR A C     1 
ATOM   2650  O  O     . THR A 1 878  ? 116.910 104.601 155.974 1.00 38.33  ?  750  THR A O     1 
ATOM   2651  C  CB    . THR A 1 878  ? 116.484 106.741 153.992 1.00 32.27  ?  750  THR A CB    1 
ATOM   2652  O  OG1   . THR A 1 878  ? 115.948 107.884 153.317 1.00 36.74  ?  750  THR A OG1   1 
ATOM   2653  C  CG2   . THR A 1 878  ? 116.336 105.549 153.092 1.00 31.85  ?  750  THR A CG2   1 
ATOM   2654  N  N     . LEU A 1 879  ? 116.769 106.273 157.478 1.00 38.39  ?  751  LEU A N     1 
ATOM   2655  C  CA    . LEU A 1 879  ? 117.557 105.623 158.518 1.00 41.44  ?  751  LEU A CA    1 
ATOM   2656  C  C     . LEU A 1 879  ? 116.816 105.497 159.838 1.00 51.98  ?  751  LEU A C     1 
ATOM   2657  O  O     . LEU A 1 879  ? 116.841 104.422 160.449 1.00 54.76  ?  751  LEU A O     1 
ATOM   2658  C  CB    . LEU A 1 879  ? 118.846 106.417 158.740 1.00 41.56  ?  751  LEU A CB    1 
ATOM   2659  C  CG    . LEU A 1 879  ? 119.420 106.963 157.442 1.00 42.09  ?  751  LEU A CG    1 
ATOM   2660  C  CD1   . LEU A 1 879  ? 120.430 108.062 157.698 1.00 50.56  ?  751  LEU A CD1   1 
ATOM   2661  C  CD2   . LEU A 1 879  ? 120.015 105.861 156.604 1.00 45.00  ?  751  LEU A CD2   1 
ATOM   2662  N  N     . CYS A 1 880  ? 116.151 106.559 160.288 1.00 51.62  ?  752  CYS A N     1 
ATOM   2663  C  CA    . CYS A 1 880  ? 115.479 106.570 161.577 1.00 49.34  ?  752  CYS A CA    1 
ATOM   2664  C  C     . CYS A 1 880  ? 113.978 106.451 161.368 1.00 46.46  ?  752  CYS A C     1 
ATOM   2665  O  O     . CYS A 1 880  ? 113.426 106.987 160.405 1.00 48.09  ?  752  CYS A O     1 
ATOM   2666  C  CB    . CYS A 1 880  ? 115.816 107.842 162.355 1.00 51.90  ?  752  CYS A CB    1 
ATOM   2667  S  SG    . CYS A 1 880  ? 114.684 108.280 163.692 1.00 120.15 ?  752  CYS A SG    1 
ATOM   2668  N  N     . ASP A 1 881  ? 113.321 105.749 162.280 1.00 53.42  ?  753  ASP A N     1 
ATOM   2669  C  CA    . ASP A 1 881  ? 111.901 105.459 162.172 1.00 55.93  ?  753  ASP A CA    1 
ATOM   2670  C  C     . ASP A 1 881  ? 111.033 106.632 162.594 1.00 52.58  ?  753  ASP A C     1 
ATOM   2671  O  O     . ASP A 1 881  ? 109.824 106.458 162.798 1.00 45.38  ?  753  ASP A O     1 
ATOM   2672  C  CB    . ASP A 1 881  ? 111.574 104.227 163.018 1.00 63.89  ?  753  ASP A CB    1 
ATOM   2673  C  CG    . ASP A 1 881  ? 112.561 103.095 162.798 1.00 76.25  ?  753  ASP A CG    1 
ATOM   2674  O  OD1   . ASP A 1 881  ? 113.778 103.361 162.830 1.00 67.22  ?  753  ASP A OD1   1 
ATOM   2675  O  OD2   . ASP A 1 881  ? 112.123 101.946 162.562 1.00 123.63 -1 753  ASP A OD2   1 
ATOM   2676  N  N     . SER A 1 882  ? 111.621 107.819 162.721 1.00 46.67  ?  754  SER A N     1 
ATOM   2677  C  CA    . SER A 1 882  ? 110.866 108.974 163.173 1.00 44.38  ?  754  SER A CA    1 
ATOM   2678  C  C     . SER A 1 882  ? 109.779 109.328 162.170 1.00 34.31  ?  754  SER A C     1 
ATOM   2679  O  O     . SER A 1 882  ? 109.943 109.182 160.955 1.00 33.23  ?  754  SER A O     1 
ATOM   2680  C  CB    . SER A 1 882  ? 111.795 110.173 163.377 1.00 50.40  ?  754  SER A CB    1 
ATOM   2681  O  OG    . SER A 1 882  ? 111.068 111.388 163.470 1.00 50.05  ?  754  SER A OG    1 
ATOM   2682  N  N     . THR A 1 883  ? 108.660 109.797 162.699 1.00 33.55  ?  755  THR A N     1 
ATOM   2683  C  CA    . THR A 1 883  ? 107.642 110.406 161.875 1.00 28.60  ?  755  THR A CA    1 
ATOM   2684  C  C     . THR A 1 883  ? 108.099 111.791 161.430 1.00 29.10  ?  755  THR A C     1 
ATOM   2685  O  O     . THR A 1 883  ? 109.152 112.294 161.833 1.00 34.77  ?  755  THR A O     1 
ATOM   2686  C  CB    . THR A 1 883  ? 106.329 110.512 162.640 1.00 32.66  ?  755  THR A CB    1 
ATOM   2687  O  OG1   . THR A 1 883  ? 105.449 111.402 161.941 1.00 34.81  ?  755  THR A OG1   1 
ATOM   2688  C  CG2   . THR A 1 883  ? 106.575 111.029 164.037 1.00 38.58  ?  755  THR A CG2   1 
ATOM   2689  N  N     . ARG A 1 884  ? 107.294 112.408 160.572 1.00 28.72  ?  756  ARG A N     1 
ATOM   2690  C  CA    . ARG A 1 884  ? 107.632 113.728 160.058 1.00 29.94  ?  756  ARG A CA    1 
ATOM   2691  C  C     . ARG A 1 884  ? 107.686 114.761 161.175 1.00 37.98  ?  756  ARG A C     1 
ATOM   2692  O  O     . ARG A 1 884  ? 108.746 115.320 161.476 1.00 41.12  ?  756  ARG A O     1 
ATOM   2693  C  CB    . ARG A 1 884  ? 106.608 114.146 159.003 1.00 27.94  ?  756  ARG A CB    1 
ATOM   2694  C  CG    . ARG A 1 884  ? 106.729 115.597 158.618 1.00 31.53  ?  756  ARG A CG    1 
ATOM   2695  C  CD    . ARG A 1 884  ? 108.028 115.831 157.905 1.00 31.11  ?  756  ARG A CD    1 
ATOM   2696  N  NE    . ARG A 1 884  ? 108.079 115.059 156.674 1.00 30.41  ?  756  ARG A NE    1 
ATOM   2697  C  CZ    . ARG A 1 884  ? 107.698 115.529 155.491 1.00 32.09  ?  756  ARG A CZ    1 
ATOM   2698  N  NH1   . ARG A 1 884  ? 107.261 116.779 155.381 1.00 31.87  ?  756  ARG A NH1   1 
ATOM   2699  N  NH2   . ARG A 1 884  ? 107.766 114.762 154.410 1.00 32.25  ?  756  ARG A NH2   1 
ATOM   2700  N  N     . ALA A 1 885  ? 106.540 115.022 161.805 1.00 41.91  ?  757  ALA A N     1 
ATOM   2701  C  CA    . ALA A 1 885  ? 106.407 116.202 162.650 1.00 51.47  ?  757  ALA A CA    1 
ATOM   2702  C  C     . ALA A 1 885  ? 107.371 116.165 163.827 1.00 60.61  ?  757  ALA A C     1 
ATOM   2703  O  O     . ALA A 1 885  ? 107.982 117.184 164.167 1.00 64.07  ?  757  ALA A O     1 
ATOM   2704  C  CB    . ALA A 1 885  ? 104.966 116.330 163.131 1.00 49.78  ?  757  ALA A CB    1 
ATOM   2705  N  N     . GLU A 1 886  ? 107.525 115.001 164.461 1.00 60.35  ?  758  GLU A N     1 
ATOM   2706  C  CA    . GLU A 1 886  ? 108.387 114.901 165.635 1.00 70.64  ?  758  GLU A CA    1 
ATOM   2707  C  C     . GLU A 1 886  ? 109.834 115.248 165.323 1.00 62.71  ?  758  GLU A C     1 
ATOM   2708  O  O     . GLU A 1 886  ? 110.592 115.603 166.232 1.00 68.25  ?  758  GLU A O     1 
ATOM   2709  C  CB    . GLU A 1 886  ? 108.301 113.496 166.230 1.00 94.01  ?  758  GLU A CB    1 
ATOM   2710  C  CG    . GLU A 1 886  ? 108.961 113.367 167.592 1.00 124.53 ?  758  GLU A CG    1 
ATOM   2711  C  CD    . GLU A 1 886  ? 108.903 111.953 168.140 1.00 162.95 ?  758  GLU A CD    1 
ATOM   2712  O  OE1   . GLU A 1 886  ? 108.714 111.007 167.341 1.00 138.36 ?  758  GLU A OE1   1 
ATOM   2713  O  OE2   . GLU A 1 886  ? 109.050 111.783 169.368 1.00 275.72 -1 758  GLU A OE2   1 
ATOM   2714  N  N     . ALA A 1 887  ? 110.233 115.168 164.060 1.00 54.06  ?  759  ALA A N     1 
ATOM   2715  C  CA    . ALA A 1 887  ? 111.562 115.607 163.667 1.00 53.42  ?  759  ALA A CA    1 
ATOM   2716  C  C     . ALA A 1 887  ? 111.725 117.128 163.699 1.00 64.31  ?  759  ALA A C     1 
ATOM   2717  O  O     . ALA A 1 887  ? 112.797 117.611 163.322 1.00 61.98  ?  759  ALA A O     1 
ATOM   2718  C  CB    . ALA A 1 887  ? 111.887 115.075 162.271 1.00 43.33  ?  759  ALA A CB    1 
ATOM   2719  N  N     . SER A 1 888  ? 110.717 117.891 164.140 1.00 68.29  ?  760  SER A N     1 
ATOM   2720  C  CA    . SER A 1 888  ? 110.806 119.348 164.264 1.00 68.76  ?  760  SER A CA    1 
ATOM   2721  C  C     . SER A 1 888  ? 111.129 119.804 165.683 1.00 75.60  ?  760  SER A C     1 
ATOM   2722  O  O     . SER A 1 888  ? 112.084 120.557 165.887 1.00 75.53  ?  760  SER A O     1 
ATOM   2723  C  CB    . SER A 1 888  ? 109.501 120.016 163.805 1.00 65.75  ?  760  SER A CB    1 
ATOM   2724  O  OG    . SER A 1 888  ? 108.557 120.093 164.859 1.00 71.74  ?  760  SER A OG    1 
ATOM   2725  N  N     . GLN A 1 889  ? 110.338 119.384 166.674 1.00 78.62  ?  761  GLN A N     1 
ATOM   2726  C  CA    . GLN A 1 889  ? 110.667 119.696 168.064 1.00 87.77  ?  761  GLN A CA    1 
ATOM   2727  C  C     . GLN A 1 889  ? 112.045 119.149 168.432 1.00 90.28  ?  761  GLN A C     1 
ATOM   2728  O  O     . GLN A 1 889  ? 112.903 119.883 168.939 1.00 91.74  ?  761  GLN A O     1 
ATOM   2729  C  CB    . GLN A 1 889  ? 109.590 119.136 169.000 1.00 92.26  ?  761  GLN A CB    1 
ATOM   2730  C  CG    . GLN A 1 889  ? 109.880 119.278 170.501 1.00 100.69 ?  761  GLN A CG    1 
ATOM   2731  C  CD    . GLN A 1 889  ? 110.704 118.135 171.079 1.00 101.69 ?  761  GLN A CD    1 
ATOM   2732  O  OE1   . GLN A 1 889  ? 111.843 118.332 171.509 1.00 119.37 ?  761  GLN A OE1   1 
ATOM   2733  N  NE2   . GLN A 1 889  ? 110.132 116.936 171.087 1.00 93.39  ?  761  GLN A NE2   1 
ATOM   2734  N  N     . ASN A 1 890  ? 112.268 117.857 168.195 1.00 81.75  ?  762  ASN A N     1 
ATOM   2735  C  CA    . ASN A 1 890  ? 113.576 117.229 168.352 1.00 74.31  ?  762  ASN A CA    1 
ATOM   2736  C  C     . ASN A 1 890  ? 114.198 116.996 166.981 1.00 65.26  ?  762  ASN A C     1 
ATOM   2737  O  O     . ASN A 1 890  ? 113.500 116.652 166.024 1.00 64.40  ?  762  ASN A O     1 
ATOM   2738  C  CB    . ASN A 1 890  ? 113.464 115.900 169.106 1.00 69.40  ?  762  ASN A CB    1 
ATOM   2739  C  CG    . ASN A 1 890  ? 114.809 115.210 169.295 1.00 64.84  ?  762  ASN A CG    1 
ATOM   2740  O  OD1   . ASN A 1 890  ? 115.353 114.616 168.359 1.00 61.51  ?  762  ASN A OD1   1 
ATOM   2741  N  ND2   . ASN A 1 890  ? 115.349 115.281 170.506 1.00 67.83  ?  762  ASN A ND2   1 
ATOM   2742  N  N     . MET A 1 891  ? 115.515 117.195 166.890 1.00 61.97  ?  763  MET A N     1 
ATOM   2743  C  CA    . MET A 1 891  ? 116.223 117.103 165.619 1.00 57.30  ?  763  MET A CA    1 
ATOM   2744  C  C     . MET A 1 891  ? 117.546 116.351 165.667 1.00 53.64  ?  763  MET A C     1 
ATOM   2745  O  O     . MET A 1 891  ? 118.097 116.065 164.600 1.00 53.83  ?  763  MET A O     1 
ATOM   2746  C  CB    . MET A 1 891  ? 116.502 118.508 165.051 1.00 60.88  ?  763  MET A CB    1 
ATOM   2747  C  CG    . MET A 1 891  ? 115.264 119.342 164.724 1.00 68.53  ?  763  MET A CG    1 
ATOM   2748  S  SD    . MET A 1 891  ? 115.665 121.024 164.181 1.00 80.30  ?  763  MET A SD    1 
ATOM   2749  C  CE    . MET A 1 891  ? 114.039 121.651 163.752 1.00 67.71  ?  763  MET A CE    1 
ATOM   2750  N  N     . VAL A 1 892  ? 118.078 116.022 166.843 1.00 58.04  ?  764  VAL A N     1 
ATOM   2751  C  CA    . VAL A 1 892  ? 119.461 115.562 166.924 1.00 60.28  ?  764  VAL A CA    1 
ATOM   2752  C  C     . VAL A 1 892  ? 119.559 114.054 167.154 1.00 56.23  ?  764  VAL A C     1 
ATOM   2753  O  O     . VAL A 1 892  ? 120.045 113.321 166.285 1.00 49.51  ?  764  VAL A O     1 
ATOM   2754  C  CB    . VAL A 1 892  ? 120.222 116.345 168.011 1.00 73.72  ?  764  VAL A CB    1 
ATOM   2755  C  CG1   . VAL A 1 892  ? 120.703 117.686 167.456 1.00 91.31  ?  764  VAL A CG1   1 
ATOM   2756  C  CG2   . VAL A 1 892  ? 119.345 116.576 169.233 1.00 76.99  ?  764  VAL A CG2   1 
ATOM   2757  N  N     . LEU A 1 893  ? 119.084 113.569 168.301 1.00 59.39  ?  765  LEU A N     1 
ATOM   2758  C  CA    . LEU A 1 893  ? 119.297 112.173 168.679 1.00 58.87  ?  765  LEU A CA    1 
ATOM   2759  C  C     . LEU A 1 893  ? 118.368 111.279 167.870 1.00 53.07  ?  765  LEU A C     1 
ATOM   2760  O  O     . LEU A 1 893  ? 117.160 111.224 168.125 1.00 53.16  ?  765  LEU A O     1 
ATOM   2761  C  CB    . LEU A 1 893  ? 119.067 111.967 170.174 1.00 60.05  ?  765  LEU A CB    1 
ATOM   2762  C  CG    . LEU A 1 893  ? 119.049 110.489 170.596 1.00 57.71  ?  765  LEU A CG    1 
ATOM   2763  C  CD1   . LEU A 1 893  ? 120.449 109.894 170.579 1.00 54.93  ?  765  LEU A CD1   1 
ATOM   2764  C  CD2   . LEU A 1 893  ? 118.367 110.263 171.939 1.00 60.83  ?  765  LEU A CD2   1 
ATOM   2765  N  N     . HIS A 1 894  ? 118.928 110.562 166.906 1.00 47.83  ?  766  HIS A N     1 
ATOM   2766  C  CA    . HIS A 1 894  ? 118.146 109.632 166.107 1.00 44.42  ?  766  HIS A CA    1 
ATOM   2767  C  C     . HIS A 1 894  ? 119.047 108.468 165.721 1.00 44.18  ?  766  HIS A C     1 
ATOM   2768  O  O     . HIS A 1 894  ? 119.968 108.636 164.917 1.00 44.62  ?  766  HIS A O     1 
ATOM   2769  C  CB    . HIS A 1 894  ? 117.579 110.335 164.877 1.00 46.72  ?  766  HIS A CB    1 
ATOM   2770  C  CG    . HIS A 1 894  ? 116.794 111.573 165.191 1.00 49.71  ?  766  HIS A CG    1 
ATOM   2771  N  ND1   . HIS A 1 894  ? 115.454 111.537 165.515 1.00 51.00  ?  766  HIS A ND1   1 
ATOM   2772  C  CD2   . HIS A 1 894  ? 117.154 112.878 165.223 1.00 48.21  ?  766  HIS A CD2   1 
ATOM   2773  C  CE1   . HIS A 1 894  ? 115.022 112.766 165.728 1.00 54.25  ?  766  HIS A CE1   1 
ATOM   2774  N  NE2   . HIS A 1 894  ? 116.034 113.598 165.558 1.00 54.66  ?  766  HIS A NE2   1 
ATOM   2775  N  N     . SER A 1 895  ? 118.773 107.295 166.284 1.00 45.13  ?  767  SER A N     1 
ATOM   2776  C  CA    . SER A 1 895  ? 119.580 106.113 166.026 1.00 42.81  ?  767  SER A CA    1 
ATOM   2777  C  C     . SER A 1 895  ? 119.263 105.558 164.643 1.00 48.14  ?  767  SER A C     1 
ATOM   2778  O  O     . SER A 1 895  ? 118.112 105.587 164.199 1.00 49.23  ?  767  SER A O     1 
ATOM   2779  C  CB    . SER A 1 895  ? 119.327 105.059 167.111 1.00 38.32  ?  767  SER A CB    1 
ATOM   2780  O  OG    . SER A 1 895  ? 117.945 104.819 167.299 1.00 34.76  ?  767  SER A OG    1 
ATOM   2781  N  N     . ILE A 1 896  ? 120.296 105.086 163.947 1.00 50.94  ?  768  ILE A N     1 
ATOM   2782  C  CA    . ILE A 1 896  ? 120.118 104.479 162.631 1.00 48.39  ?  768  ILE A CA    1 
ATOM   2783  C  C     . ILE A 1 896  ? 119.613 103.056 162.814 1.00 53.28  ?  768  ILE A C     1 
ATOM   2784  O  O     . ILE A 1 896  ? 120.231 102.252 163.518 1.00 54.74  ?  768  ILE A O     1 
ATOM   2785  C  CB    . ILE A 1 896  ? 121.421 104.500 161.823 1.00 49.03  ?  768  ILE A CB    1 
ATOM   2786  C  CG1   . ILE A 1 896  ? 121.685 105.899 161.277 1.00 48.27  ?  768  ILE A CG1   1 
ATOM   2787  C  CG2   . ILE A 1 896  ? 121.355 103.493 160.690 1.00 47.04  ?  768  ILE A CG2   1 
ATOM   2788  C  CD1   . ILE A 1 896  ? 122.759 105.951 160.216 1.00 54.82  ?  768  ILE A CD1   1 
ATOM   2789  N  N     . THR A 1 897  ? 118.487 102.746 162.195 1.00 56.43  ?  769  THR A N     1 
ATOM   2790  C  CA    . THR A 1 897  ? 117.894 101.420 162.289 1.00 63.26  ?  769  THR A CA    1 
ATOM   2791  C  C     . THR A 1 897  ? 117.647 100.767 160.941 1.00 73.99  ?  769  THR A C     1 
ATOM   2792  O  O     . THR A 1 897  ? 117.822 99.556  160.818 1.00 85.46  ?  769  THR A O     1 
ATOM   2793  C  CB    . THR A 1 897  ? 116.573 101.487 163.074 1.00 68.39  ?  769  THR A CB    1 
ATOM   2794  O  OG1   . THR A 1 897  ? 115.819 102.634 162.653 1.00 63.56  ?  769  THR A OG1   1 
ATOM   2795  C  CG2   . THR A 1 897  ? 116.826 101.561 164.574 1.00 65.05  ?  769  THR A CG2   1 
ATOM   2796  N  N     . ARG A 1 898  ? 117.279 101.540 159.919 1.00 66.46  ?  770  ARG A N     1 
ATOM   2797  C  CA    . ARG A 1 898  ? 116.843 100.961 158.653 1.00 65.13  ?  770  ARG A CA    1 
ATOM   2798  C  C     . ARG A 1 898  ? 117.913 100.039 158.072 1.00 66.58  ?  770  ARG A C     1 
ATOM   2799  O  O     . ARG A 1 898  ? 119.084 100.408 157.957 1.00 65.05  ?  770  ARG A O     1 
ATOM   2800  C  CB    . ARG A 1 898  ? 116.500 102.076 157.665 1.00 56.07  ?  770  ARG A CB    1 
ATOM   2801  C  CG    . ARG A 1 898  ? 115.267 102.892 158.044 1.00 45.68  ?  770  ARG A CG    1 
ATOM   2802  C  CD    . ARG A 1 898  ? 114.014 102.045 157.947 1.00 54.53  ?  770  ARG A CD    1 
ATOM   2803  N  NE    . ARG A 1 898  ? 112.806 102.767 158.338 1.00 49.67  ?  770  ARG A NE    1 
ATOM   2804  C  CZ    . ARG A 1 898  ? 112.040 103.450 157.491 1.00 42.94  ?  770  ARG A CZ    1 
ATOM   2805  N  NH1   . ARG A 1 898  ? 112.368 103.511 156.208 1.00 46.84  ?  770  ARG A NH1   1 
ATOM   2806  N  NH2   . ARG A 1 898  ? 110.952 104.073 157.926 1.00 39.73  ?  770  ARG A NH2   1 
ATOM   2807  N  N     . SER A 1 899  ? 117.499 98.826  157.704 1.00 69.60  ?  771  SER A N     1 
ATOM   2808  C  CA    . SER A 1 899  ? 118.409 97.787  157.232 1.00 66.95  ?  771  SER A CA    1 
ATOM   2809  C  C     . SER A 1 899  ? 117.623 96.785  156.398 1.00 63.34  ?  771  SER A C     1 
ATOM   2810  O  O     . SER A 1 899  ? 116.410 96.638  156.556 1.00 66.20  ?  771  SER A O     1 
ATOM   2811  C  CB    . SER A 1 899  ? 119.107 97.079  158.397 1.00 75.22  ?  771  SER A CB    1 
ATOM   2812  O  OG    . SER A 1 899  ? 118.156 96.513  159.279 1.00 88.23  ?  771  SER A OG    1 
ATOM   2813  N  N     . HIS A 1 900  ? 118.342 96.067  155.534 1.00 61.18  ?  772  HIS A N     1 
ATOM   2814  C  CA    . HIS A 1 900  ? 117.698 95.271  154.491 1.00 60.05  ?  772  HIS A CA    1 
ATOM   2815  C  C     . HIS A 1 900  ? 116.955 94.072  155.066 1.00 60.61  ?  772  HIS A C     1 
ATOM   2816  O  O     . HIS A 1 900  ? 115.776 93.853  154.761 1.00 61.39  ?  772  HIS A O     1 
ATOM   2817  C  CB    . HIS A 1 900  ? 118.750 94.814  153.485 1.00 64.60  ?  772  HIS A CB    1 
ATOM   2818  C  CG    . HIS A 1 900  ? 118.184 94.240  152.225 1.00 65.33  ?  772  HIS A CG    1 
ATOM   2819  N  ND1   . HIS A 1 900  ? 118.277 94.882  151.008 1.00 56.21  ?  772  HIS A ND1   1 
ATOM   2820  C  CD2   . HIS A 1 900  ? 117.524 93.081  151.991 1.00 61.52  ?  772  HIS A CD2   1 
ATOM   2821  C  CE1   . HIS A 1 900  ? 117.696 94.143  150.080 1.00 44.61  ?  772  HIS A CE1   1 
ATOM   2822  N  NE2   . HIS A 1 900  ? 117.231 93.046  150.651 1.00 48.50  ?  772  HIS A NE2   1 
ATOM   2823  N  N     . ASP A 1 901  ? 117.646 93.267  155.869 1.00 66.73  ?  773  ASP A N     1 
ATOM   2824  C  CA    . ASP A 1 901  ? 117.052 92.060  156.432 1.00 68.72  ?  773  ASP A CA    1 
ATOM   2825  C  C     . ASP A 1 901  ? 115.797 92.370  157.244 1.00 68.02  ?  773  ASP A C     1 
ATOM   2826  O  O     . ASP A 1 901  ? 114.755 91.721  157.075 1.00 61.15  ?  773  ASP A O     1 
ATOM   2827  C  CB    . ASP A 1 901  ? 118.101 91.350  157.283 1.00 89.66  ?  773  ASP A CB    1 
ATOM   2828  C  CG    . ASP A 1 901  ? 118.920 92.320  158.134 1.00 110.07 ?  773  ASP A CG    1 
ATOM   2829  O  OD1   . ASP A 1 901  ? 118.841 93.543  157.897 1.00 89.50  ?  773  ASP A OD1   1 
ATOM   2830  O  OD2   . ASP A 1 901  ? 119.649 91.859  159.045 1.00 256.43 -1 773  ASP A OD2   1 
ATOM   2831  N  N     . GLU A 1 902  ? 115.866 93.377  158.117 1.00 77.17  ?  774  GLU A N     1 
ATOM   2832  C  CA    . GLU A 1 902  ? 114.697 93.718  158.920 1.00 79.55  ?  774  GLU A CA    1 
ATOM   2833  C  C     . GLU A 1 902  ? 113.606 94.351  158.068 1.00 67.09  ?  774  GLU A C     1 
ATOM   2834  O  O     . GLU A 1 902  ? 112.430 94.282  158.427 1.00 56.36  ?  774  GLU A O     1 
ATOM   2835  C  CB    . GLU A 1 902  ? 115.077 94.664  160.060 1.00 89.77  ?  774  GLU A CB    1 
ATOM   2836  C  CG    . GLU A 1 902  ? 114.707 96.116  159.781 1.00 85.77  ?  774  GLU A CG    1 
ATOM   2837  C  CD    . GLU A 1 902  ? 115.391 97.108  160.695 1.00 108.20 ?  774  GLU A CD    1 
ATOM   2838  O  OE1   . GLU A 1 902  ? 115.351 96.925  161.932 1.00 104.64 ?  774  GLU A OE1   1 
ATOM   2839  O  OE2   . GLU A 1 902  ? 115.950 98.091  160.167 1.00 233.65 -1 774  GLU A OE2   1 
ATOM   2840  N  N     . ASN A 1 903  ? 113.969 94.978  156.947 1.00 64.35  ?  775  ASN A N     1 
ATOM   2841  C  CA    . ASN A 1 903  ? 112.945 95.500  156.052 1.00 57.51  ?  775  ASN A CA    1 
ATOM   2842  C  C     . ASN A 1 903  ? 112.172 94.367  155.396 1.00 45.00  ?  775  ASN A C     1 
ATOM   2843  O  O     . ASN A 1 903  ? 110.946 94.445  155.250 1.00 41.36  ?  775  ASN A O     1 
ATOM   2844  C  CB    . ASN A 1 903  ? 113.570 96.408  154.998 1.00 56.89  ?  775  ASN A CB    1 
ATOM   2845  C  CG    . ASN A 1 903  ? 113.871 97.801  155.530 1.00 63.27  ?  775  ASN A CG    1 
ATOM   2846  O  OD1   . ASN A 1 903  ? 112.964 98.540  155.913 1.00 61.84  ?  775  ASN A OD1   1 
ATOM   2847  N  ND2   . ASN A 1 903  ? 115.144 98.175  155.526 1.00 70.16  ?  775  ASN A ND2   1 
ATOM   2848  N  N     . LEU A 1 904  ? 112.873 93.309  154.990 1.00 42.58  ?  776  LEU A N     1 
ATOM   2849  C  CA    . LEU A 1 904  ? 112.185 92.104  154.548 1.00 41.11  ?  776  LEU A CA    1 
ATOM   2850  C  C     . LEU A 1 904  ? 111.278 91.567  155.647 1.00 45.28  ?  776  LEU A C     1 
ATOM   2851  O  O     . LEU A 1 904  ? 110.139 91.155  155.390 1.00 43.53  ?  776  LEU A O     1 
ATOM   2852  C  CB    . LEU A 1 904  ? 113.207 91.053  154.126 1.00 38.67  ?  776  LEU A CB    1 
ATOM   2853  C  CG    . LEU A 1 904  ? 114.087 91.414  152.936 1.00 37.72  ?  776  LEU A CG    1 
ATOM   2854  C  CD1   . LEU A 1 904  ? 114.779 90.173  152.406 1.00 36.20  ?  776  LEU A CD1   1 
ATOM   2855  C  CD2   . LEU A 1 904  ? 113.265 92.080  151.863 1.00 30.24  ?  776  LEU A CD2   1 
ATOM   2856  N  N     . GLU A 1 905  ? 111.784 91.539  156.881 1.00 50.14  ?  777  GLU A N     1 
ATOM   2857  C  CA    . GLU A 1 905  ? 110.971 91.064  157.998 1.00 56.66  ?  777  GLU A CA    1 
ATOM   2858  C  C     . GLU A 1 905  ? 109.699 91.896  158.145 1.00 50.85  ?  777  GLU A C     1 
ATOM   2859  O  O     . GLU A 1 905  ? 108.596 91.357  158.307 1.00 46.90  ?  777  GLU A O     1 
ATOM   2860  C  CB    . GLU A 1 905  ? 111.795 91.091  159.285 1.00 76.50  ?  777  GLU A CB    1 
ATOM   2861  C  CG    . GLU A 1 905  ? 111.202 90.287  160.441 1.00 101.46 ?  777  GLU A CG    1 
ATOM   2862  C  CD    . GLU A 1 905  ? 112.241 89.902  161.488 1.00 142.55 ?  777  GLU A CD    1 
ATOM   2863  O  OE1   . GLU A 1 905  ? 113.446 90.150  161.267 1.00 121.73 ?  777  GLU A OE1   1 
ATOM   2864  O  OE2   . GLU A 1 905  ? 111.854 89.334  162.530 1.00 260.31 -1 777  GLU A OE2   1 
ATOM   2865  N  N     . ARG A 1 906  ? 109.836 93.220  158.080 1.00 49.23  ?  778  ARG A N     1 
ATOM   2866  C  CA    . ARG A 1 906  ? 108.688 94.104  158.248 1.00 49.71  ?  778  ARG A CA    1 
ATOM   2867  C  C     . ARG A 1 906  ? 107.700 93.951  157.096 1.00 40.36  ?  778  ARG A C     1 
ATOM   2868  O  O     . ARG A 1 906  ? 106.483 94.022  157.301 1.00 37.45  ?  778  ARG A O     1 
ATOM   2869  C  CB    . ARG A 1 906  ? 109.165 95.551  158.364 1.00 48.75  ?  778  ARG A CB    1 
ATOM   2870  C  CG    . ARG A 1 906  ? 110.107 95.828  159.536 1.00 49.81  ?  778  ARG A CG    1 
ATOM   2871  C  CD    . ARG A 1 906  ? 109.551 96.887  160.458 1.00 47.99  ?  778  ARG A CD    1 
ATOM   2872  N  NE    . ARG A 1 906  ? 109.669 98.213  159.859 1.00 47.53  ?  778  ARG A NE    1 
ATOM   2873  C  CZ    . ARG A 1 906  ? 110.755 98.971  159.943 1.00 49.73  ?  778  ARG A CZ    1 
ATOM   2874  N  NH1   . ARG A 1 906  ? 111.821 98.530  160.599 1.00 53.56  ?  778  ARG A NH1   1 
ATOM   2875  N  NH2   . ARG A 1 906  ? 110.774 100.166 159.370 1.00 47.66  ?  778  ARG A NH2   1 
ATOM   2876  N  N     . TYR A 1 907  ? 108.206 93.747  155.874 1.00 35.97  ?  779  TYR A N     1 
ATOM   2877  C  CA    . TYR A 1 907  ? 107.320 93.486  154.741 1.00 36.25  ?  779  TYR A CA    1 
ATOM   2878  C  C     . TYR A 1 907  ? 106.540 92.199  154.944 1.00 34.75  ?  779  TYR A C     1 
ATOM   2879  O  O     . TYR A 1 907  ? 105.353 92.121  154.607 1.00 35.27  ?  779  TYR A O     1 
ATOM   2880  C  CB    . TYR A 1 907  ? 108.111 93.397  153.435 1.00 36.94  ?  779  TYR A CB    1 
ATOM   2881  C  CG    . TYR A 1 907  ? 107.291 92.895  152.240 1.00 27.27  ?  779  TYR A CG    1 
ATOM   2882  C  CD1   . TYR A 1 907  ? 106.399 93.729  151.578 1.00 24.15  ?  779  TYR A CD1   1 
ATOM   2883  C  CD2   . TYR A 1 907  ? 107.403 91.584  151.789 1.00 35.50  ?  779  TYR A CD2   1 
ATOM   2884  C  CE1   . TYR A 1 907  ? 105.654 93.278  150.498 1.00 18.08  ?  779  TYR A CE1   1 
ATOM   2885  C  CE2   . TYR A 1 907  ? 106.654 91.126  150.711 1.00 29.99  ?  779  TYR A CE2   1 
ATOM   2886  C  CZ    . TYR A 1 907  ? 105.783 91.979  150.074 1.00 21.00  ?  779  TYR A CZ    1 
ATOM   2887  O  OH    . TYR A 1 907  ? 105.039 91.537  149.008 1.00 21.63  ?  779  TYR A OH    1 
ATOM   2888  N  N     . GLU A 1 908  ? 107.205 91.163  155.450 1.00 39.20  ?  780  GLU A N     1 
ATOM   2889  C  CA    . GLU A 1 908  ? 106.500 89.922  155.732 1.00 46.27  ?  780  GLU A CA    1 
ATOM   2890  C  C     . GLU A 1 908  ? 105.419 90.136  156.776 1.00 46.40  ?  780  GLU A C     1 
ATOM   2891  O  O     . GLU A 1 908  ? 104.311 89.593  156.657 1.00 46.20  ?  780  GLU A O     1 
ATOM   2892  C  CB    . GLU A 1 908  ? 107.491 88.852  156.177 1.00 54.69  ?  780  GLU A CB    1 
ATOM   2893  C  CG    . GLU A 1 908  ? 108.110 88.091  155.024 1.00 71.88  ?  780  GLU A CG    1 
ATOM   2894  C  CD    . GLU A 1 908  ? 107.060 87.490  154.106 1.00 95.66  ?  780  GLU A CD    1 
ATOM   2895  O  OE1   . GLU A 1 908  ? 106.018 87.018  154.615 1.00 81.36  ?  780  GLU A OE1   1 
ATOM   2896  O  OE2   . GLU A 1 908  ? 107.259 87.523  152.873 1.00 283.90 -1 780  GLU A OE2   1 
ATOM   2897  N  N     . ILE A 1 909  ? 105.728 90.919  157.813 1.00 45.01  ?  781  ILE A N     1 
ATOM   2898  C  CA    . ILE A 1 909  ? 104.729 91.225  158.831 1.00 44.07  ?  781  ILE A CA    1 
ATOM   2899  C  C     . ILE A 1 909  ? 103.544 91.950  158.201 1.00 39.75  ?  781  ILE A C     1 
ATOM   2900  O  O     . ILE A 1 909  ? 102.383 91.695  158.549 1.00 38.08  ?  781  ILE A O     1 
ATOM   2901  C  CB    . ILE A 1 909  ? 105.370 92.041  159.972 1.00 44.50  ?  781  ILE A CB    1 
ATOM   2902  C  CG1   . ILE A 1 909  ? 105.877 91.135  161.105 1.00 45.46  ?  781  ILE A CG1   1 
ATOM   2903  C  CG2   . ILE A 1 909  ? 104.391 93.033  160.548 1.00 42.67  ?  781  ILE A CG2   1 
ATOM   2904  C  CD1   . ILE A 1 909  ? 107.000 90.196  160.733 1.00 48.97  ?  781  ILE A CD1   1 
ATOM   2905  N  N     . TRP A 1 910  ? 103.820 92.853  157.253 1.00 34.57  ?  782  TRP A N     1 
ATOM   2906  C  CA    . TRP A 1 910  ? 102.746 93.533  156.535 1.00 32.48  ?  782  TRP A CA    1 
ATOM   2907  C  C     . TRP A 1 910  ? 101.885 92.534  155.785 1.00 34.32  ?  782  TRP A C     1 
ATOM   2908  O  O     . TRP A 1 910  ? 100.656 92.532  155.916 1.00 37.14  ?  782  TRP A O     1 
ATOM   2909  C  CB    . TRP A 1 910  ? 103.323 94.554  155.553 1.00 30.51  ?  782  TRP A CB    1 
ATOM   2910  C  CG    . TRP A 1 910  ? 102.384 94.955  154.419 1.00 23.89  ?  782  TRP A CG    1 
ATOM   2911  C  CD1   . TRP A 1 910  ? 102.121 94.242  153.286 1.00 28.94  ?  782  TRP A CD1   1 
ATOM   2912  C  CD2   . TRP A 1 910  ? 101.628 96.169  154.308 1.00 20.98  ?  782  TRP A CD2   1 
ATOM   2913  N  NE1   . TRP A 1 910  ? 101.234 94.923  152.492 1.00 25.67  ?  782  TRP A NE1   1 
ATOM   2914  C  CE2   . TRP A 1 910  ? 100.920 96.110  153.095 1.00 20.31  ?  782  TRP A CE2   1 
ATOM   2915  C  CE3   . TRP A 1 910  ? 101.477 97.292  155.120 1.00 18.75  ?  782  TRP A CE3   1 
ATOM   2916  C  CZ2   . TRP A 1 910  ? 100.089 97.127  152.672 1.00 19.65  ?  782  TRP A CZ2   1 
ATOM   2917  C  CZ3   . TRP A 1 910  ? 100.647 98.295  154.702 1.00 22.40  ?  782  TRP A CZ3   1 
ATOM   2918  C  CH2   . TRP A 1 910  ? 99.959  98.208  153.489 1.00 22.65  ?  782  TRP A CH2   1 
ATOM   2919  N  N     . ARG A 1 911  ? 102.523 91.672  154.992 1.00 33.74  ?  783  ARG A N     1 
ATOM   2920  C  CA    . ARG A 1 911  ? 101.784 90.754  154.134 1.00 34.83  ?  783  ARG A CA    1 
ATOM   2921  C  C     . ARG A 1 911  ? 100.902 89.826  154.962 1.00 39.38  ?  783  ARG A C     1 
ATOM   2922  O  O     . ARG A 1 911  ? 99.687  89.737  154.747 1.00 34.21  ?  783  ARG A O     1 
ATOM   2923  C  CB    . ARG A 1 911  ? 102.757 89.949  153.280 1.00 37.98  ?  783  ARG A CB    1 
ATOM   2924  C  CG    . ARG A 1 911  ? 102.299 89.700  151.848 1.00 34.75  ?  783  ARG A CG    1 
ATOM   2925  C  CD    . ARG A 1 911  ? 103.249 88.750  151.150 1.00 42.75  ?  783  ARG A CD    1 
ATOM   2926  N  NE    . ARG A 1 911  ? 103.458 87.558  151.962 1.00 60.03  ?  783  ARG A NE    1 
ATOM   2927  C  CZ    . ARG A 1 911  ? 104.244 86.544  151.620 1.00 72.20  ?  783  ARG A CZ    1 
ATOM   2928  N  NH1   . ARG A 1 911  ? 104.894 86.564  150.464 1.00 70.42  ?  783  ARG A NH1   1 
ATOM   2929  N  NH2   . ARG A 1 911  ? 104.373 85.507  152.435 1.00 79.76  ?  783  ARG A NH2   1 
ATOM   2930  N  N     . LYS A 1 912  ? 101.507 89.112  155.910 1.00 43.17  ?  784  LYS A N     1 
ATOM   2931  C  CA    . LYS A 1 912  ? 100.741 88.195  156.746 1.00 41.90  ?  784  LYS A CA    1 
ATOM   2932  C  C     . LYS A 1 912  ? 99.746  88.943  157.618 1.00 39.44  ?  784  LYS A C     1 
ATOM   2933  O  O     . LYS A 1 912  ? 98.573  88.564  157.699 1.00 40.31  ?  784  LYS A O     1 
ATOM   2934  C  CB    . LYS A 1 912  ? 101.691 87.361  157.600 1.00 47.84  ?  784  LYS A CB    1 
ATOM   2935  C  CG    . LYS A 1 912  ? 101.339 85.896  157.668 1.00 57.40  ?  784  LYS A CG    1 
ATOM   2936  C  CD    . LYS A 1 912  ? 101.256 85.333  156.269 1.00 74.82  ?  784  LYS A CD    1 
ATOM   2937  C  CE    . LYS A 1 912  ? 102.565 85.507  155.508 1.00 74.32  ?  784  LYS A CE    1 
ATOM   2938  N  NZ    . LYS A 1 912  ? 102.360 85.373  154.038 1.00 79.49  ?  784  LYS A NZ    1 
ATOM   2939  N  N     . ASN A 1 913  ? 100.197 90.007  158.270 1.00 36.37  ?  785  ASN A N     1 
ATOM   2940  C  CA    . ASN A 1 913  ? 99.434  90.698  159.294 1.00 35.08  ?  785  ASN A CA    1 
ATOM   2941  C  C     . ASN A 1 913  ? 99.034  89.651  160.324 1.00 41.80  ?  785  ASN A C     1 
ATOM   2942  O  O     . ASN A 1 913  ? 97.852  89.309  160.444 1.00 40.24  ?  785  ASN A O     1 
ATOM   2943  C  CB    . ASN A 1 913  ? 98.216  91.402  158.693 1.00 36.07  ?  785  ASN A CB    1 
ATOM   2944  C  CG    . ASN A 1 913  ? 97.337  92.054  159.744 1.00 44.43  ?  785  ASN A CG    1 
ATOM   2945  O  OD1   . ASN A 1 913  ? 97.773  92.306  160.870 1.00 51.90  ?  785  ASN A OD1   1 
ATOM   2946  N  ND2   . ASN A 1 913  ? 96.083  92.315  159.386 1.00 45.85  ?  785  ASN A ND2   1 
ATOM   2947  N  N     . PRO A 1 914  ? 99.993  89.085  161.055 1.00 40.53  ?  786  PRO A N     1 
ATOM   2948  C  CA    . PRO A 1 914  ? 99.633  88.090  162.067 1.00 43.44  ?  786  PRO A CA    1 
ATOM   2949  C  C     . PRO A 1 914  ? 98.868  88.677  163.233 1.00 52.46  ?  786  PRO A C     1 
ATOM   2950  O  O     . PRO A 1 914  ? 98.175  87.931  163.933 1.00 59.16  ?  786  PRO A O     1 
ATOM   2951  C  CB    . PRO A 1 914  ? 100.992 87.536  162.502 1.00 44.12  ?  786  PRO A CB    1 
ATOM   2952  C  CG    . PRO A 1 914  ? 101.907 88.676  162.321 1.00 44.84  ?  786  PRO A CG    1 
ATOM   2953  C  CD    . PRO A 1 914  ? 101.431 89.398  161.087 1.00 39.79  ?  786  PRO A CD    1 
ATOM   2954  N  N     . PHE A 1 915  ? 98.955  89.986  163.454 1.00 54.90  ?  787  PHE A N     1 
ATOM   2955  C  CA    . PHE A 1 915  ? 98.252  90.647  164.542 1.00 61.42  ?  787  PHE A CA    1 
ATOM   2956  C  C     . PHE A 1 915  ? 96.852  91.108  164.155 1.00 61.49  ?  787  PHE A C     1 
ATOM   2957  O  O     . PHE A 1 915  ? 96.127  91.608  165.017 1.00 62.02  ?  787  PHE A O     1 
ATOM   2958  C  CB    . PHE A 1 915  ? 99.071  91.843  165.037 1.00 69.92  ?  787  PHE A CB    1 
ATOM   2959  C  CG    . PHE A 1 915  ? 100.350 91.459  165.717 1.00 73.77  ?  787  PHE A CG    1 
ATOM   2960  C  CD1   . PHE A 1 915  ? 100.331 90.899  166.979 1.00 76.09  ?  787  PHE A CD1   1 
ATOM   2961  C  CD2   . PHE A 1 915  ? 101.571 91.643  165.094 1.00 74.04  ?  787  PHE A CD2   1 
ATOM   2962  C  CE1   . PHE A 1 915  ? 101.503 90.540  167.612 1.00 80.14  ?  787  PHE A CE1   1 
ATOM   2963  C  CE2   . PHE A 1 915  ? 102.747 91.285  165.729 1.00 78.44  ?  787  PHE A CE2   1 
ATOM   2964  C  CZ    . PHE A 1 915  ? 102.708 90.733  166.987 1.00 79.63  ?  787  PHE A CZ    1 
ATOM   2965  N  N     . SER A 1 916  ? 96.463  90.958  162.887 1.00 57.61  ?  788  SER A N     1 
ATOM   2966  C  CA    . SER A 1 916  ? 95.107  91.267  162.425 1.00 58.47  ?  788  SER A CA    1 
ATOM   2967  C  C     . SER A 1 916  ? 94.722  92.715  162.722 1.00 59.82  ?  788  SER A C     1 
ATOM   2968  O  O     . SER A 1 916  ? 93.580  93.015  163.068 1.00 60.41  ?  788  SER A O     1 
ATOM   2969  C  CB    . SER A 1 916  ? 94.084  90.295  163.022 1.00 63.40  ?  788  SER A CB    1 
ATOM   2970  O  OG    . SER A 1 916  ? 93.916  90.506  164.413 1.00 66.13  ?  788  SER A OG    1 
ATOM   2971  N  N     . GLU A 1 917  ? 95.678  93.624  162.578 1.00 60.31  ?  789  GLU A N     1 
ATOM   2972  C  CA    . GLU A 1 917  ? 95.449  95.020  162.899 1.00 53.84  ?  789  GLU A CA    1 
ATOM   2973  C  C     . GLU A 1 917  ? 94.684  95.706  161.774 1.00 47.44  ?  789  GLU A C     1 
ATOM   2974  O  O     . GLU A 1 917  ? 94.568  95.198  160.656 1.00 46.78  ?  789  GLU A O     1 
ATOM   2975  C  CB    . GLU A 1 917  ? 96.779  95.725  163.139 1.00 56.20  ?  789  GLU A CB    1 
ATOM   2976  C  CG    . GLU A 1 917  ? 97.758  94.849  163.886 1.00 70.34  ?  789  GLU A CG    1 
ATOM   2977  C  CD    . GLU A 1 917  ? 99.112  95.495  164.107 1.00 85.39  ?  789  GLU A CD    1 
ATOM   2978  O  OE1   . GLU A 1 917  ? 99.278  96.688  163.778 1.00 77.06  ?  789  GLU A OE1   1 
ATOM   2979  O  OE2   . GLU A 1 917  ? 100.020 94.792  164.598 1.00 186.37 -1 789  GLU A OE2   1 
ATOM   2980  N  N     . SER A 1 918  ? 94.159  96.883  162.077 1.00 48.33  ?  790  SER A N     1 
ATOM   2981  C  CA    . SER A 1 918  ? 93.532  97.674  161.039 1.00 48.05  ?  790  SER A CA    1 
ATOM   2982  C  C     . SER A 1 918  ? 94.619  98.353  160.209 1.00 44.58  ?  790  SER A C     1 
ATOM   2983  O  O     . SER A 1 918  ? 95.817  98.193  160.454 1.00 43.86  ?  790  SER A O     1 
ATOM   2984  C  CB    . SER A 1 918  ? 92.561  98.680  161.650 1.00 48.04  ?  790  SER A CB    1 
ATOM   2985  O  OG    . SER A 1 918  ? 91.999  99.518  160.655 1.00 45.36  ?  790  SER A OG    1 
ATOM   2986  N  N     . ALA A 1 919  ? 94.190  99.146  159.230 1.00 43.45  ?  791  ALA A N     1 
ATOM   2987  C  CA    . ALA A 1 919  ? 95.105  99.659  158.213 1.00 45.25  ?  791  ALA A CA    1 
ATOM   2988  C  C     . ALA A 1 919  ? 96.229  100.483 158.824 1.00 47.44  ?  791  ALA A C     1 
ATOM   2989  O  O     . ALA A 1 919  ? 97.414  100.234 158.571 1.00 48.92  ?  791  ALA A O     1 
ATOM   2990  C  CB    . ALA A 1 919  ? 94.330  100.492 157.194 1.00 43.25  ?  791  ALA A CB    1 
ATOM   2991  N  N     . ASP A 1 920  ? 95.877  101.486 159.619 1.00 51.91  ?  792  ASP A N     1 
ATOM   2992  C  CA    . ASP A 1 920  ? 96.869  102.475 160.013 1.00 58.82  ?  792  ASP A CA    1 
ATOM   2993  C  C     . ASP A 1 920  ? 97.743  102.000 161.167 1.00 57.87  ?  792  ASP A C     1 
ATOM   2994  O  O     . ASP A 1 920  ? 98.938  102.311 161.193 1.00 54.36  ?  792  ASP A O     1 
ATOM   2995  C  CB    . ASP A 1 920  ? 96.164  103.788 160.347 1.00 76.69  ?  792  ASP A CB    1 
ATOM   2996  C  CG    . ASP A 1 920  ? 95.323  104.307 159.188 1.00 101.66 ?  792  ASP A CG    1 
ATOM   2997  O  OD1   . ASP A 1 920  ? 95.009  103.513 158.275 1.00 77.02  ?  792  ASP A OD1   1 
ATOM   2998  O  OD2   . ASP A 1 920  ? 94.988  105.511 159.177 1.00 319.57 -1 792  ASP A OD2   1 
ATOM   2999  N  N     . GLU A 1 921  ? 97.194  101.243 162.121 1.00 62.21  ?  793  GLU A N     1 
ATOM   3000  C  CA    . GLU A 1 921  ? 98.071  100.557 163.068 1.00 62.20  ?  793  GLU A CA    1 
ATOM   3001  C  C     . GLU A 1 921  ? 98.995  99.589  162.346 1.00 59.70  ?  793  GLU A C     1 
ATOM   3002  O  O     . GLU A 1 921  ? 100.109 99.327  162.809 1.00 63.04  ?  793  GLU A O     1 
ATOM   3003  C  CB    . GLU A 1 921  ? 97.283  99.810  164.145 1.00 75.97  ?  793  GLU A CB    1 
ATOM   3004  C  CG    . GLU A 1 921  ? 96.743  100.655 165.289 1.00 91.90  ?  793  GLU A CG    1 
ATOM   3005  C  CD    . GLU A 1 921  ? 95.244  100.845 165.238 1.00 123.51 ?  793  GLU A CD    1 
ATOM   3006  O  OE1   . GLU A 1 921  ? 94.704  101.020 164.129 1.00 98.11  ?  793  GLU A OE1   1 
ATOM   3007  O  OE2   . GLU A 1 921  ? 94.609  100.797 166.313 1.00 247.71 -1 793  GLU A OE2   1 
ATOM   3008  N  N     . LEU A 1 922  ? 98.538  99.021  161.225 1.00 58.86  ?  794  LEU A N     1 
ATOM   3009  C  CA    . LEU A 1 922  ? 99.413  98.153  160.447 1.00 59.79  ?  794  LEU A CA    1 
ATOM   3010  C  C     . LEU A 1 922  ? 100.537 98.952  159.805 1.00 51.58  ?  794  LEU A C     1 
ATOM   3011  O  O     . LEU A 1 922  ? 101.678 98.485  159.734 1.00 46.86  ?  794  LEU A O     1 
ATOM   3012  C  CB    . LEU A 1 922  ? 98.610  97.399  159.387 1.00 54.71  ?  794  LEU A CB    1 
ATOM   3013  C  CG    . LEU A 1 922  ? 99.389  96.368  158.568 1.00 43.38  ?  794  LEU A CG    1 
ATOM   3014  C  CD1   . LEU A 1 922  ? 100.239 95.479  159.461 1.00 45.83  ?  794  LEU A CD1   1 
ATOM   3015  C  CD2   . LEU A 1 922  ? 98.472  95.527  157.704 1.00 42.39  ?  794  LEU A CD2   1 
ATOM   3016  N  N     . ARG A 1 923  ? 100.230 100.152 159.324 1.00 44.18  ?  795  ARG A N     1 
ATOM   3017  C  CA    . ARG A 1 923  ? 101.276 101.054 158.864 1.00 42.48  ?  795  ARG A CA    1 
ATOM   3018  C  C     . ARG A 1 923  ? 102.278 101.335 159.975 1.00 43.17  ?  795  ARG A C     1 
ATOM   3019  O  O     . ARG A 1 923  ? 103.494 101.334 159.755 1.00 42.56  ?  795  ARG A O     1 
ATOM   3020  C  CB    . ARG A 1 923  ? 100.647 102.353 158.375 1.00 43.11  ?  795  ARG A CB    1 
ATOM   3021  C  CG    . ARG A 1 923  ? 101.651 103.381 157.912 1.00 44.80  ?  795  ARG A CG    1 
ATOM   3022  C  CD    . ARG A 1 923  ? 101.941 103.235 156.435 1.00 38.77  ?  795  ARG A CD    1 
ATOM   3023  N  NE    . ARG A 1 923  ? 102.416 104.489 155.864 1.00 41.89  ?  795  ARG A NE    1 
ATOM   3024  C  CZ    . ARG A 1 923  ? 101.625 105.515 155.565 1.00 37.24  ?  795  ARG A CZ    1 
ATOM   3025  N  NH1   . ARG A 1 923  ? 102.137 106.622 155.035 1.00 39.99  ?  795  ARG A NH1   1 
ATOM   3026  N  NH2   . ARG A 1 923  ? 100.322 105.439 155.814 1.00 35.53  ?  795  ARG A NH2   1 
ATOM   3027  N  N     . ASP A 1 924  ? 101.774 101.574 161.186 1.00 49.60  ?  796  ASP A N     1 
ATOM   3028  C  CA    . ASP A 1 924  ? 102.632 102.016 162.283 1.00 57.54  ?  796  ASP A CA    1 
ATOM   3029  C  C     . ASP A 1 924  ? 103.535 100.892 162.784 1.00 57.55  ?  796  ASP A C     1 
ATOM   3030  O  O     . ASP A 1 924  ? 104.757 101.059 162.858 1.00 52.99  ?  796  ASP A O     1 
ATOM   3031  C  CB    . ASP A 1 924  ? 101.777 102.569 163.427 1.00 75.66  ?  796  ASP A CB    1 
ATOM   3032  C  CG    . ASP A 1 924  ? 102.588 102.861 164.692 1.00 97.08  ?  796  ASP A CG    1 
ATOM   3033  O  OD1   . ASP A 1 924  ? 103.600 103.587 164.610 1.00 82.35  ?  796  ASP A OD1   1 
ATOM   3034  O  OD2   . ASP A 1 924  ? 102.198 102.370 165.776 1.00 167.86 -1 796  ASP A OD2   1 
ATOM   3035  N  N     . ARG A 1 925  ? 102.952 99.741  163.148 1.00 57.45  ?  797  ARG A N     1 
ATOM   3036  C  CA    . ARG A 1 925  ? 103.743 98.673  163.758 1.00 53.47  ?  797  ARG A CA    1 
ATOM   3037  C  C     . ARG A 1 925  ? 104.878 98.233  162.847 1.00 47.37  ?  797  ARG A C     1 
ATOM   3038  O  O     . ARG A 1 925  ? 105.932 97.805  163.331 1.00 45.96  ?  797  ARG A O     1 
ATOM   3039  C  CB    . ARG A 1 925  ? 102.866 97.468  164.095 1.00 51.72  ?  797  ARG A CB    1 
ATOM   3040  C  CG    . ARG A 1 925  ? 103.635 96.326  164.765 1.00 54.00  ?  797  ARG A CG    1 
ATOM   3041  C  CD    . ARG A 1 925  ? 102.849 95.029  164.758 1.00 66.14  ?  797  ARG A CD    1 
ATOM   3042  N  NE    . ARG A 1 925  ? 101.835 94.989  165.809 1.00 79.31  ?  797  ARG A NE    1 
ATOM   3043  C  CZ    . ARG A 1 925  ? 102.085 94.693  167.081 1.00 81.03  ?  797  ARG A CZ    1 
ATOM   3044  N  NH1   . ARG A 1 925  ? 103.322 94.410  167.471 1.00 77.85  ?  797  ARG A NH1   1 
ATOM   3045  N  NH2   . ARG A 1 925  ? 101.097 94.684  167.964 1.00 81.44  ?  797  ARG A NH2   1 
ATOM   3046  N  N     . VAL A 1 926  ? 104.676 98.324  161.527 1.00 48.47  ?  798  VAL A N     1 
ATOM   3047  C  CA    . VAL A 1 926  ? 105.729 98.033  160.563 1.00 49.16  ?  798  VAL A CA    1 
ATOM   3048  C  C     . VAL A 1 926  ? 106.535 99.268  160.215 1.00 44.77  ?  798  VAL A C     1 
ATOM   3049  O  O     . VAL A 1 926  ? 107.492 99.172  159.435 1.00 41.90  ?  798  VAL A O     1 
ATOM   3050  C  CB    . VAL A 1 926  ? 105.145 97.435  159.268 1.00 42.17  ?  798  VAL A CB    1 
ATOM   3051  C  CG1   . VAL A 1 926  ? 104.139 96.354  159.594 1.00 40.32  ?  798  VAL A CG1   1 
ATOM   3052  C  CG2   . VAL A 1 926  ? 104.516 98.522  158.416 1.00 41.32  ?  798  VAL A CG2   1 
ATOM   3053  N  N     . LYS A 1 927  ? 106.183 100.423 160.779 1.00 49.52  ?  799  LYS A N     1 
ATOM   3054  C  CA    . LYS A 1 927  ? 106.816 101.696 160.450 1.00 50.65  ?  799  LYS A CA    1 
ATOM   3055  C  C     . LYS A 1 927  ? 106.732 101.974 158.953 1.00 44.90  ?  799  LYS A C     1 
ATOM   3056  O  O     . LYS A 1 927  ? 107.642 102.544 158.346 1.00 41.52  ?  799  LYS A O     1 
ATOM   3057  C  CB    . LYS A 1 927  ? 108.262 101.748 160.955 1.00 50.96  ?  799  LYS A CB    1 
ATOM   3058  C  CG    . LYS A 1 927  ? 108.401 101.461 162.451 1.00 58.45  ?  799  LYS A CG    1 
ATOM   3059  C  CD    . LYS A 1 927  ? 107.565 102.409 163.333 1.00 58.04  ?  799  LYS A CD    1 
ATOM   3060  C  CE    . LYS A 1 927  ? 108.004 103.865 163.192 1.00 55.08  ?  799  LYS A CE    1 
ATOM   3061  N  NZ    . LYS A 1 927  ? 107.210 104.803 164.038 1.00 46.65  ?  799  LYS A NZ    1 
ATOM   3062  N  N     . GLY A 1 928  ? 105.617 101.561 158.360 1.00 43.10  ?  800  GLY A N     1 
ATOM   3063  C  CA    . GLY A 1 928  ? 105.285 101.869 156.987 1.00 46.19  ?  800  GLY A CA    1 
ATOM   3064  C  C     . GLY A 1 928  ? 106.264 101.355 155.952 1.00 49.82  ?  800  GLY A C     1 
ATOM   3065  O  O     . GLY A 1 928  ? 106.950 102.141 155.296 1.00 49.83  ?  800  GLY A O     1 
ATOM   3066  N  N     . VAL A 1 929  ? 106.349 100.041 155.790 1.00 41.94  ?  801  VAL A N     1 
ATOM   3067  C  CA    . VAL A 1 929  ? 107.197 99.426  154.771 1.00 32.61  ?  801  VAL A CA    1 
ATOM   3068  C  C     . VAL A 1 929  ? 106.287 98.498  153.975 1.00 25.74  ?  801  VAL A C     1 
ATOM   3069  O  O     . VAL A 1 929  ? 106.179 97.305  154.273 1.00 27.71  ?  801  VAL A O     1 
ATOM   3070  C  CB    . VAL A 1 929  ? 108.374 98.658  155.375 1.00 46.91  ?  801  VAL A CB    1 
ATOM   3071  C  CG1   . VAL A 1 929  ? 109.439 98.429  154.319 1.00 44.18  ?  801  VAL A CG1   1 
ATOM   3072  C  CG2   . VAL A 1 929  ? 108.930 99.396  156.585 1.00 50.08  ?  801  VAL A CG2   1 
ATOM   3073  N  N     . SER A 1 930  ? 105.634 99.031  152.949 1.00 25.32  ?  802  SER A N     1 
ATOM   3074  C  CA    . SER A 1 930  ? 104.605 98.267  152.256 1.00 24.08  ?  802  SER A CA    1 
ATOM   3075  C  C     . SER A 1 930  ? 105.139 97.511  151.055 1.00 19.25  ?  802  SER A C     1 
ATOM   3076  O  O     . SER A 1 930  ? 104.840 96.326  150.887 1.00 19.46  ?  802  SER A O     1 
ATOM   3077  C  CB    . SER A 1 930  ? 103.469 99.187  151.809 1.00 22.24  ?  802  SER A CB    1 
ATOM   3078  O  OG    . SER A 1 930  ? 103.922 100.107 150.839 1.00 23.81  ?  802  SER A OG    1 
ATOM   3079  N  N     . ALA A 1 931  ? 105.935 98.154  150.218 1.00 19.63  ?  803  ALA A N     1 
ATOM   3080  C  CA    . ALA A 1 931  ? 106.453 97.506  149.027 1.00 20.65  ?  803  ALA A CA    1 
ATOM   3081  C  C     . ALA A 1 931  ? 107.663 96.659  149.399 1.00 20.14  ?  803  ALA A C     1 
ATOM   3082  O  O     . ALA A 1 931  ? 108.493 97.076  150.213 1.00 23.44  ?  803  ALA A O     1 
ATOM   3083  C  CB    . ALA A 1 931  ? 106.840 98.556  147.986 1.00 18.98  ?  803  ALA A CB    1 
ATOM   3084  N  N     . LYS A 1 932  ? 107.765 95.470  148.803 1.00 17.79  ?  804  LYS A N     1 
ATOM   3085  C  CA    . LYS A 1 932  ? 108.872 94.575  149.123 1.00 16.48  ?  804  LYS A CA    1 
ATOM   3086  C  C     . LYS A 1 932  ? 110.164 95.079  148.491 1.00 14.47  ?  804  LYS A C     1 
ATOM   3087  O  O     . LYS A 1 932  ? 110.274 95.103  147.260 1.00 14.89  ?  804  LYS A O     1 
ATOM   3088  C  CB    . LYS A 1 932  ? 108.598 93.153  148.639 1.00 12.86  ?  804  LYS A CB    1 
ATOM   3089  C  CG    . LYS A 1 932  ? 109.793 92.233  148.785 1.00 10.96  ?  804  LYS A CG    1 
ATOM   3090  C  CD    . LYS A 1 932  ? 109.689 91.004  147.896 1.00 10.17  ?  804  LYS A CD    1 
ATOM   3091  C  CE    . LYS A 1 932  ? 110.929 90.125  148.029 1.00 7.26   ?  804  LYS A CE    1 
ATOM   3092  N  NZ    . LYS A 1 932  ? 110.963 89.055  147.000 1.00 11.41  ?  804  LYS A NZ    1 
ATOM   3093  N  N     . PRO A 1 933  ? 111.170 95.474  149.272 1.00 15.57  ?  805  PRO A N     1 
ATOM   3094  C  CA    . PRO A 1 933  ? 112.422 95.907  148.655 1.00 15.17  ?  805  PRO A CA    1 
ATOM   3095  C  C     . PRO A 1 933  ? 113.029 94.753  147.883 1.00 17.21  ?  805  PRO A C     1 
ATOM   3096  O  O     . PRO A 1 933  ? 112.758 93.580  148.149 1.00 17.47  ?  805  PRO A O     1 
ATOM   3097  C  CB    . PRO A 1 933  ? 113.284 96.311  149.849 1.00 16.43  ?  805  PRO A CB    1 
ATOM   3098  C  CG    . PRO A 1 933  ? 112.812 95.442  150.923 1.00 17.48  ?  805  PRO A CG    1 
ATOM   3099  C  CD    . PRO A 1 933  ? 111.337 95.259  150.722 1.00 17.43  ?  805  PRO A CD    1 
ATOM   3100  N  N     . PHE A 1 934  ? 113.817 95.097  146.877 1.00 19.50  ?  806  PHE A N     1 
ATOM   3101  C  CA    . PHE A 1 934  ? 114.404 94.041  146.075 1.00 20.43  ?  806  PHE A CA    1 
ATOM   3102  C  C     . PHE A 1 934  ? 115.914 94.208  145.967 1.00 21.31  ?  806  PHE A C     1 
ATOM   3103  O  O     . PHE A 1 934  ? 116.650 93.220  145.998 1.00 20.17  ?  806  PHE A O     1 
ATOM   3104  C  CB    . PHE A 1 934  ? 113.766 93.995  144.688 1.00 21.25  ?  806  PHE A CB    1 
ATOM   3105  C  CG    . PHE A 1 934  ? 114.449 94.845  143.687 1.00 18.27  ?  806  PHE A CG    1 
ATOM   3106  C  CD1   . PHE A 1 934  ? 114.253 96.199  143.664 1.00 20.55  ?  806  PHE A CD1   1 
ATOM   3107  C  CD2   . PHE A 1 934  ? 115.319 94.287  142.784 1.00 20.96  ?  806  PHE A CD2   1 
ATOM   3108  C  CE1   . PHE A 1 934  ? 114.894 96.975  142.741 1.00 22.77  ?  806  PHE A CE1   1 
ATOM   3109  C  CE2   . PHE A 1 934  ? 115.959 95.063  141.867 1.00 19.81  ?  806  PHE A CE2   1 
ATOM   3110  C  CZ    . PHE A 1 934  ? 115.744 96.405  141.847 1.00 21.45  ?  806  PHE A CZ    1 
ATOM   3111  N  N     . MET A 1 935  ? 116.403 95.438  145.883 1.00 21.79  ?  807  MET A N     1 
ATOM   3112  C  CA    . MET A 1 935  ? 117.833 95.664  145.747 1.00 20.94  ?  807  MET A CA    1 
ATOM   3113  C  C     . MET A 1 935  ? 118.410 96.202  147.051 1.00 25.62  ?  807  MET A C     1 
ATOM   3114  O  O     . MET A 1 935  ? 117.815 97.066  147.704 1.00 25.41  ?  807  MET A O     1 
ATOM   3115  C  CB    . MET A 1 935  ? 118.153 96.613  144.582 1.00 18.18  ?  807  MET A CB    1 
ATOM   3116  C  CG    . MET A 1 935  ? 119.553 97.218  144.648 1.00 24.17  ?  807  MET A CG    1 
ATOM   3117  S  SD    . MET A 1 935  ? 120.167 98.056  143.164 1.00 22.59  ?  807  MET A SD    1 
ATOM   3118  C  CE    . MET A 1 935  ? 120.884 96.696  142.246 1.00 22.72  ?  807  MET A CE    1 
ATOM   3119  N  N     . GLU A 1 936  ? 119.562 95.659  147.432 1.00 31.37  ?  808  GLU A N     1 
ATOM   3120  C  CA    . GLU A 1 936  ? 120.246 96.070  148.642 1.00 35.98  ?  808  GLU A CA    1 
ATOM   3121  C  C     . GLU A 1 936  ? 120.649 97.538  148.534 1.00 34.72  ?  808  GLU A C     1 
ATOM   3122  O  O     . GLU A 1 936  ? 120.697 98.117  147.449 1.00 31.26  ?  808  GLU A O     1 
ATOM   3123  C  CB    . GLU A 1 936  ? 121.470 95.180  148.864 1.00 45.01  ?  808  GLU A CB    1 
ATOM   3124  C  CG    . GLU A 1 936  ? 121.579 94.607  150.258 1.00 65.16  ?  808  GLU A CG    1 
ATOM   3125  C  CD    . GLU A 1 936  ? 121.825 95.671  151.310 1.00 103.49 ?  808  GLU A CD    1 
ATOM   3126  O  OE1   . GLU A 1 936  ? 122.459 96.693  150.986 1.00 71.02  ?  808  GLU A OE1   1 
ATOM   3127  O  OE2   . GLU A 1 936  ? 121.377 95.479  152.464 1.00 261.95 -1 808  GLU A OE2   1 
ATOM   3128  N  N     . THR A 1 937  ? 120.930 98.148  149.679 1.00 35.32  ?  809  THR A N     1 
ATOM   3129  C  CA    . THR A 1 937  ? 121.239 99.568  149.720 1.00 28.91  ?  809  THR A CA    1 
ATOM   3130  C  C     . THR A 1 937  ? 122.265 99.840  150.807 1.00 30.12  ?  809  THR A C     1 
ATOM   3131  O  O     . THR A 1 937  ? 122.166 99.294  151.908 1.00 35.95  ?  809  THR A O     1 
ATOM   3132  C  CB    . THR A 1 937  ? 119.976 100.390 149.999 1.00 29.50  ?  809  THR A CB    1 
ATOM   3133  O  OG1   . THR A 1 937  ? 118.979 100.091 149.015 1.00 30.89  ?  809  THR A OG1   1 
ATOM   3134  C  CG2   . THR A 1 937  ? 120.284 101.873 149.981 1.00 26.33  ?  809  THR A CG2   1 
ATOM   3135  N  N     . GLN A 1 938  ? 123.248 100.680 150.497 1.00 27.08  ?  810  GLN A N     1 
ATOM   3136  C  CA    . GLN A 1 938  ? 123.901 100.998 151.759 1.00 30.03  ?  810  GLN A CA    1 
ATOM   3137  C  C     . GLN A 1 938  ? 123.230 102.215 152.392 1.00 29.62  ?  810  GLN A C     1 
ATOM   3138  O  O     . GLN A 1 938  ? 122.904 103.177 151.690 1.00 26.56  ?  810  GLN A O     1 
ATOM   3139  C  CB    . GLN A 1 938  ? 125.391 101.270 151.550 1.00 27.42  ?  810  GLN A CB    1 
ATOM   3140  C  CG    . GLN A 1 938  ? 126.175 101.554 152.818 1.00 29.73  ?  810  GLN A CG    1 
ATOM   3141  C  CD    . GLN A 1 938  ? 126.392 100.331 153.668 1.00 38.34  ?  810  GLN A CD    1 
ATOM   3142  O  OE1   . GLN A 1 938  ? 125.837 99.265  153.404 1.00 34.57  ?  810  GLN A OE1   1 
ATOM   3143  N  NE2   . GLN A 1 938  ? 127.164 100.491 154.733 1.00 53.97  ?  810  GLN A NE2   1 
ATOM   3144  N  N     . PRO A 1 939  ? 122.998 102.194 153.701 1.00 31.47  ?  811  PRO A N     1 
ATOM   3145  C  CA    . PRO A 1 939  ? 122.267 103.298 154.331 1.00 30.16  ?  811  PRO A CA    1 
ATOM   3146  C  C     . PRO A 1 939  ? 123.071 104.579 154.414 1.00 21.33  ?  811  PRO A C     1 
ATOM   3147  O  O     . PRO A 1 939  ? 123.736 104.841 155.423 1.00 22.81  ?  811  PRO A O     1 
ATOM   3148  C  CB    . PRO A 1 939  ? 121.960 102.758 155.734 1.00 71.01  ?  811  PRO A CB    1 
ATOM   3149  C  CG    . PRO A 1 939  ? 123.006 101.749 155.981 1.00 41.92  ?  811  PRO A CG    1 
ATOM   3150  C  CD    . PRO A 1 939  ? 123.254 101.100 154.655 1.00 46.55  ?  811  PRO A CD    1 
ATOM   3151  N  N     . THR A 1 940  ? 123.024 105.379 153.366 1.00 19.40  ?  812  THR A N     1 
ATOM   3152  C  CA    . THR A 1 940  ? 123.653 106.687 153.414 1.00 17.37  ?  812  THR A CA    1 
ATOM   3153  C  C     . THR A 1 940  ? 123.084 107.534 152.289 1.00 24.33  ?  812  THR A C     1 
ATOM   3154  O  O     . THR A 1 940  ? 122.305 107.061 151.456 1.00 16.23  ?  812  THR A O     1 
ATOM   3155  C  CB    . THR A 1 940  ? 125.166 106.588 153.307 1.00 19.18  ?  812  THR A CB    1 
ATOM   3156  O  OG1   . THR A 1 940  ? 125.691 107.896 153.055 1.00 18.56  ?  812  THR A OG1   1 
ATOM   3157  C  CG2   . THR A 1 940  ? 125.547 105.667 152.195 1.00 15.29  ?  812  THR A CG2   1 
ATOM   3158  N  N     . LEU A 1 941  ? 123.499 108.795 152.269 1.00 17.75  ?  813  LEU A N     1 
ATOM   3159  C  CA    . LEU A 1 941  ? 122.936 109.819 151.407 1.00 20.57  ?  813  LEU A CA    1 
ATOM   3160  C  C     . LEU A 1 941  ? 123.971 110.294 150.404 1.00 21.62  ?  813  LEU A C     1 
ATOM   3161  O  O     . LEU A 1 941  ? 125.178 110.219 150.643 1.00 21.15  ?  813  LEU A O     1 
ATOM   3162  C  CB    . LEU A 1 941  ? 122.465 111.028 152.211 1.00 18.07  ?  813  LEU A CB    1 
ATOM   3163  C  CG    . LEU A 1 941  ? 123.608 111.839 152.810 1.00 18.27  ?  813  LEU A CG    1 
ATOM   3164  C  CD1   . LEU A 1 941  ? 123.214 113.284 152.880 1.00 18.12  ?  813  LEU A CD1   1 
ATOM   3165  C  CD2   . LEU A 1 941  ? 123.886 111.340 154.194 1.00 11.61  ?  813  LEU A CD2   1 
ATOM   3166  N  N     . ASP A 1 942  ? 123.473 110.793 149.281 1.00 21.82  ?  814  ASP A N     1 
ATOM   3167  C  CA    . ASP A 1 942  ? 124.329 111.444 148.307 1.00 22.96  ?  814  ASP A CA    1 
ATOM   3168  C  C     . ASP A 1 942  ? 124.928 112.704 148.929 1.00 27.53  ?  814  ASP A C     1 
ATOM   3169  O  O     . ASP A 1 942  ? 124.372 113.294 149.858 1.00 26.27  ?  814  ASP A O     1 
ATOM   3170  C  CB    . ASP A 1 942  ? 123.508 111.777 147.053 1.00 31.61  ?  814  ASP A CB    1 
ATOM   3171  C  CG    . ASP A 1 942  ? 124.045 112.959 146.281 1.00 46.82  ?  814  ASP A CG    1 
ATOM   3172  O  OD1   . ASP A 1 942  ? 125.278 113.106 146.169 1.00 40.82  ?  814  ASP A OD1   1 
ATOM   3173  O  OD2   . ASP A 1 942  ? 123.221 113.763 145.807 1.00 66.30  -1 814  ASP A OD2   1 
ATOM   3174  N  N     . ALA A 1 943  ? 126.098 113.093 148.429 1.00 35.29  ?  815  ALA A N     1 
ATOM   3175  C  CA    . ALA A 1 943  ? 126.760 114.322 148.850 1.00 39.64  ?  815  ALA A CA    1 
ATOM   3176  C  C     . ALA A 1 943  ? 126.256 115.533 148.076 1.00 39.20  ?  815  ALA A C     1 
ATOM   3177  O  O     . ALA A 1 943  ? 126.114 116.619 148.644 1.00 47.03  ?  815  ALA A O     1 
ATOM   3178  C  CB    . ALA A 1 943  ? 128.278 114.196 148.672 1.00 42.21  ?  815  ALA A CB    1 
ATOM   3179  N  N     . LEU A 1 944  ? 125.987 115.364 146.781 1.00 40.91  ?  816  LEU A N     1 
ATOM   3180  C  CA    . LEU A 1 944  ? 125.551 116.487 145.960 1.00 44.30  ?  816  LEU A CA    1 
ATOM   3181  C  C     . LEU A 1 944  ? 124.166 116.987 146.362 1.00 54.09  ?  816  LEU A C     1 
ATOM   3182  O  O     . LEU A 1 944  ? 123.976 118.183 146.606 1.00 52.75  ?  816  LEU A O     1 
ATOM   3183  C  CB    . LEU A 1 944  ? 125.550 116.086 144.488 1.00 47.03  ?  816  LEU A CB    1 
ATOM   3184  C  CG    . LEU A 1 944  ? 124.729 117.023 143.593 1.00 48.38  ?  816  LEU A CG    1 
ATOM   3185  C  CD1   . LEU A 1 944  ? 125.361 118.399 143.519 1.00 57.31  ?  816  LEU A CD1   1 
ATOM   3186  C  CD2   . LEU A 1 944  ? 124.476 116.448 142.205 1.00 52.25  ?  816  LEU A CD2   1 
ATOM   3187  N  N     . HIS A 1 945  ? 123.168 116.095 146.385 1.00 53.28  ?  817  HIS A N     1 
ATOM   3188  C  CA    . HIS A 1 945  ? 121.795 116.568 146.539 1.00 52.97  ?  817  HIS A CA    1 
ATOM   3189  C  C     . HIS A 1 945  ? 121.515 117.116 147.935 1.00 48.81  ?  817  HIS A C     1 
ATOM   3190  O  O     . HIS A 1 945  ? 120.569 117.890 148.093 1.00 46.42  ?  817  HIS A O     1 
ATOM   3191  C  CB    . HIS A 1 945  ? 120.770 115.478 146.198 1.00 50.36  ?  817  HIS A CB    1 
ATOM   3192  C  CG    . HIS A 1 945  ? 120.893 114.920 144.814 1.00 44.82  ?  817  HIS A CG    1 
ATOM   3193  N  ND1   . HIS A 1 945  ? 121.911 114.074 144.433 1.00 48.35  ?  817  HIS A ND1   1 
ATOM   3194  C  CD2   . HIS A 1 945  ? 120.127 115.103 143.713 1.00 47.40  ?  817  HIS A CD2   1 
ATOM   3195  C  CE1   . HIS A 1 945  ? 121.761 113.745 143.164 1.00 45.99  ?  817  HIS A CE1   1 
ATOM   3196  N  NE2   . HIS A 1 945  ? 120.688 114.360 142.702 1.00 54.25  ?  817  HIS A NE2   1 
ATOM   3197  N  N     . CYS A 1 946  ? 122.309 116.753 148.949 1.00 48.18  ?  818  CYS A N     1 
ATOM   3198  C  CA    . CYS A 1 946  ? 122.276 117.513 150.196 1.00 52.16  ?  818  CYS A CA    1 
ATOM   3199  C  C     . CYS A 1 946  ? 122.576 118.979 149.920 1.00 50.21  ?  818  CYS A C     1 
ATOM   3200  O  O     . CYS A 1 946  ? 121.837 119.878 150.340 1.00 43.13  ?  818  CYS A O     1 
ATOM   3201  C  CB    . CYS A 1 946  ? 123.285 116.937 151.191 1.00 56.70  ?  818  CYS A CB    1 
ATOM   3202  S  SG    . CYS A 1 946  ? 124.900 117.753 151.192 1.00 94.29  ?  818  CYS A SG    1 
ATOM   3203  N  N     . ASP A 1 947  ? 123.670 119.227 149.204 1.00 48.89  ?  819  ASP A N     1 
ATOM   3204  C  CA    . ASP A 1 947  ? 124.021 120.580 148.794 1.00 48.62  ?  819  ASP A CA    1 
ATOM   3205  C  C     . ASP A 1 947  ? 122.882 121.229 148.010 1.00 45.99  ?  819  ASP A C     1 
ATOM   3206  O  O     . ASP A 1 947  ? 122.535 122.388 148.248 1.00 45.96  ?  819  ASP A O     1 
ATOM   3207  C  CB    . ASP A 1 947  ? 125.308 120.524 147.968 1.00 64.45  ?  819  ASP A CB    1 
ATOM   3208  C  CG    . ASP A 1 947  ? 126.194 121.747 148.150 1.00 93.38  ?  819  ASP A CG    1 
ATOM   3209  O  OD1   . ASP A 1 947  ? 125.668 122.875 148.214 1.00 81.22  ?  819  ASP A OD1   1 
ATOM   3210  O  OD2   . ASP A 1 947  ? 127.433 121.574 148.211 1.00 209.18 -1 819  ASP A OD2   1 
ATOM   3211  N  N     . ILE A 1 948  ? 122.261 120.478 147.094 1.00 41.45  ?  820  ILE A N     1 
ATOM   3212  C  CA    . ILE A 1 948  ? 121.215 121.041 146.232 1.00 35.72  ?  820  ILE A CA    1 
ATOM   3213  C  C     . ILE A 1 948  ? 119.994 121.442 147.049 1.00 39.19  ?  820  ILE A C     1 
ATOM   3214  O  O     . ILE A 1 948  ? 119.444 122.539 146.888 1.00 40.95  ?  820  ILE A O     1 
ATOM   3215  C  CB    . ILE A 1 948  ? 120.832 120.041 145.126 1.00 35.16  ?  820  ILE A CB    1 
ATOM   3216  C  CG1   . ILE A 1 948  ? 121.925 119.947 144.062 1.00 44.35  ?  820  ILE A CG1   1 
ATOM   3217  C  CG2   . ILE A 1 948  ? 119.500 120.415 144.500 1.00 32.27  ?  820  ILE A CG2   1 
ATOM   3218  C  CD1   . ILE A 1 948  ? 121.616 118.939 142.961 1.00 47.82  ?  820  ILE A CD1   1 
ATOM   3219  N  N     . GLY A 1 949  ? 119.520 120.534 147.899 1.00 41.01  ?  821  GLY A N     1 
ATOM   3220  C  CA    . GLY A 1 949  ? 118.363 120.840 148.715 1.00 40.13  ?  821  GLY A CA    1 
ATOM   3221  C  C     . GLY A 1 949  ? 118.627 121.978 149.677 1.00 32.20  ?  821  GLY A C     1 
ATOM   3222  O  O     . GLY A 1 949  ? 117.776 122.846 149.879 1.00 35.51  ?  821  GLY A O     1 
ATOM   3223  N  N     . ASN A 1 950  ? 119.808 121.981 150.296 1.00 33.26  ?  822  ASN A N     1 
ATOM   3224  C  CA    . ASN A 1 950  ? 120.175 123.098 151.152 1.00 35.13  ?  822  ASN A CA    1 
ATOM   3225  C  C     . ASN A 1 950  ? 120.179 124.401 150.367 1.00 40.18  ?  822  ASN A C     1 
ATOM   3226  O  O     . ASN A 1 950  ? 119.729 125.439 150.867 1.00 45.44  ?  822  ASN A O     1 
ATOM   3227  C  CB    . ASN A 1 950  ? 121.539 122.837 151.782 1.00 39.59  ?  822  ASN A CB    1 
ATOM   3228  C  CG    . ASN A 1 950  ? 121.545 121.625 152.705 1.00 44.83  ?  822  ASN A CG    1 
ATOM   3229  O  OD1   . ASN A 1 950  ? 120.630 120.797 152.683 1.00 35.93  ?  822  ASN A OD1   1 
ATOM   3230  N  ND2   . ASN A 1 950  ? 122.599 121.502 153.504 1.00 47.96  ?  822  ASN A ND2   1 
ATOM   3231  N  N     . ALA A 1 951  ? 120.672 124.360 149.128 1.00 39.23  ?  823  ALA A N     1 
ATOM   3232  C  CA    . ALA A 1 951  ? 120.714 125.552 148.296 1.00 45.50  ?  823  ALA A CA    1 
ATOM   3233  C  C     . ALA A 1 951  ? 119.313 126.073 148.019 1.00 44.88  ?  823  ALA A C     1 
ATOM   3234  O  O     . ALA A 1 951  ? 119.039 127.266 148.189 1.00 42.40  ?  823  ALA A O     1 
ATOM   3235  C  CB    . ALA A 1 951  ? 121.443 125.240 146.991 1.00 53.96  ?  823  ALA A CB    1 
ATOM   3236  N  N     . THR A 1 952  ? 118.414 125.192 147.571 1.00 42.32  ?  824  THR A N     1 
ATOM   3237  C  CA    . THR A 1 952  ? 117.058 125.634 147.256 1.00 39.24  ?  824  THR A CA    1 
ATOM   3238  C  C     . THR A 1 952  ? 116.315 126.082 148.505 1.00 45.38  ?  824  THR A C     1 
ATOM   3239  O  O     . THR A 1 952  ? 115.510 127.022 148.446 1.00 48.90  ?  824  THR A O     1 
ATOM   3240  C  CB    . THR A 1 952  ? 116.279 124.537 146.524 1.00 37.79  ?  824  THR A CB    1 
ATOM   3241  O  OG1   . THR A 1 952  ? 114.998 125.044 146.119 1.00 41.31  ?  824  THR A OG1   1 
ATOM   3242  C  CG2   . THR A 1 952  ? 116.072 123.327 147.389 1.00 39.60  ?  824  THR A CG2   1 
ATOM   3243  N  N     . GLU A 1 953  ? 116.605 125.467 149.647 1.00 39.85  ?  825  GLU A N     1 
ATOM   3244  C  CA    . GLU A 1 953  ? 115.937 125.879 150.869 1.00 45.14  ?  825  GLU A CA    1 
ATOM   3245  C  C     . GLU A 1 953  ? 116.412 127.253 151.320 1.00 46.72  ?  825  GLU A C     1 
ATOM   3246  O  O     . GLU A 1 953  ? 115.601 128.088 151.733 1.00 48.25  ?  825  GLU A O     1 
ATOM   3247  C  CB    . GLU A 1 953  ? 116.162 124.840 151.963 1.00 50.83  ?  825  GLU A CB    1 
ATOM   3248  C  CG    . GLU A 1 953  ? 115.364 125.122 153.223 1.00 70.62  ?  825  GLU A CG    1 
ATOM   3249  C  CD    . GLU A 1 953  ? 113.860 125.009 153.019 1.00 87.51  ?  825  GLU A CD    1 
ATOM   3250  O  OE1   . GLU A 1 953  ? 113.431 124.481 151.973 1.00 74.83  ?  825  GLU A OE1   1 
ATOM   3251  O  OE2   . GLU A 1 953  ? 113.107 125.493 153.894 1.00 164.40 -1 825  GLU A OE2   1 
ATOM   3252  N  N     . PHE A 1 954  ? 117.719 127.506 151.252 1.00 40.17  ?  826  PHE A N     1 
ATOM   3253  C  CA    . PHE A 1 954  ? 118.226 128.832 151.582 1.00 40.75  ?  826  PHE A CA    1 
ATOM   3254  C  C     . PHE A 1 954  ? 117.711 129.870 150.598 1.00 45.79  ?  826  PHE A C     1 
ATOM   3255  O  O     . PHE A 1 954  ? 117.386 130.998 150.986 1.00 53.72  ?  826  PHE A O     1 
ATOM   3256  C  CB    . PHE A 1 954  ? 119.752 128.818 151.605 1.00 39.96  ?  826  PHE A CB    1 
ATOM   3257  C  CG    . PHE A 1 954  ? 120.332 128.167 152.825 1.00 43.22  ?  826  PHE A CG    1 
ATOM   3258  C  CD1   . PHE A 1 954  ? 119.510 127.750 153.849 1.00 42.28  ?  826  PHE A CD1   1 
ATOM   3259  C  CD2   . PHE A 1 954  ? 121.697 127.969 152.948 1.00 41.75  ?  826  PHE A CD2   1 
ATOM   3260  C  CE1   . PHE A 1 954  ? 120.033 127.159 154.971 1.00 43.39  ?  826  PHE A CE1   1 
ATOM   3261  C  CE2   . PHE A 1 954  ? 122.221 127.370 154.073 1.00 46.63  ?  826  PHE A CE2   1 
ATOM   3262  C  CZ    . PHE A 1 954  ? 121.388 126.969 155.080 1.00 45.52  ?  826  PHE A CZ    1 
ATOM   3263  N  N     . TYR A 1 955  ? 117.624 129.501 149.319 1.00 44.69  ?  827  TYR A N     1 
ATOM   3264  C  CA    . TYR A 1 955  ? 117.081 130.394 148.301 1.00 48.96  ?  827  TYR A CA    1 
ATOM   3265  C  C     . TYR A 1 955  ? 115.659 130.811 148.658 1.00 53.83  ?  827  TYR A C     1 
ATOM   3266  O  O     . TYR A 1 955  ? 115.319 132.004 148.655 1.00 56.35  ?  827  TYR A O     1 
ATOM   3267  C  CB    . TYR A 1 955  ? 117.127 129.679 146.946 1.00 49.17  ?  827  TYR A CB    1 
ATOM   3268  C  CG    . TYR A 1 955  ? 116.724 130.478 145.717 1.00 59.36  ?  827  TYR A CG    1 
ATOM   3269  C  CD1   . TYR A 1 955  ? 115.387 130.639 145.375 1.00 62.78  ?  827  TYR A CD1   1 
ATOM   3270  C  CD2   . TYR A 1 955  ? 117.681 131.007 144.860 1.00 56.21  ?  827  TYR A CD2   1 
ATOM   3271  C  CE1   . TYR A 1 955  ? 115.014 131.346 144.240 1.00 65.09  ?  827  TYR A CE1   1 
ATOM   3272  C  CE2   . TYR A 1 955  ? 117.316 131.713 143.719 1.00 59.49  ?  827  TYR A CE2   1 
ATOM   3273  C  CZ    . TYR A 1 955  ? 115.982 131.878 143.416 1.00 63.05  ?  827  TYR A CZ    1 
ATOM   3274  O  OH    . TYR A 1 955  ? 115.614 132.575 142.289 1.00 69.41  ?  827  TYR A OH    1 
ATOM   3275  N  N     . LYS A 1 956  ? 114.820 129.835 149.008 1.00 48.20  ?  828  LYS A N     1 
ATOM   3276  C  CA    . LYS A 1 956  ? 113.442 130.158 149.361 1.00 55.84  ?  828  LYS A CA    1 
ATOM   3277  C  C     . LYS A 1 956  ? 113.366 130.936 150.670 1.00 59.36  ?  828  LYS A C     1 
ATOM   3278  O  O     . LYS A 1 956  ? 112.529 131.836 150.815 1.00 65.82  ?  828  LYS A O     1 
ATOM   3279  C  CB    . LYS A 1 956  ? 112.603 128.888 149.452 1.00 55.89  ?  828  LYS A CB    1 
ATOM   3280  C  CG    . LYS A 1 956  ? 112.236 128.265 148.111 1.00 51.90  ?  828  LYS A CG    1 
ATOM   3281  C  CD    . LYS A 1 956  ? 111.421 127.005 148.341 1.00 55.29  ?  828  LYS A CD    1 
ATOM   3282  C  CE    . LYS A 1 956  ? 110.262 127.310 149.280 1.00 57.65  ?  828  LYS A CE    1 
ATOM   3283  N  NZ    . LYS A 1 956  ? 109.549 126.092 149.740 1.00 56.43  ?  828  LYS A NZ    1 
ATOM   3284  N  N     . ILE A 1 957  ? 114.221 130.602 151.643 1.00 54.16  ?  829  ILE A N     1 
ATOM   3285  C  CA    . ILE A 1 957  ? 114.168 131.304 152.921 1.00 53.88  ?  829  ILE A CA    1 
ATOM   3286  C  C     . ILE A 1 957  ? 114.588 132.761 152.738 1.00 60.27  ?  829  ILE A C     1 
ATOM   3287  O  O     . ILE A 1 957  ? 114.070 133.654 153.417 1.00 67.75  ?  829  ILE A O     1 
ATOM   3288  C  CB    . ILE A 1 957  ? 115.011 130.557 153.982 1.00 45.23  ?  829  ILE A CB    1 
ATOM   3289  C  CG1   . ILE A 1 957  ? 114.325 130.602 155.350 1.00 47.89  ?  829  ILE A CG1   1 
ATOM   3290  C  CG2   . ILE A 1 957  ? 116.411 131.115 154.089 1.00 49.04  ?  829  ILE A CG2   1 
ATOM   3291  C  CD1   . ILE A 1 957  ? 115.013 129.777 156.440 1.00 43.04  ?  829  ILE A CD1   1 
ATOM   3292  N  N     . PHE A 1 958  ? 115.483 133.034 151.782 1.00 57.22  ?  830  PHE A N     1 
ATOM   3293  C  CA    . PHE A 1 958  ? 115.829 134.415 151.463 1.00 54.84  ?  830  PHE A CA    1 
ATOM   3294  C  C     . PHE A 1 958  ? 114.663 135.114 150.782 1.00 61.20  ?  830  PHE A C     1 
ATOM   3295  O  O     . PHE A 1 958  ? 114.322 136.257 151.123 1.00 68.02  ?  830  PHE A O     1 
ATOM   3296  C  CB    . PHE A 1 958  ? 117.055 134.459 150.551 1.00 54.64  ?  830  PHE A CB    1 
ATOM   3297  C  CG    . PHE A 1 958  ? 118.299 133.869 151.156 1.00 54.94  ?  830  PHE A CG    1 
ATOM   3298  C  CD1   . PHE A 1 958  ? 118.431 133.726 152.522 1.00 57.29  ?  830  PHE A CD1   1 
ATOM   3299  C  CD2   . PHE A 1 958  ? 119.332 133.430 150.346 1.00 55.14  ?  830  PHE A CD2   1 
ATOM   3300  C  CE1   . PHE A 1 958  ? 119.575 133.176 153.059 1.00 60.61  ?  830  PHE A CE1   1 
ATOM   3301  C  CE2   . PHE A 1 958  ? 120.473 132.875 150.888 1.00 57.43  ?  830  PHE A CE2   1 
ATOM   3302  C  CZ    . PHE A 1 958  ? 120.591 132.750 152.239 1.00 59.96  ?  830  PHE A CZ    1 
ATOM   3303  N  N     . GLN A 1 959  ? 114.050 134.437 149.804 1.00 63.05  ?  831  GLN A N     1 
ATOM   3304  C  CA    . GLN A 1 959  ? 112.874 134.982 149.132 1.00 75.21  ?  831  GLN A CA    1 
ATOM   3305  C  C     . GLN A 1 959  ? 111.785 135.356 150.134 1.00 83.05  ?  831  GLN A C     1 
ATOM   3306  O  O     . GLN A 1 959  ? 111.040 136.321 149.927 1.00 85.03  ?  831  GLN A O     1 
ATOM   3307  C  CB    . GLN A 1 959  ? 112.345 133.968 148.114 1.00 70.50  ?  831  GLN A CB    1 
ATOM   3308  C  CG    . GLN A 1 959  ? 111.195 134.479 147.267 1.00 84.28  ?  831  GLN A CG    1 
ATOM   3309  C  CD    . GLN A 1 959  ? 110.619 133.421 146.340 1.00 85.06  ?  831  GLN A CD    1 
ATOM   3310  O  OE1   . GLN A 1 959  ? 111.259 132.406 146.053 1.00 75.13  ?  831  GLN A OE1   1 
ATOM   3311  N  NE2   . GLN A 1 959  ? 109.402 133.660 145.862 1.00 92.20  ?  831  GLN A NE2   1 
ATOM   3312  N  N     . ASP A 1 960  ? 111.684 134.597 151.227 1.00 80.15  ?  832  ASP A N     1 
ATOM   3313  C  CA    . ASP A 1 960  ? 110.675 134.873 152.246 1.00 88.09  ?  832  ASP A CA    1 
ATOM   3314  C  C     . ASP A 1 960  ? 111.103 135.987 153.203 1.00 84.47  ?  832  ASP A C     1 
ATOM   3315  O  O     . ASP A 1 960  ? 110.286 136.846 153.554 1.00 82.52  ?  832  ASP A O     1 
ATOM   3316  C  CB    . ASP A 1 960  ? 110.353 133.592 153.025 1.00 93.86  ?  832  ASP A CB    1 
ATOM   3317  C  CG    . ASP A 1 960  ? 109.775 132.481 152.137 1.00 103.04 ?  832  ASP A CG    1 
ATOM   3318  O  OD1   . ASP A 1 960  ? 108.892 132.768 151.299 1.00 96.78  ?  832  ASP A OD1   1 
ATOM   3319  O  OD2   . ASP A 1 960  ? 110.203 131.313 152.281 1.00 152.13 -1 832  ASP A OD2   1 
ATOM   3320  N  N     . GLU A 1 961  ? 112.368 136.002 153.631 1.00 78.30  ?  833  GLU A N     1 
ATOM   3321  C  CA    . GLU A 1 961  ? 112.841 137.028 154.556 1.00 76.80  ?  833  GLU A CA    1 
ATOM   3322  C  C     . GLU A 1 961  ? 113.058 138.379 153.894 1.00 74.73  ?  833  GLU A C     1 
ATOM   3323  O  O     . GLU A 1 961  ? 113.324 139.357 154.600 1.00 76.89  ?  833  GLU A O     1 
ATOM   3324  C  CB    . GLU A 1 961  ? 114.142 136.572 155.226 1.00 74.85  ?  833  GLU A CB    1 
ATOM   3325  C  CG    . GLU A 1 961  ? 114.015 135.319 156.063 1.00 79.45  ?  833  GLU A CG    1 
ATOM   3326  C  CD    . GLU A 1 961  ? 113.122 135.502 157.268 1.00 93.36  ?  833  GLU A CD    1 
ATOM   3327  O  OE1   . GLU A 1 961  ? 113.042 136.635 157.787 1.00 92.03  ?  833  GLU A OE1   1 
ATOM   3328  O  OE2   . GLU A 1 961  ? 112.479 134.514 157.679 1.00 142.39 -1 833  GLU A OE2   1 
ATOM   3329  N  N     . ILE A 1 962  ? 112.973 138.455 152.565 1.00 73.99  ?  834  ILE A N     1 
ATOM   3330  C  CA    . ILE A 1 962  ? 112.895 139.759 151.908 1.00 77.98  ?  834  ILE A CA    1 
ATOM   3331  C  C     . ILE A 1 962  ? 111.694 140.542 152.423 1.00 87.14  ?  834  ILE A C     1 
ATOM   3332  O  O     . ILE A 1 962  ? 111.810 141.716 152.798 1.00 90.37  ?  834  ILE A O     1 
ATOM   3333  C  CB    . ILE A 1 962  ? 112.838 139.586 150.380 1.00 75.78  ?  834  ILE A CB    1 
ATOM   3334  C  CG1   . ILE A 1 962  ? 114.240 139.403 149.806 1.00 78.09  ?  834  ILE A CG1   1 
ATOM   3335  C  CG2   . ILE A 1 962  ? 112.154 140.776 149.723 1.00 75.14  ?  834  ILE A CG2   1 
ATOM   3336  C  CD1   . ILE A 1 962  ? 115.027 140.672 149.743 1.00 78.02  ?  834  ILE A CD1   1 
ATOM   3337  N  N     . GLY A 1 963  ? 110.533 139.909 152.464 1.00 89.49  ?  835  GLY A N     1 
ATOM   3338  C  CA    . GLY A 1 963  ? 109.323 140.533 152.964 1.00 96.65  ?  835  GLY A CA    1 
ATOM   3339  C  C     . GLY A 1 963  ? 109.197 140.399 154.463 1.00 106.47 ?  835  GLY A C     1 
ATOM   3340  O  O     . GLY A 1 963  ? 110.187 140.428 155.200 1.00 107.82 ?  835  GLY A O     1 
ATOM   3341  N  N     . GLU A 1 964  ? 107.958 140.259 154.925 1.00 110.57 ?  836  GLU A N     1 
ATOM   3342  C  CA    . GLU A 1 964  ? 107.676 140.056 156.341 1.00 113.72 ?  836  GLU A CA    1 
ATOM   3343  C  C     . GLU A 1 964  ? 106.638 138.950 156.471 1.00 99.94  ?  836  GLU A C     1 
ATOM   3344  O  O     . GLU A 1 964  ? 105.525 139.077 155.954 1.00 96.41  ?  836  GLU A O     1 
ATOM   3345  C  CB    . GLU A 1 964  ? 107.194 141.355 157.001 1.00 127.17 ?  836  GLU A CB    1 
ATOM   3346  C  CG    . GLU A 1 964  ? 108.194 142.526 156.931 1.00 144.51 ?  836  GLU A CG    1 
ATOM   3347  C  CD    . GLU A 1 964  ? 109.454 142.311 157.763 1.00 150.93 ?  836  GLU A CD    1 
ATOM   3348  O  OE1   . GLU A 1 964  ? 109.451 141.420 158.636 1.00 131.22 ?  836  GLU A OE1   1 
ATOM   3349  O  OE2   . GLU A 1 964  ? 110.447 143.043 157.546 1.00 231.39 -1 836  GLU A OE2   1 
ATOM   3350  N  N     . VAL A 1 965  ? 107.006 137.864 157.150 1.00 92.72  ?  837  VAL A N     1 
ATOM   3351  C  CA    . VAL A 1 965  ? 106.139 136.699 157.273 1.00 86.75  ?  837  VAL A CA    1 
ATOM   3352  C  C     . VAL A 1 965  ? 105.798 136.444 158.736 1.00 91.55  ?  837  VAL A C     1 
ATOM   3353  O  O     . VAL A 1 965  ? 104.739 135.888 159.045 1.00 92.31  ?  837  VAL A O     1 
ATOM   3354  C  CB    . VAL A 1 965  ? 106.780 135.463 156.618 1.00 78.59  ?  837  VAL A CB    1 
ATOM   3355  C  CG1   . VAL A 1 965  ? 106.815 135.633 155.109 1.00 75.61  ?  837  VAL A CG1   1 
ATOM   3356  C  CG2   . VAL A 1 965  ? 108.183 135.251 157.152 1.00 78.33  ?  837  VAL A CG2   1 
ATOM   3357  N  N     . TYR A 1 966  ? 106.688 136.843 159.647 1.00 95.72  ?  838  TYR A N     1 
ATOM   3358  C  CA    . TYR A 1 966  ? 106.350 136.889 161.065 1.00 100.02 ?  838  TYR A CA    1 
ATOM   3359  C  C     . TYR A 1 966  ? 105.594 138.163 161.425 1.00 105.22 ?  838  TYR A C     1 
ATOM   3360  O  O     . TYR A 1 966  ? 104.978 138.228 162.496 1.00 100.79 ?  838  TYR A O     1 
ATOM   3361  C  CB    . TYR A 1 966  ? 107.620 136.750 161.911 1.00 95.85  ?  838  TYR A CB    1 
ATOM   3362  C  CG    . TYR A 1 966  ? 108.796 137.497 161.334 1.00 95.06  ?  838  TYR A CG    1 
ATOM   3363  C  CD1   . TYR A 1 966  ? 109.002 138.836 161.618 1.00 97.65  ?  838  TYR A CD1   1 
ATOM   3364  C  CD2   . TYR A 1 966  ? 109.670 136.871 160.456 1.00 92.33  ?  838  TYR A CD2   1 
ATOM   3365  C  CE1   . TYR A 1 966  ? 110.066 139.523 161.072 1.00 102.62 ?  838  TYR A CE1   1 
ATOM   3366  C  CE2   . TYR A 1 966  ? 110.733 137.550 159.900 1.00 93.92  ?  838  TYR A CE2   1 
ATOM   3367  C  CZ    . TYR A 1 966  ? 110.928 138.875 160.211 1.00 102.21 ?  838  TYR A CZ    1 
ATOM   3368  O  OH    . TYR A 1 966  ? 111.988 139.558 159.662 1.00 108.85 ?  838  TYR A OH    1 
ATOM   3369  N  N     . GLN A 1 967  ? 105.632 139.174 160.553 1.00 106.89 ?  839  GLN A N     1 
ATOM   3370  C  CA    . GLN A 1 967  ? 104.751 140.333 160.635 1.00 104.85 ?  839  GLN A CA    1 
ATOM   3371  C  C     . GLN A 1 967  ? 103.470 140.113 159.837 1.00 107.42 ?  839  GLN A C     1 
ATOM   3372  O  O     . GLN A 1 967  ? 102.397 140.565 160.250 1.00 105.02 ?  839  GLN A O     1 
ATOM   3373  C  CB    . GLN A 1 967  ? 105.477 141.588 160.130 1.00 100.39 ?  839  GLN A CB    1 
ATOM   3374  C  CG    . GLN A 1 967  ? 106.947 141.687 160.515 1.00 97.74  ?  839  GLN A CG    1 
ATOM   3375  C  CD    . GLN A 1 967  ? 107.177 142.069 161.961 1.00 87.71  ?  839  GLN A CD    1 
ATOM   3376  O  OE1   . GLN A 1 967  ? 106.236 142.300 162.718 1.00 88.51  ?  839  GLN A OE1   1 
ATOM   3377  N  NE2   . GLN A 1 967  ? 108.443 142.125 162.355 1.00 85.72  ?  839  GLN A NE2   1 
ATOM   3378  N  N     . LYS A 1 968  ? 103.570 139.429 158.698 1.00 104.79 ?  840  LYS A N     1 
ATOM   3379  C  CA    . LYS A 1 968  ? 102.412 139.023 157.895 1.00 102.44 ?  840  LYS A CA    1 
ATOM   3380  C  C     . LYS A 1 968  ? 102.375 137.503 157.782 1.00 101.94 ?  840  LYS A C     1 
ATOM   3381  O  O     . LYS A 1 968  ? 103.091 136.926 156.946 1.00 98.26  ?  840  LYS A O     1 
ATOM   3382  C  CB    . LYS A 1 968  ? 102.461 139.660 156.507 1.00 98.31  ?  840  LYS A CB    1 
ATOM   3383  C  CG    . LYS A 1 968  ? 101.226 139.391 155.669 1.00 101.18 ?  840  LYS A CG    1 
ATOM   3384  C  CD    . LYS A 1 968  ? 101.381 139.894 154.244 1.00 108.14 ?  840  LYS A CD    1 
ATOM   3385  C  CE    . LYS A 1 968  ? 100.103 139.634 153.458 1.00 112.13 ?  840  LYS A CE    1 
ATOM   3386  N  NZ    . LYS A 1 968  ? 99.622  138.235 153.643 1.00 105.56 ?  840  LYS A NZ    1 
ATOM   3387  N  N     . PRO A 1 969  ? 101.531 136.812 158.556 1.00 105.04 ?  841  PRO A N     1 
ATOM   3388  C  CA    . PRO A 1 969  ? 101.684 135.345 158.677 1.00 101.80 ?  841  PRO A CA    1 
ATOM   3389  C  C     . PRO A 1 969  ? 101.497 134.577 157.377 1.00 96.95  ?  841  PRO A C     1 
ATOM   3390  O  O     . PRO A 1 969  ? 102.318 133.708 157.058 1.00 92.56  ?  841  PRO A O     1 
ATOM   3391  C  CB    . PRO A 1 969  ? 100.621 134.978 159.721 1.00 102.06 ?  841  PRO A CB    1 
ATOM   3392  C  CG    . PRO A 1 969  ? 99.608  136.060 159.626 1.00 107.25 ?  841  PRO A CG    1 
ATOM   3393  C  CD    . PRO A 1 969  ? 100.371 137.312 159.311 1.00 109.84 ?  841  PRO A CD    1 
ATOM   3394  N  N     . ASN A 1 970  ? 100.434 134.857 156.623 1.00 95.26  ?  842  ASN A N     1 
ATOM   3395  C  CA    . ASN A 1 970  ? 100.146 134.170 155.365 1.00 91.11  ?  842  ASN A CA    1 
ATOM   3396  C  C     . ASN A 1 970  ? 100.238 135.176 154.226 1.00 93.32  ?  842  ASN A C     1 
ATOM   3397  O  O     . ASN A 1 970  ? 99.235  135.812 153.867 1.00 92.32  ?  842  ASN A O     1 
ATOM   3398  C  CB    . ASN A 1 970  ? 98.769  133.512 155.398 1.00 88.88  ?  842  ASN A CB    1 
ATOM   3399  C  CG    . ASN A 1 970  ? 98.384  132.899 154.064 1.00 85.35  ?  842  ASN A CG    1 
ATOM   3400  O  OD1   . ASN A 1 970  ? 99.239  132.490 153.277 1.00 82.74  ?  842  ASN A OD1   1 
ATOM   3401  N  ND2   . ASN A 1 970  ? 97.082  132.837 153.802 1.00 84.00  ?  842  ASN A ND2   1 
ATOM   3402  N  N     . PRO A 1 971  ? 101.415 135.371 153.642 1.00 95.59  ?  843  PRO A N     1 
ATOM   3403  C  CA    . PRO A 1 971  ? 101.504 136.170 152.412 1.00 103.70 ?  843  PRO A CA    1 
ATOM   3404  C  C     . PRO A 1 971  ? 100.825 135.469 151.236 1.00 102.86 ?  843  PRO A C     1 
ATOM   3405  O  O     . PRO A 1 971  ? 100.463 134.292 151.291 1.00 95.66  ?  843  PRO A O     1 
ATOM   3406  C  CB    . PRO A 1 971  ? 103.015 136.325 152.200 1.00 100.95 ?  843  PRO A CB    1 
ATOM   3407  C  CG    . PRO A 1 971  ? 103.637 135.224 153.003 1.00 94.27  ?  843  PRO A CG    1 
ATOM   3408  C  CD    . PRO A 1 971  ? 102.742 135.005 154.170 1.00 90.56  ?  843  PRO A CD    1 
ATOM   3409  N  N     . SER A 1 972  ? 100.647 136.225 150.150 1.00 106.38 ?  844  SER A N     1 
ATOM   3410  C  CA    . SER A 1 972  ? 99.969  135.744 148.954 1.00 99.32  ?  844  SER A CA    1 
ATOM   3411  C  C     . SER A 1 972  ? 100.984 135.456 147.846 1.00 96.59  ?  844  SER A C     1 
ATOM   3412  O  O     . SER A 1 972  ? 102.184 135.688 147.991 1.00 101.75 ?  844  SER A O     1 
ATOM   3413  C  CB    . SER A 1 972  ? 98.919  136.756 148.488 1.00 101.38 ?  844  SER A CB    1 
ATOM   3414  O  OG    . SER A 1 972  ? 97.904  136.928 149.467 1.00 100.55 ?  844  SER A OG    1 
ATOM   3415  N  N     . ARG A 1 973  ? 100.487 134.956 146.711 1.00 93.80  ?  845  ARG A N     1 
ATOM   3416  C  CA    . ARG A 1 973  ? 101.379 134.454 145.666 1.00 96.79  ?  845  ARG A CA    1 
ATOM   3417  C  C     . ARG A 1 973  ? 102.141 135.579 144.972 1.00 104.03 ?  845  ARG A C     1 
ATOM   3418  O  O     . ARG A 1 973  ? 103.341 135.443 144.682 1.00 104.54 ?  845  ARG A O     1 
ATOM   3419  C  CB    . ARG A 1 973  ? 100.578 133.650 144.644 1.00 96.44  ?  845  ARG A CB    1 
ATOM   3420  C  CG    . ARG A 1 973  ? 101.422 132.732 143.785 1.00 94.62  ?  845  ARG A CG    1 
ATOM   3421  C  CD    . ARG A 1 973  ? 100.601 132.169 142.643 1.00 95.55  ?  845  ARG A CD    1 
ATOM   3422  N  NE    . ARG A 1 973  ? 100.802 130.733 142.489 1.00 87.92  ?  845  ARG A NE    1 
ATOM   3423  C  CZ    . ARG A 1 973  ? 100.050 129.817 143.087 1.00 83.82  ?  845  ARG A CZ    1 
ATOM   3424  N  NH1   . ARG A 1 973  ? 99.051  130.198 143.871 1.00 89.37  ?  845  ARG A NH1   1 
ATOM   3425  N  NH2   . ARG A 1 973  ? 100.294 128.528 142.901 1.00 85.52  ?  845  ARG A NH2   1 
ATOM   3426  N  N     . GLU A 1 974  ? 101.461 136.689 144.675 1.00 111.91 ?  846  GLU A N     1 
ATOM   3427  C  CA    . GLU A 1 974  ? 102.117 137.783 143.965 1.00 121.01 ?  846  GLU A CA    1 
ATOM   3428  C  C     . GLU A 1 974  ? 103.266 138.355 144.783 1.00 117.89 ?  846  GLU A C     1 
ATOM   3429  O  O     . GLU A 1 974  ? 104.311 138.724 144.229 1.00 114.70 ?  846  GLU A O     1 
ATOM   3430  C  CB    . GLU A 1 974  ? 101.102 138.876 143.616 1.00 138.32 ?  846  GLU A CB    1 
ATOM   3431  C  CG    . GLU A 1 974  ? 101.697 140.076 142.880 1.00 155.06 ?  846  GLU A CG    1 
ATOM   3432  C  CD    . GLU A 1 974  ? 102.369 141.081 143.805 1.00 174.72 ?  846  GLU A CD    1 
ATOM   3433  O  OE1   . GLU A 1 974  ? 102.051 141.089 145.013 1.00 155.53 ?  846  GLU A OE1   1 
ATOM   3434  O  OE2   . GLU A 1 974  ? 103.256 141.824 143.335 1.00 287.39 -1 846  GLU A OE2   1 
ATOM   3435  N  N     . GLU A 1 975  ? 103.078 138.469 146.101 1.00 119.34 ?  847  GLU A N     1 
ATOM   3436  C  CA    . GLU A 1 975  ? 104.167 138.901 146.964 1.00 115.46 ?  847  GLU A CA    1 
ATOM   3437  C  C     . GLU A 1 975  ? 105.362 137.968 146.837 1.00 105.80 ?  847  GLU A C     1 
ATOM   3438  O  O     . GLU A 1 975  ? 106.507 138.429 146.860 1.00 102.57 ?  847  GLU A O     1 
ATOM   3439  C  CB    . GLU A 1 975  ? 103.687 138.971 148.414 1.00 110.14 ?  847  GLU A CB    1 
ATOM   3440  C  CG    . GLU A 1 975  ? 102.484 139.876 148.648 1.00 120.46 ?  847  GLU A CG    1 
ATOM   3441  C  CD    . GLU A 1 975  ? 102.100 139.957 150.115 1.00 141.71 ?  847  GLU A CD    1 
ATOM   3442  O  OE1   . GLU A 1 975  ? 102.768 139.299 150.938 1.00 123.64 ?  847  GLU A OE1   1 
ATOM   3443  O  OE2   . GLU A 1 975  ? 101.125 140.664 150.448 1.00 263.22 -1 847  GLU A OE2   1 
ATOM   3444  N  N     . ARG A 1 976  ? 105.113 136.666 146.667 1.00 102.69 ?  848  ARG A N     1 
ATOM   3445  C  CA    . ARG A 1 976  ? 106.202 135.710 146.526 1.00 95.27  ?  848  ARG A CA    1 
ATOM   3446  C  C     . ARG A 1 976  ? 106.943 135.943 145.219 1.00 94.26  ?  848  ARG A C     1 
ATOM   3447  O  O     . ARG A 1 976  ? 108.182 135.941 145.181 1.00 93.12  ?  848  ARG A O     1 
ATOM   3448  C  CB    . ARG A 1 976  ? 105.645 134.288 146.594 1.00 92.59  ?  848  ARG A CB    1 
ATOM   3449  C  CG    . ARG A 1 976  ? 104.791 134.024 147.828 1.00 88.31  ?  848  ARG A CG    1 
ATOM   3450  C  CD    . ARG A 1 976  ? 103.841 132.841 147.644 1.00 83.68  ?  848  ARG A CD    1 
ATOM   3451  N  NE    . ARG A 1 976  ? 102.754 132.877 148.621 1.00 84.77  ?  848  ARG A NE    1 
ATOM   3452  C  CZ    . ARG A 1 976  ? 102.839 132.454 149.876 1.00 84.20  ?  848  ARG A CZ    1 
ATOM   3453  N  NH1   . ARG A 1 976  ? 101.777 132.542 150.668 1.00 84.97  ?  848  ARG A NH1   1 
ATOM   3454  N  NH2   . ARG A 1 976  ? 103.974 131.956 150.351 1.00 75.72  ?  848  ARG A NH2   1 
ATOM   3455  N  N     . ARG A 1 977  ? 106.193 136.151 144.134 1.00 94.07  ?  849  ARG A N     1 
ATOM   3456  C  CA    . ARG A 1 977  ? 106.827 136.440 142.848 1.00 90.36  ?  849  ARG A CA    1 
ATOM   3457  C  C     . ARG A 1 977  ? 107.676 137.706 142.918 1.00 96.37  ?  849  ARG A C     1 
ATOM   3458  O  O     . ARG A 1 977  ? 108.801 137.743 142.399 1.00 96.68  ?  849  ARG A O     1 
ATOM   3459  C  CB    . ARG A 1 977  ? 105.776 136.584 141.747 1.00 93.18  ?  849  ARG A CB    1 
ATOM   3460  C  CG    . ARG A 1 977  ? 105.445 135.298 141.011 1.00 98.78  ?  849  ARG A CG    1 
ATOM   3461  C  CD    . ARG A 1 977  ? 104.604 134.383 141.866 1.00 105.22 ?  849  ARG A CD    1 
ATOM   3462  N  NE    . ARG A 1 977  ? 103.332 134.995 142.231 1.00 107.78 ?  849  ARG A NE    1 
ATOM   3463  C  CZ    . ARG A 1 977  ? 102.264 135.018 141.441 1.00 111.38 ?  849  ARG A CZ    1 
ATOM   3464  N  NH1   . ARG A 1 977  ? 102.312 134.445 140.246 1.00 130.86 ?  849  ARG A NH1   1 
ATOM   3465  N  NH2   . ARG A 1 977  ? 101.141 135.589 141.854 1.00 111.30 ?  849  ARG A NH2   1 
ATOM   3466  N  N     . ARG A 1 978  ? 107.157 138.755 143.565 1.00 104.17 ?  850  ARG A N     1 
ATOM   3467  C  CA    . ARG A 1 978  ? 107.893 140.019 143.643 1.00 111.04 ?  850  ARG A CA    1 
ATOM   3468  C  C     . ARG A 1 978  ? 109.130 139.899 144.525 1.00 107.00 ?  850  ARG A C     1 
ATOM   3469  O  O     . ARG A 1 978  ? 110.177 140.488 144.220 1.00 107.49 ?  850  ARG A O     1 
ATOM   3470  C  CB    . ARG A 1 978  ? 106.988 141.138 144.164 1.00 121.03 ?  850  ARG A CB    1 
ATOM   3471  C  CG    . ARG A 1 978  ? 107.690 142.498 144.250 1.00 118.43 ?  850  ARG A CG    1 
ATOM   3472  C  CD    . ARG A 1 978  ? 106.898 143.524 145.048 1.00 124.11 ?  850  ARG A CD    1 
ATOM   3473  N  NE    . ARG A 1 978  ? 105.487 143.519 144.680 1.00 142.31 ?  850  ARG A NE    1 
ATOM   3474  C  CZ    . ARG A 1 978  ? 105.016 144.023 143.546 1.00 151.34 ?  850  ARG A CZ    1 
ATOM   3475  N  NH1   . ARG A 1 978  ? 105.841 144.574 142.662 1.00 140.36 ?  850  ARG A NH1   1 
ATOM   3476  N  NH2   . ARG A 1 978  ? 103.718 143.971 143.293 1.00 172.01 ?  850  ARG A NH2   1 
ATOM   3477  N  N     . TRP A 1 979  ? 109.017 139.185 145.647 1.00 103.08 ?  851  TRP A N     1 
ATOM   3478  C  CA    . TRP A 1 979  ? 110.175 138.992 146.513 1.00 98.10  ?  851  TRP A CA    1 
ATOM   3479  C  C     . TRP A 1 979  ? 111.251 138.193 145.792 1.00 100.52 ?  851  TRP A C     1 
ATOM   3480  O  O     . TRP A 1 979  ? 112.447 138.488 145.915 1.00 98.49  ?  851  TRP A O     1 
ATOM   3481  C  CB    . TRP A 1 979  ? 109.764 138.296 147.815 1.00 89.34  ?  851  TRP A CB    1 
ATOM   3482  C  CG    . TRP A 1 979  ? 108.745 139.034 148.645 1.00 87.17  ?  851  TRP A CG    1 
ATOM   3483  C  CD1   . TRP A 1 979  ? 108.207 140.260 148.385 1.00 91.36  ?  851  TRP A CD1   1 
ATOM   3484  C  CD2   . TRP A 1 979  ? 108.112 138.566 149.846 1.00 88.76  ?  851  TRP A CD2   1 
ATOM   3485  N  NE1   . TRP A 1 979  ? 107.295 140.593 149.356 1.00 93.87  ?  851  TRP A NE1   1 
ATOM   3486  C  CE2   . TRP A 1 979  ? 107.217 139.570 150.264 1.00 94.11  ?  851  TRP A CE2   1 
ATOM   3487  C  CE3   . TRP A 1 979  ? 108.221 137.401 150.612 1.00 87.22  ?  851  TRP A CE3   1 
ATOM   3488  C  CZ2   . TRP A 1 979  ? 106.437 139.447 151.410 1.00 94.64  ?  851  TRP A CZ2   1 
ATOM   3489  C  CZ3   . TRP A 1 979  ? 107.447 137.281 151.753 1.00 85.87  ?  851  TRP A CZ3   1 
ATOM   3490  C  CH2   . TRP A 1 979  ? 106.567 138.299 152.141 1.00 87.92  ?  851  TRP A CH2   1 
ATOM   3491  N  N     . ARG A 1 980  ? 110.841 137.193 145.010 1.00 97.76  ?  852  ARG A N     1 
ATOM   3492  C  CA    . ARG A 1 980  ? 111.794 136.483 144.166 1.00 98.54  ?  852  ARG A CA    1 
ATOM   3493  C  C     . ARG A 1 980  ? 112.467 137.432 143.186 1.00 101.20 ?  852  ARG A C     1 
ATOM   3494  O  O     . ARG A 1 980  ? 113.687 137.383 142.993 1.00 106.59 ?  852  ARG A O     1 
ATOM   3495  C  CB    . ARG A 1 980  ? 111.087 135.360 143.413 1.00 98.84  ?  852  ARG A CB    1 
ATOM   3496  C  CG    . ARG A 1 980  ? 111.933 134.746 142.328 1.00 103.63 ?  852  ARG A CG    1 
ATOM   3497  C  CD    . ARG A 1 980  ? 111.072 134.183 141.223 1.00 101.23 ?  852  ARG A CD    1 
ATOM   3498  N  NE    . ARG A 1 980  ? 110.461 132.912 141.600 1.00 90.72  ?  852  ARG A NE    1 
ATOM   3499  C  CZ    . ARG A 1 980  ? 109.740 132.166 140.773 1.00 89.16  ?  852  ARG A CZ    1 
ATOM   3500  N  NH1   . ARG A 1 980  ? 109.535 132.575 139.530 1.00 91.83  ?  852  ARG A NH1   1 
ATOM   3501  N  NH2   . ARG A 1 980  ? 109.224 131.020 141.188 1.00 83.48  ?  852  ARG A NH2   1 
ATOM   3502  N  N     . SER A 1 981  ? 111.680 138.301 142.550 1.00 101.72 ?  853  SER A N     1 
ATOM   3503  C  CA    . SER A 1 981  ? 112.237 139.213 141.557 1.00 106.24 ?  853  SER A CA    1 
ATOM   3504  C  C     . SER A 1 981  ? 113.275 140.146 142.174 1.00 111.82 ?  853  SER A C     1 
ATOM   3505  O  O     . SER A 1 981  ? 114.360 140.349 141.610 1.00 116.11 ?  853  SER A O     1 
ATOM   3506  C  CB    . SER A 1 981  ? 111.114 140.014 140.899 1.00 107.20 ?  853  SER A CB    1 
ATOM   3507  O  OG    . SER A 1 981  ? 110.439 140.824 141.844 1.00 107.32 ?  853  SER A OG    1 
ATOM   3508  N  N     . THR A 1 982  ? 112.955 140.739 143.331 1.00 111.96 ?  854  THR A N     1 
ATOM   3509  C  CA    . THR A 1 982  ? 113.917 141.636 143.976 1.00 119.06 ?  854  THR A CA    1 
ATOM   3510  C  C     . THR A 1 982  ? 115.112 140.863 144.520 1.00 118.25 ?  854  THR A C     1 
ATOM   3511  O  O     . THR A 1 982  ? 116.221 141.408 144.597 1.00 118.66 ?  854  THR A O     1 
ATOM   3512  C  CB    . THR A 1 982  ? 113.256 142.466 145.090 1.00 116.26 ?  854  THR A CB    1 
ATOM   3513  O  OG1   . THR A 1 982  ? 114.172 143.471 145.552 1.00 110.92 ?  854  THR A OG1   1 
ATOM   3514  C  CG2   . THR A 1 982  ? 112.860 141.603 146.272 1.00 103.25 ?  854  THR A CG2   1 
ATOM   3515  N  N     . LEU A 1 983  ? 114.918 139.586 144.857 1.00 110.49 ?  855  LEU A N     1 
ATOM   3516  C  CA    . LEU A 1 983  ? 116.043 138.749 145.249 1.00 108.90 ?  855  LEU A CA    1 
ATOM   3517  C  C     . LEU A 1 983  ? 116.984 138.518 144.075 1.00 110.05 ?  855  LEU A C     1 
ATOM   3518  O  O     . LEU A 1 983  ? 118.209 138.538 144.236 1.00 107.02 ?  855  LEU A O     1 
ATOM   3519  C  CB    . LEU A 1 983  ? 115.521 137.421 145.794 1.00 98.12  ?  855  LEU A CB    1 
ATOM   3520  C  CG    . LEU A 1 983  ? 116.532 136.347 146.192 1.00 93.33  ?  855  LEU A CG    1 
ATOM   3521  C  CD1   . LEU A 1 983  ? 117.634 136.936 147.057 1.00 96.20  ?  855  LEU A CD1   1 
ATOM   3522  C  CD2   . LEU A 1 983  ? 115.842 135.188 146.903 1.00 79.60  ?  855  LEU A CD2   1 
ATOM   3523  N  N     . ASP A 1 984  ? 116.425 138.311 142.884 1.00 111.38 ?  856  ASP A N     1 
ATOM   3524  C  CA    . ASP A 1 984  ? 117.253 138.122 141.698 1.00 110.52 ?  856  ASP A CA    1 
ATOM   3525  C  C     . ASP A 1 984  ? 117.968 139.410 141.321 1.00 109.23 ?  856  ASP A C     1 
ATOM   3526  O  O     . ASP A 1 984  ? 119.126 139.382 140.889 1.00 100.46 ?  856  ASP A O     1 
ATOM   3527  C  CB    . ASP A 1 984  ? 116.396 137.632 140.535 1.00 135.63 ?  856  ASP A CB    1 
ATOM   3528  C  CG    . ASP A 1 984  ? 115.448 136.516 140.933 1.00 175.91 ?  856  ASP A CG    1 
ATOM   3529  O  OD1   . ASP A 1 984  ? 115.905 135.512 141.523 1.00 140.57 ?  856  ASP A OD1   1 
ATOM   3530  O  OD2   . ASP A 1 984  ? 114.234 136.647 140.666 1.00 345.48 -1 856  ASP A OD2   1 
ATOM   3531  N  N     . LYS A 1 985  ? 117.284 140.549 141.469 1.00 118.29 ?  857  LYS A N     1 
ATOM   3532  C  CA    . LYS A 1 985  ? 117.940 141.842 141.284 1.00 123.97 ?  857  LYS A CA    1 
ATOM   3533  C  C     . LYS A 1 985  ? 119.116 142.010 142.244 1.00 131.44 ?  857  LYS A C     1 
ATOM   3534  O  O     . LYS A 1 985  ? 120.193 142.464 141.843 1.00 114.65 ?  857  LYS A O     1 
ATOM   3535  C  CB    . LYS A 1 985  ? 116.927 142.977 141.470 1.00 124.78 ?  857  LYS A CB    1 
ATOM   3536  C  CG    . LYS A 1 985  ? 117.537 144.352 141.778 1.00 121.82 ?  857  LYS A CG    1 
ATOM   3537  C  CD    . LYS A 1 985  ? 118.419 144.884 140.647 1.00 114.36 ?  857  LYS A CD    1 
ATOM   3538  C  CE    . LYS A 1 985  ? 119.292 146.046 141.115 1.00 97.76  ?  857  LYS A CE    1 
ATOM   3539  N  NZ    . LYS A 1 985  ? 120.130 146.597 140.009 1.00 85.19  ?  857  LYS A NZ    1 
ATOM   3540  N  N     . GLN A 1 986  ? 118.930 141.658 143.521 1.00 124.71 ?  858  GLN A N     1 
ATOM   3541  C  CA    . GLN A 1 986  ? 120.027 141.784 144.478 1.00 115.02 ?  858  GLN A CA    1 
ATOM   3542  C  C     . GLN A 1 986  ? 121.178 140.846 144.126 1.00 107.21 ?  858  GLN A C     1 
ATOM   3543  O  O     . GLN A 1 986  ? 122.348 141.243 144.175 1.00 97.66  ?  858  GLN A O     1 
ATOM   3544  C  CB    . GLN A 1 986  ? 119.521 141.510 145.893 1.00 106.14 ?  858  GLN A CB    1 
ATOM   3545  C  CG    . GLN A 1 986  ? 120.592 141.627 146.951 1.00 97.47  ?  858  GLN A CG    1 
ATOM   3546  C  CD    . GLN A 1 986  ? 121.193 143.013 147.019 1.00 96.03  ?  858  GLN A CD    1 
ATOM   3547  O  OE1   . GLN A 1 986  ? 120.528 143.966 147.425 1.00 99.09  ?  858  GLN A OE1   1 
ATOM   3548  N  NE2   . GLN A 1 986  ? 122.446 143.140 146.597 1.00 93.86  ?  858  GLN A NE2   1 
ATOM   3549  N  N     . LEU A 1 987  ? 120.863 139.598 143.768 1.00 104.56 ?  859  LEU A N     1 
ATOM   3550  C  CA    . LEU A 1 987  ? 121.873 138.613 143.409 1.00 95.03  ?  859  LEU A CA    1 
ATOM   3551  C  C     . LEU A 1 987  ? 122.550 138.917 142.083 1.00 92.34  ?  859  LEU A C     1 
ATOM   3552  O  O     . LEU A 1 987  ? 123.612 138.352 141.811 1.00 93.24  ?  859  LEU A O     1 
ATOM   3553  C  CB    . LEU A 1 987  ? 121.240 137.223 143.353 1.00 89.99  ?  859  LEU A CB    1 
ATOM   3554  C  CG    . LEU A 1 987  ? 120.650 136.706 144.665 1.00 83.34  ?  859  LEU A CG    1 
ATOM   3555  C  CD1   . LEU A 1 987  ? 119.770 135.487 144.429 1.00 75.66  ?  859  LEU A CD1   1 
ATOM   3556  C  CD2   . LEU A 1 987  ? 121.755 136.390 145.655 1.00 81.90  ?  859  LEU A CD2   1 
ATOM   3557  N  N     . ARG A 1 988  ? 121.960 139.774 141.252 1.00 96.31  ?  860  ARG A N     1 
ATOM   3558  C  CA    . ARG A 1 988  ? 122.562 140.138 139.975 1.00 101.37 ?  860  ARG A CA    1 
ATOM   3559  C  C     . ARG A 1 988  ? 123.377 141.429 140.058 1.00 101.55 ?  860  ARG A C     1 
ATOM   3560  O  O     . ARG A 1 988  ? 124.528 141.463 139.609 1.00 100.14 ?  860  ARG A O     1 
ATOM   3561  C  CB    . ARG A 1 988  ? 121.475 140.271 138.902 1.00 101.84 ?  860  ARG A CB    1 
ATOM   3562  C  CG    . ARG A 1 988  ? 122.017 140.548 137.504 1.00 104.25 ?  860  ARG A CG    1 
ATOM   3563  C  CD    . ARG A 1 988  ? 123.180 139.619 137.162 1.00 107.38 ?  860  ARG A CD    1 
ATOM   3564  N  NE    . ARG A 1 988  ? 123.448 139.532 135.727 1.00 102.79 ?  860  ARG A NE    1 
ATOM   3565  C  CZ    . ARG A 1 988  ? 124.194 140.399 135.045 1.00 98.92  ?  860  ARG A CZ    1 
ATOM   3566  N  NH1   . ARG A 1 988  ? 124.757 141.427 135.665 1.00 102.19 ?  860  ARG A NH1   1 
ATOM   3567  N  NH2   . ARG A 1 988  ? 124.382 140.233 133.743 1.00 90.59  ?  860  ARG A NH2   1 
ATOM   3568  N  N     . LYS A 1 989  ? 122.793 142.497 140.614 1.00 100.31 ?  861  LYS A N     1 
ATOM   3569  C  CA    . LYS A 1 989  ? 123.498 143.772 140.737 1.00 97.07  ?  861  LYS A CA    1 
ATOM   3570  C  C     . LYS A 1 989  ? 124.852 143.582 141.406 1.00 93.92  ?  861  LYS A C     1 
ATOM   3571  O  O     . LYS A 1 989  ? 125.882 144.040 140.899 1.00 88.99  ?  861  LYS A O     1 
ATOM   3572  C  CB    . LYS A 1 989  ? 122.640 144.755 141.534 1.00 99.27  ?  861  LYS A CB    1 
ATOM   3573  C  CG    . LYS A 1 989  ? 123.105 146.205 141.490 1.00 96.15  ?  861  LYS A CG    1 
ATOM   3574  C  CD    . LYS A 1 989  ? 122.402 147.028 142.563 1.00 84.74  ?  861  LYS A CD    1 
ATOM   3575  C  CE    . LYS A 1 989  ? 122.750 146.498 143.949 1.00 84.59  ?  861  LYS A CE    1 
ATOM   3576  N  NZ    . LYS A 1 989  ? 122.130 147.280 145.049 1.00 89.61  ?  861  LYS A NZ    1 
ATOM   3577  N  N     . LYS A 1 990  ? 124.862 142.916 142.553 1.00 92.97  ?  862  LYS A N     1 
ATOM   3578  C  CA    . LYS A 1 990  ? 126.078 142.448 143.192 1.00 89.83  ?  862  LYS A CA    1 
ATOM   3579  C  C     . LYS A 1 990  ? 126.266 140.974 142.872 1.00 91.06  ?  862  LYS A C     1 
ATOM   3580  O  O     . LYS A 1 990  ? 125.303 140.264 142.576 1.00 91.72  ?  862  LYS A O     1 
ATOM   3581  C  CB    . LYS A 1 990  ? 126.031 142.652 144.707 1.00 83.93  ?  862  LYS A CB    1 
ATOM   3582  C  CG    . LYS A 1 990  ? 126.372 144.064 145.145 1.00 86.85  ?  862  LYS A CG    1 
ATOM   3583  C  CD    . LYS A 1 990  ? 126.381 144.203 146.658 1.00 85.19  ?  862  LYS A CD    1 
ATOM   3584  C  CE    . LYS A 1 990  ? 126.767 145.613 147.074 1.00 76.02  ?  862  LYS A CE    1 
ATOM   3585  N  NZ    . LYS A 1 990  ? 128.140 145.964 146.614 1.00 70.20  ?  862  LYS A NZ    1 
ATOM   3586  N  N     . MET A 1 991  ? 127.526 140.540 142.882 1.00 91.96  ?  863  MET A N     1 
ATOM   3587  C  CA    . MET A 1 991  ? 127.917 139.146 142.686 1.00 92.88  ?  863  MET A CA    1 
ATOM   3588  C  C     . MET A 1 991  ? 127.754 138.684 141.243 1.00 99.42  ?  863  MET A C     1 
ATOM   3589  O  O     . MET A 1 991  ? 128.261 137.621 140.878 1.00 100.42 ?  863  MET A O     1 
ATOM   3590  C  CB    . MET A 1 991  ? 127.124 138.230 143.623 1.00 89.65  ?  863  MET A CB    1 
ATOM   3591  C  CG    . MET A 1 991  ? 127.323 138.516 145.094 1.00 89.05  ?  863  MET A CG    1 
ATOM   3592  S  SD    . MET A 1 991  ? 128.940 137.960 145.654 1.00 94.30  ?  863  MET A SD    1 
ATOM   3593  C  CE    . MET A 1 991  ? 128.836 136.212 145.273 1.00 80.45  ?  863  MET A CE    1 
ATOM   3594  N  N     . LYS A 1 992  ? 127.084 139.487 140.417 1.00 101.86 ?  864  LYS A N     1 
ATOM   3595  C  CA    . LYS A 1 992  ? 126.893 139.234 138.985 1.00 108.43 ?  864  LYS A CA    1 
ATOM   3596  C  C     . LYS A 1 992  ? 126.374 137.814 138.725 1.00 111.89 ?  864  LYS A C     1 
ATOM   3597  O  O     . LYS A 1 992  ? 127.016 137.000 138.060 1.00 113.38 ?  864  LYS A O     1 
ATOM   3598  C  CB    . LYS A 1 992  ? 128.190 139.497 138.208 1.00 108.90 ?  864  LYS A CB    1 
ATOM   3599  C  CG    . LYS A 1 992  ? 128.619 140.968 138.126 1.00 103.31 ?  864  LYS A CG    1 
ATOM   3600  C  CD    . LYS A 1 992  ? 127.684 141.820 137.271 1.00 99.19  ?  864  LYS A CD    1 
ATOM   3601  C  CE    . LYS A 1 992  ? 128.243 143.224 137.091 1.00 86.75  ?  864  LYS A CE    1 
ATOM   3602  N  NZ    . LYS A 1 992  ? 129.544 143.175 136.372 1.00 77.47  ?  864  LYS A NZ    1 
ATOM   3603  N  N     . LEU A 1 993  ? 125.180 137.530 139.247 1.00 107.37 ?  865  LEU A N     1 
ATOM   3604  C  CA    . LEU A 1 993  ? 124.603 136.191 139.197 1.00 104.11 ?  865  LEU A CA    1 
ATOM   3605  C  C     . LEU A 1 993  ? 123.240 136.218 138.519 1.00 100.69 ?  865  LEU A C     1 
ATOM   3606  O  O     . LEU A 1 993  ? 122.372 137.014 138.893 1.00 101.28 ?  865  LEU A O     1 
ATOM   3607  C  CB    . LEU A 1 993  ? 124.481 135.611 140.607 1.00 102.43 ?  865  LEU A CB    1 
ATOM   3608  C  CG    . LEU A 1 993  ? 125.804 135.595 141.371 1.00 98.79  ?  865  LEU A CG    1 
ATOM   3609  C  CD1   . LEU A 1 993  ? 125.625 135.125 142.811 1.00 96.00  ?  865  LEU A CD1   1 
ATOM   3610  C  CD2   . LEU A 1 993  ? 126.822 134.749 140.621 1.00 88.05  ?  865  LEU A CD2   1 
ATOM   3611  N  N     . LYS A 1 994  ? 123.043 135.311 137.544 1.00 93.63  ?  866  LYS A N     1 
ATOM   3612  C  CA    . LYS A 1 994  ? 121.844 135.202 136.724 1.00 95.52  ?  866  LYS A CA    1 
ATOM   3613  C  C     . LYS A 1 994  ? 120.998 133.998 137.147 1.00 89.02  ?  866  LYS A C     1 
ATOM   3614  O  O     . LYS A 1 994  ? 121.537 132.996 137.626 1.00 82.75  ?  866  LYS A O     1 
ATOM   3615  C  CB    . LYS A 1 994  ? 122.216 135.077 135.240 1.00 94.78  ?  866  LYS A CB    1 
ATOM   3616  C  CG    . LYS A 1 994  ? 122.401 136.415 134.517 1.00 96.20  ?  866  LYS A CG    1 
ATOM   3617  C  CD    . LYS A 1 994  ? 121.086 137.194 134.482 1.00 97.82  ?  866  LYS A CD    1 
ATOM   3618  C  CE    . LYS A 1 994  ? 121.179 138.490 133.688 1.00 89.01  ?  866  LYS A CE    1 
ATOM   3619  N  NZ    . LYS A 1 994  ? 121.412 138.256 132.244 1.00 82.02  ?  866  LYS A NZ    1 
ATOM   3620  N  N     . PRO A 1 995  ? 119.676 134.056 136.991 1.00 89.09  ?  867  PRO A N     1 
ATOM   3621  C  CA    . PRO A 1 995  ? 118.826 132.950 137.442 1.00 78.80  ?  867  PRO A CA    1 
ATOM   3622  C  C     . PRO A 1 995  ? 118.864 131.776 136.475 1.00 69.07  ?  867  PRO A C     1 
ATOM   3623  O  O     . PRO A 1 995  ? 119.346 131.863 135.347 1.00 74.89  ?  867  PRO A O     1 
ATOM   3624  C  CB    . PRO A 1 995  ? 117.431 133.573 137.476 1.00 84.82  ?  867  PRO A CB    1 
ATOM   3625  C  CG    . PRO A 1 995  ? 117.476 134.558 136.382 1.00 89.10  ?  867  PRO A CG    1 
ATOM   3626  C  CD    . PRO A 1 995  ? 118.870 135.141 136.404 1.00 96.08  ?  867  PRO A CD    1 
ATOM   3627  N  N     . VAL A 1 996  ? 118.326 130.659 136.951 1.00 62.62  ?  868  VAL A N     1 
ATOM   3628  C  CA    . VAL A 1 996  ? 118.166 129.451 136.159 1.00 59.50  ?  868  VAL A CA    1 
ATOM   3629  C  C     . VAL A 1 996  ? 116.809 128.847 136.491 1.00 65.91  ?  868  VAL A C     1 
ATOM   3630  O  O     . VAL A 1 996  ? 116.129 129.267 137.425 1.00 63.18  ?  868  VAL A O     1 
ATOM   3631  C  CB    . VAL A 1 996  ? 119.290 128.426 136.412 1.00 61.06  ?  868  VAL A CB    1 
ATOM   3632  C  CG1   . VAL A 1 996  ? 120.618 128.958 135.910 1.00 67.87  ?  868  VAL A CG1   1 
ATOM   3633  C  CG2   . VAL A 1 996  ? 119.378 128.092 137.877 1.00 62.76  ?  868  VAL A CG2   1 
ATOM   3634  N  N     . MET A 1 997  ? 116.408 127.862 135.690 1.00 75.32  ?  869  MET A N     1 
ATOM   3635  C  CA    . MET A 1 997  ? 115.203 127.102 135.998 1.00 76.05  ?  869  MET A CA    1 
ATOM   3636  C  C     . MET A 1 997  ? 115.417 126.257 137.242 1.00 66.36  ?  869  MET A C     1 
ATOM   3637  O  O     . MET A 1 997  ? 114.733 126.429 138.257 1.00 66.17  ?  869  MET A O     1 
ATOM   3638  C  CB    . MET A 1 997  ? 114.817 126.204 134.818 1.00 82.60  ?  869  MET A CB    1 
ATOM   3639  C  CG    . MET A 1 997  ? 114.786 126.840 133.427 1.00 100.69 ?  869  MET A CG    1 
ATOM   3640  S  SD    . MET A 1 997  ? 116.410 127.329 132.790 1.00 111.09 ?  869  MET A SD    1 
ATOM   3641  C  CE    . MET A 1 997  ? 116.201 127.067 131.025 1.00 102.25 ?  869  MET A CE    1 
ATOM   3642  N  N     . ARG A 1 998  ? 116.375 125.339 137.177 1.00 62.55  ?  870  ARG A N     1 
ATOM   3643  C  CA    . ARG A 1 998  ? 116.714 124.466 138.284 1.00 58.02  ?  870  ARG A CA    1 
ATOM   3644  C  C     . ARG A 1 998  ? 118.185 124.626 138.619 1.00 56.34  ?  870  ARG A C     1 
ATOM   3645  O  O     . ARG A 1 998  ? 119.014 124.892 137.745 1.00 58.16  ?  870  ARG A O     1 
ATOM   3646  C  CB    . ARG A 1 998  ? 116.419 123.012 137.956 1.00 67.74  ?  870  ARG A CB    1 
ATOM   3647  C  CG    . ARG A 1 998  ? 115.208 122.481 138.674 1.00 105.30 ?  870  ARG A CG    1 
ATOM   3648  C  CD    . ARG A 1 998  ? 115.649 121.683 139.891 1.00 90.45  ?  870  ARG A CD    1 
ATOM   3649  N  NE    . ARG A 1 998  ? 116.297 120.433 139.501 1.00 88.33  ?  870  ARG A NE    1 
ATOM   3650  C  CZ    . ARG A 1 998  ? 117.087 119.715 140.291 1.00 73.33  ?  870  ARG A CZ    1 
ATOM   3651  N  NH1   . ARG A 1 998  ? 117.631 118.593 139.840 1.00 70.23  ?  870  ARG A NH1   1 
ATOM   3652  N  NH2   . ARG A 1 998  ? 117.344 120.121 141.527 1.00 71.09  ?  870  ARG A NH2   1 
ATOM   3653  N  N     . MET A 1 999  ? 118.505 124.435 139.895 1.00 57.86  ?  871  MET A N     1 
ATOM   3654  C  CA    . MET A 1 999  ? 119.835 124.732 140.414 1.00 57.52  ?  871  MET A CA    1 
ATOM   3655  C  C     . MET A 1 999  ? 120.711 123.484 140.348 1.00 54.38  ?  871  MET A C     1 
ATOM   3656  O  O     . MET A 1 999  ? 120.432 122.477 141.009 1.00 55.00  ?  871  MET A O     1 
ATOM   3657  C  CB    . MET A 1 999  ? 119.734 125.272 141.835 1.00 52.56  ?  871  MET A CB    1 
ATOM   3658  C  CG    . MET A 1 999  ? 121.066 125.412 142.549 1.00 56.31  ?  871  MET A CG    1 
ATOM   3659  S  SD    . MET A 1 999  ? 121.218 126.991 143.410 1.00 63.78  ?  871  MET A SD    1 
ATOM   3660  C  CE    . MET A 1 999  ? 119.544 127.224 144.003 1.00 66.29  ?  871  MET A CE    1 
ATOM   3661  N  N     . ASN A 1 1000 ? 121.771 123.559 139.544 1.00 47.35  ?  872  ASN A N     1 
ATOM   3662  C  CA    . ASN A 1 1000 ? 122.779 122.512 139.458 1.00 39.27  ?  872  ASN A CA    1 
ATOM   3663  C  C     . ASN A 1 1000 ? 123.742 122.668 140.629 1.00 37.03  ?  872  ASN A C     1 
ATOM   3664  O  O     . ASN A 1 1000 ? 123.490 123.417 141.576 1.00 45.70  ?  872  ASN A O     1 
ATOM   3665  C  CB    . ASN A 1 1000 ? 123.510 122.583 138.121 1.00 33.41  ?  872  ASN A CB    1 
ATOM   3666  C  CG    . ASN A 1 1000 ? 124.552 123.683 138.087 1.00 35.12  ?  872  ASN A CG    1 
ATOM   3667  O  OD1   . ASN A 1 1000 ? 125.680 123.505 138.549 1.00 36.90  ?  872  ASN A OD1   1 
ATOM   3668  N  ND2   . ASN A 1 1000 ? 124.175 124.831 137.542 1.00 36.70  ?  872  ASN A ND2   1 
ATOM   3669  N  N     . GLY A 1 1001 ? 124.872 121.966 140.573 1.00 37.69  ?  873  GLY A N     1 
ATOM   3670  C  CA    . GLY A 1 1001 ? 125.851 122.093 141.638 1.00 37.29  ?  873  GLY A CA    1 
ATOM   3671  C  C     . GLY A 1 1001 ? 126.501 123.462 141.697 1.00 39.02  ?  873  GLY A C     1 
ATOM   3672  O  O     . GLY A 1 1001 ? 126.706 124.014 142.782 1.00 44.85  ?  873  GLY A O     1 
ATOM   3673  N  N     . ASN A 1 1002 ? 126.852 124.022 140.538 1.00 41.80  ?  874  ASN A N     1 
ATOM   3674  C  CA    . ASN A 1 1002 ? 127.617 125.266 140.524 1.00 48.22  ?  874  ASN A CA    1 
ATOM   3675  C  C     . ASN A 1 1002 ? 126.808 126.425 141.097 1.00 49.71  ?  874  ASN A C     1 
ATOM   3676  O  O     . ASN A 1 1002 ? 127.332 127.232 141.874 1.00 53.37  ?  874  ASN A O     1 
ATOM   3677  C  CB    . ASN A 1 1002 ? 128.090 125.581 139.104 1.00 53.34  ?  874  ASN A CB    1 
ATOM   3678  C  CG    . ASN A 1 1002 ? 128.832 126.912 139.015 1.00 61.99  ?  874  ASN A CG    1 
ATOM   3679  O  OD1   . ASN A 1 1002 ? 128.293 127.902 138.515 1.00 64.69  ?  874  ASN A OD1   1 
ATOM   3680  N  ND2   . ASN A 1 1002 ? 130.073 126.940 139.500 1.00 61.30  ?  874  ASN A ND2   1 
ATOM   3681  N  N     . TYR A 1 1003 ? 125.537 126.544 140.697 1.00 59.66  ?  875  TYR A N     1 
ATOM   3682  C  CA    . TYR A 1 1003 ? 124.674 127.580 141.265 1.00 50.48  ?  875  TYR A CA    1 
ATOM   3683  C  C     . TYR A 1 1003 ? 124.597 127.460 142.779 1.00 48.88  ?  875  TYR A C     1 
ATOM   3684  O  O     . TYR A 1 1003 ? 124.627 128.468 143.499 1.00 53.89  ?  875  TYR A O     1 
ATOM   3685  C  CB    . TYR A 1 1003 ? 123.277 127.498 140.646 1.00 52.34  ?  875  TYR A CB    1 
ATOM   3686  C  CG    . TYR A 1 1003 ? 122.591 128.839 140.454 1.00 58.88  ?  875  TYR A CG    1 
ATOM   3687  C  CD1   . TYR A 1 1003 ? 123.254 129.903 139.863 1.00 71.20  ?  875  TYR A CD1   1 
ATOM   3688  C  CD2   . TYR A 1 1003 ? 121.274 129.034 140.854 1.00 54.80  ?  875  TYR A CD2   1 
ATOM   3689  C  CE1   . TYR A 1 1003 ? 122.631 131.126 139.692 1.00 77.72  ?  875  TYR A CE1   1 
ATOM   3690  C  CE2   . TYR A 1 1003 ? 120.641 130.251 140.685 1.00 62.47  ?  875  TYR A CE2   1 
ATOM   3691  C  CZ    . TYR A 1 1003 ? 121.324 131.295 140.101 1.00 75.42  ?  875  TYR A CZ    1 
ATOM   3692  O  OH    . TYR A 1 1003 ? 120.716 132.516 139.924 1.00 82.28  ?  875  TYR A OH    1 
ATOM   3693  N  N     . ALA A 1 1004 ? 124.518 126.228 143.277 1.00 47.48  ?  876  ALA A N     1 
ATOM   3694  C  CA    . ALA A 1 1004 ? 124.498 125.997 144.713 1.00 50.57  ?  876  ALA A CA    1 
ATOM   3695  C  C     . ALA A 1 1004 ? 125.780 126.500 145.360 1.00 54.86  ?  876  ALA A C     1 
ATOM   3696  O  O     . ALA A 1 1004 ? 125.747 127.299 146.304 1.00 54.33  ?  876  ALA A O     1 
ATOM   3697  C  CB    . ALA A 1 1004 ? 124.299 124.510 144.982 1.00 50.50  ?  876  ALA A CB    1 
ATOM   3698  N  N     . ARG A 1 1005 ? 126.926 126.024 144.866 1.00 49.86  ?  877  ARG A N     1 
ATOM   3699  C  CA    . ARG A 1 1005 ? 128.211 126.449 145.407 1.00 52.42  ?  877  ARG A CA    1 
ATOM   3700  C  C     . ARG A 1 1005 ? 128.343 127.962 145.401 1.00 55.53  ?  877  ARG A C     1 
ATOM   3701  O  O     . ARG A 1 1005 ? 128.933 128.543 146.318 1.00 57.47  ?  877  ARG A O     1 
ATOM   3702  C  CB    . ARG A 1 1005 ? 129.349 125.815 144.602 1.00 54.50  ?  877  ARG A CB    1 
ATOM   3703  C  CG    . ARG A 1 1005 ? 130.433 125.159 145.450 1.00 60.11  ?  877  ARG A CG    1 
ATOM   3704  C  CD    . ARG A 1 1005 ? 131.507 124.474 144.604 1.00 58.88  ?  877  ARG A CD    1 
ATOM   3705  N  NE    . ARG A 1 1005 ? 132.424 123.702 145.440 1.00 66.15  ?  877  ARG A NE    1 
ATOM   3706  C  CZ    . ARG A 1 1005 ? 132.117 122.538 146.000 1.00 72.17  ?  877  ARG A CZ    1 
ATOM   3707  N  NH1   . ARG A 1 1005 ? 130.909 122.020 145.819 1.00 79.82  ?  877  ARG A NH1   1 
ATOM   3708  N  NH2   . ARG A 1 1005 ? 133.005 121.895 146.750 1.00 66.86  ?  877  ARG A NH2   1 
ATOM   3709  N  N     . ARG A 1 1006 ? 127.796 128.616 144.381 1.00 53.51  ?  878  ARG A N     1 
ATOM   3710  C  CA    . ARG A 1 1006 ? 127.792 130.069 144.354 1.00 57.41  ?  878  ARG A CA    1 
ATOM   3711  C  C     . ARG A 1 1006 ? 126.909 130.639 145.451 1.00 60.95  ?  878  ARG A C     1 
ATOM   3712  O  O     . ARG A 1 1006 ? 127.244 131.666 146.048 1.00 65.21  ?  878  ARG A O     1 
ATOM   3713  C  CB    . ARG A 1 1006 ? 127.305 130.554 142.992 1.00 60.10  ?  878  ARG A CB    1 
ATOM   3714  C  CG    . ARG A 1 1006 ? 127.242 132.055 142.855 1.00 63.78  ?  878  ARG A CG    1 
ATOM   3715  C  CD    . ARG A 1 1006 ? 128.615 132.680 142.862 1.00 64.52  ?  878  ARG A CD    1 
ATOM   3716  N  NE    . ARG A 1 1006 ? 129.400 132.269 141.706 1.00 66.98  ?  878  ARG A NE    1 
ATOM   3717  C  CZ    . ARG A 1 1006 ? 130.232 131.232 141.703 1.00 70.13  ?  878  ARG A CZ    1 
ATOM   3718  N  NH1   . ARG A 1 1006 ? 130.385 130.498 142.801 1.00 64.83  ?  878  ARG A NH1   1 
ATOM   3719  N  NH2   . ARG A 1 1006 ? 130.912 130.926 140.607 1.00 72.35  ?  878  ARG A NH2   1 
ATOM   3720  N  N     . LEU A 1 1007 ? 125.789 129.987 145.739 1.00 52.10  ?  879  LEU A N     1 
ATOM   3721  C  CA    . LEU A 1 1007 ? 124.822 130.542 146.676 1.00 49.80  ?  879  LEU A CA    1 
ATOM   3722  C  C     . LEU A 1 1007 ? 125.176 130.281 148.133 1.00 48.92  ?  879  LEU A C     1 
ATOM   3723  O  O     . LEU A 1 1007 ? 124.338 130.511 149.007 1.00 48.72  ?  879  LEU A O     1 
ATOM   3724  C  CB    . LEU A 1 1007 ? 123.428 129.992 146.365 1.00 51.40  ?  879  LEU A CB    1 
ATOM   3725  C  CG    . LEU A 1 1007 ? 122.288 130.977 146.619 1.00 50.82  ?  879  LEU A CG    1 
ATOM   3726  C  CD1   . LEU A 1 1007 ? 122.556 132.263 145.871 1.00 58.65  ?  879  LEU A CD1   1 
ATOM   3727  C  CD2   . LEU A 1 1007 ? 120.929 130.406 146.231 1.00 46.79  ?  879  LEU A CD2   1 
ATOM   3728  N  N     . MET A 1 1008 ? 126.374 129.795 148.420 1.00 52.68  ?  880  MET A N     1 
ATOM   3729  C  CA    . MET A 1 1008 ? 126.760 129.519 149.791 1.00 59.92  ?  880  MET A CA    1 
ATOM   3730  C  C     . MET A 1 1008 ? 127.876 130.426 150.303 1.00 70.59  ?  880  MET A C     1 
ATOM   3731  O  O     . MET A 1 1008 ? 128.339 130.237 151.432 1.00 71.49  ?  880  MET A O     1 
ATOM   3732  C  CB    . MET A 1 1008 ? 127.171 128.052 149.916 1.00 59.21  ?  880  MET A CB    1 
ATOM   3733  C  CG    . MET A 1 1008 ? 126.788 127.457 151.236 1.00 63.06  ?  880  MET A CG    1 
ATOM   3734  S  SD    . MET A 1 1008 ? 125.124 128.015 151.676 1.00 75.84  ?  880  MET A SD    1 
ATOM   3735  C  CE    . MET A 1 1008 ? 124.108 127.234 150.426 1.00 50.52  ?  880  MET A CE    1 
ATOM   3736  N  N     . THR A 1 1009 ? 128.325 131.397 149.514 1.00 76.04  ?  881  THR A N     1 
ATOM   3737  C  CA    . THR A 1 1009 ? 129.332 132.331 150.001 1.00 88.37  ?  881  THR A CA    1 
ATOM   3738  C  C     . THR A 1 1009 ? 128.718 133.276 151.024 1.00 90.67  ?  881  THR A C     1 
ATOM   3739  O  O     . THR A 1 1009 ? 127.595 133.756 150.852 1.00 84.90  ?  881  THR A O     1 
ATOM   3740  C  CB    . THR A 1 1009 ? 129.944 133.131 148.845 1.00 99.88  ?  881  THR A CB    1 
ATOM   3741  O  OG1   . THR A 1 1009 ? 129.104 134.248 148.528 1.00 98.02  ?  881  THR A OG1   1 
ATOM   3742  C  CG2   . THR A 1 1009 ? 130.094 132.258 147.609 1.00 94.45  ?  881  THR A CG2   1 
ATOM   3743  N  N     . ARG A 1 1010 ? 129.457 133.530 152.108 1.00 97.16  ?  882  ARG A N     1 
ATOM   3744  C  CA    . ARG A 1 1010 ? 128.965 134.445 153.136 1.00 99.36  ?  882  ARG A CA    1 
ATOM   3745  C  C     . ARG A 1 1010 ? 128.696 135.828 152.553 1.00 105.96 ?  882  ARG A C     1 
ATOM   3746  O  O     . ARG A 1 1010 ? 127.753 136.512 152.965 1.00 103.94 ?  882  ARG A O     1 
ATOM   3747  C  CB    . ARG A 1 1010 ? 129.956 134.532 154.298 1.00 95.87  ?  882  ARG A CB    1 
ATOM   3748  C  CG    . ARG A 1 1010 ? 129.659 135.680 155.251 1.00 95.11  ?  882  ARG A CG    1 
ATOM   3749  C  CD    . ARG A 1 1010 ? 129.985 135.351 156.686 1.00 89.96  ?  882  ARG A CD    1 
ATOM   3750  N  NE    . ARG A 1 1010 ? 129.801 136.511 157.552 1.00 98.68  ?  882  ARG A NE    1 
ATOM   3751  C  CZ    . ARG A 1 1010 ? 129.854 136.458 158.878 1.00 100.96 ?  882  ARG A CZ    1 
ATOM   3752  N  NH1   . ARG A 1 1010 ? 130.077 135.299 159.477 1.00 102.70 ?  882  ARG A NH1   1 
ATOM   3753  N  NH2   . ARG A 1 1010 ? 129.680 137.555 159.603 1.00 101.97 ?  882  ARG A NH2   1 
ATOM   3754  N  N     . GLU A 1 1011 ? 129.517 136.256 151.589 1.00 110.42 ?  883  GLU A N     1 
ATOM   3755  C  CA    . GLU A 1 1011 ? 129.320 137.554 150.949 1.00 112.29 ?  883  GLU A CA    1 
ATOM   3756  C  C     . GLU A 1 1011 ? 128.061 137.588 150.087 1.00 100.08 ?  883  GLU A C     1 
ATOM   3757  O  O     . GLU A 1 1011 ? 127.454 138.654 149.921 1.00 99.43  ?  883  GLU A O     1 
ATOM   3758  C  CB    . GLU A 1 1011 ? 130.564 137.931 150.137 1.00 125.90 ?  883  GLU A CB    1 
ATOM   3759  C  CG    . GLU A 1 1011 ? 131.176 136.801 149.307 1.00 132.63 ?  883  GLU A CG    1 
ATOM   3760  C  CD    . GLU A 1 1011 ? 132.108 135.902 150.121 1.00 155.24 ?  883  GLU A CD    1 
ATOM   3761  O  OE1   . GLU A 1 1011 ? 132.032 135.919 151.371 1.00 135.32 ?  883  GLU A OE1   1 
ATOM   3762  O  OE2   . GLU A 1 1011 ? 132.898 135.153 149.508 1.00 287.64 -1 883  GLU A OE2   1 
ATOM   3763  N  N     . ALA A 1 1012 ? 127.649 136.446 149.530 1.00 88.64  ?  884  ALA A N     1 
ATOM   3764  C  CA    . ALA A 1 1012 ? 126.335 136.388 148.904 1.00 80.90  ?  884  ALA A CA    1 
ATOM   3765  C  C     . ALA A 1 1012 ? 125.246 136.689 149.924 1.00 82.27  ?  884  ALA A C     1 
ATOM   3766  O  O     . ALA A 1 1012 ? 124.293 137.425 149.636 1.00 86.81  ?  884  ALA A O     1 
ATOM   3767  C  CB    . ALA A 1 1012 ? 126.117 135.022 148.265 1.00 71.06  ?  884  ALA A CB    1 
ATOM   3768  N  N     . VAL A 1 1013 ? 125.394 136.157 151.138 1.00 84.10  ?  885  VAL A N     1 
ATOM   3769  C  CA    . VAL A 1 1013 ? 124.441 136.437 152.204 1.00 86.12  ?  885  VAL A CA    1 
ATOM   3770  C  C     . VAL A 1 1013 ? 124.526 137.891 152.650 1.00 96.72  ?  885  VAL A C     1 
ATOM   3771  O  O     . VAL A 1 1013 ? 123.524 138.464 153.081 1.00 93.67  ?  885  VAL A O     1 
ATOM   3772  C  CB    . VAL A 1 1013 ? 124.676 135.470 153.376 1.00 85.43  ?  885  VAL A CB    1 
ATOM   3773  C  CG1   . VAL A 1 1013 ? 123.431 135.349 154.248 1.00 79.07  ?  885  VAL A CG1   1 
ATOM   3774  C  CG2   . VAL A 1 1013 ? 125.108 134.123 152.854 1.00 84.50  ?  885  VAL A CG2   1 
ATOM   3775  N  N     . GLU A 1 1014 ? 125.713 138.504 152.581 1.00 104.15 ?  886  GLU A N     1 
ATOM   3776  C  CA    . GLU A 1 1014 ? 125.837 139.931 152.880 1.00 104.50 ?  886  GLU A CA    1 
ATOM   3777  C  C     . GLU A 1 1014 ? 125.054 140.762 151.875 1.00 97.91  ?  886  GLU A C     1 
ATOM   3778  O  O     . GLU A 1 1014 ? 124.251 141.627 152.248 1.00 98.19  ?  886  GLU A O     1 
ATOM   3779  C  CB    . GLU A 1 1014 ? 127.309 140.361 152.876 1.00 108.04 ?  886  GLU A CB    1 
ATOM   3780  C  CG    . GLU A 1 1014 ? 128.268 139.514 153.700 1.00 117.63 ?  886  GLU A CG    1 
ATOM   3781  C  CD    . GLU A 1 1014 ? 128.301 139.904 155.167 1.00 131.91 ?  886  GLU A CD    1 
ATOM   3782  O  OE1   . GLU A 1 1014 ? 127.770 140.982 155.508 1.00 127.54 ?  886  GLU A OE1   1 
ATOM   3783  O  OE2   . GLU A 1 1014 ? 128.861 139.131 155.974 1.00 203.53 -1 886  GLU A OE2   1 
ATOM   3784  N  N     . ALA A 1 1015 ? 125.283 140.511 150.586 1.00 94.40  ?  887  ALA A N     1 
ATOM   3785  C  CA    . ALA A 1 1015 ? 124.541 141.223 149.554 1.00 94.83  ?  887  ALA A CA    1 
ATOM   3786  C  C     . ALA A 1 1015 ? 123.040 141.012 149.717 1.00 95.20  ?  887  ALA A C     1 
ATOM   3787  O  O     . ALA A 1 1015 ? 122.252 141.946 149.533 1.00 98.29  ?  887  ALA A O     1 
ATOM   3788  C  CB    . ALA A 1 1015 ? 125.008 140.774 148.171 1.00 90.99  ?  887  ALA A CB    1 
ATOM   3789  N  N     . VAL A 1 1016 ? 122.630 139.801 150.100 1.00 92.39  ?  888  VAL A N     1 
ATOM   3790  C  CA    . VAL A 1 1016 ? 121.211 139.522 150.312 1.00 90.31  ?  888  VAL A CA    1 
ATOM   3791  C  C     . VAL A 1 1016 ? 120.675 140.325 151.494 1.00 93.72  ?  888  VAL A C     1 
ATOM   3792  O  O     . VAL A 1 1016 ? 119.783 141.167 151.339 1.00 93.75  ?  888  VAL A O     1 
ATOM   3793  C  CB    . VAL A 1 1016 ? 120.988 138.013 150.518 1.00 84.03  ?  888  VAL A CB    1 
ATOM   3794  C  CG1   . VAL A 1 1016 ? 119.588 137.746 151.040 1.00 79.49  ?  888  VAL A CG1   1 
ATOM   3795  C  CG2   . VAL A 1 1016 ? 121.216 137.252 149.226 1.00 84.33  ?  888  VAL A CG2   1 
ATOM   3796  N  N     . CYS A 1 1017 ? 121.229 140.091 152.688 1.00 94.53  ?  889  CYS A N     1 
ATOM   3797  C  CA    . CYS A 1 1017 ? 120.656 140.579 153.939 1.00 100.08 ?  889  CYS A CA    1 
ATOM   3798  C  C     . CYS A 1 1017 ? 120.552 142.096 154.010 1.00 107.10 ?  889  CYS A C     1 
ATOM   3799  O  O     . CYS A 1 1017 ? 119.904 142.604 154.931 1.00 107.79 ?  889  CYS A O     1 
ATOM   3800  C  CB    . CYS A 1 1017 ? 121.480 140.066 155.124 1.00 99.63  ?  889  CYS A CB    1 
ATOM   3801  S  SG    . CYS A 1 1017 ? 123.177 140.684 155.214 1.00 130.29 ?  889  CYS A SG    1 
ATOM   3802  N  N     . GLU A 1 1018 ? 121.179 142.824 153.084 1.00 105.88 ?  890  GLU A N     1 
ATOM   3803  C  CA    . GLU A 1 1018 ? 121.027 144.275 153.050 1.00 112.40 ?  890  GLU A CA    1 
ATOM   3804  C  C     . GLU A 1 1018 ? 119.562 144.685 152.954 1.00 110.62 ?  890  GLU A C     1 
ATOM   3805  O  O     . GLU A 1 1018 ? 119.160 145.698 153.539 1.00 111.28 ?  890  GLU A O     1 
ATOM   3806  C  CB    . GLU A 1 1018 ? 121.813 144.850 151.873 1.00 114.26 ?  890  GLU A CB    1 
ATOM   3807  C  CG    . GLU A 1 1018 ? 121.565 146.323 151.624 1.00 126.80 ?  890  GLU A CG    1 
ATOM   3808  C  CD    . GLU A 1 1018 ? 122.129 146.797 150.299 1.00 150.38 ?  890  GLU A CD    1 
ATOM   3809  O  OE1   . GLU A 1 1018 ? 123.123 146.207 149.824 1.00 134.73 ?  890  GLU A OE1   1 
ATOM   3810  O  OE2   . GLU A 1 1018 ? 121.559 147.740 149.715 1.00 265.55 -1 890  GLU A OE2   1 
ATOM   3811  N  N     . LEU A 1 1019 ? 118.747 143.903 152.244 1.00 101.39 ?  891  LEU A N     1 
ATOM   3812  C  CA    . LEU A 1 1019 ? 117.335 144.212 152.063 1.00 95.25  ?  891  LEU A CA    1 
ATOM   3813  C  C     . LEU A 1 1019 ? 116.473 143.780 153.246 1.00 93.53  ?  891  LEU A C     1 
ATOM   3814  O  O     . LEU A 1 1019 ? 115.291 144.137 153.286 1.00 91.61  ?  891  LEU A O     1 
ATOM   3815  C  CB    . LEU A 1 1019 ? 116.823 143.559 150.770 1.00 82.64  ?  891  LEU A CB    1 
ATOM   3816  C  CG    . LEU A 1 1019 ? 117.653 143.793 149.502 1.00 80.10  ?  891  LEU A CG    1 
ATOM   3817  C  CD1   . LEU A 1 1019 ? 117.083 143.079 148.280 1.00 69.76  ?  891  LEU A CD1   1 
ATOM   3818  C  CD2   . LEU A 1 1019 ? 117.793 145.276 149.219 1.00 91.74  ?  891  LEU A CD2   1 
ATOM   3819  N  N     . VAL A 1 1020 ? 117.022 143.026 154.195 1.00 95.28  ?  892  VAL A N     1 
ATOM   3820  C  CA    . VAL A 1 1020 ? 116.290 142.587 155.384 1.00 92.70  ?  892  VAL A CA    1 
ATOM   3821  C  C     . VAL A 1 1020 ? 115.931 143.801 156.232 1.00 100.27 ?  892  VAL A C     1 
ATOM   3822  O  O     . VAL A 1 1020 ? 116.817 144.582 156.604 1.00 106.56 ?  892  VAL A O     1 
ATOM   3823  C  CB    . VAL A 1 1020 ? 117.104 141.570 156.203 1.00 89.26  ?  892  VAL A CB    1 
ATOM   3824  C  CG1   . VAL A 1 1020 ? 116.445 141.306 157.543 1.00 86.97  ?  892  VAL A CG1   1 
ATOM   3825  C  CG2   . VAL A 1 1020 ? 117.256 140.278 155.436 1.00 88.25  ?  892  VAL A CG2   1 
ATOM   3826  N  N     . PRO A 1 1021 ? 114.652 144.009 156.551 1.00 100.12 ?  893  PRO A N     1 
ATOM   3827  C  CA    . PRO A 1 1021 ? 114.299 145.157 157.404 1.00 105.67 ?  893  PRO A CA    1 
ATOM   3828  C  C     . PRO A 1 1021 ? 114.782 145.018 158.838 1.00 113.01 ?  893  PRO A C     1 
ATOM   3829  O  O     . PRO A 1 1021 ? 115.326 145.979 159.394 1.00 118.47 ?  893  PRO A O     1 
ATOM   3830  C  CB    . PRO A 1 1021 ? 112.765 145.199 157.309 1.00 103.21 ?  893  PRO A CB    1 
ATOM   3831  C  CG    . PRO A 1 1021 ? 112.446 144.460 156.047 1.00 101.93 ?  893  PRO A CG    1 
ATOM   3832  C  CD    . PRO A 1 1021 ? 113.465 143.377 155.954 1.00 97.72  ?  893  PRO A CD    1 
ATOM   3833  N  N     . SER A 1 1022 ? 114.613 143.853 159.457 1.00 111.62 ?  894  SER A N     1 
ATOM   3834  C  CA    . SER A 1 1022 ? 115.004 143.671 160.850 1.00 115.82 ?  894  SER A CA    1 
ATOM   3835  C  C     . SER A 1 1022 ? 116.478 143.279 160.937 1.00 116.39 ?  894  SER A C     1 
ATOM   3836  O  O     . SER A 1 1022 ? 116.873 142.200 160.478 1.00 110.21 ?  894  SER A O     1 
ATOM   3837  C  CB    . SER A 1 1022 ? 114.119 142.616 161.507 1.00 119.96 ?  894  SER A CB    1 
ATOM   3838  O  OG    . SER A 1 1022 ? 114.711 142.092 162.684 1.00 125.21 ?  894  SER A OG    1 
ATOM   3839  N  N     . GLU A 1 1023 ? 117.288 144.153 161.542 1.00 124.61 ?  895  GLU A N     1 
ATOM   3840  C  CA    . GLU A 1 1023 ? 118.711 143.865 161.701 1.00 120.97 ?  895  GLU A CA    1 
ATOM   3841  C  C     . GLU A 1 1023 ? 118.936 142.691 162.641 1.00 115.94 ?  895  GLU A C     1 
ATOM   3842  O  O     . GLU A 1 1023 ? 119.955 141.994 162.537 1.00 109.73 ?  895  GLU A O     1 
ATOM   3843  C  CB    . GLU A 1 1023 ? 119.438 145.110 162.213 1.00 128.63 ?  895  GLU A CB    1 
ATOM   3844  C  CG    . GLU A 1 1023 ? 118.936 146.429 161.632 1.00 135.49 ?  895  GLU A CG    1 
ATOM   3845  C  CD    . GLU A 1 1023 ? 118.854 146.416 160.121 1.00 138.57 ?  895  GLU A CD    1 
ATOM   3846  O  OE1   . GLU A 1 1023 ? 119.822 145.951 159.483 1.00 130.87 ?  895  GLU A OE1   1 
ATOM   3847  O  OE2   . GLU A 1 1023 ? 117.821 146.854 159.574 1.00 176.81 -1 895  GLU A OE2   1 
ATOM   3848  N  N     . GLU A 1 1024 ? 118.000 142.462 163.564 1.00 122.22 ?  896  GLU A N     1 
ATOM   3849  C  CA    . GLU A 1 1024 ? 118.031 141.253 164.376 1.00 119.61 ?  896  GLU A CA    1 
ATOM   3850  C  C     . GLU A 1 1024 ? 117.980 140.011 163.496 1.00 109.25 ?  896  GLU A C     1 
ATOM   3851  O  O     . GLU A 1 1024 ? 118.835 139.126 163.600 1.00 104.70 ?  896  GLU A O     1 
ATOM   3852  C  CB    . GLU A 1 1024 ? 116.865 141.255 165.369 1.00 130.13 ?  896  GLU A CB    1 
ATOM   3853  C  CG    . GLU A 1 1024 ? 116.581 142.587 166.083 1.00 161.73 ?  896  GLU A CG    1 
ATOM   3854  C  CD    . GLU A 1 1024 ? 115.741 143.552 165.261 1.00 188.99 ?  896  GLU A CD    1 
ATOM   3855  O  OE1   . GLU A 1 1024 ? 115.926 143.599 164.028 1.00 150.32 ?  896  GLU A OE1   1 
ATOM   3856  O  OE2   . GLU A 1 1024 ? 114.893 144.257 165.850 1.00 339.07 -1 896  GLU A OE2   1 
ATOM   3857  N  N     . ARG A 1 1025 ? 116.978 139.933 162.614 1.00 108.49 ?  897  ARG A N     1 
ATOM   3858  C  CA    . ARG A 1 1025 ? 116.872 138.803 161.695 1.00 99.34  ?  897  ARG A CA    1 
ATOM   3859  C  C     . ARG A 1 1025 ? 118.037 138.763 160.719 1.00 92.75  ?  897  ARG A C     1 
ATOM   3860  O  O     . ARG A 1 1025 ? 118.459 137.679 160.294 1.00 92.00  ?  897  ARG A O     1 
ATOM   3861  C  CB    . ARG A 1 1025 ? 115.559 138.869 160.921 1.00 98.28  ?  897  ARG A CB    1 
ATOM   3862  C  CG    . ARG A 1 1025 ? 114.323 139.080 161.770 1.00 102.45 ?  897  ARG A CG    1 
ATOM   3863  C  CD    . ARG A 1 1025 ? 114.010 137.868 162.618 1.00 98.45  ?  897  ARG A CD    1 
ATOM   3864  N  NE    . ARG A 1 1025 ? 113.120 136.939 161.929 1.00 91.99  ?  897  ARG A NE    1 
ATOM   3865  C  CZ    . ARG A 1 1025 ? 112.601 135.853 162.491 1.00 87.10  ?  897  ARG A CZ    1 
ATOM   3866  N  NH1   . ARG A 1 1025 ? 112.873 135.569 163.756 1.00 84.27  ?  897  ARG A NH1   1 
ATOM   3867  N  NH2   . ARG A 1 1025 ? 111.802 135.056 161.793 1.00 83.99  ?  897  ARG A NH2   1 
ATOM   3868  N  N     . ARG A 1 1026 ? 118.553 139.932 160.345 1.00 93.76  ?  898  ARG A N     1 
ATOM   3869  C  CA    . ARG A 1 1026 ? 119.718 139.999 159.475 1.00 93.30  ?  898  ARG A CA    1 
ATOM   3870  C  C     . ARG A 1 1026 ? 120.906 139.278 160.105 1.00 98.99  ?  898  ARG A C     1 
ATOM   3871  O  O     . ARG A 1 1026 ? 121.453 138.323 159.534 1.00 97.87  ?  898  ARG A O     1 
ATOM   3872  C  CB    . ARG A 1 1026 ? 120.046 141.463 159.190 1.00 98.46  ?  898  ARG A CB    1 
ATOM   3873  C  CG    . ARG A 1 1026 ? 121.309 141.693 158.392 1.00 102.44 ?  898  ARG A CG    1 
ATOM   3874  C  CD    . ARG A 1 1026 ? 121.439 143.156 158.019 1.00 108.25 ?  898  ARG A CD    1 
ATOM   3875  N  NE    . ARG A 1 1026 ? 120.308 143.588 157.208 1.00 110.01 ?  898  ARG A NE    1 
ATOM   3876  C  CZ    . ARG A 1 1026 ? 120.115 144.832 156.786 1.00 113.02 ?  898  ARG A CZ    1 
ATOM   3877  N  NH1   . ARG A 1 1026 ? 120.987 145.784 157.090 1.00 114.90 ?  898  ARG A NH1   1 
ATOM   3878  N  NH2   . ARG A 1 1026 ? 119.046 145.119 156.054 1.00 109.85 ?  898  ARG A NH2   1 
ATOM   3879  N  N     . GLU A 1 1027 ? 121.308 139.714 161.305 1.00 105.97 ?  899  GLU A N     1 
ATOM   3880  C  CA    . GLU A 1 1027 ? 122.401 139.038 161.998 1.00 112.31 ?  899  GLU A CA    1 
ATOM   3881  C  C     . GLU A 1 1027 ? 122.047 137.594 162.316 1.00 108.96 ?  899  GLU A C     1 
ATOM   3882  O  O     . GLU A 1 1027 ? 122.937 136.741 162.400 1.00 105.14 ?  899  GLU A O     1 
ATOM   3883  C  CB    . GLU A 1 1027 ? 122.775 139.795 163.277 1.00 127.47 ?  899  GLU A CB    1 
ATOM   3884  C  CG    . GLU A 1 1027 ? 123.986 139.213 164.027 1.00 149.52 ?  899  GLU A CG    1 
ATOM   3885  C  CD    . GLU A 1 1027 ? 123.625 138.066 164.971 1.00 168.41 ?  899  GLU A CD    1 
ATOM   3886  O  OE1   . GLU A 1 1027 ? 122.436 137.930 165.325 1.00 146.55 ?  899  GLU A OE1   1 
ATOM   3887  O  OE2   . GLU A 1 1027 ? 124.531 137.281 165.327 1.00 331.59 -1 899  GLU A OE2   1 
ATOM   3888  N  N     . ALA A 1 1028 ? 120.757 137.297 162.484 1.00 106.45 ?  900  ALA A N     1 
ATOM   3889  C  CA    . ALA A 1 1028 ? 120.345 135.934 162.793 1.00 98.78  ?  900  ALA A CA    1 
ATOM   3890  C  C     . ALA A 1 1028 ? 120.668 134.989 161.642 1.00 92.38  ?  900  ALA A C     1 
ATOM   3891  O  O     . ALA A 1 1028 ? 121.298 133.941 161.839 1.00 87.06  ?  900  ALA A O     1 
ATOM   3892  C  CB    . ALA A 1 1028 ? 118.854 135.911 163.118 1.00 88.10  ?  900  ALA A CB    1 
ATOM   3893  N  N     . LEU A 1 1029 ? 120.247 135.348 160.425 1.00 91.00  ?  901  LEU A N     1 
ATOM   3894  C  CA    . LEU A 1 1029 ? 120.579 134.517 159.270 1.00 82.67  ?  901  LEU A CA    1 
ATOM   3895  C  C     . LEU A 1 1029 ? 122.068 134.566 158.960 1.00 78.27  ?  901  LEU A C     1 
ATOM   3896  O  O     . LEU A 1 1029 ? 122.604 133.628 158.365 1.00 73.26  ?  901  LEU A O     1 
ATOM   3897  C  CB    . LEU A 1 1029 ? 119.768 134.931 158.039 1.00 80.47  ?  901  LEU A CB    1 
ATOM   3898  C  CG    . LEU A 1 1029 ? 119.805 136.368 157.511 1.00 88.05  ?  901  LEU A CG    1 
ATOM   3899  C  CD1   . LEU A 1 1029 ? 121.020 136.637 156.632 1.00 85.59  ?  901  LEU A CD1   1 
ATOM   3900  C  CD2   . LEU A 1 1029 ? 118.520 136.703 156.750 1.00 89.02  ?  901  LEU A CD2   1 
ATOM   3901  N  N     . LEU A 1 1030 ? 122.753 135.642 159.354 1.00 85.78  ?  902  LEU A N     1 
ATOM   3902  C  CA    . LEU A 1 1030 ? 124.201 135.683 159.167 1.00 85.03  ?  902  LEU A CA    1 
ATOM   3903  C  C     . LEU A 1 1030 ? 124.900 134.647 160.042 1.00 85.18  ?  902  LEU A C     1 
ATOM   3904  O  O     . LEU A 1 1030 ? 125.777 133.909 159.575 1.00 84.87  ?  902  LEU A O     1 
ATOM   3905  C  CB    . LEU A 1 1030 ? 124.727 137.087 159.465 1.00 89.35  ?  902  LEU A CB    1 
ATOM   3906  C  CG    . LEU A 1 1030 ? 124.369 138.157 158.433 1.00 95.59  ?  902  LEU A CG    1 
ATOM   3907  C  CD1   . LEU A 1 1030 ? 125.066 139.485 158.723 1.00 104.30 ?  902  LEU A CD1   1 
ATOM   3908  C  CD2   . LEU A 1 1030 ? 124.708 137.659 157.037 1.00 95.52  ?  902  LEU A CD2   1 
ATOM   3909  N  N     . LYS A 1 1031 ? 124.527 134.581 161.321 1.00 88.64  ?  903  LYS A N     1 
ATOM   3910  C  CA    . LYS A 1 1031 ? 125.077 133.562 162.212 1.00 85.76  ?  903  LYS A CA    1 
ATOM   3911  C  C     . LYS A 1 1031 ? 124.656 132.161 161.777 1.00 80.60  ?  903  LYS A C     1 
ATOM   3912  O  O     . LYS A 1 1031 ? 125.432 131.201 161.910 1.00 77.82  ?  903  LYS A O     1 
ATOM   3913  C  CB    . LYS A 1 1031 ? 124.634 133.848 163.651 1.00 88.00  ?  903  LYS A CB    1 
ATOM   3914  C  CG    . LYS A 1 1031 ? 125.097 132.835 164.681 1.00 76.31  ?  903  LYS A CG    1 
ATOM   3915  C  CD    . LYS A 1 1031 ? 126.614 132.831 164.777 1.00 71.67  ?  903  LYS A CD    1 
ATOM   3916  C  CE    . LYS A 1 1031 ? 127.091 132.042 165.978 1.00 69.84  ?  903  LYS A CE    1 
ATOM   3917  N  NZ    . LYS A 1 1031 ? 126.391 130.736 166.026 1.00 78.48  ?  903  LYS A NZ    1 
ATOM   3918  N  N     . LEU A 1 1032 ? 123.438 132.030 161.245 1.00 77.13  ?  904  LEU A N     1 
ATOM   3919  C  CA    . LEU A 1 1032 ? 122.993 130.763 160.669 1.00 71.96  ?  904  LEU A CA    1 
ATOM   3920  C  C     . LEU A 1 1032 ? 123.903 130.320 159.529 1.00 67.43  ?  904  LEU A C     1 
ATOM   3921  O  O     . LEU A 1 1032 ? 124.383 129.178 159.497 1.00 62.54  ?  904  LEU A O     1 
ATOM   3922  C  CB    . LEU A 1 1032 ? 121.561 130.911 160.162 1.00 73.39  ?  904  LEU A CB    1 
ATOM   3923  C  CG    . LEU A 1 1032 ? 121.137 129.896 159.102 1.00 73.96  ?  904  LEU A CG    1 
ATOM   3924  C  CD1   . LEU A 1 1032 ? 120.905 128.541 159.728 1.00 72.84  ?  904  LEU A CD1   1 
ATOM   3925  C  CD2   . LEU A 1 1032 ? 119.916 130.354 158.322 1.00 72.28  ?  904  LEU A CD2   1 
ATOM   3926  N  N     . MET A 1 1033 ? 124.106 131.206 158.556 1.00 66.99  ?  905  MET A N     1 
ATOM   3927  C  CA    . MET A 1 1033 ? 125.005 130.925 157.448 1.00 65.62  ?  905  MET A CA    1 
ATOM   3928  C  C     . MET A 1 1033 ? 126.405 130.578 157.937 1.00 64.52  ?  905  MET A C     1 
ATOM   3929  O  O     . MET A 1 1033 ? 127.079 129.724 157.355 1.00 59.11  ?  905  MET A O     1 
ATOM   3930  C  CB    . MET A 1 1033 ? 125.043 132.137 156.525 1.00 74.88  ?  905  MET A CB    1 
ATOM   3931  C  CG    . MET A 1 1033 ? 126.167 132.109 155.520 1.00 81.93  ?  905  MET A CG    1 
ATOM   3932  S  SD    . MET A 1 1033 ? 126.037 130.677 154.439 1.00 99.58  ?  905  MET A SD    1 
ATOM   3933  C  CE    . MET A 1 1033 ? 124.329 130.806 153.899 1.00 83.64  ?  905  MET A CE    1 
ATOM   3934  N  N     . ASP A 1 1034 ? 126.869 131.255 158.989 1.00 77.05  ?  906  ASP A N     1 
ATOM   3935  C  CA    . ASP A 1 1034 ? 128.196 130.976 159.534 1.00 80.33  ?  906  ASP A CA    1 
ATOM   3936  C  C     . ASP A 1 1034 ? 128.278 129.549 160.057 1.00 66.71  ?  906  ASP A C     1 
ATOM   3937  O  O     . ASP A 1 1034 ? 129.230 128.815 159.758 1.00 61.75  ?  906  ASP A O     1 
ATOM   3938  C  CB    . ASP A 1 1034 ? 128.507 131.984 160.639 1.00 98.33  ?  906  ASP A CB    1 
ATOM   3939  C  CG    . ASP A 1 1034 ? 129.972 131.986 161.057 1.00 124.68 ?  906  ASP A CG    1 
ATOM   3940  O  OD1   . ASP A 1 1034 ? 130.558 130.896 161.256 1.00 108.31 ?  906  ASP A OD1   1 
ATOM   3941  O  OD2   . ASP A 1 1034 ? 130.536 133.090 161.207 1.00 193.92 -1 906  ASP A OD2   1 
ATOM   3942  N  N     . LEU A 1 1035 ? 127.302 129.155 160.875 1.00 65.73  ?  907  LEU A N     1 
ATOM   3943  C  CA    . LEU A 1 1035 ? 127.227 127.771 161.327 1.00 61.98  ?  907  LEU A CA    1 
ATOM   3944  C  C     . LEU A 1 1035 ? 127.246 126.819 160.139 1.00 57.05  ?  907  LEU A C     1 
ATOM   3945  O  O     . LEU A 1 1035 ? 127.961 125.805 160.139 1.00 59.15  ?  907  LEU A O     1 
ATOM   3946  C  CB    . LEU A 1 1035 ? 125.959 127.573 162.151 1.00 67.57  ?  907  LEU A CB    1 
ATOM   3947  C  CG    . LEU A 1 1035 ? 125.970 128.197 163.543 1.00 77.96  ?  907  LEU A CG    1 
ATOM   3948  C  CD1   . LEU A 1 1035 ? 124.653 127.949 164.265 1.00 80.43  ?  907  LEU A CD1   1 
ATOM   3949  C  CD2   . LEU A 1 1035 ? 127.136 127.643 164.334 1.00 82.19  ?  907  LEU A CD2   1 
ATOM   3950  N  N     . TYR A 1 1036 ? 126.449 127.134 159.114 1.00 55.48  ?  908  TYR A N     1 
ATOM   3951  C  CA    . TYR A 1 1036 ? 126.379 126.276 157.937 1.00 50.30  ?  908  TYR A CA    1 
ATOM   3952  C  C     . TYR A 1 1036 ? 127.739 126.140 157.274 1.00 46.92  ?  908  TYR A C     1 
ATOM   3953  O  O     . TYR A 1 1036 ? 128.133 125.048 156.853 1.00 48.16  ?  908  TYR A O     1 
ATOM   3954  C  CB    . TYR A 1 1036 ? 125.365 126.820 156.937 1.00 56.40  ?  908  TYR A CB    1 
ATOM   3955  C  CG    . TYR A 1 1036 ? 125.132 125.878 155.772 1.00 54.03  ?  908  TYR A CG    1 
ATOM   3956  C  CD1   . TYR A 1 1036 ? 125.959 125.908 154.660 1.00 55.11  ?  908  TYR A CD1   1 
ATOM   3957  C  CD2   . TYR A 1 1036 ? 124.101 124.952 155.788 1.00 50.09  ?  908  TYR A CD2   1 
ATOM   3958  C  CE1   . TYR A 1 1036 ? 125.768 125.051 153.602 1.00 49.49  ?  908  TYR A CE1   1 
ATOM   3959  C  CE2   . TYR A 1 1036 ? 123.902 124.091 154.728 1.00 44.46  ?  908  TYR A CE2   1 
ATOM   3960  C  CZ    . TYR A 1 1036 ? 124.740 124.148 153.639 1.00 42.62  ?  908  TYR A CZ    1 
ATOM   3961  O  OH    . TYR A 1 1036 ? 124.555 123.299 152.581 1.00 47.72  ?  908  TYR A OH    1 
ATOM   3962  N  N     . LEU A 1 1037 ? 128.450 127.253 157.127 1.00 50.07  ?  909  LEU A N     1 
ATOM   3963  C  CA    . LEU A 1 1037 ? 129.758 127.203 156.493 1.00 46.49  ?  909  LEU A CA    1 
ATOM   3964  C  C     . LEU A 1 1037 ? 130.743 126.419 157.338 1.00 48.11  ?  909  LEU A C     1 
ATOM   3965  O  O     . LEU A 1 1037 ? 131.624 125.748 156.796 1.00 50.14  ?  909  LEU A O     1 
ATOM   3966  C  CB    . LEU A 1 1037 ? 130.278 128.618 156.234 1.00 57.34  ?  909  LEU A CB    1 
ATOM   3967  C  CG    . LEU A 1 1037 ? 129.615 129.396 155.092 1.00 65.10  ?  909  LEU A CG    1 
ATOM   3968  C  CD1   . LEU A 1 1037 ? 130.254 130.771 154.879 1.00 68.88  ?  909  LEU A CD1   1 
ATOM   3969  C  CD2   . LEU A 1 1037 ? 129.671 128.577 153.817 1.00 63.24  ?  909  LEU A CD2   1 
ATOM   3970  N  N     . GLN A 1 1038 ? 130.613 126.489 158.658 1.00 52.69  ?  910  GLN A N     1 
ATOM   3971  C  CA    . GLN A 1 1038 ? 131.526 125.737 159.507 1.00 56.98  ?  910  GLN A CA    1 
ATOM   3972  C  C     . GLN A 1 1038 ? 131.244 124.241 159.445 1.00 56.54  ?  910  GLN A C     1 
ATOM   3973  O  O     . GLN A 1 1038 ? 132.161 123.436 159.640 1.00 55.07  ?  910  GLN A O     1 
ATOM   3974  C  CB    . GLN A 1 1038 ? 131.437 126.251 160.949 1.00 59.22  ?  910  GLN A CB    1 
ATOM   3975  C  CG    . GLN A 1 1038 ? 132.510 127.262 161.325 1.00 59.56  ?  910  GLN A CG    1 
ATOM   3976  C  CD    . GLN A 1 1038 ? 133.894 126.649 161.420 1.00 60.25  ?  910  GLN A CD    1 
ATOM   3977  O  OE1   . GLN A 1 1038 ? 134.061 125.431 161.341 1.00 60.49  ?  910  GLN A OE1   1 
ATOM   3978  N  NE2   . GLN A 1 1038 ? 134.903 127.501 161.568 1.00 63.22  ?  910  GLN A NE2   1 
ATOM   3979  N  N     . MET A 1 1039 ? 129.996 123.852 159.165 1.00 54.89  ?  911  MET A N     1 
ATOM   3980  C  CA    . MET A 1 1039 ? 129.606 122.447 159.253 1.00 54.09  ?  911  MET A CA    1 
ATOM   3981  C  C     . MET A 1 1039 ? 129.538 121.727 157.913 1.00 44.89  ?  911  MET A C     1 
ATOM   3982  O  O     . MET A 1 1039 ? 129.666 120.499 157.884 1.00 44.76  ?  911  MET A O     1 
ATOM   3983  C  CB    . MET A 1 1039 ? 128.239 122.319 159.929 1.00 61.52  ?  911  MET A CB    1 
ATOM   3984  C  CG    . MET A 1 1039 ? 127.103 122.928 159.129 1.00 58.52  ?  911  MET A CG    1 
ATOM   3985  S  SD    . MET A 1 1039 ? 125.691 123.313 160.180 1.00 86.94  ?  911  MET A SD    1 
ATOM   3986  C  CE    . MET A 1 1039 ? 125.634 121.857 161.231 1.00 77.70  ?  911  MET A CE    1 
ATOM   3987  N  N     . LYS A 1 1040 ? 129.331 122.443 156.815 1.00 49.76  ?  912  LYS A N     1 
ATOM   3988  C  CA    . LYS A 1 1040 ? 129.126 121.782 155.528 1.00 47.92  ?  912  LYS A CA    1 
ATOM   3989  C  C     . LYS A 1 1040 ? 130.336 120.985 155.055 1.00 44.09  ?  912  LYS A C     1 
ATOM   3990  O  O     . LYS A 1 1040 ? 130.155 119.822 154.661 1.00 44.09  ?  912  LYS A O     1 
ATOM   3991  C  CB    . LYS A 1 1040 ? 128.694 122.826 154.492 1.00 52.29  ?  912  LYS A CB    1 
ATOM   3992  C  CG    . LYS A 1 1040 ? 129.371 122.703 153.132 1.00 46.10  ?  912  LYS A CG    1 
ATOM   3993  C  CD    . LYS A 1 1040 ? 128.775 123.638 152.089 1.00 45.80  ?  912  LYS A CD    1 
ATOM   3994  C  CE    . LYS A 1 1040 ? 129.718 123.795 150.910 1.00 44.27  ?  912  LYS A CE    1 
ATOM   3995  N  NZ    . LYS A 1 1040 ? 130.921 124.588 151.272 1.00 37.72  ?  912  LYS A NZ    1 
ATOM   3996  N  N     . PRO A 1 1041 ? 131.579 121.506 155.081 1.00 45.50  ?  913  PRO A N     1 
ATOM   3997  C  CA    . PRO A 1 1041 ? 132.687 120.770 154.454 1.00 43.62  ?  913  PRO A CA    1 
ATOM   3998  C  C     . PRO A 1 1041 ? 132.981 119.428 155.101 1.00 43.85  ?  913  PRO A C     1 
ATOM   3999  O  O     . PRO A 1 1041 ? 133.929 118.743 154.710 1.00 48.50  ?  913  PRO A O     1 
ATOM   4000  C  CB    . PRO A 1 1041 ? 133.875 121.728 154.610 1.00 46.25  ?  913  PRO A CB    1 
ATOM   4001  C  CG    . PRO A 1 1041 ? 133.532 122.555 155.766 1.00 47.95  ?  913  PRO A CG    1 
ATOM   4002  C  CD    . PRO A 1 1041 ? 132.057 122.769 155.668 1.00 50.10  ?  913  PRO A CD    1 
ATOM   4003  N  N     . VAL A 1 1042 ? 132.183 119.048 156.095 1.00 45.65  ?  914  VAL A N     1 
ATOM   4004  C  CA    . VAL A 1 1042 ? 132.361 117.748 156.727 1.00 48.29  ?  914  VAL A CA    1 
ATOM   4005  C  C     . VAL A 1 1042 ? 131.987 116.625 155.761 1.00 50.49  ?  914  VAL A C     1 
ATOM   4006  O  O     . VAL A 1 1042 ? 132.779 115.706 155.527 1.00 52.61  ?  914  VAL A O     1 
ATOM   4007  C  CB    . VAL A 1 1042 ? 131.553 117.681 158.035 1.00 53.64  ?  914  VAL A CB    1 
ATOM   4008  C  CG1   . VAL A 1 1042 ? 131.733 116.334 158.701 1.00 59.99  ?  914  VAL A CG1   1 
ATOM   4009  C  CG2   . VAL A 1 1042 ? 131.995 118.783 158.983 1.00 60.73  ?  914  VAL A CG2   1 
ATOM   4010  N  N     . TRP A 1 1043 ? 130.790 116.691 155.161 1.00 49.87  ?  915  TRP A N     1 
ATOM   4011  C  CA    . TRP A 1 1043 ? 130.372 115.653 154.220 1.00 45.10  ?  915  TRP A CA    1 
ATOM   4012  C  C     . TRP A 1 1043 ? 130.885 115.901 152.810 1.00 43.78  ?  915  TRP A C     1 
ATOM   4013  O  O     . TRP A 1 1043 ? 131.074 114.944 152.050 1.00 41.34  ?  915  TRP A O     1 
ATOM   4014  C  CB    . TRP A 1 1043 ? 128.846 115.516 154.174 1.00 42.94  ?  915  TRP A CB    1 
ATOM   4015  C  CG    . TRP A 1 1043 ? 128.069 116.752 154.459 1.00 47.50  ?  915  TRP A CG    1 
ATOM   4016  C  CD1   . TRP A 1 1043 ? 127.405 117.055 155.611 1.00 48.24  ?  915  TRP A CD1   1 
ATOM   4017  C  CD2   . TRP A 1 1043 ? 127.849 117.846 153.568 1.00 53.98  ?  915  TRP A CD2   1 
ATOM   4018  N  NE1   . TRP A 1 1043 ? 126.794 118.281 155.496 1.00 54.69  ?  915  TRP A NE1   1 
ATOM   4019  C  CE2   . TRP A 1 1043 ? 127.052 118.787 154.250 1.00 54.24  ?  915  TRP A CE2   1 
ATOM   4020  C  CE3   . TRP A 1 1043 ? 128.254 118.124 152.260 1.00 56.89  ?  915  TRP A CE3   1 
ATOM   4021  C  CZ2   . TRP A 1 1043 ? 126.655 119.983 153.671 1.00 52.06  ?  915  TRP A CZ2   1 
ATOM   4022  C  CZ3   . TRP A 1 1043 ? 127.869 119.305 151.691 1.00 63.19  ?  915  TRP A CZ3   1 
ATOM   4023  C  CH2   . TRP A 1 1043 ? 127.071 120.224 152.391 1.00 60.78  ?  915  TRP A CH2   1 
ATOM   4024  N  N     . ARG A 1 1044 ? 131.112 117.164 152.441 1.00 47.70  ?  916  ARG A N     1 
ATOM   4025  C  CA    . ARG A 1 1044 ? 131.798 117.457 151.190 1.00 45.97  ?  916  ARG A CA    1 
ATOM   4026  C  C     . ARG A 1 1044 ? 133.181 116.834 151.159 1.00 47.60  ?  916  ARG A C     1 
ATOM   4027  O  O     . ARG A 1 1044 ? 133.681 116.473 150.088 1.00 46.74  ?  916  ARG A O     1 
ATOM   4028  C  CB    . ARG A 1 1044 ? 131.896 118.969 150.996 1.00 47.99  ?  916  ARG A CB    1 
ATOM   4029  C  CG    . ARG A 1 1044 ? 132.762 119.391 149.815 1.00 51.15  ?  916  ARG A CG    1 
ATOM   4030  C  CD    . ARG A 1 1044 ? 132.147 118.915 148.530 1.00 54.45  ?  916  ARG A CD    1 
ATOM   4031  N  NE    . ARG A 1 1044 ? 130.817 119.466 148.341 1.00 59.82  ?  916  ARG A NE    1 
ATOM   4032  C  CZ    . ARG A 1 1044 ? 130.163 119.461 147.187 1.00 63.40  ?  916  ARG A CZ    1 
ATOM   4033  N  NH1   . ARG A 1 1044 ? 130.707 118.911 146.115 1.00 62.82  ?  916  ARG A NH1   1 
ATOM   4034  N  NH2   . ARG A 1 1044 ? 128.948 119.988 147.115 1.00 71.08  ?  916  ARG A NH2   1 
ATOM   4035  N  N     . SER A 1 1045 ? 133.806 116.694 152.324 1.00 53.48  ?  917  SER A N     1 
ATOM   4036  C  CA    . SER A 1 1045 ? 135.155 116.155 152.415 1.00 61.01  ?  917  SER A CA    1 
ATOM   4037  C  C     . SER A 1 1045 ? 135.232 114.765 151.793 1.00 57.55  ?  917  SER A C     1 
ATOM   4038  O  O     . SER A 1 1045 ? 134.279 113.984 151.837 1.00 49.35  ?  917  SER A O     1 
ATOM   4039  C  CB    . SER A 1 1045 ? 135.591 116.099 153.881 1.00 67.71  ?  917  SER A CB    1 
ATOM   4040  O  OG    . SER A 1 1045 ? 136.706 115.245 154.054 1.00 72.84  ?  917  SER A OG    1 
ATOM   4041  N  N     . THR A 1 1046 ? 136.385 114.467 151.197 1.00 60.67  ?  918  THR A N     1 
ATOM   4042  C  CA    . THR A 1 1046 ? 136.645 113.116 150.716 1.00 55.31  ?  918  THR A CA    1 
ATOM   4043  C  C     . THR A 1 1046 ? 137.071 112.209 151.864 1.00 59.56  ?  918  THR A C     1 
ATOM   4044  O  O     . THR A 1 1046 ? 136.727 111.022 151.880 1.00 55.46  ?  918  THR A O     1 
ATOM   4045  C  CB    . THR A 1 1046 ? 137.706 113.147 149.612 1.00 59.25  ?  918  THR A CB    1 
ATOM   4046  O  OG1   . THR A 1 1046 ? 137.284 114.038 148.572 1.00 53.66  ?  918  THR A OG1   1 
ATOM   4047  C  CG2   . THR A 1 1046 ? 137.897 111.768 149.013 1.00 51.97  ?  918  THR A CG2   1 
ATOM   4048  N  N     . CYS A 1 1047 ? 137.808 112.754 152.831 1.00 65.55  ?  919  CYS A N     1 
ATOM   4049  C  CA    . CYS A 1 1047 ? 138.168 112.033 154.051 1.00 73.45  ?  919  CYS A CA    1 
ATOM   4050  C  C     . CYS A 1 1047 ? 138.269 113.017 155.214 1.00 76.47  ?  919  CYS A C     1 
ATOM   4051  O  O     . CYS A 1 1047 ? 139.329 113.627 155.427 1.00 77.79  ?  919  CYS A O     1 
ATOM   4052  C  CB    . CYS A 1 1047 ? 139.475 111.264 153.865 1.00 78.20  ?  919  CYS A CB    1 
ATOM   4053  S  SG    . CYS A 1 1047 ? 140.044 110.299 155.291 1.00 132.55 ?  919  CYS A SG    1 
ATOM   4054  N  N     . PRO A 1 1048 ? 137.198 113.188 155.995 1.00 76.18  ?  920  PRO A N     1 
ATOM   4055  C  CA    . PRO A 1 1048 ? 137.283 114.091 157.156 1.00 77.37  ?  920  PRO A CA    1 
ATOM   4056  C  C     . PRO A 1 1048 ? 138.293 113.643 158.191 1.00 80.97  ?  920  PRO A C     1 
ATOM   4057  O  O     . PRO A 1 1048 ? 138.923 114.491 158.838 1.00 80.54  ?  920  PRO A O     1 
ATOM   4058  C  CB    . PRO A 1 1048 ? 135.852 114.078 157.710 1.00 71.88  ?  920  PRO A CB    1 
ATOM   4059  C  CG    . PRO A 1 1048 ? 135.267 112.806 157.221 1.00 64.60  ?  920  PRO A CG    1 
ATOM   4060  C  CD    . PRO A 1 1048 ? 135.858 112.598 155.860 1.00 64.98  ?  920  PRO A CD    1 
ATOM   4061  N  N     . SER A 1 1049 ? 138.472 112.330 158.360 1.00 80.86  ?  921  SER A N     1 
ATOM   4062  C  CA    . SER A 1 1049 ? 139.532 111.780 159.198 1.00 87.02  ?  921  SER A CA    1 
ATOM   4063  C  C     . SER A 1 1049 ? 140.922 112.143 158.693 1.00 86.14  ?  921  SER A C     1 
ATOM   4064  O  O     . SER A 1 1049 ? 141.910 111.814 159.358 1.00 84.82  ?  921  SER A O     1 
ATOM   4065  C  CB    . SER A 1 1049 ? 139.377 110.255 159.285 1.00 81.91  ?  921  SER A CB    1 
ATOM   4066  O  OG    . SER A 1 1049 ? 139.512 109.644 158.014 1.00 79.86  ?  921  SER A OG    1 
ATOM   4067  N  N     . ARG A 1 1050 ? 141.023 112.795 157.535 1.00 82.83  ?  922  ARG A N     1 
ATOM   4068  C  CA    . ARG A 1 1050 ? 142.295 113.290 157.023 1.00 80.63  ?  922  ARG A CA    1 
ATOM   4069  C  C     . ARG A 1 1050 ? 142.176 114.739 156.564 1.00 75.46  ?  922  ARG A C     1 
ATOM   4070  O  O     . ARG A 1 1050 ? 143.173 115.466 156.527 1.00 74.61  ?  922  ARG A O     1 
ATOM   4071  C  CB    . ARG A 1 1050 ? 142.795 112.400 155.881 1.00 77.75  ?  922  ARG A CB    1 
ATOM   4072  C  CG    . ARG A 1 1050 ? 144.260 112.586 155.529 1.00 74.78  ?  922  ARG A CG    1 
ATOM   4073  C  CD    . ARG A 1 1050 ? 144.415 112.686 154.032 1.00 71.18  ?  922  ARG A CD    1 
ATOM   4074  N  NE    . ARG A 1 1050 ? 143.544 113.728 153.506 1.00 72.73  ?  922  ARG A NE    1 
ATOM   4075  C  CZ    . ARG A 1 1050 ? 143.253 113.883 152.221 1.00 75.34  ?  922  ARG A CZ    1 
ATOM   4076  N  NH1   . ARG A 1 1050 ? 143.776 113.068 151.315 1.00 76.45  ?  922  ARG A NH1   1 
ATOM   4077  N  NH2   . ARG A 1 1050 ? 142.441 114.860 151.844 1.00 79.34  ?  922  ARG A NH2   1 
ATOM   4078  N  N     . ASP A 1 1051 ? 140.971 115.171 156.192 1.00 76.19  ?  923  ASP A N     1 
ATOM   4079  C  CA    . ASP A 1 1051 ? 140.785 116.559 155.777 1.00 79.73  ?  923  ASP A CA    1 
ATOM   4080  C  C     . ASP A 1 1051 ? 140.772 117.497 156.974 1.00 80.97  ?  923  ASP A C     1 
ATOM   4081  O  O     . ASP A 1 1051 ? 141.672 118.327 157.134 1.00 92.24  ?  923  ASP A O     1 
ATOM   4082  C  CB    . ASP A 1 1051 ? 139.487 116.706 154.975 1.00 87.22  ?  923  ASP A CB    1 
ATOM   4083  C  CG    . ASP A 1 1051 ? 139.295 118.108 154.403 1.00 111.36 ?  923  ASP A CG    1 
ATOM   4084  O  OD1   . ASP A 1 1051 ? 139.251 119.090 155.173 1.00 102.08 ?  923  ASP A OD1   1 
ATOM   4085  O  OD2   . ASP A 1 1051 ? 139.205 118.233 153.167 1.00 205.50 -1 923  ASP A OD2   1 
ATOM   4086  N  N     . CYS A 1 1052 ? 139.767 117.372 157.827 1.00 78.53  ?  924  CYS A N     1 
ATOM   4087  C  CA    . CYS A 1 1052 ? 139.616 118.318 158.920 1.00 79.13  ?  924  CYS A CA    1 
ATOM   4088  C  C     . CYS A 1 1052 ? 138.847 117.685 160.073 1.00 81.23  ?  924  CYS A C     1 
ATOM   4089  O  O     . CYS A 1 1052 ? 137.649 117.943 160.247 1.00 82.92  ?  924  CYS A O     1 
ATOM   4090  C  CB    . CYS A 1 1052 ? 138.914 119.586 158.435 1.00 85.00  ?  924  CYS A CB    1 
ATOM   4091  S  SG    . CYS A 1 1052 ? 137.367 119.317 157.549 1.00 84.45  ?  924  CYS A SG    1 
ATOM   4092  N  N     . PRO A 1 1053 ? 139.507 116.867 160.894 1.00 80.61  ?  925  PRO A N     1 
ATOM   4093  C  CA    . PRO A 1 1053 ? 138.811 116.235 162.025 1.00 82.94  ?  925  PRO A CA    1 
ATOM   4094  C  C     . PRO A 1 1053 ? 138.277 117.227 163.053 1.00 92.23  ?  925  PRO A C     1 
ATOM   4095  O  O     . PRO A 1 1053 ? 137.497 116.820 163.923 1.00 90.49  ?  925  PRO A O     1 
ATOM   4096  C  CB    . PRO A 1 1053 ? 139.885 115.320 162.634 1.00 74.74  ?  925  PRO A CB    1 
ATOM   4097  C  CG    . PRO A 1 1053 ? 140.875 115.114 161.534 1.00 71.13  ?  925  PRO A CG    1 
ATOM   4098  C  CD    . PRO A 1 1053 ? 140.890 116.385 160.752 1.00 73.84  ?  925  PRO A CD    1 
ATOM   4099  N  N     . ASP A 1 1054 ? 138.654 118.506 162.966 1.00 98.95  ?  926  ASP A N     1 
ATOM   4100  C  CA    . ASP A 1 1054 ? 138.244 119.484 163.971 1.00 103.67 ?  926  ASP A CA    1 
ATOM   4101  C  C     . ASP A 1 1054 ? 136.739 119.745 163.928 1.00 100.02 ?  926  ASP A C     1 
ATOM   4102  O  O     . ASP A 1 1054 ? 136.063 119.662 164.960 1.00 97.66  ?  926  ASP A O     1 
ATOM   4103  C  CB    . ASP A 1 1054 ? 139.033 120.786 163.799 1.00 117.52 ?  926  ASP A CB    1 
ATOM   4104  C  CG    . ASP A 1 1054 ? 139.191 121.194 162.343 1.00 127.72 ?  926  ASP A CG    1 
ATOM   4105  O  OD1   . ASP A 1 1054 ? 139.283 120.301 161.481 1.00 108.59 ?  926  ASP A OD1   1 
ATOM   4106  O  OD2   . ASP A 1 1054 ? 139.218 122.415 162.056 1.00 254.73 -1 926  ASP A OD2   1 
ATOM   4107  N  N     . GLN A 1 1055 ? 136.191 120.081 162.752 1.00 99.25  ?  927  GLN A N     1 
ATOM   4108  C  CA    . GLN A 1 1055 ? 134.748 120.289 162.664 1.00 96.43  ?  927  GLN A CA    1 
ATOM   4109  C  C     . GLN A 1 1055 ? 134.000 119.008 162.996 1.00 91.89  ?  927  GLN A C     1 
ATOM   4110  O  O     . GLN A 1 1055 ? 132.911 119.049 163.580 1.00 92.25  ?  927  GLN A O     1 
ATOM   4111  C  CB    . GLN A 1 1055 ? 134.339 120.781 161.273 1.00 89.55  ?  927  GLN A CB    1 
ATOM   4112  C  CG    . GLN A 1 1055 ? 134.946 122.098 160.805 1.00 92.67  ?  927  GLN A CG    1 
ATOM   4113  C  CD    . GLN A 1 1055 ? 136.352 121.918 160.294 1.00 104.12 ?  927  GLN A CD    1 
ATOM   4114  O  OE1   . GLN A 1 1055 ? 136.884 120.812 160.325 1.00 101.76 ?  927  GLN A OE1   1 
ATOM   4115  N  NE2   . GLN A 1 1055 ? 136.968 122.998 159.825 1.00 109.47 ?  927  GLN A NE2   1 
ATOM   4116  N  N     . LEU A 1 1056 ? 134.559 117.861 162.606 1.00 84.89  ?  928  LEU A N     1 
ATOM   4117  C  CA    . LEU A 1 1056 ? 133.926 116.585 162.912 1.00 77.81  ?  928  LEU A CA    1 
ATOM   4118  C  C     . LEU A 1 1056 ? 133.799 116.379 164.417 1.00 81.62  ?  928  LEU A C     1 
ATOM   4119  O  O     . LEU A 1 1056 ? 132.737 115.980 164.908 1.00 80.83  ?  928  LEU A O     1 
ATOM   4120  C  CB    . LEU A 1 1056 ? 134.717 115.450 162.269 1.00 67.03  ?  928  LEU A CB    1 
ATOM   4121  C  CG    . LEU A 1 1056 ? 134.343 114.042 162.714 1.00 63.27  ?  928  LEU A CG    1 
ATOM   4122  C  CD1   . LEU A 1 1056 ? 132.867 113.795 162.494 1.00 62.22  ?  928  LEU A CD1   1 
ATOM   4123  C  CD2   . LEU A 1 1056 ? 135.184 113.002 161.988 1.00 61.51  ?  928  LEU A CD2   1 
ATOM   4124  N  N     . CYS A 1 1057 ? 134.869 116.648 165.169 1.00 86.10  ?  929  CYS A N     1 
ATOM   4125  C  CA    . CYS A 1 1057 ? 134.789 116.575 166.624 1.00 88.62  ?  929  CYS A CA    1 
ATOM   4126  C  C     . CYS A 1 1057 ? 133.933 117.691 167.209 1.00 95.22  ?  929  CYS A C     1 
ATOM   4127  O  O     . CYS A 1 1057 ? 133.377 117.519 168.297 1.00 102.62 ?  929  CYS A O     1 
ATOM   4128  C  CB    . CYS A 1 1057 ? 136.194 116.623 167.230 1.00 92.11  ?  929  CYS A CB    1 
ATOM   4129  S  SG    . CYS A 1 1057 ? 136.288 116.275 169.008 1.00 101.70 ?  929  CYS A SG    1 
ATOM   4130  N  N     . GLN A 1 1058 ? 133.827 118.829 166.522 1.00 97.33  ?  930  GLN A N     1 
ATOM   4131  C  CA    . GLN A 1 1058 ? 132.960 119.931 166.921 1.00 96.56  ?  930  GLN A CA    1 
ATOM   4132  C  C     . GLN A 1 1058 ? 131.644 119.930 166.152 1.00 90.02  ?  930  GLN A C     1 
ATOM   4133  O  O     . GLN A 1 1058 ? 131.016 120.980 165.999 1.00 85.56  ?  930  GLN A O     1 
ATOM   4134  C  CB    . GLN A 1 1058 ? 133.677 121.271 166.735 1.00 95.08  ?  930  GLN A CB    1 
ATOM   4135  C  CG    . GLN A 1 1058 ? 134.965 121.423 167.529 1.00 95.94  ?  930  GLN A CG    1 
ATOM   4136  C  CD    . GLN A 1 1058 ? 134.733 121.419 169.027 1.00 98.37  ?  930  GLN A CD    1 
ATOM   4137  O  OE1   . GLN A 1 1058 ? 133.607 121.589 169.498 1.00 96.81  ?  930  GLN A OE1   1 
ATOM   4138  N  NE2   . GLN A 1 1058 ? 135.802 121.206 169.787 1.00 98.53  ?  930  GLN A NE2   1 
ATOM   4139  N  N     . TYR A 1 1059 ? 131.216 118.765 165.660 1.00 88.44  ?  931  TYR A N     1 
ATOM   4140  C  CA    . TYR A 1 1059 ? 130.008 118.674 164.850 1.00 82.01  ?  931  TYR A CA    1 
ATOM   4141  C  C     . TYR A 1 1059 ? 128.758 118.476 165.685 1.00 77.25  ?  931  TYR A C     1 
ATOM   4142  O  O     . TYR A 1 1059 ? 127.692 118.970 165.310 1.00 74.26  ?  931  TYR A O     1 
ATOM   4143  C  CB    . TYR A 1 1059 ? 130.112 117.521 163.848 1.00 98.84  ?  931  TYR A CB    1 
ATOM   4144  C  CG    . TYR A 1 1059 ? 129.086 117.621 162.746 1.00 106.78 ?  931  TYR A CG    1 
ATOM   4145  C  CD1   . TYR A 1 1059 ? 127.838 117.039 162.876 1.00 67.58  ?  931  TYR A CD1   1 
ATOM   4146  C  CD2   . TYR A 1 1059 ? 129.365 118.316 161.582 1.00 90.32  ?  931  TYR A CD2   1 
ATOM   4147  C  CE1   . TYR A 1 1059 ? 126.900 117.142 161.875 1.00 61.73  ?  931  TYR A CE1   1 
ATOM   4148  C  CE2   . TYR A 1 1059 ? 128.436 118.423 160.574 1.00 59.41  ?  931  TYR A CE2   1 
ATOM   4149  C  CZ    . TYR A 1 1059 ? 127.206 117.835 160.725 1.00 57.28  ?  931  TYR A CZ    1 
ATOM   4150  O  OH    . TYR A 1 1059 ? 126.281 117.940 159.720 1.00 51.51  ?  931  TYR A OH    1 
ATOM   4151  N  N     . SER A 1 1060 ? 128.866 117.748 166.795 1.00 83.55  ?  932  SER A N     1 
ATOM   4152  C  CA    . SER A 1 1060 ? 127.726 117.557 167.682 1.00 84.34  ?  932  SER A CA    1 
ATOM   4153  C  C     . SER A 1 1060 ? 127.206 118.894 168.195 1.00 88.17  ?  932  SER A C     1 
ATOM   4154  O  O     . SER A 1 1060 ? 126.035 119.237 167.997 1.00 90.21  ?  932  SER A O     1 
ATOM   4155  C  CB    . SER A 1 1060 ? 128.120 116.646 168.847 1.00 90.83  ?  932  SER A CB    1 
ATOM   4156  O  OG    . SER A 1 1060 ? 128.793 115.483 168.389 1.00 93.65  ?  932  SER A OG    1 
ATOM   4157  N  N     . TYR A 1 1061 ? 128.073 119.666 168.860 1.00 91.79  ?  933  TYR A N     1 
ATOM   4158  C  CA    . TYR A 1 1061 ? 127.652 120.950 169.418 1.00 95.70  ?  933  TYR A CA    1 
ATOM   4159  C  C     . TYR A 1 1061 ? 127.291 121.955 168.325 1.00 93.93  ?  933  TYR A C     1 
ATOM   4160  O  O     . TYR A 1 1061 ? 126.366 122.757 168.505 1.00 95.27  ?  933  TYR A O     1 
ATOM   4161  C  CB    . TYR A 1 1061 ? 128.748 121.520 170.328 1.00 91.21  ?  933  TYR A CB    1 
ATOM   4162  C  CG    . TYR A 1 1061 ? 128.890 123.025 170.237 1.00 93.93  ?  933  TYR A CG    1 
ATOM   4163  C  CD1   . TYR A 1 1061 ? 127.990 123.874 170.872 1.00 94.43  ?  933  TYR A CD1   1 
ATOM   4164  C  CD2   . TYR A 1 1061 ? 129.910 123.594 169.488 1.00 91.63  ?  933  TYR A CD2   1 
ATOM   4165  C  CE1   . TYR A 1 1061 ? 128.109 125.250 170.771 1.00 94.60  ?  933  TYR A CE1   1 
ATOM   4166  C  CE2   . TYR A 1 1061 ? 130.038 124.966 169.382 1.00 93.33  ?  933  TYR A CE2   1 
ATOM   4167  C  CZ    . TYR A 1 1061 ? 129.138 125.790 170.025 1.00 95.51  ?  933  TYR A CZ    1 
ATOM   4168  O  OH    . TYR A 1 1061 ? 129.265 127.156 169.922 1.00 92.57  ?  933  TYR A OH    1 
ATOM   4169  N  N     . ASN A 1 1062 ? 127.990 121.919 167.186 1.00 86.87  ?  934  ASN A N     1 
ATOM   4170  C  CA    . ASN A 1 1062 ? 127.665 122.823 166.086 1.00 80.82  ?  934  ASN A CA    1 
ATOM   4171  C  C     . ASN A 1 1062 ? 126.272 122.532 165.544 1.00 78.95  ?  934  ASN A C     1 
ATOM   4172  O  O     . ASN A 1 1062 ? 125.464 123.447 165.342 1.00 79.04  ?  934  ASN A O     1 
ATOM   4173  C  CB    . ASN A 1 1062 ? 128.718 122.692 164.984 1.00 73.08  ?  934  ASN A CB    1 
ATOM   4174  C  CG    . ASN A 1 1062 ? 128.740 123.880 164.042 1.00 67.65  ?  934  ASN A CG    1 
ATOM   4175  O  OD1   . ASN A 1 1062 ? 127.766 124.138 163.335 1.00 68.66  ?  934  ASN A OD1   1 
ATOM   4176  N  ND2   . ASN A 1 1062 ? 129.863 124.594 164.007 1.00 62.20  ?  934  ASN A ND2   1 
ATOM   4177  N  N     . SER A 1 1063 ? 125.969 121.251 165.330 1.00 78.69  ?  935  SER A N     1 
ATOM   4178  C  CA    . SER A 1 1063 ? 124.648 120.847 164.869 1.00 77.14  ?  935  SER A CA    1 
ATOM   4179  C  C     . SER A 1 1063 ? 123.571 121.199 165.883 1.00 83.40  ?  935  SER A C     1 
ATOM   4180  O  O     . SER A 1 1063 ? 122.465 121.617 165.512 1.00 80.94  ?  935  SER A O     1 
ATOM   4181  C  CB    . SER A 1 1063 ? 124.646 119.347 164.597 1.00 74.67  ?  935  SER A CB    1 
ATOM   4182  O  OG    . SER A 1 1063 ? 125.199 118.634 165.693 1.00 76.18  ?  935  SER A OG    1 
ATOM   4183  N  N     . GLN A 1 1064 ? 123.864 121.004 167.170 1.00 97.30  ?  936  GLN A N     1 
ATOM   4184  C  CA    . GLN A 1 1064 ? 122.894 121.337 168.205 1.00 111.47 ?  936  GLN A CA    1 
ATOM   4185  C  C     . GLN A 1 1064 ? 122.568 122.825 168.177 1.00 112.07 ?  936  GLN A C     1 
ATOM   4186  O  O     . GLN A 1 1064 ? 121.395 123.212 168.135 1.00 114.21 ?  936  GLN A O     1 
ATOM   4187  C  CB    . GLN A 1 1064 ? 123.431 120.926 169.580 1.00 124.22 ?  936  GLN A CB    1 
ATOM   4188  C  CG    . GLN A 1 1064 ? 122.580 121.368 170.772 1.00 136.35 ?  936  GLN A CG    1 
ATOM   4189  C  CD    . GLN A 1 1064 ? 121.339 120.517 170.985 1.00 124.48 ?  936  GLN A CD    1 
ATOM   4190  O  OE1   . GLN A 1 1064 ? 121.382 119.494 171.671 1.00 116.66 ?  936  GLN A OE1   1 
ATOM   4191  N  NE2   . GLN A 1 1064 ? 120.233 120.921 170.375 1.00 125.83 ?  936  GLN A NE2   1 
ATOM   4192  N  N     . GLN A 1 1065 ? 123.604 123.675 168.198 1.00 107.63 ?  937  GLN A N     1 
ATOM   4193  C  CA    . GLN A 1 1065 ? 123.395 125.119 168.133 1.00 103.88 ?  937  GLN A CA    1 
ATOM   4194  C  C     . GLN A 1 1065 ? 122.643 125.507 166.867 1.00 95.91  ?  937  GLN A C     1 
ATOM   4195  O  O     . GLN A 1 1065 ? 121.806 126.423 166.883 1.00 99.65  ?  937  GLN A O     1 
ATOM   4196  C  CB    . GLN A 1 1065 ? 124.740 125.843 168.192 1.00 93.22  ?  937  GLN A CB    1 
ATOM   4197  C  CG    . GLN A 1 1065 ? 124.665 127.319 167.833 1.00 87.17  ?  937  GLN A CG    1 
ATOM   4198  C  CD    . GLN A 1 1065 ? 126.029 127.959 167.680 1.00 87.34  ?  937  GLN A CD    1 
ATOM   4199  O  OE1   . GLN A 1 1065 ? 126.158 129.038 167.101 1.00 86.35  ?  937  GLN A OE1   1 
ATOM   4200  N  NE2   . GLN A 1 1065 ? 127.060 127.286 168.181 1.00 87.44  ?  937  GLN A NE2   1 
ATOM   4201  N  N     . PHE A 1 1066 ? 122.931 124.819 165.758 1.00 82.62  ?  938  PHE A N     1 
ATOM   4202  C  CA    . PHE A 1 1066 ? 122.215 125.083 164.515 1.00 77.11  ?  938  PHE A CA    1 
ATOM   4203  C  C     . PHE A 1 1066 ? 120.728 124.835 164.689 1.00 77.68  ?  938  PHE A C     1 
ATOM   4204  O  O     . PHE A 1 1066 ? 119.895 125.685 164.350 1.00 78.24  ?  938  PHE A O     1 
ATOM   4205  C  CB    . PHE A 1 1066 ? 122.761 124.202 163.395 1.00 71.98  ?  938  PHE A CB    1 
ATOM   4206  C  CG    . PHE A 1 1066 ? 122.082 124.416 162.066 1.00 70.55  ?  938  PHE A CG    1 
ATOM   4207  C  CD1   . PHE A 1 1066 ? 120.851 123.842 161.793 1.00 64.91  ?  938  PHE A CD1   1 
ATOM   4208  C  CD2   . PHE A 1 1066 ? 122.676 125.185 161.086 1.00 67.83  ?  938  PHE A CD2   1 
ATOM   4209  C  CE1   . PHE A 1 1066 ? 120.231 124.043 160.582 1.00 56.94  ?  938  PHE A CE1   1 
ATOM   4210  C  CE2   . PHE A 1 1066 ? 122.057 125.374 159.871 1.00 61.43  ?  938  PHE A CE2   1 
ATOM   4211  C  CZ    . PHE A 1 1066 ? 120.834 124.804 159.623 1.00 56.07  ?  938  PHE A CZ    1 
ATOM   4212  N  N     . ALA A 1 1067 ? 120.381 123.645 165.175 1.00 80.86  ?  939  ALA A N     1 
ATOM   4213  C  CA    . ALA A 1 1067 ? 118.979 123.302 165.360 1.00 83.26  ?  939  ALA A CA    1 
ATOM   4214  C  C     . ALA A 1 1067 ? 118.303 124.260 166.332 1.00 92.96  ?  939  ALA A C     1 
ATOM   4215  O  O     . ALA A 1 1067 ? 117.128 124.609 166.159 1.00 88.92  ?  939  ALA A O     1 
ATOM   4216  C  CB    . ALA A 1 1067 ? 118.865 121.863 165.853 1.00 85.59  ?  939  ALA A CB    1 
ATOM   4217  N  N     . ASP A 1 1068 ? 119.041 124.708 167.354 1.00 108.57 ?  940  ASP A N     1 
ATOM   4218  C  CA    . ASP A 1 1068 ? 118.479 125.611 168.356 1.00 120.25 ?  940  ASP A CA    1 
ATOM   4219  C  C     . ASP A 1 1068 ? 118.117 126.955 167.742 1.00 101.14 ?  940  ASP A C     1 
ATOM   4220  O  O     . ASP A 1 1068 ? 117.005 127.463 167.941 1.00 91.12  ?  940  ASP A O     1 
ATOM   4221  C  CB    . ASP A 1 1068 ? 119.470 125.819 169.507 1.00 148.37 ?  940  ASP A CB    1 
ATOM   4222  C  CG    . ASP A 1 1068 ? 119.906 124.517 170.172 1.00 169.96 ?  940  ASP A CG    1 
ATOM   4223  O  OD1   . ASP A 1 1068 ? 119.069 123.603 170.337 1.00 159.48 ?  940  ASP A OD1   1 
ATOM   4224  O  OD2   . ASP A 1 1068 ? 121.104 124.408 170.524 1.00 269.04 -1 940  ASP A OD2   1 
ATOM   4225  N  N     . LEU A 1 1069 ? 119.068 127.566 167.031 1.00 95.40  ?  941  LEU A N     1 
ATOM   4226  C  CA    . LEU A 1 1069 ? 118.786 128.820 166.344 1.00 88.49  ?  941  LEU A CA    1 
ATOM   4227  C  C     . LEU A 1 1069 ? 117.634 128.654 165.359 1.00 83.31  ?  941  LEU A C     1 
ATOM   4228  O  O     . LEU A 1 1069 ? 116.706 129.476 165.318 1.00 78.15  ?  941  LEU A O     1 
ATOM   4229  C  CB    . LEU A 1 1069 ? 120.044 129.310 165.628 1.00 87.86  ?  941  LEU A CB    1 
ATOM   4230  C  CG    . LEU A 1 1069 ? 119.867 130.502 164.686 1.00 85.25  ?  941  LEU A CG    1 
ATOM   4231  C  CD1   . LEU A 1 1069 ? 119.340 131.718 165.430 1.00 90.40  ?  941  LEU A CD1   1 
ATOM   4232  C  CD2   . LEU A 1 1069 ? 121.151 130.834 163.926 1.00 78.69  ?  941  LEU A CD2   1 
ATOM   4233  N  N     . LEU A 1 1070 ? 117.676 127.582 164.557 1.00 82.84  ?  942  LEU A N     1 
ATOM   4234  C  CA    . LEU A 1 1070 ? 116.647 127.366 163.547 1.00 80.19  ?  942  LEU A CA    1 
ATOM   4235  C  C     . LEU A 1 1070 ? 115.266 127.321 164.185 1.00 76.44  ?  942  LEU A C     1 
ATOM   4236  O  O     . LEU A 1 1070 ? 114.362 128.064 163.787 1.00 71.34  ?  942  LEU A O     1 
ATOM   4237  C  CB    . LEU A 1 1070 ? 116.935 126.074 162.779 1.00 72.61  ?  942  LEU A CB    1 
ATOM   4238  C  CG    . LEU A 1 1070 ? 116.000 125.607 161.649 1.00 63.57  ?  942  LEU A CG    1 
ATOM   4239  C  CD1   . LEU A 1 1070 ? 114.868 124.719 162.153 1.00 64.28  ?  942  LEU A CD1   1 
ATOM   4240  C  CD2   . LEU A 1 1070 ? 115.449 126.778 160.854 1.00 64.14  ?  942  LEU A CD2   1 
ATOM   4241  N  N     . SER A 1 1071 ? 115.092 126.462 165.192 1.00 78.40  ?  943  SER A N     1 
ATOM   4242  C  CA    . SER A 1 1071 ? 113.803 126.367 165.865 1.00 75.92  ?  943  SER A CA    1 
ATOM   4243  C  C     . SER A 1 1071 ? 113.402 127.701 166.484 1.00 74.92  ?  943  SER A C     1 
ATOM   4244  O  O     . SER A 1 1071 ? 112.316 128.221 166.205 1.00 73.27  ?  943  SER A O     1 
ATOM   4245  C  CB    . SER A 1 1071 ? 113.839 125.274 166.934 1.00 78.62  ?  943  SER A CB    1 
ATOM   4246  O  OG    . SER A 1 1071 ? 114.201 124.015 166.391 1.00 78.76  ?  943  SER A OG    1 
ATOM   4247  N  N     . SER A 1 1072 ? 114.273 128.282 167.318 1.00 78.36  ?  944  SER A N     1 
ATOM   4248  C  CA    . SER A 1 1072 ? 113.886 129.458 168.095 1.00 79.00  ?  944  SER A CA    1 
ATOM   4249  C  C     . SER A 1 1072 ? 113.488 130.621 167.194 1.00 74.54  ?  944  SER A C     1 
ATOM   4250  O  O     . SER A 1 1072 ? 112.370 131.141 167.290 1.00 71.67  ?  944  SER A O     1 
ATOM   4251  C  CB    . SER A 1 1072 ? 115.027 129.867 169.028 1.00 76.42  ?  944  SER A CB    1 
ATOM   4252  O  OG    . SER A 1 1072 ? 114.675 130.988 169.825 1.00 69.86  ?  944  SER A OG    1 
ATOM   4253  N  N     . MET A 1 1073 ? 114.384 131.048 166.310 1.00 72.06  ?  945  MET A N     1 
ATOM   4254  C  CA    . MET A 1 1073 ? 114.081 132.220 165.501 1.00 70.52  ?  945  MET A CA    1 
ATOM   4255  C  C     . MET A 1 1073 ? 113.285 131.896 164.244 1.00 70.60  ?  945  MET A C     1 
ATOM   4256  O  O     . MET A 1 1073 ? 112.914 132.825 163.520 1.00 70.39  ?  945  MET A O     1 
ATOM   4257  C  CB    . MET A 1 1073 ? 115.372 132.958 165.117 1.00 73.99  ?  945  MET A CB    1 
ATOM   4258  C  CG    . MET A 1 1073 ? 116.132 133.560 166.293 1.00 79.19  ?  945  MET A CG    1 
ATOM   4259  S  SD    . MET A 1 1073 ? 116.884 135.166 165.926 1.00 92.61  ?  945  MET A SD    1 
ATOM   4260  C  CE    . MET A 1 1073 ? 115.453 136.106 165.414 1.00 81.49  ?  945  MET A CE    1 
ATOM   4261  N  N     . PHE A 1 1074 ? 113.003 130.613 163.964 1.00 72.84  ?  946  PHE A N     1 
ATOM   4262  C  CA    . PHE A 1 1074 ? 112.289 130.281 162.737 1.00 70.79  ?  946  PHE A CA    1 
ATOM   4263  C  C     . PHE A 1 1074 ? 111.256 129.167 162.915 1.00 68.65  ?  946  PHE A C     1 
ATOM   4264  O  O     . PHE A 1 1074 ? 110.934 128.478 161.941 1.00 66.86  ?  946  PHE A O     1 
ATOM   4265  C  CB    . PHE A 1 1074 ? 113.283 129.905 161.637 1.00 69.64  ?  946  PHE A CB    1 
ATOM   4266  C  CG    . PHE A 1 1074 ? 114.248 131.006 161.299 1.00 69.38  ?  946  PHE A CG    1 
ATOM   4267  C  CD1   . PHE A 1 1074 ? 113.894 132.022 160.429 1.00 72.49  ?  946  PHE A CD1   1 
ATOM   4268  C  CD2   . PHE A 1 1074 ? 115.503 131.035 161.870 1.00 67.32  ?  946  PHE A CD2   1 
ATOM   4269  C  CE1   . PHE A 1 1074 ? 114.786 133.035 160.130 1.00 76.31  ?  946  PHE A CE1   1 
ATOM   4270  C  CE2   . PHE A 1 1074 ? 116.389 132.043 161.572 1.00 69.13  ?  946  PHE A CE2   1 
ATOM   4271  C  CZ    . PHE A 1 1074 ? 116.030 133.041 160.704 1.00 73.64  ?  946  PHE A CZ    1 
ATOM   4272  N  N     . LYS A 1 1075 ? 110.715 128.973 164.122 1.00 71.20  ?  947  LYS A N     1 
ATOM   4273  C  CA    . LYS A 1 1075 ? 109.620 128.022 164.295 1.00 72.58  ?  947  LYS A CA    1 
ATOM   4274  C  C     . LYS A 1 1075 ? 108.392 128.423 163.487 1.00 73.42  ?  947  LYS A C     1 
ATOM   4275  O  O     . LYS A 1 1075 ? 107.525 127.579 163.230 1.00 79.52  ?  947  LYS A O     1 
ATOM   4276  C  CB    . LYS A 1 1075 ? 109.253 127.889 165.782 1.00 77.57  ?  947  LYS A CB    1 
ATOM   4277  C  CG    . LYS A 1 1075 ? 108.197 126.825 166.079 1.00 79.75  ?  947  LYS A CG    1 
ATOM   4278  C  CD    . LYS A 1 1075 ? 107.917 126.669 167.568 1.00 83.68  ?  947  LYS A CD    1 
ATOM   4279  C  CE    . LYS A 1 1075 ? 109.078 126.009 168.287 1.00 88.13  ?  947  LYS A CE    1 
ATOM   4280  N  NZ    . LYS A 1 1075 ? 108.782 125.813 169.732 1.00 89.95  ?  947  LYS A NZ    1 
ATOM   4281  N  N     . TYR A 1 1076 ? 108.313 129.693 163.071 1.00 73.83  ?  948  TYR A N     1 
ATOM   4282  C  CA    . TYR A 1 1076 ? 107.208 130.167 162.242 1.00 78.03  ?  948  TYR A CA    1 
ATOM   4283  C  C     . TYR A 1 1076 ? 106.988 129.287 161.021 1.00 77.55  ?  948  TYR A C     1 
ATOM   4284  O  O     . TYR A 1 1076 ? 105.863 129.192 160.518 1.00 80.10  ?  948  TYR A O     1 
ATOM   4285  C  CB    . TYR A 1 1076 ? 107.484 131.596 161.774 1.00 78.33  ?  948  TYR A CB    1 
ATOM   4286  C  CG    . TYR A 1 1076 ? 108.415 131.637 160.582 1.00 72.21  ?  948  TYR A CG    1 
ATOM   4287  C  CD1   . TYR A 1 1076 ? 109.746 131.273 160.713 1.00 69.80  ?  948  TYR A CD1   1 
ATOM   4288  C  CD2   . TYR A 1 1076 ? 107.954 131.982 159.319 1.00 67.15  ?  948  TYR A CD2   1 
ATOM   4289  C  CE1   . TYR A 1 1076 ? 110.604 131.285 159.637 1.00 68.14  ?  948  TYR A CE1   1 
ATOM   4290  C  CE2   . TYR A 1 1076 ? 108.806 131.993 158.231 1.00 68.82  ?  948  TYR A CE2   1 
ATOM   4291  C  CZ    . TYR A 1 1076 ? 110.132 131.645 158.398 1.00 70.60  ?  948  TYR A CZ    1 
ATOM   4292  O  OH    . TYR A 1 1076 ? 110.993 131.653 157.325 1.00 71.64  ?  948  TYR A OH    1 
ATOM   4293  N  N     . ARG A 1 1077 ? 108.046 128.644 160.531 1.00 75.07  ?  949  ARG A N     1 
ATOM   4294  C  CA    . ARG A 1 1077 ? 108.014 127.905 159.278 1.00 73.84  ?  949  ARG A CA    1 
ATOM   4295  C  C     . ARG A 1 1077 ? 108.214 126.405 159.442 1.00 72.88  ?  949  ARG A C     1 
ATOM   4296  O  O     . ARG A 1 1077 ? 107.676 125.633 158.643 1.00 69.04  ?  949  ARG A O     1 
ATOM   4297  C  CB    . ARG A 1 1077 ? 109.081 128.455 158.326 1.00 65.87  ?  949  ARG A CB    1 
ATOM   4298  C  CG    . ARG A 1 1077 ? 109.209 127.748 157.000 1.00 62.01  ?  949  ARG A CG    1 
ATOM   4299  C  CD    . ARG A 1 1077 ? 110.409 128.268 156.232 1.00 65.27  ?  949  ARG A CD    1 
ATOM   4300  N  NE    . ARG A 1 1077 ? 110.694 127.438 155.069 1.00 66.39  ?  949  ARG A NE    1 
ATOM   4301  C  CZ    . ARG A 1 1077 ? 109.926 127.386 153.988 1.00 67.38  ?  949  ARG A CZ    1 
ATOM   4302  N  NH1   . ARG A 1 1077 ? 108.817 128.109 153.928 1.00 69.16  ?  949  ARG A NH1   1 
ATOM   4303  N  NH2   . ARG A 1 1077 ? 110.261 126.604 152.971 1.00 67.83  ?  949  ARG A NH2   1 
ATOM   4304  N  N     . TYR A 1 1078 ? 108.937 125.965 160.476 1.00 75.53  ?  950  TYR A N     1 
ATOM   4305  C  CA    . TYR A 1 1078 ? 109.247 124.547 160.655 1.00 73.08  ?  950  TYR A CA    1 
ATOM   4306  C  C     . TYR A 1 1078 ? 108.563 124.021 161.910 1.00 79.25  ?  950  TYR A C     1 
ATOM   4307  O  O     . TYR A 1 1078 ? 109.151 123.261 162.687 1.00 77.42  ?  950  TYR A O     1 
ATOM   4308  C  CB    . TYR A 1 1078 ? 110.764 124.347 160.720 1.00 72.56  ?  950  TYR A CB    1 
ATOM   4309  C  CG    . TYR A 1 1078 ? 111.439 124.737 159.426 1.00 70.30  ?  950  TYR A CG    1 
ATOM   4310  C  CD1   . TYR A 1 1078 ? 110.751 124.667 158.226 1.00 67.95  ?  950  TYR A CD1   1 
ATOM   4311  C  CD2   . TYR A 1 1078 ? 112.737 125.217 159.407 1.00 65.70  ?  950  TYR A CD2   1 
ATOM   4312  C  CE1   . TYR A 1 1078 ? 111.346 125.027 157.045 1.00 68.50  ?  950  TYR A CE1   1 
ATOM   4313  C  CE2   . TYR A 1 1078 ? 113.342 125.586 158.227 1.00 62.98  ?  950  TYR A CE2   1 
ATOM   4314  C  CZ    . TYR A 1 1078 ? 112.638 125.490 157.048 1.00 67.25  ?  950  TYR A CZ    1 
ATOM   4315  O  OH    . TYR A 1 1078 ? 113.227 125.855 155.864 1.00 74.77  ?  950  TYR A OH    1 
ATOM   4316  N  N     . ASP A 1 1079 ? 107.316 124.449 162.108 1.00 85.87  ?  951  ASP A N     1 
ATOM   4317  C  CA    . ASP A 1 1079 ? 106.489 123.950 163.199 1.00 92.88  ?  951  ASP A CA    1 
ATOM   4318  C  C     . ASP A 1 1079 ? 106.391 122.430 163.173 1.00 90.34  ?  951  ASP A C     1 
ATOM   4319  O  O     . ASP A 1 1079 ? 106.733 121.755 164.149 1.00 86.17  ?  951  ASP A O     1 
ATOM   4320  C  CB    . ASP A 1 1079 ? 105.101 124.591 163.118 1.00 109.91 ?  951  ASP A CB    1 
ATOM   4321  C  CG    . ASP A 1 1079 ? 104.616 124.763 161.684 1.00 116.65 ?  951  ASP A CG    1 
ATOM   4322  O  OD1   . ASP A 1 1079 ? 105.314 124.309 160.754 1.00 92.87  ?  951  ASP A OD1   1 
ATOM   4323  O  OD2   . ASP A 1 1079 ? 103.535 125.360 161.487 1.00 263.24 -1 951  ASP A OD2   1 
ATOM   4324  N  N     . GLY A 1 1080 ? 105.924 121.874 162.057 1.00 83.74  ?  952  GLY A N     1 
ATOM   4325  C  CA    . GLY A 1 1080 ? 105.787 120.436 161.935 1.00 75.54  ?  952  GLY A CA    1 
ATOM   4326  C  C     . GLY A 1 1080 ? 106.342 119.845 160.652 1.00 63.05  ?  952  GLY A C     1 
ATOM   4327  O  O     . GLY A 1 1080 ? 106.461 118.622 160.536 1.00 55.79  ?  952  GLY A O     1 
ATOM   4328  N  N     . LYS A 1 1081 ? 106.687 120.691 159.682 1.00 64.12  ?  953  LYS A N     1 
ATOM   4329  C  CA    . LYS A 1 1081 ? 107.160 120.241 158.376 1.00 52.79  ?  953  LYS A CA    1 
ATOM   4330  C  C     . LYS A 1 1081 ? 108.661 120.484 158.257 1.00 49.48  ?  953  LYS A C     1 
ATOM   4331  O  O     . LYS A 1 1081 ? 109.125 121.613 158.437 1.00 59.38  ?  953  LYS A O     1 
ATOM   4332  C  CB    . LYS A 1 1081 ? 106.411 120.967 157.258 1.00 55.44  ?  953  LYS A CB    1 
ATOM   4333  C  CG    . LYS A 1 1081 ? 106.197 122.456 157.519 1.00 62.13  ?  953  LYS A CG    1 
ATOM   4334  C  CD    . LYS A 1 1081 ? 105.509 123.139 156.349 1.00 64.88  ?  953  LYS A CD    1 
ATOM   4335  C  CE    . LYS A 1 1081 ? 105.307 124.624 156.618 1.00 70.07  ?  953  LYS A CE    1 
ATOM   4336  N  NZ    . LYS A 1 1081 ? 104.696 125.329 155.457 1.00 63.36  ?  953  LYS A NZ    1 
ATOM   4337  N  N     . ILE A 1 1082 ? 109.418 119.426 157.963 1.00 40.51  ?  954  ILE A N     1 
ATOM   4338  C  CA    . ILE A 1 1082 ? 110.859 119.519 157.768 1.00 36.41  ?  954  ILE A CA    1 
ATOM   4339  C  C     . ILE A 1 1082 ? 111.213 118.777 156.486 1.00 36.54  ?  954  ILE A C     1 
ATOM   4340  O  O     . ILE A 1 1082 ? 110.476 117.902 156.029 1.00 32.49  ?  954  ILE A O     1 
ATOM   4341  C  CB    . ILE A 1 1082 ? 111.656 118.944 158.963 1.00 36.12  ?  954  ILE A CB    1 
ATOM   4342  C  CG1   . ILE A 1 1082 ? 110.988 119.287 160.296 1.00 43.03  ?  954  ILE A CG1   1 
ATOM   4343  C  CG2   . ILE A 1 1082 ? 113.081 119.469 158.953 1.00 34.83  ?  954  ILE A CG2   1 
ATOM   4344  C  CD1   . ILE A 1 1082 ? 110.088 118.188 160.836 1.00 42.50  ?  954  ILE A CD1   1 
ATOM   4345  N  N     . THR A 1 1083 ? 112.359 119.132 155.908 1.00 35.67  ?  955  THR A N     1 
ATOM   4346  C  CA    . THR A 1 1083 ? 112.850 118.485 154.700 1.00 34.20  ?  955  THR A CA    1 
ATOM   4347  C  C     . THR A 1 1083 ? 113.867 117.388 155.019 1.00 31.87  ?  955  THR A C     1 
ATOM   4348  O  O     . THR A 1 1083 ? 114.442 117.330 156.110 1.00 31.68  ?  955  THR A O     1 
ATOM   4349  C  CB    . THR A 1 1083 ? 113.473 119.503 153.750 1.00 36.70  ?  955  THR A CB    1 
ATOM   4350  O  OG1   . THR A 1 1083 ? 114.231 118.817 152.742 1.00 39.78  ?  955  THR A OG1   1 
ATOM   4351  C  CG2   . THR A 1 1083 ? 114.360 120.466 154.500 1.00 32.37  ?  955  THR A CG2   1 
ATOM   4352  N  N     . ASN A 1 1084 ? 114.096 116.521 154.025 1.00 31.84  ?  956  ASN A N     1 
ATOM   4353  C  CA    . ASN A 1 1084 ? 114.838 115.282 154.250 1.00 33.29  ?  956  ASN A CA    1 
ATOM   4354  C  C     . ASN A 1 1084 ? 116.328 115.534 154.459 1.00 29.70  ?  956  ASN A C     1 
ATOM   4355  O  O     . ASN A 1 1084 ? 116.852 115.306 155.551 1.00 28.52  ?  956  ASN A O     1 
ATOM   4356  C  CB    . ASN A 1 1084 ? 114.603 114.313 153.086 1.00 32.80  ?  956  ASN A CB    1 
ATOM   4357  C  CG    . ASN A 1 1084 ? 113.144 113.867 152.978 1.00 32.90  ?  956  ASN A CG    1 
ATOM   4358  O  OD1   . ASN A 1 1084 ? 112.731 112.910 153.634 1.00 27.46  ?  956  ASN A OD1   1 
ATOM   4359  N  ND2   . ASN A 1 1084 ? 112.359 114.568 152.167 1.00 34.84  ?  956  ASN A ND2   1 
ATOM   4360  N  N     . TYR A 1 1085 ? 117.027 115.994 153.418 1.00 27.90  ?  957  TYR A N     1 
ATOM   4361  C  CA    . TYR A 1 1085 ? 118.475 116.178 153.504 1.00 35.21  ?  957  TYR A CA    1 
ATOM   4362  C  C     . TYR A 1 1085 ? 118.858 117.000 154.720 1.00 36.08  ?  957  TYR A C     1 
ATOM   4363  O  O     . TYR A 1 1085 ? 119.876 116.736 155.369 1.00 35.93  ?  957  TYR A O     1 
ATOM   4364  C  CB    . TYR A 1 1085 ? 118.981 116.868 152.245 1.00 40.97  ?  957  TYR A CB    1 
ATOM   4365  C  CG    . TYR A 1 1085 ? 118.868 116.024 151.011 1.00 42.58  ?  957  TYR A CG    1 
ATOM   4366  C  CD1   . TYR A 1 1085 ? 119.221 114.691 151.036 1.00 40.90  ?  957  TYR A CD1   1 
ATOM   4367  C  CD2   . TYR A 1 1085 ? 118.400 116.560 149.826 1.00 41.43  ?  957  TYR A CD2   1 
ATOM   4368  C  CE1   . TYR A 1 1085 ? 119.122 113.917 149.919 1.00 43.38  ?  957  TYR A CE1   1 
ATOM   4369  C  CE2   . TYR A 1 1085 ? 118.295 115.794 148.700 1.00 48.74  ?  957  TYR A CE2   1 
ATOM   4370  C  CZ    . TYR A 1 1085 ? 118.657 114.472 148.753 1.00 45.29  ?  957  TYR A CZ    1 
ATOM   4371  O  OH    . TYR A 1 1085 ? 118.553 113.696 147.630 1.00 51.29  ?  957  TYR A OH    1 
ATOM   4372  N  N     . LEU A 1 1086 ? 118.072 118.032 155.010 1.00 35.76  ?  958  LEU A N     1 
ATOM   4373  C  CA    . LEU A 1 1086 ? 118.252 118.787 156.237 1.00 33.56  ?  958  LEU A CA    1 
ATOM   4374  C  C     . LEU A 1 1086 ? 118.220 117.861 157.446 1.00 32.08  ?  958  LEU A C     1 
ATOM   4375  O  O     . LEU A 1 1086 ? 119.074 117.946 158.338 1.00 32.57  ?  958  LEU A O     1 
ATOM   4376  C  CB    . LEU A 1 1086 ? 117.165 119.849 156.327 1.00 31.55  ?  958  LEU A CB    1 
ATOM   4377  C  CG    . LEU A 1 1086 ? 117.343 120.943 157.368 1.00 38.76  ?  958  LEU A CG    1 
ATOM   4378  C  CD1   . LEU A 1 1086 ? 118.535 121.806 157.020 1.00 40.08  ?  958  LEU A CD1   1 
ATOM   4379  C  CD2   . LEU A 1 1086 ? 116.076 121.778 157.488 1.00 34.66  ?  958  LEU A CD2   1 
ATOM   4380  N  N     . HIS A 1 1087 ? 117.238 116.961 157.488 1.00 29.85  ?  959  HIS A N     1 
ATOM   4381  C  CA    . HIS A 1 1087 ? 117.137 116.046 158.618 1.00 27.86  ?  959  HIS A CA    1 
ATOM   4382  C  C     . HIS A 1 1087 ? 118.354 115.139 158.692 1.00 32.33  ?  959  HIS A C     1 
ATOM   4383  O  O     . HIS A 1 1087 ? 118.899 114.893 159.773 1.00 31.88  ?  959  HIS A O     1 
ATOM   4384  C  CB    . HIS A 1 1087 ? 115.877 115.206 158.506 1.00 24.59  ?  959  HIS A CB    1 
ATOM   4385  C  CG    . HIS A 1 1087 ? 116.016 113.861 159.138 1.00 26.64  ?  959  HIS A CG    1 
ATOM   4386  N  ND1   . HIS A 1 1087 ? 115.996 113.678 160.505 1.00 29.19  ?  959  HIS A ND1   1 
ATOM   4387  C  CD2   . HIS A 1 1087 ? 116.255 112.644 158.596 1.00 30.66  ?  959  HIS A CD2   1 
ATOM   4388  C  CE1   . HIS A 1 1087 ? 116.167 112.398 160.776 1.00 31.90  ?  959  HIS A CE1   1 
ATOM   4389  N  NE2   . HIS A 1 1087 ? 116.334 111.752 159.636 1.00 30.45  ?  959  HIS A NE2   1 
ATOM   4390  N  N     . LYS A 1 1088 ? 118.766 114.607 157.545 1.00 30.71  ?  960  LYS A N     1 
ATOM   4391  C  CA    . LYS A 1 1088 ? 119.972 113.797 157.468 1.00 35.98  ?  960  LYS A CA    1 
ATOM   4392  C  C     . LYS A 1 1088 ? 121.157 114.533 158.071 1.00 35.98  ?  960  LYS A C     1 
ATOM   4393  O  O     . LYS A 1 1088 ? 121.864 114.005 158.938 1.00 33.61  ?  960  LYS A O     1 
ATOM   4394  C  CB    . LYS A 1 1088 ? 120.258 113.452 156.006 1.00 31.49  ?  960  LYS A CB    1 
ATOM   4395  C  CG    . LYS A 1 1088 ? 119.033 113.063 155.192 1.00 28.40  ?  960  LYS A CG    1 
ATOM   4396  C  CD    . LYS A 1 1088 ? 118.697 111.590 155.386 1.00 38.73  ?  960  LYS A CD    1 
ATOM   4397  C  CE    . LYS A 1 1088 ? 117.765 111.068 154.297 1.00 48.35  ?  960  LYS A CE    1 
ATOM   4398  N  NZ    . LYS A 1 1088 ? 117.451 109.622 154.519 1.00 46.66  ?  960  LYS A NZ    1 
ATOM   4399  N  N     . THR A 1 1089 ? 121.375 115.772 157.626 1.00 37.17  ?  961  THR A N     1 
ATOM   4400  C  CA    . THR A 1 1089 ? 122.605 116.477 157.949 1.00 41.05  ?  961  THR A CA    1 
ATOM   4401  C  C     . THR A 1 1089 ? 122.599 117.008 159.376 1.00 43.45  ?  961  THR A C     1 
ATOM   4402  O  O     . THR A 1 1089 ? 123.669 117.191 159.965 1.00 44.75  ?  961  THR A O     1 
ATOM   4403  C  CB    . THR A 1 1089 ? 122.855 117.603 156.933 1.00 33.66  ?  961  THR A CB    1 
ATOM   4404  O  OG1   . THR A 1 1089 ? 124.097 118.254 157.227 1.00 41.81  ?  961  THR A OG1   1 
ATOM   4405  C  CG2   . THR A 1 1089 ? 121.754 118.632 156.950 1.00 28.51  ?  961  THR A CG2   1 
ATOM   4406  N  N     . LEU A 1 1090 ? 121.424 117.227 159.958 1.00 35.96  ?  962  LEU A N     1 
ATOM   4407  C  CA    . LEU A 1 1090 ? 121.345 117.675 161.340 1.00 35.09  ?  962  LEU A CA    1 
ATOM   4408  C  C     . LEU A 1 1090 ? 121.121 116.539 162.325 1.00 35.33  ?  962  LEU A C     1 
ATOM   4409  O  O     . LEU A 1 1090 ? 121.160 116.775 163.535 1.00 44.20  ?  962  LEU A O     1 
ATOM   4410  C  CB    . LEU A 1 1090 ? 120.231 118.716 161.494 1.00 38.89  ?  962  LEU A CB    1 
ATOM   4411  C  CG    . LEU A 1 1090 ? 120.274 119.854 160.478 1.00 46.31  ?  962  LEU A CG    1 
ATOM   4412  C  CD1   . LEU A 1 1090 ? 119.103 120.812 160.662 1.00 60.43  ?  962  LEU A CD1   1 
ATOM   4413  C  CD2   . LEU A 1 1090 ? 121.594 120.592 160.563 1.00 52.95  ?  962  LEU A CD2   1 
ATOM   4414  N  N     . ALA A 1 1091 ? 120.895 115.318 161.844 1.00 38.40  ?  963  ALA A N     1 
ATOM   4415  C  CA    . ALA A 1 1091 ? 120.618 114.202 162.738 1.00 44.69  ?  963  ALA A CA    1 
ATOM   4416  C  C     . ALA A 1 1091 ? 121.514 112.991 162.484 1.00 45.93  ?  963  ALA A C     1 
ATOM   4417  O  O     . ALA A 1 1091 ? 121.834 112.249 163.420 1.00 46.30  ?  963  ALA A O     1 
ATOM   4418  C  CB    . ALA A 1 1091 ? 119.149 113.788 162.615 1.00 44.47  ?  963  ALA A CB    1 
ATOM   4419  N  N     . HIS A 1 1092 ? 121.943 112.783 161.234 1.00 39.48  ?  964  HIS A N     1 
ATOM   4420  C  CA    . HIS A 1 1092 ? 122.564 111.524 160.848 1.00 38.16  ?  964  HIS A CA    1 
ATOM   4421  C  C     . HIS A 1 1092 ? 123.989 111.621 160.323 1.00 40.39  ?  964  HIS A C     1 
ATOM   4422  O  O     . HIS A 1 1092 ? 124.620 110.576 160.146 1.00 38.45  ?  964  HIS A O     1 
ATOM   4423  C  CB    . HIS A 1 1092 ? 121.707 110.819 159.789 1.00 42.39  ?  964  HIS A CB    1 
ATOM   4424  C  CG    . HIS A 1 1092 ? 120.384 110.349 160.306 1.00 46.26  ?  964  HIS A CG    1 
ATOM   4425  N  ND1   . HIS A 1 1092 ? 120.223 109.127 160.929 1.00 47.17  ?  964  HIS A ND1   1 
ATOM   4426  C  CD2   . HIS A 1 1092 ? 119.163 110.933 160.299 1.00 43.48  ?  964  HIS A CD2   1 
ATOM   4427  C  CE1   . HIS A 1 1092 ? 118.958 108.975 161.277 1.00 44.37  ?  964  HIS A CE1   1 
ATOM   4428  N  NE2   . HIS A 1 1092 ? 118.295 110.057 160.906 1.00 43.88  ?  964  HIS A NE2   1 
ATOM   4429  N  N     . VAL A 1 1093 ? 124.505 112.814 160.051 1.00 41.73  ?  965  VAL A N     1 
ATOM   4430  C  CA    . VAL A 1 1093 ? 125.892 112.962 159.615 1.00 39.51  ?  965  VAL A CA    1 
ATOM   4431  C  C     . VAL A 1 1093 ? 126.840 112.259 160.585 1.00 41.14  ?  965  VAL A C     1 
ATOM   4432  O  O     . VAL A 1 1093 ? 127.561 111.336 160.170 1.00 42.54  ?  965  VAL A O     1 
ATOM   4433  C  CB    . VAL A 1 1093 ? 126.257 114.447 159.454 1.00 40.42  ?  965  VAL A CB    1 
ATOM   4434  C  CG1   . VAL A 1 1093 ? 127.749 114.637 159.561 1.00 50.13  ?  965  VAL A CG1   1 
ATOM   4435  C  CG2   . VAL A 1 1093 ? 125.770 114.969 158.121 1.00 37.82  ?  965  VAL A CG2   1 
ATOM   4436  N  N     . PRO A 1 1094 ? 126.860 112.618 161.877 1.00 46.22  ?  966  PRO A N     1 
ATOM   4437  C  CA    . PRO A 1 1094 ? 127.943 112.109 162.735 1.00 48.77  ?  966  PRO A CA    1 
ATOM   4438  C  C     . PRO A 1 1094 ? 128.009 110.598 162.786 1.00 49.68  ?  966  PRO A C     1 
ATOM   4439  O  O     . PRO A 1 1094 ? 129.106 110.032 162.813 1.00 50.75  ?  966  PRO A O     1 
ATOM   4440  C  CB    . PRO A 1 1094 ? 127.612 112.716 164.107 1.00 50.20  ?  966  PRO A CB    1 
ATOM   4441  C  CG    . PRO A 1 1094 ? 126.726 113.863 163.813 1.00 48.30  ?  966  PRO A CG    1 
ATOM   4442  C  CD    . PRO A 1 1094 ? 125.904 113.423 162.660 1.00 42.98  ?  966  PRO A CD    1 
ATOM   4443  N  N     . GLU A 1 1095 ? 126.860 109.928 162.780 1.00 49.57  ?  967  GLU A N     1 
ATOM   4444  C  CA    . GLU A 1 1095 ? 126.841 108.473 162.882 1.00 55.14  ?  967  GLU A CA    1 
ATOM   4445  C  C     . GLU A 1 1095 ? 127.626 107.828 161.743 1.00 52.74  ?  967  GLU A C     1 
ATOM   4446  O  O     . GLU A 1 1095 ? 128.574 107.059 161.967 1.00 55.81  ?  967  GLU A O     1 
ATOM   4447  C  CB    . GLU A 1 1095 ? 125.390 107.981 162.883 1.00 66.70  ?  967  GLU A CB    1 
ATOM   4448  C  CG    . GLU A 1 1095 ? 125.225 106.474 162.724 1.00 84.23  ?  967  GLU A CG    1 
ATOM   4449  C  CD    . GLU A 1 1095 ? 125.615 105.693 163.967 1.00 113.69 ?  967  GLU A CD    1 
ATOM   4450  O  OE1   . GLU A 1 1095 ? 125.797 106.315 165.034 1.00 114.27 ?  967  GLU A OE1   1 
ATOM   4451  O  OE2   . GLU A 1 1095 ? 125.754 104.454 163.869 1.00 182.32 -1 967  GLU A OE2   1 
ATOM   4452  N  N     . ILE A 1 1096 ? 127.235 108.127 160.504 1.00 47.04  ?  968  ILE A N     1 
ATOM   4453  C  CA    . ILE A 1 1096 ? 127.883 107.500 159.360 1.00 48.76  ?  968  ILE A CA    1 
ATOM   4454  C  C     . ILE A 1 1096 ? 129.326 107.960 159.246 1.00 48.24  ?  968  ILE A C     1 
ATOM   4455  O  O     . ILE A 1 1096 ? 130.215 107.166 158.912 1.00 50.19  ?  968  ILE A O     1 
ATOM   4456  C  CB    . ILE A 1 1096 ? 127.103 107.786 158.067 1.00 41.25  ?  968  ILE A CB    1 
ATOM   4457  C  CG1   . ILE A 1 1096 ? 126.560 109.210 158.097 1.00 40.44  ?  968  ILE A CG1   1 
ATOM   4458  C  CG2   . ILE A 1 1096 ? 126.008 106.749 157.862 1.00 41.07  ?  968  ILE A CG2   1 
ATOM   4459  C  CD1   . ILE A 1 1096 ? 125.888 109.660 156.827 1.00 35.35  ?  968  ILE A CD1   1 
ATOM   4460  N  N     . VAL A 1 1097 ? 129.588 109.244 159.506 1.00 42.68  ?  969  VAL A N     1 
ATOM   4461  C  CA    . VAL A 1 1097 ? 130.963 109.723 159.412 1.00 45.37  ?  969  VAL A CA    1 
ATOM   4462  C  C     . VAL A 1 1097 ? 131.846 108.979 160.406 1.00 48.37  ?  969  VAL A C     1 
ATOM   4463  O  O     . VAL A 1 1097 ? 133.027 108.718 160.143 1.00 50.49  ?  969  VAL A O     1 
ATOM   4464  C  CB    . VAL A 1 1097 ? 131.016 111.245 159.626 1.00 50.20  ?  969  VAL A CB    1 
ATOM   4465  C  CG1   . VAL A 1 1097 ? 132.454 111.742 159.605 1.00 55.64  ?  969  VAL A CG1   1 
ATOM   4466  C  CG2   . VAL A 1 1097 ? 130.193 111.956 158.577 1.00 49.41  ?  969  VAL A CG2   1 
ATOM   4467  N  N     . GLU A 1 1098 ? 131.278 108.607 161.555 1.00 54.03  ?  970  GLU A N     1 
ATOM   4468  C  CA    . GLU A 1 1098 ? 132.002 107.783 162.515 1.00 67.59  ?  970  GLU A CA    1 
ATOM   4469  C  C     . GLU A 1 1098 ? 132.224 106.375 161.979 1.00 61.08  ?  970  GLU A C     1 
ATOM   4470  O  O     . GLU A 1 1098 ? 133.324 105.824 162.101 1.00 60.73  ?  970  GLU A O     1 
ATOM   4471  C  CB    . GLU A 1 1098 ? 131.229 107.729 163.837 1.00 84.31  ?  970  GLU A CB    1 
ATOM   4472  C  CG    . GLU A 1 1098 ? 131.823 106.797 164.903 1.00 115.81 ?  970  GLU A CG    1 
ATOM   4473  C  CD    . GLU A 1 1098 ? 131.144 106.932 166.269 1.00 157.66 ?  970  GLU A CD    1 
ATOM   4474  O  OE1   . GLU A 1 1098 ? 130.487 107.967 166.514 1.00 143.59 ?  970  GLU A OE1   1 
ATOM   4475  O  OE2   . GLU A 1 1098 ? 131.265 106.003 167.098 1.00 261.06 -1 970  GLU A OE2   1 
ATOM   4476  N  N     . ARG A 1 1099 ? 131.190 105.776 161.388 1.00 55.26  ?  971  ARG A N     1 
ATOM   4477  C  CA    . ARG A 1 1099 ? 131.263 104.354 161.054 1.00 57.62  ?  971  ARG A CA    1 
ATOM   4478  C  C     . ARG A 1 1099 ? 132.051 104.096 159.768 1.00 58.38  ?  971  ARG A C     1 
ATOM   4479  O  O     . ARG A 1 1099 ? 133.091 103.432 159.791 1.00 54.33  ?  971  ARG A O     1 
ATOM   4480  C  CB    . ARG A 1 1099 ? 129.855 103.768 160.941 1.00 61.65  ?  971  ARG A CB    1 
ATOM   4481  C  CG    . ARG A 1 1099 ? 129.821 102.311 160.482 1.00 66.35  ?  971  ARG A CG    1 
ATOM   4482  C  CD    . ARG A 1 1099 ? 128.434 101.704 160.649 1.00 76.63  ?  971  ARG A CD    1 
ATOM   4483  N  NE    . ARG A 1 1099 ? 127.437 102.337 159.785 1.00 81.27  ?  971  ARG A NE    1 
ATOM   4484  C  CZ    . ARG A 1 1099 ? 127.257 102.037 158.502 1.00 78.19  ?  971  ARG A CZ    1 
ATOM   4485  N  NH1   . ARG A 1 1099 ? 126.332 102.675 157.798 1.00 67.90  ?  971  ARG A NH1   1 
ATOM   4486  N  NH2   . ARG A 1 1099 ? 128.003 101.101 157.925 1.00 82.72  ?  971  ARG A NH2   1 
ATOM   4487  N  N     . ASP A 1 1100 ? 131.570 104.610 158.636 1.00 58.07  ?  972  ASP A N     1 
ATOM   4488  C  CA    . ASP A 1 1100 ? 132.040 104.196 157.318 1.00 57.00  ?  972  ASP A CA    1 
ATOM   4489  C  C     . ASP A 1 1100 ? 133.190 105.043 156.791 1.00 44.66  ?  972  ASP A C     1 
ATOM   4490  O  O     . ASP A 1 1100 ? 133.287 105.246 155.579 1.00 43.10  ?  972  ASP A O     1 
ATOM   4491  C  CB    . ASP A 1 1100 ? 130.888 104.219 156.312 1.00 64.77  ?  972  ASP A CB    1 
ATOM   4492  C  CG    . ASP A 1 1100 ? 129.623 103.616 156.866 1.00 77.53  ?  972  ASP A CG    1 
ATOM   4493  O  OD1   . ASP A 1 1100 ? 128.913 104.304 157.617 1.00 70.21  ?  972  ASP A OD1   1 
ATOM   4494  O  OD2   . ASP A 1 1100 ? 129.353 102.436 156.566 1.00 174.03 -1 972  ASP A OD2   1 
ATOM   4495  N  N     . GLY A 1 1101 ? 134.047 105.550 157.665 1.00 46.13  ?  973  GLY A N     1 
ATOM   4496  C  CA    . GLY A 1 1101 ? 135.243 106.231 157.224 1.00 42.33  ?  973  GLY A CA    1 
ATOM   4497  C  C     . GLY A 1 1101 ? 135.007 107.626 156.690 1.00 39.85  ?  973  GLY A C     1 
ATOM   4498  O  O     . GLY A 1 1101 ? 135.502 108.600 157.263 1.00 47.18  ?  973  GLY A O     1 
ATOM   4499  N  N     . SER A 1 1102 ? 134.251 107.745 155.601 1.00 34.17  ?  974  SER A N     1 
ATOM   4500  C  CA    . SER A 1 1102 ? 134.060 109.038 154.963 1.00 35.33  ?  974  SER A CA    1 
ATOM   4501  C  C     . SER A 1 1102 ? 132.816 109.000 154.089 1.00 30.28  ?  974  SER A C     1 
ATOM   4502  O  O     . SER A 1 1102 ? 132.540 107.991 153.435 1.00 26.47  ?  974  SER A O     1 
ATOM   4503  C  CB    . SER A 1 1102 ? 135.275 109.414 154.110 1.00 44.09  ?  974  SER A CB    1 
ATOM   4504  O  OG    . SER A 1 1102 ? 136.433 109.562 154.909 1.00 54.25  ?  974  SER A OG    1 
ATOM   4505  N  N     . ILE A 1 1103 ? 132.082 110.112 154.078 1.00 30.86  ?  975  ILE A N     1 
ATOM   4506  C  CA    . ILE A 1 1103 ? 130.984 110.346 153.148 1.00 25.53  ?  975  ILE A CA    1 
ATOM   4507  C  C     . ILE A 1 1103 ? 131.416 111.464 152.213 1.00 28.61  ?  975  ILE A C     1 
ATOM   4508  O  O     . ILE A 1 1103 ? 132.362 112.199 152.487 1.00 35.62  ?  975  ILE A O     1 
ATOM   4509  C  CB    . ILE A 1 1103 ? 129.660 110.702 153.858 1.00 21.56  ?  975  ILE A CB    1 
ATOM   4510  C  CG1   . ILE A 1 1103 ? 128.474 110.514 152.916 1.00 15.09  ?  975  ILE A CG1   1 
ATOM   4511  C  CG2   . ILE A 1 1103 ? 129.699 112.105 154.360 1.00 30.16  ?  975  ILE A CG2   1 
ATOM   4512  C  CD1   . ILE A 1 1103 ? 127.176 110.949 153.499 1.00 19.23  ?  975  ILE A CD1   1 
ATOM   4513  N  N     . GLY A 1 1104 ? 130.737 111.568 151.078 1.00 27.45  ?  976  GLY A N     1 
ATOM   4514  C  CA    . GLY A 1 1104 ? 131.223 112.408 150.001 1.00 31.83  ?  976  GLY A CA    1 
ATOM   4515  C  C     . GLY A 1 1104 ? 132.283 111.653 149.226 1.00 30.58  ?  976  GLY A C     1 
ATOM   4516  O  O     . GLY A 1 1104 ? 132.443 111.809 148.012 1.00 23.31  ?  976  GLY A O     1 
ATOM   4517  N  N     . ALA A 1 1105 ? 133.029 110.825 149.954 1.00 31.24  ?  977  ALA A N     1 
ATOM   4518  C  CA    . ALA A 1 1105 ? 133.841 109.805 149.317 1.00 25.89  ?  977  ALA A CA    1 
ATOM   4519  C  C     . ALA A 1 1105 ? 132.974 108.903 148.453 1.00 21.90  ?  977  ALA A C     1 
ATOM   4520  O  O     . ALA A 1 1105 ? 133.354 108.553 147.335 1.00 20.68  ?  977  ALA A O     1 
ATOM   4521  C  CB    . ALA A 1 1105 ? 134.579 108.996 150.383 1.00 27.80  ?  977  ALA A CB    1 
ATOM   4522  N  N     . TRP A 1 1106 ? 131.787 108.540 148.942 1.00 18.25  ?  978  TRP A N     1 
ATOM   4523  C  CA    . TRP A 1 1106 ? 130.839 107.749 148.168 1.00 14.76  ?  978  TRP A CA    1 
ATOM   4524  C  C     . TRP A 1 1106 ? 129.871 108.611 147.391 1.00 14.04  ?  978  TRP A C     1 
ATOM   4525  O  O     . TRP A 1 1106 ? 128.700 108.247 147.242 1.00 13.22  ?  978  TRP A O     1 
ATOM   4526  C  CB    . TRP A 1 1106 ? 130.053 106.791 149.053 1.00 16.44  ?  978  TRP A CB    1 
ATOM   4527  C  CG    . TRP A 1 1106 ? 130.852 106.047 150.018 1.00 14.88  ?  978  TRP A CG    1 
ATOM   4528  C  CD1   . TRP A 1 1106 ? 130.938 106.278 151.353 1.00 22.91  ?  978  TRP A CD1   1 
ATOM   4529  C  CD2   . TRP A 1 1106 ? 131.722 104.962 149.740 1.00 18.24  ?  978  TRP A CD2   1 
ATOM   4530  N  NE1   . TRP A 1 1106 ? 131.791 105.386 151.936 1.00 22.03  ?  978  TRP A NE1   1 
ATOM   4531  C  CE2   . TRP A 1 1106 ? 132.294 104.567 150.965 1.00 17.96  ?  978  TRP A CE2   1 
ATOM   4532  C  CE3   . TRP A 1 1106 ? 132.073 104.281 148.578 1.00 15.19  ?  978  TRP A CE3   1 
ATOM   4533  C  CZ2   . TRP A 1 1106 ? 133.195 103.527 151.062 1.00 16.78  ?  978  TRP A CZ2   1 
ATOM   4534  C  CZ3   . TRP A 1 1106 ? 132.954 103.256 148.674 1.00 18.24  ?  978  TRP A CZ3   1 
ATOM   4535  C  CH2   . TRP A 1 1106 ? 133.518 102.884 149.905 1.00 18.25  ?  978  TRP A CH2   1 
ATOM   4536  N  N     . ALA A 1 1107 ? 130.324 109.756 146.905 1.00 16.17  ?  979  ALA A N     1 
ATOM   4537  C  CA    . ALA A 1 1107 ? 129.449 110.621 146.133 1.00 21.59  ?  979  ALA A CA    1 
ATOM   4538  C  C     . ALA A 1 1107 ? 128.840 109.876 144.945 1.00 26.03  ?  979  ALA A C     1 
ATOM   4539  O  O     . ALA A 1 1107 ? 129.531 109.164 144.210 1.00 28.99  ?  979  ALA A O     1 
ATOM   4540  C  CB    . ALA A 1 1107 ? 130.227 111.839 145.637 1.00 31.74  ?  979  ALA A CB    1 
ATOM   4541  N  N     . SER A 1 1108 ? 127.528 110.045 144.763 1.00 27.16  ?  980  SER A N     1 
ATOM   4542  C  CA    . SER A 1 1108 ? 126.867 109.715 143.506 1.00 24.18  ?  980  SER A CA    1 
ATOM   4543  C  C     . SER A 1 1108 ? 127.235 110.688 142.405 1.00 24.00  ?  980  SER A C     1 
ATOM   4544  O  O     . SER A 1 1108 ? 126.940 110.428 141.235 1.00 25.77  ?  980  SER A O     1 
ATOM   4545  C  CB    . SER A 1 1108 ? 125.342 109.729 143.678 1.00 23.40  ?  980  SER A CB    1 
ATOM   4546  O  OG    . SER A 1 1108 ? 124.821 111.040 143.609 1.00 28.91  ?  980  SER A OG    1 
ATOM   4547  N  N     . GLU A 1 1109 ? 127.858 111.804 142.780 1.00 28.37  ?  981  GLU A N     1 
ATOM   4548  C  CA    . GLU A 1 1109 ? 128.219 112.870 141.857 1.00 34.76  ?  981  GLU A CA    1 
ATOM   4549  C  C     . GLU A 1 1109 ? 128.783 112.319 140.560 1.00 39.38  ?  981  GLU A C     1 
ATOM   4550  O  O     . GLU A 1 1109 ? 128.415 112.767 139.473 1.00 42.43  ?  981  GLU A O     1 
ATOM   4551  C  CB    . GLU A 1 1109 ? 129.235 113.804 142.536 1.00 44.91  ?  981  GLU A CB    1 
ATOM   4552  C  CG    . GLU A 1 1109 ? 130.274 114.426 141.612 1.00 57.76  ?  981  GLU A CG    1 
ATOM   4553  C  CD    . GLU A 1 1109 ? 129.701 115.500 140.700 1.00 106.91 ?  981  GLU A CD    1 
ATOM   4554  O  OE1   . GLU A 1 1109 ? 128.510 115.833 140.847 1.00 79.66  ?  981  GLU A OE1   1 
ATOM   4555  O  OE2   . GLU A 1 1109 ? 130.439 115.999 139.822 1.00 272.81 -1 981  GLU A OE2   1 
ATOM   4556  N  N     . GLY A 1 1110 ? 129.667 111.329 140.663 1.00 35.51  ?  982  GLY A N     1 
ATOM   4557  C  CA    . GLY A 1 1110 ? 130.355 110.837 139.483 1.00 32.26  ?  982  GLY A CA    1 
ATOM   4558  C  C     . GLY A 1 1110 ? 129.431 110.396 138.366 1.00 33.29  ?  982  GLY A C     1 
ATOM   4559  O  O     . GLY A 1 1110 ? 129.562 110.854 137.228 1.00 32.07  ?  982  GLY A O     1 
ATOM   4560  N  N     . ASN A 1 1111 ? 128.466 109.530 138.676 1.00 33.20  ?  983  ASN A N     1 
ATOM   4561  C  CA    . ASN A 1 1111 ? 127.674 108.921 137.616 1.00 27.20  ?  983  ASN A CA    1 
ATOM   4562  C  C     . ASN A 1 1111 ? 126.814 109.971 136.928 1.00 32.31  ?  983  ASN A C     1 
ATOM   4563  O  O     . ASN A 1 1111 ? 126.901 110.158 135.709 1.00 34.28  ?  983  ASN A O     1 
ATOM   4564  C  CB    . ASN A 1 1111 ? 126.806 107.799 138.185 1.00 24.28  ?  983  ASN A CB    1 
ATOM   4565  C  CG    . ASN A 1 1111 ? 125.587 107.519 137.334 1.00 22.59  ?  983  ASN A CG    1 
ATOM   4566  O  OD1   . ASN A 1 1111 ? 125.686 107.400 136.114 1.00 23.65  ?  983  ASN A OD1   1 
ATOM   4567  N  ND2   . ASN A 1 1111 ? 124.426 107.420 137.971 1.00 27.90  ?  983  ASN A ND2   1 
ATOM   4568  N  N     . GLU A 1 1112 ? 125.973 110.661 137.701 1.00 37.76  ?  984  GLU A N     1 
ATOM   4569  C  CA    . GLU A 1 1112 ? 125.142 111.731 137.154 1.00 53.15  ?  984  GLU A CA    1 
ATOM   4570  C  C     . GLU A 1 1112 ? 125.974 112.757 136.397 1.00 48.10  ?  984  GLU A C     1 
ATOM   4571  O  O     . GLU A 1 1112 ? 125.698 113.061 135.232 1.00 45.39  ?  984  GLU A O     1 
ATOM   4572  C  CB    . GLU A 1 1112 ? 124.340 112.403 138.269 1.00 76.37  ?  984  GLU A CB    1 
ATOM   4573  C  CG    . GLU A 1 1112 ? 122.920 111.895 138.362 1.00 95.63  ?  984  GLU A CG    1 
ATOM   4574  C  CD    . GLU A 1 1112 ? 121.970 112.698 137.496 1.00 109.97 ?  984  GLU A CD    1 
ATOM   4575  O  OE1   . GLU A 1 1112 ? 122.412 113.710 136.908 1.00 104.81 ?  984  GLU A OE1   1 
ATOM   4576  O  OE2   . GLU A 1 1112 ? 120.802 112.276 137.353 1.00 188.61 -1 984  GLU A OE2   1 
ATOM   4577  N  N     . SER A 1 1113 ? 126.975 113.329 137.066 1.00 44.47  ?  985  SER A N     1 
ATOM   4578  C  CA    . SER A 1 1113 ? 127.825 114.331 136.437 1.00 51.45  ?  985  SER A CA    1 
ATOM   4579  C  C     . SER A 1 1113 ? 128.354 113.838 135.099 1.00 46.42  ?  985  SER A C     1 
ATOM   4580  O  O     . SER A 1 1113 ? 128.241 114.524 134.077 1.00 46.60  ?  985  SER A O     1 
ATOM   4581  C  CB    . SER A 1 1113 ? 128.975 114.674 137.377 1.00 58.36  ?  985  SER A CB    1 
ATOM   4582  O  OG    . SER A 1 1113 ? 129.596 113.490 137.846 1.00 50.73  ?  985  SER A OG    1 
ATOM   4583  N  N     . GLY A 1 1114 ? 128.930 112.636 135.089 1.00 40.38  ?  986  GLY A N     1 
ATOM   4584  C  CA    . GLY A 1 1114 ? 129.497 112.102 133.868 1.00 38.13  ?  986  GLY A CA    1 
ATOM   4585  C  C     . GLY A 1 1114 ? 128.478 111.773 132.804 1.00 32.31  ?  986  GLY A C     1 
ATOM   4586  O  O     . GLY A 1 1114 ? 128.835 111.694 131.625 1.00 35.50  ?  986  GLY A O     1 
ATOM   4587  N  N     . ASN A 1 1115 ? 127.216 111.592 133.193 1.00 31.55  ?  987  ASN A N     1 
ATOM   4588  C  CA    . ASN A 1 1115 ? 126.202 111.121 132.257 1.00 25.78  ?  987  ASN A CA    1 
ATOM   4589  C  C     . ASN A 1 1115 ? 126.085 111.993 131.009 1.00 27.69  ?  987  ASN A C     1 
ATOM   4590  O  O     . ASN A 1 1115 ? 125.553 111.535 129.993 1.00 24.48  ?  987  ASN A O     1 
ATOM   4591  C  CB    . ASN A 1 1115 ? 124.857 111.040 132.972 1.00 30.56  ?  987  ASN A CB    1 
ATOM   4592  C  CG    . ASN A 1 1115 ? 123.819 110.290 132.183 1.00 29.31  ?  987  ASN A CG    1 
ATOM   4593  O  OD1   . ASN A 1 1115 ? 123.905 109.073 131.997 1.00 28.71  ?  987  ASN A OD1   1 
ATOM   4594  N  ND2   . ASN A 1 1115 ? 122.830 111.016 131.701 1.00 35.42  ?  987  ASN A ND2   1 
ATOM   4595  N  N     . LYS A 1 1116 ? 126.553 113.239 131.063 1.00 29.18  ?  988  LYS A N     1 
ATOM   4596  C  CA    . LYS A 1 1116 ? 126.648 114.054 129.859 1.00 30.65  ?  988  LYS A CA    1 
ATOM   4597  C  C     . LYS A 1 1116 ? 127.527 113.402 128.793 1.00 26.28  ?  988  LYS A C     1 
ATOM   4598  O  O     . LYS A 1 1116 ? 127.399 113.729 127.606 1.00 24.88  ?  988  LYS A O     1 
ATOM   4599  C  CB    . LYS A 1 1116 ? 127.145 115.461 130.237 1.00 41.23  ?  988  LYS A CB    1 
ATOM   4600  C  CG    . LYS A 1 1116 ? 128.308 115.478 131.220 1.00 43.20  ?  988  LYS A CG    1 
ATOM   4601  C  CD    . LYS A 1 1116 ? 128.825 116.881 131.502 1.00 74.38  ?  988  LYS A CD    1 
ATOM   4602  C  CE    . LYS A 1 1116 ? 129.304 117.561 130.243 1.00 87.21  ?  988  LYS A CE    1 
ATOM   4603  N  NZ    . LYS A 1 1116 ? 130.392 116.788 129.580 1.00 83.84  ?  988  LYS A NZ    1 
ATOM   4604  N  N     . LEU A 1 1117 ? 128.395 112.472 129.184 1.00 21.85  ?  989  LEU A N     1 
ATOM   4605  C  CA    . LEU A 1 1117 ? 129.084 111.660 128.192 1.00 21.28  ?  989  LEU A CA    1 
ATOM   4606  C  C     . LEU A 1 1117 ? 128.099 110.817 127.399 1.00 20.57  ?  989  LEU A C     1 
ATOM   4607  O  O     . LEU A 1 1117 ? 128.254 110.645 126.186 1.00 22.39  ?  989  LEU A O     1 
ATOM   4608  C  CB    . LEU A 1 1117 ? 130.104 110.765 128.880 1.00 18.36  ?  989  LEU A CB    1 
ATOM   4609  C  CG    . LEU A 1 1117 ? 131.180 111.466 129.686 1.00 22.84  ?  989  LEU A CG    1 
ATOM   4610  C  CD1   . LEU A 1 1117 ? 132.148 110.454 130.222 1.00 19.25  ?  989  LEU A CD1   1 
ATOM   4611  C  CD2   . LEU A 1 1117 ? 131.893 112.443 128.802 1.00 40.45  ?  989  LEU A CD2   1 
ATOM   4612  N  N     . PHE A 1 1118 ? 127.114 110.227 128.078 1.00 21.40  ?  990  PHE A N     1 
ATOM   4613  C  CA    . PHE A 1 1118 ? 126.070 109.516 127.353 1.00 21.57  ?  990  PHE A CA    1 
ATOM   4614  C  C     . PHE A 1 1118 ? 125.323 110.466 126.442 1.00 20.13  ?  990  PHE A C     1 
ATOM   4615  O  O     . PHE A 1 1118 ? 124.822 110.060 125.389 1.00 21.73  ?  990  PHE A O     1 
ATOM   4616  C  CB    . PHE A 1 1118 ? 125.102 108.833 128.318 1.00 23.15  ?  990  PHE A CB    1 
ATOM   4617  C  CG    . PHE A 1 1118 ? 123.997 108.055 127.639 1.00 15.84  ?  990  PHE A CG    1 
ATOM   4618  C  CD1   . PHE A 1 1118 ? 124.225 106.796 127.134 1.00 13.65  ?  990  PHE A CD1   1 
ATOM   4619  C  CD2   . PHE A 1 1118 ? 122.738 108.595 127.497 1.00 12.51  ?  990  PHE A CD2   1 
ATOM   4620  C  CE1   . PHE A 1 1118 ? 123.218 106.104 126.518 1.00 13.87  ?  990  PHE A CE1   1 
ATOM   4621  C  CE2   . PHE A 1 1118 ? 121.744 107.895 126.881 1.00 11.43  ?  990  PHE A CE2   1 
ATOM   4622  C  CZ    . PHE A 1 1118 ? 121.982 106.662 126.397 1.00 11.45  ?  990  PHE A CZ    1 
ATOM   4623  N  N     . ARG A 1 1119 ? 125.224 111.734 126.832 1.00 20.84  ?  991  ARG A N     1 
ATOM   4624  C  CA    . ARG A 1 1119 ? 124.627 112.715 125.939 1.00 21.47  ?  991  ARG A CA    1 
ATOM   4625  C  C     . ARG A 1 1119 ? 125.445 112.862 124.661 1.00 20.58  ?  991  ARG A C     1 
ATOM   4626  O  O     . ARG A 1 1119 ? 124.915 112.735 123.552 1.00 21.64  ?  991  ARG A O     1 
ATOM   4627  C  CB    . ARG A 1 1119 ? 124.467 114.054 126.657 1.00 29.74  ?  991  ARG A CB    1 
ATOM   4628  C  CG    . ARG A 1 1119 ? 123.030 114.352 127.052 1.00 33.67  ?  991  ARG A CG    1 
ATOM   4629  C  CD    . ARG A 1 1119 ? 122.116 114.227 125.846 1.00 40.95  ?  991  ARG A CD    1 
ATOM   4630  N  NE    . ARG A 1 1119 ? 120.836 114.903 126.031 1.00 54.70  ?  991  ARG A NE    1 
ATOM   4631  C  CZ    . ARG A 1 1119 ? 119.814 114.363 126.690 1.00 62.38  ?  991  ARG A CZ    1 
ATOM   4632  N  NH1   . ARG A 1 1119 ? 119.943 113.158 127.220 1.00 67.08  ?  991  ARG A NH1   1 
ATOM   4633  N  NH2   . ARG A 1 1119 ? 118.667 115.017 126.811 1.00 75.58  ?  991  ARG A NH2   1 
ATOM   4634  N  N     . ARG A 1 1120 ? 126.745 113.120 124.796 1.00 21.55  ?  992  ARG A N     1 
ATOM   4635  C  CA    . ARG A 1 1120 ? 127.535 113.446 123.607 1.00 25.55  ?  992  ARG A CA    1 
ATOM   4636  C  C     . ARG A 1 1120 ? 127.790 112.224 122.725 1.00 20.58  ?  992  ARG A C     1 
ATOM   4637  O  O     . ARG A 1 1120 ? 127.731 112.320 121.488 1.00 21.13  ?  992  ARG A O     1 
ATOM   4638  C  CB    . ARG A 1 1120 ? 128.867 114.088 123.983 1.00 33.05  ?  992  ARG A CB    1 
ATOM   4639  C  CG    . ARG A 1 1120 ? 129.652 114.489 122.740 1.00 35.08  ?  992  ARG A CG    1 
ATOM   4640  C  CD    . ARG A 1 1120 ? 131.149 114.519 122.944 1.00 39.12  ?  992  ARG A CD    1 
ATOM   4641  N  NE    . ARG A 1 1120 ? 131.563 115.648 123.766 1.00 58.84  ?  992  ARG A NE    1 
ATOM   4642  C  CZ    . ARG A 1 1120 ? 131.491 116.914 123.369 1.00 75.93  ?  992  ARG A CZ    1 
ATOM   4643  N  NH1   . ARG A 1 1120 ? 131.019 117.207 122.165 1.00 78.61  ?  992  ARG A NH1   1 
ATOM   4644  N  NH2   . ARG A 1 1120 ? 131.889 117.889 124.176 1.00 135.92 ?  992  ARG A NH2   1 
ATOM   4645  N  N     . PHE A 1 1121 ? 128.121 111.084 123.337 1.00 19.82  ?  993  PHE A N     1 
ATOM   4646  C  CA    . PHE A 1 1121 ? 128.404 109.881 122.566 1.00 19.41  ?  993  PHE A CA    1 
ATOM   4647  C  C     . PHE A 1 1121 ? 127.263 109.539 121.623 1.00 21.41  ?  993  PHE A C     1 
ATOM   4648  O  O     . PHE A 1 1121 ? 127.495 109.125 120.482 1.00 23.47  ?  993  PHE A O     1 
ATOM   4649  C  CB    . PHE A 1 1121 ? 128.692 108.723 123.516 1.00 23.49  ?  993  PHE A CB    1 
ATOM   4650  C  CG    . PHE A 1 1121 ? 130.142 108.579 123.865 1.00 24.85  ?  993  PHE A CG    1 
ATOM   4651  C  CD1   . PHE A 1 1121 ? 131.052 109.503 123.427 1.00 22.09  ?  993  PHE A CD1   1 
ATOM   4652  C  CD2   . PHE A 1 1121 ? 130.596 107.511 124.615 1.00 35.47  ?  993  PHE A CD2   1 
ATOM   4653  C  CE1   . PHE A 1 1121 ? 132.376 109.359 123.726 1.00 26.66  ?  993  PHE A CE1   1 
ATOM   4654  C  CE2   . PHE A 1 1121 ? 131.931 107.378 124.918 1.00 37.19  ?  993  PHE A CE2   1 
ATOM   4655  C  CZ    . PHE A 1 1121 ? 132.813 108.300 124.471 1.00 32.45  ?  993  PHE A CZ    1 
ATOM   4656  N  N     . ARG A 1 1122 ? 126.026 109.715 122.081 1.00 21.67  ?  994  ARG A N     1 
ATOM   4657  C  CA    . ARG A 1 1122 ? 124.873 109.482 121.225 1.00 19.99  ?  994  ARG A CA    1 
ATOM   4658  C  C     . ARG A 1 1122 ? 124.927 110.353 119.985 1.00 21.23  ?  994  ARG A C     1 
ATOM   4659  O  O     . ARG A 1 1122 ? 124.567 109.911 118.891 1.00 26.55  ?  994  ARG A O     1 
ATOM   4660  C  CB    . ARG A 1 1122 ? 123.599 109.767 121.998 1.00 25.45  ?  994  ARG A CB    1 
ATOM   4661  C  CG    . ARG A 1 1122 ? 122.369 109.202 121.365 1.00 39.60  ?  994  ARG A CG    1 
ATOM   4662  C  CD    . ARG A 1 1122 ? 121.319 108.909 122.402 1.00 52.60  ?  994  ARG A CD    1 
ATOM   4663  N  NE    . ARG A 1 1122 ? 120.235 108.145 121.806 1.00 82.43  ?  994  ARG A NE    1 
ATOM   4664  C  CZ    . ARG A 1 1122 ? 119.092 108.667 121.380 1.00 101.79 ?  994  ARG A CZ    1 
ATOM   4665  N  NH1   . ARG A 1 1122 ? 118.870 109.974 121.472 1.00 108.35 ?  994  ARG A NH1   1 
ATOM   4666  N  NH2   . ARG A 1 1122 ? 118.172 107.879 120.846 1.00 119.61 ?  994  ARG A NH2   1 
ATOM   4667  N  N     . LYS A 1 1123 ? 125.352 111.605 120.142 1.00 19.55  ?  995  LYS A N     1 
ATOM   4668  C  CA    . LYS A 1 1123 ? 125.476 112.489 118.992 1.00 21.64  ?  995  LYS A CA    1 
ATOM   4669  C  C     . LYS A 1 1123 ? 126.573 112.006 118.057 1.00 21.56  ?  995  LYS A C     1 
ATOM   4670  O  O     . LYS A 1 1123 ? 126.317 111.670 116.897 1.00 22.43  ?  995  LYS A O     1 
ATOM   4671  C  CB    . LYS A 1 1123 ? 125.759 113.928 119.447 1.00 31.02  ?  995  LYS A CB    1 
ATOM   4672  C  CG    . LYS A 1 1123 ? 124.565 114.691 120.055 1.00 38.28  ?  995  LYS A CG    1 
ATOM   4673  C  CD    . LYS A 1 1123 ? 124.840 116.197 120.262 1.00 36.54  ?  995  LYS A CD    1 
ATOM   4674  C  CE    . LYS A 1 1123 ? 123.670 116.873 120.964 1.00 43.83  ?  995  LYS A CE    1 
ATOM   4675  N  NZ    . LYS A 1 1123 ? 122.372 116.426 120.384 1.00 50.92  ?  995  LYS A NZ    1 
ATOM   4676  N  N     . MET A 1 1124 ? 127.804 111.954 118.550 1.00 20.55  ?  996  MET A N     1 
ATOM   4677  C  CA    . MET A 1 1124 ? 128.926 111.796 117.639 1.00 19.27  ?  996  MET A CA    1 
ATOM   4678  C  C     . MET A 1 1124 ? 129.051 110.376 117.113 1.00 19.20  ?  996  MET A C     1 
ATOM   4679  O  O     . MET A 1 1124 ? 128.908 110.151 115.913 1.00 23.53  ?  996  MET A O     1 
ATOM   4680  C  CB    . MET A 1 1124 ? 130.228 112.202 118.324 1.00 26.68  ?  996  MET A CB    1 
ATOM   4681  C  CG    . MET A 1 1124 ? 130.585 113.676 118.200 1.00 23.62  ?  996  MET A CG    1 
ATOM   4682  S  SD    . MET A 1 1124 ? 129.176 114.761 118.511 1.00 38.51  ?  996  MET A SD    1 
ATOM   4683  C  CE    . MET A 1 1124 ? 129.901 116.395 118.370 1.00 26.48  ?  996  MET A CE    1 
ATOM   4684  N  N     . ASN A 1 1125 ? 129.283 109.405 117.988 1.00 19.52  ?  997  ASN A N     1 
ATOM   4685  C  CA    . ASN A 1 1125 ? 129.751 108.106 117.530 1.00 23.18  ?  997  ASN A CA    1 
ATOM   4686  C  C     . ASN A 1 1125 ? 128.633 107.088 117.403 1.00 22.62  ?  997  ASN A C     1 
ATOM   4687  O  O     . ASN A 1 1125 ? 128.887 105.878 117.435 1.00 28.43  ?  997  ASN A O     1 
ATOM   4688  C  CB    . ASN A 1 1125 ? 130.840 107.604 118.468 1.00 23.35  ?  997  ASN A CB    1 
ATOM   4689  C  CG    . ASN A 1 1125 ? 132.085 108.457 118.402 1.00 29.05  ?  997  ASN A CG    1 
ATOM   4690  O  OD1   . ASN A 1 1125 ? 132.024 109.673 118.583 1.00 21.94  ?  997  ASN A OD1   1 
ATOM   4691  N  ND2   . ASN A 1 1125 ? 133.215 107.837 118.093 1.00 37.97  ?  997  ASN A ND2   1 
ATOM   4692  N  N     . ALA A 1 1126 ? 127.401 107.543 117.228 1.00 23.11  ?  998  ALA A N     1 
ATOM   4693  C  CA    . ALA A 1 1126 ? 126.276 106.627 117.132 1.00 25.44  ?  998  ALA A CA    1 
ATOM   4694  C  C     . ALA A 1 1126 ? 126.461 105.661 115.965 1.00 37.60  ?  998  ALA A C     1 
ATOM   4695  O  O     . ALA A 1 1126 ? 127.298 105.860 115.083 1.00 36.57  ?  998  ALA A O     1 
ATOM   4696  C  CB    . ALA A 1 1126 ? 124.972 107.404 116.964 1.00 34.54  ?  998  ALA A CB    1 
ATOM   4697  N  N     . ARG A 1 1127 ? 125.655 104.599 115.963 1.00 40.27  ?  999  ARG A N     1 
ATOM   4698  C  CA    . ARG A 1 1127 ? 125.793 103.595 114.910 1.00 43.10  ?  999  ARG A CA    1 
ATOM   4699  C  C     . ARG A 1 1127 ? 125.258 104.113 113.568 1.00 41.26  ?  999  ARG A C     1 
ATOM   4700  O  O     . ARG A 1 1127 ? 126.007 104.162 112.589 1.00 47.14  ?  999  ARG A O     1 
ATOM   4701  C  CB    . ARG A 1 1127 ? 125.133 102.266 115.317 1.00 45.96  ?  999  ARG A CB    1 
ATOM   4702  C  CG    . ARG A 1 1127 ? 125.163 101.201 114.220 1.00 43.76  ?  999  ARG A CG    1 
ATOM   4703  C  CD    . ARG A 1 1127 ? 126.559 100.624 114.027 1.00 38.95  ?  999  ARG A CD    1 
ATOM   4704  N  NE    . ARG A 1 1127 ? 126.752 99.349  114.713 1.00 36.69  ?  999  ARG A NE    1 
ATOM   4705  C  CZ    . ARG A 1 1127 ? 126.391 98.177  114.202 1.00 29.96  ?  999  ARG A CZ    1 
ATOM   4706  N  NH1   . ARG A 1 1127 ? 126.606 97.056  114.873 1.00 34.32  ?  999  ARG A NH1   1 
ATOM   4707  N  NH2   . ARG A 1 1127 ? 125.817 98.126  113.009 1.00 30.80  ?  999  ARG A NH2   1 
ATOM   4708  N  N     . GLN A 1 1128 ? 123.982 104.526 113.476 1.00 35.06  ?  1000 GLN A N     1 
ATOM   4709  C  CA    . GLN A 1 1128 ? 122.976 104.567 114.533 1.00 35.51  ?  1000 GLN A CA    1 
ATOM   4710  C  C     . GLN A 1 1128 ? 121.769 103.704 114.210 1.00 36.45  ?  1000 GLN A C     1 
ATOM   4711  O  O     . GLN A 1 1128 ? 121.229 103.723 113.100 1.00 42.80  ?  1000 GLN A O     1 
ATOM   4712  C  CB    . GLN A 1 1128 ? 122.515 106.003 114.804 1.00 35.85  ?  1000 GLN A CB    1 
ATOM   4713  C  CG    . GLN A 1 1128 ? 121.207 106.389 114.150 1.00 33.50  ?  1000 GLN A CG    1 
ATOM   4714  C  CD    . GLN A 1 1128 ? 121.382 106.832 112.738 1.00 37.44  ?  1000 GLN A CD    1 
ATOM   4715  O  OE1   . GLN A 1 1128 ? 122.447 107.314 112.357 1.00 36.47  ?  1000 GLN A OE1   1 
ATOM   4716  N  NE2   . GLN A 1 1128 ? 120.342 106.668 111.938 1.00 45.73  ?  1000 GLN A NE2   1 
ATOM   4717  N  N     . SER A 1 1129 ? 121.408 102.892 115.196 1.00 44.88  ?  1001 SER A N     1 
ATOM   4718  C  CA    . SER A 1 1129 ? 120.137 102.189 115.272 1.00 53.06  ?  1001 SER A CA    1 
ATOM   4719  C  C     . SER A 1 1129 ? 120.078 101.565 116.658 1.00 57.46  ?  1001 SER A C     1 
ATOM   4720  O  O     . SER A 1 1129 ? 121.012 100.865 117.062 1.00 53.99  ?  1001 SER A O     1 
ATOM   4721  C  CB    . SER A 1 1129 ? 119.994 101.134 114.169 1.00 61.02  ?  1001 SER A CB    1 
ATOM   4722  O  OG    . SER A 1 1129 ? 119.740 101.753 112.920 1.00 64.79  ?  1001 SER A OG    1 
ATOM   4723  N  N     . LYS A 1 1130 ? 118.994 101.819 117.389 1.00 56.20  ?  1002 LYS A N     1 
ATOM   4724  C  CA    . LYS A 1 1130 ? 118.948 101.510 118.811 1.00 53.25  ?  1002 LYS A CA    1 
ATOM   4725  C  C     . LYS A 1 1130 ? 119.266 100.051 119.102 1.00 47.91  ?  1002 LYS A C     1 
ATOM   4726  O  O     . LYS A 1 1130 ? 119.655 99.728  120.226 1.00 47.58  ?  1002 LYS A O     1 
ATOM   4727  C  CB    . LYS A 1 1130 ? 117.576 101.891 119.347 1.00 53.28  ?  1002 LYS A CB    1 
ATOM   4728  C  CG    . LYS A 1 1130 ? 117.228 103.342 119.075 1.00 66.48  ?  1002 LYS A CG    1 
ATOM   4729  C  CD    . LYS A 1 1130 ? 115.751 103.570 119.265 1.00 82.06  ?  1002 LYS A CD    1 
ATOM   4730  C  CE    . LYS A 1 1130 ? 114.962 102.634 118.367 1.00 81.38  ?  1002 LYS A CE    1 
ATOM   4731  N  NZ    . LYS A 1 1130 ? 113.493 102.771 118.549 1.00 88.67  ?  1002 LYS A NZ    1 
ATOM   4732  N  N     . THR A 1 1131 ? 119.113 99.170  118.112 1.00 50.83  ?  1003 THR A N     1 
ATOM   4733  C  CA    . THR A 1 1131 ? 119.633 97.815  118.236 1.00 51.77  ?  1003 THR A CA    1 
ATOM   4734  C  C     . THR A 1 1131 ? 121.106 97.834  118.614 1.00 48.62  ?  1003 THR A C     1 
ATOM   4735  O  O     . THR A 1 1131 ? 121.541 97.069  119.481 1.00 46.48  ?  1003 THR A O     1 
ATOM   4736  C  CB    . THR A 1 1131 ? 119.436 97.050  116.923 1.00 54.64  ?  1003 THR A CB    1 
ATOM   4737  O  OG1   . THR A 1 1131 ? 120.295 97.599  115.912 1.00 53.24  ?  1003 THR A OG1   1 
ATOM   4738  C  CG2   . THR A 1 1131 ? 117.989 97.132  116.441 1.00 60.03  ?  1003 THR A CG2   1 
ATOM   4739  N  N     . PHE A 1 1132 ? 121.882 98.720  117.988 1.00 49.57  ?  1004 PHE A N     1 
ATOM   4740  C  CA    . PHE A 1 1132 ? 123.313 98.835  118.233 1.00 50.73  ?  1004 PHE A CA    1 
ATOM   4741  C  C     . PHE A 1 1132 ? 123.679 100.044 119.080 1.00 52.41  ?  1004 PHE A C     1 
ATOM   4742  O  O     . PHE A 1 1132 ? 124.630 99.967  119.866 1.00 58.38  ?  1004 PHE A O     1 
ATOM   4743  C  CB    . PHE A 1 1132 ? 124.074 98.925  116.903 1.00 49.33  ?  1004 PHE A CB    1 
ATOM   4744  C  CG    . PHE A 1 1132 ? 123.743 97.827  115.924 1.00 44.56  ?  1004 PHE A CG    1 
ATOM   4745  C  CD1   . PHE A 1 1132 ? 124.110 96.519  116.175 1.00 43.23  ?  1004 PHE A CD1   1 
ATOM   4746  C  CD2   . PHE A 1 1132 ? 123.100 98.113  114.737 1.00 39.20  ?  1004 PHE A CD2   1 
ATOM   4747  C  CE1   . PHE A 1 1132 ? 123.815 95.524  115.273 1.00 40.29  ?  1004 PHE A CE1   1 
ATOM   4748  C  CE2   . PHE A 1 1132 ? 122.808 97.115  113.837 1.00 39.16  ?  1004 PHE A CE2   1 
ATOM   4749  C  CZ    . PHE A 1 1132 ? 123.166 95.825  114.109 1.00 41.24  ?  1004 PHE A CZ    1 
ATOM   4750  N  N     . GLU A 1 1133 ? 122.920 101.136 118.947 1.00 53.00  ?  1005 GLU A N     1 
ATOM   4751  C  CA    . GLU A 1 1133 ? 123.241 102.421 119.556 1.00 58.03  ?  1005 GLU A CA    1 
ATOM   4752  C  C     . GLU A 1 1133 ? 123.785 102.268 120.969 1.00 51.40  ?  1005 GLU A C     1 
ATOM   4753  O  O     . GLU A 1 1133 ? 124.866 102.772 121.304 1.00 58.66  ?  1005 GLU A O     1 
ATOM   4754  C  CB    . GLU A 1 1133 ? 121.992 103.303 119.554 1.00 67.36  ?  1005 GLU A CB    1 
ATOM   4755  C  CG    . GLU A 1 1133 ? 122.159 104.594 120.319 1.00 99.22  ?  1005 GLU A CG    1 
ATOM   4756  C  CD    . GLU A 1 1133 ? 120.988 105.543 120.133 1.00 120.81 ?  1005 GLU A CD    1 
ATOM   4757  O  OE1   . GLU A 1 1133 ? 119.936 105.108 119.619 1.00 103.47 ?  1005 GLU A OE1   1 
ATOM   4758  O  OE2   . GLU A 1 1133 ? 121.120 106.730 120.506 1.00 207.60 -1 1005 GLU A OE2   1 
ATOM   4759  N  N     . LEU A 1 1134 ? 123.041 101.559 121.810 1.00 45.88  ?  1006 LEU A N     1 
ATOM   4760  C  CA    . LEU A 1 1134 ? 123.586 101.171 123.099 1.00 50.10  ?  1006 LEU A CA    1 
ATOM   4761  C  C     . LEU A 1 1134 ? 124.942 100.501 122.937 1.00 48.12  ?  1006 LEU A C     1 
ATOM   4762  O  O     . LEU A 1 1134 ? 125.965 101.062 123.326 1.00 53.56  ?  1006 LEU A O     1 
ATOM   4763  C  CB    . LEU A 1 1134 ? 122.602 100.256 123.817 1.00 44.34  ?  1006 LEU A CB    1 
ATOM   4764  C  CG    . LEU A 1 1134 ? 121.340 101.018 124.168 1.00 41.84  ?  1006 LEU A CG    1 
ATOM   4765  C  CD1   . LEU A 1 1134 ? 120.371 100.183 124.994 1.00 37.63  ?  1006 LEU A CD1   1 
ATOM   4766  C  CD2   . LEU A 1 1134 ? 121.752 102.266 124.895 1.00 40.22  ?  1006 LEU A CD2   1 
ATOM   4767  N  N     . GLU A 1 1135 ? 124.970 99.338  122.281 1.00 55.16  ?  1007 GLU A N     1 
ATOM   4768  C  CA    . GLU A 1 1135 ? 126.159 98.485  122.274 1.00 59.97  ?  1007 GLU A CA    1 
ATOM   4769  C  C     . GLU A 1 1135 ? 127.421 99.292  122.001 1.00 60.47  ?  1007 GLU A C     1 
ATOM   4770  O  O     . GLU A 1 1135 ? 128.389 99.262  122.773 1.00 63.16  ?  1007 GLU A O     1 
ATOM   4771  C  CB    . GLU A 1 1135 ? 125.989 97.377  121.232 1.00 69.11  ?  1007 GLU A CB    1 
ATOM   4772  C  CG    . GLU A 1 1135 ? 127.248 96.578  120.928 1.00 88.23  ?  1007 GLU A CG    1 
ATOM   4773  C  CD    . GLU A 1 1135 ? 126.984 95.394  120.004 1.00 121.15 ?  1007 GLU A CD    1 
ATOM   4774  O  OE1   . GLU A 1 1135 ? 125.820 94.947  119.906 1.00 97.23  ?  1007 GLU A OE1   1 
ATOM   4775  O  OE2   . GLU A 1 1135 ? 127.944 94.903  119.377 1.00 258.00 -1 1007 GLU A OE2   1 
ATOM   4776  N  N     . ASP A 1 1136 ? 127.404 100.063 120.919 1.00 65.41  ?  1008 ASP A N     1 
ATOM   4777  C  CA    . ASP A 1 1136 ? 128.607 100.822 120.593 1.00 75.51  ?  1008 ASP A CA    1 
ATOM   4778  C  C     . ASP A 1 1136 ? 128.827 101.979 121.567 1.00 68.45  ?  1008 ASP A C     1 
ATOM   4779  O  O     . ASP A 1 1136 ? 129.983 102.288 121.888 1.00 69.09  ?  1008 ASP A O     1 
ATOM   4780  C  CB    . ASP A 1 1136 ? 128.590 101.307 119.135 1.00 132.21 ?  1008 ASP A CB    1 
ATOM   4781  C  CG    . ASP A 1 1136 ? 127.235 101.802 118.686 1.00 112.12 ?  1008 ASP A CG    1 
ATOM   4782  O  OD1   . ASP A 1 1136 ? 126.319 101.801 119.508 1.00 78.23  ?  1008 ASP A OD1   1 
ATOM   4783  O  OD2   . ASP A 1 1136 ? 127.084 102.164 117.492 1.00 197.32 -1 1008 ASP A OD2   1 
ATOM   4784  N  N     . ILE A 1 1137 ? 127.760 102.621 122.067 1.00 61.77  ?  1009 ILE A N     1 
ATOM   4785  C  CA    . ILE A 1 1137 ? 127.952 103.668 123.068 1.00 56.98  ?  1009 ILE A CA    1 
ATOM   4786  C  C     . ILE A 1 1137 ? 128.636 103.108 124.306 1.00 131.12 ?  1009 ILE A C     1 
ATOM   4787  O  O     . ILE A 1 1137 ? 129.615 103.673 124.801 1.00 66.36  ?  1009 ILE A O     1 
ATOM   4788  C  CB    . ILE A 1 1137 ? 126.609 104.336 123.417 1.00 48.57  ?  1009 ILE A CB    1 
ATOM   4789  C  CG1   . ILE A 1 1137 ? 126.226 105.379 122.367 1.00 54.00  ?  1009 ILE A CG1   1 
ATOM   4790  C  CG2   . ILE A 1 1137 ? 126.649 104.942 124.798 1.00 43.44  ?  1009 ILE A CG2   1 
ATOM   4791  C  CD1   . ILE A 1 1137 ? 125.147 106.344 122.826 1.00 39.90  ?  1009 ILE A CD1   1 
ATOM   4792  N  N     . LEU A 1 1138 ? 128.101 102.015 124.842 1.00 57.08  ?  1010 LEU A N     1 
ATOM   4793  C  CA    . LEU A 1 1138 ? 128.713 101.358 125.985 1.00 50.13  ?  1010 LEU A CA    1 
ATOM   4794  C  C     . LEU A 1 1138 ? 130.167 101.013 125.697 1.00 54.73  ?  1010 LEU A C     1 
ATOM   4795  O  O     . LEU A 1 1138 ? 131.038 101.180 126.560 1.00 57.11  ?  1010 LEU A O     1 
ATOM   4796  C  CB    . LEU A 1 1138 ? 127.920 100.105 126.336 1.00 42.98  ?  1010 LEU A CB    1 
ATOM   4797  C  CG    . LEU A 1 1138 ? 128.660 98.970  127.027 1.00 33.56  ?  1010 LEU A CG    1 
ATOM   4798  C  CD1   . LEU A 1 1138 ? 129.298 99.436  128.322 1.00 36.67  ?  1010 LEU A CD1   1 
ATOM   4799  C  CD2   . LEU A 1 1138 ? 127.747 97.786  127.269 1.00 28.85  ?  1010 LEU A CD2   1 
ATOM   4800  N  N     . LYS A 1 1139 ? 130.446 100.508 124.490 1.00 58.30  ?  1011 LYS A N     1 
ATOM   4801  C  CA    . LYS A 1 1139 ? 131.820 100.153 124.154 1.00 63.09  ?  1011 LYS A CA    1 
ATOM   4802  C  C     . LYS A 1 1139 ? 132.730 101.369 124.271 1.00 76.31  ?  1011 LYS A C     1 
ATOM   4803  O  O     . LYS A 1 1139 ? 133.742 101.351 124.984 1.00 64.94  ?  1011 LYS A O     1 
ATOM   4804  C  CB    . LYS A 1 1139 ? 131.883 99.560  122.750 1.00 61.48  ?  1011 LYS A CB    1 
ATOM   4805  C  CG    . LYS A 1 1139 ? 133.258 99.021  122.385 1.00 56.60  ?  1011 LYS A CG    1 
ATOM   4806  C  CD    . LYS A 1 1139 ? 133.230 98.221  121.103 1.00 50.59  ?  1011 LYS A CD    1 
ATOM   4807  C  CE    . LYS A 1 1139 ? 132.999 99.124  119.918 1.00 59.66  ?  1011 LYS A CE    1 
ATOM   4808  N  NZ    . LYS A 1 1139 ? 133.018 98.342  118.660 1.00 69.78  ?  1011 LYS A NZ    1 
ATOM   4809  N  N     . HIS A 1 1140 ? 132.365 102.444 123.579 1.00 251.76 ?  1012 HIS A N     1 
ATOM   4810  C  CA    . HIS A 1 1140 ? 133.164 103.661 123.619 1.00 59.81  ?  1012 HIS A CA    1 
ATOM   4811  C  C     . HIS A 1 1140 ? 133.299 104.189 125.038 1.00 56.83  ?  1012 HIS A C     1 
ATOM   4812  O  O     . HIS A 1 1140 ? 134.363 104.680 125.429 1.00 246.04 ?  1012 HIS A O     1 
ATOM   4813  C  CB    . HIS A 1 1140 ? 132.526 104.708 122.718 1.00 54.66  ?  1012 HIS A CB    1 
ATOM   4814  C  CG    . HIS A 1 1140 ? 133.141 104.784 121.361 1.00 53.51  ?  1012 HIS A CG    1 
ATOM   4815  N  ND1   . HIS A 1 1140 ? 133.222 103.690 120.526 1.00 56.29  ?  1012 HIS A ND1   1 
ATOM   4816  C  CD2   . HIS A 1 1140 ? 133.720 105.812 120.697 1.00 48.99  ?  1012 HIS A CD2   1 
ATOM   4817  C  CE1   . HIS A 1 1140 ? 133.811 104.045 119.399 1.00 49.15  ?  1012 HIS A CE1   1 
ATOM   4818  N  NE2   . HIS A 1 1140 ? 134.125 105.326 119.479 1.00 46.65  ?  1012 HIS A NE2   1 
ATOM   4819  N  N     . HIS A 1 1141 ? 132.223 104.111 125.816 1.00 49.11  ?  1013 HIS A N     1 
ATOM   4820  C  CA    . HIS A 1 1141 ? 132.230 104.614 127.181 1.00 40.82  ?  1013 HIS A CA    1 
ATOM   4821  C  C     . HIS A 1 1141 ? 133.262 103.873 128.013 1.00 35.47  ?  1013 HIS A C     1 
ATOM   4822  O  O     . HIS A 1 1141 ? 134.232 104.469 128.504 1.00 29.54  ?  1013 HIS A O     1 
ATOM   4823  C  CB    . HIS A 1 1141 ? 130.830 104.451 127.771 1.00 36.38  ?  1013 HIS A CB    1 
ATOM   4824  C  CG    . HIS A 1 1141 ? 130.564 105.270 128.996 1.00 27.80  ?  1013 HIS A CG    1 
ATOM   4825  N  ND1   . HIS A 1 1141 ? 131.566 105.880 129.720 1.00 26.51  ?  1013 HIS A ND1   1 
ATOM   4826  C  CD2   . HIS A 1 1141 ? 129.403 105.552 129.640 1.00 25.19  ?  1013 HIS A CD2   1 
ATOM   4827  C  CE1   . HIS A 1 1141 ? 131.031 106.512 130.749 1.00 24.21  ?  1013 HIS A CE1   1 
ATOM   4828  N  NE2   . HIS A 1 1141 ? 129.722 106.327 130.725 1.00 15.88  ?  1013 HIS A NE2   1 
ATOM   4829  N  N     . TRP A 1 1142 ? 133.064 102.559 128.180 1.00 41.35  ?  1014 TRP A N     1 
ATOM   4830  C  CA    . TRP A 1 1142 ? 134.000 101.769 128.973 1.00 38.71  ?  1014 TRP A CA    1 
ATOM   4831  C  C     . TRP A 1 1142 ? 135.415 101.979 128.476 1.00 30.24  ?  1014 TRP A C     1 
ATOM   4832  O  O     . TRP A 1 1142 ? 136.359 102.044 129.272 1.00 28.18  ?  1014 TRP A O     1 
ATOM   4833  C  CB    . TRP A 1 1142 ? 133.646 100.280 128.942 1.00 142.14 ?  1014 TRP A CB    1 
ATOM   4834  C  CG    . TRP A 1 1142 ? 134.771 99.396  129.443 1.00 27.46  ?  1014 TRP A CG    1 
ATOM   4835  C  CD1   . TRP A 1 1142 ? 135.773 98.844  128.704 1.00 25.81  ?  1014 TRP A CD1   1 
ATOM   4836  C  CD2   . TRP A 1 1142 ? 134.994 98.980  130.787 1.00 18.78  ?  1014 TRP A CD2   1 
ATOM   4837  N  NE1   . TRP A 1 1142 ? 136.607 98.112  129.504 1.00 19.76  ?  1014 TRP A NE1   1 
ATOM   4838  C  CE2   . TRP A 1 1142 ? 136.149 98.182  130.789 1.00 16.74  ?  1014 TRP A CE2   1 
ATOM   4839  C  CE3   . TRP A 1 1142 ? 134.332 99.206  131.984 1.00 25.60  ?  1014 TRP A CE3   1 
ATOM   4840  C  CZ2   . TRP A 1 1142 ? 136.650 97.614  131.933 1.00 14.64  ?  1014 TRP A CZ2   1 
ATOM   4841  C  CZ3   . TRP A 1 1142 ? 134.823 98.639  133.110 1.00 24.15  ?  1014 TRP A CZ3   1 
ATOM   4842  C  CH2   . TRP A 1 1142 ? 135.978 97.853  133.087 1.00 19.08  ?  1014 TRP A CH2   1 
ATOM   4843  N  N     . LEU A 1 1143 ? 135.580 102.096 127.159 1.00 35.53  ?  1015 LEU A N     1 
ATOM   4844  C  CA    . LEU A 1 1143 ? 136.906 102.349 126.625 1.00 29.77  ?  1015 LEU A CA    1 
ATOM   4845  C  C     . LEU A 1 1143 ? 137.463 103.646 127.178 1.00 24.35  ?  1015 LEU A C     1 
ATOM   4846  O  O     . LEU A 1 1143 ? 138.602 103.697 127.651 1.00 23.35  ?  1015 LEU A O     1 
ATOM   4847  C  CB    . LEU A 1 1143 ? 136.855 102.380 125.105 1.00 39.98  ?  1015 LEU A CB    1 
ATOM   4848  C  CG    . LEU A 1 1143 ? 138.212 102.408 124.404 1.00 49.22  ?  1015 LEU A CG    1 
ATOM   4849  C  CD1   . LEU A 1 1143 ? 139.153 101.412 125.038 1.00 45.56  ?  1015 LEU A CD1   1 
ATOM   4850  C  CD2   . LEU A 1 1143 ? 138.064 102.127 122.916 1.00 59.32  ?  1015 LEU A CD2   1 
ATOM   4851  N  N     . TYR A 1 1144 ? 136.660 104.701 127.144 1.00 26.57  ?  1016 TYR A N     1 
ATOM   4852  C  CA    . TYR A 1 1144 ? 137.041 105.981 127.713 1.00 24.78  ?  1016 TYR A CA    1 
ATOM   4853  C  C     . TYR A 1 1144 ? 137.198 105.921 129.222 1.00 19.43  ?  1016 TYR A C     1 
ATOM   4854  O  O     . TYR A 1 1144 ? 137.688 106.882 129.821 1.00 20.58  ?  1016 TYR A O     1 
ATOM   4855  C  CB    . TYR A 1 1144 ? 135.993 107.039 127.333 1.00 30.05  ?  1016 TYR A CB    1 
ATOM   4856  C  CG    . TYR A 1 1144 ? 136.122 108.369 128.055 1.00 19.21  ?  1016 TYR A CG    1 
ATOM   4857  C  CD1   . TYR A 1 1144 ? 137.158 109.244 127.769 1.00 21.44  ?  1016 TYR A CD1   1 
ATOM   4858  C  CD2   . TYR A 1 1144 ? 135.204 108.745 129.014 1.00 20.64  ?  1016 TYR A CD2   1 
ATOM   4859  C  CE1   . TYR A 1 1144 ? 137.266 110.446 128.421 1.00 17.20  ?  1016 TYR A CE1   1 
ATOM   4860  C  CE2   . TYR A 1 1144 ? 135.312 109.938 129.666 1.00 19.42  ?  1016 TYR A CE2   1 
ATOM   4861  C  CZ    . TYR A 1 1144 ? 136.337 110.786 129.369 1.00 16.25  ?  1016 TYR A CZ    1 
ATOM   4862  O  OH    . TYR A 1 1144 ? 136.429 111.982 130.028 1.00 23.37  ?  1016 TYR A OH    1 
ATOM   4863  N  N     . THR A 1 1145 ? 136.828 104.814 129.847 1.00 20.98  ?  1017 THR A N     1 
ATOM   4864  C  CA    . THR A 1 1145 ? 136.788 104.769 131.299 1.00 17.35  ?  1017 THR A CA    1 
ATOM   4865  C  C     . THR A 1 1145 ? 137.971 104.088 131.960 1.00 18.99  ?  1017 THR A C     1 
ATOM   4866  O  O     . THR A 1 1145 ? 138.343 104.484 133.063 1.00 23.89  ?  1017 THR A O     1 
ATOM   4867  C  CB    . THR A 1 1145 ? 135.522 104.062 131.763 1.00 20.27  ?  1017 THR A CB    1 
ATOM   4868  O  OG1   . THR A 1 1145 ? 134.467 104.371 130.847 1.00 28.63  ?  1017 THR A OG1   1 
ATOM   4869  C  CG2   . THR A 1 1145 ? 135.145 104.556 133.136 1.00 19.51  ?  1017 THR A CG2   1 
ATOM   4870  N  N     . SER A 1 1146 ? 138.559 103.075 131.338 1.00 23.68  ?  1018 SER A N     1 
ATOM   4871  C  CA    . SER A 1 1146 ? 139.649 102.349 131.975 1.00 23.31  ?  1018 SER A CA    1 
ATOM   4872  C  C     . SER A 1 1146 ? 140.812 103.278 132.307 1.00 23.34  ?  1018 SER A C     1 
ATOM   4873  O  O     . SER A 1 1146 ? 141.054 104.276 131.623 1.00 24.25  ?  1018 SER A O     1 
ATOM   4874  C  CB    . SER A 1 1146 ? 140.132 101.220 131.062 1.00 28.09  ?  1018 SER A CB    1 
ATOM   4875  O  OG    . SER A 1 1146 ? 141.480 100.881 131.325 1.00 31.03  ?  1018 SER A OG    1 
ATOM   4876  N  N     . LYS A 1 1147 ? 141.515 102.955 133.392 1.00 22.23  ?  1019 LYS A N     1 
ATOM   4877  C  CA    . LYS A 1 1147 ? 142.749 103.658 133.724 1.00 23.63  ?  1019 LYS A CA    1 
ATOM   4878  C  C     . LYS A 1 1147 ? 143.699 103.711 132.534 1.00 26.10  ?  1019 LYS A C     1 
ATOM   4879  O  O     . LYS A 1 1147 ? 144.175 104.783 132.159 1.00 28.81  ?  1019 LYS A O     1 
ATOM   4880  C  CB    . LYS A 1 1147 ? 143.429 102.972 134.909 1.00 28.00  ?  1019 LYS A CB    1 
ATOM   4881  C  CG    . LYS A 1 1147 ? 143.057 103.497 136.268 1.00 23.01  ?  1019 LYS A CG    1 
ATOM   4882  C  CD    . LYS A 1 1147 ? 143.508 104.919 136.442 1.00 21.23  ?  1019 LYS A CD    1 
ATOM   4883  C  CE    . LYS A 1 1147 ? 143.018 105.431 137.761 1.00 24.05  ?  1019 LYS A CE    1 
ATOM   4884  N  NZ    . LYS A 1 1147 ? 141.622 104.970 137.956 1.00 19.05  ?  1019 LYS A NZ    1 
ATOM   4885  N  N     . TYR A 1 1148 ? 143.955 102.555 131.913 1.00 26.28  ?  1020 TYR A N     1 
ATOM   4886  C  CA    . TYR A 1 1148 ? 145.073 102.386 130.984 1.00 24.44  ?  1020 TYR A CA    1 
ATOM   4887  C  C     . TYR A 1 1148 ? 145.219 103.528 129.989 1.00 29.68  ?  1020 TYR A C     1 
ATOM   4888  O  O     . TYR A 1 1148 ? 146.290 104.136 129.850 1.00 35.05  ?  1020 TYR A O     1 
ATOM   4889  C  CB    . TYR A 1 1148 ? 144.912 101.063 130.234 1.00 22.69  ?  1020 TYR A CB    1 
ATOM   4890  C  CG    . TYR A 1 1148 ? 146.180 100.613 129.563 1.00 25.81  ?  1020 TYR A CG    1 
ATOM   4891  C  CD1   . TYR A 1 1148 ? 147.284 100.270 130.315 1.00 19.31  ?  1020 TYR A CD1   1 
ATOM   4892  C  CD2   . TYR A 1 1148 ? 146.275 100.527 128.185 1.00 23.45  ?  1020 TYR A CD2   1 
ATOM   4893  C  CE1   . TYR A 1 1148 ? 148.448 99.867  129.723 1.00 27.42  ?  1020 TYR A CE1   1 
ATOM   4894  C  CE2   . TYR A 1 1148 ? 147.440 100.115 127.579 1.00 24.32  ?  1020 TYR A CE2   1 
ATOM   4895  C  CZ    . TYR A 1 1148 ? 148.526 99.789  128.357 1.00 27.86  ?  1020 TYR A CZ    1 
ATOM   4896  O  OH    . TYR A 1 1148 ? 149.702 99.379  127.781 1.00 32.39  ?  1020 TYR A OH    1 
ATOM   4897  N  N     . LEU A 1 1149 ? 144.136 103.836 129.291 1.00 27.04  ?  1021 LEU A N     1 
ATOM   4898  C  CA    . LEU A 1 1149 ? 144.190 104.893 128.299 1.00 28.82  ?  1021 LEU A CA    1 
ATOM   4899  C  C     . LEU A 1 1149 ? 144.283 106.263 128.953 1.00 29.42  ?  1021 LEU A C     1 
ATOM   4900  O  O     . LEU A 1 1149 ? 144.849 107.187 128.369 1.00 31.85  ?  1021 LEU A O     1 
ATOM   4901  C  CB    . LEU A 1 1149 ? 142.969 104.801 127.393 1.00 23.16  ?  1021 LEU A CB    1 
ATOM   4902  C  CG    . LEU A 1 1149 ? 142.863 103.448 126.703 1.00 23.19  ?  1021 LEU A CG    1 
ATOM   4903  C  CD1   . LEU A 1 1149 ? 141.845 102.569 127.420 1.00 25.86  ?  1021 LEU A CD1   1 
ATOM   4904  C  CD2   . LEU A 1 1149 ? 142.520 103.606 125.236 1.00 36.27  ?  1021 LEU A CD2   1 
ATOM   4905  N  N     . GLN A 1 1150 ? 143.741 106.420 130.161 1.00 27.30  ?  1022 GLN A N     1 
ATOM   4906  C  CA    . GLN A 1 1150 ? 143.935 107.676 130.877 1.00 26.94  ?  1022 GLN A CA    1 
ATOM   4907  C  C     . GLN A 1 1150 ? 145.405 107.874 131.225 1.00 36.04  ?  1022 GLN A C     1 
ATOM   4908  O  O     . GLN A 1 1150 ? 145.951 108.974 131.067 1.00 46.73  ?  1022 GLN A O     1 
ATOM   4909  C  CB    . GLN A 1 1150 ? 143.063 107.706 132.134 1.00 22.55  ?  1022 GLN A CB    1 
ATOM   4910  C  CG    . GLN A 1 1150 ? 141.567 107.629 131.856 1.00 25.94  ?  1022 GLN A CG    1 
ATOM   4911  C  CD    . GLN A 1 1150 ? 140.728 107.635 133.120 1.00 23.24  ?  1022 GLN A CD    1 
ATOM   4912  O  OE1   . GLN A 1 1150 ? 141.250 107.763 134.231 1.00 24.52  ?  1022 GLN A OE1   1 
ATOM   4913  N  NE2   . GLN A 1 1150 ? 139.411 107.510 132.954 1.00 21.79  ?  1022 GLN A NE2   1 
ATOM   4914  N  N     . LYS A 1 1151 ? 146.055 106.816 131.711 1.00 32.29  ?  1023 LYS A N     1 
ATOM   4915  C  CA    . LYS A 1 1151 ? 147.492 106.846 131.929 1.00 36.93  ?  1023 LYS A CA    1 
ATOM   4916  C  C     . LYS A 1 1151 ? 148.215 107.275 130.664 1.00 42.27  ?  1023 LYS A C     1 
ATOM   4917  O  O     . LYS A 1 1151 ? 149.055 108.182 130.691 1.00 46.81  ?  1023 LYS A O     1 
ATOM   4918  C  CB    . LYS A 1 1151 ? 147.973 105.472 132.393 1.00 29.65  ?  1023 LYS A CB    1 
ATOM   4919  C  CG    . LYS A 1 1151 ? 148.399 105.425 133.846 1.00 35.89  ?  1023 LYS A CG    1 
ATOM   4920  C  CD    . LYS A 1 1151 ? 149.805 106.002 133.986 1.00 36.00  ?  1023 LYS A CD    1 
ATOM   4921  C  CE    . LYS A 1 1151 ? 150.085 106.481 135.398 1.00 37.66  ?  1023 LYS A CE    1 
ATOM   4922  N  NZ    . LYS A 1 1151 ? 150.006 105.368 136.377 1.00 45.47  ?  1023 LYS A NZ    1 
ATOM   4923  N  N     . PHE A 1 1152 ? 147.888 106.642 129.535 1.00 39.25  ?  1024 PHE A N     1 
ATOM   4924  C  CA    . PHE A 1 1152 ? 148.556 107.011 128.291 1.00 39.33  ?  1024 PHE A CA    1 
ATOM   4925  C  C     . PHE A 1 1152 ? 148.168 108.400 127.814 1.00 35.76  ?  1024 PHE A C     1 
ATOM   4926  O  O     . PHE A 1 1152 ? 148.869 108.970 126.978 1.00 38.42  ?  1024 PHE A O     1 
ATOM   4927  C  CB    . PHE A 1 1152 ? 148.262 105.974 127.205 1.00 42.30  ?  1024 PHE A CB    1 
ATOM   4928  C  CG    . PHE A 1 1152 ? 149.057 104.705 127.356 1.00 54.35  ?  1024 PHE A CG    1 
ATOM   4929  C  CD1   . PHE A 1 1152 ? 150.084 104.636 128.277 1.00 63.42  ?  1024 PHE A CD1   1 
ATOM   4930  C  CD2   . PHE A 1 1152 ? 148.798 103.593 126.574 1.00 63.46  ?  1024 PHE A CD2   1 
ATOM   4931  C  CE1   . PHE A 1 1152 ? 150.826 103.484 128.429 1.00 67.07  ?  1024 PHE A CE1   1 
ATOM   4932  C  CE2   . PHE A 1 1152 ? 149.549 102.441 126.722 1.00 78.35  ?  1024 PHE A CE2   1 
ATOM   4933  C  CZ    . PHE A 1 1152 ? 150.556 102.388 127.650 1.00 80.82  ?  1024 PHE A CZ    1 
ATOM   4934  N  N     . MET A 1 1153 ? 147.080 108.951 128.335 1.00 36.18  ?  1025 MET A N     1 
ATOM   4935  C  CA    . MET A 1 1153 ? 146.696 110.320 128.040 1.00 45.70  ?  1025 MET A CA    1 
ATOM   4936  C  C     . MET A 1 1153 ? 147.514 111.318 128.844 1.00 56.20  ?  1025 MET A C     1 
ATOM   4937  O  O     . MET A 1 1153 ? 147.786 112.425 128.367 1.00 58.77  ?  1025 MET A O     1 
ATOM   4938  C  CB    . MET A 1 1153 ? 145.206 110.490 128.331 1.00 45.39  ?  1025 MET A CB    1 
ATOM   4939  C  CG    . MET A 1 1153 ? 144.677 111.899 128.222 1.00 46.68  ?  1025 MET A CG    1 
ATOM   4940  S  SD    . MET A 1 1153 ? 144.854 112.528 126.546 1.00 34.57  ?  1025 MET A SD    1 
ATOM   4941  C  CE    . MET A 1 1153 ? 144.124 111.201 125.588 1.00 27.29  ?  1025 MET A CE    1 
ATOM   4942  N  N     . GLU A 1 1154 ? 147.906 110.958 130.064 1.00 59.44  ?  1026 GLU A N     1 
ATOM   4943  C  CA    . GLU A 1 1154 ? 148.722 111.869 130.862 1.00 68.43  ?  1026 GLU A CA    1 
ATOM   4944  C  C     . GLU A 1 1154 ? 150.097 112.066 130.239 1.00 76.97  ?  1026 GLU A C     1 
ATOM   4945  O  O     . GLU A 1 1154 ? 150.526 113.202 130.015 1.00 80.34  ?  1026 GLU A O     1 
ATOM   4946  C  CB    . GLU A 1 1154 ? 148.839 111.347 132.287 1.00 74.12  ?  1026 GLU A CB    1 
ATOM   4947  C  CG    . GLU A 1 1154 ? 147.490 111.148 132.906 1.00 86.83  ?  1026 GLU A CG    1 
ATOM   4948  C  CD    . GLU A 1 1154 ? 146.521 112.220 132.460 1.00 131.35 ?  1026 GLU A CD    1 
ATOM   4949  O  OE1   . GLU A 1 1154 ? 146.744 113.406 132.782 1.00 133.20 ?  1026 GLU A OE1   1 
ATOM   4950  O  OE2   . GLU A 1 1154 ? 145.577 111.884 131.718 1.00 218.66 -1 1026 GLU A OE2   1 
ATOM   4951  N  N     . ALA A 1 1155 ? 150.801 110.970 129.961 1.00 72.18  ?  1027 ALA A N     1 
ATOM   4952  C  CA    . ALA A 1 1155 ? 152.073 110.979 129.237 1.00 76.29  ?  1027 ALA A CA    1 
ATOM   4953  C  C     . ALA A 1 1155 ? 153.079 111.940 129.875 1.00 94.11  ?  1027 ALA A C     1 
ATOM   4954  O  O     . ALA A 1 1155 ? 153.440 112.974 129.315 1.00 91.01  ?  1027 ALA A O     1 
ATOM   4955  C  CB    . ALA A 1 1155 ? 151.856 111.318 127.758 1.00 64.39  ?  1027 ALA A CB    1 
ATOM   4956  N  N     . HIS A 1 1156 ? 153.492 111.574 131.091 1.00 108.91 ?  1028 HIS A N     1 
ATOM   4957  C  CA    . HIS A 1 1156 ? 154.539 112.292 131.818 1.00 123.50 ?  1028 HIS A CA    1 
ATOM   4958  C  C     . HIS A 1 1156 ? 154.084 113.719 132.143 1.00 121.41 ?  1028 HIS A C     1 
ATOM   4959  O  O     . HIS A 1 1156 ? 154.801 114.693 131.909 1.00 122.77 ?  1028 HIS A O     1 
ATOM   4960  C  CB    . HIS A 1 1156 ? 155.850 112.274 131.013 1.00 130.31 ?  1028 HIS A CB    1 
ATOM   4961  C  CG    . HIS A 1 1156 ? 157.096 112.408 131.836 1.00 136.96 ?  1028 HIS A CG    1 
ATOM   4962  N  ND1   . HIS A 1 1156 ? 158.297 112.810 131.289 1.00 136.58 ?  1028 HIS A ND1   1 
ATOM   4963  C  CD2   . HIS A 1 1156 ? 157.341 112.159 133.145 1.00 140.43 ?  1028 HIS A CD2   1 
ATOM   4964  C  CE1   . HIS A 1 1156 ? 159.223 112.822 132.231 1.00 137.96 ?  1028 HIS A CE1   1 
ATOM   4965  N  NE2   . HIS A 1 1156 ? 158.670 112.431 133.366 1.00 139.65 ?  1028 HIS A NE2   1 
ATOM   4966  N  N     . LYS A 1 1157 ? 152.864 113.831 132.678 1.00 109.74 ?  1029 LYS A N     1 
ATOM   4967  C  CA    . LYS A 1 1157 ? 152.242 115.116 133.009 1.00 98.68  ?  1029 LYS A CA    1 
ATOM   4968  C  C     . LYS A 1 1157 ? 152.090 116.019 131.786 1.00 84.35  ?  1029 LYS A C     1 
ATOM   4969  O  O     . LYS A 1 1157 ? 151.021 116.087 131.176 1.00 71.61  ?  1029 LYS A O     1 
ATOM   4970  C  CB    . LYS A 1 1157 ? 153.044 115.824 134.112 1.00 114.84 ?  1029 LYS A CB    1 
ATOM   4971  C  CG    . LYS A 1 1157 ? 153.129 117.342 134.002 1.00 140.86 ?  1029 LYS A CG    1 
ATOM   4972  C  CD    . LYS A 1 1157 ? 154.442 117.779 133.346 1.00 145.75 ?  1029 LYS A CD    1 
ATOM   4973  C  CE    . LYS A 1 1157 ? 155.644 117.504 134.239 1.00 139.76 ?  1029 LYS A CE    1 
ATOM   4974  N  NZ    . LYS A 1 1157 ? 156.938 117.766 133.541 1.00 132.42 ?  1029 LYS A NZ    1 
ATOM   4975  N  N     . MET B 2 4    ? 75.840  92.929  121.369 1.00 90.32  ?  1    MET B N     1 
ATOM   4976  C  CA    . MET B 2 4    ? 76.933  92.587  120.473 1.00 80.02  ?  1    MET B CA    1 
ATOM   4977  C  C     . MET B 2 4    ? 77.462  93.848  119.790 1.00 78.89  ?  1    MET B C     1 
ATOM   4978  O  O     . MET B 2 4    ? 77.627  93.887  118.573 1.00 77.88  ?  1    MET B O     1 
ATOM   4979  C  CB    . MET B 2 4    ? 76.458  91.544  119.448 1.00 78.28  ?  1    MET B CB    1 
ATOM   4980  C  CG    . MET B 2 4    ? 75.302  91.979  118.538 1.00 72.48  ?  1    MET B CG    1 
ATOM   4981  S  SD    . MET B 2 4    ? 73.750  92.292  119.412 1.00 71.63  ?  1    MET B SD    1 
ATOM   4982  C  CE    . MET B 2 4    ? 72.610  92.540  118.052 1.00 53.09  ?  1    MET B CE    1 
ATOM   4983  N  N     . SER B 2 5    ? 77.735  94.881  120.586 1.00 79.55  ?  2    SER B N     1 
ATOM   4984  C  CA    . SER B 2 5    ? 78.186  96.161  120.055 1.00 76.87  ?  2    SER B CA    1 
ATOM   4985  C  C     . SER B 2 5    ? 79.177  96.801  121.018 1.00 70.25  ?  2    SER B C     1 
ATOM   4986  O  O     . SER B 2 5    ? 79.130  96.565  122.227 1.00 70.98  ?  2    SER B O     1 
ATOM   4987  C  CB    . SER B 2 5    ? 77.007  97.122  119.814 1.00 77.04  ?  2    SER B CB    1 
ATOM   4988  O  OG    . SER B 2 5    ? 77.456  98.428  119.500 1.00 73.32  ?  2    SER B OG    1 
ATOM   4989  N  N     . LEU B 2 6    ? 80.069  97.626  120.473 1.00 67.06  ?  3    LEU B N     1 
ATOM   4990  C  CA    . LEU B 2 6    ? 81.045  98.364  121.263 1.00 64.52  ?  3    LEU B CA    1 
ATOM   4991  C  C     . LEU B 2 6    ? 80.634  99.829  121.369 1.00 69.81  ?  3    LEU B C     1 
ATOM   4992  O  O     . LEU B 2 6    ? 79.708  100.298 120.701 1.00 68.39  ?  3    LEU B O     1 
ATOM   4993  C  CB    . LEU B 2 6    ? 82.449  98.253  120.654 1.00 54.63  ?  3    LEU B CB    1 
ATOM   4994  C  CG    . LEU B 2 6    ? 82.690  98.905  119.295 1.00 58.53  ?  3    LEU B CG    1 
ATOM   4995  C  CD1   . LEU B 2 6    ? 83.286  100.310 119.417 1.00 55.23  ?  3    LEU B CD1   1 
ATOM   4996  C  CD2   . LEU B 2 6    ? 83.581  98.024  118.453 1.00 65.85  ?  3    LEU B CD2   1 
ATOM   4997  N  N     . GLN B 2 7    ? 81.351  100.546 122.234 1.00 66.66  ?  4    GLN B N     1 
ATOM   4998  C  CA    . GLN B 2 7    ? 81.176  101.964 122.480 1.00 62.76  ?  4    GLN B CA    1 
ATOM   4999  C  C     . GLN B 2 7    ? 82.508  102.490 123.004 1.00 61.45  ?  4    GLN B C     1 
ATOM   5000  O  O     . GLN B 2 7    ? 83.068  101.901 123.946 1.00 63.20  ?  4    GLN B O     1 
ATOM   5001  C  CB    . GLN B 2 7    ? 80.067  102.264 123.486 1.00 62.91  ?  4    GLN B CB    1 
ATOM   5002  C  CG    . GLN B 2 7    ? 80.231  103.596 124.203 1.00 66.76  ?  4    GLN B CG    1 
ATOM   5003  C  CD    . GLN B 2 7    ? 79.472  103.664 125.516 1.00 68.73  ?  4    GLN B CD    1 
ATOM   5004  O  OE1   . GLN B 2 7    ? 78.789  102.714 125.910 1.00 68.12  ?  4    GLN B OE1   1 
ATOM   5005  N  NE2   . GLN B 2 7    ? 79.593  104.791 126.206 1.00 70.27  ?  4    GLN B NE2   1 
ATOM   5006  N  N     . PRO B 2 8    ? 83.040  103.566 122.428 1.00 59.94  ?  5    PRO B N     1 
ATOM   5007  C  CA    . PRO B 2 8    ? 84.278  104.144 122.963 1.00 60.38  ?  5    PRO B CA    1 
ATOM   5008  C  C     . PRO B 2 8    ? 84.046  104.827 124.306 1.00 69.36  ?  5    PRO B C     1 
ATOM   5009  O  O     . PRO B 2 8    ? 83.018  105.471 124.531 1.00 64.28  ?  5    PRO B O     1 
ATOM   5010  C  CB    . PRO B 2 8    ? 84.689  105.148 121.883 1.00 59.06  ?  5    PRO B CB    1 
ATOM   5011  C  CG    . PRO B 2 8    ? 83.409  105.550 121.257 1.00 61.24  ?  5    PRO B CG    1 
ATOM   5012  C  CD    . PRO B 2 8    ? 82.508  104.344 121.297 1.00 59.09  ?  5    PRO B CD    1 
ATOM   5013  N  N     . LEU B 2 9    ? 85.014  104.671 125.205 1.00 61.85  ?  6    LEU B N     1 
ATOM   5014  C  CA    . LEU B 2 9    ? 85.019  105.353 126.493 1.00 63.18  ?  6    LEU B CA    1 
ATOM   5015  C  C     . LEU B 2 9    ? 86.211  106.306 126.564 1.00 69.06  ?  6    LEU B C     1 
ATOM   5016  O  O     . LEU B 2 9    ? 87.038  106.380 125.653 1.00 69.26  ?  6    LEU B O     1 
ATOM   5017  C  CB    . LEU B 2 9    ? 85.062  104.345 127.649 1.00 55.09  ?  6    LEU B CB    1 
ATOM   5018  C  CG    . LEU B 2 9    ? 83.960  103.288 127.747 1.00 56.75  ?  6    LEU B CG    1 
ATOM   5019  C  CD1   . LEU B 2 9    ? 84.032  102.575 129.081 1.00 48.23  ?  6    LEU B CD1   1 
ATOM   5020  C  CD2   . LEU B 2 9    ? 82.577  103.870 127.514 1.00 63.72  ?  6    LEU B CD2   1 
ATOM   5021  N  N     . THR B 2 10   ? 86.286  107.046 127.667 1.00 70.78  ?  7    THR B N     1 
ATOM   5022  C  CA    . THR B 2 10   ? 87.465  107.808 128.052 1.00 72.61  ?  7    THR B CA    1 
ATOM   5023  C  C     . THR B 2 10   ? 87.594  107.711 129.562 1.00 75.75  ?  7    THR B C     1 
ATOM   5024  O  O     . THR B 2 10   ? 86.586  107.715 130.275 1.00 77.88  ?  7    THR B O     1 
ATOM   5025  C  CB    . THR B 2 10   ? 87.396  109.288 127.614 1.00 71.01  ?  7    THR B CB    1 
ATOM   5026  O  OG1   . THR B 2 10   ? 86.097  109.829 127.888 1.00 80.34  ?  7    THR B OG1   1 
ATOM   5027  C  CG2   . THR B 2 10   ? 87.722  109.452 126.133 1.00 66.97  ?  7    THR B CG2   1 
ATOM   5028  N  N     . ALA B 2 11   ? 88.828  107.595 130.046 1.00 76.41  ?  8    ALA B N     1 
ATOM   5029  C  CA    . ALA B 2 11   ? 89.089  107.581 131.481 1.00 81.41  ?  8    ALA B CA    1 
ATOM   5030  C  C     . ALA B 2 11   ? 89.178  109.022 131.971 1.00 89.15  ?  8    ALA B C     1 
ATOM   5031  O  O     . ALA B 2 11   ? 89.950  109.817 131.423 1.00 90.42  ?  8    ALA B O     1 
ATOM   5032  C  CB    . ALA B 2 11   ? 90.376  106.823 131.808 1.00 72.74  ?  8    ALA B CB    1 
ATOM   5033  N  N     . VAL B 2 12   ? 88.380  109.359 132.990 1.00 91.50  ?  9    VAL B N     1 
ATOM   5034  C  CA    . VAL B 2 12   ? 88.395  110.715 133.537 1.00 106.22 ?  9    VAL B CA    1 
ATOM   5035  C  C     . VAL B 2 12   ? 89.793  111.071 134.022 1.00 96.95  ?  9    VAL B C     1 
ATOM   5036  O  O     . VAL B 2 12   ? 90.307  112.162 133.749 1.00 100.92 ?  9    VAL B O     1 
ATOM   5037  C  CB    . VAL B 2 12   ? 87.347  110.856 134.659 1.00 113.66 ?  9    VAL B CB    1 
ATOM   5038  C  CG1   . VAL B 2 12   ? 87.558  109.821 135.746 1.00 84.03  ?  9    VAL B CG1   1 
ATOM   5039  C  CG2   . VAL B 2 12   ? 87.373  112.260 135.266 1.00 106.81 ?  9    VAL B CG2   1 
ATOM   5040  N  N     . ASN B 2 13   ? 90.430  110.148 134.731 1.00 90.98  ?  10   ASN B N     1 
ATOM   5041  C  CA    . ASN B 2 13   ? 91.796  110.279 135.213 1.00 89.21  ?  10   ASN B CA    1 
ATOM   5042  C  C     . ASN B 2 13   ? 92.287  108.873 135.530 1.00 84.45  ?  10   ASN B C     1 
ATOM   5043  O  O     . ASN B 2 13   ? 91.697  107.882 135.087 1.00 79.95  ?  10   ASN B O     1 
ATOM   5044  C  CB    . ASN B 2 13   ? 91.877  111.223 136.420 1.00 87.03  ?  10   ASN B CB    1 
ATOM   5045  C  CG    . ASN B 2 13   ? 91.234  110.640 137.662 1.00 83.86  ?  10   ASN B CG    1 
ATOM   5046  O  OD1   . ASN B 2 13   ? 90.242  109.914 137.580 1.00 86.85  ?  10   ASN B OD1   1 
ATOM   5047  N  ND2   . ASN B 2 13   ? 91.793  110.961 138.823 1.00 75.37  ?  10   ASN B ND2   1 
ATOM   5048  N  N     . CYS B 2 14   ? 93.378  108.784 136.291 1.00 81.51  ?  11   CYS B N     1 
ATOM   5049  C  CA    . CYS B 2 14   ? 93.948  107.503 136.708 1.00 73.63  ?  11   CYS B CA    1 
ATOM   5050  C  C     . CYS B 2 14   ? 94.286  106.621 135.512 1.00 64.38  ?  11   CYS B C     1 
ATOM   5051  O  O     . CYS B 2 14   ? 94.419  105.404 135.644 1.00 56.54  ?  11   CYS B O     1 
ATOM   5052  C  CB    . CYS B 2 14   ? 93.008  106.764 137.669 1.00 75.20  ?  11   CYS B CB    1 
ATOM   5053  S  SG    . CYS B 2 14   ? 92.364  107.748 139.048 1.00 83.18  ?  11   CYS B SG    1 
ATOM   5054  N  N     . GLY B 2 15   ? 94.460  107.236 134.345 1.00 71.08  ?  12   GLY B N     1 
ATOM   5055  C  CA    . GLY B 2 15   ? 94.743  106.523 133.116 1.00 73.37  ?  12   GLY B CA    1 
ATOM   5056  C  C     . GLY B 2 15   ? 96.186  106.073 133.033 1.00 68.97  ?  12   GLY B C     1 
ATOM   5057  O  O     . GLY B 2 15   ? 96.726  105.847 131.944 1.00 72.46  ?  12   GLY B O     1 
ATOM   5058  N  N     . SER B 2 16   ? 96.820  105.946 134.203 1.00 55.20  ?  13   SER B N     1 
ATOM   5059  C  CA    . SER B 2 16   ? 98.203  105.508 134.330 1.00 45.35  ?  13   SER B CA    1 
ATOM   5060  C  C     . SER B 2 16   ? 98.330  104.345 135.305 1.00 35.50  ?  13   SER B C     1 
ATOM   5061  O  O     . SER B 2 16   ? 99.441  104.004 135.718 1.00 35.51  ?  13   SER B O     1 
ATOM   5062  C  CB    . SER B 2 16   ? 99.085  106.673 134.784 1.00 47.80  ?  13   SER B CB    1 
ATOM   5063  O  OG    . SER B 2 16   ? 98.685  107.136 136.060 1.00 43.54  ?  13   SER B OG    1 
ATOM   5064  N  N     . LEU B 2 17   ? 97.216  103.715 135.663 1.00 35.41  ?  14   LEU B N     1 
ATOM   5065  C  CA    . LEU B 2 17   ? 97.187  102.718 136.717 1.00 30.43  ?  14   LEU B CA    1 
ATOM   5066  C  C     . LEU B 2 17   ? 96.694  101.365 136.231 1.00 24.58  ?  14   LEU B C     1 
ATOM   5067  O  O     . LEU B 2 17   ? 96.577  100.439 137.041 1.00 24.25  ?  14   LEU B O     1 
ATOM   5068  C  CB    . LEU B 2 17   ? 96.310  103.218 137.873 1.00 34.38  ?  14   LEU B CB    1 
ATOM   5069  C  CG    . LEU B 2 17   ? 96.738  104.607 138.351 1.00 39.83  ?  14   LEU B CG    1 
ATOM   5070  C  CD1   . LEU B 2 17   ? 95.901  105.096 139.524 1.00 51.95  ?  14   LEU B CD1   1 
ATOM   5071  C  CD2   . LEU B 2 17   ? 98.205  104.594 138.722 1.00 37.51  ?  14   LEU B CD2   1 
ATOM   5072  N  N     . VAL B 2 18   ? 96.379  101.232 134.947 1.00 25.51  ?  15   VAL B N     1 
ATOM   5073  C  CA    . VAL B 2 18   ? 96.140  99.933  134.349 1.00 19.99  ?  15   VAL B CA    1 
ATOM   5074  C  C     . VAL B 2 18   ? 97.417  99.471  133.660 1.00 21.38  ?  15   VAL B C     1 
ATOM   5075  O  O     . VAL B 2 18   ? 98.244  100.274 133.228 1.00 23.99  ?  15   VAL B O     1 
ATOM   5076  C  CB    . VAL B 2 18   ? 94.952  99.977  133.369 1.00 20.59  ?  15   VAL B CB    1 
ATOM   5077  C  CG1   . VAL B 2 18   ? 93.791  100.730 133.993 1.00 17.62  ?  15   VAL B CG1   1 
ATOM   5078  C  CG2   . VAL B 2 18   ? 95.353  100.599 132.043 1.00 26.07  ?  15   VAL B CG2   1 
ATOM   5079  N  N     . GLN B 2 19   ? 97.579  98.155  133.565 1.00 22.45  ?  16   GLN B N     1 
ATOM   5080  C  CA    . GLN B 2 19   ? 98.749  97.536  132.959 1.00 25.30  ?  16   GLN B CA    1 
ATOM   5081  C  C     . GLN B 2 19   ? 98.276  96.337  132.157 1.00 21.58  ?  16   GLN B C     1 
ATOM   5082  O  O     . GLN B 2 19   ? 97.272  95.716  132.521 1.00 19.33  ?  16   GLN B O     1 
ATOM   5083  C  CB    . GLN B 2 19   ? 99.780  97.117  134.020 1.00 25.43  ?  16   GLN B CB    1 
ATOM   5084  C  CG    . GLN B 2 19   ? 99.302  96.046  134.984 1.00 26.09  ?  16   GLN B CG    1 
ATOM   5085  C  CD    . GLN B 2 19   ? 100.372 95.589  135.953 1.00 28.57  ?  16   GLN B CD    1 
ATOM   5086  O  OE1   . GLN B 2 19   ? 100.230 95.743  137.166 1.00 27.91  ?  16   GLN B OE1   1 
ATOM   5087  N  NE2   . GLN B 2 19   ? 101.464 95.049  135.422 1.00 50.45  ?  16   GLN B NE2   1 
ATOM   5088  N  N     . PRO B 2 20   ? 98.963  95.999  131.052 1.00 21.00  ?  17   PRO B N     1 
ATOM   5089  C  CA    . PRO B 2 20   ? 98.438  95.011  130.093 1.00 19.76  ?  17   PRO B CA    1 
ATOM   5090  C  C     . PRO B 2 20   ? 97.738  93.806  130.698 1.00 18.77  ?  17   PRO B C     1 
ATOM   5091  O  O     . PRO B 2 20   ? 96.669  93.412  130.225 1.00 21.16  ?  17   PRO B O     1 
ATOM   5092  C  CB    . PRO B 2 20   ? 99.694  94.600  129.315 1.00 22.59  ?  17   PRO B CB    1 
ATOM   5093  C  CG    . PRO B 2 20   ? 100.487 95.857  129.289 1.00 21.66  ?  17   PRO B CG    1 
ATOM   5094  C  CD    . PRO B 2 20   ? 100.284 96.499  130.639 1.00 20.73  ?  17   PRO B CD    1 
ATOM   5095  N  N     . GLY B 2 21   ? 98.315  93.211  131.739 1.00 13.91  ?  18   GLY B N     1 
ATOM   5096  C  CA    . GLY B 2 21   ? 97.651  92.154  132.476 1.00 12.06  ?  18   GLY B CA    1 
ATOM   5097  C  C     . GLY B 2 21   ? 97.007  92.715  133.725 1.00 12.85  ?  18   GLY B C     1 
ATOM   5098  O  O     . GLY B 2 21   ? 97.632  93.471  134.472 1.00 15.35  ?  18   GLY B O     1 
ATOM   5099  N  N     . PHE B 2 22   ? 95.743  92.351  133.938 1.00 12.14  ?  19   PHE B N     1 
ATOM   5100  C  CA    . PHE B 2 22   ? 95.041  92.654  135.180 1.00 14.08  ?  19   PHE B CA    1 
ATOM   5101  C  C     . PHE B 2 22   ? 93.804  91.771  135.253 1.00 14.25  ?  19   PHE B C     1 
ATOM   5102  O  O     . PHE B 2 22   ? 93.502  91.023  134.323 1.00 12.63  ?  19   PHE B O     1 
ATOM   5103  C  CB    . PHE B 2 22   ? 94.654  94.126  135.276 1.00 15.84  ?  19   PHE B CB    1 
ATOM   5104  C  CG    . PHE B 2 22   ? 93.736  94.582  134.192 1.00 15.87  ?  19   PHE B CG    1 
ATOM   5105  C  CD1   . PHE B 2 22   ? 94.237  95.066  133.009 1.00 15.63  ?  19   PHE B CD1   1 
ATOM   5106  C  CD2   . PHE B 2 22   ? 92.371  94.545  134.371 1.00 17.98  ?  19   PHE B CD2   1 
ATOM   5107  C  CE1   . PHE B 2 22   ? 93.392  95.496  132.024 1.00 16.51  ?  19   PHE B CE1   1 
ATOM   5108  C  CE2   . PHE B 2 22   ? 91.529  94.973  133.382 1.00 19.32  ?  19   PHE B CE2   1 
ATOM   5109  C  CZ    . PHE B 2 22   ? 92.042  95.449  132.210 1.00 19.44  ?  19   PHE B CZ    1 
ATOM   5110  N  N     . SER B 2 23   ? 93.072  91.876  136.360 1.00 18.10  ?  20   SER B N     1 
ATOM   5111  C  CA    . SER B 2 23   ? 91.909  91.028  136.589 1.00 22.96  ?  20   SER B CA    1 
ATOM   5112  C  C     . SER B 2 23   ? 90.702  91.849  137.028 1.00 25.37  ?  20   SER B C     1 
ATOM   5113  O  O     . SER B 2 23   ? 90.837  92.888  137.671 1.00 26.36  ?  20   SER B O     1 
ATOM   5114  C  CB    . SER B 2 23   ? 92.219  89.940  137.633 1.00 22.42  ?  20   SER B CB    1 
ATOM   5115  O  OG    . SER B 2 23   ? 93.352  89.184  137.247 1.00 21.19  ?  20   SER B OG    1 
ATOM   5116  N  N     . LEU B 2 24   ? 89.514  91.371  136.664 1.00 23.29  ?  21   LEU B N     1 
ATOM   5117  C  CA    . LEU B 2 24   ? 88.247  91.997  137.031 1.00 25.28  ?  21   LEU B CA    1 
ATOM   5118  C  C     . LEU B 2 24   ? 87.377  90.956  137.711 1.00 32.08  ?  21   LEU B C     1 
ATOM   5119  O  O     . LEU B 2 24   ? 87.183  89.865  137.166 1.00 35.07  ?  21   LEU B O     1 
ATOM   5120  C  CB    . LEU B 2 24   ? 87.527  92.573  135.807 1.00 28.80  ?  21   LEU B CB    1 
ATOM   5121  C  CG    . LEU B 2 24   ? 88.323  93.499  134.891 1.00 32.75  ?  21   LEU B CG    1 
ATOM   5122  C  CD1   . LEU B 2 24   ? 87.464  94.059  133.765 1.00 43.26  ?  21   LEU B CD1   1 
ATOM   5123  C  CD2   . LEU B 2 24   ? 88.938  94.619  135.687 1.00 24.24  ?  21   LEU B CD2   1 
ATOM   5124  N  N     . LEU B 2 25   ? 86.856  91.283  138.889 1.00 33.61  ?  22   LEU B N     1 
ATOM   5125  C  CA    . LEU B 2 25   ? 85.956  90.378  139.594 1.00 46.10  ?  22   LEU B CA    1 
ATOM   5126  C  C     . LEU B 2 25   ? 84.666  91.098  139.950 1.00 50.07  ?  22   LEU B C     1 
ATOM   5127  O  O     . LEU B 2 25   ? 84.694  92.208  140.493 1.00 46.84  ?  22   LEU B O     1 
ATOM   5128  C  CB    . LEU B 2 25   ? 86.608  89.811  140.858 1.00 51.48  ?  22   LEU B CB    1 
ATOM   5129  C  CG    . LEU B 2 25   ? 87.750  88.821  140.637 1.00 53.25  ?  22   LEU B CG    1 
ATOM   5130  C  CD1   . LEU B 2 25   ? 88.104  88.113  141.929 1.00 56.20  ?  22   LEU B CD1   1 
ATOM   5131  C  CD2   . LEU B 2 25   ? 87.402  87.816  139.561 1.00 48.02  ?  22   LEU B CD2   1 
ATOM   5132  N  N     . ASP B 2 26   ? 83.543  90.467  139.632 1.00 57.47  ?  23   ASP B N     1 
ATOM   5133  C  CA    . ASP B 2 26   ? 82.246  90.873  140.146 1.00 69.05  ?  23   ASP B CA    1 
ATOM   5134  C  C     . ASP B 2 26   ? 81.851  89.849  141.192 1.00 67.83  ?  23   ASP B C     1 
ATOM   5135  O  O     . ASP B 2 26   ? 81.515  88.706  140.858 1.00 71.21  ?  23   ASP B O     1 
ATOM   5136  C  CB    . ASP B 2 26   ? 81.192  90.970  139.041 1.00 88.60  ?  23   ASP B CB    1 
ATOM   5137  C  CG    . ASP B 2 26   ? 79.859  91.536  139.542 1.00 108.63 ?  23   ASP B CG    1 
ATOM   5138  O  OD1   . ASP B 2 26   ? 79.649  91.603  140.773 1.00 95.08  ?  23   ASP B OD1   1 
ATOM   5139  O  OD2   . ASP B 2 26   ? 79.022  91.937  138.699 1.00 220.58 -1 23   ASP B OD2   1 
ATOM   5140  N  N     . LEU B 2 27   ? 81.915  90.262  142.451 1.00 67.95  ?  24   LEU B N     1 
ATOM   5141  C  CA    . LEU B 2 27   ? 81.389  89.497  143.570 1.00 77.93  ?  24   LEU B CA    1 
ATOM   5142  C  C     . LEU B 2 27   ? 80.342  90.376  144.240 1.00 83.16  ?  24   LEU B C     1 
ATOM   5143  O  O     . LEU B 2 27   ? 80.678  91.374  144.888 1.00 75.99  ?  24   LEU B O     1 
ATOM   5144  C  CB    . LEU B 2 27   ? 82.498  89.077  144.538 1.00 75.35  ?  24   LEU B CB    1 
ATOM   5145  C  CG    . LEU B 2 27   ? 83.488  90.108  145.072 1.00 70.22  ?  24   LEU B CG    1 
ATOM   5146  C  CD1   . LEU B 2 27   ? 84.012  89.678  146.425 1.00 69.96  ?  24   LEU B CD1   1 
ATOM   5147  C  CD2   . LEU B 2 27   ? 84.642  90.273  144.105 1.00 62.05  ?  24   LEU B CD2   1 
ATOM   5148  N  N     . GLU B 2 28   ? 79.072  90.013  144.055 1.00 92.10  ?  25   GLU B N     1 
ATOM   5149  C  CA    . GLU B 2 28   ? 77.931  90.736  144.608 1.00 95.98  ?  25   GLU B CA    1 
ATOM   5150  C  C     . GLU B 2 28   ? 77.900  92.184  144.108 1.00 88.24  ?  25   GLU B C     1 
ATOM   5151  O  O     . GLU B 2 28   ? 78.105  93.142  144.850 1.00 87.95  ?  25   GLU B O     1 
ATOM   5152  C  CB    . GLU B 2 28   ? 77.937  90.656  146.139 1.00 105.59 ?  25   GLU B CB    1 
ATOM   5153  C  CG    . GLU B 2 28   ? 78.198  89.254  146.672 1.00 123.50 ?  25   GLU B CG    1 
ATOM   5154  C  CD    . GLU B 2 28   ? 77.248  88.210  146.097 1.00 147.44 ?  25   GLU B CD    1 
ATOM   5155  O  OE1   . GLU B 2 28   ? 76.064  88.536  145.854 1.00 144.16 ?  25   GLU B OE1   1 
ATOM   5156  O  OE2   . GLU B 2 28   ? 77.693  87.065  145.873 1.00 180.81 -1 25   GLU B OE2   1 
ATOM   5157  N  N     . GLY B 2 29   ? 77.663  92.306  142.805 1.00 87.88  ?  26   GLY B N     1 
ATOM   5158  C  CA    . GLY B 2 29   ? 77.362  93.603  142.242 1.00 91.34  ?  26   GLY B CA    1 
ATOM   5159  C  C     . GLY B 2 29   ? 78.556  94.352  141.697 1.00 89.14  ?  26   GLY B C     1 
ATOM   5160  O  O     . GLY B 2 29   ? 78.906  94.223  140.522 1.00 89.27  ?  26   GLY B O     1 
ATOM   5161  N  N     . ASP B 2 30   ? 79.152  95.183  142.547 1.00 86.99  ?  27   ASP B N     1 
ATOM   5162  C  CA    . ASP B 2 30   ? 80.282  96.010  142.152 1.00 84.46  ?  27   ASP B CA    1 
ATOM   5163  C  C     . ASP B 2 30   ? 81.390  95.169  141.528 1.00 70.52  ?  27   ASP B C     1 
ATOM   5164  O  O     . ASP B 2 30   ? 81.609  94.009  141.894 1.00 69.16  ?  27   ASP B O     1 
ATOM   5165  C  CB    . ASP B 2 30   ? 80.815  96.774  143.368 1.00 98.70  ?  27   ASP B CB    1 
ATOM   5166  C  CG    . ASP B 2 30   ? 80.534  98.270  143.295 1.00 129.82 ?  27   ASP B CG    1 
ATOM   5167  O  OD1   . ASP B 2 30   ? 79.948  98.720  142.286 1.00 120.53 ?  27   ASP B OD1   1 
ATOM   5168  O  OD2   . ASP B 2 30   ? 80.877  98.993  144.253 1.00 204.42 -1 27   ASP B OD2   1 
ATOM   5169  N  N     . VAL B 2 31   ? 82.087  95.772  140.569 1.00 57.56  ?  28   VAL B N     1 
ATOM   5170  C  CA    . VAL B 2 31   ? 83.242  95.172  139.916 1.00 48.15  ?  28   VAL B CA    1 
ATOM   5171  C  C     . VAL B 2 31   ? 84.496  95.807  140.499 1.00 46.68  ?  28   VAL B C     1 
ATOM   5172  O  O     . VAL B 2 31   ? 84.568  97.033  140.655 1.00 45.19  ?  28   VAL B O     1 
ATOM   5173  C  CB    . VAL B 2 31   ? 83.184  95.351  138.388 1.00 48.80  ?  28   VAL B CB    1 
ATOM   5174  C  CG1   . VAL B 2 31   ? 82.829  96.785  138.017 1.00 46.80  ?  28   VAL B CG1   1 
ATOM   5175  C  CG2   . VAL B 2 31   ? 84.499  94.935  137.745 1.00 42.44  ?  28   VAL B CG2   1 
ATOM   5176  N  N     . TYR B 2 32   ? 85.469  94.973  140.845 1.00 41.40  ?  29   TYR B N     1 
ATOM   5177  C  CA    . TYR B 2 32   ? 86.725  95.421  141.421 1.00 29.35  ?  29   TYR B CA    1 
ATOM   5178  C  C     . TYR B 2 32   ? 87.858  95.027  140.488 1.00 24.94  ?  29   TYR B C     1 
ATOM   5179  O  O     . TYR B 2 32   ? 87.875  93.907  139.951 1.00 30.81  ?  29   TYR B O     1 
ATOM   5180  C  CB    . TYR B 2 32   ? 86.913  94.838  142.823 1.00 31.02  ?  29   TYR B CB    1 
ATOM   5181  C  CG    . TYR B 2 32   ? 85.634  94.871  143.630 1.00 40.07  ?  29   TYR B CG    1 
ATOM   5182  C  CD1   . TYR B 2 32   ? 85.175  96.053  144.190 1.00 44.07  ?  29   TYR B CD1   1 
ATOM   5183  C  CD2   . TYR B 2 32   ? 84.857  93.737  143.779 1.00 52.63  ?  29   TYR B CD2   1 
ATOM   5184  C  CE1   . TYR B 2 32   ? 83.996  96.089  144.915 1.00 59.74  ?  29   TYR B CE1   1 
ATOM   5185  C  CE2   . TYR B 2 32   ? 83.678  93.763  144.495 1.00 59.99  ?  29   TYR B CE2   1 
ATOM   5186  C  CZ    . TYR B 2 32   ? 83.250  94.942  145.063 1.00 65.11  ?  29   TYR B CZ    1 
ATOM   5187  O  OH    . TYR B 2 32   ? 82.074  94.961  145.776 1.00 74.06  ?  29   TYR B OH    1 
ATOM   5188  N  N     . LEU B 2 33   ? 88.768  95.974  140.270 1.00 22.12  ?  30   LEU B N     1 
ATOM   5189  C  CA    . LEU B 2 33   ? 89.898  95.854  139.364 1.00 20.61  ?  30   LEU B CA    1 
ATOM   5190  C  C     . LEU B 2 33   ? 91.146  95.552  140.174 1.00 20.67  ?  30   LEU B C     1 
ATOM   5191  O  O     . LEU B 2 33   ? 91.473  96.294  141.109 1.00 20.52  ?  30   LEU B O     1 
ATOM   5192  C  CB    . LEU B 2 33   ? 90.088  97.146  138.568 1.00 19.91  ?  30   LEU B CB    1 
ATOM   5193  C  CG    . LEU B 2 33   ? 90.957  97.164  137.315 1.00 15.55  ?  30   LEU B CG    1 
ATOM   5194  C  CD1   . LEU B 2 33   ? 90.684  98.435  136.561 1.00 14.58  ?  30   LEU B CD1   1 
ATOM   5195  C  CD2   . LEU B 2 33   ? 92.426  97.079  137.632 1.00 18.14  ?  30   LEU B CD2   1 
ATOM   5196  N  N     . PHE B 2 34   ? 91.840  94.476  139.798 1.00 22.69  ?  31   PHE B N     1 
ATOM   5197  C  CA    . PHE B 2 34   ? 93.020  93.973  140.481 1.00 21.12  ?  31   PHE B CA    1 
ATOM   5198  C  C     . PHE B 2 34   ? 94.231  94.080  139.569 1.00 21.87  ?  31   PHE B C     1 
ATOM   5199  O  O     . PHE B 2 34   ? 94.154  93.747  138.380 1.00 21.70  ?  31   PHE B O     1 
ATOM   5200  C  CB    . PHE B 2 34   ? 92.844  92.508  140.900 1.00 15.56  ?  31   PHE B CB    1 
ATOM   5201  C  CG    . PHE B 2 34   ? 94.002  91.974  141.687 1.00 13.99  ?  31   PHE B CG    1 
ATOM   5202  C  CD1   . PHE B 2 34   ? 95.138  91.519  141.050 1.00 18.16  ?  31   PHE B CD1   1 
ATOM   5203  C  CD2   . PHE B 2 34   ? 93.964  91.941  143.062 1.00 15.61  ?  31   PHE B CD2   1 
ATOM   5204  C  CE1   . PHE B 2 34   ? 96.203  91.048  141.766 1.00 19.10  ?  31   PHE B CE1   1 
ATOM   5205  C  CE2   . PHE B 2 34   ? 95.033  91.458  143.784 1.00 22.86  ?  31   PHE B CE2   1 
ATOM   5206  C  CZ    . PHE B 2 34   ? 96.150  91.012  143.128 1.00 18.31  ?  31   PHE B CZ    1 
ATOM   5207  N  N     . GLY B 2 35   ? 95.353  94.504  140.147 1.00 22.41  ?  32   GLY B N     1 
ATOM   5208  C  CA    . GLY B 2 35   ? 96.607  94.657  139.437 1.00 18.33  ?  32   GLY B CA    1 
ATOM   5209  C  C     . GLY B 2 35   ? 96.858  96.081  138.987 1.00 17.11  ?  32   GLY B C     1 
ATOM   5210  O  O     . GLY B 2 35   ? 95.963  96.726  138.439 1.00 18.11  ?  32   GLY B O     1 
ATOM   5211  N  N     . GLN B 2 36   ? 98.060  96.594  139.219 1.00 16.98  ?  33   GLN B N     1 
ATOM   5212  C  CA    . GLN B 2 36   ? 98.373  97.966  138.850 1.00 18.48  ?  33   GLN B CA    1 
ATOM   5213  C  C     . GLN B 2 36   ? 99.873  98.096  138.677 1.00 16.43  ?  33   GLN B C     1 
ATOM   5214  O  O     . GLN B 2 36   ? 100.646 97.454  139.389 1.00 18.97  ?  33   GLN B O     1 
ATOM   5215  C  CB    . GLN B 2 36   ? 97.885  98.961  139.912 1.00 22.70  ?  33   GLN B CB    1 
ATOM   5216  C  CG    . GLN B 2 36   ? 98.376  98.646  141.330 1.00 27.63  ?  33   GLN B CG    1 
ATOM   5217  C  CD    . GLN B 2 36   ? 97.658  99.444  142.412 1.00 27.70  ?  33   GLN B CD    1 
ATOM   5218  O  OE1   . GLN B 2 36   ? 98.017  99.370  143.592 1.00 17.36  ?  33   GLN B OE1   1 
ATOM   5219  N  NE2   . GLN B 2 36   ? 96.635  100.198 142.018 1.00 31.74  ?  33   GLN B NE2   1 
ATOM   5220  N  N     . LYS B 2 37   ? 100.284 98.910  137.710 1.00 52.19  ?  34   LYS B N     1 
ATOM   5221  C  CA    . LYS B 2 37   ? 101.706 99.167  137.524 1.00 37.93  ?  34   LYS B CA    1 
ATOM   5222  C  C     . LYS B 2 37   ? 102.303 99.739  138.799 1.00 14.12  ?  34   LYS B C     1 
ATOM   5223  O  O     . LYS B 2 37   ? 101.734 100.638 139.416 1.00 16.13  ?  34   LYS B O     1 
ATOM   5224  C  CB    . LYS B 2 37   ? 101.935 100.122 136.351 1.00 16.06  ?  34   LYS B CB    1 
ATOM   5225  C  CG    . LYS B 2 37   ? 102.536 99.445  135.134 1.00 16.75  ?  34   LYS B CG    1 
ATOM   5226  C  CD    . LYS B 2 37   ? 102.751 100.437 134.005 1.00 17.35  ?  34   LYS B CD    1 
ATOM   5227  C  CE    . LYS B 2 37   ? 103.154 99.733  132.714 1.00 11.72  ?  34   LYS B CE    1 
ATOM   5228  N  NZ    . LYS B 2 37   ? 104.316 98.830  132.925 1.00 17.67  ?  34   LYS B NZ    1 
ATOM   5229  N  N     . GLY B 2 38   ? 103.442 99.202  139.203 1.00 15.65  ?  35   GLY B N     1 
ATOM   5230  C  CA    . GLY B 2 38   ? 104.096 99.639  140.415 1.00 15.63  ?  35   GLY B CA    1 
ATOM   5231  C  C     . GLY B 2 38   ? 103.361 99.255  141.675 1.00 23.05  ?  35   GLY B C     1 
ATOM   5232  O  O     . GLY B 2 38   ? 102.186 98.887  141.643 1.00 16.16  ?  35   GLY B O     1 
ATOM   5233  N  N     . TRP B 2 39   ? 104.059 99.346  142.796 1.00 13.00  ?  36   TRP B N     1 
ATOM   5234  C  CA    . TRP B 2 39   ? 103.502 98.954  144.070 1.00 19.69  ?  36   TRP B CA    1 
ATOM   5235  C  C     . TRP B 2 39   ? 102.369 99.896  144.471 1.00 16.47  ?  36   TRP B C     1 
ATOM   5236  O  O     . TRP B 2 39   ? 102.240 100.994 143.931 1.00 17.08  ?  36   TRP B O     1 
ATOM   5237  C  CB    . TRP B 2 39   ? 104.604 98.939  145.119 1.00 14.18  ?  36   TRP B CB    1 
ATOM   5238  C  CG    . TRP B 2 39   ? 105.552 97.841  144.854 1.00 13.72  ?  36   TRP B CG    1 
ATOM   5239  C  CD1   . TRP B 2 39   ? 106.745 97.942  144.213 1.00 14.71  ?  36   TRP B CD1   1 
ATOM   5240  C  CD2   . TRP B 2 39   ? 105.394 96.465  145.193 1.00 14.31  ?  36   TRP B CD2   1 
ATOM   5241  N  NE1   . TRP B 2 39   ? 107.349 96.720  144.133 1.00 15.46  ?  36   TRP B NE1   1 
ATOM   5242  C  CE2   . TRP B 2 39   ? 106.541 95.792  144.730 1.00 15.17  ?  36   TRP B CE2   1 
ATOM   5243  C  CE3   . TRP B 2 39   ? 104.401 95.735  145.848 1.00 16.41  ?  36   TRP B CE3   1 
ATOM   5244  C  CZ2   . TRP B 2 39   ? 106.724 94.431  144.899 1.00 13.07  ?  36   TRP B CZ2   1 
ATOM   5245  C  CZ3   . TRP B 2 39   ? 104.583 94.390  146.014 1.00 23.23  ?  36   TRP B CZ3   1 
ATOM   5246  C  CH2   . TRP B 2 39   ? 105.734 93.747  145.545 1.00 17.27  ?  36   TRP B CH2   1 
ATOM   5247  N  N     . PRO B 2 40   ? 101.512 99.476  145.396 1.00 18.26  ?  37   PRO B N     1 
ATOM   5248  C  CA    . PRO B 2 40   ? 100.367 100.313 145.772 1.00 18.85  ?  37   PRO B CA    1 
ATOM   5249  C  C     . PRO B 2 40   ? 100.815 101.646 146.335 1.00 19.33  ?  37   PRO B C     1 
ATOM   5250  O  O     . PRO B 2 40   ? 101.560 101.714 147.313 1.00 18.88  ?  37   PRO B O     1 
ATOM   5251  C  CB    . PRO B 2 40   ? 99.640  99.472  146.825 1.00 18.63  ?  37   PRO B CB    1 
ATOM   5252  C  CG    . PRO B 2 40   ? 100.095 98.091  146.577 1.00 23.99  ?  37   PRO B CG    1 
ATOM   5253  C  CD    . PRO B 2 40   ? 101.491 98.179  146.083 1.00 21.10  ?  37   PRO B CD    1 
ATOM   5254  N  N     . LYS B 2 41   ? 100.350 102.710 145.700 1.00 21.95  ?  38   LYS B N     1 
ATOM   5255  C  CA    . LYS B 2 41   ? 100.571 104.044 146.222 1.00 27.11  ?  38   LYS B CA    1 
ATOM   5256  C  C     . LYS B 2 41   ? 99.815  104.215 147.538 1.00 29.15  ?  38   LYS B C     1 
ATOM   5257  O  O     . LYS B 2 41   ? 98.907  103.447 147.871 1.00 28.90  ?  38   LYS B O     1 
ATOM   5258  C  CB    . LYS B 2 41   ? 100.115 105.092 145.205 1.00 24.97  ?  38   LYS B CB    1 
ATOM   5259  C  CG    . LYS B 2 41   ? 100.155 104.608 143.756 1.00 21.48  ?  38   LYS B CG    1 
ATOM   5260  C  CD    . LYS B 2 41   ? 101.581 104.423 143.245 1.00 22.46  ?  38   LYS B CD    1 
ATOM   5261  C  CE    . LYS B 2 41   ? 101.585 103.840 141.843 1.00 16.29  ?  38   LYS B CE    1 
ATOM   5262  N  NZ    . LYS B 2 41   ? 100.852 104.701 140.878 1.00 25.40  ?  38   LYS B NZ    1 
ATOM   5263  N  N     . ARG B 2 42   ? 100.205 105.236 148.302 1.00 30.58  ?  39   ARG B N     1 
ATOM   5264  C  CA    . ARG B 2 42   ? 99.536  105.460 149.576 1.00 30.24  ?  39   ARG B CA    1 
ATOM   5265  C  C     . ARG B 2 42   ? 98.131  106.016 149.396 1.00 29.89  ?  39   ARG B C     1 
ATOM   5266  O  O     . ARG B 2 42   ? 97.297  105.843 150.290 1.00 33.90  ?  39   ARG B O     1 
ATOM   5267  C  CB    . ARG B 2 42   ? 100.346 106.410 150.453 1.00 43.94  ?  39   ARG B CB    1 
ATOM   5268  C  CG    . ARG B 2 42   ? 101.095 105.757 151.592 1.00 34.14  ?  39   ARG B CG    1 
ATOM   5269  C  CD    . ARG B 2 42   ? 100.147 104.990 152.487 1.00 33.09  ?  39   ARG B CD    1 
ATOM   5270  N  NE    . ARG B 2 42   ? 98.982  105.781 152.869 1.00 32.21  ?  39   ARG B NE    1 
ATOM   5271  C  CZ    . ARG B 2 42   ? 99.014  106.871 153.626 1.00 41.68  ?  39   ARG B CZ    1 
ATOM   5272  N  NH1   . ARG B 2 42   ? 100.167 107.355 154.064 1.00 44.84  ?  39   ARG B NH1   1 
ATOM   5273  N  NH2   . ARG B 2 42   ? 97.882  107.495 153.925 1.00 45.81  ?  39   ARG B NH2   1 
ATOM   5274  N  N     . SER B 2 43   ? 97.850  106.677 148.266 1.00 28.92  ?  40   SER B N     1 
ATOM   5275  C  CA    . SER B 2 43   ? 96.489  107.128 147.984 1.00 27.38  ?  40   SER B CA    1 
ATOM   5276  C  C     . SER B 2 43   ? 95.506  105.969 147.981 1.00 34.58  ?  40   SER B C     1 
ATOM   5277  O  O     . SER B 2 43   ? 94.302  106.183 148.168 1.00 39.07  ?  40   SER B O     1 
ATOM   5278  C  CB    . SER B 2 43   ? 96.424  107.862 146.644 1.00 27.11  ?  40   SER B CB    1 
ATOM   5279  O  OG    . SER B 2 43   ? 97.216  109.034 146.643 1.00 35.32  ?  40   SER B OG    1 
ATOM   5280  N  N     . CYS B 2 44   ? 95.994  104.744 147.737 1.00 35.86  ?  41   CYS B N     1 
ATOM   5281  C  CA    . CYS B 2 44   ? 95.209  103.527 147.916 1.00 35.38  ?  41   CYS B CA    1 
ATOM   5282  C  C     . CYS B 2 44   ? 96.110  102.323 148.177 1.00 24.57  ?  41   CYS B C     1 
ATOM   5283  O  O     . CYS B 2 44   ? 96.581  101.670 147.236 1.00 23.07  ?  41   CYS B O     1 
ATOM   5284  C  CB    . CYS B 2 44   ? 94.332  103.260 146.696 1.00 36.65  ?  41   CYS B CB    1 
ATOM   5285  S  SG    . CYS B 2 44   ? 93.403  101.725 146.815 1.00 37.29  ?  41   CYS B SG    1 
ATOM   5286  N  N     . PRO B 2 45   ? 96.372  101.999 149.441 1.00 20.91  ?  42   PRO B N     1 
ATOM   5287  C  CA    . PRO B 2 45   ? 97.227  100.844 149.741 1.00 18.90  ?  42   PRO B CA    1 
ATOM   5288  C  C     . PRO B 2 45   ? 96.602  99.509  149.397 1.00 18.16  ?  42   PRO B C     1 
ATOM   5289  O  O     . PRO B 2 45   ? 97.337  98.529  149.247 1.00 20.32  ?  42   PRO B O     1 
ATOM   5290  C  CB    . PRO B 2 45   ? 97.449  100.972 151.251 1.00 26.36  ?  42   PRO B CB    1 
ATOM   5291  C  CG    . PRO B 2 45   ? 96.219  101.652 151.726 1.00 27.24  ?  42   PRO B CG    1 
ATOM   5292  C  CD    . PRO B 2 45   ? 95.872  102.647 150.662 1.00 28.50  ?  42   PRO B CD    1 
ATOM   5293  N  N     . THR B 2 46   ? 95.278  99.438  149.274 1.00 18.31  ?  43   THR B N     1 
ATOM   5294  C  CA    . THR B 2 46   ? 94.615  98.163  149.028 1.00 19.41  ?  43   THR B CA    1 
ATOM   5295  C  C     . THR B 2 46   ? 95.087  97.534  147.722 1.00 16.64  ?  43   THR B C     1 
ATOM   5296  O  O     . THR B 2 46   ? 95.178  96.308  147.612 1.00 20.93  ?  43   THR B O     1 
ATOM   5297  C  CB    . THR B 2 46   ? 93.099  98.384  149.032 1.00 26.61  ?  43   THR B CB    1 
ATOM   5298  O  OG1   . THR B 2 46   ? 92.621  98.447  150.382 1.00 28.06  ?  43   THR B OG1   1 
ATOM   5299  C  CG2   . THR B 2 46   ? 92.360  97.302  148.282 1.00 37.72  ?  43   THR B CG2   1 
ATOM   5300  N  N     . GLY B 2 47   ? 95.419  98.356  146.736 1.00 16.63  ?  44   GLY B N     1 
ATOM   5301  C  CA    . GLY B 2 47   ? 95.836  97.862  145.445 1.00 15.24  ?  44   GLY B CA    1 
ATOM   5302  C  C     . GLY B 2 47   ? 94.717  97.398  144.547 1.00 15.88  ?  44   GLY B C     1 
ATOM   5303  O  O     . GLY B 2 47   ? 94.988  96.880  143.463 1.00 15.52  ?  44   GLY B O     1 
ATOM   5304  N  N     . ILE B 2 48   ? 93.475  97.570  144.964 1.00 17.27  ?  45   ILE B N     1 
ATOM   5305  C  CA    . ILE B 2 48   ? 92.296  97.182  144.205 1.00 18.22  ?  45   ILE B CA    1 
ATOM   5306  C  C     . ILE B 2 48   ? 91.429  98.424  144.040 1.00 26.04  ?  45   ILE B C     1 
ATOM   5307  O  O     . ILE B 2 48   ? 91.385  99.274  144.935 1.00 27.66  ?  45   ILE B O     1 
ATOM   5308  C  CB    . ILE B 2 48   ? 91.515  96.061  144.926 1.00 20.16  ?  45   ILE B CB    1 
ATOM   5309  C  CG1   . ILE B 2 48   ? 92.463  94.974  145.446 1.00 22.28  ?  45   ILE B CG1   1 
ATOM   5310  C  CG2   . ILE B 2 48   ? 90.442  95.482  144.037 1.00 22.65  ?  45   ILE B CG2   1 
ATOM   5311  C  CD1   . ILE B 2 48   ? 91.760  93.816  146.161 1.00 17.62  ?  45   ILE B CD1   1 
ATOM   5312  N  N     . PHE B 2 49   ? 90.744  98.544  142.904 1.00 30.10  ?  46   PHE B N     1 
ATOM   5313  C  CA    . PHE B 2 49   ? 89.891  99.705  142.655 1.00 32.09  ?  46   PHE B CA    1 
ATOM   5314  C  C     . PHE B 2 49   ? 88.485  99.279  142.259 1.00 33.79  ?  46   PHE B C     1 
ATOM   5315  O  O     . PHE B 2 49   ? 88.308  98.526  141.299 1.00 33.46  ?  46   PHE B O     1 
ATOM   5316  C  CB    . PHE B 2 49   ? 90.483  100.604 141.560 1.00 35.22  ?  46   PHE B CB    1 
ATOM   5317  C  CG    . PHE B 2 49   ? 91.779  101.277 141.937 1.00 34.13  ?  46   PHE B CG    1 
ATOM   5318  C  CD1   . PHE B 2 49   ? 91.937  101.863 143.176 1.00 35.91  ?  46   PHE B CD1   1 
ATOM   5319  C  CD2   . PHE B 2 49   ? 92.848  101.303 141.060 1.00 41.34  ?  46   PHE B CD2   1 
ATOM   5320  C  CE1   . PHE B 2 49   ? 93.126  102.486 143.516 1.00 39.44  ?  46   PHE B CE1   1 
ATOM   5321  C  CE2   . PHE B 2 49   ? 94.039  101.919 141.407 1.00 39.87  ?  46   PHE B CE2   1 
ATOM   5322  C  CZ    . PHE B 2 49   ? 94.173  102.505 142.631 1.00 36.61  ?  46   PHE B CZ    1 
ATOM   5323  N  N     . GLY B 2 50   ? 87.484  99.777  142.976 1.00 35.22  ?  47   GLY B N     1 
ATOM   5324  C  CA    . GLY B 2 50   ? 86.122  99.629  142.503 1.00 37.23  ?  47   GLY B CA    1 
ATOM   5325  C  C     . GLY B 2 50   ? 85.927  100.437 141.231 1.00 38.81  ?  47   GLY B C     1 
ATOM   5326  O  O     . GLY B 2 50   ? 86.395  101.570 141.110 1.00 37.40  ?  47   GLY B O     1 
ATOM   5327  N  N     . VAL B 2 51   ? 85.236  99.838  140.266 1.00 35.50  ?  48   VAL B N     1 
ATOM   5328  C  CA    . VAL B 2 51   ? 85.090  100.406 138.935 1.00 34.96  ?  48   VAL B CA    1 
ATOM   5329  C  C     . VAL B 2 51   ? 83.625  100.729 138.697 1.00 39.83  ?  48   VAL B C     1 
ATOM   5330  O  O     . VAL B 2 51   ? 82.744  99.945  139.063 1.00 43.32  ?  48   VAL B O     1 
ATOM   5331  C  CB    . VAL B 2 51   ? 85.621  99.431  137.869 1.00 32.44  ?  48   VAL B CB    1 
ATOM   5332  C  CG1   . VAL B 2 51   ? 85.415  99.990  136.483 1.00 38.51  ?  48   VAL B CG1   1 
ATOM   5333  C  CG2   . VAL B 2 51   ? 87.083  99.139  138.124 1.00 27.99  ?  48   VAL B CG2   1 
ATOM   5334  N  N     . ARG B 2 52   ? 83.366  101.892 138.102 1.00 43.54  ?  49   ARG B N     1 
ATOM   5335  C  CA    . ARG B 2 52   ? 82.020  102.267 137.691 1.00 49.88  ?  49   ARG B CA    1 
ATOM   5336  C  C     . ARG B 2 52   ? 82.087  102.961 136.338 1.00 57.01  ?  49   ARG B C     1 
ATOM   5337  O  O     . ARG B 2 52   ? 83.086  103.601 135.998 1.00 56.30  ?  49   ARG B O     1 
ATOM   5338  C  CB    . ARG B 2 52   ? 81.340  103.176 138.729 1.00 48.17  ?  49   ARG B CB    1 
ATOM   5339  C  CG    . ARG B 2 52   ? 80.944  102.461 140.015 1.00 47.74  ?  49   ARG B CG    1 
ATOM   5340  C  CD    . ARG B 2 52   ? 80.410  103.421 141.068 1.00 57.99  ?  49   ARG B CD    1 
ATOM   5341  N  NE    . ARG B 2 52   ? 81.373  104.465 141.409 1.00 64.24  ?  49   ARG B NE    1 
ATOM   5342  C  CZ    . ARG B 2 52   ? 81.341  105.181 142.531 1.00 64.25  ?  49   ARG B CZ    1 
ATOM   5343  N  NH1   . ARG B 2 52   ? 82.264  106.111 142.752 1.00 57.84  ?  49   ARG B NH1   1 
ATOM   5344  N  NH2   . ARG B 2 52   ? 80.395  104.959 143.435 1.00 60.45  ?  49   ARG B NH2   1 
ATOM   5345  N  N     . ILE B 2 53   ? 81.010  102.822 135.569 1.00 62.68  ?  50   ILE B N     1 
ATOM   5346  C  CA    . ILE B 2 53   ? 80.854  103.484 134.278 1.00 70.80  ?  50   ILE B CA    1 
ATOM   5347  C  C     . ILE B 2 53   ? 79.587  104.329 134.339 1.00 80.02  ?  50   ILE B C     1 
ATOM   5348  O  O     . ILE B 2 53   ? 78.489  103.795 134.546 1.00 77.79  ?  50   ILE B O     1 
ATOM   5349  C  CB    . ILE B 2 53   ? 80.792  102.475 133.120 1.00 66.82  ?  50   ILE B CB    1 
ATOM   5350  C  CG1   . ILE B 2 53   ? 82.136  101.769 132.956 1.00 60.86  ?  50   ILE B CG1   1 
ATOM   5351  C  CG2   . ILE B 2 53   ? 80.404  103.164 131.824 1.00 72.64  ?  50   ILE B CG2   1 
ATOM   5352  C  CD1   . ILE B 2 53   ? 82.269  101.003 131.658 1.00 56.68  ?  50   ILE B CD1   1 
ATOM   5353  N  N     . LYS B 2 54   ? 79.742  105.644 134.181 1.00 83.55  ?  51   LYS B N     1 
ATOM   5354  C  CA    . LYS B 2 54   ? 78.620  106.580 134.166 1.00 81.26  ?  51   LYS B CA    1 
ATOM   5355  C  C     . LYS B 2 54   ? 78.778  107.514 132.977 1.00 84.87  ?  51   LYS B C     1 
ATOM   5356  O  O     . LYS B 2 54   ? 79.771  108.244 132.885 1.00 86.75  ?  51   LYS B O     1 
ATOM   5357  C  CB    . LYS B 2 54   ? 78.524  107.380 135.472 1.00 77.06  ?  51   LYS B CB    1 
ATOM   5358  C  CG    . LYS B 2 54   ? 78.058  106.562 136.668 1.00 77.86  ?  51   LYS B CG    1 
ATOM   5359  C  CD    . LYS B 2 54   ? 77.790  107.444 137.875 1.00 82.07  ?  51   LYS B CD    1 
ATOM   5360  C  CE    . LYS B 2 54   ? 77.069  106.676 138.969 1.00 84.50  ?  51   LYS B CE    1 
ATOM   5361  N  NZ    . LYS B 2 54   ? 76.660  107.563 140.092 1.00 83.15  ?  51   LYS B NZ    1 
ATOM   5362  N  N     . LYS B 2 55   ? 77.807  107.474 132.066 1.00 89.46  ?  52   LYS B N     1 
ATOM   5363  C  CA    . LYS B 2 55   ? 77.806  108.308 130.864 1.00 95.51  ?  52   LYS B CA    1 
ATOM   5364  C  C     . LYS B 2 55   ? 79.055  108.062 130.024 1.00 97.70  ?  52   LYS B C     1 
ATOM   5365  O  O     . LYS B 2 55   ? 79.690  108.997 129.535 1.00 100.74 ?  52   LYS B O     1 
ATOM   5366  C  CB    . LYS B 2 55   ? 77.668  109.794 131.215 1.00 91.09  ?  52   LYS B CB    1 
ATOM   5367  C  CG    . LYS B 2 55   ? 76.528  110.129 132.170 1.00 84.37  ?  52   LYS B CG    1 
ATOM   5368  C  CD    . LYS B 2 55   ? 76.861  111.367 132.984 1.00 80.29  ?  52   LYS B CD    1 
ATOM   5369  C  CE    . LYS B 2 55   ? 78.197  111.202 133.692 1.00 78.13  ?  52   LYS B CE    1 
ATOM   5370  N  NZ    . LYS B 2 55   ? 78.623  112.423 134.426 1.00 67.91  ?  52   LYS B NZ    1 
ATOM   5371  N  N     . GLY B 2 56   ? 79.418  106.791 129.863 1.00 92.14  ?  53   GLY B N     1 
ATOM   5372  C  CA    . GLY B 2 56   ? 80.633  106.434 129.166 1.00 95.16  ?  53   GLY B CA    1 
ATOM   5373  C  C     . GLY B 2 56   ? 81.917  106.751 129.897 1.00 97.28  ?  53   GLY B C     1 
ATOM   5374  O  O     . GLY B 2 56   ? 82.983  106.290 129.464 1.00 88.36  ?  53   GLY B O     1 
ATOM   5375  N  N     . GLU B 2 57   ? 81.867  107.533 130.971 1.00 99.37  ?  54   GLU B N     1 
ATOM   5376  C  CA    . GLU B 2 57   ? 83.073  107.879 131.707 1.00 93.90  ?  54   GLU B CA    1 
ATOM   5377  C  C     . GLU B 2 57   ? 83.379  106.831 132.767 1.00 81.54  ?  54   GLU B C     1 
ATOM   5378  O  O     . GLU B 2 57   ? 82.479  106.173 133.296 1.00 80.13  ?  54   GLU B O     1 
ATOM   5379  C  CB    . GLU B 2 57   ? 82.922  109.261 132.341 1.00 96.95  ?  54   GLU B CB    1 
ATOM   5380  C  CG    . GLU B 2 57   ? 82.387  110.311 131.390 1.00 106.15 ?  54   GLU B CG    1 
ATOM   5381  C  CD    . GLU B 2 57   ? 83.006  110.226 130.011 1.00 117.82 ?  54   GLU B CD    1 
ATOM   5382  O  OE1   . GLU B 2 57   ? 84.257  110.218 129.915 1.00 104.72 ?  54   GLU B OE1   1 
ATOM   5383  O  OE2   . GLU B 2 57   ? 82.244  110.155 129.028 1.00 169.98 -1 54   GLU B OE2   1 
ATOM   5384  N  N     . LEU B 2 58   ? 84.662  106.693 133.088 1.00 75.21  ?  55   LEU B N     1 
ATOM   5385  C  CA    . LEU B 2 58   ? 85.157  105.585 133.891 1.00 66.35  ?  55   LEU B CA    1 
ATOM   5386  C  C     . LEU B 2 58   ? 85.729  106.102 135.203 1.00 66.52  ?  55   LEU B C     1 
ATOM   5387  O  O     . LEU B 2 58   ? 86.615  106.960 135.202 1.00 66.78  ?  55   LEU B O     1 
ATOM   5388  C  CB    . LEU B 2 58   ? 86.221  104.807 133.122 1.00 60.62  ?  55   LEU B CB    1 
ATOM   5389  C  CG    . LEU B 2 58   ? 86.705  103.583 133.874 1.00 53.98  ?  55   LEU B CG    1 
ATOM   5390  C  CD1   . LEU B 2 58   ? 85.537  102.648 134.092 1.00 55.12  ?  55   LEU B CD1   1 
ATOM   5391  C  CD2   . LEU B 2 58   ? 87.829  102.897 133.127 1.00 53.04  ?  55   LEU B CD2   1 
ATOM   5392  N  N     . LYS B 2 59   ? 85.234  105.567 136.317 1.00 61.77  ?  56   LYS B N     1 
ATOM   5393  C  CA    . LYS B 2 59   ? 85.598  106.035 137.649 1.00 58.04  ?  56   LYS B CA    1 
ATOM   5394  C  C     . LYS B 2 59   ? 86.178  104.876 138.448 1.00 46.85  ?  56   LYS B C     1 
ATOM   5395  O  O     . LYS B 2 59   ? 85.613  103.775 138.446 1.00 48.52  ?  56   LYS B O     1 
ATOM   5396  C  CB    . LYS B 2 59   ? 84.375  106.619 138.374 1.00 60.84  ?  56   LYS B CB    1 
ATOM   5397  C  CG    . LYS B 2 59   ? 84.549  108.050 138.890 1.00 64.71  ?  56   LYS B CG    1 
ATOM   5398  C  CD    . LYS B 2 59   ? 84.784  109.009 137.728 1.00 64.41  ?  56   LYS B CD    1 
ATOM   5399  C  CE    . LYS B 2 59   ? 84.750  110.477 138.146 1.00 66.43  ?  56   LYS B CE    1 
ATOM   5400  N  NZ    . LYS B 2 59   ? 85.833  110.802 139.102 1.00 68.91  ?  56   LYS B NZ    1 
ATOM   5401  N  N     . LEU B 2 60   ? 87.300  105.127 139.124 1.00 47.03  ?  57   LEU B N     1 
ATOM   5402  C  CA    . LEU B 2 60   ? 88.046  104.112 139.868 1.00 36.56  ?  57   LEU B CA    1 
ATOM   5403  C  C     . LEU B 2 60   ? 88.264  104.594 141.295 1.00 32.75  ?  57   LEU B C     1 
ATOM   5404  O  O     . LEU B 2 60   ? 88.960  105.589 141.516 1.00 42.57  ?  57   LEU B O     1 
ATOM   5405  C  CB    . LEU B 2 60   ? 89.387  103.820 139.195 1.00 34.42  ?  57   LEU B CB    1 
ATOM   5406  C  CG    . LEU B 2 60   ? 89.300  103.815 137.678 1.00 36.16  ?  57   LEU B CG    1 
ATOM   5407  C  CD1   . LEU B 2 60   ? 90.670  103.938 137.036 1.00 39.28  ?  57   LEU B CD1   1 
ATOM   5408  C  CD2   . LEU B 2 60   ? 88.589  102.567 137.219 1.00 38.03  ?  57   LEU B CD2   1 
ATOM   5409  N  N     . ARG B 2 61   ? 87.686  103.892 142.258 1.00 30.65  ?  58   ARG B N     1 
ATOM   5410  C  CA    . ARG B 2 61   ? 87.691  104.318 143.647 1.00 30.42  ?  58   ARG B CA    1 
ATOM   5411  C  C     . ARG B 2 61   ? 88.471  103.335 144.509 1.00 27.18  ?  58   ARG B C     1 
ATOM   5412  O  O     . ARG B 2 61   ? 88.569  102.146 144.198 1.00 28.77  ?  58   ARG B O     1 
ATOM   5413  C  CB    . ARG B 2 61   ? 86.260  104.459 144.170 1.00 40.84  ?  58   ARG B CB    1 
ATOM   5414  C  CG    . ARG B 2 61   ? 85.363  103.291 143.817 1.00 42.05  ?  58   ARG B CG    1 
ATOM   5415  C  CD    . ARG B 2 61   ? 83.914  103.546 144.219 1.00 50.59  ?  58   ARG B CD    1 
ATOM   5416  N  NE    . ARG B 2 61   ? 83.706  103.609 145.661 1.00 58.35  ?  58   ARG B NE    1 
ATOM   5417  C  CZ    . ARG B 2 61   ? 83.544  104.741 146.338 1.00 67.38  ?  58   ARG B CZ    1 
ATOM   5418  N  NH1   . ARG B 2 61   ? 83.351  104.713 147.650 1.00 79.31  ?  58   ARG B NH1   1 
ATOM   5419  N  NH2   . ARG B 2 61   ? 83.575  105.901 145.695 1.00 70.19  ?  58   ARG B NH2   1 
ATOM   5420  N  N     . ALA B 2 62   ? 89.024  103.855 145.602 1.00 27.46  ?  59   ALA B N     1 
ATOM   5421  C  CA    . ALA B 2 62   ? 89.814  103.053 146.520 1.00 23.20  ?  59   ALA B CA    1 
ATOM   5422  C  C     . ALA B 2 62   ? 88.917  102.132 147.345 1.00 25.38  ?  59   ALA B C     1 
ATOM   5423  O  O     . ALA B 2 62   ? 87.708  102.339 147.458 1.00 28.97  ?  59   ALA B O     1 
ATOM   5424  C  CB    . ALA B 2 62   ? 90.637  103.960 147.437 1.00 21.12  ?  59   ALA B CB    1 
ATOM   5425  N  N     . ILE B 2 63   ? 89.530  101.100 147.928 1.00 24.19  ?  60   ILE B N     1 
ATOM   5426  C  CA    . ILE B 2 63   ? 88.845  100.096 148.739 1.00 25.48  ?  60   ILE B CA    1 
ATOM   5427  C  C     . ILE B 2 63   ? 89.571  99.986  150.082 1.00 28.46  ?  60   ILE B C     1 
ATOM   5428  O  O     . ILE B 2 63   ? 90.478  100.759 150.384 1.00 30.56  ?  60   ILE B O     1 
ATOM   5429  C  CB    . ILE B 2 63   ? 88.776  98.720  148.034 1.00 22.31  ?  60   ILE B CB    1 
ATOM   5430  C  CG1   . ILE B 2 63   ? 88.675  98.869  146.515 1.00 22.05  ?  60   ILE B CG1   1 
ATOM   5431  C  CG2   . ILE B 2 63   ? 87.594  97.917  148.512 1.00 33.61  ?  60   ILE B CG2   1 
ATOM   5432  C  CD1   . ILE B 2 63   ? 87.395  99.486  146.056 1.00 22.08  ?  60   ILE B CD1   1 
ATOM   5433  N  N     . SER B 2 64   ? 89.152  99.019  150.894 1.00 28.77  ?  61   SER B N     1 
ATOM   5434  C  CA    . SER B 2 64   ? 89.799  98.697  152.161 1.00 25.88  ?  61   SER B CA    1 
ATOM   5435  C  C     . SER B 2 64   ? 89.320  97.316  152.587 1.00 32.92  ?  61   SER B C     1 
ATOM   5436  O  O     . SER B 2 64   ? 88.464  96.711  151.941 1.00 36.71  ?  61   SER B O     1 
ATOM   5437  C  CB    . SER B 2 64   ? 89.505  99.746  153.239 1.00 29.02  ?  61   SER B CB    1 
ATOM   5438  O  OG    . SER B 2 64   ? 88.190  99.613  153.740 1.00 33.88  ?  61   SER B OG    1 
ATOM   5439  N  N     . PHE B 2 65   ? 89.891  96.816  153.670 1.00 31.62  ?  62   PHE B N     1 
ATOM   5440  C  CA    . PHE B 2 65   ? 89.631  95.458  154.115 1.00 36.76  ?  62   PHE B CA    1 
ATOM   5441  C  C     . PHE B 2 65   ? 89.089  95.462  155.541 1.00 39.74  ?  62   PHE B C     1 
ATOM   5442  O  O     . PHE B 2 65   ? 88.765  96.508  156.108 1.00 40.35  ?  62   PHE B O     1 
ATOM   5443  C  CB    . PHE B 2 65   ? 90.901  94.614  154.013 1.00 44.00  ?  62   PHE B CB    1 
ATOM   5444  C  CG    . PHE B 2 65   ? 91.449  94.496  152.621 1.00 50.29  ?  62   PHE B CG    1 
ATOM   5445  C  CD1   . PHE B 2 65   ? 90.946  93.557  151.741 1.00 55.21  ?  62   PHE B CD1   1 
ATOM   5446  C  CD2   . PHE B 2 65   ? 92.483  95.309  152.198 1.00 46.57  ?  62   PHE B CD2   1 
ATOM   5447  C  CE1   . PHE B 2 65   ? 91.462  93.443  150.468 1.00 54.91  ?  62   PHE B CE1   1 
ATOM   5448  C  CE2   . PHE B 2 65   ? 93.005  95.191  150.926 1.00 43.45  ?  62   PHE B CE2   1 
ATOM   5449  C  CZ    . PHE B 2 65   ? 92.491  94.256  150.062 1.00 46.91  ?  62   PHE B CZ    1 
ATOM   5450  N  N     . SER B 2 66   ? 88.970  94.267  156.102 1.00 40.89  ?  63   SER B N     1 
ATOM   5451  C  CA    . SER B 2 66   ? 88.696  94.087  157.515 1.00 40.47  ?  63   SER B CA    1 
ATOM   5452  C  C     . SER B 2 66   ? 89.997  94.149  158.302 1.00 40.92  ?  63   SER B C     1 
ATOM   5453  O  O     . SER B 2 66   ? 91.094  94.113  157.742 1.00 42.80  ?  63   SER B O     1 
ATOM   5454  C  CB    . SER B 2 66   ? 87.984  92.754  157.762 1.00 45.65  ?  63   SER B CB    1 
ATOM   5455  O  OG    . SER B 2 66   ? 88.908  91.683  157.836 1.00 45.40  ?  63   SER B OG    1 
ATOM   5456  N  N     . ASN B 2 67   ? 89.860  94.269  159.620 1.00 45.92  ?  64   ASN B N     1 
ATOM   5457  C  CA    . ASN B 2 67   ? 91.032  94.225  160.482 1.00 46.63  ?  64   ASN B CA    1 
ATOM   5458  C  C     . ASN B 2 67   ? 91.721  92.868  160.387 1.00 51.11  ?  64   ASN B C     1 
ATOM   5459  O  O     . ASN B 2 67   ? 92.950  92.796  160.272 1.00 48.50  ?  64   ASN B O     1 
ATOM   5460  C  CB    . ASN B 2 67   ? 90.620  94.540  161.923 1.00 56.11  ?  64   ASN B CB    1 
ATOM   5461  C  CG    . ASN B 2 67   ? 89.690  95.754  162.023 1.00 57.38  ?  64   ASN B CG    1 
ATOM   5462  O  OD1   . ASN B 2 67   ? 89.392  96.412  161.025 1.00 52.03  ?  64   ASN B OD1   1 
ATOM   5463  N  ND2   . ASN B 2 67   ? 89.215  96.036  163.235 1.00 58.64  ?  64   ASN B ND2   1 
ATOM   5464  N  N     . ASN B 2 68   ? 90.937  91.784  160.378 1.00 56.13  ?  65   ASN B N     1 
ATOM   5465  C  CA    . ASN B 2 68   ? 91.444  90.414  160.376 1.00 55.90  ?  65   ASN B CA    1 
ATOM   5466  C  C     . ASN B 2 68   ? 91.741  89.887  158.981 1.00 54.64  ?  65   ASN B C     1 
ATOM   5467  O  O     . ASN B 2 68   ? 92.069  88.707  158.836 1.00 52.91  ?  65   ASN B O     1 
ATOM   5468  C  CB    . ASN B 2 68   ? 90.457  89.472  161.089 1.00 59.88  ?  65   ASN B CB    1 
ATOM   5469  C  CG    . ASN B 2 68   ? 89.091  89.414  160.418 1.00 60.14  ?  65   ASN B CG    1 
ATOM   5470  O  OD1   . ASN B 2 68   ? 88.720  90.303  159.651 1.00 54.16  ?  65   ASN B OD1   1 
ATOM   5471  N  ND2   . ASN B 2 68   ? 88.326  88.367  160.726 1.00 60.55  ?  65   ASN B ND2   1 
ATOM   5472  N  N     . SER B 2 69   ? 91.657  90.734  157.963 1.00 50.39  ?  66   SER B N     1 
ATOM   5473  C  CA    . SER B 2 69   ? 92.034  90.367  156.608 1.00 49.07  ?  66   SER B CA    1 
ATOM   5474  C  C     . SER B 2 69   ? 93.478  90.774  156.329 1.00 46.67  ?  66   SER B C     1 
ATOM   5475  O  O     . SER B 2 69   ? 93.950  91.813  156.796 1.00 46.01  ?  66   SER B O     1 
ATOM   5476  C  CB    . SER B 2 69   ? 91.101  91.025  155.591 1.00 43.71  ?  66   SER B CB    1 
ATOM   5477  O  OG    . SER B 2 69   ? 90.787  92.345  155.989 1.00 41.60  ?  66   SER B OG    1 
ATOM   5478  N  N     . SER B 2 70   ? 94.171  89.956  155.541 1.00 43.40  ?  67   SER B N     1 
ATOM   5479  C  CA    . SER B 2 70   ? 95.576  90.170  155.232 1.00 29.75  ?  67   SER B CA    1 
ATOM   5480  C  C     . SER B 2 70   ? 95.720  90.908  153.907 1.00 28.49  ?  67   SER B C     1 
ATOM   5481  O  O     . SER B 2 70   ? 94.862  90.811  153.026 1.00 32.15  ?  67   SER B O     1 
ATOM   5482  C  CB    . SER B 2 70   ? 96.327  88.839  155.182 1.00 35.16  ?  67   SER B CB    1 
ATOM   5483  O  OG    . SER B 2 70   ? 95.787  87.987  154.192 1.00 42.27  ?  67   SER B OG    1 
ATOM   5484  N  N     . TYR B 2 71   ? 96.816  91.652  153.775 1.00 26.91  ?  68   TYR B N     1 
ATOM   5485  C  CA    . TYR B 2 71   ? 97.035  92.498  152.608 1.00 24.59  ?  68   TYR B CA    1 
ATOM   5486  C  C     . TYR B 2 71   ? 97.824  91.738  151.553 1.00 20.15  ?  68   TYR B C     1 
ATOM   5487  O  O     . TYR B 2 71   ? 98.736  90.970  151.873 1.00 21.43  ?  68   TYR B O     1 
ATOM   5488  C  CB    . TYR B 2 71   ? 97.772  93.784  152.997 1.00 32.26  ?  68   TYR B CB    1 
ATOM   5489  C  CG    . TYR B 2 71   ? 96.906  94.841  153.678 1.00 36.81  ?  68   TYR B CG    1 
ATOM   5490  C  CD1   . TYR B 2 71   ? 95.579  94.587  153.990 1.00 40.29  ?  68   TYR B CD1   1 
ATOM   5491  C  CD2   . TYR B 2 71   ? 97.413  96.096  153.992 1.00 31.35  ?  68   TYR B CD2   1 
ATOM   5492  C  CE1   . TYR B 2 71   ? 94.791  95.549  154.601 1.00 38.45  ?  68   TYR B CE1   1 
ATOM   5493  C  CE2   . TYR B 2 71   ? 96.633  97.065  154.599 1.00 31.29  ?  68   TYR B CE2   1 
ATOM   5494  C  CZ    . TYR B 2 71   ? 95.321  96.784  154.900 1.00 36.23  ?  68   TYR B CZ    1 
ATOM   5495  O  OH    . TYR B 2 71   ? 94.535  97.737  155.504 1.00 37.93  ?  68   TYR B OH    1 
ATOM   5496  N  N     . LEU B 2 72   ? 97.468  91.961  150.297 1.00 18.81  ?  69   LEU B N     1 
ATOM   5497  C  CA    . LEU B 2 72   ? 97.958  91.163  149.193 1.00 18.54  ?  69   LEU B CA    1 
ATOM   5498  C  C     . LEU B 2 72   ? 98.807  91.987  148.241 1.00 14.83  ?  69   LEU B C     1 
ATOM   5499  O  O     . LEU B 2 72   ? 98.486  93.148  147.969 1.00 15.02  ?  69   LEU B O     1 
ATOM   5500  C  CB    . LEU B 2 72   ? 96.790  90.563  148.416 1.00 20.01  ?  69   LEU B CB    1 
ATOM   5501  C  CG    . LEU B 2 72   ? 96.332  89.166  148.851 1.00 35.19  ?  69   LEU B CG    1 
ATOM   5502  C  CD1   . LEU B 2 72   ? 96.200  89.016  150.362 1.00 39.19  ?  69   LEU B CD1   1 
ATOM   5503  C  CD2   . LEU B 2 72   ? 95.015  88.865  148.181 1.00 61.18  ?  69   LEU B CD2   1 
ATOM   5504  N  N     . PRO B 2 73   ? 99.883  91.415  147.718 1.00 14.33  ?  70   PRO B N     1 
ATOM   5505  C  CA    . PRO B 2 73   ? 100.677 92.106  146.706 1.00 17.17  ?  70   PRO B CA    1 
ATOM   5506  C  C     . PRO B 2 73   ? 99.966  92.113  145.365 1.00 14.20  ?  70   PRO B C     1 
ATOM   5507  O  O     . PRO B 2 73   ? 99.126  91.244  145.083 1.00 15.41  ?  70   PRO B O     1 
ATOM   5508  C  CB    . PRO B 2 73   ? 101.966 91.281  146.667 1.00 13.22  ?  70   PRO B CB    1 
ATOM   5509  C  CG    . PRO B 2 73   ? 101.505 89.908  146.976 1.00 17.37  ?  70   PRO B CG    1 
ATOM   5510  C  CD    . PRO B 2 73   ? 100.380 90.051  147.969 1.00 18.27  ?  70   PRO B CD    1 
ATOM   5511  N  N     . PRO B 2 74   ? 100.259 93.099  144.515 1.00 15.12  ?  71   PRO B N     1 
ATOM   5512  C  CA    . PRO B 2 74   ? 99.495  93.257  143.267 1.00 17.40  ?  71   PRO B CA    1 
ATOM   5513  C  C     . PRO B 2 74   ? 99.910  92.292  142.173 1.00 18.13  ?  71   PRO B C     1 
ATOM   5514  O  O     . PRO B 2 74   ? 100.721 92.622  141.300 1.00 18.51  ?  71   PRO B O     1 
ATOM   5515  C  CB    . PRO B 2 74   ? 99.778  94.712  142.867 1.00 15.05  ?  71   PRO B CB    1 
ATOM   5516  C  CG    . PRO B 2 74   ? 101.133 94.941  143.349 1.00 15.51  ?  71   PRO B CG    1 
ATOM   5517  C  CD    . PRO B 2 74   ? 101.311 94.127  144.624 1.00 16.08  ?  71   PRO B CD    1 
ATOM   5518  N  N     . LEU B 2 75   ? 99.338  91.095  142.215 1.00 16.32  ?  72   LEU B N     1 
ATOM   5519  C  CA    . LEU B 2 75   ? 99.612  90.099  141.197 1.00 15.47  ?  72   LEU B CA    1 
ATOM   5520  C  C     . LEU B 2 75   ? 99.269  90.642  139.816 1.00 15.38  ?  72   LEU B C     1 
ATOM   5521  O  O     . LEU B 2 75   ? 98.453  91.554  139.655 1.00 15.92  ?  72   LEU B O     1 
ATOM   5522  C  CB    . LEU B 2 75   ? 98.825  88.820  141.476 1.00 16.26  ?  72   LEU B CB    1 
ATOM   5523  C  CG    . LEU B 2 75   ? 99.092  88.246  142.858 1.00 17.11  ?  72   LEU B CG    1 
ATOM   5524  C  CD1   . LEU B 2 75   ? 98.433  86.881  143.057 1.00 24.19  ?  72   LEU B CD1   1 
ATOM   5525  C  CD2   . LEU B 2 75   ? 100.578 88.180  143.108 1.00 18.27  ?  72   LEU B CD2   1 
ATOM   5526  N  N     . ARG B 2 76   ? 99.914  90.060  138.812 1.00 16.28  ?  73   ARG B N     1 
ATOM   5527  C  CA    . ARG B 2 76   ? 99.882  90.574  137.457 1.00 17.03  ?  73   ARG B CA    1 
ATOM   5528  C  C     . ARG B 2 76   ? 98.970  89.764  136.547 1.00 20.56  ?  73   ARG B C     1 
ATOM   5529  O  O     . ARG B 2 76   ? 98.007  90.301  136.000 1.00 19.18  ?  73   ARG B O     1 
ATOM   5530  C  CB    . ARG B 2 76   ? 101.306 90.593  136.909 1.00 18.92  ?  73   ARG B CB    1 
ATOM   5531  C  CG    . ARG B 2 76   ? 101.642 91.844  136.181 1.00 21.07  ?  73   ARG B CG    1 
ATOM   5532  C  CD    . ARG B 2 76   ? 102.855 91.606  135.342 1.00 29.01  ?  73   ARG B CD    1 
ATOM   5533  N  NE    . ARG B 2 76   ? 103.989 91.219  136.182 1.00 29.02  ?  73   ARG B NE    1 
ATOM   5534  C  CZ    . ARG B 2 76   ? 105.056 90.562  135.743 1.00 29.85  ?  73   ARG B CZ    1 
ATOM   5535  N  NH1   . ARG B 2 76   ? 105.144 90.222  134.465 1.00 29.39  ?  73   ARG B NH1   1 
ATOM   5536  N  NH2   . ARG B 2 76   ? 106.038 90.262  136.579 1.00 26.41  ?  73   ARG B NH2   1 
ATOM   5537  N  N     . CYS B 2 77   ? 99.251  88.480  136.376 1.00 20.20  ?  74   CYS B N     1 
ATOM   5538  C  CA    . CYS B 2 77   ? 98.417  87.588  135.571 1.00 15.82  ?  74   CYS B CA    1 
ATOM   5539  C  C     . CYS B 2 77   ? 98.145  86.347  136.396 1.00 16.33  ?  74   CYS B C     1 
ATOM   5540  O  O     . CYS B 2 77   ? 98.811  85.320  136.251 1.00 16.92  ?  74   CYS B O     1 
ATOM   5541  C  CB    . CYS B 2 77   ? 99.082  87.249  134.237 1.00 18.54  ?  74   CYS B CB    1 
ATOM   5542  S  SG    . CYS B 2 77   ? 99.412  88.701  133.220 1.00 41.42  ?  74   CYS B SG    1 
ATOM   5543  N  N     . PRO B 2 78   ? 97.177  86.409  137.270 1.00 17.23  ?  75   PRO B N     1 
ATOM   5544  C  CA    . PRO B 2 78   ? 96.922  85.304  138.196 1.00 20.38  ?  75   PRO B CA    1 
ATOM   5545  C  C     . PRO B 2 78   ? 96.052  84.207  137.605 1.00 23.88  ?  75   PRO B C     1 
ATOM   5546  O  O     . PRO B 2 78   ? 95.781  84.192  136.401 1.00 21.82  ?  75   PRO B O     1 
ATOM   5547  C  CB    . PRO B 2 78   ? 96.203  86.012  139.345 1.00 22.31  ?  75   PRO B CB    1 
ATOM   5548  C  CG    . PRO B 2 78   ? 95.383  87.024  138.639 1.00 17.43  ?  75   PRO B CG    1 
ATOM   5549  C  CD    . PRO B 2 78   ? 96.222  87.510  137.472 1.00 15.17  ?  75   PRO B CD    1 
ATOM   5550  N  N     . ALA B 2 79   ? 95.632  83.269  138.448 1.00 27.54  ?  76   ALA B N     1 
ATOM   5551  C  CA    . ALA B 2 79   ? 94.560  82.338  138.130 1.00 31.39  ?  76   ALA B CA    1 
ATOM   5552  C  C     . ALA B 2 79   ? 93.368  82.622  139.040 1.00 34.58  ?  76   ALA B C     1 
ATOM   5553  O  O     . ALA B 2 79   ? 93.534  82.983  140.213 1.00 35.95  ?  76   ALA B O     1 
ATOM   5554  C  CB    . ALA B 2 79   ? 95.012  80.881  138.298 1.00 30.16  ?  76   ALA B CB    1 
ATOM   5555  N  N     . ILE B 2 80   ? 92.168  82.418  138.493 1.00 35.04  ?  77   ILE B N     1 
ATOM   5556  C  CA    . ILE B 2 80   ? 90.912  82.872  139.079 1.00 31.53  ?  77   ILE B CA    1 
ATOM   5557  C  C     . ILE B 2 80   ? 89.998  81.667  139.271 1.00 39.48  ?  77   ILE B C     1 
ATOM   5558  O  O     . ILE B 2 80   ? 90.016  80.735  138.459 1.00 42.16  ?  77   ILE B O     1 
ATOM   5559  C  CB    . ILE B 2 80   ? 90.250  83.931  138.169 1.00 27.68  ?  77   ILE B CB    1 
ATOM   5560  C  CG1   . ILE B 2 80   ? 91.036  85.241  138.189 1.00 25.77  ?  77   ILE B CG1   1 
ATOM   5561  C  CG2   . ILE B 2 80   ? 88.820  84.204  138.571 1.00 37.45  ?  77   ILE B CG2   1 
ATOM   5562  C  CD1   . ILE B 2 80   ? 92.145  85.326  137.162 1.00 26.50  ?  77   ILE B CD1   1 
ATOM   5563  N  N     . ALA B 2 81   ? 89.215  81.675  140.354 1.00 44.63  ?  78   ALA B N     1 
ATOM   5564  C  CA    . ALA B 2 81   ? 88.196  80.659  140.601 1.00 52.85  ?  78   ALA B CA    1 
ATOM   5565  C  C     . ALA B 2 81   ? 87.025  81.317  141.318 1.00 61.40  ?  78   ALA B C     1 
ATOM   5566  O  O     . ALA B 2 81   ? 87.230  82.010  142.320 1.00 66.09  ?  78   ALA B O     1 
ATOM   5567  C  CB    . ALA B 2 81   ? 88.743  79.508  141.453 1.00 55.57  ?  78   ALA B CB    1 
ATOM   5568  N  N     . HIS B 2 82   ? 85.805  81.083  140.825 1.00 66.53  ?  79   HIS B N     1 
ATOM   5569  C  CA    . HIS B 2 82   ? 84.597  81.727  141.351 1.00 77.78  ?  79   HIS B CA    1 
ATOM   5570  C  C     . HIS B 2 82   ? 83.895  80.736  142.279 1.00 86.20  ?  79   HIS B C     1 
ATOM   5571  O  O     . HIS B 2 82   ? 82.896  80.111  141.922 1.00 92.73  ?  79   HIS B O     1 
ATOM   5572  C  CB    . HIS B 2 82   ? 83.691  82.168  140.198 1.00 79.21  ?  79   HIS B CB    1 
ATOM   5573  C  CG    . HIS B 2 82   ? 82.544  83.043  140.606 1.00 81.19  ?  79   HIS B CG    1 
ATOM   5574  N  ND1   . HIS B 2 82   ? 82.412  83.569  141.873 1.00 90.35  ?  79   HIS B ND1   1 
ATOM   5575  C  CD2   . HIS B 2 82   ? 81.482  83.497  139.897 1.00 84.01  ?  79   HIS B CD2   1 
ATOM   5576  C  CE1   . HIS B 2 82   ? 81.319  84.312  141.924 1.00 96.41  ?  79   HIS B CE1   1 
ATOM   5577  N  NE2   . HIS B 2 82   ? 80.733  84.277  140.742 1.00 91.47  ?  79   HIS B NE2   1 
ATOM   5578  N  N     . PHE B 2 83   ? 84.437  80.586  143.490 1.00 85.71  ?  80   PHE B N     1 
ATOM   5579  C  CA    . PHE B 2 83   ? 83.894  79.617  144.440 1.00 95.58  ?  80   PHE B CA    1 
ATOM   5580  C  C     . PHE B 2 83   ? 82.476  80.033  144.819 1.00 113.45 ?  80   PHE B C     1 
ATOM   5581  O  O     . PHE B 2 83   ? 82.272  81.040  145.514 1.00 116.65 ?  80   PHE B O     1 
ATOM   5582  C  CB    . PHE B 2 83   ? 84.784  79.490  145.675 1.00 93.81  ?  80   PHE B CB    1 
ATOM   5583  C  CG    . PHE B 2 83   ? 84.320  78.434  146.659 1.00 99.15  ?  80   PHE B CG    1 
ATOM   5584  C  CD1   . PHE B 2 83   ? 83.455  77.426  146.269 1.00 102.66 ?  80   PHE B CD1   1 
ATOM   5585  C  CD2   . PHE B 2 83   ? 84.703  78.489  147.986 1.00 100.26 ?  80   PHE B CD2   1 
ATOM   5586  C  CE1   . PHE B 2 83   ? 83.012  76.483  147.173 1.00 102.74 ?  80   PHE B CE1   1 
ATOM   5587  C  CE2   . PHE B 2 83   ? 84.256  77.547  148.892 1.00 97.93  ?  80   PHE B CE2   1 
ATOM   5588  C  CZ    . PHE B 2 83   ? 83.414  76.546  148.483 1.00 97.80  ?  80   PHE B CZ    1 
ATOM   5589  N  N     . GLU B 2 84   ? 81.514  79.209  144.400 1.00 121.51 ?  81   GLU B N     1 
ATOM   5590  C  CA    . GLU B 2 84   ? 80.092  79.529  144.419 1.00 131.17 ?  81   GLU B CA    1 
ATOM   5591  C  C     . GLU B 2 84   ? 79.563  79.763  145.836 1.00 134.49 ?  81   GLU B C     1 
ATOM   5592  O  O     . GLU B 2 84   ? 80.087  79.245  146.827 1.00 128.52 ?  81   GLU B O     1 
ATOM   5593  C  CB    . GLU B 2 84   ? 79.323  78.392  143.725 1.00 142.10 ?  81   GLU B CB    1 
ATOM   5594  C  CG    . GLU B 2 84   ? 77.810  78.372  143.890 1.00 163.93 ?  81   GLU B CG    1 
ATOM   5595  C  CD    . GLU B 2 84   ? 77.385  77.545  145.088 1.00 170.87 ?  81   GLU B CD    1 
ATOM   5596  O  OE1   . GLU B 2 84   ? 78.289  77.008  145.765 1.00 148.41 ?  81   GLU B OE1   1 
ATOM   5597  O  OE2   . GLU B 2 84   ? 76.171  77.428  145.360 1.00 274.66 -1 81   GLU B OE2   1 
ATOM   5598  N  N     . ALA B 2 85   ? 78.511  80.573  145.916 1.00 135.94 ?  82   ALA B N     1 
ATOM   5599  C  CA    . ALA B 2 85   ? 77.826  80.903  147.159 1.00 134.22 ?  82   ALA B CA    1 
ATOM   5600  C  C     . ALA B 2 85   ? 77.197  79.677  147.804 1.00 137.58 ?  82   ALA B C     1 
ATOM   5601  O  O     . ALA B 2 85   ? 76.190  79.162  147.313 1.00 144.54 ?  82   ALA B O     1 
ATOM   5602  C  CB    . ALA B 2 85   ? 76.749  81.962  146.885 1.00 132.11 ?  82   ALA B CB    1 
ATOM   5603  N  N     . GLN B 2 86   ? 77.758  79.220  148.913 1.00 128.18 ?  83   GLN B N     1 
ATOM   5604  C  CA    . GLN B 2 86   ? 77.311  78.001  149.600 1.00 130.74 ?  83   GLN B CA    1 
ATOM   5605  C  C     . GLN B 2 86   ? 77.955  77.949  150.975 1.00 125.89 ?  83   GLN B C     1 
ATOM   5606  O  O     . GLN B 2 86   ? 78.526  78.935  151.452 1.00 120.41 ?  83   GLN B O     1 
ATOM   5607  C  CB    . GLN B 2 86   ? 77.650  76.732  148.793 1.00 128.95 ?  83   GLN B CB    1 
ATOM   5608  C  CG    . GLN B 2 86   ? 79.131  76.328  148.803 1.00 115.25 ?  83   GLN B CG    1 
ATOM   5609  C  CD    . GLN B 2 86   ? 79.354  74.841  148.608 1.00 106.93 ?  83   GLN B CD    1 
ATOM   5610  O  OE1   . GLN B 2 86   ? 80.466  74.341  148.806 1.00 105.26 ?  83   GLN B OE1   1 
ATOM   5611  N  NE2   . GLN B 2 86   ? 78.281  74.108  148.316 1.00 106.21 ?  83   GLN B NE2   1 
ATOM   5612  N  N     . ASP B 2 87   ? 77.814  76.792  151.611 1.00 138.23 ?  84   ASP B N     1 
ATOM   5613  C  CA    . ASP B 2 87   ? 78.547  76.472  152.822 1.00 144.69 ?  84   ASP B CA    1 
ATOM   5614  C  C     . ASP B 2 87   ? 80.041  76.661  152.586 1.00 135.03 ?  84   ASP B C     1 
ATOM   5615  O  O     . ASP B 2 87   ? 80.606  76.123  151.628 1.00 124.48 ?  84   ASP B O     1 
ATOM   5616  C  CB    . ASP B 2 87   ? 78.251  75.028  153.249 1.00 167.08 ?  84   ASP B CB    1 
ATOM   5617  C  CG    . ASP B 2 87   ? 76.759  74.693  153.247 1.00 202.85 ?  84   ASP B CG    1 
ATOM   5618  O  OD1   . ASP B 2 87   ? 75.925  75.625  153.115 1.00 184.64 ?  84   ASP B OD1   1 
ATOM   5619  O  OD2   . ASP B 2 87   ? 76.435  73.489  153.354 1.00 338.05 -1 84   ASP B OD2   1 
ATOM   5620  N  N     . GLY B 2 88   ? 80.678  77.444  153.455 1.00 132.59 ?  85   GLY B N     1 
ATOM   5621  C  CA    . GLY B 2 88   ? 79.998  78.087  154.567 1.00 129.02 ?  85   GLY B CA    1 
ATOM   5622  C  C     . GLY B 2 88   ? 79.981  79.598  154.457 1.00 113.81 ?  85   GLY B C     1 
ATOM   5623  O  O     . GLY B 2 88   ? 79.305  80.279  155.228 1.00 107.67 ?  85   GLY B O     1 
ATOM   5624  N  N     . LYS B 2 89   ? 80.721  80.125  153.485 1.00 112.50 ?  86   LYS B N     1 
ATOM   5625  C  CA    . LYS B 2 89   ? 80.852  81.569  153.301 1.00 106.47 ?  86   LYS B CA    1 
ATOM   5626  C  C     . LYS B 2 89   ? 80.606  81.930  151.843 1.00 102.63 ?  86   LYS B C     1 
ATOM   5627  O  O     . LYS B 2 89   ? 81.501  81.769  150.997 1.00 101.29 ?  86   LYS B O     1 
ATOM   5628  C  CB    . LYS B 2 89   ? 82.222  82.055  153.757 1.00 117.84 ?  86   LYS B CB    1 
ATOM   5629  C  CG    . LYS B 2 89   ? 82.518  83.509  153.414 1.00 110.27 ?  86   LYS B CG    1 
ATOM   5630  C  CD    . LYS B 2 89   ? 81.441  84.431  153.955 1.00 111.25 ?  86   LYS B CD    1 
ATOM   5631  C  CE    . LYS B 2 89   ? 81.570  85.831  153.386 1.00 104.22 ?  86   LYS B CE    1 
ATOM   5632  N  NZ    . LYS B 2 89   ? 81.375  85.844  151.908 1.00 93.72  ?  86   LYS B NZ    1 
ATOM   5633  N  N     . PRO B 2 90   ? 79.409  82.402  151.505 1.00 102.85 ?  87   PRO B N     1 
ATOM   5634  C  CA    . PRO B 2 90   ? 79.181  83.035  150.200 1.00 102.58 ?  87   PRO B CA    1 
ATOM   5635  C  C     . PRO B 2 90   ? 79.580  84.503  150.208 1.00 94.74  ?  87   PRO B C     1 
ATOM   5636  O  O     . PRO B 2 90   ? 79.326  85.230  151.169 1.00 95.27  ?  87   PRO B O     1 
ATOM   5637  C  CB    . PRO B 2 90   ? 77.661  82.905  150.025 1.00 108.04 ?  87   PRO B CB    1 
ATOM   5638  C  CG    . PRO B 2 90   ? 77.242  81.837  150.989 1.00 109.25 ?  87   PRO B CG    1 
ATOM   5639  C  CD    . PRO B 2 90   ? 78.146  82.025  152.154 1.00 106.22 ?  87   PRO B CD    1 
ATOM   5640  N  N     . GLU B 2 91   ? 80.207  84.962  149.123 1.00 97.17  ?  88   GLU B N     1 
ATOM   5641  C  CA    . GLU B 2 91   ? 80.608  84.166  147.963 1.00 107.51 ?  88   GLU B CA    1 
ATOM   5642  C  C     . GLU B 2 91   ? 82.121  84.338  147.835 1.00 100.56 ?  88   GLU B C     1 
ATOM   5643  O  O     . GLU B 2 91   ? 82.629  85.424  148.119 1.00 93.21  ?  88   GLU B O     1 
ATOM   5644  C  CB    . GLU B 2 91   ? 79.894  84.641  146.690 1.00 119.81 ?  88   GLU B CB    1 
ATOM   5645  C  CG    . GLU B 2 91   ? 80.658  84.410  145.383 1.00 124.07 ?  88   GLU B CG    1 
ATOM   5646  C  CD    . GLU B 2 91   ? 80.233  83.125  144.675 1.00 135.18 ?  88   GLU B CD    1 
ATOM   5647  O  OE1   . GLU B 2 91   ? 79.133  82.623  144.958 1.00 134.79 ?  88   GLU B OE1   1 
ATOM   5648  O  OE2   . GLU B 2 91   ? 81.009  82.599  143.849 1.00 209.40 -1 88   GLU B OE2   1 
ATOM   5649  N  N     . CYS B 2 92   ? 82.855  83.307  147.412 1.00 103.87 ?  89   CYS B N     1 
ATOM   5650  C  CA    . CYS B 2 92   ? 84.312  83.365  147.461 1.00 95.63  ?  89   CYS B CA    1 
ATOM   5651  C  C     . CYS B 2 92   ? 84.922  83.540  146.076 1.00 87.08  ?  89   CYS B C     1 
ATOM   5652  O  O     . CYS B 2 92   ? 84.390  83.055  145.074 1.00 92.23  ?  89   CYS B O     1 
ATOM   5653  C  CB    . CYS B 2 92   ? 84.894  82.105  148.109 1.00 100.86 ?  89   CYS B CB    1 
ATOM   5654  S  SG    . CYS B 2 92   ? 84.218  81.686  149.725 1.00 121.52 ?  89   CYS B SG    1 
ATOM   5655  N  N     . TYR B 2 93   ? 86.075  84.209  146.035 1.00 73.56  ?  90   TYR B N     1 
ATOM   5656  C  CA    . TYR B 2 93   ? 86.918  84.232  144.845 1.00 69.22  ?  90   TYR B CA    1 
ATOM   5657  C  C     . TYR B 2 93   ? 88.335  83.824  145.230 1.00 64.91  ?  90   TYR B C     1 
ATOM   5658  O  O     . TYR B 2 93   ? 88.972  84.479  146.060 1.00 59.33  ?  90   TYR B O     1 
ATOM   5659  C  CB    . TYR B 2 93   ? 86.902  85.603  144.156 1.00 63.11  ?  90   TYR B CB    1 
ATOM   5660  C  CG    . TYR B 2 93   ? 86.108  85.582  142.858 1.00 65.95  ?  90   TYR B CG    1 
ATOM   5661  C  CD1   . TYR B 2 93   ? 86.634  84.993  141.718 1.00 63.96  ?  90   TYR B CD1   1 
ATOM   5662  C  CD2   . TYR B 2 93   ? 84.853  86.164  142.765 1.00 72.35  ?  90   TYR B CD2   1 
ATOM   5663  C  CE1   . TYR B 2 93   ? 85.922  84.958  140.531 1.00 64.46  ?  90   TYR B CE1   1 
ATOM   5664  C  CE2   . TYR B 2 93   ? 84.136  86.145  141.571 1.00 72.88  ?  90   TYR B CE2   1 
ATOM   5665  C  CZ    . TYR B 2 93   ? 84.677  85.540  140.458 1.00 66.00  ?  90   TYR B CZ    1 
ATOM   5666  O  OH    . TYR B 2 93   ? 83.978  85.509  139.273 1.00 63.86  ?  90   TYR B OH    1 
ATOM   5667  N  N     . LEU B 2 94   ? 88.811  82.731  144.640 1.00 65.37  ?  91   LEU B N     1 
ATOM   5668  C  CA    . LEU B 2 94   ? 90.138  82.187  144.899 1.00 58.94  ?  91   LEU B CA    1 
ATOM   5669  C  C     . LEU B 2 94   ? 91.072  82.664  143.793 1.00 42.59  ?  91   LEU B C     1 
ATOM   5670  O  O     . LEU B 2 94   ? 90.788  82.460  142.610 1.00 41.81  ?  91   LEU B O     1 
ATOM   5671  C  CB    . LEU B 2 94   ? 90.081  80.656  144.951 1.00 63.84  ?  91   LEU B CB    1 
ATOM   5672  C  CG    . LEU B 2 94   ? 89.157  79.980  145.982 1.00 70.58  ?  91   LEU B CG    1 
ATOM   5673  C  CD1   . LEU B 2 94   ? 88.998  78.476  145.740 1.00 88.65  ?  91   LEU B CD1   1 
ATOM   5674  C  CD2   . LEU B 2 94   ? 89.663  80.218  147.392 1.00 69.80  ?  91   LEU B CD2   1 
ATOM   5675  N  N     . ILE B 2 95   ? 92.173  83.305  144.168 1.00 41.47  ?  92   ILE B N     1 
ATOM   5676  C  CA    . ILE B 2 95   ? 93.154  83.786  143.207 1.00 31.63  ?  92   ILE B CA    1 
ATOM   5677  C  C     . ILE B 2 95   ? 94.531  83.293  143.621 1.00 31.62  ?  92   ILE B C     1 
ATOM   5678  O  O     . ILE B 2 95   ? 94.898  83.363  144.802 1.00 33.95  ?  92   ILE B O     1 
ATOM   5679  C  CB    . ILE B 2 95   ? 93.127  85.320  143.069 1.00 34.38  ?  92   ILE B CB    1 
ATOM   5680  C  CG1   . ILE B 2 95   ? 91.858  85.749  142.338 1.00 41.38  ?  92   ILE B CG1   1 
ATOM   5681  C  CG2   . ILE B 2 95   ? 94.339  85.823  142.332 1.00 29.20  ?  92   ILE B CG2   1 
ATOM   5682  C  CD1   . ILE B 2 95   ? 91.822  87.215  141.944 1.00 46.96  ?  92   ILE B CD1   1 
ATOM   5683  N  N     . HIS B 2 96   ? 95.273  82.773  142.645 1.00 32.95  ?  93   HIS B N     1 
ATOM   5684  C  CA    . HIS B 2 96   ? 96.632  82.287  142.842 1.00 24.52  ?  93   HIS B CA    1 
ATOM   5685  C  C     . HIS B 2 96   ? 97.237  81.987  141.483 1.00 22.48  ?  93   HIS B C     1 
ATOM   5686  O  O     . HIS B 2 96   ? 96.537  81.512  140.590 1.00 24.71  ?  93   HIS B O     1 
ATOM   5687  C  CB    . HIS B 2 96   ? 96.648  81.026  143.711 1.00 28.37  ?  93   HIS B CB    1 
ATOM   5688  C  CG    . HIS B 2 96   ? 97.790  80.110  143.412 1.00 26.50  ?  93   HIS B CG    1 
ATOM   5689  N  ND1   . HIS B 2 96   ? 99.030  80.258  143.997 1.00 28.17  ?  93   HIS B ND1   1 
ATOM   5690  C  CD2   . HIS B 2 96   ? 97.888  79.050  142.573 1.00 30.50  ?  93   HIS B CD2   1 
ATOM   5691  C  CE1   . HIS B 2 96   ? 99.838  79.320  143.537 1.00 34.66  ?  93   HIS B CE1   1 
ATOM   5692  N  NE2   . HIS B 2 96   ? 99.170  78.573  142.676 1.00 33.73  ?  93   HIS B NE2   1 
ATOM   5693  N  N     . GLY B 2 97   ? 98.526  82.262  141.327 1.00 22.84  ?  94   GLY B N     1 
ATOM   5694  C  CA    . GLY B 2 97   ? 99.345  82.892  142.347 1.00 22.55  ?  94   GLY B CA    1 
ATOM   5695  C  C     . GLY B 2 97   ? 100.078 84.064  141.742 1.00 16.55  ?  94   GLY B C     1 
ATOM   5696  O  O     . GLY B 2 97   ? 100.932 84.676  142.384 1.00 15.72  ?  94   GLY B O     1 
ATOM   5697  N  N     . GLY B 2 98   ? 99.750  84.347  140.477 1.00 16.14  ?  95   GLY B N     1 
ATOM   5698  C  CA    . GLY B 2 98   ? 100.141 85.530  139.727 1.00 17.44  ?  95   GLY B CA    1 
ATOM   5699  C  C     . GLY B 2 98   ? 101.639 85.834  139.670 1.00 20.81  ?  95   GLY B C     1 
ATOM   5700  O  O     . GLY B 2 98   ? 102.498 85.028  140.037 1.00 19.73  ?  95   GLY B O     1 
ATOM   5701  N  N     . ARG B 2 99   ? 101.931 87.052  139.204 1.00 21.05  ?  96   ARG B N     1 
ATOM   5702  C  CA    . ARG B 2 99   ? 103.297 87.536  139.030 1.00 21.13  ?  96   ARG B CA    1 
ATOM   5703  C  C     . ARG B 2 99   ? 103.532 88.777  139.886 1.00 20.07  ?  96   ARG B C     1 
ATOM   5704  O  O     . ARG B 2 99   ? 102.748 89.734  139.832 1.00 18.57  ?  96   ARG B O     1 
ATOM   5705  C  CB    . ARG B 2 99   ? 103.579 87.853  137.558 1.00 20.99  ?  96   ARG B CB    1 
ATOM   5706  C  CG    . ARG B 2 99   ? 104.909 87.312  137.035 1.00 21.86  ?  96   ARG B CG    1 
ATOM   5707  C  CD    . ARG B 2 99   ? 104.894 87.164  135.517 1.00 19.05  ?  96   ARG B CD    1 
ATOM   5708  N  NE    . ARG B 2 99   ? 106.153 87.596  134.909 1.00 17.85  ?  96   ARG B NE    1 
ATOM   5709  C  CZ    . ARG B 2 99   ? 106.475 87.426  133.629 1.00 15.66  ?  96   ARG B CZ    1 
ATOM   5710  N  NH1   . ARG B 2 99   ? 107.644 87.859  133.181 1.00 15.49  ?  96   ARG B NH1   1 
ATOM   5711  N  NH2   . ARG B 2 99   ? 105.627 86.843  132.793 1.00 19.36  ?  96   ARG B NH2   1 
ATOM   5712  N  N     . THR B 2 100  ? 104.620 88.752  140.663 1.00 18.41  ?  97   THR B N     1 
ATOM   5713  C  CA    . THR B 2 100  ? 104.977 89.866  141.540 1.00 13.37  ?  97   THR B CA    1 
ATOM   5714  C  C     . THR B 2 100  ? 105.431 91.064  140.720 1.00 12.57  ?  97   THR B C     1 
ATOM   5715  O  O     . THR B 2 100  ? 106.232 90.902  139.799 1.00 14.58  ?  97   THR B O     1 
ATOM   5716  C  CB    . THR B 2 100  ? 106.087 89.431  142.507 1.00 12.57  ?  97   THR B CB    1 
ATOM   5717  O  OG1   . THR B 2 100  ? 105.695 88.227  143.179 1.00 13.10  ?  97   THR B OG1   1 
ATOM   5718  C  CG2   . THR B 2 100  ? 106.405 90.493  143.527 1.00 15.41  ?  97   THR B CG2   1 
ATOM   5719  N  N     . PRO B 2 101  ? 104.930 92.266  141.005 1.00 11.08  ?  98   PRO B N     1 
ATOM   5720  C  CA    . PRO B 2 101  ? 105.427 93.452  140.290 1.00 11.82  ?  98   PRO B CA    1 
ATOM   5721  C  C     . PRO B 2 101  ? 106.935 93.556  140.300 1.00 10.68  ?  98   PRO B C     1 
ATOM   5722  O  O     . PRO B 2 101  ? 107.538 93.727  139.238 1.00 14.62  ?  98   PRO B O     1 
ATOM   5723  C  CB    . PRO B 2 101  ? 104.749 94.610  141.034 1.00 11.43  ?  98   PRO B CB    1 
ATOM   5724  C  CG    . PRO B 2 101  ? 104.348 94.039  142.321 1.00 12.45  ?  98   PRO B CG    1 
ATOM   5725  C  CD    . PRO B 2 101  ? 103.960 92.639  142.040 1.00 13.97  ?  98   PRO B CD    1 
ATOM   5726  N  N     . ASN B 2 102  ? 107.568 93.474  141.463 1.00 15.46  ?  99   ASN B N     1 
ATOM   5727  C  CA    . ASN B 2 102  ? 108.977 93.119  141.457 1.00 12.35  ?  99   ASN B CA    1 
ATOM   5728  C  C     . ASN B 2 102  ? 109.037 91.751  140.803 1.00 14.69  ?  99   ASN B C     1 
ATOM   5729  O  O     . ASN B 2 102  ? 108.550 90.773  141.372 1.00 14.78  ?  99   ASN B O     1 
ATOM   5730  C  CB    . ASN B 2 102  ? 109.565 93.084  142.864 1.00 13.37  ?  99   ASN B CB    1 
ATOM   5731  C  CG    . ASN B 2 102  ? 110.994 92.609  142.879 1.00 13.88  ?  99   ASN B CG    1 
ATOM   5732  O  OD1   . ASN B 2 102  ? 111.755 92.862  141.945 1.00 14.02  ?  99   ASN B OD1   1 
ATOM   5733  N  ND2   . ASN B 2 102  ? 111.368 91.902  143.942 1.00 13.46  ?  99   ASN B ND2   1 
ATOM   5734  N  N     . ASN B 2 103  ? 109.629 91.667  139.616 1.00 16.17  ?  100  ASN B N     1 
ATOM   5735  C  CA    . ASN B 2 103  ? 109.381 90.541  138.723 1.00 16.75  ?  100  ASN B CA    1 
ATOM   5736  C  C     . ASN B 2 103  ? 109.830 89.225  139.341 1.00 17.56  ?  100  ASN B C     1 
ATOM   5737  O  O     . ASN B 2 103  ? 111.026 88.925  139.382 1.00 16.60  ?  100  ASN B O     1 
ATOM   5738  C  CB    . ASN B 2 103  ? 110.103 90.776  137.388 1.00 19.97  ?  100  ASN B CB    1 
ATOM   5739  C  CG    . ASN B 2 103  ? 109.977 89.612  136.429 1.00 21.28  ?  100  ASN B CG    1 
ATOM   5740  O  OD1   . ASN B 2 103  ? 110.766 88.668  136.476 1.00 19.34  ?  100  ASN B OD1   1 
ATOM   5741  N  ND2   . ASN B 2 103  ? 108.992 89.680  135.538 1.00 26.11  ?  100  ASN B ND2   1 
ATOM   5742  N  N     . GLU B 2 104  ? 108.871 88.433  139.812 1.00 20.03  ?  101  GLU B N     1 
ATOM   5743  C  CA    . GLU B 2 104  ? 109.116 87.120  140.398 1.00 24.92  ?  101  GLU B CA    1 
ATOM   5744  C  C     . GLU B 2 104  ? 107.758 86.492  140.708 1.00 24.38  ?  101  GLU B C     1 
ATOM   5745  O  O     . GLU B 2 104  ? 106.713 87.131  140.554 1.00 23.17  ?  101  GLU B O     1 
ATOM   5746  C  CB    . GLU B 2 104  ? 109.994 87.218  141.645 1.00 30.97  ?  101  GLU B CB    1 
ATOM   5747  C  CG    . GLU B 2 104  ? 111.202 86.279  141.607 1.00 60.36  ?  101  GLU B CG    1 
ATOM   5748  C  CD    . GLU B 2 104  ? 112.008 86.281  142.904 1.00 121.44 ?  101  GLU B CD    1 
ATOM   5749  O  OE1   . GLU B 2 104  ? 111.639 87.014  143.844 1.00 96.72  ?  101  GLU B OE1   1 
ATOM   5750  O  OE2   . GLU B 2 104  ? 113.035 85.569  142.973 1.00 328.40 -1 101  GLU B OE2   1 
ATOM   5751  N  N     . LEU B 2 105  ? 107.781 85.233  141.138 1.00 19.38  ?  102  LEU B N     1 
ATOM   5752  C  CA    . LEU B 2 105  ? 106.570 84.439  141.312 1.00 20.02  ?  102  LEU B CA    1 
ATOM   5753  C  C     . LEU B 2 105  ? 106.276 84.182  142.787 1.00 20.18  ?  102  LEU B C     1 
ATOM   5754  O  O     . LEU B 2 105  ? 107.086 84.461  143.673 1.00 23.89  ?  102  LEU B O     1 
ATOM   5755  C  CB    . LEU B 2 105  ? 106.686 83.124  140.538 1.00 21.58  ?  102  LEU B CB    1 
ATOM   5756  C  CG    . LEU B 2 105  ? 106.783 83.321  139.028 1.00 20.35  ?  102  LEU B CG    1 
ATOM   5757  C  CD1   . LEU B 2 105  ? 106.507 82.036  138.274 1.00 25.93  ?  102  LEU B CD1   1 
ATOM   5758  C  CD2   . LEU B 2 105  ? 105.798 84.374  138.614 1.00 16.78  ?  102  LEU B CD2   1 
ATOM   5759  N  N     . SER B 2 106  ? 105.092 83.625  143.037 1.00 19.07  ?  103  SER B N     1 
ATOM   5760  C  CA    . SER B 2 106  ? 104.543 83.520  144.386 1.00 20.42  ?  103  SER B CA    1 
ATOM   5761  C  C     . SER B 2 106  ? 103.890 82.160  144.575 1.00 22.62  ?  103  SER B C     1 
ATOM   5762  O  O     . SER B 2 106  ? 103.040 81.762  143.776 1.00 24.17  ?  103  SER B O     1 
ATOM   5763  C  CB    . SER B 2 106  ? 103.520 84.626  144.645 1.00 23.45  ?  103  SER B CB    1 
ATOM   5764  O  OG    . SER B 2 106  ? 102.386 84.441  143.832 1.00 22.21  ?  103  SER B OG    1 
ATOM   5765  N  N     . SER B 2 107  ? 104.287 81.454  145.628 1.00 21.38  ?  104  SER B N     1 
ATOM   5766  C  CA    . SER B 2 107  ? 103.658 80.209  146.052 1.00 29.68  ?  104  SER B CA    1 
ATOM   5767  C  C     . SER B 2 107  ? 102.452 80.432  146.958 1.00 29.69  ?  104  SER B C     1 
ATOM   5768  O  O     . SER B 2 107  ? 102.129 79.556  147.770 1.00 34.30  ?  104  SER B O     1 
ATOM   5769  C  CB    . SER B 2 107  ? 104.681 79.321  146.763 1.00 33.50  ?  104  SER B CB    1 
ATOM   5770  O  OG    . SER B 2 107  ? 104.059 78.308  147.533 1.00 36.30  ?  104  SER B OG    1 
ATOM   5771  N  N     . SER B 2 108  ? 101.793 81.582  146.856 1.00 26.70  ?  105  SER B N     1 
ATOM   5772  C  CA    . SER B 2 108  ? 100.693 81.945  147.738 1.00 31.45  ?  105  SER B CA    1 
ATOM   5773  C  C     . SER B 2 108  ? 99.339  81.587  147.133 1.00 32.76  ?  105  SER B C     1 
ATOM   5774  O  O     . SER B 2 108  ? 99.168  81.556  145.913 1.00 30.23  ?  105  SER B O     1 
ATOM   5775  C  CB    . SER B 2 108  ? 100.731 83.442  148.051 1.00 34.11  ?  105  SER B CB    1 
ATOM   5776  O  OG    . SER B 2 108  ? 100.387 84.206  146.916 1.00 32.91  ?  105  SER B OG    1 
ATOM   5777  N  N     . LEU B 2 109  ? 98.376  81.317  148.010 1.00 40.03  ?  106  LEU B N     1 
ATOM   5778  C  CA    . LEU B 2 109  ? 96.973  81.173  147.645 1.00 38.32  ?  106  LEU B CA    1 
ATOM   5779  C  C     . LEU B 2 109  ? 96.159  82.222  148.389 1.00 43.70  ?  106  LEU B C     1 
ATOM   5780  O  O     . LEU B 2 109  ? 96.351  82.423  149.591 1.00 47.03  ?  106  LEU B O     1 
ATOM   5781  C  CB    . LEU B 2 109  ? 96.452  79.772  147.984 1.00 44.65  ?  106  LEU B CB    1 
ATOM   5782  C  CG    . LEU B 2 109  ? 94.967  79.483  147.764 1.00 42.77  ?  106  LEU B CG    1 
ATOM   5783  C  CD1   . LEU B 2 109  ? 94.797  78.060  147.275 1.00 54.50  ?  106  LEU B CD1   1 
ATOM   5784  C  CD2   . LEU B 2 109  ? 94.141  79.697  149.020 1.00 49.48  ?  106  LEU B CD2   1 
ATOM   5785  N  N     . TYR B 2 110  ? 95.230  82.872  147.689 1.00 41.46  ?  107  TYR B N     1 
ATOM   5786  C  CA    . TYR B 2 110  ? 94.468  83.969  148.276 1.00 45.75  ?  107  TYR B CA    1 
ATOM   5787  C  C     . TYR B 2 110  ? 92.977  83.700  148.131 1.00 46.81  ?  107  TYR B C     1 
ATOM   5788  O  O     . TYR B 2 110  ? 92.469  83.574  147.012 1.00 45.23  ?  107  TYR B O     1 
ATOM   5789  C  CB    . TYR B 2 110  ? 94.845  85.307  147.628 1.00 43.24  ?  107  TYR B CB    1 
ATOM   5790  C  CG    . TYR B 2 110  ? 96.286  85.729  147.873 1.00 43.64  ?  107  TYR B CG    1 
ATOM   5791  C  CD1   . TYR B 2 110  ? 96.852  85.611  149.133 1.00 43.21  ?  107  TYR B CD1   1 
ATOM   5792  C  CD2   . TYR B 2 110  ? 97.064  86.278  146.862 1.00 38.31  ?  107  TYR B CD2   1 
ATOM   5793  C  CE1   . TYR B 2 110  ? 98.156  85.997  149.372 1.00 42.74  ?  107  TYR B CE1   1 
ATOM   5794  C  CE2   . TYR B 2 110  ? 98.372  86.675  147.097 1.00 33.71  ?  107  TYR B CE2   1 
ATOM   5795  C  CZ    . TYR B 2 110  ? 98.911  86.530  148.352 1.00 30.56  ?  107  TYR B CZ    1 
ATOM   5796  O  OH    . TYR B 2 110  ? 100.208 86.919  148.579 1.00 27.06  ?  107  TYR B OH    1 
ATOM   5797  N  N     . MET B 2 111  ? 92.278  83.626  149.259 1.00 52.25  ?  108  MET B N     1 
ATOM   5798  C  CA    . MET B 2 111  ? 90.829  83.471  149.280 1.00 56.02  ?  108  MET B CA    1 
ATOM   5799  C  C     . MET B 2 111  ? 90.227  84.824  149.637 1.00 53.38  ?  108  MET B C     1 
ATOM   5800  O  O     . MET B 2 111  ? 90.571  85.403  150.672 1.00 56.04  ?  108  MET B O     1 
ATOM   5801  C  CB    . MET B 2 111  ? 90.403  82.392  150.279 1.00 60.51  ?  108  MET B CB    1 
ATOM   5802  C  CG    . MET B 2 111  ? 88.903  82.172  150.367 1.00 66.23  ?  108  MET B CG    1 
ATOM   5803  S  SD    . MET B 2 111  ? 88.459  80.797  151.448 1.00 87.63  ?  108  MET B SD    1 
ATOM   5804  C  CE    . MET B 2 111  ? 89.071  81.393  153.018 1.00 77.09  ?  108  MET B CE    1 
ATOM   5805  N  N     . LEU B 2 112  ? 89.343  85.331  148.780 1.00 53.24  ?  109  LEU B N     1 
ATOM   5806  C  CA    . LEU B 2 112  ? 88.816  86.680  148.897 1.00 51.58  ?  109  LEU B CA    1 
ATOM   5807  C  C     . LEU B 2 112  ? 87.297  86.646  148.964 1.00 57.08  ?  109  LEU B C     1 
ATOM   5808  O  O     . LEU B 2 112  ? 86.649  85.778  148.374 1.00 64.23  ?  109  LEU B O     1 
ATOM   5809  C  CB    . LEU B 2 112  ? 89.277  87.548  147.712 1.00 46.48  ?  109  LEU B CB    1 
ATOM   5810  C  CG    . LEU B 2 112  ? 88.737  88.962  147.521 1.00 43.52  ?  109  LEU B CG    1 
ATOM   5811  C  CD1   . LEU B 2 112  ? 89.736  89.789  146.754 1.00 39.69  ?  109  LEU B CD1   1 
ATOM   5812  C  CD2   . LEU B 2 112  ? 87.440  88.952  146.751 1.00 45.43  ?  109  LEU B CD2   1 
ATOM   5813  N  N     . SER B 2 113  ? 86.740  87.615  149.681 1.00 64.60  ?  110  SER B N     1 
ATOM   5814  C  CA    . SER B 2 113  ? 85.293  87.755  149.783 1.00 76.16  ?  110  SER B CA    1 
ATOM   5815  C  C     . SER B 2 113  ? 84.961  89.210  150.097 1.00 73.21  ?  110  SER B C     1 
ATOM   5816  O  O     . SER B 2 113  ? 85.847  90.038  150.330 1.00 67.72  ?  110  SER B O     1 
ATOM   5817  C  CB    . SER B 2 113  ? 84.717  86.813  150.847 1.00 89.97  ?  110  SER B CB    1 
ATOM   5818  O  OG    . SER B 2 113  ? 83.364  87.134  151.128 1.00 88.32  ?  110  SER B OG    1 
ATOM   5819  N  N     . VAL B 2 114  ? 83.657  89.508  150.098 1.00 74.88  ?  111  VAL B N     1 
ATOM   5820  C  CA    . VAL B 2 114  ? 83.114  90.786  150.544 1.00 72.55  ?  111  VAL B CA    1 
ATOM   5821  C  C     . VAL B 2 114  ? 82.593  90.605  151.963 1.00 78.80  ?  111  VAL B C     1 
ATOM   5822  O  O     . VAL B 2 114  ? 82.004  89.565  152.288 1.00 80.07  ?  111  VAL B O     1 
ATOM   5823  C  CB    . VAL B 2 114  ? 82.002  91.270  149.590 1.00 74.20  ?  111  VAL B CB    1 
ATOM   5824  C  CG1   . VAL B 2 114  ? 81.022  90.143  149.275 1.00 75.80  ?  111  VAL B CG1   1 
ATOM   5825  C  CG2   . VAL B 2 114  ? 81.268  92.469  150.161 1.00 79.39  ?  111  VAL B CG2   1 
ATOM   5826  N  N     . ASP B 2 115  ? 82.829  91.601  152.824 1.00 83.20  ?  112  ASP B N     1 
ATOM   5827  C  CA    . ASP B 2 115  ? 82.506  91.467  154.243 1.00 92.38  ?  112  ASP B CA    1 
ATOM   5828  C  C     . ASP B 2 115  ? 81.399  92.412  154.701 1.00 101.20 ?  112  ASP B C     1 
ATOM   5829  O  O     . ASP B 2 115  ? 80.361  91.937  155.175 1.00 104.69 ?  112  ASP B O     1 
ATOM   5830  C  CB    . ASP B 2 115  ? 83.778  91.665  155.081 1.00 92.60  ?  112  ASP B CB    1 
ATOM   5831  C  CG    . ASP B 2 115  ? 83.476  91.961  156.537 1.00 119.25 ?  112  ASP B CG    1 
ATOM   5832  O  OD1   . ASP B 2 115  ? 83.340  91.004  157.328 1.00 116.41 ?  112  ASP B OD1   1 
ATOM   5833  O  OD2   . ASP B 2 115  ? 83.372  93.157  156.884 1.00 213.64 -1 112  ASP B OD2   1 
ATOM   5834  N  N     . SER B 2 116  ? 81.561  93.731  154.552 1.00 98.48  ?  113  SER B N     1 
ATOM   5835  C  CA    . SER B 2 116  ? 80.616  94.695  155.113 1.00 94.50  ?  113  SER B CA    1 
ATOM   5836  C  C     . SER B 2 116  ? 80.324  95.809  154.116 1.00 86.47  ?  113  SER B C     1 
ATOM   5837  O  O     . SER B 2 116  ? 81.153  96.140  153.263 1.00 84.43  ?  113  SER B O     1 
ATOM   5838  C  CB    . SER B 2 116  ? 81.148  95.303  156.421 1.00 92.96  ?  113  SER B CB    1 
ATOM   5839  O  OG    . SER B 2 116  ? 80.382  96.433  156.815 1.00 85.93  ?  113  SER B OG    1 
ATOM   5840  N  N     . ARG B 2 117  ? 79.136  96.397  154.253 1.00 84.36  ?  114  ARG B N     1 
ATOM   5841  C  CA    . ARG B 2 117  ? 78.639  97.440  153.365 1.00 87.11  ?  114  ARG B CA    1 
ATOM   5842  C  C     . ARG B 2 117  ? 77.313  97.945  153.922 1.00 89.76  ?  114  ARG B C     1 
ATOM   5843  O  O     . ARG B 2 117  ? 76.527  97.165  154.471 1.00 84.75  ?  114  ARG B O     1 
ATOM   5844  C  CB    . ARG B 2 117  ? 78.480  96.903  151.931 1.00 81.16  ?  114  ARG B CB    1 
ATOM   5845  C  CG    . ARG B 2 117  ? 77.295  97.412  151.127 1.00 79.11  ?  114  ARG B CG    1 
ATOM   5846  C  CD    . ARG B 2 117  ? 77.016  96.433  150.006 1.00 72.74  ?  114  ARG B CD    1 
ATOM   5847  N  NE    . ARG B 2 117  ? 76.935  95.070  150.518 1.00 72.35  ?  114  ARG B NE    1 
ATOM   5848  C  CZ    . ARG B 2 117  ? 76.907  93.980  149.758 1.00 66.92  ?  114  ARG B CZ    1 
ATOM   5849  N  NH1   . ARG B 2 117  ? 76.832  92.780  150.324 1.00 60.78  ?  114  ARG B NH1   1 
ATOM   5850  N  NH2   . ARG B 2 117  ? 76.952  94.088  148.437 1.00 67.94  ?  114  ARG B NH2   1 
ATOM   5851  N  N     . GLY B 2 118  ? 77.072  99.250  153.786 1.00 98.07  ?  115  GLY B N     1 
ATOM   5852  C  CA    . GLY B 2 118  ? 78.015  100.174 153.179 1.00 102.58 ?  115  GLY B CA    1 
ATOM   5853  C  C     . GLY B 2 118  ? 79.159  100.723 154.028 1.00 103.70 ?  115  GLY B C     1 
ATOM   5854  O  O     . GLY B 2 118  ? 80.319  100.417 153.760 1.00 99.02  ?  115  GLY B O     1 
ATOM   5855  N  N     . CYS B 2 119  ? 78.853  101.536 155.038 1.00 113.75 ?  116  CYS B N     1 
ATOM   5856  C  CA    . CYS B 2 119  ? 77.490  101.962 155.335 1.00 114.46 ?  116  CYS B CA    1 
ATOM   5857  C  C     . CYS B 2 119  ? 76.981  103.014 154.349 1.00 102.33 ?  116  CYS B C     1 
ATOM   5858  O  O     . CYS B 2 119  ? 75.775  103.185 154.195 1.00 106.10 ?  116  CYS B O     1 
ATOM   5859  C  CB    . CYS B 2 119  ? 77.410  102.504 156.764 1.00 120.61 ?  116  CYS B CB    1 
ATOM   5860  S  SG    . CYS B 2 119  ? 75.744  102.928 157.324 1.00 152.13 ?  116  CYS B SG    1 
ATOM   5861  N  N     . ASN B 2 120  ? 77.897  103.707 153.675 1.00 96.69  ?  117  ASN B N     1 
ATOM   5862  C  CA    . ASN B 2 120  ? 77.553  104.729 152.686 1.00 95.45  ?  117  ASN B CA    1 
ATOM   5863  C  C     . ASN B 2 120  ? 78.135  104.306 151.337 1.00 100.55 ?  117  ASN B C     1 
ATOM   5864  O  O     . ASN B 2 120  ? 79.216  104.750 150.954 1.00 103.49 ?  117  ASN B O     1 
ATOM   5865  C  CB    . ASN B 2 120  ? 78.083  106.122 153.144 1.00 94.74  ?  117  ASN B CB    1 
ATOM   5866  C  CG    . ASN B 2 120  ? 77.940  107.188 152.073 1.00 95.83  ?  117  ASN B CG    1 
ATOM   5867  O  OD1   . ASN B 2 120  ? 77.058  107.115 151.220 1.00 96.92  ?  117  ASN B OD1   1 
ATOM   5868  N  ND2   . ASN B 2 120  ? 78.820  108.186 152.111 1.00 109.12 ?  117  ASN B ND2   1 
ATOM   5869  N  N     . ARG B 2 121  ? 77.407  103.442 150.621 1.00 101.00 ?  118  ARG B N     1 
ATOM   5870  C  CA    . ARG B 2 121  ? 77.766  102.966 149.278 1.00 100.59 ?  118  ARG B CA    1 
ATOM   5871  C  C     . ARG B 2 121  ? 79.199  102.438 149.192 1.00 94.28  ?  118  ARG B C     1 
ATOM   5872  O  O     . ARG B 2 121  ? 79.762  102.328 148.097 1.00 86.70  ?  118  ARG B O     1 
ATOM   5873  C  CB    . ARG B 2 121  ? 77.529  104.053 148.224 1.00 100.14 ?  118  ARG B CB    1 
ATOM   5874  C  CG    . ARG B 2 121  ? 76.059  104.307 147.972 1.00 108.24 ?  118  ARG B CG    1 
ATOM   5875  C  CD    . ARG B 2 121  ? 75.376  103.005 147.587 1.00 109.82 ?  118  ARG B CD    1 
ATOM   5876  N  NE    . ARG B 2 121  ? 73.978  102.957 148.000 1.00 129.00 ?  118  ARG B NE    1 
ATOM   5877  C  CZ    . ARG B 2 121  ? 73.575  102.631 149.225 1.00 135.25 ?  118  ARG B CZ    1 
ATOM   5878  N  NH1   . ARG B 2 121  ? 72.281  102.605 149.515 1.00 152.02 ?  118  ARG B NH1   1 
ATOM   5879  N  NH2   . ARG B 2 121  ? 74.466  102.328 150.163 1.00 123.67 ?  118  ARG B NH2   1 
ATOM   5880  N  N     . LYS B 2 122  ? 79.795  102.091 150.328 1.00 95.49  ?  119  LYS B N     1 
ATOM   5881  C  CA    . LYS B 2 122  ? 81.158  101.587 150.412 1.00 88.48  ?  119  LYS B CA    1 
ATOM   5882  C  C     . LYS B 2 122  ? 81.142  100.076 150.616 1.00 88.00  ?  119  LYS B C     1 
ATOM   5883  O  O     . LYS B 2 122  ? 80.131  99.489  151.008 1.00 91.68  ?  119  LYS B O     1 
ATOM   5884  C  CB    . LYS B 2 122  ? 81.913  102.278 151.552 1.00 89.99  ?  119  LYS B CB    1 
ATOM   5885  C  CG    . LYS B 2 122  ? 83.417  102.326 151.382 1.00 86.85  ?  119  LYS B CG    1 
ATOM   5886  C  CD    . LYS B 2 122  ? 84.072  103.256 152.393 1.00 93.98  ?  119  LYS B CD    1 
ATOM   5887  C  CE    . LYS B 2 122  ? 83.527  103.030 153.788 1.00 89.99  ?  119  LYS B CE    1 
ATOM   5888  N  NZ    . LYS B 2 122  ? 83.607  101.602 154.177 1.00 80.37  ?  119  LYS B NZ    1 
ATOM   5889  N  N     . VAL B 2 123  ? 82.278  99.443  150.330 1.00 81.44  ?  120  VAL B N     1 
ATOM   5890  C  CA    . VAL B 2 123  ? 82.394  97.990  150.381 1.00 75.74  ?  120  VAL B CA    1 
ATOM   5891  C  C     . VAL B 2 123  ? 83.685  97.622  151.096 1.00 70.45  ?  120  VAL B C     1 
ATOM   5892  O  O     . VAL B 2 123  ? 84.736  98.218  150.834 1.00 64.09  ?  120  VAL B O     1 
ATOM   5893  C  CB    . VAL B 2 123  ? 82.361  97.370  148.974 1.00 75.55  ?  120  VAL B CB    1 
ATOM   5894  C  CG1   . VAL B 2 123  ? 82.557  95.869  149.053 1.00 86.09  ?  120  VAL B CG1   1 
ATOM   5895  C  CG2   . VAL B 2 123  ? 81.042  97.695  148.290 1.00 82.09  ?  120  VAL B CG2   1 
ATOM   5896  N  N     . THR B 2 124  ? 83.595  96.670  152.020 1.00 76.40  ?  121  THR B N     1 
ATOM   5897  C  CA    . THR B 2 124  ? 84.759  96.085  152.670 1.00 75.41  ?  121  THR B CA    1 
ATOM   5898  C  C     . THR B 2 124  ? 85.053  94.720  152.066 1.00 71.31  ?  121  THR B C     1 
ATOM   5899  O  O     . THR B 2 124  ? 84.136  93.967  151.732 1.00 74.47  ?  121  THR B O     1 
ATOM   5900  C  CB    . THR B 2 124  ? 84.541  95.936  154.177 1.00 86.12  ?  121  THR B CB    1 
ATOM   5901  O  OG1   . THR B 2 124  ? 83.713  94.791  154.430 1.00 91.26  ?  121  THR B OG1   1 
ATOM   5902  C  CG2   . THR B 2 124  ? 83.873  97.172  154.750 1.00 90.05  ?  121  THR B CG2   1 
ATOM   5903  N  N     . LEU B 2 125  ? 86.333  94.394  151.947 1.00 63.16  ?  122  LEU B N     1 
ATOM   5904  C  CA    . LEU B 2 125  ? 86.759  93.113  151.411 1.00 63.89  ?  122  LEU B CA    1 
ATOM   5905  C  C     . LEU B 2 125  ? 87.588  92.363  152.446 1.00 65.01  ?  122  LEU B C     1 
ATOM   5906  O  O     . LEU B 2 125  ? 87.962  92.905  153.489 1.00 61.86  ?  122  LEU B O     1 
ATOM   5907  C  CB    . LEU B 2 125  ? 87.552  93.305  150.106 1.00 55.29  ?  122  LEU B CB    1 
ATOM   5908  C  CG    . LEU B 2 125  ? 86.766  94.030  149.016 1.00 54.85  ?  122  LEU B CG    1 
ATOM   5909  C  CD1   . LEU B 2 125  ? 87.561  94.145  147.725 1.00 45.22  ?  122  LEU B CD1   1 
ATOM   5910  C  CD2   . LEU B 2 125  ? 85.457  93.308  148.767 1.00 62.46  ?  122  LEU B CD2   1 
ATOM   5911  N  N     . ARG B 2 126  ? 87.847  91.092  152.157 1.00 64.40  ?  123  ARG B N     1 
ATOM   5912  C  CA    . ARG B 2 126  ? 88.664  90.253  153.019 1.00 62.68  ?  123  ARG B CA    1 
ATOM   5913  C  C     . ARG B 2 126  ? 89.506  89.329  152.155 1.00 64.25  ?  123  ARG B C     1 
ATOM   5914  O  O     . ARG B 2 126  ? 89.005  88.748  151.186 1.00 64.19  ?  123  ARG B O     1 
ATOM   5915  C  CB    . ARG B 2 126  ? 87.792  89.455  154.005 1.00 62.10  ?  123  ARG B CB    1 
ATOM   5916  C  CG    . ARG B 2 126  ? 88.293  88.059  154.304 1.00 68.42  ?  123  ARG B CG    1 
ATOM   5917  C  CD    . ARG B 2 126  ? 87.893  87.618  155.690 1.00 75.33  ?  123  ARG B CD    1 
ATOM   5918  N  NE    . ARG B 2 126  ? 89.003  87.785  156.621 1.00 75.66  ?  123  ARG B NE    1 
ATOM   5919  C  CZ    . ARG B 2 126  ? 89.026  87.298  157.857 1.00 77.98  ?  123  ARG B CZ    1 
ATOM   5920  N  NH1   . ARG B 2 126  ? 90.089  87.500  158.627 1.00 71.01  ?  123  ARG B NH1   1 
ATOM   5921  N  NH2   . ARG B 2 126  ? 87.994  86.608  158.321 1.00 80.22  ?  123  ARG B NH2   1 
ATOM   5922  N  N     . CYS B 2 127  ? 90.789  89.214  152.503 1.00 59.92  ?  124  CYS B N     1 
ATOM   5923  C  CA    . CYS B 2 127  ? 91.748  88.393  151.771 1.00 59.03  ?  124  CYS B CA    1 
ATOM   5924  C  C     . CYS B 2 127  ? 92.582  87.590  152.756 1.00 57.58  ?  124  CYS B C     1 
ATOM   5925  O  O     . CYS B 2 127  ? 93.256  88.165  153.616 1.00 52.43  ?  124  CYS B O     1 
ATOM   5926  C  CB    . CYS B 2 127  ? 92.657  89.258  150.890 1.00 49.83  ?  124  CYS B CB    1 
ATOM   5927  S  SG    . CYS B 2 127  ? 91.776  90.223  149.653 1.00 59.16  ?  124  CYS B SG    1 
ATOM   5928  N  N     . GLU B 2 128  ? 92.544  86.265  152.616 1.00 59.55  ?  125  GLU B N     1 
ATOM   5929  C  CA    . GLU B 2 128  ? 93.175  85.355  153.561 1.00 59.53  ?  125  GLU B CA    1 
ATOM   5930  C  C     . GLU B 2 128  ? 94.106  84.413  152.819 1.00 54.22  ?  125  GLU B C     1 
ATOM   5931  O  O     . GLU B 2 128  ? 93.737  83.863  151.777 1.00 54.44  ?  125  GLU B O     1 
ATOM   5932  C  CB    . GLU B 2 128  ? 92.135  84.530  154.326 1.00 67.08  ?  125  GLU B CB    1 
ATOM   5933  C  CG    . GLU B 2 128  ? 91.010  85.335  154.933 1.00 80.07  ?  125  GLU B CG    1 
ATOM   5934  C  CD    . GLU B 2 128  ? 90.014  84.463  155.669 1.00 107.10 ?  125  GLU B CD    1 
ATOM   5935  O  OE1   . GLU B 2 128  ? 90.241  83.237  155.749 1.00 101.34 ?  125  GLU B OE1   1 
ATOM   5936  O  OE2   . GLU B 2 128  ? 88.988  84.999  156.141 1.00 178.14 -1 125  GLU B OE2   1 
ATOM   5937  N  N     . GLU B 2 129  ? 95.305  84.226  153.359 1.00 57.25  ?  126  GLU B N     1 
ATOM   5938  C  CA    . GLU B 2 129  ? 96.182  83.189  152.854 1.00 66.44  ?  126  GLU B CA    1 
ATOM   5939  C  C     . GLU B 2 129  ? 95.667  81.817  153.272 1.00 66.44  ?  126  GLU B C     1 
ATOM   5940  O  O     . GLU B 2 129  ? 94.777  81.682  154.113 1.00 65.01  ?  126  GLU B O     1 
ATOM   5941  C  CB    . GLU B 2 129  ? 97.606  83.377  153.372 1.00 80.74  ?  126  GLU B CB    1 
ATOM   5942  C  CG    . GLU B 2 129  ? 98.320  84.629  152.901 1.00 89.68  ?  126  GLU B CG    1 
ATOM   5943  C  CD    . GLU B 2 129  ? 99.825  84.543  153.131 1.00 113.74 ?  126  GLU B CD    1 
ATOM   5944  O  OE1   . GLU B 2 129  ? 100.335 83.415  153.299 1.00 107.16 ?  126  GLU B OE1   1 
ATOM   5945  O  OE2   . GLU B 2 129  ? 100.498 85.597  153.144 1.00 213.92 -1 126  GLU B OE2   1 
ATOM   5946  N  N     . LYS B 2 130  ? 96.255  80.786  152.674 1.00 62.85  ?  127  LYS B N     1 
ATOM   5947  C  CA    . LYS B 2 130  ? 96.014  79.414  153.094 1.00 64.40  ?  127  LYS B CA    1 
ATOM   5948  C  C     . LYS B 2 130  ? 97.278  78.607  152.858 1.00 70.25  ?  127  LYS B C     1 
ATOM   5949  O  O     . LYS B 2 130  ? 97.867  78.666  151.775 1.00 65.69  ?  127  LYS B O     1 
ATOM   5950  C  CB    . LYS B 2 130  ? 94.834  78.795  152.344 1.00 58.90  ?  127  LYS B CB    1 
ATOM   5951  C  CG    . LYS B 2 130  ? 93.477  79.207  152.896 1.00 61.66  ?  127  LYS B CG    1 
ATOM   5952  C  CD    . LYS B 2 130  ? 92.444  78.109  152.761 1.00 74.81  ?  127  LYS B CD    1 
ATOM   5953  C  CE    . LYS B 2 130  ? 91.105  78.552  153.322 1.00 78.87  ?  127  LYS B CE    1 
ATOM   5954  N  NZ    . LYS B 2 130  ? 91.238  79.113  154.698 1.00 72.62  ?  127  LYS B NZ    1 
ATOM   5955  N  N     . GLU B 2 131  ? 97.700  77.882  153.888 1.00 88.30  ?  128  GLU B N     1 
ATOM   5956  C  CA    . GLU B 2 131  ? 98.735  76.871  153.742 1.00 108.75 ?  128  GLU B CA    1 
ATOM   5957  C  C     . GLU B 2 131  ? 98.359  75.882  152.643 1.00 110.75 ?  128  GLU B C     1 
ATOM   5958  O  O     . GLU B 2 131  ? 97.182  75.701  152.314 1.00 107.14 ?  128  GLU B O     1 
ATOM   5959  C  CB    . GLU B 2 131  ? 98.929  76.149  155.086 1.00 147.36 ?  128  GLU B CB    1 
ATOM   5960  C  CG    . GLU B 2 131  ? 100.002 75.060  155.141 1.00 184.73 ?  128  GLU B CG    1 
ATOM   5961  C  CD    . GLU B 2 131  ? 99.496  73.696  154.688 1.00 175.10 ?  128  GLU B CD    1 
ATOM   5962  O  OE1   . GLU B 2 131  ? 98.264  73.483  154.697 1.00 153.37 ?  128  GLU B OE1   1 
ATOM   5963  O  OE2   . GLU B 2 131  ? 100.330 72.838  154.318 1.00 264.40 -1 128  GLU B OE2   1 
ATOM   5964  N  N     . LEU B 2 132  ? 99.373  75.237  152.069 1.00 115.35 ?  129  LEU B N     1 
ATOM   5965  C  CA    . LEU B 2 132  ? 99.189  74.204  151.054 1.00 115.19 ?  129  LEU B CA    1 
ATOM   5966  C  C     . LEU B 2 132  ? 99.796  72.897  151.557 1.00 125.45 ?  129  LEU B C     1 
ATOM   5967  O  O     . LEU B 2 132  ? 101.023 72.763  151.617 1.00 126.78 ?  129  LEU B O     1 
ATOM   5968  C  CB    . LEU B 2 132  ? 99.821  74.631  149.729 1.00 98.10  ?  129  LEU B CB    1 
ATOM   5969  C  CG    . LEU B 2 132  ? 99.345  75.959  149.141 1.00 80.60  ?  129  LEU B CG    1 
ATOM   5970  C  CD1   . LEU B 2 132  ? 99.947  76.181  147.762 1.00 71.14  ?  129  LEU B CD1   1 
ATOM   5971  C  CD2   . LEU B 2 132  ? 97.834  76.023  149.089 1.00 71.31  ?  129  LEU B CD2   1 
ATOM   5972  N  N     . VAL B 2 133  ? 98.945  71.938  151.925 1.00 123.69 ?  130  VAL B N     1 
ATOM   5973  C  CA    . VAL B 2 133  ? 99.396  70.594  152.282 1.00 118.90 ?  130  VAL B CA    1 
ATOM   5974  C  C     . VAL B 2 133  ? 99.634  69.811  150.998 1.00 110.23 ?  130  VAL B C     1 
ATOM   5975  O  O     . VAL B 2 133  ? 98.713  69.619  150.198 1.00 106.06 ?  130  VAL B O     1 
ATOM   5976  C  CB    . VAL B 2 133  ? 98.376  69.876  153.180 1.00 118.00 ?  130  VAL B CB    1 
ATOM   5977  C  CG1   . VAL B 2 133  ? 98.568  68.365  153.100 1.00 113.39 ?  130  VAL B CG1   1 
ATOM   5978  C  CG2   . VAL B 2 133  ? 98.508  70.329  154.621 1.00 124.98 ?  130  VAL B CG2   1 
ATOM   5979  N  N     . GLY B 2 134  ? 100.863 69.355  150.800 1.00 111.52 ?  131  GLY B N     1 
ATOM   5980  C  CA    . GLY B 2 134  ? 101.186 68.636  149.586 1.00 114.31 ?  131  GLY B CA    1 
ATOM   5981  C  C     . GLY B 2 134  ? 102.660 68.302  149.530 1.00 122.44 ?  131  GLY B C     1 
ATOM   5982  O  O     . GLY B 2 134  ? 103.345 68.380  150.552 1.00 123.67 ?  131  GLY B O     1 
ATOM   5983  N  N     . ASP B 2 135  ? 103.175 67.926  148.348 1.00 131.11 ?  132  ASP B N     1 
ATOM   5984  C  CA    . ASP B 2 135  ? 102.501 67.792  147.039 1.00 114.96 ?  132  ASP B CA    1 
ATOM   5985  C  C     . ASP B 2 135  ? 101.814 69.076  146.561 1.00 98.24  ?  132  ASP B C     1 
ATOM   5986  O  O     . ASP B 2 135  ? 100.783 69.023  145.891 1.00 91.57  ?  132  ASP B O     1 
ATOM   5987  C  CB    . ASP B 2 135  ? 101.492 66.629  147.057 1.00 121.78 ?  132  ASP B CB    1 
ATOM   5988  C  CG    . ASP B 2 135  ? 101.972 65.443  147.880 1.00 149.15 ?  132  ASP B CG    1 
ATOM   5989  O  OD1   . ASP B 2 135  ? 103.165 65.079  147.790 1.00 150.49 ?  132  ASP B OD1   1 
ATOM   5990  O  OD2   . ASP B 2 135  ? 101.145 64.866  148.619 1.00 188.79 -1 132  ASP B OD2   1 
ATOM   5991  N  N     . VAL B 2 136  ? 102.411 70.214  146.908 1.00 96.35  ?  133  VAL B N     1 
ATOM   5992  C  CA    . VAL B 2 136  ? 101.873 71.538  146.606 1.00 82.61  ?  133  VAL B CA    1 
ATOM   5993  C  C     . VAL B 2 136  ? 102.125 71.865  145.141 1.00 70.22  ?  133  VAL B C     1 
ATOM   5994  O  O     . VAL B 2 136  ? 103.019 71.271  144.520 1.00 70.22  ?  133  VAL B O     1 
ATOM   5995  C  CB    . VAL B 2 136  ? 102.486 72.613  147.522 1.00 78.05  ?  133  VAL B CB    1 
ATOM   5996  C  CG1   . VAL B 2 136  ? 102.567 72.110  148.953 1.00 105.97 ?  133  VAL B CG1   1 
ATOM   5997  C  CG2   . VAL B 2 136  ? 103.851 73.050  147.017 1.00 61.85  ?  133  VAL B CG2   1 
ATOM   5998  N  N     . PRO B 2 137  ? 101.359 72.777  144.542 1.00 65.15  ?  134  PRO B N     1 
ATOM   5999  C  CA    . PRO B 2 137  ? 101.736 73.305  143.226 1.00 53.70  ?  134  PRO B CA    1 
ATOM   6000  C  C     . PRO B 2 137  ? 102.768 74.414  143.376 1.00 44.29  ?  134  PRO B C     1 
ATOM   6001  O  O     . PRO B 2 137  ? 102.639 75.294  144.231 1.00 45.32  ?  134  PRO B O     1 
ATOM   6002  C  CB    . PRO B 2 137  ? 100.414 73.839  142.671 1.00 50.58  ?  134  PRO B CB    1 
ATOM   6003  C  CG    . PRO B 2 137  ? 99.665  74.243  143.881 1.00 56.53  ?  134  PRO B CG    1 
ATOM   6004  C  CD    . PRO B 2 137  ? 100.036 73.265  144.971 1.00 67.26  ?  134  PRO B CD    1 
ATOM   6005  N  N     . SER B 2 138  ? 103.805 74.355  142.547 1.00 46.34  ?  135  SER B N     1 
ATOM   6006  C  CA    . SER B 2 138  ? 104.810 75.404  142.536 1.00 42.83  ?  135  SER B CA    1 
ATOM   6007  C  C     . SER B 2 138  ? 104.221 76.686  141.948 1.00 36.81  ?  135  SER B C     1 
ATOM   6008  O  O     . SER B 2 138  ? 103.108 76.710  141.413 1.00 35.45  ?  135  SER B O     1 
ATOM   6009  C  CB    . SER B 2 138  ? 106.054 74.962  141.757 1.00 43.03  ?  135  SER B CB    1 
ATOM   6010  O  OG    . SER B 2 138  ? 105.752 74.624  140.414 1.00 39.56  ?  135  SER B OG    1 
ATOM   6011  N  N     . ALA B 2 139  ? 104.983 77.769  142.063 1.00 28.89  ?  136  ALA B N     1 
ATOM   6012  C  CA    . ALA B 2 139  ? 104.554 79.053  141.534 1.00 23.10  ?  136  ALA B CA    1 
ATOM   6013  C  C     . ALA B 2 139  ? 104.666 79.067  140.013 1.00 20.03  ?  136  ALA B C     1 
ATOM   6014  O  O     . ALA B 2 139  ? 105.524 78.403  139.425 1.00 20.92  ?  136  ALA B O     1 
ATOM   6015  C  CB    . ALA B 2 139  ? 105.392 80.185  142.127 1.00 21.22  ?  136  ALA B CB    1 
ATOM   6016  N  N     . ARG B 2 140  ? 103.793 79.846  139.384 1.00 18.34  ?  137  ARG B N     1 
ATOM   6017  C  CA    . ARG B 2 140  ? 103.611 79.872  137.935 1.00 21.78  ?  137  ARG B CA    1 
ATOM   6018  C  C     . ARG B 2 140  ? 102.732 81.082  137.621 1.00 21.35  ?  137  ARG B C     1 
ATOM   6019  O  O     . ARG B 2 140  ? 102.453 81.903  138.499 1.00 21.91  ?  137  ARG B O     1 
ATOM   6020  C  CB    . ARG B 2 140  ? 103.004 78.554  137.447 1.00 25.27  ?  137  ARG B CB    1 
ATOM   6021  C  CG    . ARG B 2 140  ? 101.841 78.066  138.299 1.00 28.63  ?  137  ARG B CG    1 
ATOM   6022  C  CD    . ARG B 2 140  ? 101.569 76.577  138.159 1.00 33.03  ?  137  ARG B CD    1 
ATOM   6023  N  NE    . ARG B 2 140  ? 102.695 75.775  138.641 1.00 42.23  ?  137  ARG B NE    1 
ATOM   6024  C  CZ    . ARG B 2 140  ? 102.596 74.531  139.105 1.00 46.18  ?  137  ARG B CZ    1 
ATOM   6025  N  NH1   . ARG B 2 140  ? 101.416 73.929  139.178 1.00 47.83  ?  137  ARG B NH1   1 
ATOM   6026  N  NH2   . ARG B 2 140  ? 103.686 73.895  139.522 1.00 45.42  ?  137  ARG B NH2   1 
ATOM   6027  N  N     . TYR B 2 141  ? 102.312 81.206  136.361 1.00 22.15  ?  138  TYR B N     1 
ATOM   6028  C  CA    . TYR B 2 141  ? 101.451 82.305  135.933 1.00 20.75  ?  138  TYR B CA    1 
ATOM   6029  C  C     . TYR B 2 141  ? 100.677 81.880  134.692 1.00 25.10  ?  138  TYR B C     1 
ATOM   6030  O  O     . TYR B 2 141  ? 101.011 80.895  134.042 1.00 28.04  ?  138  TYR B O     1 
ATOM   6031  C  CB    . TYR B 2 141  ? 102.259 83.581  135.666 1.00 17.35  ?  138  TYR B CB    1 
ATOM   6032  C  CG    . TYR B 2 141  ? 102.985 83.593  134.345 1.00 17.23  ?  138  TYR B CG    1 
ATOM   6033  C  CD1   . TYR B 2 141  ? 103.904 82.612  134.041 1.00 19.43  ?  138  TYR B CD1   1 
ATOM   6034  C  CD2   . TYR B 2 141  ? 102.742 84.575  133.401 1.00 18.74  ?  138  TYR B CD2   1 
ATOM   6035  C  CE1   . TYR B 2 141  ? 104.572 82.608  132.836 1.00 21.61  ?  138  TYR B CE1   1 
ATOM   6036  C  CE2   . TYR B 2 141  ? 103.407 84.582  132.193 1.00 21.54  ?  138  TYR B CE2   1 
ATOM   6037  C  CZ    . TYR B 2 141  ? 104.322 83.594  131.915 1.00 19.72  ?  138  TYR B CZ    1 
ATOM   6038  O  OH    . TYR B 2 141  ? 104.992 83.591  130.714 1.00 25.83  ?  138  TYR B OH    1 
ATOM   6039  N  N     . GLY B 2 142  ? 99.619  82.622  134.375 1.00 26.81  ?  139  GLY B N     1 
ATOM   6040  C  CA    . GLY B 2 142  ? 98.822  82.395  133.177 1.00 23.72  ?  139  GLY B CA    1 
ATOM   6041  C  C     . GLY B 2 142  ? 98.083  81.071  133.103 1.00 22.21  ?  139  GLY B C     1 
ATOM   6042  O  O     . GLY B 2 142  ? 97.439  80.759  132.098 1.00 27.47  ?  139  GLY B O     1 
ATOM   6043  N  N     . HIS B 2 143  ? 98.150  80.292  134.173 1.00 21.06  ?  140  HIS B N     1 
ATOM   6044  C  CA    . HIS B 2 143  ? 97.573  78.956  134.207 1.00 23.99  ?  140  HIS B CA    1 
ATOM   6045  C  C     . HIS B 2 143  ? 96.066  79.083  134.377 1.00 26.11  ?  140  HIS B C     1 
ATOM   6046  O  O     . HIS B 2 143  ? 95.497  80.169  134.259 1.00 28.91  ?  140  HIS B O     1 
ATOM   6047  C  CB    . HIS B 2 143  ? 98.185  78.147  135.339 1.00 28.04  ?  140  HIS B CB    1 
ATOM   6048  C  CG    . HIS B 2 143  ? 98.369  78.930  136.597 1.00 25.29  ?  140  HIS B CG    1 
ATOM   6049  N  ND1   . HIS B 2 143  ? 99.397  79.831  136.775 1.00 23.94  ?  140  HIS B ND1   1 
ATOM   6050  C  CD2   . HIS B 2 143  ? 97.652  78.944  137.743 1.00 29.42  ?  140  HIS B CD2   1 
ATOM   6051  C  CE1   . HIS B 2 143  ? 99.306  80.362  137.981 1.00 26.82  ?  140  HIS B CE1   1 
ATOM   6052  N  NE2   . HIS B 2 143  ? 98.258  79.838  138.589 1.00 31.53  ?  140  HIS B NE2   1 
ATOM   6053  N  N     . THR B 2 144  ? 95.390  77.978  134.675 1.00 32.99  ?  141  THR B N     1 
ATOM   6054  C  CA    . THR B 2 144  ? 93.947  78.024  134.850 1.00 39.17  ?  141  THR B CA    1 
ATOM   6055  C  C     . THR B 2 144  ? 93.520  77.103  135.983 1.00 42.00  ?  141  THR B C     1 
ATOM   6056  O  O     . THR B 2 144  ? 94.010  75.976  136.107 1.00 43.50  ?  141  THR B O     1 
ATOM   6057  C  CB    . THR B 2 144  ? 93.228  77.652  133.554 1.00 41.91  ?  141  THR B CB    1 
ATOM   6058  O  OG1   . THR B 2 144  ? 93.870  78.306  132.451 1.00 38.81  ?  141  THR B OG1   1 
ATOM   6059  C  CG2   . THR B 2 144  ? 91.778  78.098  133.609 1.00 44.10  ?  141  THR B CG2   1 
ATOM   6060  N  N     . LEU B 2 145  ? 92.578  77.588  136.788 1.00 36.99  ?  142  LEU B N     1 
ATOM   6061  C  CA    . LEU B 2 145  ? 92.078  76.891  137.960 1.00 36.18  ?  142  LEU B CA    1 
ATOM   6062  C  C     . LEU B 2 145  ? 90.572  77.077  138.022 1.00 35.45  ?  142  LEU B C     1 
ATOM   6063  O  O     . LEU B 2 145  ? 90.062  78.124  137.620 1.00 35.46  ?  142  LEU B O     1 
ATOM   6064  C  CB    . LEU B 2 145  ? 92.743  77.433  139.230 1.00 37.31  ?  142  LEU B CB    1 
ATOM   6065  C  CG    . LEU B 2 145  ? 92.044  77.261  140.574 1.00 52.01  ?  142  LEU B CG    1 
ATOM   6066  C  CD1   . LEU B 2 145  ? 92.049  75.821  141.064 1.00 58.95  ?  142  LEU B CD1   1 
ATOM   6067  C  CD2   . LEU B 2 145  ? 92.667  78.192  141.606 1.00 54.46  ?  142  LEU B CD2   1 
ATOM   6068  N  N     . SER B 2 146  ? 89.859  76.058  138.499 1.00 44.84  ?  143  SER B N     1 
ATOM   6069  C  CA    . SER B 2 146  ? 88.406  76.151  138.637 1.00 48.22  ?  143  SER B CA    1 
ATOM   6070  C  C     . SER B 2 146  ? 87.930  75.235  139.759 1.00 49.08  ?  143  SER B C     1 
ATOM   6071  O  O     . SER B 2 146  ? 88.723  74.562  140.419 1.00 53.11  ?  143  SER B O     1 
ATOM   6072  C  CB    . SER B 2 146  ? 87.701  75.833  137.315 1.00 50.93  ?  143  SER B CB    1 
ATOM   6073  O  OG    . SER B 2 146  ? 87.931  76.853  136.359 1.00 48.65  ?  143  SER B OG    1 
ATOM   6074  N  N     . VAL B 2 147  ? 86.613  75.218  139.965 1.00 56.75  ?  144  VAL B N     1 
ATOM   6075  C  CA    . VAL B 2 147  ? 85.980  74.592  141.120 1.00 68.64  ?  144  VAL B CA    1 
ATOM   6076  C  C     . VAL B 2 147  ? 84.819  73.725  140.638 1.00 73.57  ?  144  VAL B C     1 
ATOM   6077  O  O     . VAL B 2 147  ? 84.115  74.095  139.691 1.00 68.59  ?  144  VAL B O     1 
ATOM   6078  C  CB    . VAL B 2 147  ? 85.499  75.671  142.118 1.00 67.43  ?  144  VAL B CB    1 
ATOM   6079  C  CG1   . VAL B 2 147  ? 84.701  75.058  143.256 1.00 76.85  ?  144  VAL B CG1   1 
ATOM   6080  C  CG2   . VAL B 2 147  ? 86.677  76.481  142.650 1.00 62.19  ?  144  VAL B CG2   1 
ATOM   6081  N  N     . ILE B 2 148  ? 84.618  72.566  141.281 1.00 75.93  ?  145  ILE B N     1 
ATOM   6082  C  CA    . ILE B 2 148  ? 83.556  71.633  140.904 1.00 78.22  ?  145  ILE B CA    1 
ATOM   6083  C  C     . ILE B 2 148  ? 82.974  70.960  142.142 1.00 83.68  ?  145  ILE B C     1 
ATOM   6084  O  O     . ILE B 2 148  ? 83.583  70.944  143.216 1.00 85.49  ?  145  ILE B O     1 
ATOM   6085  C  CB    . ILE B 2 148  ? 84.038  70.558  139.897 1.00 77.78  ?  145  ILE B CB    1 
ATOM   6086  C  CG1   . ILE B 2 148  ? 85.423  70.019  140.271 1.00 76.55  ?  145  ILE B CG1   1 
ATOM   6087  C  CG2   . ILE B 2 148  ? 84.034  71.104  138.482 1.00 75.29  ?  145  ILE B CG2   1 
ATOM   6088  C  CD1   . ILE B 2 148  ? 85.411  68.870  141.265 1.00 82.11  ?  145  ILE B CD1   1 
ATOM   6089  N  N     . ASN B 2 149  ? 81.768  70.401  141.978 1.00 86.07  ?  146  ASN B N     1 
ATOM   6090  C  CA    . ASN B 2 149  ? 81.078  69.622  143.008 1.00 89.22  ?  146  ASN B CA    1 
ATOM   6091  C  C     . ASN B 2 149  ? 80.907  68.191  142.511 1.00 94.77  ?  146  ASN B C     1 
ATOM   6092  O  O     . ASN B 2 149  ? 80.112  67.941  141.600 1.00 103.26 ?  146  ASN B O     1 
ATOM   6093  C  CB    . ASN B 2 149  ? 79.713  70.222  143.360 1.00 88.74  ?  146  ASN B CB    1 
ATOM   6094  C  CG    . ASN B 2 149  ? 79.786  71.691  143.741 1.00 92.51  ?  146  ASN B CG    1 
ATOM   6095  O  OD1   . ASN B 2 149  ? 80.852  72.206  144.075 1.00 93.40  ?  146  ASN B OD1   1 
ATOM   6096  N  ND2   . ASN B 2 149  ? 78.645  72.372  143.695 1.00 89.96  ?  146  ASN B ND2   1 
ATOM   6097  N  N     . SER B 2 150  ? 81.625  67.254  143.127 1.00 99.19  ?  147  SER B N     1 
ATOM   6098  C  CA    . SER B 2 150  ? 81.555  65.834  142.789 1.00 107.38 ?  147  SER B CA    1 
ATOM   6099  C  C     . SER B 2 150  ? 80.842  65.090  143.917 1.00 109.29 ?  147  SER B C     1 
ATOM   6100  O  O     . SER B 2 150  ? 81.402  64.921  145.007 1.00 109.90 ?  147  SER B O     1 
ATOM   6101  C  CB    . SER B 2 150  ? 82.951  65.262  142.541 1.00 104.36 ?  147  SER B CB    1 
ATOM   6102  O  OG    . SER B 2 150  ? 83.714  65.233  143.731 1.00 103.02 ?  147  SER B OG    1 
ATOM   6103  N  N     . ARG B 2 151  ? 79.585  64.729  143.666 1.00 110.89 ?  148  ARG B N     1 
ATOM   6104  C  CA    . ARG B 2 151  ? 78.803  63.746  144.433 1.00 113.26 ?  148  ARG B CA    1 
ATOM   6105  C  C     . ARG B 2 151  ? 79.036  63.807  145.950 1.00 114.95 ?  148  ARG B C     1 
ATOM   6106  O  O     . ARG B 2 151  ? 79.480  62.839  146.567 1.00 117.26 ?  148  ARG B O     1 
ATOM   6107  C  CB    . ARG B 2 151  ? 79.080  62.333  143.905 1.00 116.57 ?  148  ARG B CB    1 
ATOM   6108  C  CG    . ARG B 2 151  ? 78.079  61.259  144.336 1.00 117.91 ?  148  ARG B CG    1 
ATOM   6109  C  CD    . ARG B 2 151  ? 78.763  59.900  144.550 1.00 117.38 ?  148  ARG B CD    1 
ATOM   6110  N  NE    . ARG B 2 151  ? 79.638  59.523  143.442 1.00 114.43 ?  148  ARG B NE    1 
ATOM   6111  C  CZ    . ARG B 2 151  ? 80.966  59.469  143.514 1.00 107.49 ?  148  ARG B CZ    1 
ATOM   6112  N  NH1   . ARG B 2 151  ? 81.677  59.113  142.450 1.00 99.05  ?  148  ARG B NH1   1 
ATOM   6113  N  NH2   . ARG B 2 151  ? 81.583  59.769  144.647 1.00 107.02 ?  148  ARG B NH2   1 
ATOM   6114  N  N     . GLY B 2 152  ? 78.754  64.959  146.563 1.00 113.85 ?  149  GLY B N     1 
ATOM   6115  C  CA    . GLY B 2 152  ? 78.408  66.211  145.919 1.00 109.43 ?  149  GLY B CA    1 
ATOM   6116  C  C     . GLY B 2 152  ? 79.339  67.283  146.458 1.00 110.55 ?  149  GLY B C     1 
ATOM   6117  O  O     . GLY B 2 152  ? 79.064  68.479  146.338 1.00 105.37 ?  149  GLY B O     1 
ATOM   6118  N  N     . LYS B 2 153  ? 80.456  66.846  147.043 1.00 111.20 ?  150  LYS B N     1 
ATOM   6119  C  CA    . LYS B 2 153  ? 81.339  67.727  147.796 1.00 106.45 ?  150  LYS B CA    1 
ATOM   6120  C  C     . LYS B 2 153  ? 82.293  68.474  146.863 1.00 101.52 ?  150  LYS B C     1 
ATOM   6121  O  O     . LYS B 2 153  ? 82.517  68.090  145.716 1.00 101.71 ?  150  LYS B O     1 
ATOM   6122  C  CB    . LYS B 2 153  ? 82.121  66.935  148.847 1.00 105.26 ?  150  LYS B CB    1 
ATOM   6123  C  CG    . LYS B 2 153  ? 82.791  65.677  148.316 1.00 107.34 ?  150  LYS B CG    1 
ATOM   6124  C  CD    . LYS B 2 153  ? 83.054  64.670  149.424 1.00 108.11 ?  150  LYS B CD    1 
ATOM   6125  C  CE    . LYS B 2 153  ? 83.860  63.495  148.907 1.00 110.52 ?  150  LYS B CE    1 
ATOM   6126  N  NZ    . LYS B 2 153  ? 83.290  62.980  147.630 1.00 112.81 ?  150  LYS B NZ    1 
ATOM   6127  N  N     . THR B 2 154  ? 82.875  69.549  147.381 1.00 92.01  ?  151  THR B N     1 
ATOM   6128  C  CA    . THR B 2 154  ? 83.548  70.542  146.558 1.00 86.22  ?  151  THR B CA    1 
ATOM   6129  C  C     . THR B 2 154  ? 85.042  70.262  146.458 1.00 83.51  ?  151  THR B C     1 
ATOM   6130  O  O     . THR B 2 154  ? 85.649  69.696  147.370 1.00 86.61  ?  151  THR B O     1 
ATOM   6131  C  CB    . THR B 2 154  ? 83.313  71.940  147.131 1.00 88.44  ?  151  THR B CB    1 
ATOM   6132  O  OG1   . THR B 2 154  ? 81.998  71.998  147.699 1.00 90.80  ?  151  THR B OG1   1 
ATOM   6133  C  CG2   . THR B 2 154  ? 83.412  72.986  146.038 1.00 88.10  ?  151  THR B CG2   1 
ATOM   6134  N  N     . ALA B 2 155  ? 85.624  70.654  145.322 1.00 85.36  ?  152  ALA B N     1 
ATOM   6135  C  CA    . ALA B 2 155  ? 87.062  70.537  145.105 1.00 87.98  ?  152  ALA B CA    1 
ATOM   6136  C  C     . ALA B 2 155  ? 87.490  71.567  144.060 1.00 86.03  ?  152  ALA B C     1 
ATOM   6137  O  O     . ALA B 2 155  ? 86.655  72.158  143.366 1.00 82.06  ?  152  ALA B O     1 
ATOM   6138  C  CB    . ALA B 2 155  ? 87.448  69.115  144.674 1.00 88.13  ?  152  ALA B CB    1 
ATOM   6139  N  N     . CYS B 2 156  ? 88.811  71.772  143.940 1.00 80.66  ?  153  CYS B N     1 
ATOM   6140  C  CA    . CYS B 2 156  ? 89.391  72.747  143.018 1.00 70.35  ?  153  CYS B CA    1 
ATOM   6141  C  C     . CYS B 2 156  ? 90.483  72.084  142.189 1.00 69.25  ?  153  CYS B C     1 
ATOM   6142  O  O     . CYS B 2 156  ? 91.302  71.335  142.725 1.00 69.66  ?  153  CYS B O     1 
ATOM   6143  C  CB    . CYS B 2 156  ? 89.970  73.952  143.776 1.00 70.44  ?  153  CYS B CB    1 
ATOM   6144  S  SG    . CYS B 2 156  ? 88.883  74.700  145.023 1.00 87.39  ?  153  CYS B SG    1 
ATOM   6145  N  N     . VAL B 2 157  ? 90.494  72.362  140.887 1.00 66.90  ?  154  VAL B N     1 
ATOM   6146  C  CA    . VAL B 2 157  ? 91.419  71.739  139.941 1.00 66.77  ?  154  VAL B CA    1 
ATOM   6147  C  C     . VAL B 2 157  ? 92.272  72.828  139.294 1.00 54.96  ?  154  VAL B C     1 
ATOM   6148  O  O     . VAL B 2 157  ? 91.738  73.803  138.746 1.00 52.53  ?  154  VAL B O     1 
ATOM   6149  C  CB    . VAL B 2 157  ? 90.667  70.913  138.882 1.00 76.87  ?  154  VAL B CB    1 
ATOM   6150  C  CG1   . VAL B 2 157  ? 89.483  71.692  138.305 1.00 68.56  ?  154  VAL B CG1   1 
ATOM   6151  C  CG2   . VAL B 2 157  ? 91.603  70.452  137.776 1.00 75.45  ?  154  VAL B CG2   1 
ATOM   6152  N  N     . LEU B 2 158  ? 93.596  72.666  139.363 1.00 55.14  ?  155  LEU B N     1 
ATOM   6153  C  CA    . LEU B 2 158  ? 94.550  73.603  138.779 1.00 45.87  ?  155  LEU B CA    1 
ATOM   6154  C  C     . LEU B 2 158  ? 95.357  72.895  137.700 1.00 51.64  ?  155  LEU B C     1 
ATOM   6155  O  O     . LEU B 2 158  ? 95.791  71.755  137.895 1.00 56.36  ?  155  LEU B O     1 
ATOM   6156  C  CB    . LEU B 2 158  ? 95.489  74.183  139.845 1.00 51.62  ?  155  LEU B CB    1 
ATOM   6157  C  CG    . LEU B 2 158  ? 96.695  74.973  139.332 1.00 45.57  ?  155  LEU B CG    1 
ATOM   6158  C  CD1   . LEU B 2 158  ? 96.216  76.168  138.552 1.00 40.90  ?  155  LEU B CD1   1 
ATOM   6159  C  CD2   . LEU B 2 158  ? 97.643  75.408  140.456 1.00 40.51  ?  155  LEU B CD2   1 
ATOM   6160  N  N     . PHE B 2 159  ? 95.570  73.577  136.577 1.00 43.42  ?  156  PHE B N     1 
ATOM   6161  C  CA    . PHE B 2 159  ? 96.279  72.990  135.451 1.00 44.48  ?  156  PHE B CA    1 
ATOM   6162  C  C     . PHE B 2 159  ? 96.913  74.094  134.624 1.00 39.63  ?  156  PHE B C     1 
ATOM   6163  O  O     . PHE B 2 159  ? 96.424  75.228  134.591 1.00 37.92  ?  156  PHE B O     1 
ATOM   6164  C  CB    . PHE B 2 159  ? 95.347  72.148  134.566 1.00 52.76  ?  156  PHE B CB    1 
ATOM   6165  C  CG    . PHE B 2 159  ? 95.949  71.773  133.242 1.00 55.38  ?  156  PHE B CG    1 
ATOM   6166  C  CD1   . PHE B 2 159  ? 96.804  70.695  133.136 1.00 59.44  ?  156  PHE B CD1   1 
ATOM   6167  C  CD2   . PHE B 2 159  ? 95.664  72.502  132.102 1.00 53.62  ?  156  PHE B CD2   1 
ATOM   6168  C  CE1   . PHE B 2 159  ? 97.365  70.355  131.926 1.00 65.79  ?  156  PHE B CE1   1 
ATOM   6169  C  CE2   . PHE B 2 159  ? 96.222  72.158  130.893 1.00 54.91  ?  156  PHE B CE2   1 
ATOM   6170  C  CZ    . PHE B 2 159  ? 97.071  71.087  130.809 1.00 61.40  ?  156  PHE B CZ    1 
ATOM   6171  N  N     . GLY B 2 160  ? 98.019  73.750  133.977 1.00 44.99  ?  157  GLY B N     1 
ATOM   6172  C  CA    . GLY B 2 160  ? 98.615  74.595  132.967 1.00 39.24  ?  157  GLY B CA    1 
ATOM   6173  C  C     . GLY B 2 160  ? 99.760  75.434  133.495 1.00 37.41  ?  157  GLY B C     1 
ATOM   6174  O  O     . GLY B 2 160  ? 100.395 75.136  134.510 1.00 34.42  ?  157  GLY B O     1 
ATOM   6175  N  N     . GLY B 2 161  ? 100.039 76.496  132.758 1.00 39.37  ?  158  GLY B N     1 
ATOM   6176  C  CA    . GLY B 2 161  ? 100.938 77.532  133.211 1.00 36.46  ?  158  GLY B CA    1 
ATOM   6177  C  C     . GLY B 2 161  ? 102.402 77.196  132.984 1.00 34.46  ?  158  GLY B C     1 
ATOM   6178  O  O     . GLY B 2 161  ? 102.803 76.039  132.850 1.00 38.91  ?  158  GLY B O     1 
ATOM   6179  N  N     . ARG B 2 162  ? 103.206 78.244  132.955 1.00 28.14  ?  159  ARG B N     1 
ATOM   6180  C  CA    . ARG B 2 162  ? 104.640 78.148  132.751 1.00 29.56  ?  159  ARG B CA    1 
ATOM   6181  C  C     . ARG B 2 162  ? 105.355 78.708  133.973 1.00 25.06  ?  159  ARG B C     1 
ATOM   6182  O  O     . ARG B 2 162  ? 104.732 79.113  134.953 1.00 26.46  ?  159  ARG B O     1 
ATOM   6183  C  CB    . ARG B 2 162  ? 105.047 78.883  131.474 1.00 30.71  ?  159  ARG B CB    1 
ATOM   6184  C  CG    . ARG B 2 162  ? 104.014 78.816  130.368 1.00 39.50  ?  159  ARG B CG    1 
ATOM   6185  C  CD    . ARG B 2 162  ? 104.655 79.083  129.020 1.00 46.25  ?  159  ARG B CD    1 
ATOM   6186  N  NE    . ARG B 2 162  ? 103.719 79.713  128.097 1.00 52.47  ?  159  ARG B NE    1 
ATOM   6187  C  CZ    . ARG B 2 162  ? 103.646 81.024  127.899 1.00 54.28  ?  159  ARG B CZ    1 
ATOM   6188  N  NH1   . ARG B 2 162  ? 104.452 81.836  128.572 1.00 47.56  ?  159  ARG B NH1   1 
ATOM   6189  N  NH2   . ARG B 2 162  ? 102.757 81.522  127.049 1.00 60.98  ?  159  ARG B NH2   1 
ATOM   6190  N  N     . SER B 2 163  ? 106.674 78.736  133.898 1.00 24.18  ?  160  SER B N     1 
ATOM   6191  C  CA    . SER B 2 163  ? 107.499 79.202  135.004 1.00 20.30  ?  160  SER B CA    1 
ATOM   6192  C  C     . SER B 2 163  ? 108.937 79.267  134.506 1.00 23.38  ?  160  SER B C     1 
ATOM   6193  O  O     . SER B 2 163  ? 109.246 78.873  133.374 1.00 25.89  ?  160  SER B O     1 
ATOM   6194  C  CB    . SER B 2 163  ? 107.367 78.291  136.232 1.00 19.27  ?  160  SER B CB    1 
ATOM   6195  O  OG    . SER B 2 163  ? 108.544 78.298  137.012 1.00 21.22  ?  160  SER B OG    1 
ATOM   6196  N  N     . TYR B 2 164  ? 109.820 79.757  135.370 1.00 20.26  ?  161  TYR B N     1 
ATOM   6197  C  CA    . TYR B 2 164  ? 111.229 79.854  135.025 1.00 24.69  ?  161  TYR B CA    1 
ATOM   6198  C  C     . TYR B 2 164  ? 111.887 78.475  135.095 1.00 30.30  ?  161  TYR B C     1 
ATOM   6199  O  O     . TYR B 2 164  ? 111.373 77.543  135.722 1.00 30.87  ?  161  TYR B O     1 
ATOM   6200  C  CB    . TYR B 2 164  ? 111.925 80.846  135.961 1.00 26.24  ?  161  TYR B CB    1 
ATOM   6201  C  CG    . TYR B 2 164  ? 111.319 82.232  135.904 1.00 20.03  ?  161  TYR B CG    1 
ATOM   6202  C  CD1   . TYR B 2 164  ? 110.244 82.572  136.706 1.00 17.95  ?  161  TYR B CD1   1 
ATOM   6203  C  CD2   . TYR B 2 164  ? 111.782 83.177  135.002 1.00 20.83  ?  161  TYR B CD2   1 
ATOM   6204  C  CE1   . TYR B 2 164  ? 109.675 83.822  136.643 1.00 14.99  ?  161  TYR B CE1   1 
ATOM   6205  C  CE2   . TYR B 2 164  ? 111.217 84.426  134.929 1.00 19.48  ?  161  TYR B CE2   1 
ATOM   6206  C  CZ    . TYR B 2 164  ? 110.164 84.742  135.750 1.00 17.49  ?  161  TYR B CZ    1 
ATOM   6207  O  OH    . TYR B 2 164  ? 109.589 85.984  135.682 1.00 21.69  ?  161  TYR B OH    1 
ATOM   6208  N  N     . MET B 2 165  ? 113.024 78.346  134.404 1.00 32.55  ?  162  MET B N     1 
ATOM   6209  C  CA    . MET B 2 165  ? 113.869 77.157  134.410 1.00 33.34  ?  162  MET B CA    1 
ATOM   6210  C  C     . MET B 2 165  ? 114.083 76.674  135.840 1.00 39.06  ?  162  MET B C     1 
ATOM   6211  O  O     . MET B 2 165  ? 114.126 77.494  136.766 1.00 41.11  ?  162  MET B O     1 
ATOM   6212  C  CB    . MET B 2 165  ? 115.214 77.475  133.748 1.00 34.98  ?  162  MET B CB    1 
ATOM   6213  C  CG    . MET B 2 165  ? 115.121 77.936  132.298 1.00 32.81  ?  162  MET B CG    1 
ATOM   6214  S  SD    . MET B 2 165  ? 116.745 78.319  131.591 1.00 35.38  ?  162  MET B SD    1 
ATOM   6215  C  CE    . MET B 2 165  ? 116.349 78.424  129.845 1.00 31.02  ?  162  MET B CE    1 
ATOM   6216  N  N     . PRO B 2 166  ? 114.217 75.371  136.065 1.00 48.33  ?  163  PRO B N     1 
ATOM   6217  C  CA    . PRO B 2 166  ? 114.468 74.868  137.428 1.00 55.05  ?  163  PRO B CA    1 
ATOM   6218  C  C     . PRO B 2 166  ? 115.683 75.538  138.045 1.00 55.92  ?  163  PRO B C     1 
ATOM   6219  O  O     . PRO B 2 166  ? 116.628 75.893  137.326 1.00 55.37  ?  163  PRO B O     1 
ATOM   6220  C  CB    . PRO B 2 166  ? 114.705 73.367  137.209 1.00 59.26  ?  163  PRO B CB    1 
ATOM   6221  C  CG    . PRO B 2 166  ? 113.941 73.065  135.943 1.00 54.55  ?  163  PRO B CG    1 
ATOM   6222  C  CD    . PRO B 2 166  ? 114.091 74.281  135.081 1.00 46.97  ?  163  PRO B CD    1 
ATOM   6223  N  N     . PRO B 2 167  ? 115.699 75.737  139.367 1.00 58.20  ?  164  PRO B N     1 
ATOM   6224  C  CA    . PRO B 2 167  ? 116.745 76.587  139.968 1.00 59.85  ?  164  PRO B CA    1 
ATOM   6225  C  C     . PRO B 2 167  ? 118.162 76.063  139.792 1.00 55.19  ?  164  PRO B C     1 
ATOM   6226  O  O     . PRO B 2 167  ? 119.110 76.854  139.843 1.00 51.67  ?  164  PRO B O     1 
ATOM   6227  C  CB    . PRO B 2 167  ? 116.341 76.644  141.447 1.00 60.62  ?  164  PRO B CB    1 
ATOM   6228  C  CG    . PRO B 2 167  ? 115.526 75.420  141.664 1.00 61.09  ?  164  PRO B CG    1 
ATOM   6229  C  CD    . PRO B 2 167  ? 114.773 75.204  140.380 1.00 55.43  ?  164  PRO B CD    1 
ATOM   6230  N  N     . THR B 2 168  ? 118.338 74.762  139.573 1.00 59.06  ?  165  THR B N     1 
ATOM   6231  C  CA    . THR B 2 168  ? 119.656 74.241  139.233 1.00 62.07  ?  165  THR B CA    1 
ATOM   6232  C  C     . THR B 2 168  ? 120.132 74.801  137.899 1.00 63.71  ?  165  THR B C     1 
ATOM   6233  O  O     . THR B 2 168  ? 121.323 75.076  137.723 1.00 64.56  ?  165  THR B O     1 
ATOM   6234  C  CB    . THR B 2 168  ? 119.608 72.713  139.196 1.00 66.69  ?  165  THR B CB    1 
ATOM   6235  O  OG1   . THR B 2 168  ? 118.578 72.292  138.291 1.00 64.80  ?  165  THR B OG1   1 
ATOM   6236  C  CG2   . THR B 2 168  ? 119.303 72.142  140.574 1.00 68.37  ?  165  THR B CG2   1 
ATOM   6237  N  N     . GLU B 2 169  ? 119.215 74.987  136.954 1.00 66.97  ?  166  GLU B N     1 
ATOM   6238  C  CA    . GLU B 2 169  ? 119.514 75.522  135.633 1.00 66.00  ?  166  GLU B CA    1 
ATOM   6239  C  C     . GLU B 2 169  ? 119.377 77.033  135.555 1.00 49.98  ?  166  GLU B C     1 
ATOM   6240  O  O     . GLU B 2 169  ? 119.423 77.586  134.454 1.00 47.48  ?  166  GLU B O     1 
ATOM   6241  C  CB    . GLU B 2 169  ? 118.595 74.882  134.585 1.00 73.02  ?  166  GLU B CB    1 
ATOM   6242  C  CG    . GLU B 2 169  ? 118.947 73.453  134.244 1.00 94.25  ?  166  GLU B CG    1 
ATOM   6243  C  CD    . GLU B 2 169  ? 120.232 73.354  133.448 1.00 125.90 ?  166  GLU B CD    1 
ATOM   6244  O  OE1   . GLU B 2 169  ? 120.642 74.366  132.838 1.00 110.42 ?  166  GLU B OE1   1 
ATOM   6245  O  OE2   . GLU B 2 169  ? 120.848 72.270  133.461 1.00 212.25 -1 166  GLU B OE2   1 
ATOM   6246  N  N     . ARG B 2 170  ? 119.201 77.715  136.683 1.00 47.99  ?  167  ARG B N     1 
ATOM   6247  C  CA    . ARG B 2 170  ? 118.956 79.147  136.611 1.00 40.55  ?  167  ARG B CA    1 
ATOM   6248  C  C     . ARG B 2 170  ? 120.182 79.835  136.038 1.00 32.24  ?  167  ARG B C     1 
ATOM   6249  O  O     . ARG B 2 170  ? 121.203 79.986  136.712 1.00 30.53  ?  167  ARG B O     1 
ATOM   6250  C  CB    . ARG B 2 170  ? 118.619 79.735  137.980 1.00 42.18  ?  167  ARG B CB    1 
ATOM   6251  C  CG    . ARG B 2 170  ? 118.522 81.252  137.969 1.00 30.47  ?  167  ARG B CG    1 
ATOM   6252  C  CD    . ARG B 2 170  ? 117.507 81.722  136.931 1.00 22.60  ?  167  ARG B CD    1 
ATOM   6253  N  NE    . ARG B 2 170  ? 116.139 81.629  137.431 1.00 20.26  ?  167  ARG B NE    1 
ATOM   6254  C  CZ    . ARG B 2 170  ? 115.159 82.461  137.091 1.00 16.55  ?  167  ARG B CZ    1 
ATOM   6255  N  NH1   . ARG B 2 170  ? 113.950 82.295  137.605 1.00 15.62  ?  167  ARG B NH1   1 
ATOM   6256  N  NH2   . ARG B 2 170  ? 115.372 83.433  136.217 1.00 15.92  ?  167  ARG B NH2   1 
ATOM   6257  N  N     . THR B 2 171  ? 120.076 80.246  134.789 1.00 28.52  ?  168  THR B N     1 
ATOM   6258  C  CA    . THR B 2 171  ? 121.163 80.874  134.058 1.00 28.92  ?  168  THR B CA    1 
ATOM   6259  C  C     . THR B 2 171  ? 120.834 82.350  133.890 1.00 26.17  ?  168  THR B C     1 
ATOM   6260  O  O     . THR B 2 171  ? 119.714 82.693  133.505 1.00 25.55  ?  168  THR B O     1 
ATOM   6261  C  CB    . THR B 2 171  ? 121.341 80.192  132.699 1.00 30.27  ?  168  THR B CB    1 
ATOM   6262  O  OG1   . THR B 2 171  ? 121.040 78.796  132.835 1.00 38.44  ?  168  THR B OG1   1 
ATOM   6263  C  CG2   . THR B 2 171  ? 122.768 80.323  132.207 1.00 35.34  ?  168  THR B CG2   1 
ATOM   6264  N  N     . THR B 2 172  ? 121.800 83.220  134.200 1.00 25.00  ?  169  THR B N     1 
ATOM   6265  C  CA    . THR B 2 172  ? 121.540 84.655  134.119 1.00 19.45  ?  169  THR B CA    1 
ATOM   6266  C  C     . THR B 2 172  ? 121.314 85.097  132.681 1.00 18.25  ?  169  THR B C     1 
ATOM   6267  O  O     . THR B 2 172  ? 120.441 85.930  132.415 1.00 18.66  ?  169  THR B O     1 
ATOM   6268  C  CB    . THR B 2 172  ? 122.688 85.448  134.740 1.00 16.12  ?  169  THR B CB    1 
ATOM   6269  O  OG1   . THR B 2 172  ? 123.681 85.708  133.739 1.00 15.58  ?  169  THR B OG1   1 
ATOM   6270  C  CG2   . THR B 2 172  ? 123.326 84.688  135.877 1.00 21.27  ?  169  THR B CG2   1 
ATOM   6271  N  N     . GLN B 2 173  ? 122.091 84.557  131.739 1.00 18.86  ?  170  GLN B N     1 
ATOM   6272  C  CA    . GLN B 2 173  ? 121.854 84.824  130.324 1.00 17.72  ?  170  GLN B CA    1 
ATOM   6273  C  C     . GLN B 2 173  ? 120.489 84.332  129.878 1.00 17.20  ?  170  GLN B C     1 
ATOM   6274  O  O     . GLN B 2 173  ? 119.974 84.799  128.858 1.00 16.86  ?  170  GLN B O     1 
ATOM   6275  C  CB    . GLN B 2 173  ? 122.914 84.141  129.459 1.00 22.36  ?  170  GLN B CB    1 
ATOM   6276  C  CG    . GLN B 2 173  ? 124.066 85.009  129.030 1.00 21.18  ?  170  GLN B CG    1 
ATOM   6277  C  CD    . GLN B 2 173  ? 125.142 85.081  130.075 1.00 20.46  ?  170  GLN B CD    1 
ATOM   6278  O  OE1   . GLN B 2 173  ? 125.720 86.133  130.308 1.00 20.57  ?  170  GLN B OE1   1 
ATOM   6279  N  NE2   . GLN B 2 173  ? 125.429 83.950  130.709 1.00 24.65  ?  170  GLN B NE2   1 
ATOM   6280  N  N     . ASN B 2 174  ? 119.910 83.382  130.607 1.00 21.23  ?  171  ASN B N     1 
ATOM   6281  C  CA    . ASN B 2 174  ? 118.588 82.845  130.324 1.00 26.22  ?  171  ASN B CA    1 
ATOM   6282  C  C     . ASN B 2 174  ? 117.618 83.158  131.464 1.00 28.18  ?  171  ASN B C     1 
ATOM   6283  O  O     . ASN B 2 174  ? 116.658 82.415  131.677 1.00 29.30  ?  171  ASN B O     1 
ATOM   6284  C  CB    . ASN B 2 174  ? 118.648 81.328  130.082 1.00 28.37  ?  171  ASN B CB    1 
ATOM   6285  C  CG    . ASN B 2 174  ? 119.405 80.947  128.812 1.00 25.35  ?  171  ASN B CG    1 
ATOM   6286  O  OD1   . ASN B 2 174  ? 120.468 80.324  128.870 1.00 26.95  ?  171  ASN B OD1   1 
ATOM   6287  N  ND2   . ASN B 2 174  ? 118.852 81.317  127.656 1.00 24.02  ?  171  ASN B ND2   1 
ATOM   6288  N  N     . TRP B 2 175  ? 117.847 84.261  132.199 1.00 24.35  ?  172  TRP B N     1 
ATOM   6289  C  CA    . TRP B 2 175  ? 117.070 84.525  133.415 1.00 22.87  ?  172  TRP B CA    1 
ATOM   6290  C  C     . TRP B 2 175  ? 115.587 84.682  133.119 1.00 19.96  ?  172  TRP B C     1 
ATOM   6291  O  O     . TRP B 2 175  ? 114.751 84.234  133.910 1.00 20.49  ?  172  TRP B O     1 
ATOM   6292  C  CB    . TRP B 2 175  ? 117.562 85.792  134.130 1.00 22.77  ?  172  TRP B CB    1 
ATOM   6293  C  CG    . TRP B 2 175  ? 116.726 86.149  135.359 1.00 18.50  ?  172  TRP B CG    1 
ATOM   6294  C  CD1   . TRP B 2 175  ? 115.494 86.734  135.372 1.00 17.83  ?  172  TRP B CD1   1 
ATOM   6295  C  CD2   . TRP B 2 175  ? 117.095 85.982  136.731 1.00 18.14  ?  172  TRP B CD2   1 
ATOM   6296  N  NE1   . TRP B 2 175  ? 115.058 86.905  136.658 1.00 17.87  ?  172  TRP B NE1   1 
ATOM   6297  C  CE2   . TRP B 2 175  ? 116.024 86.457  137.514 1.00 16.50  ?  172  TRP B CE2   1 
ATOM   6298  C  CE3   . TRP B 2 175  ? 118.217 85.463  137.371 1.00 19.70  ?  172  TRP B CE3   1 
ATOM   6299  C  CZ2   . TRP B 2 175  ? 116.040 86.433  138.898 1.00 21.56  ?  172  TRP B CZ2   1 
ATOM   6300  C  CZ3   . TRP B 2 175  ? 118.231 85.438  138.749 1.00 20.50  ?  172  TRP B CZ3   1 
ATOM   6301  C  CH2   . TRP B 2 175  ? 117.148 85.925  139.499 1.00 14.15  ?  172  TRP B CH2   1 
ATOM   6302  N  N     . ASN B 2 176  ? 115.243 85.310  131.999 1.00 19.68  ?  173  ASN B N     1 
ATOM   6303  C  CA    . ASN B 2 176  ? 113.866 85.664  131.683 1.00 19.92  ?  173  ASN B CA    1 
ATOM   6304  C  C     . ASN B 2 176  ? 113.199 84.666  130.754 1.00 22.02  ?  173  ASN B C     1 
ATOM   6305  O  O     . ASN B 2 176  ? 112.012 84.816  130.452 1.00 21.56  ?  173  ASN B O     1 
ATOM   6306  C  CB    . ASN B 2 176  ? 113.807 87.055  131.053 1.00 21.86  ?  173  ASN B CB    1 
ATOM   6307  C  CG    . ASN B 2 176  ? 114.443 88.113  131.925 1.00 22.71  ?  173  ASN B CG    1 
ATOM   6308  O  OD1   . ASN B 2 176  ? 115.336 87.821  132.719 1.00 19.68  ?  173  ASN B OD1   1 
ATOM   6309  N  ND2   . ASN B 2 176  ? 113.964 89.350  131.804 1.00 30.99  ?  173  ASN B ND2   1 
ATOM   6310  N  N     . SER B 2 177  ? 113.947 83.681  130.269 1.00 21.70  ?  174  SER B N     1 
ATOM   6311  C  CA    . SER B 2 177  ? 113.350 82.525  129.628 1.00 25.89  ?  174  SER B CA    1 
ATOM   6312  C  C     . SER B 2 177  ? 112.310 81.904  130.546 1.00 24.61  ?  174  SER B C     1 
ATOM   6313  O  O     . SER B 2 177  ? 112.466 81.888  131.770 1.00 23.83  ?  174  SER B O     1 
ATOM   6314  C  CB    . SER B 2 177  ? 114.435 81.497  129.286 1.00 29.07  ?  174  SER B CB    1 
ATOM   6315  O  OG    . SER B 2 177  ? 113.881 80.305  128.758 1.00 32.04  ?  174  SER B OG    1 
ATOM   6316  N  N     . VAL B 2 178  ? 111.244 81.391  129.947 1.00 25.72  ?  175  VAL B N     1 
ATOM   6317  C  CA    . VAL B 2 178  ? 110.173 80.754  130.701 1.00 25.94  ?  175  VAL B CA    1 
ATOM   6318  C  C     . VAL B 2 178  ? 109.658 79.577  129.885 1.00 32.73  ?  175  VAL B C     1 
ATOM   6319  O  O     . VAL B 2 178  ? 109.336 79.721  128.702 1.00 29.86  ?  175  VAL B O     1 
ATOM   6320  C  CB    . VAL B 2 178  ? 109.059 81.763  131.037 1.00 22.94  ?  175  VAL B CB    1 
ATOM   6321  C  CG1   . VAL B 2 178  ? 108.689 82.580  129.820 1.00 21.83  ?  175  VAL B CG1   1 
ATOM   6322  C  CG2   . VAL B 2 178  ? 107.847 81.054  131.588 1.00 28.39  ?  175  VAL B CG2   1 
ATOM   6323  N  N     . VAL B 2 179  ? 109.629 78.402  130.510 1.00 36.98  ?  176  VAL B N     1 
ATOM   6324  C  CA    . VAL B 2 179  ? 109.191 77.174  129.863 1.00 36.39  ?  176  VAL B CA    1 
ATOM   6325  C  C     . VAL B 2 179  ? 107.989 76.624  130.619 1.00 34.97  ?  176  VAL B C     1 
ATOM   6326  O  O     . VAL B 2 179  ? 107.683 77.034  131.742 1.00 32.83  ?  176  VAL B O     1 
ATOM   6327  C  CB    . VAL B 2 179  ? 110.318 76.118  129.761 1.00 33.86  ?  176  VAL B CB    1 
ATOM   6328  C  CG1   . VAL B 2 179  ? 111.557 76.701  129.086 1.00 25.27  ?  176  VAL B CG1   1 
ATOM   6329  C  CG2   . VAL B 2 179  ? 110.655 75.535  131.122 1.00 36.78  ?  176  VAL B CG2   1 
ATOM   6330  N  N     . ASP B 2 180  ? 107.301 75.688  129.972 1.00 43.51  ?  177  ASP B N     1 
ATOM   6331  C  CA    . ASP B 2 180  ? 106.049 75.157  130.490 1.00 49.69  ?  177  ASP B CA    1 
ATOM   6332  C  C     . ASP B 2 180  ? 106.264 74.360  131.771 1.00 45.80  ?  177  ASP B C     1 
ATOM   6333  O  O     . ASP B 2 180  ? 107.259 73.646  131.926 1.00 45.20  ?  177  ASP B O     1 
ATOM   6334  C  CB    . ASP B 2 180  ? 105.384 74.281  129.427 1.00 67.83  ?  177  ASP B CB    1 
ATOM   6335  C  CG    . ASP B 2 180  ? 105.569 74.832  128.016 1.00 86.58  ?  177  ASP B CG    1 
ATOM   6336  O  OD1   . ASP B 2 180  ? 105.438 76.064  127.841 1.00 71.58  ?  177  ASP B OD1   1 
ATOM   6337  O  OD2   . ASP B 2 180  ? 105.871 74.050  127.089 1.00 147.07 -1 177  ASP B OD2   1 
ATOM   6338  N  N     . CYS B 2 181  ? 105.325 74.495  132.696 1.00 42.74  ?  178  CYS B N     1 
ATOM   6339  C  CA    . CYS B 2 181  ? 105.354 73.666  133.882 1.00 48.50  ?  178  CYS B CA    1 
ATOM   6340  C  C     . CYS B 2 181  ? 104.993 72.234  133.486 1.00 55.04  ?  178  CYS B C     1 
ATOM   6341  O  O     . CYS B 2 181  ? 104.218 72.023  132.551 1.00 54.60  ?  178  CYS B O     1 
ATOM   6342  C  CB    . CYS B 2 181  ? 104.377 74.206  134.927 1.00 43.51  ?  178  CYS B CB    1 
ATOM   6343  S  SG    . CYS B 2 181  ? 104.714 73.731  136.625 1.00 54.31  ?  178  CYS B SG    1 
ATOM   6344  N  N     . PRO B 2 182  ? 105.563 71.236  134.154 1.00 58.97  ?  179  PRO B N     1 
ATOM   6345  C  CA    . PRO B 2 182  ? 105.242 69.838  133.828 1.00 66.58  ?  179  PRO B CA    1 
ATOM   6346  C  C     . PRO B 2 182  ? 103.747 69.578  133.874 1.00 68.36  ?  179  PRO B C     1 
ATOM   6347  O  O     . PRO B 2 182  ? 103.072 69.948  134.848 1.00 63.04  ?  179  PRO B O     1 
ATOM   6348  C  CB    . PRO B 2 182  ? 105.986 69.054  134.917 1.00 70.91  ?  179  PRO B CB    1 
ATOM   6349  C  CG    . PRO B 2 182  ? 107.164 69.907  135.212 1.00 64.28  ?  179  PRO B CG    1 
ATOM   6350  C  CD    . PRO B 2 182  ? 106.691 71.330  135.098 1.00 60.19  ?  179  PRO B CD    1 
ATOM   6351  N  N     . PRO B 2 183  ? 103.187 68.931  132.833 1.00 74.25  ?  180  PRO B N     1 
ATOM   6352  C  CA    . PRO B 2 183  ? 101.731 68.716  132.789 1.00 74.72  ?  180  PRO B CA    1 
ATOM   6353  C  C     . PRO B 2 183  ? 101.218 67.718  133.815 1.00 74.14  ?  180  PRO B C     1 
ATOM   6354  O  O     . PRO B 2 183  ? 100.807 66.605  133.471 1.00 75.89  ?  180  PRO B O     1 
ATOM   6355  C  CB    . PRO B 2 183  ? 101.487 68.203  131.362 1.00 77.51  ?  180  PRO B CB    1 
ATOM   6356  C  CG    . PRO B 2 183  ? 102.709 68.571  130.601 1.00 75.46  ?  180  PRO B CG    1 
ATOM   6357  C  CD    . PRO B 2 183  ? 103.836 68.533  131.573 1.00 74.53  ?  180  PRO B CD    1 
ATOM   6358  N  N     . GLN B 2 184  ? 101.232 68.121  135.081 1.00 69.94  ?  181  GLN B N     1 
ATOM   6359  C  CA    . GLN B 2 184  ? 100.504 67.442  136.143 1.00 69.91  ?  181  GLN B CA    1 
ATOM   6360  C  C     . GLN B 2 184  ? 99.475  68.402  136.719 1.00 66.02  ?  181  GLN B C     1 
ATOM   6361  O  O     . GLN B 2 184  ? 99.817  69.522  137.112 1.00 66.53  ?  181  GLN B O     1 
ATOM   6362  C  CB    . GLN B 2 184  ? 101.441 66.936  137.255 1.00 69.74  ?  181  GLN B CB    1 
ATOM   6363  C  CG    . GLN B 2 184  ? 102.236 65.689  136.892 1.00 76.18  ?  181  GLN B CG    1 
ATOM   6364  C  CD    . GLN B 2 184  ? 103.361 65.974  135.932 1.00 83.48  ?  181  GLN B CD    1 
ATOM   6365  O  OE1   . GLN B 2 184  ? 103.688 67.132  135.682 1.00 80.26  ?  181  GLN B OE1   1 
ATOM   6366  N  NE2   . GLN B 2 184  ? 103.935 64.926  135.358 1.00 102.28 ?  181  GLN B NE2   1 
ATOM   6367  N  N     . VAL B 2 185  ? 98.215  67.967  136.759 1.00 66.10  ?  182  VAL B N     1 
ATOM   6368  C  CA    . VAL B 2 185  ? 97.168  68.773  137.373 1.00 62.52  ?  182  VAL B CA    1 
ATOM   6369  C  C     . VAL B 2 185  ? 97.238  68.618  138.888 1.00 71.40  ?  182  VAL B C     1 
ATOM   6370  O  O     . VAL B 2 185  ? 97.921  67.741  139.416 1.00 72.95  ?  182  VAL B O     1 
ATOM   6371  C  CB    . VAL B 2 185  ? 95.778  68.389  136.836 1.00 61.01  ?  182  VAL B CB    1 
ATOM   6372  C  CG1   . VAL B 2 185  ? 95.777  68.377  135.323 1.00 59.11  ?  182  VAL B CG1   1 
ATOM   6373  C  CG2   . VAL B 2 185  ? 95.344  67.046  137.388 1.00 71.04  ?  182  VAL B CG2   1 
ATOM   6374  N  N     . TYR B 2 186  ? 96.533  69.495  139.596 1.00 71.18  ?  183  TYR B N     1 
ATOM   6375  C  CA    . TYR B 2 186  ? 96.536  69.446  141.052 1.00 72.22  ?  183  TYR B CA    1 
ATOM   6376  C  C     . TYR B 2 186  ? 95.123  69.626  141.583 1.00 66.99  ?  183  TYR B C     1 
ATOM   6377  O  O     . TYR B 2 186  ? 94.386  70.506  141.131 1.00 62.34  ?  183  TYR B O     1 
ATOM   6378  C  CB    . TYR B 2 186  ? 97.475  70.510  141.651 1.00 77.87  ?  183  TYR B CB    1 
ATOM   6379  C  CG    . TYR B 2 186  ? 98.957  70.288  141.362 1.00 80.64  ?  183  TYR B CG    1 
ATOM   6380  C  CD1   . TYR B 2 186  ? 99.509  70.644  140.137 1.00 78.18  ?  183  TYR B CD1   1 
ATOM   6381  C  CD2   . TYR B 2 186  ? 99.798  69.715  142.313 1.00 80.16  ?  183  TYR B CD2   1 
ATOM   6382  C  CE1   . TYR B 2 186  ? 100.856 70.444  139.868 1.00 72.82  ?  183  TYR B CE1   1 
ATOM   6383  C  CE2   . TYR B 2 186  ? 101.148 69.514  142.050 1.00 78.12  ?  183  TYR B CE2   1 
ATOM   6384  C  CZ    . TYR B 2 186  ? 101.667 69.878  140.824 1.00 73.86  ?  183  TYR B CZ    1 
ATOM   6385  O  OH    . TYR B 2 186  ? 103.000 69.684  140.547 1.00 71.59  ?  183  TYR B OH    1 
ATOM   6386  N  N     . LEU B 2 187  ? 94.749  68.777  142.532 1.00 75.16  ?  184  LEU B N     1 
ATOM   6387  C  CA    . LEU B 2 187  ? 93.462  68.873  143.202 1.00 77.90  ?  184  LEU B CA    1 
ATOM   6388  C  C     . LEU B 2 187  ? 93.682  69.462  144.590 1.00 80.35  ?  184  LEU B C     1 
ATOM   6389  O  O     . LEU B 2 187  ? 94.545  68.991  145.341 1.00 85.47  ?  184  LEU B O     1 
ATOM   6390  C  CB    . LEU B 2 187  ? 92.784  67.502  143.282 1.00 93.49  ?  184  LEU B CB    1 
ATOM   6391  C  CG    . LEU B 2 187  ? 92.660  66.754  141.945 1.00 99.55  ?  184  LEU B CG    1 
ATOM   6392  C  CD1   . LEU B 2 187  ? 91.857  65.460  142.075 1.00 96.28  ?  184  LEU B CD1   1 
ATOM   6393  C  CD2   . LEU B 2 187  ? 92.063  67.649  140.864 1.00 92.82  ?  184  LEU B CD2   1 
ATOM   6394  N  N     . ILE B 2 188  ? 92.912  70.499  144.914 1.00 79.92  ?  185  ILE B N     1 
ATOM   6395  C  CA    . ILE B 2 188  ? 93.075  71.289  146.127 1.00 87.47  ?  185  ILE B CA    1 
ATOM   6396  C  C     . ILE B 2 188  ? 91.717  71.412  146.806 1.00 94.61  ?  185  ILE B C     1 
ATOM   6397  O  O     . ILE B 2 188  ? 90.699  71.626  146.137 1.00 91.29  ?  185  ILE B O     1 
ATOM   6398  C  CB    . ILE B 2 188  ? 93.650  72.686  145.817 1.00 79.49  ?  185  ILE B CB    1 
ATOM   6399  C  CG1   . ILE B 2 188  ? 95.034  72.566  145.183 1.00 77.01  ?  185  ILE B CG1   1 
ATOM   6400  C  CG2   . ILE B 2 188  ? 93.714  73.530  147.074 1.00 78.59  ?  185  ILE B CG2   1 
ATOM   6401  C  CD1   . ILE B 2 188  ? 95.706  73.890  144.908 1.00 66.08  ?  185  ILE B CD1   1 
ATOM   6402  N  N     . ASP B 2 189  ? 91.697  71.260  148.126 1.00 107.07 ?  186  ASP B N     1 
ATOM   6403  C  CA    . ASP B 2 189  ? 90.519  71.552  148.928 1.00 121.46 ?  186  ASP B CA    1 
ATOM   6404  C  C     . ASP B 2 189  ? 90.768  72.818  149.736 1.00 116.41 ?  186  ASP B C     1 
ATOM   6405  O  O     . ASP B 2 189  ? 91.896  73.083  150.166 1.00 112.57 ?  186  ASP B O     1 
ATOM   6406  C  CB    . ASP B 2 189  ? 90.163  70.379  149.851 1.00 143.58 ?  186  ASP B CB    1 
ATOM   6407  C  CG    . ASP B 2 189  ? 88.754  70.490  150.439 1.00 166.60 ?  186  ASP B CG    1 
ATOM   6408  O  OD1   . ASP B 2 189  ? 88.390  71.579  150.934 1.00 145.89 ?  186  ASP B OD1   1 
ATOM   6409  O  OD2   . ASP B 2 189  ? 88.003  69.488  150.392 1.00 226.90 -1 186  ASP B OD2   1 
ATOM   6410  N  N     . LEU B 2 190  ? 89.708  73.609  149.915 1.00 113.72 ?  187  LEU B N     1 
ATOM   6411  C  CA    . LEU B 2 190  ? 89.800  74.806  150.742 1.00 106.94 ?  187  LEU B CA    1 
ATOM   6412  C  C     . LEU B 2 190  ? 90.145  74.465  152.185 1.00 113.02 ?  187  LEU B C     1 
ATOM   6413  O  O     . LEU B 2 190  ? 90.879  75.210  152.841 1.00 111.54 ?  187  LEU B O     1 
ATOM   6414  C  CB    . LEU B 2 190  ? 88.480  75.573  150.672 1.00 101.27 ?  187  LEU B CB    1 
ATOM   6415  C  CG    . LEU B 2 190  ? 87.255  74.724  151.027 1.00 106.68 ?  187  LEU B CG    1 
ATOM   6416  C  CD1   . LEU B 2 190  ? 86.763  74.978  152.450 1.00 105.54 ?  187  LEU B CD1   1 
ATOM   6417  C  CD2   . LEU B 2 190  ? 86.134  74.907  150.017 1.00 103.38 ?  187  LEU B CD2   1 
ATOM   6418  N  N     . GLU B 2 191  ? 89.631  73.348  152.695 1.00 122.20 ?  188  GLU B N     1 
ATOM   6419  C  CA    . GLU B 2 191  ? 89.918  72.937  154.068 1.00 128.91 ?  188  GLU B CA    1 
ATOM   6420  C  C     . GLU B 2 191  ? 89.675  71.439  154.190 1.00 135.14 ?  188  GLU B C     1 
ATOM   6421  O  O     . GLU B 2 191  ? 88.525  70.997  154.106 1.00 133.88 ?  188  GLU B O     1 
ATOM   6422  C  CB    . GLU B 2 191  ? 89.062  73.710  155.060 1.00 130.23 ?  188  GLU B CB    1 
ATOM   6423  C  CG    . GLU B 2 191  ? 89.712  73.817  156.421 1.00 146.50 ?  188  GLU B CG    1 
ATOM   6424  C  CD    . GLU B 2 191  ? 91.139  74.310  156.335 1.00 158.02 ?  188  GLU B CD    1 
ATOM   6425  O  OE1   . GLU B 2 191  ? 91.381  75.295  155.605 1.00 136.83 ?  188  GLU B OE1   1 
ATOM   6426  O  OE2   . GLU B 2 191  ? 92.023  73.698  156.968 1.00 256.41 -1 188  GLU B OE2   1 
ATOM   6427  N  N     . PHE B 2 192  ? 90.739  70.669  154.415 1.00 135.49 ?  189  PHE B N     1 
ATOM   6428  C  CA    . PHE B 2 192  ? 92.080  71.206  154.638 1.00 130.90 ?  189  PHE B CA    1 
ATOM   6429  C  C     . PHE B 2 192  ? 92.798  71.438  153.314 1.00 122.58 ?  189  PHE B C     1 
ATOM   6430  O  O     . PHE B 2 192  ? 92.381  70.929  152.274 1.00 121.58 ?  189  PHE B O     1 
ATOM   6431  C  CB    . PHE B 2 192  ? 92.889  70.256  155.526 1.00 131.79 ?  189  PHE B CB    1 
ATOM   6432  C  CG    . PHE B 2 192  ? 92.099  69.671  156.668 1.00 137.62 ?  189  PHE B CG    1 
ATOM   6433  C  CD1   . PHE B 2 192  ? 91.872  70.403  157.821 1.00 146.26 ?  189  PHE B CD1   1 
ATOM   6434  C  CD2   . PHE B 2 192  ? 91.582  68.390  156.585 1.00 133.63 ?  189  PHE B CD2   1 
ATOM   6435  C  CE1   . PHE B 2 192  ? 91.147  69.864  158.870 1.00 154.08 ?  189  PHE B CE1   1 
ATOM   6436  C  CE2   . PHE B 2 192  ? 90.857  67.850  157.630 1.00 133.37 ?  189  PHE B CE2   1 
ATOM   6437  C  CZ    . PHE B 2 192  ? 90.640  68.588  158.772 1.00 137.68 ?  189  PHE B CZ    1 
ATOM   6438  N  N     . GLY B 2 193  ? 93.879  72.211  153.351 1.00 115.23 ?  190  GLY B N     1 
ATOM   6439  C  CA    . GLY B 2 193  ? 94.575  72.560  152.129 1.00 107.46 ?  190  GLY B CA    1 
ATOM   6440  C  C     . GLY B 2 193  ? 95.407  71.434  151.546 1.00 111.79 ?  190  GLY B C     1 
ATOM   6441  O  O     . GLY B 2 193  ? 96.562  71.645  151.166 1.00 113.69 ?  190  GLY B O     1 
ATOM   6442  N  N     . CYS B 2 194  ? 94.827  70.238  151.455 1.00 109.06 ?  191  CYS B N     1 
ATOM   6443  C  CA    . CYS B 2 194  ? 95.527  69.087  150.894 1.00 102.26 ?  191  CYS B CA    1 
ATOM   6444  C  C     . CYS B 2 194  ? 95.610  69.227  149.380 1.00 96.93  ?  191  CYS B C     1 
ATOM   6445  O  O     . CYS B 2 194  ? 94.590  69.173  148.684 1.00 93.56  ?  191  CYS B O     1 
ATOM   6446  C  CB    . CYS B 2 194  ? 94.821  67.791  151.284 1.00 100.68 ?  191  CYS B CB    1 
ATOM   6447  S  SG    . CYS B 2 194  ? 94.670  67.507  153.063 1.00 105.86 ?  191  CYS B SG    1 
ATOM   6448  N  N     . CYS B 2 195  ? 96.824  69.412  148.869 1.00 98.25  ?  192  CYS B N     1 
ATOM   6449  C  CA    . CYS B 2 195  ? 97.078  69.469  147.436 1.00 95.35  ?  192  CYS B CA    1 
ATOM   6450  C  C     . CYS B 2 195  ? 97.641  68.128  146.988 1.00 96.98  ?  192  CYS B C     1 
ATOM   6451  O  O     . CYS B 2 195  ? 98.645  67.661  147.536 1.00 99.63  ?  192  CYS B O     1 
ATOM   6452  C  CB    . CYS B 2 195  ? 98.052  70.597  147.093 1.00 94.17  ?  192  CYS B CB    1 
ATOM   6453  S  SG    . CYS B 2 195  ? 97.578  72.238  147.693 1.00 105.80 ?  192  CYS B SG    1 
ATOM   6454  N  N     . THR B 2 196  ? 96.989  67.509  146.006 1.00 96.28  ?  193  THR B N     1 
ATOM   6455  C  CA    . THR B 2 196  ? 97.438  66.243  145.441 1.00 91.82  ?  193  THR B CA    1 
ATOM   6456  C  C     . THR B 2 196  ? 97.754  66.433  143.965 1.00 83.07  ?  193  THR B C     1 
ATOM   6457  O  O     . THR B 2 196  ? 96.914  66.926  143.202 1.00 80.24  ?  193  THR B O     1 
ATOM   6458  C  CB    . THR B 2 196  ? 96.388  65.138  145.629 1.00 89.57  ?  193  THR B CB    1 
ATOM   6459  O  OG1   . THR B 2 196  ? 95.224  65.439  144.848 1.00 91.88  ?  193  THR B OG1   1 
ATOM   6460  C  CG2   . THR B 2 196  ? 95.992  65.003  147.098 1.00 89.38  ?  193  THR B CG2   1 
ATOM   6461  N  N     . ALA B 2 197  ? 98.969  66.062  143.574 1.00 81.62  ?  194  ALA B N     1 
ATOM   6462  C  CA    . ALA B 2 197  ? 99.355  66.086  142.174 1.00 77.30  ?  194  ALA B CA    1 
ATOM   6463  C  C     . ALA B 2 197  ? 98.823  64.845  141.475 1.00 82.29  ?  194  ALA B C     1 
ATOM   6464  O  O     . ALA B 2 197  ? 98.796  63.755  142.052 1.00 86.38  ?  194  ALA B O     1 
ATOM   6465  C  CB    . ALA B 2 197  ? 100.876 66.143  142.035 1.00 77.92  ?  194  ALA B CB    1 
ATOM   6466  N  N     . HIS B 2 198  ? 98.383  65.017  140.234 1.00 80.04  ?  195  HIS B N     1 
ATOM   6467  C  CA    . HIS B 2 198  ? 97.986  63.913  139.376 1.00 80.36  ?  195  HIS B CA    1 
ATOM   6468  C  C     . HIS B 2 198  ? 98.608  64.108  138.005 1.00 77.24  ?  195  HIS B C     1 
ATOM   6469  O  O     . HIS B 2 198  ? 98.821  65.239  137.559 1.00 78.51  ?  195  HIS B O     1 
ATOM   6470  C  CB    . HIS B 2 198  ? 96.460  63.804  139.232 1.00 83.84  ?  195  HIS B CB    1 
ATOM   6471  C  CG    . HIS B 2 198  ? 95.726  63.702  140.533 1.00 92.11  ?  195  HIS B CG    1 
ATOM   6472  N  ND1   . HIS B 2 198  ? 94.978  62.596  140.876 1.00 98.57  ?  195  HIS B ND1   1 
ATOM   6473  C  CD2   . HIS B 2 198  ? 95.609  64.572  141.565 1.00 91.12  ?  195  HIS B CD2   1 
ATOM   6474  C  CE1   . HIS B 2 198  ? 94.440  62.784  142.067 1.00 97.05  ?  195  HIS B CE1   1 
ATOM   6475  N  NE2   . HIS B 2 198  ? 94.809  63.974  142.508 1.00 95.10  ?  195  HIS B NE2   1 
ATOM   6476  N  N     . THR B 2 199  ? 98.892  62.999  137.336 1.00 78.66  ?  196  THR B N     1 
ATOM   6477  C  CA    . THR B 2 199  ? 99.390  63.029  135.973 1.00 87.82  ?  196  THR B CA    1 
ATOM   6478  C  C     . THR B 2 199  ? 98.388  62.326  135.067 1.00 98.20  ?  196  THR B C     1 
ATOM   6479  O  O     . THR B 2 199  ? 97.550  61.543  135.521 1.00 95.54  ?  196  THR B O     1 
ATOM   6480  C  CB    . THR B 2 199  ? 100.772 62.371  135.865 1.00 86.60  ?  196  THR B CB    1 
ATOM   6481  O  OG1   . THR B 2 199  ? 101.090 62.132  134.488 1.00 91.04  ?  196  THR B OG1   1 
ATOM   6482  C  CG2   . THR B 2 199  ? 100.801 61.061  136.626 1.00 85.86  ?  196  THR B CG2   1 
ATOM   6483  N  N     . LEU B 2 200  ? 98.474  62.622  133.771 1.00 105.64 ?  197  LEU B N     1 
ATOM   6484  C  CA    . LEU B 2 200  ? 97.547  62.079  132.790 1.00 114.05 ?  197  LEU B CA    1 
ATOM   6485  C  C     . LEU B 2 200  ? 98.340  61.481  131.635 1.00 123.75 ?  197  LEU B C     1 
ATOM   6486  O  O     . LEU B 2 200  ? 99.165  62.179  131.019 1.00 120.88 ?  197  LEU B O     1 
ATOM   6487  C  CB    . LEU B 2 200  ? 96.580  63.162  132.288 1.00 111.88 ?  197  LEU B CB    1 
ATOM   6488  C  CG    . LEU B 2 200  ? 95.511  63.557  133.309 1.00 106.32 ?  197  LEU B CG    1 
ATOM   6489  C  CD1   . LEU B 2 200  ? 94.446  64.457  132.701 1.00 105.33 ?  197  LEU B CD1   1 
ATOM   6490  C  CD2   . LEU B 2 200  ? 94.878  62.310  133.900 1.00 101.34 ?  197  LEU B CD2   1 
ATOM   6491  N  N     . PRO B 2 201  ? 98.120  60.207  131.307 1.00 130.53 ?  198  PRO B N     1 
ATOM   6492  C  CA    . PRO B 2 201  ? 98.895  59.567  130.233 1.00 140.51 ?  198  PRO B CA    1 
ATOM   6493  C  C     . PRO B 2 201  ? 98.575  60.098  128.840 1.00 142.37 ?  198  PRO B C     1 
ATOM   6494  O  O     . PRO B 2 201  ? 99.026  59.533  127.837 1.00 141.27 ?  198  PRO B O     1 
ATOM   6495  C  CB    . PRO B 2 201  ? 98.522  58.081  130.370 1.00 142.47 ?  198  PRO B CB    1 
ATOM   6496  C  CG    . PRO B 2 201  ? 97.965  57.948  131.767 1.00 131.20 ?  198  PRO B CG    1 
ATOM   6497  C  CD    . PRO B 2 201  ? 97.277  59.244  132.034 1.00 127.34 ?  198  PRO B CD    1 
ATOM   6498  N  N     . GLU B 2 202  ? 97.805  61.183  128.765 1.00 135.15 ?  199  GLU B N     1 
ATOM   6499  C  CA    . GLU B 2 202  ? 97.451  61.828  127.507 1.00 130.91 ?  199  GLU B CA    1 
ATOM   6500  C  C     . GLU B 2 202  ? 98.052  63.214  127.352 1.00 122.01 ?  199  GLU B C     1 
ATOM   6501  O  O     . GLU B 2 202  ? 98.411  63.602  126.238 1.00 119.26 ?  199  GLU B O     1 
ATOM   6502  C  CB    . GLU B 2 202  ? 95.926  61.956  127.378 1.00 131.76 ?  199  GLU B CB    1 
ATOM   6503  C  CG    . GLU B 2 202  ? 95.093  60.895  128.097 1.00 150.62 ?  199  GLU B CG    1 
ATOM   6504  C  CD    . GLU B 2 202  ? 95.605  59.484  127.899 1.00 181.88 ?  199  GLU B CD    1 
ATOM   6505  O  OE1   . GLU B 2 202  ? 95.837  59.086  126.738 1.00 175.42 ?  199  GLU B OE1   1 
ATOM   6506  O  OE2   . GLU B 2 202  ? 95.799  58.786  128.918 1.00 300.18 -1 199  GLU B OE2   1 
ATOM   6507  N  N     . LEU B 2 203  ? 98.160  63.966  128.448 1.00 117.56 ?  200  LEU B N     1 
ATOM   6508  C  CA    . LEU B 2 203  ? 98.593  65.361  128.419 1.00 110.15 ?  200  LEU B CA    1 
ATOM   6509  C  C     . LEU B 2 203  ? 100.118 65.437  128.383 1.00 111.14 ?  200  LEU B C     1 
ATOM   6510  O  O     . LEU B 2 203  ? 100.772 66.014  129.251 1.00 104.48 ?  200  LEU B O     1 
ATOM   6511  C  CB    . LEU B 2 203  ? 98.039  66.100  129.629 1.00 106.82 ?  200  LEU B CB    1 
ATOM   6512  C  CG    . LEU B 2 203  ? 96.637  66.701  129.516 1.00 113.84 ?  200  LEU B CG    1 
ATOM   6513  C  CD1   . LEU B 2 203  ? 95.625  65.715  128.946 1.00 116.63 ?  200  LEU B CD1   1 
ATOM   6514  C  CD2   . LEU B 2 203  ? 96.181  67.195  130.879 1.00 130.15 ?  200  LEU B CD2   1 
ATOM   6515  N  N     . THR B 2 204  ? 100.682 64.844  127.338 1.00 119.70 ?  201  THR B N     1 
ATOM   6516  C  CA    . THR B 2 204  ? 102.126 64.713  127.210 1.00 128.61 ?  201  THR B CA    1 
ATOM   6517  C  C     . THR B 2 204  ? 102.816 66.025  126.834 1.00 126.00 ?  201  THR B C     1 
ATOM   6518  O  O     . THR B 2 204  ? 103.986 65.997  126.441 1.00 127.77 ?  201  THR B O     1 
ATOM   6519  C  CB    . THR B 2 204  ? 102.462 63.607  126.195 1.00 126.77 ?  201  THR B CB    1 
ATOM   6520  O  OG1   . THR B 2 204  ? 103.885 63.434  126.118 1.00 124.49 ?  201  THR B OG1   1 
ATOM   6521  C  CG2   . THR B 2 204  ? 101.909 63.939  124.819 1.00 127.62 ?  201  THR B CG2   1 
ATOM   6522  N  N     . ASP B 2 205  ? 102.135 67.161  126.957 1.00 117.48 ?  202  ASP B N     1 
ATOM   6523  C  CA    . ASP B 2 205  ? 102.768 68.444  126.700 1.00 116.20 ?  202  ASP B CA    1 
ATOM   6524  C  C     . ASP B 2 205  ? 102.095 69.499  127.565 1.00 102.49 ?  202  ASP B C     1 
ATOM   6525  O  O     . ASP B 2 205  ? 100.931 69.358  127.946 1.00 96.12  ?  202  ASP B O     1 
ATOM   6526  C  CB    . ASP B 2 205  ? 102.686 68.812  125.210 1.00 126.00 ?  202  ASP B CB    1 
ATOM   6527  C  CG    . ASP B 2 205  ? 103.586 69.984  124.831 1.00 128.15 ?  202  ASP B CG    1 
ATOM   6528  O  OD1   . ASP B 2 205  ? 103.704 70.958  125.603 1.00 110.56 ?  202  ASP B OD1   1 
ATOM   6529  O  OD2   . ASP B 2 205  ? 104.200 69.919  123.745 1.00 178.52 -1 202  ASP B OD2   1 
ATOM   6530  N  N     . GLY B 2 206  ? 102.857 70.532  127.920 1.00 95.78  ?  203  GLY B N     1 
ATOM   6531  C  CA    . GLY B 2 206  ? 102.318 71.646  128.673 1.00 82.39  ?  203  GLY B CA    1 
ATOM   6532  C  C     . GLY B 2 206  ? 101.667 72.665  127.758 1.00 82.56  ?  203  GLY B C     1 
ATOM   6533  O  O     . GLY B 2 206  ? 101.635 72.517  126.540 1.00 86.39  ?  203  GLY B O     1 
ATOM   6534  N  N     . GLN B 2 207  ? 101.141 73.722  128.367 1.00 73.90  ?  204  GLN B N     1 
ATOM   6535  C  CA    . GLN B 2 207  ? 100.347 74.720  127.658 1.00 66.16  ?  204  GLN B CA    1 
ATOM   6536  C  C     . GLN B 2 207  ? 100.078 75.885  128.608 1.00 53.13  ?  204  GLN B C     1 
ATOM   6537  O  O     . GLN B 2 207  ? 100.293 75.784  129.818 1.00 48.30  ?  204  GLN B O     1 
ATOM   6538  C  CB    . GLN B 2 207  ? 99.041  74.104  127.100 1.00 70.81  ?  204  GLN B CB    1 
ATOM   6539  C  CG    . GLN B 2 207  ? 98.321  73.147  128.014 1.00 70.16  ?  204  GLN B CG    1 
ATOM   6540  C  CD    . GLN B 2 207  ? 97.434  72.178  127.262 1.00 72.06  ?  204  GLN B CD    1 
ATOM   6541  O  OE1   . GLN B 2 207  ? 96.958  71.216  127.857 1.00 70.28  ?  204  GLN B OE1   1 
ATOM   6542  N  NE2   . GLN B 2 207  ? 97.239  72.390  125.957 1.00 74.36  ?  204  GLN B NE2   1 
ATOM   6543  N  N     . SER B 2 208  ? 99.646  77.014  128.041 1.00 50.53  ?  205  SER B N     1 
ATOM   6544  C  CA    . SER B 2 208  ? 99.433  78.234  128.818 1.00 51.02  ?  205  SER B CA    1 
ATOM   6545  C  C     . SER B 2 208  ? 98.280  79.043  128.227 1.00 48.95  ?  205  SER B C     1 
ATOM   6546  O  O     . SER B 2 208  ? 97.839  78.804  127.099 1.00 49.84  ?  205  SER B O     1 
ATOM   6547  C  CB    . SER B 2 208  ? 100.712 79.076  128.885 1.00 46.39  ?  205  SER B CB    1 
ATOM   6548  O  OG    . SER B 2 208  ? 101.200 79.353  127.592 1.00 50.81  ?  205  SER B OG    1 
ATOM   6549  N  N     . PHE B 2 209  ? 97.771  79.977  129.035 1.00 42.49  ?  206  PHE B N     1 
ATOM   6550  C  CA    . PHE B 2 209  ? 96.769  80.977  128.673 1.00 36.06  ?  206  PHE B CA    1 
ATOM   6551  C  C     . PHE B 2 209  ? 95.429  80.380  128.254 1.00 39.16  ?  206  PHE B C     1 
ATOM   6552  O  O     . PHE B 2 209  ? 94.553  81.113  127.794 1.00 39.28  ?  206  PHE B O     1 
ATOM   6553  C  CB    . PHE B 2 209  ? 97.275  81.903  127.557 1.00 38.43  ?  206  PHE B CB    1 
ATOM   6554  C  CG    . PHE B 2 209  ? 98.293  82.916  128.008 1.00 41.61  ?  206  PHE B CG    1 
ATOM   6555  C  CD1   . PHE B 2 209  ? 99.120  82.668  129.079 1.00 39.70  ?  206  PHE B CD1   1 
ATOM   6556  C  CD2   . PHE B 2 209  ? 98.397  84.138  127.361 1.00 45.41  ?  206  PHE B CD2   1 
ATOM   6557  C  CE1   . PHE B 2 209  ? 100.045 83.594  129.483 1.00 37.16  ?  206  PHE B CE1   1 
ATOM   6558  C  CE2   . PHE B 2 209  ? 99.320  85.069  127.778 1.00 51.51  ?  206  PHE B CE2   1 
ATOM   6559  C  CZ    . PHE B 2 209  ? 100.140 84.796  128.834 1.00 47.66  ?  206  PHE B CZ    1 
ATOM   6560  N  N     . HIS B 2 210  ? 95.239  79.080  128.421 1.00 41.76  ?  207  HIS B N     1 
ATOM   6561  C  CA    . HIS B 2 210  ? 94.047  78.409  127.941 1.00 43.83  ?  207  HIS B CA    1 
ATOM   6562  C  C     . HIS B 2 210  ? 92.894  78.624  128.911 1.00 40.76  ?  207  HIS B C     1 
ATOM   6563  O  O     . HIS B 2 210  ? 93.014  78.317  130.100 1.00 42.36  ?  207  HIS B O     1 
ATOM   6564  C  CB    . HIS B 2 210  ? 94.341  76.925  127.754 1.00 53.31  ?  207  HIS B CB    1 
ATOM   6565  C  CG    . HIS B 2 210  ? 95.340  76.366  128.717 1.00 53.53  ?  207  HIS B CG    1 
ATOM   6566  N  ND1   . HIS B 2 210  ? 94.982  75.825  129.935 1.00 55.87  ?  207  HIS B ND1   1 
ATOM   6567  C  CD2   . HIS B 2 210  ? 96.687  76.254  128.633 1.00 53.79  ?  207  HIS B CD2   1 
ATOM   6568  C  CE1   . HIS B 2 210  ? 96.069  75.413  130.563 1.00 53.79  ?  207  HIS B CE1   1 
ATOM   6569  N  NE2   . HIS B 2 210  ? 97.115  75.659  129.793 1.00 53.92  ?  207  HIS B NE2   1 
ATOM   6570  N  N     . VAL B 2 211  ? 91.779  79.139  128.400 1.00 44.50  ?  208  VAL B N     1 
ATOM   6571  C  CA    . VAL B 2 211  ? 90.601  79.375  129.225 1.00 44.50  ?  208  VAL B CA    1 
ATOM   6572  C  C     . VAL B 2 211  ? 89.858  78.055  129.389 1.00 45.36  ?  208  VAL B C     1 
ATOM   6573  O  O     . VAL B 2 211  ? 89.538  77.383  128.402 1.00 47.74  ?  208  VAL B O     1 
ATOM   6574  C  CB    . VAL B 2 211  ? 89.700  80.449  128.605 1.00 41.98  ?  208  VAL B CB    1 
ATOM   6575  C  CG1   . VAL B 2 211  ? 88.380  80.543  129.358 1.00 44.61  ?  208  VAL B CG1   1 
ATOM   6576  C  CG2   . VAL B 2 211  ? 90.409  81.790  128.594 1.00 44.63  ?  208  VAL B CG2   1 
ATOM   6577  N  N     . ALA B 2 212  ? 89.606  77.672  130.635 1.00 49.10  ?  209  ALA B N     1 
ATOM   6578  C  CA    . ALA B 2 212  ? 88.888  76.451  130.961 1.00 54.82  ?  209  ALA B CA    1 
ATOM   6579  C  C     . ALA B 2 212  ? 87.538  76.794  131.571 1.00 57.09  ?  209  ALA B C     1 
ATOM   6580  O  O     . ALA B 2 212  ? 87.261  77.941  131.928 1.00 53.98  ?  209  ALA B O     1 
ATOM   6581  C  CB    . ALA B 2 212  ? 89.693  75.576  131.927 1.00 58.70  ?  209  ALA B CB    1 
ATOM   6582  N  N     . LEU B 2 213  ? 86.697  75.773  131.700 1.00 65.65  ?  210  LEU B N     1 
ATOM   6583  C  CA    . LEU B 2 213  ? 85.339  75.936  132.189 1.00 70.28  ?  210  LEU B CA    1 
ATOM   6584  C  C     . LEU B 2 213  ? 84.956  74.711  133.006 1.00 73.62  ?  210  LEU B C     1 
ATOM   6585  O  O     . LEU B 2 213  ? 85.339  73.588  132.670 1.00 75.19  ?  210  LEU B O     1 
ATOM   6586  C  CB    . LEU B 2 213  ? 84.361  76.124  131.028 1.00 78.69  ?  210  LEU B CB    1 
ATOM   6587  C  CG    . LEU B 2 213  ? 84.642  77.309  130.101 1.00 82.86  ?  210  LEU B CG    1 
ATOM   6588  C  CD1   . LEU B 2 213  ? 83.865  77.183  128.802 1.00 145.59 ?  210  LEU B CD1   1 
ATOM   6589  C  CD2   . LEU B 2 213  ? 84.331  78.626  130.797 1.00 80.27  ?  210  LEU B CD2   1 
ATOM   6590  N  N     . ALA B 2 214  ? 84.209  74.932  134.083 1.00 76.23  ?  211  ALA B N     1 
ATOM   6591  C  CA    . ALA B 2 214  ? 83.737  73.862  134.950 1.00 84.04  ?  211  ALA B CA    1 
ATOM   6592  C  C     . ALA B 2 214  ? 82.216  73.844  134.955 1.00 88.43  ?  211  ALA B C     1 
ATOM   6593  O  O     . ALA B 2 214  ? 81.578  74.902  134.946 1.00 85.17  ?  211  ALA B O     1 
ATOM   6594  C  CB    . ALA B 2 214  ? 84.259  74.037  136.380 1.00 78.35  ?  211  ALA B CB    1 
ATOM   6595  N  N     . ARG B 2 215  ? 81.638  72.642  134.971 1.00 94.04  ?  212  ARG B N     1 
ATOM   6596  C  CA    . ARG B 2 215  ? 80.191  72.495  135.109 1.00 94.88  ?  212  ARG B CA    1 
ATOM   6597  C  C     . ARG B 2 215  ? 79.911  71.085  135.595 1.00 103.34 ?  212  ARG B C     1 
ATOM   6598  O  O     . ARG B 2 215  ? 80.333  70.120  134.948 1.00 108.68 ?  212  ARG B O     1 
ATOM   6599  C  CB    . ARG B 2 215  ? 79.469  72.760  133.786 1.00 91.06  ?  212  ARG B CB    1 
ATOM   6600  C  CG    . ARG B 2 215  ? 78.047  72.237  133.776 1.00 91.03  ?  212  ARG B CG    1 
ATOM   6601  C  CD    . ARG B 2 215  ? 77.899  70.982  132.945 1.00 99.94  ?  212  ARG B CD    1 
ATOM   6602  N  NE    . ARG B 2 215  ? 76.643  70.300  133.240 1.00 105.97 ?  212  ARG B NE    1 
ATOM   6603  C  CZ    . ARG B 2 215  ? 75.523  70.462  132.545 1.00 109.24 ?  212  ARG B CZ    1 
ATOM   6604  N  NH1   . ARG B 2 215  ? 75.496  71.295  131.514 1.00 107.78 ?  212  ARG B NH1   1 
ATOM   6605  N  NH2   . ARG B 2 215  ? 74.428  69.798  132.885 1.00 109.41 ?  212  ARG B NH2   1 
ATOM   6606  N  N     . GLN B 2 216  ? 79.217  70.964  136.724 1.00 107.85 ?  213  GLN B N     1 
ATOM   6607  C  CA    . GLN B 2 216  ? 78.727  69.682  137.230 1.00 119.14 ?  213  GLN B CA    1 
ATOM   6608  C  C     . GLN B 2 216  ? 79.837  68.628  137.236 1.00 126.96 ?  213  GLN B C     1 
ATOM   6609  O  O     . GLN B 2 216  ? 79.764  67.607  136.555 1.00 134.53 ?  213  GLN B O     1 
ATOM   6610  C  CB    . GLN B 2 216  ? 77.524  69.213  136.404 1.00 120.28 ?  213  GLN B CB    1 
ATOM   6611  C  CG    . GLN B 2 216  ? 76.635  68.188  137.084 1.00 129.28 ?  213  GLN B CG    1 
ATOM   6612  C  CD    . GLN B 2 216  ? 75.941  68.734  138.312 1.00 140.33 ?  213  GLN B CD    1 
ATOM   6613  O  OE1   . GLN B 2 216  ? 75.608  69.917  138.376 1.00 137.99 ?  213  GLN B OE1   1 
ATOM   6614  N  NE2   . GLN B 2 216  ? 75.728  67.874  139.302 1.00 141.06 ?  213  GLN B NE2   1 
ATOM   6615  N  N     . ASP B 2 217  ? 80.891  68.915  138.004 1.00 117.51 ?  214  ASP B N     1 
ATOM   6616  C  CA    . ASP B 2 217  ? 82.065  68.040  138.183 1.00 120.35 ?  214  ASP B CA    1 
ATOM   6617  C  C     . ASP B 2 217  ? 82.602  67.479  136.862 1.00 120.02 ?  214  ASP B C     1 
ATOM   6618  O  O     . ASP B 2 217  ? 83.229  66.417  136.835 1.00 118.82 ?  214  ASP B O     1 
ATOM   6619  C  CB    . ASP B 2 217  ? 81.791  66.906  139.189 1.00 130.95 ?  214  ASP B CB    1 
ATOM   6620  C  CG    . ASP B 2 217  ? 80.621  66.012  138.794 1.00 151.69 ?  214  ASP B CG    1 
ATOM   6621  O  OD1   . ASP B 2 217  ? 80.797  65.152  137.902 1.00 145.97 ?  214  ASP B OD1   1 
ATOM   6622  O  OD2   . ASP B 2 217  ? 79.529  66.162  139.390 1.00 200.48 -1 214  ASP B OD2   1 
ATOM   6623  N  N     . CYS B 2 218  ? 82.395  68.204  135.762 1.00 115.27 ?  215  CYS B N     1 
ATOM   6624  C  CA    . CYS B 2 218  ? 83.032  67.903  134.484 1.00 109.04 ?  215  CYS B CA    1 
ATOM   6625  C  C     . CYS B 2 218  ? 83.685  69.180  133.971 1.00 99.78  ?  215  CYS B C     1 
ATOM   6626  O  O     . CYS B 2 218  ? 83.045  70.239  133.940 1.00 98.73  ?  215  CYS B O     1 
ATOM   6627  C  CB    . CYS B 2 218  ? 82.025  67.356  133.454 1.00 109.08 ?  215  CYS B CB    1 
ATOM   6628  S  SG    . CYS B 2 218  ? 81.229  65.758  133.847 1.00 110.20 ?  215  CYS B SG    1 
ATOM   6629  N  N     . VAL B 2 219  ? 84.956  69.090  133.582 1.00 94.31  ?  216  VAL B N     1 
ATOM   6630  C  CA    . VAL B 2 219  ? 85.764  70.270  133.295 1.00 91.74  ?  216  VAL B CA    1 
ATOM   6631  C  C     . VAL B 2 219  ? 86.258  70.195  131.852 1.00 88.81  ?  216  VAL B C     1 
ATOM   6632  O  O     . VAL B 2 219  ? 86.788  69.163  131.421 1.00 87.77  ?  216  VAL B O     1 
ATOM   6633  C  CB    . VAL B 2 219  ? 86.935  70.402  134.288 1.00 88.81  ?  216  VAL B CB    1 
ATOM   6634  C  CG1   . VAL B 2 219  ? 87.456  71.826  134.311 1.00 80.59  ?  216  VAL B CG1   1 
ATOM   6635  C  CG2   . VAL B 2 219  ? 86.501  69.977  135.690 1.00 88.84  ?  216  VAL B CG2   1 
ATOM   6636  N  N     . TYR B 2 220  ? 86.075  71.291  131.108 1.00 81.02  ?  217  TYR B N     1 
ATOM   6637  C  CA    . TYR B 2 220  ? 86.416  71.368  129.689 1.00 78.09  ?  217  TYR B CA    1 
ATOM   6638  C  C     . TYR B 2 220  ? 87.429  72.491  129.485 1.00 68.35  ?  217  TYR B C     1 
ATOM   6639  O  O     . TYR B 2 220  ? 87.127  73.665  129.739 1.00 65.83  ?  217  TYR B O     1 
ATOM   6640  C  CB    . TYR B 2 220  ? 85.156  71.565  128.838 1.00 79.54  ?  217  TYR B CB    1 
ATOM   6641  C  CG    . TYR B 2 220  ? 84.222  70.361  128.871 1.00 83.98  ?  217  TYR B CG    1 
ATOM   6642  C  CD1   . TYR B 2 220  ? 83.412  70.112  129.971 1.00 86.72  ?  217  TYR B CD1   1 
ATOM   6643  C  CD2   . TYR B 2 220  ? 84.181  69.456  127.816 1.00 81.59  ?  217  TYR B CD2   1 
ATOM   6644  C  CE1   . TYR B 2 220  ? 82.578  69.005  130.015 1.00 86.73  ?  217  TYR B CE1   1 
ATOM   6645  C  CE2   . TYR B 2 220  ? 83.348  68.345  127.850 1.00 84.35  ?  217  TYR B CE2   1 
ATOM   6646  C  CZ    . TYR B 2 220  ? 82.549  68.126  128.955 1.00 85.57  ?  217  TYR B CZ    1 
ATOM   6647  O  OH    . TYR B 2 220  ? 81.717  67.030  129.006 1.00 84.23  ?  217  TYR B OH    1 
ATOM   6648  N  N     . PHE B 2 221  ? 88.640  72.121  129.064 1.00 66.96  ?  218  PHE B N     1 
ATOM   6649  C  CA    . PHE B 2 221  ? 89.706  73.079  128.802 1.00 60.64  ?  218  PHE B CA    1 
ATOM   6650  C  C     . PHE B 2 221  ? 89.759  73.386  127.311 1.00 61.32  ?  218  PHE B C     1 
ATOM   6651  O  O     . PHE B 2 221  ? 89.832  72.469  126.482 1.00 67.15  ?  218  PHE B O     1 
ATOM   6652  C  CB    . PHE B 2 221  ? 91.059  72.530  129.264 1.00 60.97  ?  218  PHE B CB    1 
ATOM   6653  C  CG    . PHE B 2 221  ? 91.270  72.586  130.756 1.00 69.12  ?  218  PHE B CG    1 
ATOM   6654  C  CD1   . PHE B 2 221  ? 90.407  71.933  131.618 1.00 75.10  ?  218  PHE B CD1   1 
ATOM   6655  C  CD2   . PHE B 2 221  ? 92.331  73.290  131.296 1.00 63.63  ?  218  PHE B CD2   1 
ATOM   6656  C  CE1   . PHE B 2 221  ? 90.603  71.984  132.990 1.00 73.09  ?  218  PHE B CE1   1 
ATOM   6657  C  CE2   . PHE B 2 221  ? 92.524  73.343  132.671 1.00 60.73  ?  218  PHE B CE2   1 
ATOM   6658  C  CZ    . PHE B 2 221  ? 91.661  72.687  133.513 1.00 65.44  ?  218  PHE B CZ    1 
ATOM   6659  N  N     . LEU B 2 222  ? 89.705  74.667  126.973 1.00 53.51  ?  219  LEU B N     1 
ATOM   6660  C  CA    . LEU B 2 222  ? 89.914  75.067  125.594 1.00 52.96  ?  219  LEU B CA    1 
ATOM   6661  C  C     . LEU B 2 222  ? 91.407  75.143  125.292 1.00 55.92  ?  219  LEU B C     1 
ATOM   6662  O  O     . LEU B 2 222  ? 92.241  75.240  126.190 1.00 54.19  ?  219  LEU B O     1 
ATOM   6663  C  CB    . LEU B 2 222  ? 89.248  76.415  125.322 1.00 49.04  ?  219  LEU B CB    1 
ATOM   6664  C  CG    . LEU B 2 222  ? 89.166  76.895  123.875 1.00 51.91  ?  219  LEU B CG    1 
ATOM   6665  C  CD1   . LEU B 2 222  ? 88.791  75.765  122.941 1.00 57.50  ?  219  LEU B CD1   1 
ATOM   6666  C  CD2   . LEU B 2 222  ? 88.159  78.011  123.777 1.00 50.58  ?  219  LEU B CD2   1 
ATOM   6667  N  N     . GLY B 2 223  ? 91.740  75.077  124.009 1.00 62.25  ?  220  GLY B N     1 
ATOM   6668  C  CA    . GLY B 2 223  ? 93.125  75.188  123.606 1.00 68.50  ?  220  GLY B CA    1 
ATOM   6669  C  C     . GLY B 2 223  ? 93.655  76.602  123.718 1.00 64.98  ?  220  GLY B C     1 
ATOM   6670  O  O     . GLY B 2 223  ? 92.906  77.573  123.798 1.00 59.34  ?  220  GLY B O     1 
ATOM   6671  N  N     . GLY B 2 224  ? 94.978  76.706  123.715 1.00 63.24  ?  221  GLY B N     1 
ATOM   6672  C  CA    . GLY B 2 224  ? 95.665  77.973  123.896 1.00 55.03  ?  221  GLY B CA    1 
ATOM   6673  C  C     . GLY B 2 224  ? 97.036  77.963  123.257 1.00 53.14  ?  221  GLY B C     1 
ATOM   6674  O  O     . GLY B 2 224  ? 97.230  77.405  122.174 1.00 59.50  ?  221  GLY B O     1 
ATOM   6675  N  N     . HIS B 2 225  ? 97.989  78.607  123.920 1.00 53.09  ?  222  HIS B N     1 
ATOM   6676  C  CA    . HIS B 2 225  ? 99.353  78.711  123.421 1.00 57.13  ?  222  HIS B CA    1 
ATOM   6677  C  C     . HIS B 2 225  ? 100.233 77.633  124.032 1.00 57.55  ?  222  HIS B C     1 
ATOM   6678  O  O     . HIS B 2 225  ? 100.145 77.345  125.227 1.00 54.90  ?  222  HIS B O     1 
ATOM   6679  C  CB    . HIS B 2 225  ? 99.917  80.096  123.739 1.00 63.03  ?  222  HIS B CB    1 
ATOM   6680  C  CG    . HIS B 2 225  ? 101.247 80.378  123.109 1.00 66.97  ?  222  HIS B CG    1 
ATOM   6681  N  ND1   . HIS B 2 225  ? 101.367 81.018  121.895 1.00 75.26  ?  222  HIS B ND1   1 
ATOM   6682  C  CD2   . HIS B 2 225  ? 102.510 80.132  123.536 1.00 66.22  ?  222  HIS B CD2   1 
ATOM   6683  C  CE1   . HIS B 2 225  ? 102.648 81.145  121.599 1.00 78.07  ?  222  HIS B CE1   1 
ATOM   6684  N  NE2   . HIS B 2 225  ? 103.362 80.617  122.577 1.00 72.11  ?  222  HIS B NE2   1 
ATOM   6685  N  N     . ILE B 2 226  ? 101.085 77.043  123.200 1.00 65.76  ?  223  ILE B N     1 
ATOM   6686  C  CA    . ILE B 2 226  ? 102.069 76.055  123.626 1.00 68.41  ?  223  ILE B CA    1 
ATOM   6687  C  C     . ILE B 2 226  ? 103.416 76.459  123.048 1.00 72.98  ?  223  ILE B C     1 
ATOM   6688  O  O     . ILE B 2 226  ? 103.493 76.918  121.904 1.00 76.63  ?  223  ILE B O     1 
ATOM   6689  C  CB    . ILE B 2 226  ? 101.688 74.629  123.176 1.00 70.95  ?  223  ILE B CB    1 
ATOM   6690  C  CG1   . ILE B 2 226  ? 100.351 74.220  123.790 1.00 71.40  ?  223  ILE B CG1   1 
ATOM   6691  C  CG2   . ILE B 2 226  ? 102.771 73.636  123.558 1.00 75.54  ?  223  ILE B CG2   1 
ATOM   6692  C  CD1   . ILE B 2 226  ? 100.012 72.749  123.633 1.00 75.09  ?  223  ILE B CD1   1 
ATOM   6693  N  N     . LEU B 2 227  ? 104.479 76.298  123.836 1.00 74.78  ?  224  LEU B N     1 
ATOM   6694  C  CA    . LEU B 2 227  ? 105.808 76.719  123.417 1.00 76.91  ?  224  LEU B CA    1 
ATOM   6695  C  C     . LEU B 2 227  ? 106.735 75.557  123.075 1.00 77.49  ?  224  LEU B C     1 
ATOM   6696  O  O     . LEU B 2 227  ? 107.842 75.797  122.587 1.00 78.88  ?  224  LEU B O     1 
ATOM   6697  C  CB    . LEU B 2 227  ? 106.455 77.591  124.504 1.00 70.77  ?  224  LEU B CB    1 
ATOM   6698  C  CG    . LEU B 2 227  ? 107.586 78.515  124.045 1.00 67.15  ?  224  LEU B CG    1 
ATOM   6699  C  CD1   . LEU B 2 227  ? 107.173 79.261  122.789 1.00 65.04  ?  224  LEU B CD1   1 
ATOM   6700  C  CD2   . LEU B 2 227  ? 107.971 79.489  125.144 1.00 60.04  ?  224  LEU B CD2   1 
ATOM   6701  N  N     . SER B 2 228  ? 106.327 74.312  123.321 1.00 82.07  ?  225  SER B N     1 
ATOM   6702  C  CA    . SER B 2 228  ? 107.137 73.166  122.918 1.00 87.90  ?  225  SER B CA    1 
ATOM   6703  C  C     . SER B 2 228  ? 107.288 73.121  121.402 1.00 91.82  ?  225  SER B C     1 
ATOM   6704  O  O     . SER B 2 228  ? 108.395 73.283  120.879 1.00 93.62  ?  225  SER B O     1 
ATOM   6705  C  CB    . SER B 2 228  ? 106.526 71.855  123.422 1.00 90.63  ?  225  SER B CB    1 
ATOM   6706  O  OG    . SER B 2 228  ? 107.318 70.741  123.044 1.00 88.60  ?  225  SER B OG    1 
ATOM   6707  N  N     . SER B 2 229  ? 106.180 72.904  120.692 1.00 93.53  ?  226  SER B N     1 
ATOM   6708  C  CA    . SER B 2 229  ? 106.151 72.941  119.236 1.00 92.33  ?  226  SER B CA    1 
ATOM   6709  C  C     . SER B 2 229  ? 105.681 74.291  118.705 1.00 95.67  ?  226  SER B C     1 
ATOM   6710  O  O     . SER B 2 229  ? 105.384 74.407  117.511 1.00 95.56  ?  226  SER B O     1 
ATOM   6711  C  CB    . SER B 2 229  ? 105.269 71.809  118.694 1.00 87.87  ?  226  SER B CB    1 
ATOM   6712  O  OG    . SER B 2 229  ? 103.943 71.897  119.179 1.00 90.00  ?  226  SER B OG    1 
ATOM   6713  N  N     . ASP B 2 230  ? 105.604 75.306  119.571 1.00 95.28  ?  227  ASP B N     1 
ATOM   6714  C  CA    . ASP B 2 230  ? 105.281 76.678  119.178 1.00 94.08  ?  227  ASP B CA    1 
ATOM   6715  C  C     . ASP B 2 230  ? 103.897 76.784  118.550 1.00 89.07  ?  227  ASP B C     1 
ATOM   6716  O  O     . ASP B 2 230  ? 103.644 77.673  117.734 1.00 87.30  ?  227  ASP B O     1 
ATOM   6717  C  CB    . ASP B 2 230  ? 106.339 77.239  118.222 1.00 110.39 ?  227  ASP B CB    1 
ATOM   6718  C  CG    . ASP B 2 230  ? 107.758 76.968  118.691 1.00 128.91 ?  227  ASP B CG    1 
ATOM   6719  O  OD1   . ASP B 2 230  ? 107.942 76.551  119.851 1.00 108.49 ?  227  ASP B OD1   1 
ATOM   6720  O  OD2   . ASP B 2 230  ? 108.695 77.158  117.881 1.00 246.44 -1 227  ASP B OD2   1 
ATOM   6721  N  N     . CYS B 2 231  ? 102.991 75.902  118.947 1.00 85.86  ?  228  CYS B N     1 
ATOM   6722  C  CA    . CYS B 2 231  ? 101.739 75.681  118.239 1.00 85.50  ?  228  CYS B CA    1 
ATOM   6723  C  C     . CYS B 2 231  ? 100.547 76.095  119.098 1.00 71.86  ?  228  CYS B C     1 
ATOM   6724  O  O     . CYS B 2 231  ? 100.681 76.523  120.248 1.00 68.26  ?  228  CYS B O     1 
ATOM   6725  C  CB    . CYS B 2 231  ? 101.609 74.212  117.811 1.00 92.73  ?  228  CYS B CB    1 
ATOM   6726  S  SG    . CYS B 2 231  ? 101.499 73.012  119.169 1.00 97.25  ?  228  CYS B SG    1 
ATOM   6727  N  N     . ARG B 2 232  ? 99.365  75.962  118.501 1.00 73.90  ?  229  ARG B N     1 
ATOM   6728  C  CA    . ARG B 2 232  ? 98.092  76.287  119.136 1.00 70.81  ?  229  ARG B CA    1 
ATOM   6729  C  C     . ARG B 2 232  ? 97.103  75.182  118.796 1.00 69.10  ?  229  ARG B C     1 
ATOM   6730  O  O     . ARG B 2 232  ? 96.263  75.335  117.898 1.00 66.01  ?  229  ARG B O     1 
ATOM   6731  C  CB    . ARG B 2 232  ? 97.570  77.636  118.657 1.00 70.34  ?  229  ARG B CB    1 
ATOM   6732  C  CG    . ARG B 2 232  ? 98.629  78.690  118.567 1.00 72.28  ?  229  ARG B CG    1 
ATOM   6733  C  CD    . ARG B 2 232  ? 98.077  79.896  117.884 1.00 76.70  ?  229  ARG B CD    1 
ATOM   6734  N  NE    . ARG B 2 232  ? 98.579  81.107  118.504 1.00 79.78  ?  229  ARG B NE    1 
ATOM   6735  C  CZ    . ARG B 2 232  ? 99.641  81.768  118.071 1.00 86.90  ?  229  ARG B CZ    1 
ATOM   6736  N  NH1   . ARG B 2 232  ? 100.315 81.328  117.011 1.00 88.29  ?  229  ARG B NH1   1 
ATOM   6737  N  NH2   . ARG B 2 232  ? 100.035 82.864  118.700 1.00 91.81  ?  229  ARG B NH2   1 
ATOM   6738  N  N     . PRO B 2 233  ? 97.175  74.054  119.484 1.00 69.93  ?  230  PRO B N     1 
ATOM   6739  C  CA    . PRO B 2 233  ? 96.206  72.984  119.227 1.00 71.47  ?  230  PRO B CA    1 
ATOM   6740  C  C     . PRO B 2 233  ? 94.795  73.408  119.592 1.00 69.33  ?  230  PRO B C     1 
ATOM   6741  O  O     . PRO B 2 233  ? 94.489  73.649  120.763 1.00 69.31  ?  230  PRO B O     1 
ATOM   6742  C  CB    . PRO B 2 233  ? 96.703  71.842  120.119 1.00 77.60  ?  230  PRO B CB    1 
ATOM   6743  C  CG    . PRO B 2 233  ? 97.482  72.507  121.182 1.00 70.55  ?  230  PRO B CG    1 
ATOM   6744  C  CD    . PRO B 2 233  ? 98.145  73.677  120.524 1.00 71.24  ?  230  PRO B CD    1 
ATOM   6745  N  N     . SER B 2 234  ? 93.925  73.504  118.585 1.00 66.45  ?  231  SER B N     1 
ATOM   6746  C  CA    . SER B 2 234  ? 92.543  73.901  118.821 1.00 68.18  ?  231  SER B CA    1 
ATOM   6747  C  C     . SER B 2 234  ? 91.806  72.915  119.716 1.00 67.77  ?  231  SER B C     1 
ATOM   6748  O  O     . SER B 2 234  ? 90.867  73.309  120.412 1.00 64.71  ?  231  SER B O     1 
ATOM   6749  C  CB    . SER B 2 234  ? 91.801  74.035  117.482 1.00 65.68  ?  231  SER B CB    1 
ATOM   6750  O  OG    . SER B 2 234  ? 92.562  74.775  116.543 1.00 61.35  ?  231  SER B OG    1 
ATOM   6751  N  N     . ARG B 2 235  ? 92.255  71.661  119.753 1.00 72.86  ?  232  ARG B N     1 
ATOM   6752  C  CA    . ARG B 2 235  ? 91.527  70.540  120.336 1.00 74.00  ?  232  ARG B CA    1 
ATOM   6753  C  C     . ARG B 2 235  ? 91.085  70.766  121.775 1.00 66.79  ?  232  ARG B C     1 
ATOM   6754  O  O     . ARG B 2 235  ? 91.912  70.863  122.687 1.00 65.12  ?  232  ARG B O     1 
ATOM   6755  C  CB    . ARG B 2 235  ? 92.394  69.281  120.265 1.00 81.83  ?  232  ARG B CB    1 
ATOM   6756  C  CG    . ARG B 2 235  ? 93.885  69.593  120.268 1.00 89.50  ?  232  ARG B CG    1 
ATOM   6757  C  CD    . ARG B 2 235  ? 94.742  68.364  120.523 1.00 90.82  ?  232  ARG B CD    1 
ATOM   6758  N  NE    . ARG B 2 235  ? 94.788  68.030  121.941 1.00 83.79  ?  232  ARG B NE    1 
ATOM   6759  C  CZ    . ARG B 2 235  ? 95.573  68.631  122.826 1.00 80.86  ?  232  ARG B CZ    1 
ATOM   6760  N  NH1   . ARG B 2 235  ? 95.542  68.248  124.092 1.00 79.56  ?  232  ARG B NH1   1 
ATOM   6761  N  NH2   . ARG B 2 235  ? 96.367  69.626  122.457 1.00 78.90  ?  232  ARG B NH2   1 
ATOM   6762  N  N     . LEU B 2 236  ? 89.773  70.835  121.972 1.00 68.64  ?  233  LEU B N     1 
ATOM   6763  C  CA    . LEU B 2 236  ? 89.197  70.849  123.306 1.00 66.10  ?  233  LEU B CA    1 
ATOM   6764  C  C     . LEU B 2 236  ? 89.610  69.595  124.069 1.00 69.08  ?  233  LEU B C     1 
ATOM   6765  O  O     . LEU B 2 236  ? 89.785  68.519  123.491 1.00 72.66  ?  233  LEU B O     1 
ATOM   6766  C  CB    . LEU B 2 236  ? 87.669  70.943  123.203 1.00 69.71  ?  233  LEU B CB    1 
ATOM   6767  C  CG    . LEU B 2 236  ? 86.789  71.188  124.434 1.00 71.17  ?  233  LEU B CG    1 
ATOM   6768  C  CD1   . LEU B 2 236  ? 85.499  71.883  124.029 1.00 70.56  ?  233  LEU B CD1   1 
ATOM   6769  C  CD2   . LEU B 2 236  ? 86.468  69.893  125.159 1.00 74.63  ?  233  LEU B CD2   1 
ATOM   6770  N  N     . ILE B 2 237  ? 89.764  69.738  125.384 1.00 70.22  ?  234  ILE B N     1 
ATOM   6771  C  CA    . ILE B 2 237  ? 90.202  68.645  126.250 1.00 73.85  ?  234  ILE B CA    1 
ATOM   6772  C  C     . ILE B 2 237  ? 89.178  68.467  127.365 1.00 74.05  ?  234  ILE B C     1 
ATOM   6773  O  O     . ILE B 2 237  ? 88.978  69.376  128.181 1.00 72.25  ?  234  ILE B O     1 
ATOM   6774  C  CB    . ILE B 2 237  ? 91.599  68.905  126.838 1.00 72.12  ?  234  ILE B CB    1 
ATOM   6775  C  CG1   . ILE B 2 237  ? 92.592  69.270  125.733 1.00 67.13  ?  234  ILE B CG1   1 
ATOM   6776  C  CG2   . ILE B 2 237  ? 92.075  67.708  127.640 1.00 79.11  ?  234  ILE B CG2   1 
ATOM   6777  C  CD1   . ILE B 2 237  ? 92.682  68.251  124.632 1.00 66.43  ?  234  ILE B CD1   1 
ATOM   6778  N  N     . ARG B 2 238  ? 88.534  67.301  127.404 1.00 81.28  ?  235  ARG B N     1 
ATOM   6779  C  CA    . ARG B 2 238  ? 87.500  67.000  128.382 1.00 86.48  ?  235  ARG B CA    1 
ATOM   6780  C  C     . ARG B 2 238  ? 88.094  66.210  129.545 1.00 88.65  ?  235  ARG B C     1 
ATOM   6781  O  O     . ARG B 2 238  ? 89.034  65.429  129.369 1.00 90.19  ?  235  ARG B O     1 
ATOM   6782  C  CB    . ARG B 2 238  ? 86.361  66.209  127.722 1.00 92.26  ?  235  ARG B CB    1 
ATOM   6783  C  CG    . ARG B 2 238  ? 85.410  65.478  128.684 1.00 91.87  ?  235  ARG B CG    1 
ATOM   6784  C  CD    . ARG B 2 238  ? 84.427  64.540  127.970 1.00 83.31  ?  235  ARG B CD    1 
ATOM   6785  N  NE    . ARG B 2 238  ? 84.210  63.324  128.751 1.00 79.16  ?  235  ARG B NE    1 
ATOM   6786  C  CZ    . ARG B 2 238  ? 83.334  63.204  129.744 1.00 76.92  ?  235  ARG B CZ    1 
ATOM   6787  N  NH1   . ARG B 2 238  ? 83.225  62.050  130.392 1.00 72.68  ?  235  ARG B NH1   1 
ATOM   6788  N  NH2   . ARG B 2 238  ? 82.576  64.231  130.098 1.00 78.60  ?  235  ARG B NH2   1 
ATOM   6789  N  N     . LEU B 2 239  ? 87.540  66.416  130.741 1.00 88.43  ?  236  LEU B N     1 
ATOM   6790  C  CA    . LEU B 2 239  ? 87.932  65.608  131.884 1.00 91.67  ?  236  LEU B CA    1 
ATOM   6791  C  C     . LEU B 2 239  ? 86.763  65.490  132.852 1.00 93.50  ?  236  LEU B C     1 
ATOM   6792  O  O     . LEU B 2 239  ? 85.876  66.350  132.911 1.00 93.45  ?  236  LEU B O     1 
ATOM   6793  C  CB    . LEU B 2 239  ? 89.159  66.191  132.583 1.00 88.97  ?  236  LEU B CB    1 
ATOM   6794  C  CG    . LEU B 2 239  ? 88.927  67.525  133.281 1.00 87.71  ?  236  LEU B CG    1 
ATOM   6795  C  CD1   . LEU B 2 239  ? 88.849  67.362  134.790 1.00 87.56  ?  236  LEU B CD1   1 
ATOM   6796  C  CD2   . LEU B 2 239  ? 89.984  68.530  132.886 1.00 86.74  ?  236  LEU B CD2   1 
ATOM   6797  N  N     . HIS B 2 240  ? 86.814  64.426  133.649 1.00 101.37 ?  237  HIS B N     1 
ATOM   6798  C  CA    . HIS B 2 240  ? 85.726  64.013  134.521 1.00 112.36 ?  237  HIS B CA    1 
ATOM   6799  C  C     . HIS B 2 240  ? 86.361  63.587  135.839 1.00 117.72 ?  237  HIS B C     1 
ATOM   6800  O  O     . HIS B 2 240  ? 87.152  62.637  135.867 1.00 116.09 ?  237  HIS B O     1 
ATOM   6801  C  CB    . HIS B 2 240  ? 84.943  62.867  133.856 1.00 113.22 ?  237  HIS B CB    1 
ATOM   6802  C  CG    . HIS B 2 240  ? 83.732  62.407  134.609 1.00 124.52 ?  237  HIS B CG    1 
ATOM   6803  N  ND1   . HIS B 2 240  ? 83.176  63.119  135.650 1.00 133.14 ?  237  HIS B ND1   1 
ATOM   6804  C  CD2   . HIS B 2 240  ? 82.961  61.305  134.451 1.00 127.02 ?  237  HIS B CD2   1 
ATOM   6805  C  CE1   . HIS B 2 240  ? 82.118  62.471  136.106 1.00 141.94 ?  237  HIS B CE1   1 
ATOM   6806  N  NE2   . HIS B 2 240  ? 81.967  61.366  135.396 1.00 140.00 ?  237  HIS B NE2   1 
ATOM   6807  N  N     . VAL B 2 241  ? 86.037  64.301  136.920 1.00 117.14 ?  238  VAL B N     1 
ATOM   6808  C  CA    . VAL B 2 241  ? 86.706  64.154  138.212 1.00 115.40 ?  238  VAL B CA    1 
ATOM   6809  C  C     . VAL B 2 241  ? 85.674  63.852  139.291 1.00 115.00 ?  238  VAL B C     1 
ATOM   6810  O  O     . VAL B 2 241  ? 84.612  64.484  139.336 1.00 114.37 ?  238  VAL B O     1 
ATOM   6811  C  CB    . VAL B 2 241  ? 87.521  65.412  138.581 1.00 107.31 ?  238  VAL B CB    1 
ATOM   6812  C  CG1   . VAL B 2 241  ? 88.746  65.519  137.713 1.00 99.95  ?  238  VAL B CG1   1 
ATOM   6813  C  CG2   . VAL B 2 241  ? 86.677  66.671  138.411 1.00 100.57 ?  238  VAL B CG2   1 
ATOM   6814  N  N     . GLU B 2 242  ? 85.985  62.885  140.158 1.00 112.44 ?  239  GLU B N     1 
ATOM   6815  C  CA    . GLU B 2 242  ? 85.064  62.435  141.196 1.00 110.54 ?  239  GLU B CA    1 
ATOM   6816  C  C     . GLU B 2 242  ? 85.830  62.252  142.498 1.00 112.46 ?  239  GLU B C     1 
ATOM   6817  O  O     . GLU B 2 242  ? 86.895  61.624  142.511 1.00 111.69 ?  239  GLU B O     1 
ATOM   6818  C  CB    . GLU B 2 242  ? 84.379  61.114  140.810 1.00 116.44 ?  239  GLU B CB    1 
ATOM   6819  C  CG    . GLU B 2 242  ? 83.732  61.088  139.424 1.00 134.29 ?  239  GLU B CG    1 
ATOM   6820  C  CD    . GLU B 2 242  ? 84.749  60.985  138.289 1.00 148.26 ?  239  GLU B CD    1 
ATOM   6821  O  OE1   . GLU B 2 242  ? 85.959  60.858  138.580 1.00 130.59 ?  239  GLU B OE1   1 
ATOM   6822  O  OE2   . GLU B 2 242  ? 84.344  61.074  137.109 1.00 202.28 -1 239  GLU B OE2   1 
ATOM   6823  N  N     . LEU B 2 243  ? 85.288  62.783  143.595 1.00 114.34 ?  240  LEU B N     1 
ATOM   6824  C  CA    . LEU B 2 243  ? 85.924  62.657  144.906 1.00 117.75 ?  240  LEU B CA    1 
ATOM   6825  C  C     . LEU B 2 243  ? 85.212  61.545  145.672 1.00 119.13 ?  240  LEU B C     1 
ATOM   6826  O  O     . LEU B 2 243  ? 84.113  61.739  146.201 1.00 115.60 ?  240  LEU B O     1 
ATOM   6827  C  CB    . LEU B 2 243  ? 85.900  63.977  145.672 1.00 109.59 ?  240  LEU B CB    1 
ATOM   6828  C  CG    . LEU B 2 243  ? 86.772  64.059  146.934 1.00 101.95 ?  240  LEU B CG    1 
ATOM   6829  C  CD1   . LEU B 2 243  ? 88.178  63.537  146.671 1.00 99.08  ?  240  LEU B CD1   1 
ATOM   6830  C  CD2   . LEU B 2 243  ? 86.824  65.474  147.490 1.00 98.78  ?  240  LEU B CD2   1 
ATOM   6831  N  N     . LEU B 2 244  ? 85.839  60.370  145.710 1.00 119.92 ?  241  LEU B N     1 
ATOM   6832  C  CA    . LEU B 2 244  ? 85.385  59.251  146.520 1.00 120.90 ?  241  LEU B CA    1 
ATOM   6833  C  C     . LEU B 2 244  ? 86.011  59.364  147.912 1.00 126.66 ?  241  LEU B C     1 
ATOM   6834  O  O     . LEU B 2 244  ? 86.629  60.373  148.258 1.00 127.22 ?  241  LEU B O     1 
ATOM   6835  C  CB    . LEU B 2 244  ? 85.735  57.924  145.839 1.00 116.03 ?  241  LEU B CB    1 
ATOM   6836  C  CG    . LEU B 2 244  ? 84.780  57.310  144.799 1.00 103.49 ?  241  LEU B CG    1 
ATOM   6837  C  CD1   . LEU B 2 244  ? 84.582  58.207  143.597 1.00 99.57  ?  241  LEU B CD1   1 
ATOM   6838  C  CD2   . LEU B 2 244  ? 85.289  55.945  144.349 1.00 93.95  ?  241  LEU B CD2   1 
ATOM   6839  N  N     . LEU B 2 245  ? 85.825  58.335  148.739 1.00 129.94 ?  242  LEU B N     1 
ATOM   6840  C  CA    . LEU B 2 245  ? 86.363  58.312  150.098 1.00 134.88 ?  242  LEU B CA    1 
ATOM   6841  C  C     . LEU B 2 245  ? 87.494  57.291  150.162 1.00 150.61 ?  242  LEU B C     1 
ATOM   6842  O  O     . LEU B 2 245  ? 87.249  56.096  150.328 1.00 151.37 ?  242  LEU B O     1 
ATOM   6843  C  CB    . LEU B 2 245  ? 85.255  57.990  151.095 1.00 127.96 ?  242  LEU B CB    1 
ATOM   6844  C  CG    . LEU B 2 245  ? 84.091  58.983  151.128 1.00 118.06 ?  242  LEU B CG    1 
ATOM   6845  C  CD1   . LEU B 2 245  ? 83.020  58.572  152.126 1.00 106.50 ?  242  LEU B CD1   1 
ATOM   6846  C  CD2   . LEU B 2 245  ? 84.588  60.385  151.425 1.00 127.81 ?  242  LEU B CD2   1 
ATOM   6847  N  N     . GLY B 2 246  ? 88.735  57.758  150.032 1.00 150.26 ?  243  GLY B N     1 
ATOM   6848  C  CA    . GLY B 2 246  ? 89.045  59.145  149.725 1.00 143.19 ?  243  GLY B CA    1 
ATOM   6849  C  C     . GLY B 2 246  ? 89.800  59.317  148.416 1.00 135.39 ?  243  GLY B C     1 
ATOM   6850  O  O     . GLY B 2 246  ? 90.740  60.111  148.332 1.00 125.48 ?  243  GLY B O     1 
ATOM   6851  N  N     . SER B 2 247  ? 89.369  58.582  147.385 1.00 136.48 ?  244  SER B N     1 
ATOM   6852  C  CA    . SER B 2 247  ? 90.113  58.485  146.134 1.00 128.27 ?  244  SER B CA    1 
ATOM   6853  C  C     . SER B 2 247  ? 89.735  59.625  145.197 1.00 117.49 ?  244  SER B C     1 
ATOM   6854  O  O     . SER B 2 247  ? 88.570  59.711  144.785 1.00 115.53 ?  244  SER B O     1 
ATOM   6855  C  CB    . SER B 2 247  ? 89.862  57.136  145.461 1.00 125.87 ?  244  SER B CB    1 
ATOM   6856  O  OG    . SER B 2 247  ? 88.582  57.066  144.851 1.00 114.91 ?  244  SER B OG    1 
ATOM   6857  N  N     . PRO B 2 248  ? 90.661  60.512  144.845 1.00 108.29 ?  245  PRO B N     1 
ATOM   6858  C  CA    . PRO B 2 248  ? 90.401  61.545  143.823 1.00 102.75 ?  245  PRO B CA    1 
ATOM   6859  C  C     . PRO B 2 248  ? 90.475  60.982  142.404 1.00 103.03 ?  245  PRO B C     1 
ATOM   6860  O  O     . PRO B 2 248  ? 91.416  61.211  141.641 1.00 97.80  ?  245  PRO B O     1 
ATOM   6861  C  CB    . PRO B 2 248  ? 91.506  62.564  144.100 1.00 94.45  ?  245  PRO B CB    1 
ATOM   6862  C  CG    . PRO B 2 248  ? 92.638  61.735  144.599 1.00 93.52  ?  245  PRO B CG    1 
ATOM   6863  C  CD    . PRO B 2 248  ? 92.031  60.602  145.384 1.00 101.53 ?  245  PRO B CD    1 
ATOM   6864  N  N     . VAL B 2 249  ? 89.437  60.229  142.025 1.00 107.40 ?  246  VAL B N     1 
ATOM   6865  C  CA    . VAL B 2 249  ? 89.488  59.489  140.770 1.00 106.66 ?  246  VAL B CA    1 
ATOM   6866  C  C     . VAL B 2 249  ? 89.277  60.450  139.607 1.00 103.87 ?  246  VAL B C     1 
ATOM   6867  O  O     . VAL B 2 249  ? 88.473  61.390  139.683 1.00 106.23 ?  246  VAL B O     1 
ATOM   6868  C  CB    . VAL B 2 249  ? 88.461  58.339  140.765 1.00 111.05 ?  246  VAL B CB    1 
ATOM   6869  C  CG1   . VAL B 2 249  ? 87.088  58.816  141.197 1.00 109.23 ?  246  VAL B CG1   1 
ATOM   6870  C  CG2   . VAL B 2 249  ? 88.394  57.654  139.399 1.00 115.26 ?  246  VAL B CG2   1 
ATOM   6871  N  N     . LEU B 2 250  ? 90.034  60.238  138.534 1.00 100.85 ?  247  LEU B N     1 
ATOM   6872  C  CA    . LEU B 2 250  ? 90.044  61.141  137.395 1.00 104.85 ?  247  LEU B CA    1 
ATOM   6873  C  C     . LEU B 2 250  ? 90.037  60.321  136.112 1.00 109.08 ?  247  LEU B C     1 
ATOM   6874  O  O     . LEU B 2 250  ? 90.622  59.235  136.060 1.00 106.50 ?  247  LEU B O     1 
ATOM   6875  C  CB    . LEU B 2 250  ? 91.280  62.062  137.446 1.00 102.96 ?  247  LEU B CB    1 
ATOM   6876  C  CG    . LEU B 2 250  ? 91.371  63.344  136.607 1.00 98.46  ?  247  LEU B CG    1 
ATOM   6877  C  CD1   . LEU B 2 250  ? 92.416  64.279  137.194 1.00 91.56  ?  247  LEU B CD1   1 
ATOM   6878  C  CD2   . LEU B 2 250  ? 91.674  63.089  135.144 1.00 98.36  ?  247  LEU B CD2   1 
ATOM   6879  N  N     . THR B 2 251  ? 89.346  60.832  135.091 1.00 113.01 ?  248  THR B N     1 
ATOM   6880  C  CA    . THR B 2 251  ? 89.502  60.360  133.720 1.00 113.97 ?  248  THR B CA    1 
ATOM   6881  C  C     . THR B 2 251  ? 89.560  61.577  132.806 1.00 108.89 ?  248  THR B C     1 
ATOM   6882  O  O     . THR B 2 251  ? 89.024  62.640  133.132 1.00 106.39 ?  248  THR B O     1 
ATOM   6883  C  CB    . THR B 2 251  ? 88.362  59.404  133.279 1.00 115.42 ?  248  THR B CB    1 
ATOM   6884  O  OG1   . THR B 2 251  ? 88.384  59.247  131.854 1.00 113.02 ?  248  THR B OG1   1 
ATOM   6885  C  CG2   . THR B 2 251  ? 87.001  59.935  133.695 1.00 117.04 ?  248  THR B CG2   1 
ATOM   6886  N  N     . CYS B 2 252  ? 90.238  61.427  131.671 1.00 104.27 ?  249  CYS B N     1 
ATOM   6887  C  CA    . CYS B 2 252  ? 90.359  62.514  130.711 1.00 99.96  ?  249  CYS B CA    1 
ATOM   6888  C  C     . CYS B 2 252  ? 90.154  61.959  129.310 1.00 101.14 ?  249  CYS B C     1 
ATOM   6889  O  O     . CYS B 2 252  ? 90.192  60.745  129.092 1.00 103.55 ?  249  CYS B O     1 
ATOM   6890  C  CB    . CYS B 2 252  ? 91.723  63.214  130.817 1.00 101.11 ?  249  CYS B CB    1 
ATOM   6891  S  SG    . CYS B 2 252  ? 92.027  64.502  129.587 1.00 140.99 ?  249  CYS B SG    1 
ATOM   6892  N  N     . THR B 2 253  ? 89.926  62.862  128.359 1.00 97.57  ?  250  THR B N     1 
ATOM   6893  C  CA    . THR B 2 253  ? 89.812  62.483  126.959 1.00 95.36  ?  250  THR B CA    1 
ATOM   6894  C  C     . THR B 2 253  ? 90.057  63.711  126.097 1.00 87.91  ?  250  THR B C     1 
ATOM   6895  O  O     . THR B 2 253  ? 89.944  64.855  126.553 1.00 86.96  ?  250  THR B O     1 
ATOM   6896  C  CB    . THR B 2 253  ? 88.445  61.860  126.635 1.00 93.72  ?  250  THR B CB    1 
ATOM   6897  O  OG1   . THR B 2 253  ? 88.267  61.797  125.214 1.00 88.55  ?  250  THR B OG1   1 
ATOM   6898  C  CG2   . THR B 2 253  ? 87.326  62.670  127.245 1.00 91.94  ?  250  THR B CG2   1 
ATOM   6899  N  N     . ILE B 2 254  ? 90.418  63.450  124.845 1.00 86.88  ?  251  ILE B N     1 
ATOM   6900  C  CA    . ILE B 2 254  ? 90.638  64.485  123.846 1.00 83.13  ?  251  ILE B CA    1 
ATOM   6901  C  C     . ILE B 2 254  ? 89.378  64.601  123.006 1.00 79.04  ?  251  ILE B C     1 
ATOM   6902  O  O     . ILE B 2 254  ? 88.776  63.588  122.631 1.00 79.81  ?  251  ILE B O     1 
ATOM   6903  C  CB    . ILE B 2 254  ? 91.859  64.163  122.966 1.00 84.30  ?  251  ILE B CB    1 
ATOM   6904  C  CG1   . ILE B 2 254  ? 93.045  63.692  123.818 1.00 88.66  ?  251  ILE B CG1   1 
ATOM   6905  C  CG2   . ILE B 2 254  ? 92.235  65.346  122.097 1.00 82.45  ?  251  ILE B CG2   1 
ATOM   6906  C  CD1   . ILE B 2 254  ? 93.515  64.688  124.859 1.00 84.04  ?  251  ILE B CD1   1 
ATOM   6907  N  N     . LEU B 2 255  ? 88.960  65.825  122.735 1.00 79.32  ?  252  LEU B N     1 
ATOM   6908  C  CA    . LEU B 2 255  ? 87.924  66.036  121.743 1.00 87.06  ?  252  LEU B CA    1 
ATOM   6909  C  C     . LEU B 2 255  ? 88.569  66.133  120.366 1.00 95.11  ?  252  LEU B C     1 
ATOM   6910  O  O     . LEU B 2 255  ? 89.747  66.470  120.226 1.00 88.49  ?  252  LEU B O     1 
ATOM   6911  C  CB    . LEU B 2 255  ? 87.113  67.297  122.054 1.00 87.04  ?  252  LEU B CB    1 
ATOM   6912  C  CG    . LEU B 2 255  ? 85.817  67.470  121.254 1.00 93.81  ?  252  LEU B CG    1 
ATOM   6913  C  CD1   . LEU B 2 255  ? 84.920  66.271  121.455 1.00 95.94  ?  252  LEU B CD1   1 
ATOM   6914  C  CD2   . LEU B 2 255  ? 85.090  68.752  121.633 1.00 92.38  ?  252  LEU B CD2   1 
ATOM   6915  N  N     . HIS B 2 256  ? 87.783  65.806  119.343 1.00 107.69 ?  253  HIS B N     1 
ATOM   6916  C  CA    . HIS B 2 256  ? 88.301  65.819  117.981 1.00 111.51 ?  253  HIS B CA    1 
ATOM   6917  C  C     . HIS B 2 256  ? 88.600  67.238  117.517 1.00 103.84 ?  253  HIS B C     1 
ATOM   6918  O  O     . HIS B 2 256  ? 89.566  67.464  116.780 1.00 98.56  ?  253  HIS B O     1 
ATOM   6919  C  CB    . HIS B 2 256  ? 87.300  65.139  117.045 1.00 127.63 ?  253  HIS B CB    1 
ATOM   6920  C  CG    . HIS B 2 256  ? 86.439  64.111  117.718 1.00 136.87 ?  253  HIS B CG    1 
ATOM   6921  N  ND1   . HIS B 2 256  ? 86.873  62.827  117.972 1.00 143.49 ?  253  HIS B ND1   1 
ATOM   6922  C  CD2   . HIS B 2 256  ? 85.177  64.185  118.203 1.00 133.08 ?  253  HIS B CD2   1 
ATOM   6923  C  CE1   . HIS B 2 256  ? 85.910  62.151  118.573 1.00 138.78 ?  253  HIS B CE1   1 
ATOM   6924  N  NE2   . HIS B 2 256  ? 84.871  62.952  118.727 1.00 134.43 ?  253  HIS B NE2   1 
ATOM   6925  N  N     . GLU B 2 257  ? 87.789  68.206  117.947 1.00 103.15 ?  254  GLU B N     1 
ATOM   6926  C  CA    . GLU B 2 257  ? 87.933  69.591  117.518 1.00 103.24 ?  254  GLU B CA    1 
ATOM   6927  C  C     . GLU B 2 257  ? 87.498  70.543  118.625 1.00 94.53  ?  254  GLU B C     1 
ATOM   6928  O  O     . GLU B 2 257  ? 86.464  70.335  119.262 1.00 90.44  ?  254  GLU B O     1 
ATOM   6929  C  CB    . GLU B 2 257  ? 87.111  69.868  116.257 1.00 107.85 ?  254  GLU B CB    1 
ATOM   6930  C  CG    . GLU B 2 257  ? 87.778  69.400  114.987 1.00 122.44 ?  254  GLU B CG    1 
ATOM   6931  C  CD    . GLU B 2 257  ? 87.103  69.939  113.751 1.00 157.21 ?  254  GLU B CD    1 
ATOM   6932  O  OE1   . GLU B 2 257  ? 86.080  70.645  113.887 1.00 146.09 ?  254  GLU B OE1   1 
ATOM   6933  O  OE2   . GLU B 2 257  ? 87.601  69.666  112.641 1.00 270.70 -1 254  GLU B OE2   1 
ATOM   6934  N  N     . GLY B 2 258  ? 88.290  71.598  118.824 1.00 87.56  ?  255  GLY B N     1 
ATOM   6935  C  CA    . GLY B 2 258  ? 87.983  72.680  119.745 1.00 76.97  ?  255  GLY B CA    1 
ATOM   6936  C  C     . GLY B 2 258  ? 88.057  74.029  119.052 1.00 71.50  ?  255  GLY B C     1 
ATOM   6937  O  O     . GLY B 2 258  ? 87.339  74.254  118.073 1.00 72.09  ?  255  GLY B O     1 
ATOM   6938  N  N     . LEU B 2 259  ? 88.906  74.938  119.537 1.00 62.80  ?  256  LEU B N     1 
ATOM   6939  C  CA    . LEU B 2 259  ? 89.125  76.209  118.852 1.00 58.34  ?  256  LEU B CA    1 
ATOM   6940  C  C     . LEU B 2 259  ? 90.516  76.747  119.170 1.00 56.66  ?  256  LEU B C     1 
ATOM   6941  O  O     . LEU B 2 259  ? 91.004  76.588  120.292 1.00 57.48  ?  256  LEU B O     1 
ATOM   6942  C  CB    . LEU B 2 259  ? 88.057  77.240  119.241 1.00 55.38  ?  256  LEU B CB    1 
ATOM   6943  C  CG    . LEU B 2 259  ? 88.107  78.588  118.520 1.00 56.67  ?  256  LEU B CG    1 
ATOM   6944  C  CD1   . LEU B 2 259  ? 88.257  78.383  117.029 1.00 62.01  ?  256  LEU B CD1   1 
ATOM   6945  C  CD2   . LEU B 2 259  ? 86.873  79.421  118.826 1.00 54.19  ?  256  LEU B CD2   1 
ATOM   6946  N  N     . THR B 2 260  ? 91.146  77.385  118.173 1.00 59.54  ?  257  THR B N     1 
ATOM   6947  C  CA    . THR B 2 260  ? 92.502  77.934  118.289 1.00 62.85  ?  257  THR B CA    1 
ATOM   6948  C  C     . THR B 2 260  ? 92.447  79.380  118.786 1.00 59.59  ?  257  THR B C     1 
ATOM   6949  O  O     . THR B 2 260  ? 92.579  80.335  118.016 1.00 58.77  ?  257  THR B O     1 
ATOM   6950  C  CB    . THR B 2 260  ? 93.235  77.841  116.951 1.00 60.55  ?  257  THR B CB    1 
ATOM   6951  O  OG1   . THR B 2 260  ? 94.410  78.664  116.973 1.00 59.76  ?  257  THR B OG1   1 
ATOM   6952  C  CG2   . THR B 2 260  ? 92.345  78.254  115.777 1.00 56.91  ?  257  THR B CG2   1 
ATOM   6953  N  N     . ILE B 2 261  ? 92.319  79.552  120.100 1.00 60.97  ?  258  ILE B N     1 
ATOM   6954  C  CA    . ILE B 2 261  ? 92.226  80.872  120.716 1.00 58.36  ?  258  ILE B CA    1 
ATOM   6955  C  C     . ILE B 2 261  ? 93.274  80.976  121.818 1.00 58.51  ?  258  ILE B C     1 
ATOM   6956  O  O     . ILE B 2 261  ? 93.647  79.978  122.442 1.00 57.43  ?  258  ILE B O     1 
ATOM   6957  C  CB    . ILE B 2 261  ? 90.804  81.137  121.275 1.00 56.68  ?  258  ILE B CB    1 
ATOM   6958  C  CG1   . ILE B 2 261  ? 90.692  82.534  121.897 1.00 61.26  ?  258  ILE B CG1   1 
ATOM   6959  C  CG2   . ILE B 2 261  ? 90.445  80.090  122.298 1.00 52.48  ?  258  ILE B CG2   1 
ATOM   6960  C  CD1   . ILE B 2 261  ? 91.101  83.667  120.987 1.00 63.63  ?  258  ILE B CD1   1 
ATOM   6961  N  N     . THR B 2 262  ? 93.774  82.192  122.037 1.00 56.82  ?  259  THR B N     1 
ATOM   6962  C  CA    . THR B 2 262  ? 94.754  82.453  123.084 1.00 55.94  ?  259  THR B CA    1 
ATOM   6963  C  C     . THR B 2 262  ? 94.381  83.730  123.820 1.00 55.26  ?  259  THR B C     1 
ATOM   6964  O  O     . THR B 2 262  ? 94.141  84.761  123.186 1.00 50.50  ?  259  THR B O     1 
ATOM   6965  C  CB    . THR B 2 262  ? 96.173  82.585  122.510 1.00 59.12  ?  259  THR B CB    1 
ATOM   6966  O  OG1   . THR B 2 262  ? 96.176  83.561  121.462 1.00 56.64  ?  259  THR B OG1   1 
ATOM   6967  C  CG2   . THR B 2 262  ? 96.662  81.253  121.958 1.00 59.62  ?  259  THR B CG2   1 
ATOM   6968  N  N     . SER B 2 263  ? 94.319  83.650  125.153 1.00 55.45  ?  260  SER B N     1 
ATOM   6969  C  CA    . SER B 2 263  ? 94.179  84.809  126.040 1.00 57.54  ?  260  SER B CA    1 
ATOM   6970  C  C     . SER B 2 263  ? 92.921  85.620  125.707 1.00 57.18  ?  260  SER B C     1 
ATOM   6971  O  O     . SER B 2 263  ? 92.975  86.720  125.160 1.00 54.07  ?  260  SER B O     1 
ATOM   6972  C  CB    . SER B 2 263  ? 95.438  85.683  125.989 1.00 55.44  ?  260  SER B CB    1 
ATOM   6973  O  OG    . SER B 2 263  ? 95.281  86.872  126.743 1.00 56.64  ?  260  SER B OG    1 
ATOM   6974  N  N     . ALA B 2 264  ? 91.779  85.028  126.037 1.00 61.01  ?  261  ALA B N     1 
ATOM   6975  C  CA    . ALA B 2 264  ? 90.478  85.600  125.720 1.00 64.93  ?  261  ALA B CA    1 
ATOM   6976  C  C     . ALA B 2 264  ? 89.856  86.289  126.932 1.00 66.01  ?  261  ALA B C     1 
ATOM   6977  O  O     . ALA B 2 264  ? 90.381  86.254  128.047 1.00 62.13  ?  261  ALA B O     1 
ATOM   6978  C  CB    . ALA B 2 264  ? 89.531  84.517  125.193 1.00 77.54  ?  261  ALA B CB    1 
ATOM   6979  N  N     . ILE B 2 265  ? 88.714  86.928  126.688 1.00 65.39  ?  262  ILE B N     1 
ATOM   6980  C  CA    . ILE B 2 265  ? 87.869  87.506  127.726 1.00 61.51  ?  262  ILE B CA    1 
ATOM   6981  C  C     . ILE B 2 265  ? 86.604  86.661  127.783 1.00 68.77  ?  262  ILE B C     1 
ATOM   6982  O  O     . ILE B 2 265  ? 85.915  86.498  126.767 1.00 69.55  ?  262  ILE B O     1 
ATOM   6983  C  CB    . ILE B 2 265  ? 87.532  88.976  127.431 1.00 52.26  ?  262  ILE B CB    1 
ATOM   6984  C  CG1   . ILE B 2 265  ? 88.802  89.796  127.188 1.00 46.23  ?  262  ILE B CG1   1 
ATOM   6985  C  CG2   . ILE B 2 265  ? 86.743  89.582  128.573 1.00 49.62  ?  262  ILE B CG2   1 
ATOM   6986  C  CD1   . ILE B 2 265  ? 89.138  90.018  125.726 1.00 45.55  ?  262  ILE B CD1   1 
ATOM   6987  N  N     . ALA B 2 266  ? 86.299  86.117  128.961 1.00 70.84  ?  263  ALA B N     1 
ATOM   6988  C  CA    . ALA B 2 266  ? 85.215  85.148  129.126 1.00 72.51  ?  263  ALA B CA    1 
ATOM   6989  C  C     . ALA B 2 266  ? 83.999  85.848  129.727 1.00 67.88  ?  263  ALA B C     1 
ATOM   6990  O  O     . ALA B 2 266  ? 83.913  86.019  130.947 1.00 65.78  ?  263  ALA B O     1 
ATOM   6991  C  CB    . ALA B 2 266  ? 85.661  83.987  130.008 1.00 71.68  ?  263  ALA B CB    1 
ATOM   6992  N  N     . SER B 2 267  ? 83.053  86.251  128.871 1.00 63.75  ?  264  SER B N     1 
ATOM   6993  C  CA    . SER B 2 267  ? 81.991  86.763  129.724 1.00 58.83  ?  264  SER B CA    1 
ATOM   6994  C  C     . SER B 2 267  ? 80.910  85.709  129.901 1.00 59.92  ?  264  SER B C     1 
ATOM   6995  O  O     . SER B 2 267  ? 80.514  85.045  128.924 1.00 62.82  ?  264  SER B O     1 
ATOM   6996  C  CB    . SER B 2 267  ? 81.365  88.035  129.148 1.00 59.78  ?  264  SER B CB    1 
ATOM   6997  O  OG    . SER B 2 267  ? 80.235  88.442  129.909 1.00 57.43  ?  264  SER B OG    1 
ATOM   6998  N  N     . PRO B 2 268  ? 80.455  85.539  131.144 1.00 55.80  ?  265  PRO B N     1 
ATOM   6999  C  CA    . PRO B 2 268  ? 79.287  84.688  131.404 1.00 58.84  ?  265  PRO B CA    1 
ATOM   7000  C  C     . PRO B 2 268  ? 78.015  85.483  131.144 1.00 59.84  ?  265  PRO B C     1 
ATOM   7001  O  O     . PRO B 2 268  ? 77.728  86.463  131.835 1.00 58.41  ?  265  PRO B O     1 
ATOM   7002  C  CB    . PRO B 2 268  ? 79.439  84.325  132.885 1.00 51.41  ?  265  PRO B CB    1 
ATOM   7003  C  CG    . PRO B 2 268  ? 80.202  85.475  133.463 1.00 44.91  ?  265  PRO B CG    1 
ATOM   7004  C  CD    . PRO B 2 268  ? 81.085  86.027  132.387 1.00 47.09  ?  265  PRO B CD    1 
ATOM   7005  N  N     . ILE B 2 269  ? 77.265  85.077  130.121 1.00 66.79  ?  266  ILE B N     1 
ATOM   7006  C  CA    . ILE B 2 269  ? 76.037  85.777  129.761 1.00 72.01  ?  266  ILE B CA    1 
ATOM   7007  C  C     . ILE B 2 269  ? 74.869  85.125  130.482 1.00 77.76  ?  266  ILE B C     1 
ATOM   7008  O  O     . ILE B 2 269  ? 74.263  85.721  131.379 1.00 76.93  ?  266  ILE B O     1 
ATOM   7009  C  CB    . ILE B 2 269  ? 75.800  85.782  128.238 1.00 76.22  ?  266  ILE B CB    1 
ATOM   7010  C  CG1   . ILE B 2 269  ? 76.777  86.727  127.545 1.00 80.08  ?  266  ILE B CG1   1 
ATOM   7011  C  CG2   . ILE B 2 269  ? 74.359  86.181  127.907 1.00 79.78  ?  266  ILE B CG2   1 
ATOM   7012  C  CD1   . ILE B 2 269  ? 76.489  86.905  126.080 1.00 92.35  ?  266  ILE B CD1   1 
ATOM   7013  N  N     . GLY B 2 270  ? 74.569  83.884  130.120 1.00 79.02  ?  267  GLY B N     1 
ATOM   7014  C  CA    . GLY B 2 270  ? 73.454  83.168  130.684 1.00 77.92  ?  267  GLY B CA    1 
ATOM   7015  C  C     . GLY B 2 270  ? 73.862  82.347  131.886 1.00 68.18  ?  267  GLY B C     1 
ATOM   7016  O  O     . GLY B 2 270  ? 74.904  82.579  132.512 1.00 66.83  ?  267  GLY B O     1 
ATOM   7017  N  N     . TYR B 2 271  ? 73.011  81.380  132.225 1.00 70.49  ?  268  TYR B N     1 
ATOM   7018  C  CA    . TYR B 2 271  ? 73.349  80.420  133.265 1.00 79.88  ?  268  TYR B CA    1 
ATOM   7019  C  C     . TYR B 2 271  ? 74.705  79.783  132.978 1.00 83.91  ?  268  TYR B C     1 
ATOM   7020  O  O     . TYR B 2 271  ? 75.633  79.878  133.784 1.00 87.60  ?  268  TYR B O     1 
ATOM   7021  C  CB    . TYR B 2 271  ? 72.247  79.369  133.364 1.00 92.47  ?  268  TYR B CB    1 
ATOM   7022  C  CG    . TYR B 2 271  ? 72.491  78.324  134.425 1.00 104.19 ?  268  TYR B CG    1 
ATOM   7023  C  CD1   . TYR B 2 271  ? 72.273  78.606  135.767 1.00 108.44 ?  268  TYR B CD1   1 
ATOM   7024  C  CD2   . TYR B 2 271  ? 72.951  77.059  134.088 1.00 107.83 ?  268  TYR B CD2   1 
ATOM   7025  C  CE1   . TYR B 2 271  ? 72.501  77.655  136.743 1.00 115.41 ?  268  TYR B CE1   1 
ATOM   7026  C  CE2   . TYR B 2 271  ? 73.183  76.101  135.057 1.00 121.01 ?  268  TYR B CE2   1 
ATOM   7027  C  CZ    . TYR B 2 271  ? 72.957  76.403  136.382 1.00 118.86 ?  268  TYR B CZ    1 
ATOM   7028  O  OH    . TYR B 2 271  ? 73.184  75.460  137.358 1.00 117.12 ?  268  TYR B OH    1 
ATOM   7029  N  N     . HIS B 2 272  ? 74.838  79.145  131.814 1.00 86.17  ?  269  HIS B N     1 
ATOM   7030  C  CA    . HIS B 2 272  ? 76.116  78.663  131.302 1.00 84.64  ?  269  HIS B CA    1 
ATOM   7031  C  C     . HIS B 2 272  ? 76.435  79.180  129.905 1.00 83.74  ?  269  HIS B C     1 
ATOM   7032  O  O     . HIS B 2 272  ? 77.484  78.824  129.356 1.00 82.37  ?  269  HIS B O     1 
ATOM   7033  C  CB    . HIS B 2 272  ? 76.159  77.126  131.275 1.00 85.90  ?  269  HIS B CB    1 
ATOM   7034  C  CG    . HIS B 2 272  ? 76.242  76.491  132.628 1.00 88.81  ?  269  HIS B CG    1 
ATOM   7035  N  ND1   . HIS B 2 272  ? 76.049  75.141  132.829 1.00 92.63  ?  269  HIS B ND1   1 
ATOM   7036  C  CD2   . HIS B 2 272  ? 76.505  77.021  133.847 1.00 91.66  ?  269  HIS B CD2   1 
ATOM   7037  C  CE1   . HIS B 2 272  ? 76.183  74.870  134.115 1.00 95.44  ?  269  HIS B CE1   1 
ATOM   7038  N  NE2   . HIS B 2 272  ? 76.461  75.992  134.754 1.00 94.59  ?  269  HIS B NE2   1 
ATOM   7039  N  N     . GLU B 2 273  ? 75.564  79.992  129.310 1.00 87.07  ?  270  GLU B N     1 
ATOM   7040  C  CA    . GLU B 2 273  ? 75.780  80.516  127.965 1.00 90.75  ?  270  GLU B CA    1 
ATOM   7041  C  C     . GLU B 2 273  ? 76.870  81.580  128.009 1.00 82.12  ?  270  GLU B C     1 
ATOM   7042  O  O     . GLU B 2 273  ? 76.641  82.691  128.496 1.00 78.37  ?  270  GLU B O     1 
ATOM   7043  C  CB    . GLU B 2 273  ? 74.472  81.082  127.416 1.00 98.64  ?  270  GLU B CB    1 
ATOM   7044  C  CG    . GLU B 2 273  ? 73.392  80.030  127.176 1.00 113.59 ?  270  GLU B CG    1 
ATOM   7045  C  CD    . GLU B 2 273  ? 72.070  80.632  126.723 1.00 145.58 ?  270  GLU B CD    1 
ATOM   7046  O  OE1   . GLU B 2 273  ? 72.033  81.846  126.433 1.00 130.39 ?  270  GLU B OE1   1 
ATOM   7047  O  OE2   . GLU B 2 273  ? 71.062  79.892  126.668 1.00 262.47 -1 270  GLU B OE2   1 
ATOM   7048  N  N     . TYR B 2 274  ? 78.055  81.249  127.499 1.00 80.04  ?  271  TYR B N     1 
ATOM   7049  C  CA    . TYR B 2 274  ? 79.218  82.121  127.585 1.00 70.70  ?  271  TYR B CA    1 
ATOM   7050  C  C     . TYR B 2 274  ? 79.584  82.670  126.216 1.00 66.08  ?  271  TYR B C     1 
ATOM   7051  O  O     . TYR B 2 274  ? 79.268  82.077  125.179 1.00 70.02  ?  271  TYR B O     1 
ATOM   7052  C  CB    . TYR B 2 274  ? 80.423  81.370  128.157 1.00 69.23  ?  271  TYR B CB    1 
ATOM   7053  C  CG    . TYR B 2 274  ? 80.185  80.764  129.517 1.00 75.81  ?  271  TYR B CG    1 
ATOM   7054  C  CD1   . TYR B 2 274  ? 79.234  81.292  130.376 1.00 79.35  ?  271  TYR B CD1   1 
ATOM   7055  C  CD2   . TYR B 2 274  ? 80.868  79.628  129.920 1.00 83.65  ?  271  TYR B CD2   1 
ATOM   7056  C  CE1   . TYR B 2 274  ? 79.006  80.733  131.618 1.00 89.12  ?  271  TYR B CE1   1 
ATOM   7057  C  CE2   . TYR B 2 274  ? 80.641  79.055  131.161 1.00 91.54  ?  271  TYR B CE2   1 
ATOM   7058  C  CZ    . TYR B 2 274  ? 79.709  79.611  132.006 1.00 93.85  ?  271  TYR B CZ    1 
ATOM   7059  O  OH    . TYR B 2 274  ? 79.478  79.046  133.242 1.00 90.63  ?  271  TYR B OH    1 
ATOM   7060  N  N     . ILE B 2 275  ? 80.257  83.815  126.221 1.00 65.26  ?  272  ILE B N     1 
ATOM   7061  C  CA    . ILE B 2 275  ? 80.874  84.335  125.011 1.00 65.53  ?  272  ILE B CA    1 
ATOM   7062  C  C     . ILE B 2 275  ? 82.369  84.426  125.241 1.00 59.99  ?  272  ILE B C     1 
ATOM   7063  O  O     . ILE B 2 275  ? 82.823  84.779  126.335 1.00 59.93  ?  272  ILE B O     1 
ATOM   7064  C  CB    . ILE B 2 275  ? 80.304  85.701  124.571 1.00 74.71  ?  272  ILE B CB    1 
ATOM   7065  C  CG1   . ILE B 2 275  ? 80.244  86.694  125.733 1.00 73.91  ?  272  ILE B CG1   1 
ATOM   7066  C  CG2   . ILE B 2 275  ? 78.950  85.521  123.905 1.00 82.54  ?  272  ILE B CG2   1 
ATOM   7067  C  CD1   . ILE B 2 275  ? 79.799  88.103  125.320 1.00 71.28  ?  272  ILE B CD1   1 
ATOM   7068  N  N     . ILE B 2 276  ? 83.121  84.053  124.218 1.00 63.43  ?  273  ILE B N     1 
ATOM   7069  C  CA    . ILE B 2 276  ? 84.545  84.323  124.133 1.00 64.49  ?  273  ILE B CA    1 
ATOM   7070  C  C     . ILE B 2 276  ? 84.707  85.562  123.275 1.00 66.61  ?  273  ILE B C     1 
ATOM   7071  O  O     . ILE B 2 276  ? 84.323  85.570  122.098 1.00 70.70  ?  273  ILE B O     1 
ATOM   7072  C  CB    . ILE B 2 276  ? 85.309  83.125  123.558 1.00 67.64  ?  273  ILE B CB    1 
ATOM   7073  C  CG1   . ILE B 2 276  ? 85.209  81.942  124.523 1.00 66.56  ?  273  ILE B CG1   1 
ATOM   7074  C  CG2   . ILE B 2 276  ? 86.738  83.506  123.216 1.00 66.55  ?  273  ILE B CG2   1 
ATOM   7075  C  CD1   . ILE B 2 276  ? 85.431  82.314  125.973 1.00 63.14  ?  273  ILE B CD1   1 
ATOM   7076  N  N     . PHE B 2 277  ? 85.247  86.618  123.875 1.00 61.46  ?  274  PHE B N     1 
ATOM   7077  C  CA    . PHE B 2 277  ? 85.236  87.916  123.221 1.00 64.66  ?  274  PHE B CA    1 
ATOM   7078  C  C     . PHE B 2 277  ? 86.308  88.013  122.150 1.00 68.02  ?  274  PHE B C     1 
ATOM   7079  O  O     . PHE B 2 277  ? 86.001  88.219  120.971 1.00 73.32  ?  274  PHE B O     1 
ATOM   7080  C  CB    . PHE B 2 277  ? 85.416  89.030  124.245 1.00 65.79  ?  274  PHE B CB    1 
ATOM   7081  C  CG    . PHE B 2 277  ? 85.264  90.387  123.656 1.00 77.06  ?  274  PHE B CG    1 
ATOM   7082  C  CD1   . PHE B 2 277  ? 84.012  90.911  123.430 1.00 108.48 ?  274  PHE B CD1   1 
ATOM   7083  C  CD2   . PHE B 2 277  ? 86.369  91.128  123.289 1.00 76.63  ?  274  PHE B CD2   1 
ATOM   7084  C  CE1   . PHE B 2 277  ? 83.864  92.150  122.857 1.00 126.29 ?  274  PHE B CE1   1 
ATOM   7085  C  CE2   . PHE B 2 277  ? 86.220  92.372  122.724 1.00 84.13  ?  274  PHE B CE2   1 
ATOM   7086  C  CZ    . PHE B 2 277  ? 84.972  92.882  122.514 1.00 99.31  ?  274  PHE B CZ    1 
ATOM   7087  N  N     . GLY B 2 278  ? 87.564  87.861  122.538 1.00 63.89  ?  275  GLY B N     1 
ATOM   7088  C  CA    . GLY B 2 278  ? 88.651  88.002  121.594 1.00 61.15  ?  275  GLY B CA    1 
ATOM   7089  C  C     . GLY B 2 278  ? 89.979  87.836  122.292 1.00 55.77  ?  275  GLY B C     1 
ATOM   7090  O  O     . GLY B 2 278  ? 90.079  87.834  123.519 1.00 56.86  ?  275  GLY B O     1 
ATOM   7091  N  N     . GLY B 2 279  ? 91.013  87.733  121.474 1.00 51.22  ?  276  GLY B N     1 
ATOM   7092  C  CA    . GLY B 2 279  ? 92.330  87.347  121.930 1.00 48.00  ?  276  GLY B CA    1 
ATOM   7093  C  C     . GLY B 2 279  ? 93.264  87.285  120.747 1.00 47.02  ?  276  GLY B C     1 
ATOM   7094  O  O     . GLY B 2 279  ? 93.313  88.230  119.955 1.00 53.38  ?  276  GLY B O     1 
ATOM   7095  N  N     . TYR B 2 280  ? 94.010  86.196  120.607 1.00 50.45  ?  277  TYR B N     1 
ATOM   7096  C  CA    . TYR B 2 280  ? 95.004  86.099  119.549 1.00 56.65  ?  277  TYR B CA    1 
ATOM   7097  C  C     . TYR B 2 280  ? 94.945  84.715  118.913 1.00 63.54  ?  277  TYR B C     1 
ATOM   7098  O  O     . TYR B 2 280  ? 95.042  83.704  119.619 1.00 61.60  ?  277  TYR B O     1 
ATOM   7099  C  CB    . TYR B 2 280  ? 96.399  86.388  120.119 1.00 57.17  ?  277  TYR B CB    1 
ATOM   7100  C  CG    . TYR B 2 280  ? 96.487  87.743  120.805 1.00 61.42  ?  277  TYR B CG    1 
ATOM   7101  C  CD1   . TYR B 2 280  ? 96.159  87.892  122.146 1.00 58.73  ?  277  TYR B CD1   1 
ATOM   7102  C  CD2   . TYR B 2 280  ? 96.875  88.878  120.103 1.00 63.28  ?  277  TYR B CD2   1 
ATOM   7103  C  CE1   . TYR B 2 280  ? 96.225  89.134  122.771 1.00 55.25  ?  277  TYR B CE1   1 
ATOM   7104  C  CE2   . TYR B 2 280  ? 96.945  90.121  120.720 1.00 51.18  ?  277  TYR B CE2   1 
ATOM   7105  C  CZ    . TYR B 2 280  ? 96.620  90.242  122.053 1.00 48.00  ?  277  TYR B CZ    1 
ATOM   7106  O  OH    . TYR B 2 280  ? 96.688  91.468  122.670 1.00 36.55  ?  277  TYR B OH    1 
ATOM   7107  N  N     . GLN B 2 281  ? 94.770  84.667  117.582 1.00 66.17  ?  278  GLN B N     1 
ATOM   7108  C  CA    . GLN B 2 281  ? 94.775  83.392  116.863 1.00 68.50  ?  278  GLN B CA    1 
ATOM   7109  C  C     . GLN B 2 281  ? 96.162  83.003  116.370 1.00 70.69  ?  278  GLN B C     1 
ATOM   7110  O  O     . GLN B 2 281  ? 96.439  81.808  116.210 1.00 70.20  ?  278  GLN B O     1 
ATOM   7111  C  CB    . GLN B 2 281  ? 93.835  83.413  115.645 1.00 71.56  ?  278  GLN B CB    1 
ATOM   7112  C  CG    . GLN B 2 281  ? 94.346  84.276  114.483 1.00 75.95  ?  278  GLN B CG    1 
ATOM   7113  C  CD    . GLN B 2 281  ? 94.043  83.684  113.111 1.00 73.64  ?  278  GLN B CD    1 
ATOM   7114  O  OE1   . GLN B 2 281  ? 93.352  84.300  112.297 1.00 76.79  ?  278  GLN B OE1   1 
ATOM   7115  N  NE2   . GLN B 2 281  ? 94.572  82.495  112.846 1.00 70.86  ?  278  GLN B NE2   1 
ATOM   7116  N  N     . SER B 2 282  ? 97.028  83.978  116.105 1.00 70.35  ?  279  SER B N     1 
ATOM   7117  C  CA    . SER B 2 282  ? 98.373  83.742  115.608 1.00 69.52  ?  279  SER B CA    1 
ATOM   7118  C  C     . SER B 2 282  ? 99.352  84.618  116.375 1.00 73.26  ?  279  SER B C     1 
ATOM   7119  O  O     . SER B 2 282  ? 98.967  85.497  117.150 1.00 67.71  ?  279  SER B O     1 
ATOM   7120  C  CB    . SER B 2 282  ? 98.495  84.028  114.102 1.00 74.23  ?  279  SER B CB    1 
ATOM   7121  O  OG    . SER B 2 282  ? 99.054  85.311  113.872 1.00 71.04  ?  279  SER B OG    1 
ATOM   7122  N  N     . GLU B 2 283  ? 100.642 84.369  116.144 1.00 79.73  ?  280  GLU B N     1 
ATOM   7123  C  CA    . GLU B 2 283  ? 101.683 85.190  116.747 1.00 78.70  ?  280  GLU B CA    1 
ATOM   7124  C  C     . GLU B 2 283  ? 101.618 86.631  116.264 1.00 68.35  ?  280  GLU B C     1 
ATOM   7125  O  O     . GLU B 2 283  ? 102.246 87.506  116.869 1.00 64.84  ?  280  GLU B O     1 
ATOM   7126  C  CB    . GLU B 2 283  ? 103.059 84.579  116.449 1.00 91.72  ?  280  GLU B CB    1 
ATOM   7127  C  CG    . GLU B 2 283  ? 103.109 83.043  116.487 1.00 113.11 ?  280  GLU B CG    1 
ATOM   7128  C  CD    . GLU B 2 283  ? 102.880 82.457  117.877 1.00 127.36 ?  280  GLU B CD    1 
ATOM   7129  O  OE1   . GLU B 2 283  ? 103.103 83.182  118.871 1.00 108.20 ?  280  GLU B OE1   1 
ATOM   7130  O  OE2   . GLU B 2 283  ? 102.471 81.276  117.971 1.00 225.58 -1 280  GLU B OE2   1 
ATOM   7131  N  N     . THR B 2 284  ? 100.880 86.889  115.205 1.00 61.61  ?  281  THR B N     1 
ATOM   7132  C  CA    . THR B 2 284  ? 100.632 88.235  114.711 1.00 63.14  ?  281  THR B CA    1 
ATOM   7133  C  C     . THR B 2 284  ? 99.154  88.521  114.483 1.00 62.58  ?  281  THR B C     1 
ATOM   7134  O  O     . THR B 2 284  ? 98.690  89.617  114.798 1.00 59.76  ?  281  THR B O     1 
ATOM   7135  C  CB    . THR B 2 284  ? 101.422 88.468  113.414 1.00 65.06  ?  281  THR B CB    1 
ATOM   7136  O  OG1   . THR B 2 284  ? 100.937 89.645  112.748 1.00 66.11  ?  281  THR B OG1   1 
ATOM   7137  C  CG2   . THR B 2 284  ? 101.307 87.267  112.498 1.00 65.62  ?  281  THR B CG2   1 
ATOM   7138  N  N     . GLN B 2 285  ? 98.394  87.560  113.965 1.00 68.90  ?  282  GLN B N     1 
ATOM   7139  C  CA    . GLN B 2 285  ? 96.960  87.753  113.782 1.00 74.25  ?  282  GLN B CA    1 
ATOM   7140  C  C     . GLN B 2 285  ? 96.256  87.596  115.122 1.00 60.12  ?  282  GLN B C     1 
ATOM   7141  O  O     . GLN B 2 285  ? 96.400  86.568  115.789 1.00 61.46  ?  282  GLN B O     1 
ATOM   7142  C  CB    . GLN B 2 285  ? 96.387  86.749  112.770 1.00 87.17  ?  282  GLN B CB    1 
ATOM   7143  C  CG    . GLN B 2 285  ? 96.974  86.789  111.347 1.00 97.57  ?  282  GLN B CG    1 
ATOM   7144  C  CD    . GLN B 2 285  ? 96.665  85.529  110.518 1.00 117.85 ?  282  GLN B CD    1 
ATOM   7145  O  OE1   . GLN B 2 285  ? 96.109  84.550  111.023 1.00 96.55  ?  282  GLN B OE1   1 
ATOM   7146  N  NE2   . GLN B 2 285  ? 97.029  85.560  109.239 1.00 116.63 ?  282  GLN B NE2   1 
ATOM   7147  N  N     . LYS B 2 286  ? 95.489  88.606  115.508 1.00 55.82  ?  283  LYS B N     1 
ATOM   7148  C  CA    . LYS B 2 286  ? 94.622  88.497  116.669 1.00 52.92  ?  283  LYS B CA    1 
ATOM   7149  C  C     . LYS B 2 286  ? 93.221  88.123  116.208 1.00 57.88  ?  283  LYS B C     1 
ATOM   7150  O  O     . LYS B 2 286  ? 92.739  88.623  115.189 1.00 59.20  ?  283  LYS B O     1 
ATOM   7151  C  CB    . LYS B 2 286  ? 94.601  89.796  117.476 1.00 49.46  ?  283  LYS B CB    1 
ATOM   7152  C  CG    . LYS B 2 286  ? 93.844  90.936  116.840 1.00 45.25  ?  283  LYS B CG    1 
ATOM   7153  C  CD    . LYS B 2 286  ? 94.791  91.919  116.216 1.00 43.75  ?  283  LYS B CD    1 
ATOM   7154  C  CE    . LYS B 2 286  ? 94.072  93.201  115.866 1.00 47.79  ?  283  LYS B CE    1 
ATOM   7155  N  NZ    . LYS B 2 286  ? 95.015  94.223  115.346 1.00 50.73  ?  283  LYS B NZ    1 
ATOM   7156  N  N     . ARG B 2 287  ? 92.583  87.217  116.948 1.00 61.51  ?  284  ARG B N     1 
ATOM   7157  C  CA    . ARG B 2 287  ? 91.261  86.734  116.566 1.00 68.01  ?  284  ARG B CA    1 
ATOM   7158  C  C     . ARG B 2 287  ? 90.243  87.851  116.734 1.00 67.42  ?  284  ARG B C     1 
ATOM   7159  O  O     . ARG B 2 287  ? 89.990  88.314  117.849 1.00 66.58  ?  284  ARG B O     1 
ATOM   7160  C  CB    . ARG B 2 287  ? 90.871  85.507  117.392 1.00 71.80  ?  284  ARG B CB    1 
ATOM   7161  C  CG    . ARG B 2 287  ? 89.363  85.250  117.486 1.00 80.01  ?  284  ARG B CG    1 
ATOM   7162  C  CD    . ARG B 2 287  ? 89.035  83.942  118.208 1.00 83.23  ?  284  ARG B CD    1 
ATOM   7163  N  NE    . ARG B 2 287  ? 89.320  82.767  117.388 1.00 80.64  ?  284  ARG B NE    1 
ATOM   7164  C  CZ    . ARG B 2 287  ? 90.481  82.117  117.388 1.00 69.93  ?  284  ARG B CZ    1 
ATOM   7165  N  NH1   . ARG B 2 287  ? 91.474  82.529  118.166 1.00 63.92  ?  284  ARG B NH1   1 
ATOM   7166  N  NH2   . ARG B 2 287  ? 90.654  81.056  116.608 1.00 66.81  ?  284  ARG B NH2   1 
ATOM   7167  N  N     . MET B 2 288  ? 89.661  88.287  115.626 1.00 66.99  ?  285  MET B N     1 
ATOM   7168  C  CA    . MET B 2 288  ? 88.741  89.411  115.686 1.00 66.95  ?  285  MET B CA    1 
ATOM   7169  C  C     . MET B 2 288  ? 87.365  88.976  116.172 1.00 74.85  ?  285  MET B C     1 
ATOM   7170  O  O     . MET B 2 288  ? 86.761  89.644  117.018 1.00 76.29  ?  285  MET B O     1 
ATOM   7171  C  CB    . MET B 2 288  ? 88.639  90.062  114.310 1.00 67.79  ?  285  MET B CB    1 
ATOM   7172  C  CG    . MET B 2 288  ? 89.794  90.994  113.988 1.00 69.80  ?  285  MET B CG    1 
ATOM   7173  S  SD    . MET B 2 288  ? 89.974  92.285  115.239 1.00 67.50  ?  285  MET B SD    1 
ATOM   7174  C  CE    . MET B 2 288  ? 90.775  93.586  114.301 1.00 64.79  ?  285  MET B CE    1 
ATOM   7175  N  N     . GLU B 2 289  ? 86.878  87.837  115.687 1.00 85.09  ?  286  GLU B N     1 
ATOM   7176  C  CA    . GLU B 2 289  ? 85.477  87.497  115.865 1.00 92.84  ?  286  GLU B CA    1 
ATOM   7177  C  C     . GLU B 2 289  ? 85.191  87.073  117.305 1.00 90.64  ?  286  GLU B C     1 
ATOM   7178  O  O     . GLU B 2 289  ? 86.094  86.846  118.118 1.00 83.78  ?  286  GLU B O     1 
ATOM   7179  C  CB    . GLU B 2 289  ? 85.060  86.375  114.913 1.00 106.05 ?  286  GLU B CB    1 
ATOM   7180  C  CG    . GLU B 2 289  ? 85.517  84.994  115.364 1.00 114.95 ?  286  GLU B CG    1 
ATOM   7181  C  CD    . GLU B 2 289  ? 87.006  84.753  115.179 1.00 122.33 ?  286  GLU B CD    1 
ATOM   7182  O  OE1   . GLU B 2 289  ? 87.720  85.656  114.692 1.00 109.08 ?  286  GLU B OE1   1 
ATOM   7183  O  OE2   . GLU B 2 289  ? 87.472  83.662  115.573 1.00 188.18 -1 286  GLU B OE2   1 
ATOM   7184  N  N     . CYS B 2 290  ? 83.901  86.946  117.600 1.00 90.61  ?  287  CYS B N     1 
ATOM   7185  C  CA    . CYS B 2 290  ? 83.409  86.533  118.904 1.00 87.68  ?  287  CYS B CA    1 
ATOM   7186  C  C     . CYS B 2 290  ? 83.259  85.011  118.911 1.00 80.82  ?  287  CYS B C     1 
ATOM   7187  O  O     . CYS B 2 290  ? 83.702  84.322  117.991 1.00 82.02  ?  287  CYS B O     1 
ATOM   7188  C  CB    . CYS B 2 290  ? 82.090  87.242  119.209 1.00 95.02  ?  287  CYS B CB    1 
ATOM   7189  S  SG    . CYS B 2 290  ? 82.003  88.950  118.615 1.00 124.29 ?  287  CYS B SG    1 
ATOM   7190  N  N     . THR B 2 291  ? 82.637  84.465  119.954 1.00 77.57  ?  288  THR B N     1 
ATOM   7191  C  CA    . THR B 2 291  ? 82.304  83.045  119.990 1.00 76.33  ?  288  THR B CA    1 
ATOM   7192  C  C     . THR B 2 291  ? 81.199  82.835  121.015 1.00 76.75  ?  288  THR B C     1 
ATOM   7193  O  O     . THR B 2 291  ? 81.309  83.329  122.138 1.00 72.10  ?  288  THR B O     1 
ATOM   7194  C  CB    . THR B 2 291  ? 83.533  82.205  120.353 1.00 72.62  ?  288  THR B CB    1 
ATOM   7195  O  OG1   . THR B 2 291  ? 84.542  82.363  119.347 1.00 72.18  ?  288  THR B OG1   1 
ATOM   7196  C  CG2   . THR B 2 291  ? 83.163  80.739  120.465 1.00 75.97  ?  288  THR B CG2   1 
ATOM   7197  N  N     . TYR B 2 292  ? 80.142  82.116  120.636 1.00 80.56  ?  289  TYR B N     1 
ATOM   7198  C  CA    . TYR B 2 292  ? 79.084  81.728  121.559 1.00 80.69  ?  289  TYR B CA    1 
ATOM   7199  C  C     . TYR B 2 292  ? 79.254  80.256  121.892 1.00 78.24  ?  289  TYR B C     1 
ATOM   7200  O  O     . TYR B 2 292  ? 79.401  79.422  120.986 1.00 81.79  ?  289  TYR B O     1 
ATOM   7201  C  CB    . TYR B 2 292  ? 77.691  81.950  120.966 1.00 87.89  ?  289  TYR B CB    1 
ATOM   7202  C  CG    . TYR B 2 292  ? 76.603  81.191  121.707 1.00 95.99  ?  289  TYR B CG    1 
ATOM   7203  C  CD1   . TYR B 2 292  ? 76.120  81.632  122.933 1.00 98.85  ?  289  TYR B CD1   1 
ATOM   7204  C  CD2   . TYR B 2 292  ? 76.108  79.993  121.210 1.00 97.60  ?  289  TYR B CD2   1 
ATOM   7205  C  CE1   . TYR B 2 292  ? 75.135  80.924  123.615 1.00 102.86 ?  289  TYR B CE1   1 
ATOM   7206  C  CE2   . TYR B 2 292  ? 75.137  79.282  121.881 1.00 98.30  ?  289  TYR B CE2   1 
ATOM   7207  C  CZ    . TYR B 2 292  ? 74.653  79.744  123.079 1.00 102.61 ?  289  TYR B CZ    1 
ATOM   7208  O  OH    . TYR B 2 292  ? 73.684  79.029  123.742 1.00 107.14 ?  289  TYR B OH    1 
ATOM   7209  N  N     . VAL B 2 293  ? 79.204  79.936  123.184 1.00 75.67  ?  290  VAL B N     1 
ATOM   7210  C  CA    . VAL B 2 293  ? 79.399  78.573  123.653 1.00 75.04  ?  290  VAL B CA    1 
ATOM   7211  C  C     . VAL B 2 293  ? 78.313  78.263  124.671 1.00 78.98  ?  290  VAL B C     1 
ATOM   7212  O  O     . VAL B 2 293  ? 78.212  78.944  125.699 1.00 79.86  ?  290  VAL B O     1 
ATOM   7213  C  CB    . VAL B 2 293  ? 80.780  78.376  124.295 1.00 71.02  ?  290  VAL B CB    1 
ATOM   7214  C  CG1   . VAL B 2 293  ? 80.948  76.935  124.746 1.00 80.02  ?  290  VAL B CG1   1 
ATOM   7215  C  CG2   . VAL B 2 293  ? 81.879  78.804  123.353 1.00 69.40  ?  290  VAL B CG2   1 
ATOM   7216  N  N     . GLY B 2 294  ? 77.507  77.245  124.395 1.00 84.06  ?  291  GLY B N     1 
ATOM   7217  C  CA    . GLY B 2 294  ? 76.670  76.636  125.406 1.00 88.76  ?  291  GLY B CA    1 
ATOM   7218  C  C     . GLY B 2 294  ? 77.339  75.363  125.891 1.00 93.07  ?  291  GLY B C     1 
ATOM   7219  O  O     . GLY B 2 294  ? 78.027  74.683  125.133 1.00 94.35  ?  291  GLY B O     1 
ATOM   7220  N  N     . LEU B 2 295  ? 77.147  75.049  127.169 1.00 93.19  ?  292  LEU B N     1 
ATOM   7221  C  CA    . LEU B 2 295  ? 77.697  73.828  127.746 1.00 95.32  ?  292  LEU B CA    1 
ATOM   7222  C  C     . LEU B 2 295  ? 76.587  73.048  128.427 1.00 97.79  ?  292  LEU B C     1 
ATOM   7223  O  O     . LEU B 2 295  ? 75.982  73.535  129.388 1.00 94.53  ?  292  LEU B O     1 
ATOM   7224  C  CB    . LEU B 2 295  ? 78.819  74.128  128.741 1.00 89.60  ?  292  LEU B CB    1 
ATOM   7225  C  CG    . LEU B 2 295  ? 79.785  72.955  128.910 1.00 87.76  ?  292  LEU B CG    1 
ATOM   7226  C  CD1   . LEU B 2 295  ? 80.421  72.585  127.584 1.00 84.48  ?  292  LEU B CD1   1 
ATOM   7227  C  CD2   . LEU B 2 295  ? 80.846  73.235  129.961 1.00 99.67  ?  292  LEU B CD2   1 
ATOM   7228  N  N     . ASP B 2 296  ? 76.329  71.838  127.938 1.00 105.55 ?  293  ASP B N     1 
ATOM   7229  C  CA    . ASP B 2 296  ? 75.385  70.928  128.555 1.00 112.98 ?  293  ASP B CA    1 
ATOM   7230  C  C     . ASP B 2 296  ? 76.149  69.673  128.951 1.00 119.39 ?  293  ASP B C     1 
ATOM   7231  O  O     . ASP B 2 296  ? 77.249  69.416  128.452 1.00 117.65 ?  293  ASP B O     1 
ATOM   7232  C  CB    . ASP B 2 296  ? 74.238  70.584  127.592 1.00 124.26 ?  293  ASP B CB    1 
ATOM   7233  C  CG    . ASP B 2 296  ? 73.199  69.668  128.213 1.00 148.65 ?  293  ASP B CG    1 
ATOM   7234  O  OD1   . ASP B 2 296  ? 73.095  69.638  129.458 1.00 141.08 ?  293  ASP B OD1   1 
ATOM   7235  O  OD2   . ASP B 2 296  ? 72.491  68.973  127.452 1.00 247.35 -1 293  ASP B OD2   1 
ATOM   7236  N  N     . ASP B 2 297  ? 75.558  68.890  129.859 1.00 128.05 ?  294  ASP B N     1 
ATOM   7237  C  CA    . ASP B 2 297  ? 76.169  67.632  130.282 1.00 135.29 ?  294  ASP B CA    1 
ATOM   7238  C  C     . ASP B 2 297  ? 76.431  66.691  129.111 1.00 134.24 ?  294  ASP B C     1 
ATOM   7239  O  O     . ASP B 2 297  ? 77.357  65.873  129.179 1.00 121.79 ?  294  ASP B O     1 
ATOM   7240  C  CB    . ASP B 2 297  ? 75.286  66.955  131.344 1.00 144.14 ?  294  ASP B CB    1 
ATOM   7241  C  CG    . ASP B 2 297  ? 73.832  66.777  130.895 1.00 160.51 ?  294  ASP B CG    1 
ATOM   7242  O  OD1   . ASP B 2 297  ? 73.543  66.911  129.688 1.00 152.93 ?  294  ASP B OD1   1 
ATOM   7243  O  OD2   . ASP B 2 297  ? 72.971  66.502  131.764 1.00 212.97 -1 294  ASP B OD2   1 
ATOM   7244  N  N     . VAL B 2 298  ? 75.654  66.807  128.032 1.00 134.64 ?  295  VAL B N     1 
ATOM   7245  C  CA    . VAL B 2 298  ? 75.910  66.016  126.832 1.00 125.57 ?  295  VAL B CA    1 
ATOM   7246  C  C     . VAL B 2 298  ? 77.199  66.474  126.156 1.00 113.51 ?  295  VAL B C     1 
ATOM   7247  O  O     . VAL B 2 298  ? 78.030  65.650  125.754 1.00 106.82 ?  295  VAL B O     1 
ATOM   7248  C  CB    . VAL B 2 298  ? 74.705  66.089  125.876 1.00 123.49 ?  295  VAL B CB    1 
ATOM   7249  C  CG1   . VAL B 2 298  ? 74.938  65.222  124.649 1.00 110.73 ?  295  VAL B CG1   1 
ATOM   7250  C  CG2   . VAL B 2 298  ? 73.428  65.663  126.589 1.00 127.35 ?  295  VAL B CG2   1 
ATOM   7251  N  N     . GLY B 2 299  ? 77.395  67.784  126.031 1.00 110.24 ?  296  GLY B N     1 
ATOM   7252  C  CA    . GLY B 2 299  ? 78.612  68.283  125.422 1.00 103.62 ?  296  GLY B CA    1 
ATOM   7253  C  C     . GLY B 2 299  ? 78.571  69.783  125.193 1.00 102.66 ?  296  GLY B C     1 
ATOM   7254  O  O     . GLY B 2 299  ? 77.693  70.496  125.695 1.00 104.21 ?  296  GLY B O     1 
ATOM   7255  N  N     . VAL B 2 300  ? 79.577  70.248  124.437 1.00 104.47 ?  297  VAL B N     1 
ATOM   7256  C  CA    . VAL B 2 300  ? 79.723  71.657  124.083 1.00 102.77 ?  297  VAL B CA    1 
ATOM   7257  C  C     . VAL B 2 300  ? 78.931  71.939  122.813 1.00 105.93 ?  297  VAL B C     1 
ATOM   7258  O  O     . VAL B 2 300  ? 78.755  71.066  121.956 1.00 107.33 ?  297  VAL B O     1 
ATOM   7259  C  CB    . VAL B 2 300  ? 81.215  72.025  123.923 1.00 96.33  ?  297  VAL B CB    1 
ATOM   7260  C  CG1   . VAL B 2 300  ? 81.870  71.211  122.810 1.00 101.14 ?  297  VAL B CG1   1 
ATOM   7261  C  CG2   . VAL B 2 300  ? 81.396  73.511  123.681 1.00 89.02  ?  297  VAL B CG2   1 
ATOM   7262  N  N     . HIS B 2 301  ? 78.425  73.165  122.698 1.00 104.73 ?  298  HIS B N     1 
ATOM   7263  C  CA    . HIS B 2 301  ? 77.576  73.570  121.585 1.00 110.64 ?  298  HIS B CA    1 
ATOM   7264  C  C     . HIS B 2 301  ? 78.035  74.940  121.111 1.00 101.06 ?  298  HIS B C     1 
ATOM   7265  O  O     . HIS B 2 301  ? 77.943  75.922  121.854 1.00 94.45  ?  298  HIS B O     1 
ATOM   7266  C  CB    . HIS B 2 301  ? 76.109  73.564  122.020 1.00 127.46 ?  298  HIS B CB    1 
ATOM   7267  C  CG    . HIS B 2 301  ? 75.769  72.407  122.910 1.00 123.29 ?  298  HIS B CG    1 
ATOM   7268  N  ND1   . HIS B 2 301  ? 75.824  71.100  122.472 1.00 119.50 ?  298  HIS B ND1   1 
ATOM   7269  C  CD2   . HIS B 2 301  ? 75.431  72.349  124.220 1.00 117.80 ?  298  HIS B CD2   1 
ATOM   7270  C  CE1   . HIS B 2 301  ? 75.502  70.289  123.463 1.00 112.66 ?  298  HIS B CE1   1 
ATOM   7271  N  NE2   . HIS B 2 301  ? 75.261  71.022  124.536 1.00 115.56 ?  298  HIS B NE2   1 
ATOM   7272  N  N     . MET B 2 302  ? 78.524  75.001  119.877 1.00 103.29 ?  299  MET B N     1 
ATOM   7273  C  CA    . MET B 2 302  ? 79.350  76.099  119.403 1.00 101.86 ?  299  MET B CA    1 
ATOM   7274  C  C     . MET B 2 302  ? 78.642  76.894  118.314 1.00 104.26 ?  299  MET B C     1 
ATOM   7275  O  O     . MET B 2 302  ? 77.907  76.333  117.496 1.00 101.69 ?  299  MET B O     1 
ATOM   7276  C  CB    . MET B 2 302  ? 80.674  75.555  118.857 1.00 98.99  ?  299  MET B CB    1 
ATOM   7277  C  CG    . MET B 2 302  ? 81.715  76.609  118.615 1.00 101.21 ?  299  MET B CG    1 
ATOM   7278  S  SD    . MET B 2 302  ? 82.114  77.381  120.187 1.00 110.14 ?  299  MET B SD    1 
ATOM   7279  C  CE    . MET B 2 302  ? 82.452  75.931  121.186 1.00 89.82  ?  299  MET B CE    1 
ATOM   7280  N  N     . GLU B 2 303  ? 78.875  78.209  118.303 1.00 101.22 ?  300  GLU B N     1 
ATOM   7281  C  CA    . GLU B 2 303  ? 78.405  79.039  117.199 1.00 97.41  ?  300  GLU B CA    1 
ATOM   7282  C  C     . GLU B 2 303  ? 79.188  80.346  117.210 1.00 85.90  ?  300  GLU B C     1 
ATOM   7283  O  O     . GLU B 2 303  ? 79.932  80.641  118.148 1.00 85.51  ?  300  GLU B O     1 
ATOM   7284  C  CB    . GLU B 2 303  ? 76.891  79.303  117.283 1.00 103.29 ?  300  GLU B CB    1 
ATOM   7285  C  CG    . GLU B 2 303  ? 76.507  80.615  117.953 1.00 103.51 ?  300  GLU B CG    1 
ATOM   7286  C  CD    . GLU B 2 303  ? 75.003  80.790  118.153 1.00 119.79 ?  300  GLU B CD    1 
ATOM   7287  O  OE1   . GLU B 2 303  ? 74.211  80.089  117.488 1.00 120.12 ?  300  GLU B OE1   1 
ATOM   7288  O  OE2   . GLU B 2 303  ? 74.613  81.666  118.961 1.00 147.66 -1 300  GLU B OE2   1 
ATOM   7289  N  N     . SER B 2 304  ? 79.020  81.124  116.146 1.00 79.17  ?  301  SER B N     1 
ATOM   7290  C  CA    . SER B 2 304  ? 79.539  82.481  116.091 1.00 72.15  ?  301  SER B CA    1 
ATOM   7291  C  C     . SER B 2 304  ? 78.407  83.485  116.295 1.00 72.79  ?  301  SER B C     1 
ATOM   7292  O  O     . SER B 2 304  ? 77.225  83.141  116.321 1.00 76.89  ?  301  SER B O     1 
ATOM   7293  C  CB    . SER B 2 304  ? 80.242  82.739  114.756 1.00 68.44  ?  301  SER B CB    1 
ATOM   7294  O  OG    . SER B 2 304  ? 80.432  84.129  114.547 1.00 67.38  ?  301  SER B OG    1 
ATOM   7295  N  N     . ARG B 2 305  ? 78.785  84.747  116.437 1.00 64.65  ?  302  ARG B N     1 
ATOM   7296  C  CA    . ARG B 2 305  ? 77.842  85.848  116.473 1.00 60.87  ?  302  ARG B CA    1 
ATOM   7297  C  C     . ARG B 2 305  ? 78.341  86.920  115.518 1.00 68.41  ?  302  ARG B C     1 
ATOM   7298  O  O     . ARG B 2 305  ? 79.407  86.787  114.909 1.00 69.41  ?  302  ARG B O     1 
ATOM   7299  C  CB    . ARG B 2 305  ? 77.675  86.386  117.897 1.00 60.43  ?  302  ARG B CB    1 
ATOM   7300  C  CG    . ARG B 2 305  ? 76.910  85.460  118.829 1.00 61.18  ?  302  ARG B CG    1 
ATOM   7301  C  CD    . ARG B 2 305  ? 75.411  85.641  118.657 1.00 73.21  ?  302  ARG B CD    1 
ATOM   7302  N  NE    . ARG B 2 305  ? 74.984  86.993  119.016 1.00 84.16  ?  302  ARG B NE    1 
ATOM   7303  C  CZ    . ARG B 2 305  ? 73.716  87.383  119.137 1.00 89.45  ?  302  ARG B CZ    1 
ATOM   7304  N  NH1   . ARG B 2 305  ? 73.432  88.639  119.468 1.00 83.11  ?  302  ARG B NH1   1 
ATOM   7305  N  NH2   . ARG B 2 305  ? 72.730  86.523  118.932 1.00 94.40  ?  302  ARG B NH2   1 
ATOM   7306  N  N     . GLU B 2 306  ? 77.564  87.981  115.368 1.00 74.95  ?  303  GLU B N     1 
ATOM   7307  C  CA    . GLU B 2 306  ? 78.014  89.110  114.567 1.00 91.53  ?  303  GLU B CA    1 
ATOM   7308  C  C     . GLU B 2 306  ? 79.072  89.879  115.347 1.00 91.08  ?  303  GLU B C     1 
ATOM   7309  O  O     . GLU B 2 306  ? 78.754  90.465  116.388 1.00 86.87  ?  303  GLU B O     1 
ATOM   7310  C  CB    . GLU B 2 306  ? 76.849  90.031  114.212 1.00 106.26 ?  303  GLU B CB    1 
ATOM   7311  C  CG    . GLU B 2 306  ? 77.279  91.307  113.482 1.00 128.79 ?  303  GLU B CG    1 
ATOM   7312  C  CD    . GLU B 2 306  ? 76.124  92.035  112.797 1.00 165.32 ?  303  GLU B CD    1 
ATOM   7313  O  OE1   . GLU B 2 306  ? 75.062  91.414  112.580 1.00 156.98 ?  303  GLU B OE1   1 
ATOM   7314  O  OE2   . GLU B 2 306  ? 76.287  93.234  112.474 1.00 226.24 -1 303  GLU B OE2   1 
ATOM   7315  N  N     . PRO B 2 307  ? 80.321  89.901  114.898 1.00 91.41  ?  304  PRO B N     1 
ATOM   7316  C  CA    . PRO B 2 307  ? 81.353  90.632  115.628 1.00 86.02  ?  304  PRO B CA    1 
ATOM   7317  C  C     . PRO B 2 307  ? 81.164  92.130  115.485 1.00 79.17  ?  304  PRO B C     1 
ATOM   7318  O  O     . PRO B 2 307  ? 81.065  92.650  114.363 1.00 78.20  ?  304  PRO B O     1 
ATOM   7319  C  CB    . PRO B 2 307  ? 82.652  90.157  114.963 1.00 89.46  ?  304  PRO B CB    1 
ATOM   7320  C  CG    . PRO B 2 307  ? 82.242  89.805  113.575 1.00 96.36  ?  304  PRO B CG    1 
ATOM   7321  C  CD    . PRO B 2 307  ? 80.847  89.259  113.680 1.00 94.26  ?  304  PRO B CD    1 
ATOM   7322  N  N     . PRO B 2 308  ? 81.105  92.858  116.598 1.00 77.79  ?  305  PRO B N     1 
ATOM   7323  C  CA    . PRO B 2 308  ? 80.971  94.317  116.515 1.00 77.39  ?  305  PRO B CA    1 
ATOM   7324  C  C     . PRO B 2 308  ? 82.104  94.914  115.701 1.00 78.49  ?  305  PRO B C     1 
ATOM   7325  O  O     . PRO B 2 308  ? 83.281  94.678  115.980 1.00 78.24  ?  305  PRO B O     1 
ATOM   7326  C  CB    . PRO B 2 308  ? 81.030  94.767  117.979 1.00 74.23  ?  305  PRO B CB    1 
ATOM   7327  C  CG    . PRO B 2 308  ? 80.699  93.554  118.773 1.00 75.63  ?  305  PRO B CG    1 
ATOM   7328  C  CD    . PRO B 2 308  ? 81.203  92.389  117.987 1.00 75.60  ?  305  PRO B CD    1 
ATOM   7329  N  N     . GLN B 2 309  ? 81.736  95.686  114.681 1.00 81.15  ?  306  GLN B N     1 
ATOM   7330  C  CA    . GLN B 2 309  ? 82.733  96.307  113.818 1.00 83.81  ?  306  GLN B CA    1 
ATOM   7331  C  C     . GLN B 2 309  ? 83.656  97.206  114.642 1.00 84.14  ?  306  GLN B C     1 
ATOM   7332  O  O     . GLN B 2 309  ? 83.196  98.118  115.334 1.00 80.59  ?  306  GLN B O     1 
ATOM   7333  C  CB    . GLN B 2 309  ? 82.042  97.093  112.691 1.00 80.55  ?  306  GLN B CB    1 
ATOM   7334  C  CG    . GLN B 2 309  ? 81.358  98.437  113.052 1.00 84.08  ?  306  GLN B CG    1 
ATOM   7335  C  CD    . GLN B 2 309  ? 80.243  98.339  114.089 1.00 84.91  ?  306  GLN B CD    1 
ATOM   7336  O  OE1   . GLN B 2 309  ? 80.065  97.321  114.754 1.00 82.95  ?  306  GLN B OE1   1 
ATOM   7337  N  NE2   . GLN B 2 309  ? 79.500  99.429  114.245 1.00 88.60  ?  306  GLN B NE2   1 
ATOM   7338  N  N     . TRP B 2 310  ? 84.960  96.930  114.598 1.00 82.27  ?  307  TRP B N     1 
ATOM   7339  C  CA    . TRP B 2 310  ? 85.920  97.735  115.344 1.00 71.63  ?  307  TRP B CA    1 
ATOM   7340  C  C     . TRP B 2 310  ? 86.246  99.018  114.593 1.00 69.32  ?  307  TRP B C     1 
ATOM   7341  O  O     . TRP B 2 310  ? 86.212  99.069  113.362 1.00 73.02  ?  307  TRP B O     1 
ATOM   7342  C  CB    . TRP B 2 310  ? 87.218  96.968  115.605 1.00 64.97  ?  307  TRP B CB    1 
ATOM   7343  C  CG    . TRP B 2 310  ? 87.068  95.517  115.842 1.00 69.04  ?  307  TRP B CG    1 
ATOM   7344  C  CD1   . TRP B 2 310  ? 87.508  94.513  115.037 1.00 72.25  ?  307  TRP B CD1   1 
ATOM   7345  C  CD2   . TRP B 2 310  ? 86.426  94.889  116.954 1.00 70.28  ?  307  TRP B CD2   1 
ATOM   7346  N  NE1   . TRP B 2 310  ? 87.187  93.296  115.576 1.00 78.25  ?  307  TRP B NE1   1 
ATOM   7347  C  CE2   . TRP B 2 310  ? 86.518  93.498  116.754 1.00 76.01  ?  307  TRP B CE2   1 
ATOM   7348  C  CE3   . TRP B 2 310  ? 85.781  95.364  118.098 1.00 67.41  ?  307  TRP B CE3   1 
ATOM   7349  C  CZ2   . TRP B 2 310  ? 85.991  92.581  117.653 1.00 73.27  ?  307  TRP B CZ2   1 
ATOM   7350  C  CZ3   . TRP B 2 310  ? 85.260  94.456  118.985 1.00 67.49  ?  307  TRP B CZ3   1 
ATOM   7351  C  CH2   . TRP B 2 310  ? 85.366  93.080  118.761 1.00 68.28  ?  307  TRP B CH2   1 
ATOM   7352  N  N     . THR B 2 311  ? 86.546  100.069 115.351 1.00 64.10  ?  308  THR B N     1 
ATOM   7353  C  CA    . THR B 2 311  ? 87.096  101.273 114.749 1.00 63.43  ?  308  THR B CA    1 
ATOM   7354  C  C     . THR B 2 311  ? 88.410  100.929 114.061 1.00 62.42  ?  308  THR B C     1 
ATOM   7355  O  O     . THR B 2 311  ? 89.162  100.073 114.528 1.00 58.29  ?  308  THR B O     1 
ATOM   7356  C  CB    . THR B 2 311  ? 87.300  102.351 115.818 1.00 59.79  ?  308  THR B CB    1 
ATOM   7357  O  OG1   . THR B 2 311  ? 86.053  102.602 116.480 1.00 58.67  ?  308  THR B OG1   1 
ATOM   7358  C  CG2   . THR B 2 311  ? 87.784  103.652 115.203 1.00 61.91  ?  308  THR B CG2   1 
ATOM   7359  N  N     . SER B 2 312  ? 88.672  101.581 112.925 1.00 68.12  ?  309  SER B N     1 
ATOM   7360  C  CA    . SER B 2 312  ? 89.892  101.318 112.164 1.00 70.35  ?  309  SER B CA    1 
ATOM   7361  C  C     . SER B 2 312  ? 91.144  101.425 113.022 1.00 66.98  ?  309  SER B C     1 
ATOM   7362  O  O     . SER B 2 312  ? 92.185  100.860 112.669 1.00 69.24  ?  309  SER B O     1 
ATOM   7363  C  CB    . SER B 2 312  ? 89.988  102.290 110.981 1.00 73.97  ?  309  SER B CB    1 
ATOM   7364  O  OG    . SER B 2 312  ? 90.356  103.587 111.415 1.00 69.84  ?  309  SER B OG    1 
ATOM   7365  N  N     . GLU B 2 313  ? 91.060  102.141 114.141 1.00 65.34  ?  310  GLU B N     1 
ATOM   7366  C  CA    . GLU B 2 313  ? 92.170  102.216 115.080 1.00 67.88  ?  310  GLU B CA    1 
ATOM   7367  C  C     . GLU B 2 313  ? 92.556  100.835 115.600 1.00 62.59  ?  310  GLU B C     1 
ATOM   7368  O  O     . GLU B 2 313  ? 93.662  100.345 115.340 1.00 58.98  ?  310  GLU B O     1 
ATOM   7369  C  CB    . GLU B 2 313  ? 91.782  103.124 116.241 1.00 79.36  ?  310  GLU B CB    1 
ATOM   7370  C  CG    . GLU B 2 313  ? 92.933  103.515 117.127 1.00 98.51  ?  310  GLU B CG    1 
ATOM   7371  C  CD    . GLU B 2 313  ? 92.503  104.416 118.266 1.00 121.83 ?  310  GLU B CD    1 
ATOM   7372  O  OE1   . GLU B 2 313  ? 91.291  104.462 118.566 1.00 96.79  ?  310  GLU B OE1   1 
ATOM   7373  O  OE2   . GLU B 2 313  ? 93.380  105.070 118.869 1.00 260.06 -1 310  GLU B OE2   1 
ATOM   7374  N  N     . ILE B 2 314  ? 91.648  100.199 116.351 1.00 60.00  ?  311  ILE B N     1 
ATOM   7375  C  CA    . ILE B 2 314  ? 91.933  98.909  116.980 1.00 54.09  ?  311  ILE B CA    1 
ATOM   7376  C  C     . ILE B 2 314  ? 92.294  97.853  115.948 1.00 50.15  ?  311  ILE B C     1 
ATOM   7377  O  O     . ILE B 2 314  ? 93.132  96.981  116.204 1.00 48.11  ?  311  ILE B O     1 
ATOM   7378  C  CB    . ILE B 2 314  ? 90.749  98.465  117.861 1.00 53.36  ?  311  ILE B CB    1 
ATOM   7379  C  CG1   . ILE B 2 314  ? 90.879  96.986  118.244 1.00 50.42  ?  311  ILE B CG1   1 
ATOM   7380  C  CG2   . ILE B 2 314  ? 89.440  98.849  117.254 1.00 53.16  ?  311  ILE B CG2   1 
ATOM   7381  C  CD1   . ILE B 2 314  ? 89.836  96.479  119.214 1.00 57.24  ?  311  ILE B CD1   1 
ATOM   7382  N  N     . SER B 2 315  ? 91.670  97.903  114.775 1.00 56.39  ?  312  SER B N     1 
ATOM   7383  C  CA    . SER B 2 315  ? 92.018  96.954  113.726 1.00 60.13  ?  312  SER B CA    1 
ATOM   7384  C  C     . SER B 2 315  ? 93.493  97.031  113.342 1.00 60.55  ?  312  SER B C     1 
ATOM   7385  O  O     . SER B 2 315  ? 94.045  96.037  112.863 1.00 58.95  ?  312  SER B O     1 
ATOM   7386  C  CB    . SER B 2 315  ? 91.131  97.197  112.502 1.00 63.16  ?  312  SER B CB    1 
ATOM   7387  O  OG    . SER B 2 315  ? 91.467  96.335  111.428 1.00 59.32  ?  312  SER B OG    1 
ATOM   7388  N  N     . HIS B 2 316  ? 94.147  98.179  113.545 1.00 61.62  ?  313  HIS B N     1 
ATOM   7389  C  CA    . HIS B 2 316  ? 95.573  98.339  113.271 1.00 61.75  ?  313  HIS B CA    1 
ATOM   7390  C  C     . HIS B 2 316  ? 96.453  98.088  114.486 1.00 50.00  ?  313  HIS B C     1 
ATOM   7391  O  O     . HIS B 2 316  ? 97.679  98.184  114.375 1.00 48.24  ?  313  HIS B O     1 
ATOM   7392  C  CB    . HIS B 2 316  ? 95.869  99.743  112.728 1.00 67.52  ?  313  HIS B CB    1 
ATOM   7393  C  CG    . HIS B 2 316  ? 95.755  99.864  111.239 1.00 78.24  ?  313  HIS B CG    1 
ATOM   7394  N  ND1   . HIS B 2 316  ? 95.882  98.784  110.391 1.00 82.13  ?  313  HIS B ND1   1 
ATOM   7395  C  CD2   . HIS B 2 316  ? 95.553  100.943 110.446 1.00 84.60  ?  313  HIS B CD2   1 
ATOM   7396  C  CE1   . HIS B 2 316  ? 95.748  99.189  109.142 1.00 100.24 ?  313  HIS B CE1   1 
ATOM   7397  N  NE2   . HIS B 2 316  ? 95.548  100.495 109.147 1.00 91.12  ?  313  HIS B NE2   1 
ATOM   7398  N  N     . SER B 2 317  ? 95.866  97.772  115.635 1.00 48.80  ?  314  SER B N     1 
ATOM   7399  C  CA    . SER B 2 317  ? 96.649  97.554  116.842 1.00 50.87  ?  314  SER B CA    1 
ATOM   7400  C  C     . SER B 2 317  ? 97.376  96.220  116.781 1.00 44.33  ?  314  SER B C     1 
ATOM   7401  O  O     . SER B 2 317  ? 96.851  95.227  116.270 1.00 49.85  ?  314  SER B O     1 
ATOM   7402  C  CB    . SER B 2 317  ? 95.751  97.590  118.076 1.00 54.50  ?  314  SER B CB    1 
ATOM   7403  O  OG    . SER B 2 317  ? 96.330  96.877  119.157 1.00 45.14  ?  314  SER B OG    1 
ATOM   7404  N  N     . ARG B 2 318  ? 98.598  96.205  117.306 1.00 38.20  ?  315  ARG B N     1 
ATOM   7405  C  CA    . ARG B 2 318  ? 99.339  94.955  117.386 1.00 40.61  ?  315  ARG B CA    1 
ATOM   7406  C  C     . ARG B 2 318  ? 98.742  94.031  118.440 1.00 39.55  ?  315  ARG B C     1 
ATOM   7407  O  O     . ARG B 2 318  ? 98.623  92.822  118.216 1.00 45.66  ?  315  ARG B O     1 
ATOM   7408  C  CB    . ARG B 2 318  ? 100.810 95.235  117.691 1.00 43.72  ?  315  ARG B CB    1 
ATOM   7409  C  CG    . ARG B 2 318  ? 101.656 93.978  117.729 1.00 53.80  ?  315  ARG B CG    1 
ATOM   7410  C  CD    . ARG B 2 318  ? 101.691 93.328  116.361 1.00 67.41  ?  315  ARG B CD    1 
ATOM   7411  N  NE    . ARG B 2 318  ? 102.869 92.486  116.173 1.00 101.73 ?  315  ARG B NE    1 
ATOM   7412  C  CZ    . ARG B 2 318  ? 102.922 91.202  116.512 1.00 80.01  ?  315  ARG B CZ    1 
ATOM   7413  N  NH1   . ARG B 2 318  ? 104.025 90.495  116.301 1.00 75.77  ?  315  ARG B NH1   1 
ATOM   7414  N  NH2   . ARG B 2 318  ? 101.857 90.617  117.037 1.00 77.94  ?  315  ARG B NH2   1 
ATOM   7415  N  N     . THR B 2 319  ? 98.366  94.579  119.597 1.00 43.58  ?  316  THR B N     1 
ATOM   7416  C  CA    . THR B 2 319  ? 97.899  93.789  120.734 1.00 40.03  ?  316  THR B CA    1 
ATOM   7417  C  C     . THR B 2 319  ? 96.730  94.484  121.422 1.00 33.43  ?  316  THR B C     1 
ATOM   7418  O  O     . THR B 2 319  ? 96.446  95.655  121.173 1.00 35.22  ?  316  THR B O     1 
ATOM   7419  C  CB    . THR B 2 319  ? 99.005  93.567  121.774 1.00 41.13  ?  316  THR B CB    1 
ATOM   7420  O  OG1   . THR B 2 319  ? 99.328  94.822  122.389 1.00 39.27  ?  316  THR B OG1   1 
ATOM   7421  C  CG2   . THR B 2 319  ? 100.251 92.975  121.146 1.00 42.82  ?  316  THR B CG2   1 
ATOM   7422  N  N     . TRP B 2 320  ? 96.064  93.745  122.306 1.00 29.74  ?  317  TRP B N     1 
ATOM   7423  C  CA    . TRP B 2 320  ? 95.015  94.276  123.174 1.00 27.88  ?  317  TRP B CA    1 
ATOM   7424  C  C     . TRP B 2 320  ? 94.621  93.178  124.150 1.00 29.23  ?  317  TRP B C     1 
ATOM   7425  O  O     . TRP B 2 320  ? 95.164  92.069  124.117 1.00 33.06  ?  317  TRP B O     1 
ATOM   7426  C  CB    . TRP B 2 320  ? 93.791  94.756  122.401 1.00 29.98  ?  317  TRP B CB    1 
ATOM   7427  C  CG    . TRP B 2 320  ? 93.347  93.858  121.290 1.00 42.32  ?  317  TRP B CG    1 
ATOM   7428  C  CD1   . TRP B 2 320  ? 93.752  93.912  119.988 1.00 44.37  ?  317  TRP B CD1   1 
ATOM   7429  C  CD2   . TRP B 2 320  ? 92.373  92.811  121.367 1.00 37.79  ?  317  TRP B CD2   1 
ATOM   7430  N  NE1   . TRP B 2 320  ? 93.113  92.944  119.253 1.00 37.93  ?  317  TRP B NE1   1 
ATOM   7431  C  CE2   . TRP B 2 320  ? 92.261  92.256  120.076 1.00 41.18  ?  317  TRP B CE2   1 
ATOM   7432  C  CE3   . TRP B 2 320  ? 91.596  92.281  122.402 1.00 32.16  ?  317  TRP B CE3   1 
ATOM   7433  C  CZ2   . TRP B 2 320  ? 91.410  91.205  119.795 1.00 45.30  ?  317  TRP B CZ2   1 
ATOM   7434  C  CZ3   . TRP B 2 320  ? 90.752  91.237  122.121 1.00 33.37  ?  317  TRP B CZ3   1 
ATOM   7435  C  CH2   . TRP B 2 320  ? 90.662  90.711  120.827 1.00 42.49  ?  317  TRP B CH2   1 
ATOM   7436  N  N     . PHE B 2 321  ? 93.646  93.487  124.998 1.00 27.57  ?  318  PHE B N     1 
ATOM   7437  C  CA    . PHE B 2 321  ? 93.218  92.630  126.100 1.00 27.98  ?  318  PHE B CA    1 
ATOM   7438  C  C     . PHE B 2 321  ? 91.960  93.261  126.684 1.00 27.58  ?  318  PHE B C     1 
ATOM   7439  O  O     . PHE B 2 321  ? 91.550  94.351  126.272 1.00 29.02  ?  318  PHE B O     1 
ATOM   7440  C  CB    . PHE B 2 321  ? 94.313  92.506  127.148 1.00 23.62  ?  318  PHE B CB    1 
ATOM   7441  C  CG    . PHE B 2 321  ? 94.837  93.826  127.592 1.00 29.62  ?  318  PHE B CG    1 
ATOM   7442  C  CD1   . PHE B 2 321  ? 94.200  94.539  128.583 1.00 32.38  ?  318  PHE B CD1   1 
ATOM   7443  C  CD2   . PHE B 2 321  ? 95.945  94.380  126.987 1.00 32.47  ?  318  PHE B CD2   1 
ATOM   7444  C  CE1   . PHE B 2 321  ? 94.674  95.767  128.977 1.00 29.47  ?  318  PHE B CE1   1 
ATOM   7445  C  CE2   . PHE B 2 321  ? 96.418  95.611  127.376 1.00 32.66  ?  318  PHE B CE2   1 
ATOM   7446  C  CZ    . PHE B 2 321  ? 95.782  96.301  128.371 1.00 32.23  ?  318  PHE B CZ    1 
ATOM   7447  N  N     . GLY B 2 322  ? 91.366  92.593  127.666 1.00 26.79  ?  319  GLY B N     1 
ATOM   7448  C  CA    . GLY B 2 322  ? 90.194  93.165  128.299 1.00 37.50  ?  319  GLY B CA    1 
ATOM   7449  C  C     . GLY B 2 322  ? 89.698  92.315  129.448 1.00 36.51  ?  319  GLY B C     1 
ATOM   7450  O  O     . GLY B 2 322  ? 90.354  91.360  129.870 1.00 34.33  ?  319  GLY B O     1 
ATOM   7451  N  N     . GLY B 2 323  ? 88.522  92.686  129.952 1.00 34.09  ?  320  GLY B N     1 
ATOM   7452  C  CA    . GLY B 2 323  ? 87.900  91.961  131.045 1.00 35.77  ?  320  GLY B CA    1 
ATOM   7453  C  C     . GLY B 2 323  ? 86.396  92.141  131.026 1.00 38.76  ?  320  GLY B C     1 
ATOM   7454  O  O     . GLY B 2 323  ? 85.869  93.130  130.505 1.00 39.14  ?  320  GLY B O     1 
ATOM   7455  N  N     . SER B 2 324  ? 85.708  91.161  131.609 1.00 42.54  ?  321  SER B N     1 
ATOM   7456  C  CA    . SER B 2 324  ? 84.250  91.145  131.609 1.00 47.71  ?  321  SER B CA    1 
ATOM   7457  C  C     . SER B 2 324  ? 83.714  91.947  132.788 1.00 46.59  ?  321  SER B C     1 
ATOM   7458  O  O     . SER B 2 324  ? 83.887  91.552  133.945 1.00 43.42  ?  321  SER B O     1 
ATOM   7459  C  CB    . SER B 2 324  ? 83.733  89.707  131.661 1.00 51.77  ?  321  SER B CB    1 
ATOM   7460  O  OG    . SER B 2 324  ? 83.644  89.231  132.992 1.00 46.39  ?  321  SER B OG    1 
ATOM   7461  N  N     . LEU B 2 325  ? 83.045  93.062  132.494 1.00 47.25  ?  322  LEU B N     1 
ATOM   7462  C  CA    . LEU B 2 325  ? 82.332  93.789  133.536 1.00 48.60  ?  322  LEU B CA    1 
ATOM   7463  C  C     . LEU B 2 325  ? 81.083  93.052  133.990 1.00 51.65  ?  322  LEU B C     1 
ATOM   7464  O  O     . LEU B 2 325  ? 80.436  93.485  134.949 1.00 52.67  ?  322  LEU B O     1 
ATOM   7465  C  CB    . LEU B 2 325  ? 81.967  95.197  133.054 1.00 51.08  ?  322  LEU B CB    1 
ATOM   7466  C  CG    . LEU B 2 325  ? 83.111  96.092  132.570 1.00 49.71  ?  322  LEU B CG    1 
ATOM   7467  C  CD1   . LEU B 2 325  ? 82.625  97.511  132.314 1.00 58.48  ?  322  LEU B CD1   1 
ATOM   7468  C  CD2   . LEU B 2 325  ? 84.270  96.099  133.542 1.00 42.58  ?  322  LEU B CD2   1 
ATOM   7469  N  N     . GLY B 2 326  ? 80.732  91.958  133.325 1.00 58.58  ?  323  GLY B N     1 
ATOM   7470  C  CA    . GLY B 2 326  ? 79.659  91.103  133.781 1.00 63.08  ?  323  GLY B CA    1 
ATOM   7471  C  C     . GLY B 2 326  ? 78.399  91.239  132.954 1.00 65.16  ?  323  GLY B C     1 
ATOM   7472  O  O     . GLY B 2 326  ? 78.054  92.337  132.512 1.00 61.02  ?  323  GLY B O     1 
ATOM   7473  N  N     . LYS B 2 327  ? 77.710  90.119  132.735 1.00 66.85  ?  324  LYS B N     1 
ATOM   7474  C  CA    . LYS B 2 327  ? 76.388  90.094  132.112 1.00 68.50  ?  324  LYS B CA    1 
ATOM   7475  C  C     . LYS B 2 327  ? 76.428  90.654  130.687 1.00 70.84  ?  324  LYS B C     1 
ATOM   7476  O  O     . LYS B 2 327  ? 75.861  91.702  130.382 1.00 71.89  ?  324  LYS B O     1 
ATOM   7477  C  CB    . LYS B 2 327  ? 75.367  90.836  132.984 1.00 71.50  ?  324  LYS B CB    1 
ATOM   7478  C  CG    . LYS B 2 327  ? 75.430  90.485  134.472 1.00 68.68  ?  324  LYS B CG    1 
ATOM   7479  C  CD    . LYS B 2 327  ? 75.191  88.994  134.687 1.00 69.80  ?  324  LYS B CD    1 
ATOM   7480  C  CE    . LYS B 2 327  ? 73.803  88.574  134.220 1.00 77.20  ?  324  LYS B CE    1 
ATOM   7481  N  NZ    . LYS B 2 327  ? 73.562  87.110  134.387 1.00 77.48  ?  324  LYS B NZ    1 
ATOM   7482  N  N     . GLY B 2 328  ? 77.119  89.923  129.813 1.00 71.75  ?  325  GLY B N     1 
ATOM   7483  C  CA    . GLY B 2 328  ? 77.278  90.315  128.428 1.00 73.43  ?  325  GLY B CA    1 
ATOM   7484  C  C     . GLY B 2 328  ? 78.115  91.549  128.205 1.00 67.42  ?  325  GLY B C     1 
ATOM   7485  O  O     . GLY B 2 328  ? 78.428  91.866  127.049 1.00 65.75  ?  325  GLY B O     1 
ATOM   7486  N  N     . THR B 2 329  ? 78.486  92.252  129.268 1.00 69.23  ?  326  THR B N     1 
ATOM   7487  C  CA    . THR B 2 329  ? 79.261  93.479  129.195 1.00 70.37  ?  326  THR B CA    1 
ATOM   7488  C  C     . THR B 2 329  ? 80.716  93.189  129.532 1.00 66.26  ?  326  THR B C     1 
ATOM   7489  O  O     . THR B 2 329  ? 81.004  92.420  130.454 1.00 61.23  ?  326  THR B O     1 
ATOM   7490  C  CB    . THR B 2 329  ? 78.707  94.526  130.169 1.00 74.52  ?  326  THR B CB    1 
ATOM   7491  O  OG1   . THR B 2 329  ? 77.282  94.396  130.258 1.00 74.84  ?  326  THR B OG1   1 
ATOM   7492  C  CG2   . THR B 2 329  ? 79.049  95.939  129.708 1.00 71.45  ?  326  THR B CG2   1 
ATOM   7493  N  N     . ALA B 2 330  ? 81.625  93.830  128.800 1.00 62.54  ?  327  ALA B N     1 
ATOM   7494  C  CA    . ALA B 2 330  ? 83.055  93.650  129.007 1.00 59.99  ?  327  ALA B CA    1 
ATOM   7495  C  C     . ALA B 2 330  ? 83.780  94.938  128.631 1.00 56.04  ?  327  ALA B C     1 
ATOM   7496  O  O     . ALA B 2 330  ? 83.220  95.815  127.967 1.00 54.84  ?  327  ALA B O     1 
ATOM   7497  C  CB    . ALA B 2 330  ? 83.590  92.465  128.191 1.00 56.12  ?  327  ALA B CB    1 
ATOM   7498  N  N     . LEU B 2 331  ? 85.038  95.044  129.067 1.00 45.87  ?  328  LEU B N     1 
ATOM   7499  C  CA    . LEU B 2 331  ? 85.871  96.209  128.788 1.00 41.92  ?  328  LEU B CA    1 
ATOM   7500  C  C     . LEU B 2 331  ? 87.187  95.749  128.188 1.00 33.83  ?  328  LEU B C     1 
ATOM   7501  O  O     . LEU B 2 331  ? 87.844  94.877  128.757 1.00 31.36  ?  328  LEU B O     1 
ATOM   7502  C  CB    . LEU B 2 331  ? 86.153  97.019  130.060 1.00 41.99  ?  328  LEU B CB    1 
ATOM   7503  C  CG    . LEU B 2 331  ? 87.448  97.840  130.055 1.00 36.15  ?  328  LEU B CG    1 
ATOM   7504  C  CD1   . LEU B 2 331  ? 87.412  98.980  129.037 1.00 37.72  ?  328  LEU B CD1   1 
ATOM   7505  C  CD2   . LEU B 2 331  ? 87.791  98.356  131.443 1.00 37.19  ?  328  LEU B CD2   1 
ATOM   7506  N  N     . VAL B 2 332  ? 87.574  96.333  127.053 1.00 35.39  ?  329  VAL B N     1 
ATOM   7507  C  CA    . VAL B 2 332  ? 88.863  96.055  126.431 1.00 30.41  ?  329  VAL B CA    1 
ATOM   7508  C  C     . VAL B 2 332  ? 89.604  97.369  126.224 1.00 28.78  ?  329  VAL B C     1 
ATOM   7509  O  O     . VAL B 2 332  ? 89.026  98.453  126.303 1.00 34.38  ?  329  VAL B O     1 
ATOM   7510  C  CB    . VAL B 2 332  ? 88.722  95.291  125.101 1.00 36.22  ?  329  VAL B CB    1 
ATOM   7511  C  CG1   . VAL B 2 332  ? 87.692  94.192  125.228 1.00 46.68  ?  329  VAL B CG1   1 
ATOM   7512  C  CG2   . VAL B 2 332  ? 88.365  96.234  123.965 1.00 38.88  ?  329  VAL B CG2   1 
ATOM   7513  N  N     . ALA B 2 333  ? 90.901  97.257  125.937 1.00 29.33  ?  330  ALA B N     1 
ATOM   7514  C  CA    . ALA B 2 333  ? 91.748  98.430  125.808 1.00 28.03  ?  330  ALA B CA    1 
ATOM   7515  C  C     . ALA B 2 333  ? 92.778  98.233  124.710 1.00 27.41  ?  330  ALA B C     1 
ATOM   7516  O  O     . ALA B 2 333  ? 93.337  97.143  124.546 1.00 28.48  ?  330  ALA B O     1 
ATOM   7517  C  CB    . ALA B 2 333  ? 92.475  98.745  127.119 1.00 41.70  ?  330  ALA B CB    1 
ATOM   7518  N  N     . ILE B 2 334  ? 93.024  99.307  123.974 1.00 31.10  ?  331  ILE B N     1 
ATOM   7519  C  CA    . ILE B 2 334  ? 94.086  99.379  122.977 1.00 34.03  ?  331  ILE B CA    1 
ATOM   7520  C  C     . ILE B 2 334  ? 95.277  100.083 123.608 1.00 41.41  ?  331  ILE B C     1 
ATOM   7521  O  O     . ILE B 2 334  ? 95.104  101.177 124.168 1.00 46.73  ?  331  ILE B O     1 
ATOM   7522  C  CB    . ILE B 2 334  ? 93.631  100.125 121.714 1.00 40.35  ?  331  ILE B CB    1 
ATOM   7523  C  CG1   . ILE B 2 334  ? 92.719  99.238  120.887 1.00 60.99  ?  331  ILE B CG1   1 
ATOM   7524  C  CG2   . ILE B 2 334  ? 94.821  100.597 120.897 1.00 39.87  ?  331  ILE B CG2   1 
ATOM   7525  C  CD1   . ILE B 2 334  ? 93.324  97.886  120.636 1.00 83.80  ?  331  ILE B CD1   1 
ATOM   7526  N  N     . PRO B 2 335  ? 96.459  99.505  123.566 1.00 43.41  ?  332  PRO B N     1 
ATOM   7527  C  CA    . PRO B 2 335  ? 97.671  100.308 123.758 1.00 52.50  ?  332  PRO B CA    1 
ATOM   7528  C  C     . PRO B 2 335  ? 97.696  101.479 122.786 1.00 57.86  ?  332  PRO B C     1 
ATOM   7529  O  O     . PRO B 2 335  ? 97.900  101.295 121.582 1.00 63.03  ?  332  PRO B O     1 
ATOM   7530  C  CB    . PRO B 2 335  ? 98.799  99.302  123.491 1.00 50.68  ?  332  PRO B CB    1 
ATOM   7531  C  CG    . PRO B 2 335  ? 98.165  98.228  122.654 1.00 43.87  ?  332  PRO B CG    1 
ATOM   7532  C  CD    . PRO B 2 335  ? 96.756  98.125  123.147 1.00 39.95  ?  332  PRO B CD    1 
ATOM   7533  N  N     . SER B 2 336  ? 97.500  102.692 123.297 1.00 55.22  ?  333  SER B N     1 
ATOM   7534  C  CA    . SER B 2 336  ? 97.336  103.864 122.450 1.00 58.71  ?  333  SER B CA    1 
ATOM   7535  C  C     . SER B 2 336  ? 98.674  104.516 122.155 1.00 66.84  ?  333  SER B C     1 
ATOM   7536  O  O     . SER B 2 336  ? 99.546  104.603 123.022 1.00 68.73  ?  333  SER B O     1 
ATOM   7537  C  CB    . SER B 2 336  ? 96.408  104.891 123.099 1.00 56.65  ?  333  SER B CB    1 
ATOM   7538  O  OG    . SER B 2 336  ? 95.199  104.293 123.520 1.00 54.72  ?  333  SER B OG    1 
ATOM   7539  N  N     . GLU B 2 337  ? 98.822  104.979 120.926 1.00 77.84  ?  334  GLU B N     1 
ATOM   7540  C  CA    . GLU B 2 337  ? 100.001 105.695 120.473 1.00 92.33  ?  334  GLU B CA    1 
ATOM   7541  C  C     . GLU B 2 337  ? 99.578  107.097 120.048 1.00 99.00  ?  334  GLU B C     1 
ATOM   7542  O  O     . GLU B 2 337  ? 98.458  107.541 120.315 1.00 98.26  ?  334  GLU B O     1 
ATOM   7543  C  CB    . GLU B 2 337  ? 100.692 104.953 119.325 1.00 99.21  ?  334  GLU B CB    1 
ATOM   7544  C  CG    . GLU B 2 337  ? 100.599 103.441 119.402 1.00 103.77 ?  334  GLU B CG    1 
ATOM   7545  C  CD    . GLU B 2 337  ? 99.324  102.911 118.768 1.00 118.95 ?  334  GLU B CD    1 
ATOM   7546  O  OE1   . GLU B 2 337  ? 98.830  103.541 117.808 1.00 114.52 ?  334  GLU B OE1   1 
ATOM   7547  O  OE2   . GLU B 2 337  ? 98.809  101.873 119.235 1.00 196.50 -1 334  GLU B OE2   1 
ATOM   7548  N  N     . GLY B 2 338  ? 100.486 107.796 119.382 1.00 112.58 ?  335  GLY B N     1 
ATOM   7549  C  CA    . GLY B 2 338  ? 100.199 109.090 118.812 1.00 143.69 ?  335  GLY B CA    1 
ATOM   7550  C  C     . GLY B 2 338  ? 101.178 110.135 119.292 1.00 176.27 ?  335  GLY B C     1 
ATOM   7551  O  O     . GLY B 2 338  ? 102.080 109.871 120.086 1.00 178.14 ?  335  GLY B O     1 
ATOM   7552  N  N     . ASN B 2 339  ? 100.973 111.355 118.805 1.00 191.42 ?  336  ASN B N     1 
ATOM   7553  C  CA    . ASN B 2 339  ? 101.816 112.494 119.142 1.00 208.15 ?  336  ASN B CA    1 
ATOM   7554  C  C     . ASN B 2 339  ? 100.974 113.488 119.931 1.00 204.89 ?  336  ASN B C     1 
ATOM   7555  O  O     . ASN B 2 339  ? 100.015 114.053 119.376 1.00 201.79 ?  336  ASN B O     1 
ATOM   7556  C  CB    . ASN B 2 339  ? 102.377 113.149 117.873 1.00 205.22 ?  336  ASN B CB    1 
ATOM   7557  C  CG    . ASN B 2 339  ? 103.168 112.179 117.007 1.00 194.47 ?  336  ASN B CG    1 
ATOM   7558  O  OD1   . ASN B 2 339  ? 102.701 111.738 115.956 1.00 189.82 ?  336  ASN B OD1   1 
ATOM   7559  N  ND2   . ASN B 2 339  ? 104.379 111.851 117.443 1.00 199.49 ?  336  ASN B ND2   1 
ATOM   7560  N  N     . PRO B 2 340  ? 101.268 113.733 121.221 1.00 208.91 ?  337  PRO B N     1 
ATOM   7561  C  CA    . PRO B 2 340  ? 102.318 113.083 122.014 1.00 207.32 ?  337  PRO B CA    1 
ATOM   7562  C  C     . PRO B 2 340  ? 101.835 111.863 122.805 1.00 194.30 ?  337  PRO B C     1 
ATOM   7563  O  O     . PRO B 2 340  ? 100.716 111.405 122.577 1.00 189.21 ?  337  PRO B O     1 
ATOM   7564  C  CB    . PRO B 2 340  ? 102.747 114.197 122.966 1.00 211.52 ?  337  PRO B CB    1 
ATOM   7565  C  CG    . PRO B 2 340  ? 101.470 114.928 123.231 1.00 210.47 ?  337  PRO B CG    1 
ATOM   7566  C  CD    . PRO B 2 340  ? 100.668 114.868 121.948 1.00 212.37 ?  337  PRO B CD    1 
ATOM   7567  N  N     . THR B 2 341  ? 102.674 111.346 123.706 1.00 182.86 ?  338  THR B N     1 
ATOM   7568  C  CA    . THR B 2 341  ? 102.218 110.325 124.646 1.00 168.97 ?  338  THR B CA    1 
ATOM   7569  C  C     . THR B 2 341  ? 101.199 110.951 125.594 1.00 165.19 ?  338  THR B C     1 
ATOM   7570  O  O     . THR B 2 341  ? 101.489 111.981 126.211 1.00 163.87 ?  338  THR B O     1 
ATOM   7571  C  CB    . THR B 2 341  ? 103.396 109.730 125.422 1.00 162.11 ?  338  THR B CB    1 
ATOM   7572  O  OG1   . THR B 2 341  ? 104.430 109.351 124.505 1.00 159.24 ?  338  THR B OG1   1 
ATOM   7573  C  CG2   . THR B 2 341  ? 102.968 108.497 126.204 1.00 154.10 ?  338  THR B CG2   1 
ATOM   7574  N  N     . PRO B 2 342  ? 100.008 110.375 125.727 1.00 157.17 ?  339  PRO B N     1 
ATOM   7575  C  CA    . PRO B 2 342  ? 98.855  111.125 126.267 1.00 153.54 ?  339  PRO B CA    1 
ATOM   7576  C  C     . PRO B 2 342  ? 99.004  111.558 127.721 1.00 147.96 ?  339  PRO B C     1 
ATOM   7577  O  O     . PRO B 2 342  ? 98.604  112.684 128.053 1.00 147.48 ?  339  PRO B O     1 
ATOM   7578  C  CB    . PRO B 2 342  ? 97.680  110.149 126.081 1.00 137.57 ?  339  PRO B CB    1 
ATOM   7579  C  CG    . PRO B 2 342  ? 98.260  108.870 125.573 1.00 131.71 ?  339  PRO B CG    1 
ATOM   7580  C  CD    . PRO B 2 342  ? 99.591  109.168 124.994 1.00 146.35 ?  339  PRO B CD    1 
ATOM   7581  N  N     . PRO B 2 343  ? 99.555  110.731 128.638 1.00 141.47 ?  340  PRO B N     1 
ATOM   7582  C  CA    . PRO B 2 343  ? 100.185 109.410 128.677 1.00 139.33 ?  340  PRO B CA    1 
ATOM   7583  C  C     . PRO B 2 343  ? 99.219  108.258 128.933 1.00 126.59 ?  340  PRO B C     1 
ATOM   7584  O  O     . PRO B 2 343  ? 99.680  107.145 129.203 1.00 117.54 ?  340  PRO B O     1 
ATOM   7585  C  CB    . PRO B 2 343  ? 101.176 109.533 129.851 1.00 130.51 ?  340  PRO B CB    1 
ATOM   7586  C  CG    . PRO B 2 343  ? 100.771 110.785 130.609 1.00 117.00 ?  340  PRO B CG    1 
ATOM   7587  C  CD    . PRO B 2 343  ? 99.506  111.296 129.997 1.00 133.50 ?  340  PRO B CD    1 
ATOM   7588  N  N     . GLU B 2 344  ? 97.911  108.503 128.830 1.00 123.17 ?  341  GLU B N     1 
ATOM   7589  C  CA    . GLU B 2 344  ? 96.948  107.418 128.952 1.00 107.58 ?  341  GLU B CA    1 
ATOM   7590  C  C     . GLU B 2 344  ? 97.089  106.535 127.723 1.00 87.89  ?  341  GLU B C     1 
ATOM   7591  O  O     . GLU B 2 344  ? 96.363  106.694 126.736 1.00 84.38  ?  341  GLU B O     1 
ATOM   7592  C  CB    . GLU B 2 344  ? 95.508  107.929 129.070 1.00 111.90 ?  341  GLU B CB    1 
ATOM   7593  C  CG    . GLU B 2 344  ? 95.227  109.235 128.339 1.00 132.81 ?  341  GLU B CG    1 
ATOM   7594  C  CD    . GLU B 2 344  ? 93.758  109.634 128.379 1.00 163.11 ?  341  GLU B CD    1 
ATOM   7595  O  OE1   . GLU B 2 344  ? 93.054  109.410 127.374 1.00 148.58 ?  341  GLU B OE1   1 
ATOM   7596  O  OE2   . GLU B 2 344  ? 93.300  110.156 129.418 1.00 250.36 -1 341  GLU B OE2   1 
ATOM   7597  N  N     . ALA B 2 345  ? 98.003  105.575 127.794 1.00 72.34  ?  342  ALA B N     1 
ATOM   7598  C  CA    . ALA B 2 345  ? 98.432  104.825 126.625 1.00 59.89  ?  342  ALA B CA    1 
ATOM   7599  C  C     . ALA B 2 345  ? 97.393  103.791 126.227 1.00 49.21  ?  342  ALA B C     1 
ATOM   7600  O  O     . ALA B 2 345  ? 97.706  102.835 125.512 1.00 47.74  ?  342  ALA B O     1 
ATOM   7601  C  CB    . ALA B 2 345  ? 99.773  104.148 126.904 1.00 51.55  ?  342  ALA B CB    1 
ATOM   7602  N  N     . TYR B 2 346  ? 96.161  103.958 126.706 1.00 53.21  ?  343  TYR B N     1 
ATOM   7603  C  CA    . TYR B 2 346  ? 95.122  102.954 126.532 1.00 56.87  ?  343  TYR B CA    1 
ATOM   7604  C  C     . TYR B 2 346  ? 93.792  103.625 126.213 1.00 55.64  ?  343  TYR B C     1 
ATOM   7605  O  O     . TYR B 2 346  ? 93.308  104.461 126.983 1.00 53.80  ?  343  TYR B O     1 
ATOM   7606  C  CB    . TYR B 2 346  ? 95.032  102.083 127.788 1.00 45.02  ?  343  TYR B CB    1 
ATOM   7607  C  CG    . TYR B 2 346  ? 96.372  101.454 128.094 1.00 40.80  ?  343  TYR B CG    1 
ATOM   7608  C  CD1   . TYR B 2 346  ? 97.297  102.093 128.904 1.00 41.17  ?  343  TYR B CD1   1 
ATOM   7609  C  CD2   . TYR B 2 346  ? 96.749  100.267 127.489 1.00 38.24  ?  343  TYR B CD2   1 
ATOM   7610  C  CE1   . TYR B 2 346  ? 98.532  101.537 129.151 1.00 37.72  ?  343  TYR B CE1   1 
ATOM   7611  C  CE2   . TYR B 2 346  ? 97.981  99.704  127.732 1.00 38.17  ?  343  TYR B CE2   1 
ATOM   7612  C  CZ    . TYR B 2 346  ? 98.870  100.343 128.563 1.00 41.01  ?  343  TYR B CZ    1 
ATOM   7613  O  OH    . TYR B 2 346  ? 100.103 99.788  128.811 1.00 32.23  ?  343  TYR B OH    1 
ATOM   7614  N  N     . HIS B 2 347  ? 93.230  103.288 125.055 1.00 53.88  ?  344  HIS B N     1 
ATOM   7615  C  CA    . HIS B 2 347  ? 91.852  103.644 124.726 1.00 46.43  ?  344  HIS B CA    1 
ATOM   7616  C  C     . HIS B 2 347  ? 90.921  102.506 125.129 1.00 39.83  ?  344  HIS B C     1 
ATOM   7617  O  O     . HIS B 2 347  ? 91.245  101.329 124.944 1.00 37.23  ?  344  HIS B O     1 
ATOM   7618  C  CB    . HIS B 2 347  ? 91.707  103.966 123.235 1.00 51.83  ?  344  HIS B CB    1 
ATOM   7619  C  CG    . HIS B 2 347  ? 92.544  105.122 122.778 1.00 57.22  ?  344  HIS B CG    1 
ATOM   7620  N  ND1   . HIS B 2 347  ? 93.028  106.076 123.649 1.00 55.76  ?  344  HIS B ND1   1 
ATOM   7621  C  CD2   . HIS B 2 347  ? 92.997  105.469 121.550 1.00 66.80  ?  344  HIS B CD2   1 
ATOM   7622  C  CE1   . HIS B 2 347  ? 93.727  106.970 122.976 1.00 54.92  ?  344  HIS B CE1   1 
ATOM   7623  N  NE2   . HIS B 2 347  ? 93.727  106.623 121.701 1.00 62.78  ?  344  HIS B NE2   1 
ATOM   7624  N  N     . PHE B 2 348  ? 89.765  102.857 125.685 1.00 41.69  ?  345  PHE B N     1 
ATOM   7625  C  CA    . PHE B 2 348  ? 88.910  101.884 126.350 1.00 42.06  ?  345  PHE B CA    1 
ATOM   7626  C  C     . PHE B 2 348  ? 87.588  101.743 125.611 1.00 48.90  ?  345  PHE B C     1 
ATOM   7627  O  O     . PHE B 2 348  ? 86.930  102.742 125.296 1.00 49.02  ?  345  PHE B O     1 
ATOM   7628  C  CB    . PHE B 2 348  ? 88.662  102.287 127.804 1.00 46.17  ?  345  PHE B CB    1 
ATOM   7629  C  CG    . PHE B 2 348  ? 89.916  102.373 128.633 1.00 43.78  ?  345  PHE B CG    1 
ATOM   7630  C  CD1   . PHE B 2 348  ? 90.669  103.534 128.664 1.00 43.11  ?  345  PHE B CD1   1 
ATOM   7631  C  CD2   . PHE B 2 348  ? 90.364  101.276 129.341 1.00 39.16  ?  345  PHE B CD2   1 
ATOM   7632  C  CE1   . PHE B 2 348  ? 91.817  103.608 129.425 1.00 40.93  ?  345  PHE B CE1   1 
ATOM   7633  C  CE2   . PHE B 2 348  ? 91.513  101.348 130.090 1.00 38.14  ?  345  PHE B CE2   1 
ATOM   7634  C  CZ    . PHE B 2 348  ? 92.239  102.510 130.130 1.00 40.66  ?  345  PHE B CZ    1 
ATOM   7635  N  N     . TYR B 2 349  ? 87.203  100.501 125.337 1.00 51.50  ?  346  TYR B N     1 
ATOM   7636  C  CA    . TYR B 2 349  ? 85.964  100.196 124.639 1.00 55.14  ?  346  TYR B CA    1 
ATOM   7637  C  C     . TYR B 2 349  ? 85.114  99.296  125.528 1.00 47.54  ?  346  TYR B C     1 
ATOM   7638  O  O     . TYR B 2 349  ? 85.592  98.262  126.018 1.00 43.28  ?  346  TYR B O     1 
ATOM   7639  C  CB    . TYR B 2 349  ? 86.245  99.523  123.284 1.00 55.20  ?  346  TYR B CB    1 
ATOM   7640  C  CG    . TYR B 2 349  ? 87.050  100.358 122.286 1.00 53.39  ?  346  TYR B CG    1 
ATOM   7641  C  CD1   . TYR B 2 349  ? 87.034  101.746 122.324 1.00 55.93  ?  346  TYR B CD1   1 
ATOM   7642  C  CD2   . TYR B 2 349  ? 87.829  99.749  121.309 1.00 50.97  ?  346  TYR B CD2   1 
ATOM   7643  C  CE1   . TYR B 2 349  ? 87.766  102.500 121.411 1.00 51.72  ?  346  TYR B CE1   1 
ATOM   7644  C  CE2   . TYR B 2 349  ? 88.563  100.495 120.394 1.00 47.66  ?  346  TYR B CE2   1 
ATOM   7645  C  CZ    . TYR B 2 349  ? 88.528  101.867 120.450 1.00 48.27  ?  346  TYR B CZ    1 
ATOM   7646  O  OH    . TYR B 2 349  ? 89.258  102.600 119.543 1.00 53.37  ?  346  TYR B OH    1 
ATOM   7647  N  N     . GLN B 2 350  ? 83.875  99.721  125.773 1.00 53.70  ?  347  GLN B N     1 
ATOM   7648  C  CA    . GLN B 2 350  ? 82.876  98.875  126.409 1.00 57.26  ?  347  GLN B CA    1 
ATOM   7649  C  C     . GLN B 2 350  ? 82.180  98.063  125.326 1.00 64.25  ?  347  GLN B C     1 
ATOM   7650  O  O     . GLN B 2 350  ? 82.009  98.537  124.201 1.00 65.08  ?  347  GLN B O     1 
ATOM   7651  C  CB    . GLN B 2 350  ? 81.859  99.719  127.187 1.00 59.77  ?  347  GLN B CB    1 
ATOM   7652  C  CG    . GLN B 2 350  ? 80.723  98.936  127.840 1.00 60.52  ?  347  GLN B CG    1 
ATOM   7653  C  CD    . GLN B 2 350  ? 79.654  99.838  128.439 1.00 56.79  ?  347  GLN B CD    1 
ATOM   7654  O  OE1   . GLN B 2 350  ? 79.644  101.050 128.216 1.00 58.84  ?  347  GLN B OE1   1 
ATOM   7655  N  NE2   . GLN B 2 350  ? 78.738  99.242  129.198 1.00 50.50  ?  347  GLN B NE2   1 
ATOM   7656  N  N     . VAL B 2 351  ? 81.809  96.829  125.656 1.00 62.15  ?  348  VAL B N     1 
ATOM   7657  C  CA    . VAL B 2 351  ? 81.160  95.938  124.702 1.00 67.33  ?  348  VAL B CA    1 
ATOM   7658  C  C     . VAL B 2 351  ? 80.014  95.220  125.396 1.00 67.26  ?  348  VAL B C     1 
ATOM   7659  O  O     . VAL B 2 351  ? 80.108  94.876  126.579 1.00 63.64  ?  348  VAL B O     1 
ATOM   7660  C  CB    . VAL B 2 351  ? 82.158  94.934  124.102 1.00 67.23  ?  348  VAL B CB    1 
ATOM   7661  C  CG1   . VAL B 2 351  ? 83.059  95.635  123.103 1.00 64.96  ?  348  VAL B CG1   1 
ATOM   7662  C  CG2   . VAL B 2 351  ? 82.980  94.313  125.202 1.00 62.08  ?  348  VAL B CG2   1 
ATOM   7663  N  N     . SER B 2 352  ? 78.934  94.992  124.653 1.00 74.83  ?  349  SER B N     1 
ATOM   7664  C  CA    . SER B 2 352  ? 77.711  94.436  125.209 1.00 80.83  ?  349  SER B CA    1 
ATOM   7665  C  C     . SER B 2 352  ? 77.172  93.350  124.286 1.00 84.29  ?  349  SER B C     1 
ATOM   7666  O  O     . SER B 2 352  ? 77.463  93.320  123.085 1.00 83.24  ?  349  SER B O     1 
ATOM   7667  C  CB    . SER B 2 352  ? 76.654  95.535  125.428 1.00 83.87  ?  349  SER B CB    1 
ATOM   7668  O  OG    . SER B 2 352  ? 76.399  96.266  124.238 1.00 80.20  ?  349  SER B OG    1 
ATOM   7669  N  N     . PHE B 2 353  ? 76.379  92.455  124.873 1.00 83.94  ?  350  PHE B N     1 
ATOM   7670  C  CA    . PHE B 2 353  ? 75.610  91.467  124.136 1.00 89.38  ?  350  PHE B CA    1 
ATOM   7671  C  C     . PHE B 2 353  ? 74.137  91.861  124.126 1.00 99.58  ?  350  PHE B C     1 
ATOM   7672  O  O     . PHE B 2 353  ? 73.612  92.385  125.111 1.00 101.56 ?  350  PHE B O     1 
ATOM   7673  C  CB    . PHE B 2 353  ? 75.769  90.071  124.738 1.00 90.06  ?  350  PHE B CB    1 
ATOM   7674  C  CG    . PHE B 2 353  ? 74.903  89.026  124.083 1.00 111.59 ?  350  PHE B CG    1 
ATOM   7675  C  CD1   . PHE B 2 353  ? 75.302  88.409  122.911 1.00 116.39 ?  350  PHE B CD1   1 
ATOM   7676  C  CD2   . PHE B 2 353  ? 73.695  88.652  124.654 1.00 123.45 ?  350  PHE B CD2   1 
ATOM   7677  C  CE1   . PHE B 2 353  ? 74.508  87.443  122.313 1.00 118.01 ?  350  PHE B CE1   1 
ATOM   7678  C  CE2   . PHE B 2 353  ? 72.899  87.690  124.060 1.00 119.32 ?  350  PHE B CE2   1 
ATOM   7679  C  CZ    . PHE B 2 353  ? 73.305  87.086  122.888 1.00 119.27 ?  350  PHE B CZ    1 
ATOM   7680  N  N     . GLN B 2 354  ? 73.480  91.605  122.998 1.00 104.21 ?  351  GLN B N     1 
ATOM   7681  C  CA    . GLN B 2 354  ? 72.058  91.905  122.793 1.00 108.01 ?  351  GLN B CA    1 
ATOM   7682  C  C     . GLN B 2 354  ? 71.704  93.359  123.106 1.00 105.06 ?  351  GLN B C     1 
ATOM   7683  O  O     . GLN B 2 354  ? 70.703  93.642  123.769 1.00 101.91 ?  351  GLN B O     1 
ATOM   7684  C  CB    . GLN B 2 354  ? 71.181  90.968  123.631 1.00 113.00 ?  351  GLN B CB    1 
ATOM   7685  C  CG    . GLN B 2 354  ? 70.411  89.920  122.822 1.00 115.64 ?  351  GLN B CG    1 
ATOM   7686  C  CD    . GLN B 2 354  ? 69.768  88.859  123.700 1.00 116.05 ?  351  GLN B CD    1 
ATOM   7687  O  OE1   . GLN B 2 354  ? 69.885  88.902  124.924 1.00 114.25 ?  351  GLN B OE1   1 
ATOM   7688  N  NE2   . GLN B 2 354  ? 69.092  87.895  123.076 1.00 114.34 ?  351  GLN B NE2   1 
ATOM   7689  N  N     . GLY C 3 536  ? 191.083 111.626 144.978 1.00 268.83 ?  408  GLY C N     1 
ATOM   7690  C  CA    . GLY C 3 536  ? 191.209 110.750 143.829 1.00 273.35 ?  408  GLY C CA    1 
ATOM   7691  C  C     . GLY C 3 536  ? 190.425 111.229 142.624 1.00 260.84 ?  408  GLY C C     1 
ATOM   7692  O  O     . GLY C 3 536  ? 190.916 111.189 141.495 1.00 254.41 ?  408  GLY C O     1 
ATOM   7693  N  N     . GLY C 3 537  ? 189.207 111.682 142.865 1.00 261.86 ?  409  GLY C N     1 
ATOM   7694  C  CA    . GLY C 3 537  ? 188.350 112.202 141.814 1.00 251.78 ?  409  GLY C CA    1 
ATOM   7695  C  C     . GLY C 3 537  ? 187.171 111.281 141.557 1.00 243.54 ?  409  GLY C C     1 
ATOM   7696  O  O     . GLY C 3 537  ? 187.322 110.059 141.435 1.00 248.85 ?  409  GLY C O     1 
ATOM   7697  N  N     . ARG C 3 538  ? 185.985 111.871 141.473 1.00 234.59 ?  410  ARG C N     1 
ATOM   7698  C  CA    . ARG C 3 538  ? 184.782 111.111 141.158 1.00 224.64 ?  410  ARG C CA    1 
ATOM   7699  C  C     . ARG C 3 538  ? 184.732 110.838 139.659 1.00 217.64 ?  410  ARG C C     1 
ATOM   7700  O  O     . ARG C 3 538  ? 184.916 111.765 138.862 1.00 215.81 ?  410  ARG C O     1 
ATOM   7701  C  CB    . ARG C 3 538  ? 183.537 111.877 141.605 1.00 225.10 ?  410  ARG C CB    1 
ATOM   7702  C  CG    . ARG C 3 538  ? 182.213 111.135 141.440 1.00 222.72 ?  410  ARG C CG    1 
ATOM   7703  C  CD    . ARG C 3 538  ? 181.456 111.614 140.203 1.00 217.52 ?  410  ARG C CD    1 
ATOM   7704  N  NE    . ARG C 3 538  ? 180.134 111.004 140.076 1.00 211.59 ?  410  ARG C NE    1 
ATOM   7705  C  CZ    . ARG C 3 538  ? 179.020 111.507 140.601 1.00 212.04 ?  410  ARG C CZ    1 
ATOM   7706  N  NH1   . ARG C 3 538  ? 179.062 112.634 141.296 1.00 220.73 ?  410  ARG C NH1   1 
ATOM   7707  N  NH2   . ARG C 3 538  ? 177.863 110.881 140.429 1.00 201.09 ?  410  ARG C NH2   1 
ATOM   7708  N  N     . PRO C 3 539  ? 184.501 109.593 139.241 1.00 214.52 ?  411  PRO C N     1 
ATOM   7709  C  CA    . PRO C 3 539  ? 184.539 109.278 137.807 1.00 202.01 ?  411  PRO C CA    1 
ATOM   7710  C  C     . PRO C 3 539  ? 183.475 110.046 137.037 1.00 194.28 ?  411  PRO C C     1 
ATOM   7711  O  O     . PRO C 3 539  ? 182.282 109.961 137.336 1.00 191.88 ?  411  PRO C O     1 
ATOM   7712  C  CB    . PRO C 3 539  ? 184.285 107.766 137.765 1.00 193.26 ?  411  PRO C CB    1 
ATOM   7713  C  CG    . PRO C 3 539  ? 184.578 107.282 139.145 1.00 212.16 ?  411  PRO C CG    1 
ATOM   7714  C  CD    . PRO C 3 539  ? 184.210 108.406 140.058 1.00 221.36 ?  411  PRO C CD    1 
ATOM   7715  N  N     . ARG C 3 540  ? 183.923 110.800 136.036 1.00 186.23 ?  412  ARG C N     1 
ATOM   7716  C  CA    . ARG C 3 540  ? 183.021 111.568 135.187 1.00 181.80 ?  412  ARG C CA    1 
ATOM   7717  C  C     . ARG C 3 540  ? 182.320 110.638 134.198 1.00 174.84 ?  412  ARG C C     1 
ATOM   7718  O  O     . ARG C 3 540  ? 182.975 109.941 133.416 1.00 169.26 ?  412  ARG C O     1 
ATOM   7719  C  CB    . ARG C 3 540  ? 183.791 112.680 134.473 1.00 173.37 ?  412  ARG C CB    1 
ATOM   7720  C  CG    . ARG C 3 540  ? 185.158 112.280 133.931 1.00 165.19 ?  412  ARG C CG    1 
ATOM   7721  C  CD    . ARG C 3 540  ? 185.889 113.498 133.398 1.00 155.27 ?  412  ARG C CD    1 
ATOM   7722  N  NE    . ARG C 3 540  ? 186.154 114.464 134.458 1.00 156.72 ?  412  ARG C NE    1 
ATOM   7723  C  CZ    . ARG C 3 540  ? 186.724 115.648 134.264 1.00 159.84 ?  412  ARG C CZ    1 
ATOM   7724  N  NH1   . ARG C 3 540  ? 187.087 116.022 133.045 1.00 161.19 ?  412  ARG C NH1   1 
ATOM   7725  N  NH2   . ARG C 3 540  ? 186.925 116.461 135.293 1.00 174.28 ?  412  ARG C NH2   1 
ATOM   7726  N  N     . GLN C 3 541  ? 180.989 110.628 134.241 1.00 170.00 ?  413  GLN C N     1 
ATOM   7727  C  CA    . GLN C 3 541  ? 180.178 109.716 133.446 1.00 160.99 ?  413  GLN C CA    1 
ATOM   7728  C  C     . GLN C 3 541  ? 180.149 110.155 131.979 1.00 156.04 ?  413  GLN C C     1 
ATOM   7729  O  O     . GLN C 3 541  ? 180.794 111.123 131.573 1.00 157.86 ?  413  GLN C O     1 
ATOM   7730  C  CB    . GLN C 3 541  ? 178.770 109.634 134.034 1.00 155.18 ?  413  GLN C CB    1 
ATOM   7731  C  CG    . GLN C 3 541  ? 178.748 109.319 135.527 1.00 155.62 ?  413  GLN C CG    1 
ATOM   7732  C  CD    . GLN C 3 541  ? 177.667 110.077 136.280 1.00 152.16 ?  413  GLN C CD    1 
ATOM   7733  O  OE1   . GLN C 3 541  ? 176.947 110.892 135.705 1.00 150.55 ?  413  GLN C OE1   1 
ATOM   7734  N  NE2   . GLN C 3 541  ? 177.558 109.815 137.579 1.00 152.33 ?  413  GLN C NE2   1 
ATOM   7735  N  N     . HIS C 3 542  ? 179.386 109.417 131.174 1.00 155.17 ?  414  HIS C N     1 
ATOM   7736  C  CA    . HIS C 3 542  ? 179.230 109.749 129.762 1.00 159.78 ?  414  HIS C CA    1 
ATOM   7737  C  C     . HIS C 3 542  ? 178.469 111.064 129.604 1.00 163.27 ?  414  HIS C C     1 
ATOM   7738  O  O     . HIS C 3 542  ? 177.552 111.361 130.372 1.00 158.81 ?  414  HIS C O     1 
ATOM   7739  C  CB    . HIS C 3 542  ? 178.498 108.611 129.041 1.00 161.78 ?  414  HIS C CB    1 
ATOM   7740  C  CG    . HIS C 3 542  ? 178.639 108.641 127.551 1.00 168.17 ?  414  HIS C CG    1 
ATOM   7741  N  ND1   . HIS C 3 542  ? 177.554 108.650 126.700 1.00 166.85 ?  414  HIS C ND1   1 
ATOM   7742  C  CD2   . HIS C 3 542  ? 179.737 108.662 126.759 1.00 175.78 ?  414  HIS C CD2   1 
ATOM   7743  C  CE1   . HIS C 3 542  ? 177.978 108.673 125.449 1.00 172.06 ?  414  HIS C CE1   1 
ATOM   7744  N  NE2   . HIS C 3 542  ? 179.299 108.682 125.457 1.00 179.98 ?  414  HIS C NE2   1 
ATOM   7745  N  N     . LEU C 3 543  ? 178.846 111.852 128.587 1.00 165.09 ?  415  LEU C N     1 
ATOM   7746  C  CA    . LEU C 3 543  ? 178.336 113.219 128.450 1.00 164.46 ?  415  LEU C CA    1 
ATOM   7747  C  C     . LEU C 3 543  ? 176.844 113.277 128.117 1.00 158.35 ?  415  LEU C C     1 
ATOM   7748  O  O     . LEU C 3 543  ? 176.226 114.329 128.306 1.00 149.94 ?  415  LEU C O     1 
ATOM   7749  C  CB    . LEU C 3 543  ? 179.139 113.976 127.378 1.00 161.77 ?  415  LEU C CB    1 
ATOM   7750  C  CG    . LEU C 3 543  ? 178.824 115.452 127.061 1.00 142.38 ?  415  LEU C CG    1 
ATOM   7751  C  CD1   . LEU C 3 543  ? 179.062 116.368 128.251 1.00 134.68 ?  415  LEU C CD1   1 
ATOM   7752  C  CD2   . LEU C 3 543  ? 179.604 115.947 125.848 1.00 139.94 ?  415  LEU C CD2   1 
ATOM   7753  N  N     . LEU C 3 544  ? 176.243 112.176 127.654 1.00 159.44 ?  416  LEU C N     1 
ATOM   7754  C  CA    . LEU C 3 544  ? 174.843 112.202 127.233 1.00 156.75 ?  416  LEU C CA    1 
ATOM   7755  C  C     . LEU C 3 544  ? 173.856 112.211 128.401 1.00 152.65 ?  416  LEU C C     1 
ATOM   7756  O  O     . LEU C 3 544  ? 172.696 112.591 128.201 1.00 147.33 ?  416  LEU C O     1 
ATOM   7757  C  CB    . LEU C 3 544  ? 174.532 111.008 126.323 1.00 151.65 ?  416  LEU C CB    1 
ATOM   7758  C  CG    . LEU C 3 544  ? 174.633 111.195 124.803 1.00 141.37 ?  416  LEU C CG    1 
ATOM   7759  C  CD1   . LEU C 3 544  ? 174.382 109.880 124.074 1.00 133.98 ?  416  LEU C CD1   1 
ATOM   7760  C  CD2   . LEU C 3 544  ? 173.654 112.262 124.323 1.00 130.07 ?  416  LEU C CD2   1 
ATOM   7761  N  N     . SER C 3 545  ? 174.280 111.820 129.607 1.00 152.34 ?  417  SER C N     1 
ATOM   7762  C  CA    . SER C 3 545  ? 173.377 111.685 130.748 1.00 147.66 ?  417  SER C CA    1 
ATOM   7763  C  C     . SER C 3 545  ? 173.410 112.874 131.703 1.00 146.05 ?  417  SER C C     1 
ATOM   7764  O  O     . SER C 3 545  ? 172.568 112.943 132.603 1.00 139.46 ?  417  SER C O     1 
ATOM   7765  C  CB    . SER C 3 545  ? 173.705 110.409 131.539 1.00 145.48 ?  417  SER C CB    1 
ATOM   7766  O  OG    . SER C 3 545  ? 175.049 110.415 131.994 1.00 145.75 ?  417  SER C OG    1 
ATOM   7767  N  N     . LEU C 3 546  ? 174.343 113.807 131.528 1.00 148.52 ?  418  LEU C N     1 
ATOM   7768  C  CA    . LEU C 3 546  ? 174.548 114.872 132.501 1.00 148.61 ?  418  LEU C CA    1 
ATOM   7769  C  C     . LEU C 3 546  ? 173.532 115.994 132.305 1.00 142.03 ?  418  LEU C C     1 
ATOM   7770  O  O     . LEU C 3 546  ? 173.076 116.260 131.191 1.00 141.46 ?  418  LEU C O     1 
ATOM   7771  C  CB    . LEU C 3 546  ? 175.971 115.427 132.385 1.00 149.10 ?  418  LEU C CB    1 
ATOM   7772  C  CG    . LEU C 3 546  ? 177.071 114.454 131.934 1.00 151.75 ?  418  LEU C CG    1 
ATOM   7773  C  CD1   . LEU C 3 546  ? 178.374 115.181 131.580 1.00 150.66 ?  418  LEU C CD1   1 
ATOM   7774  C  CD2   . LEU C 3 546  ? 177.311 113.358 132.975 1.00 157.83 ?  418  LEU C CD2   1 
ATOM   7775  N  N     . THR C 3 547  ? 173.192 116.663 133.406 1.00 142.12 ?  419  THR C N     1 
ATOM   7776  C  CA    . THR C 3 547  ? 172.246 117.769 133.354 1.00 142.14 ?  419  THR C CA    1 
ATOM   7777  C  C     . THR C 3 547  ? 172.825 118.929 132.545 1.00 145.28 ?  419  THR C C     1 
ATOM   7778  O  O     . THR C 3 547  ? 174.031 119.001 132.288 1.00 142.60 ?  419  THR C O     1 
ATOM   7779  C  CB    . THR C 3 547  ? 171.887 118.242 134.766 1.00 143.74 ?  419  THR C CB    1 
ATOM   7780  O  OG1   . THR C 3 547  ? 173.085 118.556 135.488 1.00 149.19 ?  419  THR C OG1   1 
ATOM   7781  C  CG2   . THR C 3 547  ? 171.122 117.163 135.517 1.00 146.62 ?  419  THR C CG2   1 
ATOM   7782  N  N     . ARG C 3 548  ? 171.944 119.847 132.134 1.00 146.51 ?  420  ARG C N     1 
ATOM   7783  C  CA    . ARG C 3 548  ? 172.390 120.935 131.270 1.00 145.57 ?  420  ARG C CA    1 
ATOM   7784  C  C     . ARG C 3 548  ? 173.140 122.018 132.039 1.00 149.82 ?  420  ARG C C     1 
ATOM   7785  O  O     . ARG C 3 548  ? 174.041 122.654 131.478 1.00 146.09 ?  420  ARG C O     1 
ATOM   7786  C  CB    . ARG C 3 548  ? 171.204 121.548 130.520 1.00 143.42 ?  420  ARG C CB    1 
ATOM   7787  C  CG    . ARG C 3 548  ? 170.268 120.530 129.897 1.00 141.19 ?  420  ARG C CG    1 
ATOM   7788  C  CD    . ARG C 3 548  ? 169.461 121.172 128.790 1.00 142.58 ?  420  ARG C CD    1 
ATOM   7789  N  NE    . ARG C 3 548  ? 168.847 122.434 129.205 1.00 148.58 ?  420  ARG C NE    1 
ATOM   7790  C  CZ    . ARG C 3 548  ? 167.554 122.587 129.482 1.00 156.81 ?  420  ARG C CZ    1 
ATOM   7791  N  NH1   . ARG C 3 548  ? 166.729 121.556 129.398 1.00 153.54 ?  420  ARG C NH1   1 
ATOM   7792  N  NH2   . ARG C 3 548  ? 167.091 123.774 129.845 1.00 167.88 ?  420  ARG C NH2   1 
ATOM   7793  N  N     . ARG C 3 549  ? 172.807 122.231 133.315 1.00 149.69 ?  421  ARG C N     1 
ATOM   7794  C  CA    . ARG C 3 549  ? 173.590 123.153 134.134 1.00 148.94 ?  421  ARG C CA    1 
ATOM   7795  C  C     . ARG C 3 549  ? 174.997 122.610 134.362 1.00 154.42 ?  421  ARG C C     1 
ATOM   7796  O  O     . ARG C 3 549  ? 175.990 123.331 134.186 1.00 154.49 ?  421  ARG C O     1 
ATOM   7797  C  CB    . ARG C 3 549  ? 172.872 123.407 135.464 1.00 143.46 ?  421  ARG C CB    1 
ATOM   7798  C  CG    . ARG C 3 549  ? 173.775 123.898 136.594 1.00 160.32 ?  421  ARG C CG    1 
ATOM   7799  C  CD    . ARG C 3 549  ? 174.365 125.275 136.300 1.00 161.84 ?  421  ARG C CD    1 
ATOM   7800  N  NE    . ARG C 3 549  ? 175.039 125.855 137.460 1.00 174.45 ?  421  ARG C NE    1 
ATOM   7801  C  CZ    . ARG C 3 549  ? 176.304 125.606 137.788 1.00 176.12 ?  421  ARG C CZ    1 
ATOM   7802  N  NH1   . ARG C 3 549  ? 177.031 124.784 137.043 1.00 164.14 ?  421  ARG C NH1   1 
ATOM   7803  N  NH2   . ARG C 3 549  ? 176.844 126.176 138.856 1.00 193.42 ?  421  ARG C NH2   1 
ATOM   7804  N  N     . ALA C 3 550  ? 175.106 121.324 134.706 1.00 153.51 ?  422  ALA C N     1 
ATOM   7805  C  CA    . ALA C 3 550  ? 176.418 120.722 134.919 1.00 156.55 ?  422  ALA C CA    1 
ATOM   7806  C  C     . ALA C 3 550  ? 177.188 120.546 133.610 1.00 160.14 ?  422  ALA C C     1 
ATOM   7807  O  O     . ALA C 3 550  ? 178.419 120.664 133.603 1.00 158.55 ?  422  ALA C O     1 
ATOM   7808  C  CB    . ALA C 3 550  ? 176.264 119.386 135.643 1.00 165.28 ?  422  ALA C CB    1 
ATOM   7809  N  N     . GLN C 3 551  ? 176.496 120.298 132.487 1.00 155.10 ?  423  GLN C N     1 
ATOM   7810  C  CA    . GLN C 3 551  ? 177.203 120.190 131.208 1.00 151.14 ?  423  GLN C CA    1 
ATOM   7811  C  C     . GLN C 3 551  ? 177.671 121.549 130.697 1.00 152.36 ?  423  GLN C C     1 
ATOM   7812  O  O     . GLN C 3 551  ? 178.726 121.634 130.057 1.00 149.97 ?  423  GLN C O     1 
ATOM   7813  C  CB    . GLN C 3 551  ? 176.335 119.512 130.153 1.00 135.39 ?  423  GLN C CB    1 
ATOM   7814  C  CG    . GLN C 3 551  ? 176.491 118.011 130.115 1.00 128.40 ?  423  GLN C CG    1 
ATOM   7815  C  CD    . GLN C 3 551  ? 175.679 117.375 129.011 1.00 127.42 ?  423  GLN C CD    1 
ATOM   7816  O  OE1   . GLN C 3 551  ? 175.383 118.003 127.998 1.00 120.10 ?  423  GLN C OE1   1 
ATOM   7817  N  NE2   . GLN C 3 551  ? 175.300 116.121 129.210 1.00 137.35 ?  423  GLN C NE2   1 
ATOM   7818  N  N     . LYS C 3 552  ? 176.914 122.617 130.961 1.00 149.29 ?  424  LYS C N     1 
ATOM   7819  C  CA    . LYS C 3 552  ? 177.421 123.957 130.684 1.00 146.37 ?  424  LYS C CA    1 
ATOM   7820  C  C     . LYS C 3 552  ? 178.630 124.283 131.554 1.00 155.13 ?  424  LYS C C     1 
ATOM   7821  O  O     . LYS C 3 552  ? 179.609 124.864 131.069 1.00 149.78 ?  424  LYS C O     1 
ATOM   7822  C  CB    . LYS C 3 552  ? 176.318 124.990 130.897 1.00 140.39 ?  424  LYS C CB    1 
ATOM   7823  C  CG    . LYS C 3 552  ? 176.602 126.337 130.262 1.00 137.01 ?  424  LYS C CG    1 
ATOM   7824  C  CD    . LYS C 3 552  ? 175.402 127.256 130.365 1.00 142.88 ?  424  LYS C CD    1 
ATOM   7825  C  CE    . LYS C 3 552  ? 175.587 128.481 129.494 1.00 153.52 ?  424  LYS C CE    1 
ATOM   7826  N  NZ    . LYS C 3 552  ? 174.331 129.266 129.406 1.00 176.24 ?  424  LYS C NZ    1 
ATOM   7827  N  N     . HIS C 3 553  ? 178.585 123.915 132.841 1.00 158.06 ?  425  HIS C N     1 
ATOM   7828  C  CA    . HIS C 3 553  ? 179.740 124.124 133.715 1.00 156.01 ?  425  HIS C CA    1 
ATOM   7829  C  C     . HIS C 3 553  ? 180.949 123.304 133.269 1.00 156.24 ?  425  HIS C C     1 
ATOM   7830  O  O     . HIS C 3 553  ? 182.092 123.712 133.505 1.00 149.26 ?  425  HIS C O     1 
ATOM   7831  C  CB    . HIS C 3 553  ? 179.357 123.795 135.162 1.00 152.72 ?  425  HIS C CB    1 
ATOM   7832  C  CG    . HIS C 3 553  ? 180.523 123.647 136.096 1.00 149.03 ?  425  HIS C CG    1 
ATOM   7833  N  ND1   . HIS C 3 553  ? 180.750 122.493 136.816 1.00 145.31 ?  425  HIS C ND1   1 
ATOM   7834  C  CD2   . HIS C 3 553  ? 181.517 124.504 136.435 1.00 146.49 ?  425  HIS C CD2   1 
ATOM   7835  C  CE1   . HIS C 3 553  ? 181.834 122.643 137.556 1.00 146.11 ?  425  HIS C CE1   1 
ATOM   7836  N  NE2   . HIS C 3 553  ? 182.319 123.854 137.342 1.00 144.26 ?  425  HIS C NE2   1 
ATOM   7837  N  N     . ARG C 3 554  ? 180.719 122.154 132.622 1.00 158.82 ?  426  ARG C N     1 
ATOM   7838  C  CA    . ARG C 3 554  ? 181.813 121.283 132.191 1.00 155.28 ?  426  ARG C CA    1 
ATOM   7839  C  C     . ARG C 3 554  ? 182.386 121.671 130.825 1.00 155.04 ?  426  ARG C C     1 
ATOM   7840  O  O     . ARG C 3 554  ? 183.579 121.451 130.580 1.00 149.65 ?  426  ARG C O     1 
ATOM   7841  C  CB    . ARG C 3 554  ? 181.332 119.829 132.173 1.00 148.21 ?  426  ARG C CB    1 
ATOM   7842  C  CG    . ARG C 3 554  ? 182.412 118.793 131.908 1.00 149.62 ?  426  ARG C CG    1 
ATOM   7843  C  CD    . ARG C 3 554  ? 181.956 117.413 132.352 1.00 154.00 ?  426  ARG C CD    1 
ATOM   7844  N  NE    . ARG C 3 554  ? 182.760 116.352 131.753 1.00 165.11 ?  426  ARG C NE    1 
ATOM   7845  C  CZ    . ARG C 3 554  ? 182.622 115.062 132.037 1.00 167.77 ?  426  ARG C CZ    1 
ATOM   7846  N  NH1   . ARG C 3 554  ? 181.711 114.672 132.917 1.00 167.22 ?  426  ARG C NH1   1 
ATOM   7847  N  NH2   . ARG C 3 554  ? 183.394 114.162 131.443 1.00 170.98 ?  426  ARG C NH2   1 
ATOM   7848  N  N     . LEU C 3 555  ? 181.569 122.227 129.924 1.00 156.70 ?  427  LEU C N     1 
ATOM   7849  C  CA    . LEU C 3 555  ? 182.022 122.617 128.588 1.00 154.74 ?  427  LEU C CA    1 
ATOM   7850  C  C     . LEU C 3 555  ? 182.087 124.134 128.386 1.00 153.41 ?  427  LEU C C     1 
ATOM   7851  O  O     . LEU C 3 555  ? 182.172 124.586 127.240 1.00 150.21 ?  427  LEU C O     1 
ATOM   7852  C  CB    . LEU C 3 555  ? 181.120 121.986 127.518 1.00 144.35 ?  427  LEU C CB    1 
ATOM   7853  C  CG    . LEU C 3 555  ? 181.247 120.486 127.220 1.00 134.29 ?  427  LEU C CG    1 
ATOM   7854  C  CD1   . LEU C 3 555  ? 180.600 120.136 125.885 1.00 122.45 ?  427  LEU C CD1   1 
ATOM   7855  C  CD2   . LEU C 3 555  ? 182.700 120.039 127.240 1.00 136.13 ?  427  LEU C CD2   1 
ATOM   7856  N  N     . ARG C 3 556  ? 182.031 124.929 129.465 1.00 150.01 ?  428  ARG C N     1 
ATOM   7857  C  CA    . ARG C 3 556  ? 182.143 126.383 129.342 1.00 145.42 ?  428  ARG C CA    1 
ATOM   7858  C  C     . ARG C 3 556  ? 183.451 126.830 128.688 1.00 150.29 ?  428  ARG C C     1 
ATOM   7859  O  O     . ARG C 3 556  ? 183.496 127.881 128.034 1.00 147.43 ?  428  ARG C O     1 
ATOM   7860  C  CB    . ARG C 3 556  ? 182.003 127.021 130.727 1.00 133.48 ?  428  ARG C CB    1 
ATOM   7861  C  CG    . ARG C 3 556  ? 182.124 128.526 130.725 1.00 126.89 ?  428  ARG C CG    1 
ATOM   7862  C  CD    . ARG C 3 556  ? 181.977 129.108 132.110 1.00 121.54 ?  428  ARG C CD    1 
ATOM   7863  N  NE    . ARG C 3 556  ? 182.639 130.403 132.175 1.00 128.01 ?  428  ARG C NE    1 
ATOM   7864  C  CZ    . ARG C 3 556  ? 183.950 130.548 132.317 1.00 135.78 ?  428  ARG C CZ    1 
ATOM   7865  N  NH1   . ARG C 3 556  ? 184.727 129.476 132.403 1.00 138.88 ?  428  ARG C NH1   1 
ATOM   7866  N  NH2   . ARG C 3 556  ? 184.484 131.761 132.365 1.00 139.49 ?  428  ARG C NH2   1 
ATOM   7867  N  N     . ASP C 3 557  ? 184.524 126.052 128.843 1.00 155.87 ?  429  ASP C N     1 
ATOM   7868  C  CA    . ASP C 3 557  ? 185.810 126.444 128.272 1.00 156.82 ?  429  ASP C CA    1 
ATOM   7869  C  C     . ASP C 3 557  ? 185.807 126.314 126.747 1.00 154.64 ?  429  ASP C C     1 
ATOM   7870  O  O     . ASP C 3 557  ? 186.241 127.230 126.032 1.00 148.65 ?  429  ASP C O     1 
ATOM   7871  C  CB    . ASP C 3 557  ? 186.929 125.618 128.911 1.00 168.56 ?  429  ASP C CB    1 
ATOM   7872  C  CG    . ASP C 3 557  ? 186.888 125.657 130.439 1.00 189.12 ?  429  ASP C CG    1 
ATOM   7873  O  OD1   . ASP C 3 557  ? 186.460 126.689 131.002 1.00 167.51 ?  429  ASP C OD1   1 
ATOM   7874  O  OD2   . ASP C 3 557  ? 187.282 124.660 131.081 1.00 288.41 -1 429  ASP C OD2   1 
ATOM   7875  N  N     . LEU C 3 558  ? 185.297 125.195 126.223 1.00 149.78 ?  430  LEU C N     1 
ATOM   7876  C  CA    . LEU C 3 558  ? 185.100 125.096 124.778 1.00 144.60 ?  430  LEU C CA    1 
ATOM   7877  C  C     . LEU C 3 558  ? 184.006 126.041 124.289 1.00 149.44 ?  430  LEU C C     1 
ATOM   7878  O  O     . LEU C 3 558  ? 184.030 126.449 123.122 1.00 146.46 ?  430  LEU C O     1 
ATOM   7879  C  CB    . LEU C 3 558  ? 184.777 123.652 124.376 1.00 132.07 ?  430  LEU C CB    1 
ATOM   7880  C  CG    . LEU C 3 558  ? 184.681 123.383 122.867 1.00 125.34 ?  430  LEU C CG    1 
ATOM   7881  C  CD1   . LEU C 3 558  ? 185.924 123.866 122.133 1.00 122.82 ?  430  LEU C CD1   1 
ATOM   7882  C  CD2   . LEU C 3 558  ? 184.409 121.917 122.556 1.00 129.81 ?  430  LEU C CD2   1 
ATOM   7883  N  N     . LYS C 3 559  ? 183.068 126.421 125.163 1.00 150.75 ?  431  LYS C N     1 
ATOM   7884  C  CA    . LYS C 3 559  ? 182.098 127.460 124.824 1.00 149.22 ?  431  LYS C CA    1 
ATOM   7885  C  C     . LYS C 3 559  ? 182.782 128.800 124.563 1.00 145.47 ?  431  LYS C C     1 
ATOM   7886  O  O     . LYS C 3 559  ? 182.465 129.485 123.582 1.00 142.75 ?  431  LYS C O     1 
ATOM   7887  C  CB    . LYS C 3 559  ? 181.074 127.584 125.955 1.00 147.40 ?  431  LYS C CB    1 
ATOM   7888  C  CG    . LYS C 3 559  ? 180.234 128.850 125.942 1.00 144.67 ?  431  LYS C CG    1 
ATOM   7889  C  CD    . LYS C 3 559  ? 179.392 128.944 127.209 1.00 139.99 ?  431  LYS C CD    1 
ATOM   7890  C  CE    . LYS C 3 559  ? 178.636 130.256 127.282 1.00 137.51 ?  431  LYS C CE    1 
ATOM   7891  N  NZ    . LYS C 3 559  ? 177.855 130.343 128.544 1.00 143.09 ?  431  LYS C NZ    1 
ATOM   7892  N  N     . ASN C 3 560  ? 183.726 129.189 125.428 1.00 142.11 ?  432  ASN C N     1 
ATOM   7893  C  CA    . ASN C 3 560  ? 184.498 130.410 125.189 1.00 134.25 ?  432  ASN C CA    1 
ATOM   7894  C  C     . ASN C 3 560  ? 185.411 130.278 123.968 1.00 140.79 ?  432  ASN C C     1 
ATOM   7895  O  O     . ASN C 3 560  ? 185.625 131.266 123.252 1.00 140.78 ?  432  ASN C O     1 
ATOM   7896  C  CB    . ASN C 3 560  ? 185.321 130.776 126.429 1.00 124.14 ?  432  ASN C CB    1 
ATOM   7897  C  CG    . ASN C 3 560  ? 184.466 131.310 127.573 1.00 118.00 ?  432  ASN C CG    1 
ATOM   7898  O  OD1   . ASN C 3 560  ? 183.575 132.137 127.367 1.00 113.44 ?  432  ASN C OD1   1 
ATOM   7899  N  ND2   . ASN C 3 560  ? 184.737 130.837 128.785 1.00 121.06 ?  432  ASN C ND2   1 
ATOM   7900  N  N     . GLN C 3 561  ? 185.948 129.076 123.712 1.00 145.40 ?  433  GLN C N     1 
ATOM   7901  C  CA    . GLN C 3 561  ? 186.737 128.844 122.496 1.00 142.47 ?  433  GLN C CA    1 
ATOM   7902  C  C     . GLN C 3 561  ? 185.910 129.090 121.232 1.00 142.06 ?  433  GLN C C     1 
ATOM   7903  O  O     . GLN C 3 561  ? 186.349 129.799 120.318 1.00 139.68 ?  433  GLN C O     1 
ATOM   7904  C  CB    . GLN C 3 561  ? 187.299 127.418 122.486 1.00 136.08 ?  433  GLN C CB    1 
ATOM   7905  C  CG    . GLN C 3 561  ? 188.639 127.201 123.192 1.00 128.78 ?  433  GLN C CG    1 
ATOM   7906  C  CD    . GLN C 3 561  ? 189.277 125.864 122.818 1.00 116.23 ?  433  GLN C CD    1 
ATOM   7907  O  OE1   . GLN C 3 561  ? 188.958 125.277 121.781 1.00 115.96 ?  433  GLN C OE1   1 
ATOM   7908  N  NE2   . GLN C 3 561  ? 190.179 125.379 123.665 1.00 110.05 ?  433  GLN C NE2   1 
ATOM   7909  N  N     . VAL C 3 562  ? 184.714 128.493 121.156 1.00 144.26 ?  434  VAL C N     1 
ATOM   7910  C  CA    . VAL C 3 562  ? 183.847 128.688 119.991 1.00 142.07 ?  434  VAL C CA    1 
ATOM   7911  C  C     . VAL C 3 562  ? 183.354 130.135 119.914 1.00 147.20 ?  434  VAL C C     1 
ATOM   7912  O  O     . VAL C 3 562  ? 183.202 130.688 118.815 1.00 142.67 ?  434  VAL C O     1 
ATOM   7913  C  CB    . VAL C 3 562  ? 182.670 127.686 120.015 1.00 132.84 ?  434  VAL C CB    1 
ATOM   7914  C  CG1   . VAL C 3 562  ? 181.732 127.909 118.829 1.00 121.23 ?  434  VAL C CG1   1 
ATOM   7915  C  CG2   . VAL C 3 562  ? 183.178 126.246 120.007 1.00 125.18 ?  434  VAL C CG2   1 
ATOM   7916  N  N     . LYS C 3 563  ? 183.130 130.783 121.065 1.00 150.30 ?  435  LYS C N     1 
ATOM   7917  C  CA    . LYS C 3 563  ? 182.719 132.185 121.063 1.00 150.08 ?  435  LYS C CA    1 
ATOM   7918  C  C     . LYS C 3 563  ? 183.797 133.073 120.445 1.00 153.43 ?  435  LYS C C     1 
ATOM   7919  O  O     . LYS C 3 563  ? 183.510 133.885 119.558 1.00 152.57 ?  435  LYS C O     1 
ATOM   7920  C  CB    . LYS C 3 563  ? 182.386 132.640 122.487 1.00 148.01 ?  435  LYS C CB    1 
ATOM   7921  C  CG    . LYS C 3 563  ? 181.773 134.036 122.577 1.00 149.89 ?  435  LYS C CG    1 
ATOM   7922  C  CD    . LYS C 3 563  ? 180.338 134.051 122.068 1.00 144.59 ?  435  LYS C CD    1 
ATOM   7923  C  CE    . LYS C 3 563  ? 179.703 135.428 122.189 1.00 144.23 ?  435  LYS C CE    1 
ATOM   7924  N  NZ    . LYS C 3 563  ? 180.320 136.397 121.241 1.00 146.29 ?  435  LYS C NZ    1 
ATOM   7925  N  N     . THR C 3 564  ? 185.053 132.923 120.890 1.00 151.93 ?  436  THR C N     1 
ATOM   7926  C  CA    . THR C 3 564  ? 186.121 133.753 120.329 1.00 149.33 ?  436  THR C CA    1 
ATOM   7927  C  C     . THR C 3 564  ? 186.444 133.363 118.887 1.00 146.35 ?  436  THR C C     1 
ATOM   7928  O  O     . THR C 3 564  ? 186.841 134.227 118.093 1.00 145.35 ?  436  THR C O     1 
ATOM   7929  C  CB    . THR C 3 564  ? 187.383 133.702 121.206 1.00 136.53 ?  436  THR C CB    1 
ATOM   7930  O  OG1   . THR C 3 564  ? 188.376 134.587 120.672 1.00 127.55 ?  436  THR C OG1   1 
ATOM   7931  C  CG2   . THR C 3 564  ? 187.970 132.304 121.270 1.00 133.78 ?  436  THR C CG2   1 
ATOM   7932  N  N     . PHE C 3 565  ? 186.249 132.091 118.513 1.00 144.43 ?  437  PHE C N     1 
ATOM   7933  C  CA    . PHE C 3 565  ? 186.431 131.705 117.115 1.00 142.56 ?  437  PHE C CA    1 
ATOM   7934  C  C     . PHE C 3 565  ? 185.420 132.410 116.221 1.00 147.91 ?  437  PHE C C     1 
ATOM   7935  O  O     . PHE C 3 565  ? 185.776 132.948 115.163 1.00 150.52 ?  437  PHE C O     1 
ATOM   7936  C  CB    . PHE C 3 565  ? 186.325 130.185 116.954 1.00 135.25 ?  437  PHE C CB    1 
ATOM   7937  C  CG    . PHE C 3 565  ? 186.547 129.704 115.538 1.00 132.64 ?  437  PHE C CG    1 
ATOM   7938  C  CD1   . PHE C 3 565  ? 185.490 129.618 114.642 1.00 132.02 ?  437  PHE C CD1   1 
ATOM   7939  C  CD2   . PHE C 3 565  ? 187.816 129.362 115.097 1.00 129.23 ?  437  PHE C CD2   1 
ATOM   7940  C  CE1   . PHE C 3 565  ? 185.694 129.186 113.344 1.00 132.11 ?  437  PHE C CE1   1 
ATOM   7941  C  CE2   . PHE C 3 565  ? 188.023 128.931 113.796 1.00 132.76 ?  437  PHE C CE2   1 
ATOM   7942  C  CZ    . PHE C 3 565  ? 186.960 128.844 112.921 1.00 131.74 ?  437  PHE C CZ    1 
ATOM   7943  N  N     . ALA C 3 566  ? 184.149 132.420 116.633 1.00 147.14 ?  438  ALA C N     1 
ATOM   7944  C  CA    . ALA C 3 566  ? 183.138 133.140 115.869 1.00 151.38 ?  438  ALA C CA    1 
ATOM   7945  C  C     . ALA C 3 566  ? 183.397 134.645 115.865 1.00 157.74 ?  438  ALA C C     1 
ATOM   7946  O  O     . ALA C 3 566  ? 183.141 135.311 114.855 1.00 156.71 ?  438  ALA C O     1 
ATOM   7947  C  CB    . ALA C 3 566  ? 181.749 132.832 116.426 1.00 148.06 ?  438  ALA C CB    1 
ATOM   7948  N  N     . GLU C 3 567  ? 183.903 135.196 116.976 1.00 157.05 ?  439  GLU C N     1 
ATOM   7949  C  CA    . GLU C 3 567  ? 184.205 136.626 117.036 1.00 158.70 ?  439  GLU C CA    1 
ATOM   7950  C  C     . GLU C 3 567  ? 185.310 137.010 116.056 1.00 151.96 ?  439  GLU C C     1 
ATOM   7951  O  O     . GLU C 3 567  ? 185.241 138.066 115.416 1.00 146.28 ?  439  GLU C O     1 
ATOM   7952  C  CB    . GLU C 3 567  ? 184.609 137.023 118.460 1.00 158.79 ?  439  GLU C CB    1 
ATOM   7953  C  CG    . GLU C 3 567  ? 183.505 136.965 119.510 1.00 162.39 ?  439  GLU C CG    1 
ATOM   7954  C  CD    . GLU C 3 567  ? 184.055 136.998 120.932 1.00 183.09 ?  439  GLU C CD    1 
ATOM   7955  O  OE1   . GLU C 3 567  ? 185.286 136.867 121.095 1.00 162.25 ?  439  GLU C OE1   1 
ATOM   7956  O  OE2   . GLU C 3 567  ? 183.260 137.146 121.885 1.00 416.35 -1 439  GLU C OE2   1 
ATOM   7957  N  N     . LYS C 3 568  ? 186.341 136.169 115.936 1.00 150.77 ?  440  LYS C N     1 
ATOM   7958  C  CA    . LYS C 3 568  ? 187.507 136.508 115.124 1.00 149.84 ?  440  LYS C CA    1 
ATOM   7959  C  C     . LYS C 3 568  ? 187.288 136.210 113.641 1.00 156.34 ?  440  LYS C C     1 
ATOM   7960  O  O     . LYS C 3 568  ? 187.675 137.013 112.782 1.00 151.77 ?  440  LYS C O     1 
ATOM   7961  C  CB    . LYS C 3 568  ? 188.728 135.747 115.646 1.00 141.80 ?  440  LYS C CB    1 
ATOM   7962  C  CG    . LYS C 3 568  ? 189.189 136.184 117.033 1.00 124.99 ?  440  LYS C CG    1 
ATOM   7963  C  CD    . LYS C 3 568  ? 190.321 135.307 117.551 1.00 109.51 ?  440  LYS C CD    1 
ATOM   7964  C  CE    . LYS C 3 568  ? 190.811 135.785 118.908 1.00 104.85 ?  440  LYS C CE    1 
ATOM   7965  N  NZ    . LYS C 3 568  ? 191.853 134.881 119.468 1.00 101.28 ?  440  LYS C NZ    1 
ATOM   7966  N  N     . GLU C 3 569  ? 186.679 135.069 113.316 1.00 161.96 ?  441  GLU C N     1 
ATOM   7967  C  CA    . GLU C 3 569  ? 186.626 134.581 111.940 1.00 168.79 ?  441  GLU C CA    1 
ATOM   7968  C  C     . GLU C 3 569  ? 185.250 134.680 111.291 1.00 165.25 ?  441  GLU C C     1 
ATOM   7969  O  O     . GLU C 3 569  ? 185.161 135.000 110.104 1.00 159.81 ?  441  GLU C O     1 
ATOM   7970  C  CB    . GLU C 3 569  ? 187.109 133.119 111.888 1.00 169.99 ?  441  GLU C CB    1 
ATOM   7971  C  CG    . GLU C 3 569  ? 188.543 132.873 112.400 1.00 171.47 ?  441  GLU C CG    1 
ATOM   7972  C  CD    . GLU C 3 569  ? 189.636 133.329 111.436 1.00 194.98 ?  441  GLU C CD    1 
ATOM   7973  O  OE1   . GLU C 3 569  ? 189.325 134.018 110.443 1.00 184.45 ?  441  GLU C OE1   1 
ATOM   7974  O  OE2   . GLU C 3 569  ? 190.818 132.997 111.684 1.00 257.18 -1 441  GLU C OE2   1 
ATOM   7975  N  N     . GLU C 3 570  ? 184.170 134.414 112.027 1.00 161.09 ?  442  GLU C N     1 
ATOM   7976  C  CA    . GLU C 3 570  ? 182.827 134.354 111.456 1.00 154.68 ?  442  GLU C CA    1 
ATOM   7977  C  C     . GLU C 3 570  ? 181.921 135.493 111.919 1.00 148.62 ?  442  GLU C C     1 
ATOM   7978  O  O     . GLU C 3 570  ? 180.715 135.459 111.650 1.00 145.04 ?  442  GLU C O     1 
ATOM   7979  C  CB    . GLU C 3 570  ? 182.178 133.003 111.784 1.00 147.88 ?  442  GLU C CB    1 
ATOM   7980  C  CG    . GLU C 3 570  ? 183.154 131.839 111.991 1.00 147.73 ?  442  GLU C CG    1 
ATOM   7981  C  CD    . GLU C 3 570  ? 183.956 131.481 110.747 1.00 156.40 ?  442  GLU C CD    1 
ATOM   7982  O  OE1   . GLU C 3 570  ? 183.565 131.899 109.638 1.00 153.97 ?  442  GLU C OE1   1 
ATOM   7983  O  OE2   . GLU C 3 570  ? 184.969 130.758 110.881 1.00 171.34 -1 442  GLU C OE2   1 
ATOM   7984  N  N     . GLY C 3 571  ? 182.466 136.495 112.605 1.00 148.89 ?  443  GLY C N     1 
ATOM   7985  C  CA    . GLY C 3 571  ? 181.688 137.653 113.006 1.00 148.85 ?  443  GLY C CA    1 
ATOM   7986  C  C     . GLY C 3 571  ? 180.833 137.494 114.247 1.00 158.73 ?  443  GLY C C     1 
ATOM   7987  O  O     . GLY C 3 571  ? 179.854 138.229 114.411 1.00 160.11 ?  443  GLY C O     1 
ATOM   7988  N  N     . GLY C 3 572  ? 181.183 136.569 115.139 1.00 160.00 ?  444  GLY C N     1 
ATOM   7989  C  CA    . GLY C 3 572  ? 180.476 136.430 116.401 1.00 161.05 ?  444  GLY C CA    1 
ATOM   7990  C  C     . GLY C 3 572  ? 179.191 135.627 116.371 1.00 159.50 ?  444  GLY C C     1 
ATOM   7991  O  O     . GLY C 3 572  ? 178.291 135.884 117.179 1.00 153.08 ?  444  GLY C O     1 
ATOM   7992  N  N     . ASP C 3 573  ? 179.081 134.648 115.475 1.00 159.82 ?  445  ASP C N     1 
ATOM   7993  C  CA    . ASP C 3 573  ? 177.877 133.835 115.326 1.00 158.71 ?  445  ASP C CA    1 
ATOM   7994  C  C     . ASP C 3 573  ? 178.185 132.436 115.855 1.00 148.03 ?  445  ASP C C     1 
ATOM   7995  O  O     . ASP C 3 573  ? 178.975 131.701 115.256 1.00 147.05 ?  445  ASP C O     1 
ATOM   7996  C  CB    . ASP C 3 573  ? 177.428 133.799 113.863 1.00 167.60 ?  445  ASP C CB    1 
ATOM   7997  C  CG    . ASP C 3 573  ? 176.156 132.982 113.647 1.00 169.46 ?  445  ASP C CG    1 
ATOM   7998  O  OD1   . ASP C 3 573  ? 175.470 132.660 114.640 1.00 158.02 ?  445  ASP C OD1   1 
ATOM   7999  O  OD2   . ASP C 3 573  ? 175.832 132.677 112.475 1.00 203.37 -1 445  ASP C OD2   1 
ATOM   8000  N  N     . VAL C 3 574  ? 177.571 132.077 116.986 1.00 139.05 ?  446  VAL C N     1 
ATOM   8001  C  CA    . VAL C 3 574  ? 177.781 130.753 117.573 1.00 131.70 ?  446  VAL C CA    1 
ATOM   8002  C  C     . VAL C 3 574  ? 176.985 129.673 116.827 1.00 138.64 ?  446  VAL C C     1 
ATOM   8003  O  O     . VAL C 3 574  ? 177.458 128.531 116.682 1.00 135.67 ?  446  VAL C O     1 
ATOM   8004  C  CB    . VAL C 3 574  ? 177.423 130.788 119.075 1.00 114.19 ?  446  VAL C CB    1 
ATOM   8005  C  CG1   . VAL C 3 574  ? 178.074 129.634 119.820 1.00 105.02 ?  446  VAL C CG1   1 
ATOM   8006  C  CG2   . VAL C 3 574  ? 177.813 132.123 119.704 1.00 114.59 ?  446  VAL C CG2   1 
ATOM   8007  N  N     . LYS C 3 575  ? 175.796 130.019 116.316 1.00 141.57 ?  447  LYS C N     1 
ATOM   8008  C  CA    . LYS C 3 575  ? 174.865 129.014 115.798 1.00 137.56 ?  447  LYS C CA    1 
ATOM   8009  C  C     . LYS C 3 575  ? 175.336 128.410 114.475 1.00 140.88 ?  447  LYS C C     1 
ATOM   8010  O  O     . LYS C 3 575  ? 175.346 127.184 114.320 1.00 135.19 ?  447  LYS C O     1 
ATOM   8011  C  CB    . LYS C 3 575  ? 173.468 129.614 115.628 1.00 125.88 ?  447  LYS C CB    1 
ATOM   8012  C  CG    . LYS C 3 575  ? 172.529 128.714 114.838 1.00 108.92 ?  447  LYS C CG    1 
ATOM   8013  C  CD    . LYS C 3 575  ? 171.217 129.398 114.517 1.00 103.73 ?  447  LYS C CD    1 
ATOM   8014  C  CE    . LYS C 3 575  ? 170.374 128.534 113.598 1.00 91.91  ?  447  LYS C CE    1 
ATOM   8015  N  NZ    . LYS C 3 575  ? 169.082 129.190 113.256 1.00 93.10  ?  447  LYS C NZ    1 
ATOM   8016  N  N     . SER C 3 576  ? 175.692 129.249 113.490 1.00 144.29 ?  448  SER C N     1 
ATOM   8017  C  CA    . SER C 3 576  ? 176.154 128.715 112.206 1.00 138.33 ?  448  SER C CA    1 
ATOM   8018  C  C     . SER C 3 576  ? 177.439 127.913 112.369 1.00 137.16 ?  448  SER C C     1 
ATOM   8019  O  O     . SER C 3 576  ? 177.602 126.857 111.732 1.00 133.06 ?  448  SER C O     1 
ATOM   8020  C  CB    . SER C 3 576  ? 176.368 129.845 111.190 1.00 135.60 ?  448  SER C CB    1 
ATOM   8021  O  OG    . SER C 3 576  ? 175.224 130.673 111.056 1.00 139.93 ?  448  SER C OG    1 
ATOM   8022  N  N     . VAL C 3 577  ? 178.336 128.380 113.244 1.00 142.40 ?  449  VAL C N     1 
ATOM   8023  C  CA    . VAL C 3 577  ? 179.568 127.655 113.544 1.00 142.19 ?  449  VAL C CA    1 
ATOM   8024  C  C     . VAL C 3 577  ? 179.245 126.251 114.049 1.00 138.60 ?  449  VAL C C     1 
ATOM   8025  O  O     . VAL C 3 577  ? 179.627 125.249 113.430 1.00 133.58 ?  449  VAL C O     1 
ATOM   8026  C  CB    . VAL C 3 577  ? 180.417 128.444 114.560 1.00 140.85 ?  449  VAL C CB    1 
ATOM   8027  C  CG1   . VAL C 3 577  ? 181.435 127.550 115.213 1.00 135.30 ?  449  VAL C CG1   1 
ATOM   8028  C  CG2   . VAL C 3 577  ? 181.108 129.634 113.888 1.00 133.57 ?  449  VAL C CG2   1 
ATOM   8029  N  N     . CYS C 3 578  ? 178.496 126.155 115.161 1.00 138.39 ?  450  CYS C N     1 
ATOM   8030  C  CA    . CYS C 3 578  ? 178.232 124.837 115.741 1.00 135.39 ?  450  CYS C CA    1 
ATOM   8031  C  C     . CYS C 3 578  ? 177.357 123.964 114.843 1.00 136.38 ?  450  CYS C C     1 
ATOM   8032  O  O     . CYS C 3 578  ? 177.486 122.734 114.887 1.00 128.78 ?  450  CYS C O     1 
ATOM   8033  C  CB    . CYS C 3 578  ? 177.591 124.973 117.126 1.00 125.06 ?  450  CYS C CB    1 
ATOM   8034  S  SG    . CYS C 3 578  ? 175.954 125.738 117.175 1.00 122.52 ?  450  CYS C SG    1 
ATOM   8035  N  N     . LEU C 3 579  ? 176.507 124.565 113.999 1.00 137.37 ?  451  LEU C N     1 
ATOM   8036  C  CA    . LEU C 3 579  ? 175.687 123.780 113.079 1.00 131.19 ?  451  LEU C CA    1 
ATOM   8037  C  C     . LEU C 3 579  ? 176.542 123.104 112.014 1.00 130.94 ?  451  LEU C C     1 
ATOM   8038  O  O     . LEU C 3 579  ? 176.414 121.894 111.781 1.00 128.42 ?  451  LEU C O     1 
ATOM   8039  C  CB    . LEU C 3 579  ? 174.624 124.668 112.424 1.00 128.49 ?  451  LEU C CB    1 
ATOM   8040  C  CG    . LEU C 3 579  ? 173.963 124.130 111.144 1.00 116.03 ?  451  LEU C CG    1 
ATOM   8041  C  CD1   . LEU C 3 579  ? 173.147 122.877 111.417 1.00 114.25 ?  451  LEU C CD1   1 
ATOM   8042  C  CD2   . LEU C 3 579  ? 173.104 125.174 110.441 1.00 106.24 ?  451  LEU C CD2   1 
ATOM   8043  N  N     . THR C 3 580  ? 177.408 123.870 111.335 1.00 133.51 ?  452  THR C N     1 
ATOM   8044  C  CA    . THR C 3 580  ? 178.279 123.240 110.343 1.00 132.22 ?  452  THR C CA    1 
ATOM   8045  C  C     . THR C 3 580  ? 179.278 122.287 111.001 1.00 133.92 ?  452  THR C C     1 
ATOM   8046  O  O     . THR C 3 580  ? 179.653 121.274 110.394 1.00 130.95 ?  452  THR C O     1 
ATOM   8047  C  CB    . THR C 3 580  ? 178.989 124.305 109.498 1.00 125.47 ?  452  THR C CB    1 
ATOM   8048  O  OG1   . THR C 3 580  ? 178.032 125.264 109.024 1.00 122.88 ?  452  THR C OG1   1 
ATOM   8049  C  CG2   . THR C 3 580  ? 179.679 123.676 108.297 1.00 117.71 ?  452  THR C CG2   1 
ATOM   8050  N  N     . LEU C 3 581  ? 179.669 122.554 112.255 1.00 133.87 ?  453  LEU C N     1 
ATOM   8051  C  CA    . LEU C 3 581  ? 180.539 121.624 112.977 1.00 132.45 ?  453  LEU C CA    1 
ATOM   8052  C  C     . LEU C 3 581  ? 179.851 120.278 113.198 1.00 131.16 ?  453  LEU C C     1 
ATOM   8053  O  O     . LEU C 3 581  ? 180.433 119.214 112.942 1.00 128.88 ?  453  LEU C O     1 
ATOM   8054  C  CB    . LEU C 3 581  ? 180.962 122.224 114.322 1.00 129.06 ?  453  LEU C CB    1 
ATOM   8055  C  CG    . LEU C 3 581  ? 181.869 123.455 114.362 1.00 128.06 ?  453  LEU C CG    1 
ATOM   8056  C  CD1   . LEU C 3 581  ? 182.128 123.909 115.803 1.00 125.37 ?  453  LEU C CD1   1 
ATOM   8057  C  CD2   . LEU C 3 581  ? 183.172 123.199 113.622 1.00 128.32 ?  453  LEU C CD2   1 
ATOM   8058  N  N     . PHE C 3 582  ? 178.607 120.306 113.690 1.00 129.08 ?  454  PHE C N     1 
ATOM   8059  C  CA    . PHE C 3 582  ? 177.888 119.058 113.927 1.00 127.11 ?  454  PHE C CA    1 
ATOM   8060  C  C     . PHE C 3 582  ? 177.559 118.350 112.611 1.00 131.14 ?  454  PHE C C     1 
ATOM   8061  O  O     . PHE C 3 582  ? 177.559 117.113 112.560 1.00 129.35 ?  454  PHE C O     1 
ATOM   8062  C  CB    . PHE C 3 582  ? 176.624 119.326 114.751 1.00 122.22 ?  454  PHE C CB    1 
ATOM   8063  C  CG    . PHE C 3 582  ? 175.956 118.080 115.266 1.00 125.56 ?  454  PHE C CG    1 
ATOM   8064  C  CD1   . PHE C 3 582  ? 176.581 117.288 116.210 1.00 124.38 ?  454  PHE C CD1   1 
ATOM   8065  C  CD2   . PHE C 3 582  ? 174.707 117.697 114.805 1.00 123.81 ?  454  PHE C CD2   1 
ATOM   8066  C  CE1   . PHE C 3 582  ? 175.982 116.138 116.686 1.00 122.82 ?  454  PHE C CE1   1 
ATOM   8067  C  CE2   . PHE C 3 582  ? 174.103 116.545 115.278 1.00 119.59 ?  454  PHE C CE2   1 
ATOM   8068  C  CZ    . PHE C 3 582  ? 174.738 115.768 116.217 1.00 119.04 ?  454  PHE C CZ    1 
ATOM   8069  N  N     . LEU C 3 583  ? 177.318 119.107 111.531 1.00 131.98 ?  455  LEU C N     1 
ATOM   8070  C  CA    . LEU C 3 583  ? 177.126 118.492 110.213 1.00 128.53 ?  455  LEU C CA    1 
ATOM   8071  C  C     . LEU C 3 583  ? 178.365 117.725 109.767 1.00 132.99 ?  455  LEU C C     1 
ATOM   8072  O  O     . LEU C 3 583  ? 178.269 116.574 109.322 1.00 131.98 ?  455  LEU C O     1 
ATOM   8073  C  CB    . LEU C 3 583  ? 176.772 119.548 109.159 1.00 122.11 ?  455  LEU C CB    1 
ATOM   8074  C  CG    . LEU C 3 583  ? 175.359 119.558 108.573 1.00 115.84 ?  455  LEU C CG    1 
ATOM   8075  C  CD1   . LEU C 3 583  ? 175.117 120.800 107.732 1.00 116.79 ?  455  LEU C CD1   1 
ATOM   8076  C  CD2   . LEU C 3 583  ? 175.166 118.312 107.728 1.00 116.57 ?  455  LEU C CD2   1 
ATOM   8077  N  N     . LEU C 3 584  ? 179.540 118.360 109.850 1.00 134.63 ?  456  LEU C N     1 
ATOM   8078  C  CA    . LEU C 3 584  ? 180.771 117.721 109.394 1.00 135.25 ?  456  LEU C CA    1 
ATOM   8079  C  C     . LEU C 3 584  ? 181.261 116.631 110.345 1.00 140.15 ?  456  LEU C C     1 
ATOM   8080  O  O     . LEU C 3 584  ? 182.102 115.820 109.945 1.00 139.82 ?  456  LEU C O     1 
ATOM   8081  C  CB    . LEU C 3 584  ? 181.854 118.787 109.182 1.00 127.91 ?  456  LEU C CB    1 
ATOM   8082  C  CG    . LEU C 3 584  ? 181.516 119.923 108.199 1.00 120.63 ?  456  LEU C CG    1 
ATOM   8083  C  CD1   . LEU C 3 584  ? 182.729 120.787 107.887 1.00 116.44 ?  456  LEU C CD1   1 
ATOM   8084  C  CD2   . LEU C 3 584  ? 180.901 119.385 106.905 1.00 120.13 ?  456  LEU C CD2   1 
ATOM   8085  N  N     . ALA C 3 585  ? 180.753 116.584 111.581 1.00 138.46 ?  457  ALA C N     1 
ATOM   8086  C  CA    . ALA C 3 585  ? 181.021 115.444 112.455 1.00 133.32 ?  457  ALA C CA    1 
ATOM   8087  C  C     . ALA C 3 585  ? 180.072 114.272 112.219 1.00 133.10 ?  457  ALA C C     1 
ATOM   8088  O  O     . ALA C 3 585  ? 180.489 113.114 112.349 1.00 129.24 ?  457  ALA C O     1 
ATOM   8089  C  CB    . ALA C 3 585  ? 180.944 115.867 113.924 1.00 118.72 ?  457  ALA C CB    1 
ATOM   8090  N  N     . LEU C 3 586  ? 178.808 114.540 111.873 1.00 132.89 ?  458  LEU C N     1 
ATOM   8091  C  CA    . LEU C 3 586  ? 177.900 113.457 111.497 1.00 130.96 ?  458  LEU C CA    1 
ATOM   8092  C  C     . LEU C 3 586  ? 178.316 112.826 110.174 1.00 136.70 ?  458  LEU C C     1 
ATOM   8093  O  O     . LEU C 3 586  ? 178.376 111.597 110.053 1.00 146.77 ?  458  LEU C O     1 
ATOM   8094  C  CB    . LEU C 3 586  ? 176.459 113.963 111.404 1.00 125.25 ?  458  LEU C CB    1 
ATOM   8095  C  CG    . LEU C 3 586  ? 175.568 113.942 112.649 1.00 121.70 ?  458  LEU C CG    1 
ATOM   8096  C  CD1   . LEU C 3 586  ? 174.112 114.235 112.295 1.00 109.87 ?  458  LEU C CD1   1 
ATOM   8097  C  CD2   . LEU C 3 586  ? 175.674 112.585 113.321 1.00 120.20 ?  458  LEU C CD2   1 
ATOM   8098  N  N     . ARG C 3 587  ? 178.606 113.654 109.166 1.00 135.38 ?  459  ARG C N     1 
ATOM   8099  C  CA    . ARG C 3 587  ? 178.986 113.129 107.860 1.00 138.46 ?  459  ARG C CA    1 
ATOM   8100  C  C     . ARG C 3 587  ? 180.300 112.358 107.902 1.00 161.65 ?  459  ARG C C     1 
ATOM   8101  O  O     . ARG C 3 587  ? 180.637 111.693 106.919 1.00 171.16 ?  459  ARG C O     1 
ATOM   8102  C  CB    . ARG C 3 587  ? 179.070 114.281 106.854 1.00 138.73 ?  459  ARG C CB    1 
ATOM   8103  C  CG    . ARG C 3 587  ? 177.769 115.068 106.724 1.00 128.76 ?  459  ARG C CG    1 
ATOM   8104  C  CD    . ARG C 3 587  ? 177.726 115.963 105.497 1.00 129.43 ?  459  ARG C CD    1 
ATOM   8105  N  NE    . ARG C 3 587  ? 176.365 116.437 105.257 1.00 131.28 ?  459  ARG C NE    1 
ATOM   8106  C  CZ    . ARG C 3 587  ? 175.379 115.668 104.810 1.00 136.67 ?  459  ARG C CZ    1 
ATOM   8107  N  NH1   . ARG C 3 587  ? 175.597 114.387 104.563 1.00 141.86 ?  459  ARG C NH1   1 
ATOM   8108  N  NH2   . ARG C 3 587  ? 174.172 116.179 104.619 1.00 139.46 ?  459  ARG C NH2   1 
ATOM   8109  N  N     . ALA C 3 588  ? 181.041 112.432 109.011 1.00 208.31 ?  460  ALA C N     1 
ATOM   8110  C  CA    . ALA C 3 588  ? 182.279 111.670 109.146 1.00 192.43 ?  460  ALA C CA    1 
ATOM   8111  C  C     . ALA C 3 588  ? 182.013 110.184 109.351 1.00 179.33 ?  460  ALA C C     1 
ATOM   8112  O  O     . ALA C 3 588  ? 182.857 109.351 108.999 1.00 168.64 ?  460  ALA C O     1 
ATOM   8113  C  CB    . ALA C 3 588  ? 183.113 112.219 110.305 1.00 158.86 ?  460  ALA C CB    1 
ATOM   8114  N  N     . GLY C 3 589  ? 180.865 109.831 109.925 1.00 162.96 ?  461  GLY C N     1 
ATOM   8115  C  CA    . GLY C 3 589  ? 180.517 108.436 110.123 1.00 161.99 ?  461  GLY C CA    1 
ATOM   8116  C  C     . GLY C 3 589  ? 179.668 107.850 109.011 1.00 168.62 ?  461  GLY C C     1 
ATOM   8117  O  O     . GLY C 3 589  ? 178.999 106.830 109.206 1.00 164.42 ?  461  GLY C O     1 
ATOM   8118  N  N     . ASN C 3 590  ? 179.687 108.494 107.841 1.00 169.07 ?  462  ASN C N     1 
ATOM   8119  C  CA    . ASN C 3 590  ? 178.886 108.120 106.672 1.00 165.08 ?  462  ASN C CA    1 
ATOM   8120  C  C     . ASN C 3 590  ? 177.387 108.129 106.971 1.00 161.59 ?  462  ASN C C     1 
ATOM   8121  O  O     . ASN C 3 590  ? 176.598 107.523 106.239 1.00 166.11 ?  462  ASN C O     1 
ATOM   8122  C  CB    . ASN C 3 590  ? 179.312 106.753 106.111 1.00 166.24 ?  462  ASN C CB    1 
ATOM   8123  C  CG    . ASN C 3 590  ? 179.910 106.851 104.715 1.00 169.56 ?  462  ASN C CG    1 
ATOM   8124  O  OD1   . ASN C 3 590  ? 180.510 107.862 104.352 1.00 179.29 ?  462  ASN C OD1   1 
ATOM   8125  N  ND2   . ASN C 3 590  ? 179.743 105.796 103.925 1.00 178.10 ?  462  ASN C ND2   1 
ATOM   8126  N  N     . GLU C 3 591  ? 176.977 108.833 108.028 1.00 158.01 ?  463  GLU C N     1 
ATOM   8127  C  CA    . GLU C 3 591  ? 175.577 108.894 108.450 1.00 156.08 ?  463  GLU C CA    1 
ATOM   8128  C  C     . GLU C 3 591  ? 174.894 110.038 107.704 1.00 146.03 ?  463  GLU C C     1 
ATOM   8129  O  O     . GLU C 3 591  ? 174.712 111.144 108.216 1.00 140.17 ?  463  GLU C O     1 
ATOM   8130  C  CB    . GLU C 3 591  ? 175.490 109.061 109.964 1.00 157.05 ?  463  GLU C CB    1 
ATOM   8131  C  CG    . GLU C 3 591  ? 176.376 108.094 110.750 1.00 167.36 ?  463  GLU C CG    1 
ATOM   8132  C  CD    . GLU C 3 591  ? 176.547 108.490 112.211 1.00 176.11 ?  463  GLU C CD    1 
ATOM   8133  O  OE1   . GLU C 3 591  ? 175.761 109.325 112.708 1.00 150.70 ?  463  GLU C OE1   1 
ATOM   8134  O  OE2   . GLU C 3 591  ? 177.483 107.971 112.860 1.00 271.48 -1 463  GLU C OE2   1 
ATOM   8135  N  N     . HIS C 3 592  ? 174.507 109.753 106.458 1.00 146.25 ?  464  HIS C N     1 
ATOM   8136  C  CA    . HIS C 3 592  ? 173.936 110.784 105.596 1.00 146.96 ?  464  HIS C CA    1 
ATOM   8137  C  C     . HIS C 3 592  ? 172.495 111.129 105.973 1.00 142.37 ?  464  HIS C C     1 
ATOM   8138  O  O     . HIS C 3 592  ? 172.080 112.286 105.829 1.00 141.07 ?  464  HIS C O     1 
ATOM   8139  C  CB    . HIS C 3 592  ? 174.007 110.335 104.135 1.00 151.66 ?  464  HIS C CB    1 
ATOM   8140  C  CG    . HIS C 3 592  ? 175.197 110.862 103.394 1.00 160.72 ?  464  HIS C CG    1 
ATOM   8141  N  ND1   . HIS C 3 592  ? 175.142 112.001 102.619 1.00 165.51 ?  464  HIS C ND1   1 
ATOM   8142  C  CD2   . HIS C 3 592  ? 176.470 110.406 103.303 1.00 175.06 ?  464  HIS C CD2   1 
ATOM   8143  C  CE1   . HIS C 3 592  ? 176.329 112.225 102.085 1.00 186.65 ?  464  HIS C CE1   1 
ATOM   8144  N  NE2   . HIS C 3 592  ? 177.153 111.272 102.484 1.00 195.64 ?  464  HIS C NE2   1 
ATOM   8145  N  N     . LYS C 3 593  ? 171.724 110.155 106.466 1.00 138.24 ?  465  LYS C N     1 
ATOM   8146  C  CA    . LYS C 3 593  ? 170.303 110.382 106.721 1.00 129.71 ?  465  LYS C CA    1 
ATOM   8147  C  C     . LYS C 3 593  ? 170.091 111.371 107.863 1.00 127.99 ?  465  LYS C C     1 
ATOM   8148  O  O     . LYS C 3 593  ? 169.326 112.338 107.732 1.00 127.94 ?  465  LYS C O     1 
ATOM   8149  C  CB    . LYS C 3 593  ? 169.616 109.053 107.034 1.00 124.27 ?  465  LYS C CB    1 
ATOM   8150  C  CG    . LYS C 3 593  ? 169.642 108.045 105.903 1.00 124.34 ?  465  LYS C CG    1 
ATOM   8151  C  CD    . LYS C 3 593  ? 168.819 106.830 106.275 1.00 122.51 ?  465  LYS C CD    1 
ATOM   8152  C  CE    . LYS C 3 593  ? 168.678 105.873 105.109 1.00 129.26 ?  465  LYS C CE    1 
ATOM   8153  N  NZ    . LYS C 3 593  ? 167.733 104.771 105.436 1.00 119.48 ?  465  LYS C NZ    1 
ATOM   8154  N  N     . GLN C 3 594  ? 170.757 111.138 108.998 1.00 126.08 ?  466  GLN C N     1 
ATOM   8155  C  CA    . GLN C 3 594  ? 170.625 112.030 110.144 1.00 121.40 ?  466  GLN C CA    1 
ATOM   8156  C  C     . GLN C 3 594  ? 171.191 113.412 109.840 1.00 122.10 ?  466  GLN C C     1 
ATOM   8157  O  O     . GLN C 3 594  ? 170.657 114.420 110.316 1.00 118.43 ?  466  GLN C O     1 
ATOM   8158  C  CB    . GLN C 3 594  ? 171.315 111.405 111.356 1.00 113.77 ?  466  GLN C CB    1 
ATOM   8159  C  CG    . GLN C 3 594  ? 170.850 109.980 111.647 1.00 107.75 ?  466  GLN C CG    1 
ATOM   8160  C  CD    . GLN C 3 594  ? 171.796 109.231 112.564 1.00 107.85 ?  466  GLN C CD    1 
ATOM   8161  O  OE1   . GLN C 3 594  ? 172.958 109.604 112.711 1.00 115.45 ?  466  GLN C OE1   1 
ATOM   8162  N  NE2   . GLN C 3 594  ? 171.305 108.155 113.171 1.00 100.30 ?  466  GLN C NE2   1 
ATOM   8163  N  N     . ALA C 3 595  ? 172.235 113.481 109.012 1.00 125.36 ?  467  ALA C N     1 
ATOM   8164  C  CA    . ALA C 3 595  ? 172.798 114.772 108.628 1.00 127.11 ?  467  ALA C CA    1 
ATOM   8165  C  C     . ALA C 3 595  ? 171.843 115.561 107.732 1.00 134.79 ?  467  ALA C C     1 
ATOM   8166  O  O     . ALA C 3 595  ? 171.704 116.782 107.890 1.00 135.29 ?  467  ALA C O     1 
ATOM   8167  C  CB    . ALA C 3 595  ? 174.145 114.562 107.936 1.00 126.53 ?  467  ALA C CB    1 
ATOM   8168  N  N     . ASP C 3 596  ? 171.170 114.888 106.787 1.00 136.38 ?  468  ASP C N     1 
ATOM   8169  C  CA    . ASP C 3 596  ? 170.220 115.592 105.925 1.00 135.31 ?  468  ASP C CA    1 
ATOM   8170  C  C     . ASP C 3 596  ? 168.971 116.015 106.689 1.00 128.60 ?  468  ASP C C     1 
ATOM   8171  O  O     . ASP C 3 596  ? 168.404 117.077 106.409 1.00 123.32 ?  468  ASP C O     1 
ATOM   8172  C  CB    . ASP C 3 596  ? 169.838 114.740 104.712 1.00 141.78 ?  468  ASP C CB    1 
ATOM   8173  C  CG    . ASP C 3 596  ? 170.761 114.961 103.520 1.00 165.09 ?  468  ASP C CG    1 
ATOM   8174  O  OD1   . ASP C 3 596  ? 171.926 115.363 103.724 1.00 152.21 ?  468  ASP C OD1   1 
ATOM   8175  O  OD2   . ASP C 3 596  ? 170.313 114.748 102.371 1.00 276.59 -1 468  ASP C OD2   1 
ATOM   8176  N  N     . GLU C 3 597  ? 168.519 115.200 107.650 1.00 130.18 ?  469  GLU C N     1 
ATOM   8177  C  CA    . GLU C 3 597  ? 167.448 115.657 108.535 1.00 132.82 ?  469  GLU C CA    1 
ATOM   8178  C  C     . GLU C 3 597  ? 167.881 116.872 109.348 1.00 129.70 ?  469  GLU C C     1 
ATOM   8179  O  O     . GLU C 3 597  ? 167.104 117.819 109.522 1.00 125.50 ?  469  GLU C O     1 
ATOM   8180  C  CB    . GLU C 3 597  ? 166.997 114.537 109.472 1.00 140.94 ?  469  GLU C CB    1 
ATOM   8181  C  CG    . GLU C 3 597  ? 165.748 113.781 109.042 1.00 154.06 ?  469  GLU C CG    1 
ATOM   8182  C  CD    . GLU C 3 597  ? 165.143 112.981 110.191 1.00 172.37 ?  469  GLU C CD    1 
ATOM   8183  O  OE1   . GLU C 3 597  ? 165.543 113.209 111.355 1.00 149.09 ?  469  GLU C OE1   1 
ATOM   8184  O  OE2   . GLU C 3 597  ? 164.253 112.138 109.937 1.00 310.09 -1 469  GLU C OE2   1 
ATOM   8185  N  N     . LEU C 3 598  ? 169.118 116.864 109.858 1.00 127.10 ?  470  LEU C N     1 
ATOM   8186  C  CA    . LEU C 3 598  ? 169.610 118.002 110.627 1.00 124.63 ?  470  LEU C CA    1 
ATOM   8187  C  C     . LEU C 3 598  ? 169.650 119.272 109.785 1.00 126.80 ?  470  LEU C C     1 
ATOM   8188  O  O     . LEU C 3 598  ? 169.275 120.352 110.259 1.00 122.02 ?  470  LEU C O     1 
ATOM   8189  C  CB    . LEU C 3 598  ? 171.002 117.690 111.177 1.00 119.90 ?  470  LEU C CB    1 
ATOM   8190  C  CG    . LEU C 3 598  ? 171.848 118.903 111.573 1.00 120.02 ?  470  LEU C CG    1 
ATOM   8191  C  CD1   . LEU C 3 598  ? 171.267 119.612 112.783 1.00 116.38 ?  470  LEU C CD1   1 
ATOM   8192  C  CD2   . LEU C 3 598  ? 173.314 118.539 111.788 1.00 119.58 ?  470  LEU C CD2   1 
ATOM   8193  N  N     . GLU C 3 599  ? 170.110 119.167 108.533 1.00 131.64 ?  471  GLU C N     1 
ATOM   8194  C  CA    . GLU C 3 599  ? 170.244 120.360 107.699 1.00 136.15 ?  471  GLU C CA    1 
ATOM   8195  C  C     . GLU C 3 599  ? 168.889 120.854 107.204 1.00 132.00 ?  471  GLU C C     1 
ATOM   8196  O  O     . GLU C 3 599  ? 168.621 122.061 107.221 1.00 129.82 ?  471  GLU C O     1 
ATOM   8197  C  CB    . GLU C 3 599  ? 171.170 120.088 106.515 1.00 144.21 ?  471  GLU C CB    1 
ATOM   8198  C  CG    . GLU C 3 599  ? 171.187 121.219 105.485 1.00 158.14 ?  471  GLU C CG    1 
ATOM   8199  C  CD    . GLU C 3 599  ? 172.161 120.981 104.341 1.00 186.75 ?  471  GLU C CD    1 
ATOM   8200  O  OE1   . GLU C 3 599  ? 173.145 120.236 104.536 1.00 166.56 ?  471  GLU C OE1   1 
ATOM   8201  O  OE2   . GLU C 3 599  ? 171.943 121.546 103.247 1.00 308.01 -1 471  GLU C OE2   1 
ATOM   8202  N  N     . ALA C 3 600  ? 168.021 119.944 106.752 1.00 129.94 ?  472  ALA C N     1 
ATOM   8203  C  CA    . ALA C 3 600  ? 166.697 120.356 106.305 1.00 123.52 ?  472  ALA C CA    1 
ATOM   8204  C  C     . ALA C 3 600  ? 165.867 120.909 107.456 1.00 122.81 ?  472  ALA C C     1 
ATOM   8205  O  O     . ALA C 3 600  ? 165.054 121.813 107.247 1.00 120.73 ?  472  ALA C O     1 
ATOM   8206  C  CB    . ALA C 3 600  ? 165.983 119.179 105.639 1.00 110.78 ?  472  ALA C CB    1 
ATOM   8207  N  N     . MET C 3 601  ? 166.075 120.393 108.675 1.00 122.33 ?  473  MET C N     1 
ATOM   8208  C  CA    . MET C 3 601  ? 165.342 120.867 109.848 1.00 116.04 ?  473  MET C CA    1 
ATOM   8209  C  C     . MET C 3 601  ? 165.423 122.381 109.997 1.00 119.92 ?  473  MET C C     1 
ATOM   8210  O  O     . MET C 3 601  ? 164.514 123.003 110.561 1.00 119.97 ?  473  MET C O     1 
ATOM   8211  C  CB    . MET C 3 601  ? 165.884 120.177 111.102 1.00 109.93 ?  473  MET C CB    1 
ATOM   8212  C  CG    . MET C 3 601  ? 165.020 120.312 112.345 1.00 107.93 ?  473  MET C CG    1 
ATOM   8213  S  SD    . MET C 3 601  ? 165.662 119.291 113.685 1.00 99.14  ?  473  MET C SD    1 
ATOM   8214  C  CE    . MET C 3 601  ? 167.337 119.903 113.794 1.00 105.52 ?  473  MET C CE    1 
ATOM   8215  N  N     . MET C 3 602  ? 166.506 122.988 109.515 1.00 124.06 ?  474  MET C N     1 
ATOM   8216  C  CA    . MET C 3 602  ? 166.573 124.434 109.332 1.00 126.14 ?  474  MET C CA    1 
ATOM   8217  C  C     . MET C 3 602  ? 165.911 124.780 108.003 1.00 125.05 ?  474  MET C C     1 
ATOM   8218  O  O     . MET C 3 602  ? 166.455 124.478 106.936 1.00 120.27 ?  474  MET C O     1 
ATOM   8219  C  CB    . MET C 3 602  ? 168.021 124.918 109.371 1.00 122.91 ?  474  MET C CB    1 
ATOM   8220  C  CG    . MET C 3 602  ? 168.832 124.493 110.594 1.00 117.59 ?  474  MET C CG    1 
ATOM   8221  S  SD    . MET C 3 602  ? 168.046 124.917 112.162 1.00 103.22 ?  474  MET C SD    1 
ATOM   8222  C  CE    . MET C 3 602  ? 167.812 126.687 111.956 1.00 96.29  ?  474  MET C CE    1 
ATOM   8223  N  N     . GLN C 3 603  ? 164.720 125.381 108.073 1.00 125.99 ?  475  GLN C N     1 
ATOM   8224  C  CA    . GLN C 3 603  ? 163.987 125.932 106.932 1.00 123.38 ?  475  GLN C CA    1 
ATOM   8225  C  C     . GLN C 3 603  ? 163.389 124.864 106.018 1.00 122.46 ?  475  GLN C C     1 
ATOM   8226  O  O     . GLN C 3 603  ? 163.125 125.139 104.843 1.00 115.37 ?  475  GLN C O     1 
ATOM   8227  C  CB    . GLN C 3 603  ? 164.867 126.886 106.110 1.00 122.75 ?  475  GLN C CB    1 
ATOM   8228  C  CG    . GLN C 3 603  ? 165.104 128.254 106.751 1.00 118.79 ?  475  GLN C CG    1 
ATOM   8229  C  CD    . GLN C 3 603  ? 166.561 128.494 107.117 1.00 113.41 ?  475  GLN C CD    1 
ATOM   8230  O  OE1   . GLN C 3 603  ? 167.200 127.649 107.743 1.00 113.67 ?  475  GLN C OE1   1 
ATOM   8231  N  NE2   . GLN C 3 603  ? 167.089 129.650 106.729 1.00 106.62 ?  475  GLN C NE2   1 
ATOM   8232  N  N     . GLY C 3 604  ? 163.173 123.653 106.514 1.00 148.92 ?  476  GLY C N     1 
ATOM   8233  C  CA    . GLY C 3 604  ? 162.567 122.615 105.709 1.00 123.90 ?  476  GLY C CA    1 
ATOM   8234  C  C     . GLY C 3 604  ? 162.158 121.394 106.512 1.00 122.25 ?  476  GLY C C     1 
ATOM   8235  O  O     . GLY C 3 604  ? 161.956 121.470 107.725 1.00 118.17 ?  476  GLY C O     1 
ATOM   8236  N  N     . ARG C 3 605  ? 162.020 120.266 105.800 1.00 120.23 ?  477  ARG C N     1 
ATOM   8237  C  CA    . ARG C 3 605  ? 161.689 118.944 106.339 1.00 108.75 ?  477  ARG C CA    1 
ATOM   8238  C  C     . ARG C 3 605  ? 160.261 118.866 106.872 1.00 101.46 ?  477  ARG C C     1 
ATOM   8239  O  O     . ARG C 3 605  ? 159.798 117.789 107.261 1.00 93.76  ?  477  ARG C O     1 
ATOM   8240  C  CB    . ARG C 3 605  ? 162.672 118.530 107.448 1.00 102.71 ?  477  ARG C CB    1 
ATOM   8241  C  CG    . ARG C 3 605  ? 162.556 117.055 107.876 1.00 94.04  ?  477  ARG C CG    1 
ATOM   8242  C  CD    . ARG C 3 605  ? 162.718 116.895 109.386 1.00 97.61  ?  477  ARG C CD    1 
ATOM   8243  N  NE    . ARG C 3 605  ? 162.155 115.639 109.875 1.00 97.37  ?  477  ARG C NE    1 
ATOM   8244  C  CZ    . ARG C 3 605  ? 160.979 115.541 110.493 1.00 82.08  ?  477  ARG C CZ    1 
ATOM   8245  N  NH1   . ARG C 3 605  ? 160.538 114.360 110.913 1.00 75.17  ?  477  ARG C NH1   1 
ATOM   8246  N  NH2   . ARG C 3 605  ? 160.247 116.627 110.699 1.00 75.91  ?  477  ARG C NH2   1 
ATOM   8247  N  N     . GLY C 3 606  ? 159.529 119.973 106.867 1.00 102.61 ?  478  GLY C N     1 
ATOM   8248  C  CA    . GLY C 3 606  ? 158.286 119.959 107.607 1.00 92.95  ?  478  GLY C CA    1 
ATOM   8249  C  C     . GLY C 3 606  ? 158.590 119.946 109.089 1.00 91.44  ?  478  GLY C C     1 
ATOM   8250  O  O     . GLY C 3 606  ? 158.439 118.905 109.734 1.00 85.72  ?  478  GLY C O     1 
ATOM   8251  N  N     . PHE C 3 607  ? 159.026 121.097 109.622 1.00 99.97  ?  479  PHE C N     1 
ATOM   8252  C  CA    . PHE C 3 607  ? 159.779 121.204 110.874 1.00 111.28 ?  479  PHE C CA    1 
ATOM   8253  C  C     . PHE C 3 607  ? 159.354 120.171 111.912 1.00 110.90 ?  479  PHE C C     1 
ATOM   8254  O  O     . PHE C 3 607  ? 160.146 119.308 112.302 1.00 114.85 ?  479  PHE C O     1 
ATOM   8255  C  CB    . PHE C 3 607  ? 159.620 122.640 111.409 1.00 112.94 ?  479  PHE C CB    1 
ATOM   8256  C  CG    . PHE C 3 607  ? 160.473 122.970 112.614 1.00 122.24 ?  479  PHE C CG    1 
ATOM   8257  C  CD1   . PHE C 3 607  ? 161.859 122.972 112.543 1.00 126.58 ?  479  PHE C CD1   1 
ATOM   8258  C  CD2   . PHE C 3 607  ? 159.876 123.304 113.818 1.00 128.86 ?  479  PHE C CD2   1 
ATOM   8259  C  CE1   . PHE C 3 607  ? 162.622 123.295 113.658 1.00 132.86 ?  479  PHE C CE1   1 
ATOM   8260  C  CE2   . PHE C 3 607  ? 160.636 123.630 114.926 1.00 135.15 ?  479  PHE C CE2   1 
ATOM   8261  C  CZ    . PHE C 3 607  ? 162.006 123.621 114.846 1.00 135.90 ?  479  PHE C CZ    1 
ATOM   8262  N  N     . GLY C 3 608  ? 158.104 120.221 112.349 1.00 98.88  ?  480  GLY C N     1 
ATOM   8263  C  CA    . GLY C 3 608  ? 157.466 119.044 112.903 1.00 81.72  ?  480  GLY C CA    1 
ATOM   8264  C  C     . GLY C 3 608  ? 156.367 118.638 111.947 1.00 65.39  ?  480  GLY C C     1 
ATOM   8265  O  O     . GLY C 3 608  ? 156.131 117.455 111.688 1.00 60.47  ?  480  GLY C O     1 
ATOM   8266  N  N     . LEU C 3 609  ? 155.714 119.659 111.398 1.00 61.57  ?  481  LEU C N     1 
ATOM   8267  C  CA    . LEU C 3 609  ? 154.777 119.597 110.288 1.00 49.93  ?  481  LEU C CA    1 
ATOM   8268  C  C     . LEU C 3 609  ? 154.452 121.034 109.904 1.00 47.38  ?  481  LEU C C     1 
ATOM   8269  O  O     . LEU C 3 609  ? 154.376 121.904 110.776 1.00 41.74  ?  481  LEU C O     1 
ATOM   8270  C  CB    . LEU C 3 609  ? 153.501 118.835 110.663 1.00 38.25  ?  481  LEU C CB    1 
ATOM   8271  C  CG    . LEU C 3 609  ? 152.552 118.452 109.534 1.00 37.47  ?  481  LEU C CG    1 
ATOM   8272  C  CD1   . LEU C 3 609  ? 153.322 118.104 108.280 1.00 36.21  ?  481  LEU C CD1   1 
ATOM   8273  C  CD2   . LEU C 3 609  ? 151.680 117.296 109.969 1.00 27.83  ?  481  LEU C CD2   1 
ATOM   8274  N  N     . HIS C 3 610  ? 154.281 121.283 108.617 1.00 41.70  ?  482  HIS C N     1 
ATOM   8275  C  CA    . HIS C 3 610  ? 154.079 122.653 108.150 1.00 35.10  ?  482  HIS C CA    1 
ATOM   8276  C  C     . HIS C 3 610  ? 152.781 123.208 108.732 1.00 32.96  ?  482  HIS C C     1 
ATOM   8277  O  O     . HIS C 3 610  ? 151.716 122.624 108.508 1.00 32.68  ?  482  HIS C O     1 
ATOM   8278  C  CB    . HIS C 3 610  ? 154.070 122.669 106.623 1.00 34.91  ?  482  HIS C CB    1 
ATOM   8279  C  CG    . HIS C 3 610  ? 154.305 124.019 106.027 1.00 44.32  ?  482  HIS C CG    1 
ATOM   8280  N  ND1   . HIS C 3 610  ? 153.378 125.038 106.096 1.00 42.03  ?  482  HIS C ND1   1 
ATOM   8281  C  CD2   . HIS C 3 610  ? 155.371 124.520 105.361 1.00 54.44  ?  482  HIS C CD2   1 
ATOM   8282  C  CE1   . HIS C 3 610  ? 153.858 126.105 105.484 1.00 52.05  ?  482  HIS C CE1   1 
ATOM   8283  N  NE2   . HIS C 3 610  ? 155.067 125.818 105.032 1.00 57.18  ?  482  HIS C NE2   1 
ATOM   8284  N  N     . PRO C 3 611  ? 152.823 124.308 109.493 1.00 30.96  ?  483  PRO C N     1 
ATOM   8285  C  CA    . PRO C 3 611  ? 151.630 124.731 110.257 1.00 25.82  ?  483  PRO C CA    1 
ATOM   8286  C  C     . PRO C 3 611  ? 150.400 124.960 109.409 1.00 25.09  ?  483  PRO C C     1 
ATOM   8287  O  O     . PRO C 3 611  ? 149.271 124.717 109.859 1.00 29.06  ?  483  PRO C O     1 
ATOM   8288  C  CB    . PRO C 3 611  ? 152.093 126.038 110.917 1.00 30.13  ?  483  PRO C CB    1 
ATOM   8289  C  CG    . PRO C 3 611  ? 153.554 125.914 110.975 1.00 32.87  ?  483  PRO C CG    1 
ATOM   8290  C  CD    . PRO C 3 611  ? 153.972 125.188 109.745 1.00 36.04  ?  483  PRO C CD    1 
ATOM   8291  N  N     . ALA C 3 612  ? 150.591 125.469 108.197 1.00 28.74  ?  484  ALA C N     1 
ATOM   8292  C  CA    . ALA C 3 612  ? 149.484 125.603 107.265 1.00 25.84  ?  484  ALA C CA    1 
ATOM   8293  C  C     . ALA C 3 612  ? 148.776 124.267 107.054 1.00 26.60  ?  484  ALA C C     1 
ATOM   8294  O  O     . ALA C 3 612  ? 147.538 124.190 107.086 1.00 23.45  ?  484  ALA C O     1 
ATOM   8295  C  CB    . ALA C 3 612  ? 150.005 126.167 105.945 1.00 33.06  ?  484  ALA C CB    1 
ATOM   8296  N  N     . VAL C 3 613  ? 149.553 123.205 106.811 1.00 29.87  ?  485  VAL C N     1 
ATOM   8297  C  CA    . VAL C 3 613  ? 148.984 121.871 106.634 1.00 30.74  ?  485  VAL C CA    1 
ATOM   8298  C  C     . VAL C 3 613  ? 148.130 121.495 107.834 1.00 23.27  ?  485  VAL C C     1 
ATOM   8299  O  O     . VAL C 3 613  ? 147.079 120.860 107.701 1.00 22.30  ?  485  VAL C O     1 
ATOM   8300  C  CB    . VAL C 3 613  ? 150.104 120.839 106.408 1.00 31.89  ?  485  VAL C CB    1 
ATOM   8301  C  CG1   . VAL C 3 613  ? 149.522 119.444 106.279 1.00 30.04  ?  485  VAL C CG1   1 
ATOM   8302  C  CG2   . VAL C 3 613  ? 150.936 121.184 105.181 1.00 35.14  ?  485  VAL C CG2   1 
ATOM   8303  N  N     . CYS C 3 614  ? 148.570 121.881 109.027 1.00 21.54  ?  486  CYS C N     1 
ATOM   8304  C  CA    . CYS C 3 614  ? 147.848 121.489 110.228 1.00 21.86  ?  486  CYS C CA    1 
ATOM   8305  C  C     . CYS C 3 614  ? 146.540 122.260 110.359 1.00 20.80  ?  486  CYS C C     1 
ATOM   8306  O  O     . CYS C 3 614  ? 145.511 121.691 110.739 1.00 19.85  ?  486  CYS C O     1 
ATOM   8307  C  CB    . CYS C 3 614  ? 148.736 121.700 111.449 1.00 40.87  ?  486  CYS C CB    1 
ATOM   8308  S  SG    . CYS C 3 614  ? 148.532 120.483 112.782 1.00 129.64 ?  486  CYS C SG    1 
ATOM   8309  N  N     . LEU C 3 615  ? 146.562 123.566 110.082 1.00 21.83  ?  487  LEU C N     1 
ATOM   8310  C  CA    . LEU C 3 615  ? 145.307 124.310 110.082 1.00 21.20  ?  487  LEU C CA    1 
ATOM   8311  C  C     . LEU C 3 615  ? 144.322 123.692 109.103 1.00 20.09  ?  487  LEU C C     1 
ATOM   8312  O  O     . LEU C 3 615  ? 143.125 123.553 109.400 1.00 22.56  ?  487  LEU C O     1 
ATOM   8313  C  CB    . LEU C 3 615  ? 145.549 125.774 109.729 1.00 24.60  ?  487  LEU C CB    1 
ATOM   8314  C  CG    . LEU C 3 615  ? 144.258 126.520 109.373 1.00 26.61  ?  487  LEU C CG    1 
ATOM   8315  C  CD1   . LEU C 3 615  ? 143.361 126.678 110.587 1.00 24.36  ?  487  LEU C CD1   1 
ATOM   8316  C  CD2   . LEU C 3 615  ? 144.493 127.859 108.685 1.00 28.22  ?  487  LEU C CD2   1 
ATOM   8317  N  N     . ALA C 3 616  ? 144.813 123.328 107.918 1.00 19.68  ?  488  ALA C N     1 
ATOM   8318  C  CA    . ALA C 3 616  ? 143.966 122.641 106.954 1.00 16.75  ?  488  ALA C CA    1 
ATOM   8319  C  C     . ALA C 3 616  ? 143.379 121.377 107.564 1.00 19.55  ?  488  ALA C C     1 
ATOM   8320  O  O     . ALA C 3 616  ? 142.167 121.281 107.765 1.00 19.87  ?  488  ALA C O     1 
ATOM   8321  C  CB    . ALA C 3 616  ? 144.763 122.319 105.696 1.00 21.81  ?  488  ALA C CB    1 
ATOM   8322  N  N     . ILE C 3 617  ? 144.241 120.424 107.933 1.00 19.33  ?  489  ILE C N     1 
ATOM   8323  C  CA    . ILE C 3 617  ? 143.792 119.145 108.479 1.00 18.50  ?  489  ILE C CA    1 
ATOM   8324  C  C     . ILE C 3 617  ? 142.913 119.319 109.707 1.00 18.32  ?  489  ILE C C     1 
ATOM   8325  O  O     . ILE C 3 617  ? 142.219 118.381 110.104 1.00 20.47  ?  489  ILE C O     1 
ATOM   8326  C  CB    . ILE C 3 617  ? 144.994 118.236 108.802 1.00 18.28  ?  489  ILE C CB    1 
ATOM   8327  C  CG1   . ILE C 3 617  ? 144.590 116.765 108.689 1.00 18.49  ?  489  ILE C CG1   1 
ATOM   8328  C  CG2   . ILE C 3 617  ? 145.546 118.555 110.159 1.00 15.33  ?  489  ILE C CG2   1 
ATOM   8329  C  CD1   . ILE C 3 617  ? 145.690 115.762 109.037 1.00 23.51  ?  489  ILE C CD1   1 
ATOM   8330  N  N     . ARG C 3 618  ? 142.927 120.496 110.328 1.00 21.85  ?  490  ARG C N     1 
ATOM   8331  C  CA    . ARG C 3 618  ? 141.927 120.785 111.350 1.00 20.95  ?  490  ARG C CA    1 
ATOM   8332  C  C     . ARG C 3 618  ? 140.584 121.093 110.707 1.00 21.50  ?  490  ARG C C     1 
ATOM   8333  O  O     . ARG C 3 618  ? 139.577 120.443 110.999 1.00 22.90  ?  490  ARG C O     1 
ATOM   8334  C  CB    . ARG C 3 618  ? 142.349 121.964 112.230 1.00 21.70  ?  490  ARG C CB    1 
ATOM   8335  C  CG    . ARG C 3 618  ? 141.176 122.440 113.098 1.00 17.47  ?  490  ARG C CG    1 
ATOM   8336  C  CD    . ARG C 3 618  ? 141.502 123.601 113.999 1.00 14.52  ?  490  ARG C CD    1 
ATOM   8337  N  NE    . ARG C 3 618  ? 140.509 124.665 113.877 1.00 20.31  ?  490  ARG C NE    1 
ATOM   8338  C  CZ    . ARG C 3 618  ? 140.578 125.830 114.509 1.00 24.27  ?  490  ARG C CZ    1 
ATOM   8339  N  NH1   . ARG C 3 618  ? 139.630 126.743 114.333 1.00 27.07  ?  490  ARG C NH1   1 
ATOM   8340  N  NH2   . ARG C 3 618  ? 141.592 126.079 115.323 1.00 26.77  ?  490  ARG C NH2   1 
ATOM   8341  N  N     . VAL C 3 619  ? 140.560 122.096 109.833 1.00 16.76  ?  491  VAL C N     1 
ATOM   8342  C  CA    . VAL C 3 619  ? 139.308 122.512 109.208 1.00 14.72  ?  491  VAL C CA    1 
ATOM   8343  C  C     . VAL C 3 619  ? 138.660 121.351 108.461 1.00 12.04  ?  491  VAL C C     1 
ATOM   8344  O  O     . VAL C 3 619  ? 137.470 121.065 108.640 1.00 13.97  ?  491  VAL C O     1 
ATOM   8345  C  CB    . VAL C 3 619  ? 139.564 123.706 108.276 1.00 14.79  ?  491  VAL C CB    1 
ATOM   8346  C  CG1   . VAL C 3 619  ? 138.540 123.746 107.171 1.00 18.57  ?  491  VAL C CG1   1 
ATOM   8347  C  CG2   . VAL C 3 619  ? 139.555 124.997 109.062 1.00 31.01  ?  491  VAL C CG2   1 
ATOM   8348  N  N     . ASN C 3 620  ? 139.445 120.631 107.659 1.00 22.09  ?  492  ASN C N     1 
ATOM   8349  C  CA    . ASN C 3 620  ? 138.997 119.573 106.751 1.00 16.90  ?  492  ASN C CA    1 
ATOM   8350  C  C     . ASN C 3 620  ? 138.401 118.419 107.467 1.00 12.10  ?  492  ASN C C     1 
ATOM   8351  O  O     . ASN C 3 620  ? 138.021 117.416 106.857 1.00 14.71  ?  492  ASN C O     1 
ATOM   8352  C  CB    . ASN C 3 620  ? 140.166 119.101 105.880 1.00 18.78  ?  492  ASN C CB    1 
ATOM   8353  C  CG    . ASN C 3 620  ? 139.710 118.471 104.569 1.00 19.43  ?  492  ASN C CG    1 
ATOM   8354  O  OD1   . ASN C 3 620  ? 138.514 118.280 104.337 1.00 18.61  ?  492  ASN C OD1   1 
ATOM   8355  N  ND2   . ASN C 3 620  ? 140.663 118.177 103.694 1.00 18.34  ?  492  ASN C ND2   1 
ATOM   8356  N  N     . THR C 3 621  ? 138.291 118.488 108.789 1.00 34.34  ?  493  THR C N     1 
ATOM   8357  C  CA    . THR C 3 621  ? 137.684 117.384 109.513 1.00 14.99  ?  493  THR C CA    1 
ATOM   8358  C  C     . THR C 3 621  ? 136.805 117.870 110.661 1.00 13.87  ?  493  THR C C     1 
ATOM   8359  O  O     . THR C 3 621  ? 136.558 117.113 111.602 1.00 15.06  ?  493  THR C O     1 
ATOM   8360  C  CB    . THR C 3 621  ? 138.771 116.422 110.003 1.00 12.80  ?  493  THR C CB    1 
ATOM   8361  O  OG1   . THR C 3 621  ? 138.167 115.233 110.516 1.00 11.49  ?  493  THR C OG1   1 
ATOM   8362  C  CG2   . THR C 3 621  ? 139.606 117.050 111.070 1.00 13.40  ?  493  THR C CG2   1 
ATOM   8363  N  N     . PHE C 3 622  ? 136.314 119.106 110.601 1.00 14.36  ?  494  PHE C N     1 
ATOM   8364  C  CA    . PHE C 3 622  ? 135.406 119.686 111.591 1.00 15.22  ?  494  PHE C CA    1 
ATOM   8365  C  C     . PHE C 3 622  ? 136.022 119.748 112.986 1.00 13.63  ?  494  PHE C C     1 
ATOM   8366  O  O     . PHE C 3 622  ? 135.326 120.047 113.963 1.00 11.77  ?  494  PHE C O     1 
ATOM   8367  C  CB    . PHE C 3 622  ? 134.071 118.925 111.653 1.00 17.69  ?  494  PHE C CB    1 
ATOM   8368  C  CG    . PHE C 3 622  ? 133.388 118.761 110.319 1.00 18.78  ?  494  PHE C CG    1 
ATOM   8369  C  CD1   . PHE C 3 622  ? 133.841 117.840 109.404 1.00 18.04  ?  494  PHE C CD1   1 
ATOM   8370  C  CD2   . PHE C 3 622  ? 132.287 119.520 109.991 1.00 20.87  ?  494  PHE C CD2   1 
ATOM   8371  C  CE1   . PHE C 3 622  ? 133.226 117.687 108.192 1.00 19.62  ?  494  PHE C CE1   1 
ATOM   8372  C  CE2   . PHE C 3 622  ? 131.672 119.363 108.775 1.00 18.27  ?  494  PHE C CE2   1 
ATOM   8373  C  CZ    . PHE C 3 622  ? 132.142 118.445 107.881 1.00 18.93  ?  494  PHE C CZ    1 
ATOM   8374  N  N     . LEU C 3 623  ? 137.317 119.499 113.090 1.00 13.55  ?  495  LEU C N     1 
ATOM   8375  C  CA    . LEU C 3 623  ? 137.941 119.279 114.378 1.00 13.01  ?  495  LEU C CA    1 
ATOM   8376  C  C     . LEU C 3 623  ? 137.917 120.566 115.189 1.00 10.19  ?  495  LEU C C     1 
ATOM   8377  O  O     . LEU C 3 623  ? 138.399 121.609 114.741 1.00 11.05  ?  495  LEU C O     1 
ATOM   8378  C  CB    . LEU C 3 623  ? 139.367 118.778 114.152 1.00 12.87  ?  495  LEU C CB    1 
ATOM   8379  C  CG    . LEU C 3 623  ? 140.140 118.015 115.221 1.00 14.17  ?  495  LEU C CG    1 
ATOM   8380  C  CD1   . LEU C 3 623  ? 140.407 118.872 116.409 1.00 16.49  ?  495  LEU C CD1   1 
ATOM   8381  C  CD2   . LEU C 3 623  ? 139.378 116.788 115.631 1.00 20.03  ?  495  LEU C CD2   1 
ATOM   8382  N  N     . SER C 3 624  ? 137.357 120.480 116.389 1.00 12.49  ?  496  SER C N     1 
ATOM   8383  C  CA    . SER C 3 624  ? 137.121 121.634 117.241 1.00 14.46  ?  496  SER C CA    1 
ATOM   8384  C  C     . SER C 3 624  ? 138.330 121.941 118.121 1.00 19.82  ?  496  SER C C     1 
ATOM   8385  O  O     . SER C 3 624  ? 139.139 121.065 118.427 1.00 18.33  ?  496  SER C O     1 
ATOM   8386  C  CB    . SER C 3 624  ? 135.888 121.407 118.111 1.00 16.70  ?  496  SER C CB    1 
ATOM   8387  O  OG    . SER C 3 624  ? 136.247 120.990 119.406 1.00 18.87  ?  496  SER C OG    1 
ATOM   8388  N  N     . CYS C 3 625  ? 138.427 123.209 118.539 1.00 22.03  ?  497  CYS C N     1 
ATOM   8389  C  CA    . CYS C 3 625  ? 139.638 123.716 119.188 1.00 17.97  ?  497  CYS C CA    1 
ATOM   8390  C  C     . CYS C 3 625  ? 140.014 122.920 120.433 1.00 17.94  ?  497  CYS C C     1 
ATOM   8391  O  O     . CYS C 3 625  ? 141.178 122.543 120.610 1.00 20.17  ?  497  CYS C O     1 
ATOM   8392  C  CB    . CYS C 3 625  ? 139.464 125.194 119.545 1.00 28.89  ?  497  CYS C CB    1 
ATOM   8393  S  SG    . CYS C 3 625  ? 138.667 126.243 118.288 1.00 110.10 ?  497  CYS C SG    1 
ATOM   8394  N  N     . SER C 3 626  ? 139.057 122.709 121.338 1.00 17.29  ?  498  SER C N     1 
ATOM   8395  C  CA    . SER C 3 626  ? 139.342 121.946 122.547 1.00 17.66  ?  498  SER C CA    1 
ATOM   8396  C  C     . SER C 3 626  ? 139.948 120.591 122.202 1.00 20.78  ?  498  SER C C     1 
ATOM   8397  O  O     . SER C 3 626  ? 140.969 120.178 122.774 1.00 21.46  ?  498  SER C O     1 
ATOM   8398  C  CB    . SER C 3 626  ? 138.062 121.760 123.355 1.00 13.76  ?  498  SER C CB    1 
ATOM   8399  O  OG    . SER C 3 626  ? 138.218 120.761 124.343 1.00 25.98  ?  498  SER C OG    1 
ATOM   8400  N  N     . GLN C 3 627  ? 139.307 119.880 121.272 1.00 20.11  ?  499  GLN C N     1 
ATOM   8401  C  CA    . GLN C 3 627  ? 139.829 118.621 120.765 1.00 20.58  ?  499  GLN C CA    1 
ATOM   8402  C  C     . GLN C 3 627  ? 141.278 118.781 120.342 1.00 18.36  ?  499  GLN C C     1 
ATOM   8403  O  O     . GLN C 3 627  ? 142.183 118.143 120.896 1.00 16.54  ?  499  GLN C O     1 
ATOM   8404  C  CB    . GLN C 3 627  ? 138.992 118.173 119.570 1.00 18.51  ?  499  GLN C CB    1 
ATOM   8405  C  CG    . GLN C 3 627  ? 137.501 118.142 119.761 1.00 16.09  ?  499  GLN C CG    1 
ATOM   8406  C  CD    . GLN C 3 627  ? 136.786 118.190 118.428 1.00 13.27  ?  499  GLN C CD    1 
ATOM   8407  O  OE1   . GLN C 3 627  ? 137.388 118.492 117.405 1.00 11.98  ?  499  GLN C OE1   1 
ATOM   8408  N  NE2   . GLN C 3 627  ? 135.489 117.920 118.439 1.00 17.86  ?  499  GLN C NE2   1 
ATOM   8409  N  N     . TYR C 3 628  ? 141.494 119.673 119.373 1.00 18.70  ?  500  TYR C N     1 
ATOM   8410  C  CA    . TYR C 3 628  ? 142.810 119.914 118.791 1.00 15.99  ?  500  TYR C CA    1 
ATOM   8411  C  C     . TYR C 3 628  ? 143.872 120.084 119.864 1.00 16.07  ?  500  TYR C C     1 
ATOM   8412  O  O     . TYR C 3 628  ? 144.894 119.394 119.851 1.00 16.96  ?  500  TYR C O     1 
ATOM   8413  C  CB    . TYR C 3 628  ? 142.756 121.155 117.902 1.00 14.66  ?  500  TYR C CB    1 
ATOM   8414  C  CG    . TYR C 3 628  ? 143.945 121.308 116.995 1.00 10.13  ?  500  TYR C CG    1 
ATOM   8415  C  CD1   . TYR C 3 628  ? 144.741 120.228 116.698 1.00 9.51   ?  500  TYR C CD1   1 
ATOM   8416  C  CD2   . TYR C 3 628  ? 144.264 122.532 116.436 1.00 11.26  ?  500  TYR C CD2   1 
ATOM   8417  C  CE1   . TYR C 3 628  ? 145.827 120.360 115.884 1.00 10.49  ?  500  TYR C CE1   1 
ATOM   8418  C  CE2   . TYR C 3 628  ? 145.354 122.673 115.622 1.00 12.72  ?  500  TYR C CE2   1 
ATOM   8419  C  CZ    . TYR C 3 628  ? 146.130 121.584 115.349 1.00 14.86  ?  500  TYR C CZ    1 
ATOM   8420  O  OH    . TYR C 3 628  ? 147.220 121.707 114.534 1.00 23.58  ?  500  TYR C OH    1 
ATOM   8421  N  N     . HIS C 3 629  ? 143.652 121.017 120.792 1.00 18.25  ?  501  HIS C N     1 
ATOM   8422  C  CA    . HIS C 3 629  ? 144.600 121.220 121.883 1.00 18.47  ?  501  HIS C CA    1 
ATOM   8423  C  C     . HIS C 3 629  ? 144.836 119.945 122.664 1.00 18.50  ?  501  HIS C C     1 
ATOM   8424  O  O     . HIS C 3 629  ? 145.973 119.638 123.049 1.00 20.22  ?  501  HIS C O     1 
ATOM   8425  C  CB    . HIS C 3 629  ? 144.097 122.304 122.830 1.00 19.92  ?  501  HIS C CB    1 
ATOM   8426  C  CG    . HIS C 3 629  ? 144.970 122.508 124.029 1.00 33.44  ?  501  HIS C CG    1 
ATOM   8427  N  ND1   . HIS C 3 629  ? 146.344 122.406 123.972 1.00 42.54  ?  501  HIS C ND1   1 
ATOM   8428  C  CD2   . HIS C 3 629  ? 144.664 122.793 125.319 1.00 54.15  ?  501  HIS C CD2   1 
ATOM   8429  C  CE1   . HIS C 3 629  ? 146.847 122.629 125.173 1.00 69.13  ?  501  HIS C CE1   1 
ATOM   8430  N  NE2   . HIS C 3 629  ? 145.850 122.867 126.008 1.00 78.34  ?  501  HIS C NE2   1 
ATOM   8431  N  N     . LYS C 3 630  ? 143.764 119.204 122.933 1.00 17.03  ?  502  LYS C N     1 
ATOM   8432  C  CA    . LYS C 3 630  ? 143.900 117.982 123.705 1.00 17.78  ?  502  LYS C CA    1 
ATOM   8433  C  C     . LYS C 3 630  ? 144.837 117.009 123.002 1.00 18.81  ?  502  LYS C C     1 
ATOM   8434  O  O     . LYS C 3 630  ? 145.898 116.651 123.527 1.00 19.75  ?  502  LYS C O     1 
ATOM   8435  C  CB    . LYS C 3 630  ? 142.520 117.369 123.921 1.00 16.21  ?  502  LYS C CB    1 
ATOM   8436  C  CG    . LYS C 3 630  ? 142.542 116.108 124.740 1.00 19.29  ?  502  LYS C CG    1 
ATOM   8437  C  CD    . LYS C 3 630  ? 141.680 116.238 125.981 1.00 14.70  ?  502  LYS C CD    1 
ATOM   8438  C  CE    . LYS C 3 630  ? 140.214 116.381 125.620 1.00 16.30  ?  502  LYS C CE    1 
ATOM   8439  N  NZ    . LYS C 3 630  ? 139.370 116.365 126.846 1.00 15.64  ?  502  LYS C NZ    1 
ATOM   8440  N  N     . MET C 3 631  ? 144.469 116.602 121.787 1.00 17.00  ?  503  MET C N     1 
ATOM   8441  C  CA    . MET C 3 631  ? 145.271 115.616 121.067 1.00 17.59  ?  503  MET C CA    1 
ATOM   8442  C  C     . MET C 3 631  ? 146.669 116.143 120.807 1.00 17.69  ?  503  MET C C     1 
ATOM   8443  O  O     . MET C 3 631  ? 147.613 115.359 120.682 1.00 20.81  ?  503  MET C O     1 
ATOM   8444  C  CB    . MET C 3 631  ? 144.594 115.203 119.761 1.00 19.65  ?  503  MET C CB    1 
ATOM   8445  C  CG    . MET C 3 631  ? 144.386 116.305 118.746 1.00 17.96  ?  503  MET C CG    1 
ATOM   8446  S  SD    . MET C 3 631  ? 145.862 116.505 117.735 1.00 16.17  ?  503  MET C SD    1 
ATOM   8447  C  CE    . MET C 3 631  ? 146.356 114.785 117.597 1.00 20.01  ?  503  MET C CE    1 
ATOM   8448  N  N     . TYR C 3 632  ? 146.821 117.468 120.747 1.00 18.63  ?  504  TYR C N     1 
ATOM   8449  C  CA    . TYR C 3 632  ? 148.134 118.076 120.572 1.00 18.79  ?  504  TYR C CA    1 
ATOM   8450  C  C     . TYR C 3 632  ? 149.030 117.792 121.765 1.00 19.68  ?  504  TYR C C     1 
ATOM   8451  O  O     . TYR C 3 632  ? 150.131 117.238 121.618 1.00 20.02  ?  504  TYR C O     1 
ATOM   8452  C  CB    . TYR C 3 632  ? 147.982 119.585 120.359 1.00 20.39  ?  504  TYR C CB    1 
ATOM   8453  C  CG    . TYR C 3 632  ? 149.277 120.378 120.460 1.00 22.04  ?  504  TYR C CG    1 
ATOM   8454  C  CD1   . TYR C 3 632  ? 149.709 120.876 121.681 1.00 28.92  ?  504  TYR C CD1   1 
ATOM   8455  C  CD2   . TYR C 3 632  ? 150.045 120.654 119.340 1.00 25.19  ?  504  TYR C CD2   1 
ATOM   8456  C  CE1   . TYR C 3 632  ? 150.884 121.599 121.791 1.00 35.17  ?  504  TYR C CE1   1 
ATOM   8457  C  CE2   . TYR C 3 632  ? 151.229 121.378 119.444 1.00 33.33  ?  504  TYR C CE2   1 
ATOM   8458  C  CZ    . TYR C 3 632  ? 151.639 121.853 120.675 1.00 35.50  ?  504  TYR C CZ    1 
ATOM   8459  O  OH    . TYR C 3 632  ? 152.804 122.575 120.794 1.00 32.87  ?  504  TYR C OH    1 
ATOM   8460  N  N     . ARG C 3 633  ? 148.587 118.210 122.957 1.00 21.18  ?  505  ARG C N     1 
ATOM   8461  C  CA    . ARG C 3 633  ? 149.334 117.873 124.161 1.00 26.03  ?  505  ARG C CA    1 
ATOM   8462  C  C     . ARG C 3 633  ? 149.589 116.381 124.194 1.00 20.54  ?  505  ARG C C     1 
ATOM   8463  O  O     . ARG C 3 633  ? 150.681 115.924 124.562 1.00 21.60  ?  505  ARG C O     1 
ATOM   8464  C  CB    . ARG C 3 633  ? 148.575 118.316 125.417 1.00 28.14  ?  505  ARG C CB    1 
ATOM   8465  C  CG    . ARG C 3 633  ? 147.858 117.171 126.154 1.00 27.96  ?  505  ARG C CG    1 
ATOM   8466  C  CD    . ARG C 3 633  ? 147.588 117.449 127.617 1.00 38.90  ?  505  ARG C CD    1 
ATOM   8467  N  NE    . ARG C 3 633  ? 146.718 118.612 127.776 1.00 59.03  ?  505  ARG C NE    1 
ATOM   8468  C  CZ    . ARG C 3 633  ? 147.076 119.731 128.386 1.00 87.63  ?  505  ARG C CZ    1 
ATOM   8469  N  NH1   . ARG C 3 633  ? 146.225 120.738 128.476 1.00 106.03 ?  505  ARG C NH1   1 
ATOM   8470  N  NH2   . ARG C 3 633  ? 148.292 119.842 128.907 1.00 98.31  ?  505  ARG C NH2   1 
ATOM   8471  N  N     . THR C 3 634  ? 148.592 115.612 123.758 1.00 19.48  ?  506  THR C N     1 
ATOM   8472  C  CA    . THR C 3 634  ? 148.656 114.165 123.863 1.00 20.47  ?  506  THR C CA    1 
ATOM   8473  C  C     . THR C 3 634  ? 149.830 113.624 123.070 1.00 24.65  ?  506  THR C C     1 
ATOM   8474  O  O     . THR C 3 634  ? 150.711 112.953 123.613 1.00 29.58  ?  506  THR C O     1 
ATOM   8475  C  CB    . THR C 3 634  ? 147.352 113.552 123.365 1.00 22.12  ?  506  THR C CB    1 
ATOM   8476  O  OG1   . THR C 3 634  ? 146.246 114.318 123.852 1.00 26.61  ?  506  THR C OG1   1 
ATOM   8477  C  CG2   . THR C 3 634  ? 147.224 112.128 123.854 1.00 28.69  ?  506  THR C CG2   1 
ATOM   8478  N  N     . VAL C 3 635  ? 149.871 113.941 121.780 1.00 25.21  ?  507  VAL C N     1 
ATOM   8479  C  CA    . VAL C 3 635  ? 150.914 113.388 120.934 1.00 26.22  ?  507  VAL C CA    1 
ATOM   8480  C  C     . VAL C 3 635  ? 152.278 113.985 121.289 1.00 32.31  ?  507  VAL C C     1 
ATOM   8481  O  O     . VAL C 3 635  ? 153.297 113.289 121.203 1.00 34.37  ?  507  VAL C O     1 
ATOM   8482  C  CB    . VAL C 3 635  ? 150.536 113.578 119.450 1.00 25.96  ?  507  VAL C CB    1 
ATOM   8483  C  CG1   . VAL C 3 635  ? 150.476 115.055 119.069 1.00 30.66  ?  507  VAL C CG1   1 
ATOM   8484  C  CG2   . VAL C 3 635  ? 151.479 112.805 118.541 1.00 32.39  ?  507  VAL C CG2   1 
ATOM   8485  N  N     . LYS C 3 636  ? 152.337 115.250 121.734 1.00 30.43  ?  508  LYS C N     1 
ATOM   8486  C  CA    . LYS C 3 636  ? 153.645 115.837 122.042 1.00 28.39  ?  508  LYS C CA    1 
ATOM   8487  C  C     . LYS C 3 636  ? 154.268 115.177 123.263 1.00 28.33  ?  508  LYS C C     1 
ATOM   8488  O  O     . LYS C 3 636  ? 155.422 114.733 123.229 1.00 30.65  ?  508  LYS C O     1 
ATOM   8489  C  CB    . LYS C 3 636  ? 153.540 117.350 122.256 1.00 33.33  ?  508  LYS C CB    1 
ATOM   8490  C  CG    . LYS C 3 636  ? 154.853 117.997 122.751 1.00 34.07  ?  508  LYS C CG    1 
ATOM   8491  C  CD    . LYS C 3 636  ? 155.085 119.431 122.216 1.00 38.47  ?  508  LYS C CD    1 
ATOM   8492  C  CE    . LYS C 3 636  ? 154.354 120.512 123.027 1.00 31.40  ?  508  LYS C CE    1 
ATOM   8493  N  NZ    . LYS C 3 636  ? 155.013 120.795 124.333 1.00 28.83  ?  508  LYS C NZ    1 
ATOM   8494  N  N     . ALA C 3 637  ? 153.519 115.114 124.360 1.00 28.76  ?  509  ALA C N     1 
ATOM   8495  C  CA    . ALA C 3 637  ? 153.983 114.381 125.526 1.00 36.71  ?  509  ALA C CA    1 
ATOM   8496  C  C     . ALA C 3 637  ? 154.034 112.875 125.295 1.00 38.66  ?  509  ALA C C     1 
ATOM   8497  O  O     . ALA C 3 637  ? 154.630 112.168 126.110 1.00 39.97  ?  509  ALA C O     1 
ATOM   8498  C  CB    . ALA C 3 637  ? 153.081 114.707 126.718 1.00 46.72  ?  509  ALA C CB    1 
ATOM   8499  N  N     . THR C 3 638  ? 153.424 112.372 124.218 1.00 34.29  ?  510  THR C N     1 
ATOM   8500  C  CA    . THR C 3 638  ? 153.445 110.939 123.940 1.00 32.40  ?  510  THR C CA    1 
ATOM   8501  C  C     . THR C 3 638  ? 154.809 110.500 123.433 1.00 34.98  ?  510  THR C C     1 
ATOM   8502  O  O     . THR C 3 638  ? 155.488 109.689 124.070 1.00 38.77  ?  510  THR C O     1 
ATOM   8503  C  CB    . THR C 3 638  ? 152.367 110.574 122.921 1.00 34.63  ?  510  THR C CB    1 
ATOM   8504  O  OG1   . THR C 3 638  ? 151.076 110.899 123.445 1.00 33.57  ?  510  THR C OG1   1 
ATOM   8505  C  CG2   . THR C 3 638  ? 152.402 109.082 122.626 1.00 34.54  ?  510  THR C CG2   1 
ATOM   8506  N  N     . SER C 3 639  ? 155.238 111.032 122.285 1.00 35.13  ?  511  SER C N     1 
ATOM   8507  C  CA    . SER C 3 639  ? 156.515 110.640 121.684 1.00 40.49  ?  511  SER C CA    1 
ATOM   8508  C  C     . SER C 3 639  ? 157.362 111.886 121.445 1.00 46.29  ?  511  SER C C     1 
ATOM   8509  O  O     . SER C 3 639  ? 157.446 112.388 120.323 1.00 46.21  ?  511  SER C O     1 
ATOM   8510  C  CB    . SER C 3 639  ? 156.285 109.865 120.385 1.00 42.13  ?  511  SER C CB    1 
ATOM   8511  O  OG    . SER C 3 639  ? 155.900 110.723 119.329 1.00 40.81  ?  511  SER C OG    1 
ATOM   8512  N  N     . GLY C 3 640  ? 157.983 112.385 122.512 1.00 45.57  ?  512  GLY C N     1 
ATOM   8513  C  CA    . GLY C 3 640  ? 159.228 113.135 122.463 1.00 59.13  ?  512  GLY C CA    1 
ATOM   8514  C  C     . GLY C 3 640  ? 159.396 114.225 121.423 1.00 55.75  ?  512  GLY C C     1 
ATOM   8515  O  O     . GLY C 3 640  ? 160.488 114.782 121.290 1.00 60.27  ?  512  GLY C O     1 
ATOM   8516  N  N     . ARG C 3 641  ? 158.344 114.552 120.685 1.00 49.76  ?  513  ARG C N     1 
ATOM   8517  C  CA    . ARG C 3 641  ? 158.462 115.409 119.516 1.00 50.43  ?  513  ARG C CA    1 
ATOM   8518  C  C     . ARG C 3 641  ? 157.351 116.447 119.564 1.00 45.79  ?  513  ARG C C     1 
ATOM   8519  O  O     . ARG C 3 641  ? 156.446 116.382 120.399 1.00 53.93  ?  513  ARG C O     1 
ATOM   8520  C  CB    . ARG C 3 641  ? 158.381 114.586 118.211 1.00 53.35  ?  513  ARG C CB    1 
ATOM   8521  C  CG    . ARG C 3 641  ? 158.835 115.310 116.944 1.00 54.19  ?  513  ARG C CG    1 
ATOM   8522  C  CD    . ARG C 3 641  ? 159.979 114.590 116.230 1.00 63.19  ?  513  ARG C CD    1 
ATOM   8523  N  NE    . ARG C 3 641  ? 159.615 113.248 115.781 1.00 64.88  ?  513  ARG C NE    1 
ATOM   8524  C  CZ    . ARG C 3 641  ? 160.078 112.121 116.307 1.00 62.67  ?  513  ARG C CZ    1 
ATOM   8525  N  NH1   . ARG C 3 641  ? 160.925 112.144 117.327 1.00 65.53  ?  513  ARG C NH1   1 
ATOM   8526  N  NH2   . ARG C 3 641  ? 159.682 110.959 115.816 1.00 59.45  ?  513  ARG C NH2   1 
ATOM   8527  N  N     . GLN C 3 642  ? 157.432 117.414 118.657 1.00 42.57  ?  514  GLN C N     1 
ATOM   8528  C  CA    . GLN C 3 642  ? 156.360 118.361 118.382 1.00 35.81  ?  514  GLN C CA    1 
ATOM   8529  C  C     . GLN C 3 642  ? 155.864 118.051 116.973 1.00 41.00  ?  514  GLN C C     1 
ATOM   8530  O  O     . GLN C 3 642  ? 156.466 118.476 115.985 1.00 42.62  ?  514  GLN C O     1 
ATOM   8531  C  CB    . GLN C 3 642  ? 156.827 119.785 118.496 1.00 29.98  ?  514  GLN C CB    1 
ATOM   8532  C  CG    . GLN C 3 642  ? 155.774 120.779 118.096 1.00 31.79  ?  514  GLN C CG    1 
ATOM   8533  C  CD    . GLN C 3 642  ? 156.293 122.189 118.057 1.00 37.84  ?  514  GLN C CD    1 
ATOM   8534  O  OE1   . GLN C 3 642  ? 157.319 122.504 118.666 1.00 47.68  ?  514  GLN C OE1   1 
ATOM   8535  N  NE2   . GLN C 3 642  ? 155.592 123.054 117.339 1.00 38.91  ?  514  GLN C NE2   1 
ATOM   8536  N  N     . ILE C 3 643  ? 154.776 117.288 116.881 1.00 37.94  ?  515  ILE C N     1 
ATOM   8537  C  CA    . ILE C 3 643  ? 154.246 116.903 115.578 1.00 39.25  ?  515  ILE C CA    1 
ATOM   8538  C  C     . ILE C 3 643  ? 153.345 117.996 115.019 1.00 38.45  ?  515  ILE C C     1 
ATOM   8539  O  O     . ILE C 3 643  ? 153.505 118.431 113.873 1.00 40.86  ?  515  ILE C O     1 
ATOM   8540  C  CB    . ILE C 3 643  ? 153.511 115.556 115.687 1.00 28.60  ?  515  ILE C CB    1 
ATOM   8541  C  CG1   . ILE C 3 643  ? 154.465 114.492 116.233 1.00 32.00  ?  515  ILE C CG1   1 
ATOM   8542  C  CG2   . ILE C 3 643  ? 152.965 115.134 114.350 1.00 28.02  ?  515  ILE C CG2   1 
ATOM   8543  C  CD1   . ILE C 3 643  ? 155.724 114.331 115.436 1.00 36.84  ?  515  ILE C CD1   1 
ATOM   8544  N  N     . PHE C 3 644  ? 152.383 118.453 115.805 1.00 33.17  ?  516  PHE C N     1 
ATOM   8545  C  CA    . PHE C 3 644  ? 151.477 119.495 115.357 1.00 64.54  ?  516  PHE C CA    1 
ATOM   8546  C  C     . PHE C 3 644  ? 151.880 120.835 115.951 1.00 28.64  ?  516  PHE C C     1 
ATOM   8547  O  O     . PHE C 3 644  ? 152.739 120.924 116.829 1.00 29.36  ?  516  PHE C O     1 
ATOM   8548  C  CB    . PHE C 3 644  ? 150.037 119.141 115.726 1.00 30.16  ?  516  PHE C CB    1 
ATOM   8549  C  CG    . PHE C 3 644  ? 149.561 117.844 115.134 1.00 25.90  ?  516  PHE C CG    1 
ATOM   8550  C  CD1   . PHE C 3 644  ? 150.221 117.275 114.070 1.00 29.23  ?  516  PHE C CD1   1 
ATOM   8551  C  CD2   . PHE C 3 644  ? 148.437 117.212 115.618 1.00 26.85  ?  516  PHE C CD2   1 
ATOM   8552  C  CE1   . PHE C 3 644  ? 149.781 116.101 113.524 1.00 27.53  ?  516  PHE C CE1   1 
ATOM   8553  C  CE2   . PHE C 3 644  ? 147.999 116.040 115.061 1.00 20.72  ?  516  PHE C CE2   1 
ATOM   8554  C  CZ    . PHE C 3 644  ? 148.670 115.486 114.023 1.00 19.33  ?  516  PHE C CZ    1 
ATOM   8555  N  N     . GLN C 3 645  ? 151.292 121.843 115.459 1.00 31.59  ?  517  GLN C N     1 
ATOM   8556  C  CA    . GLN C 3 645  ? 151.591 123.112 116.083 1.00 33.96  ?  517  GLN C CA    1 
ATOM   8557  C  C     . GLN C 3 645  ? 150.493 123.483 117.070 1.00 30.17  ?  517  GLN C C     1 
ATOM   8558  O  O     . GLN C 3 645  ? 149.333 123.109 116.892 1.00 26.77  ?  517  GLN C O     1 
ATOM   8559  C  CB    . GLN C 3 645  ? 151.741 124.227 115.042 1.00 34.30  ?  517  GLN C CB    1 
ATOM   8560  C  CG    . GLN C 3 645  ? 152.201 123.788 113.649 1.00 32.51  ?  517  GLN C CG    1 
ATOM   8561  C  CD    . GLN C 3 645  ? 153.382 122.842 113.677 1.00 33.51  ?  517  GLN C CD    1 
ATOM   8562  O  OE1   . GLN C 3 645  ? 153.245 121.645 113.371 1.00 36.47  ?  517  GLN C OE1   1 
ATOM   8563  N  NE2   . GLN C 3 645  ? 154.536 123.355 114.046 1.00 35.38  ?  517  GLN C NE2   1 
ATOM   8564  N  N     . PRO C 3 646  ? 150.825 124.195 118.136 1.00 27.45  ?  518  PRO C N     1 
ATOM   8565  C  CA    . PRO C 3 646  ? 149.792 124.656 119.064 1.00 25.09  ?  518  PRO C CA    1 
ATOM   8566  C  C     . PRO C 3 646  ? 148.901 125.698 118.409 1.00 27.58  ?  518  PRO C C     1 
ATOM   8567  O  O     . PRO C 3 646  ? 149.165 126.199 117.314 1.00 31.43  ?  518  PRO C O     1 
ATOM   8568  C  CB    . PRO C 3 646  ? 150.602 125.225 120.230 1.00 35.66  ?  518  PRO C CB    1 
ATOM   8569  C  CG    . PRO C 3 646  ? 151.885 125.615 119.624 1.00 36.82  ?  518  PRO C CG    1 
ATOM   8570  C  CD    . PRO C 3 646  ? 152.167 124.660 118.517 1.00 31.23  ?  518  PRO C CD    1 
ATOM   8571  N  N     . LEU C 3 647  ? 147.801 125.996 119.095 1.00 26.69  ?  519  LEU C N     1 
ATOM   8572  C  CA    . LEU C 3 647  ? 146.749 126.798 118.487 1.00 29.71  ?  519  LEU C CA    1 
ATOM   8573  C  C     . LEU C 3 647  ? 147.246 128.191 118.143 1.00 34.13  ?  519  LEU C C     1 
ATOM   8574  O  O     . LEU C 3 647  ? 147.344 128.551 116.967 1.00 38.59  ?  519  LEU C O     1 
ATOM   8575  C  CB    . LEU C 3 647  ? 145.540 126.872 119.414 1.00 20.43  ?  519  LEU C CB    1 
ATOM   8576  C  CG    . LEU C 3 647  ? 144.696 125.611 119.355 1.00 22.68  ?  519  LEU C CG    1 
ATOM   8577  C  CD1   . LEU C 3 647  ? 145.116 124.654 120.451 1.00 22.77  ?  519  LEU C CD1   1 
ATOM   8578  C  CD2   . LEU C 3 647  ? 143.224 125.947 119.459 1.00 19.82  ?  519  LEU C CD2   1 
ATOM   8579  N  N     . HIS C 3 648  ? 147.602 128.975 119.164 1.00 30.69  ?  520  HIS C N     1 
ATOM   8580  C  CA    . HIS C 3 648  ? 147.836 130.403 118.974 1.00 36.06  ?  520  HIS C CA    1 
ATOM   8581  C  C     . HIS C 3 648  ? 148.692 130.681 117.740 1.00 47.32  ?  520  HIS C C     1 
ATOM   8582  O  O     . HIS C 3 648  ? 148.393 131.596 116.960 1.00 47.34  ?  520  HIS C O     1 
ATOM   8583  C  CB    . HIS C 3 648  ? 148.502 130.986 120.218 1.00 45.06  ?  520  HIS C CB    1 
ATOM   8584  C  CG    . HIS C 3 648  ? 149.980 130.755 120.257 1.00 60.73  ?  520  HIS C CG    1 
ATOM   8585  N  ND1   . HIS C 3 648  ? 150.535 129.491 120.280 1.00 57.34  ?  520  HIS C ND1   1 
ATOM   8586  C  CD2   . HIS C 3 648  ? 151.017 131.625 120.215 1.00 70.57  ?  520  HIS C CD2   1 
ATOM   8587  C  CE1   . HIS C 3 648  ? 151.852 129.596 120.285 1.00 77.75  ?  520  HIS C CE1   1 
ATOM   8588  N  NE2   . HIS C 3 648  ? 152.169 130.879 120.247 1.00 86.46  ?  520  HIS C NE2   1 
ATOM   8589  N  N     . THR C 3 649  ? 149.728 129.863 117.517 1.00 46.26  ?  521  THR C N     1 
ATOM   8590  C  CA    . THR C 3 649  ? 150.625 130.072 116.384 1.00 46.52  ?  521  THR C CA    1 
ATOM   8591  C  C     . THR C 3 649  ? 149.987 129.621 115.074 1.00 42.50  ?  521  THR C C     1 
ATOM   8592  O  O     . THR C 3 649  ? 150.137 130.286 114.041 1.00 45.03  ?  521  THR C O     1 
ATOM   8593  C  CB    . THR C 3 649  ? 151.952 129.339 116.614 1.00 50.38  ?  521  THR C CB    1 
ATOM   8594  O  OG1   . THR C 3 649  ? 152.691 129.269 115.386 1.00 56.60  ?  521  THR C OG1   1 
ATOM   8595  C  CG2   . THR C 3 649  ? 151.723 127.943 117.121 1.00 40.05  ?  521  THR C CG2   1 
ATOM   8596  N  N     . LEU C 3 650  ? 149.267 128.497 115.104 1.00 35.42  ?  522  LEU C N     1 
ATOM   8597  C  CA    . LEU C 3 650  ? 148.486 128.075 113.948 1.00 33.48  ?  522  LEU C CA    1 
ATOM   8598  C  C     . LEU C 3 650  ? 147.528 129.171 113.502 1.00 34.37  ?  522  LEU C C     1 
ATOM   8599  O  O     . LEU C 3 650  ? 147.381 129.427 112.307 1.00 34.76  ?  522  LEU C O     1 
ATOM   8600  C  CB    . LEU C 3 650  ? 147.722 126.800 114.297 1.00 34.87  ?  522  LEU C CB    1 
ATOM   8601  C  CG    . LEU C 3 650  ? 146.650 126.302 113.329 1.00 32.54  ?  522  LEU C CG    1 
ATOM   8602  C  CD1   . LEU C 3 650  ? 146.674 124.790 113.273 1.00 25.74  ?  522  LEU C CD1   1 
ATOM   8603  C  CD2   . LEU C 3 650  ? 145.268 126.782 113.728 1.00 31.65  ?  522  LEU C CD2   1 
ATOM   8604  N  N     . ARG C 3 651  ? 146.872 129.831 114.456 1.00 35.08  ?  523  ARG C N     1 
ATOM   8605  C  CA    . ARG C 3 651  ? 145.873 130.847 114.137 1.00 40.26  ?  523  ARG C CA    1 
ATOM   8606  C  C     . ARG C 3 651  ? 146.523 132.130 113.634 1.00 42.83  ?  523  ARG C C     1 
ATOM   8607  O  O     . ARG C 3 651  ? 146.011 132.779 112.708 1.00 48.37  ?  523  ARG C O     1 
ATOM   8608  C  CB    . ARG C 3 651  ? 145.038 131.125 115.381 1.00 39.87  ?  523  ARG C CB    1 
ATOM   8609  C  CG    . ARG C 3 651  ? 143.801 131.989 115.211 1.00 42.58  ?  523  ARG C CG    1 
ATOM   8610  C  CD    . ARG C 3 651  ? 143.241 132.361 116.585 1.00 44.03  ?  523  ARG C CD    1 
ATOM   8611  N  NE    . ARG C 3 651  ? 143.289 131.243 117.531 1.00 47.10  ?  523  ARG C NE    1 
ATOM   8612  C  CZ    . ARG C 3 651  ? 144.241 131.074 118.453 1.00 45.23  ?  523  ARG C CZ    1 
ATOM   8613  N  NH1   . ARG C 3 651  ? 145.231 131.954 118.559 1.00 42.11  ?  523  ARG C NH1   1 
ATOM   8614  N  NH2   . ARG C 3 651  ? 144.206 130.022 119.263 1.00 41.14  ?  523  ARG C NH2   1 
ATOM   8615  N  N     . ASN C 3 652  ? 147.622 132.543 114.270 1.00 45.49  ?  524  ASN C N     1 
ATOM   8616  C  CA    . ASN C 3 652  ? 148.392 133.664 113.743 1.00 45.39  ?  524  ASN C CA    1 
ATOM   8617  C  C     . ASN C 3 652  ? 148.794 133.398 112.303 1.00 51.22  ?  524  ASN C C     1 
ATOM   8618  O  O     . ASN C 3 652  ? 148.680 134.278 111.443 1.00 48.58  ?  524  ASN C O     1 
ATOM   8619  C  CB    . ASN C 3 652  ? 149.638 133.902 114.600 1.00 51.89  ?  524  ASN C CB    1 
ATOM   8620  C  CG    . ASN C 3 652  ? 150.654 134.824 113.931 1.00 55.83  ?  524  ASN C CG    1 
ATOM   8621  O  OD1   . ASN C 3 652  ? 150.298 135.800 113.267 1.00 55.69  ?  524  ASN C OD1   1 
ATOM   8622  N  ND2   . ASN C 3 652  ? 151.934 134.498 114.094 1.00 53.22  ?  524  ASN C ND2   1 
ATOM   8623  N  N     . ALA C 3 653  ? 149.244 132.174 112.022 1.00 46.71  ?  525  ALA C N     1 
ATOM   8624  C  CA    . ALA C 3 653  ? 149.574 131.796 110.656 1.00 53.53  ?  525  ALA C CA    1 
ATOM   8625  C  C     . ALA C 3 653  ? 148.340 131.837 109.766 1.00 55.53  ?  525  ALA C C     1 
ATOM   8626  O  O     . ALA C 3 653  ? 148.416 132.256 108.606 1.00 60.08  ?  525  ALA C O     1 
ATOM   8627  C  CB    . ALA C 3 653  ? 150.210 130.408 110.649 1.00 46.33  ?  525  ALA C CB    1 
ATOM   8628  N  N     . GLU C 3 654  ? 147.195 131.406 110.298 1.00 46.11  ?  526  GLU C N     1 
ATOM   8629  C  CA    . GLU C 3 654  ? 145.941 131.447 109.550 1.00 46.89  ?  526  GLU C CA    1 
ATOM   8630  C  C     . GLU C 3 654  ? 145.609 132.848 109.071 1.00 44.24  ?  526  GLU C C     1 
ATOM   8631  O  O     . GLU C 3 654  ? 145.148 133.031 107.939 1.00 41.86  ?  526  GLU C O     1 
ATOM   8632  C  CB    . GLU C 3 654  ? 144.798 130.929 110.423 1.00 53.70  ?  526  GLU C CB    1 
ATOM   8633  C  CG    . GLU C 3 654  ? 143.416 131.384 109.941 1.00 70.24  ?  526  GLU C CG    1 
ATOM   8634  C  CD    . GLU C 3 654  ? 142.926 132.651 110.628 1.00 92.11  ?  526  GLU C CD    1 
ATOM   8635  O  OE1   . GLU C 3 654  ? 143.655 133.187 111.495 1.00 75.14  ?  526  GLU C OE1   1 
ATOM   8636  O  OE2   . GLU C 3 654  ? 141.832 133.146 110.285 1.00 216.74 -1 526  GLU C OE2   1 
ATOM   8637  N  N     . LYS C 3 655  ? 145.819 133.846 109.927 1.00 49.87  ?  527  LYS C N     1 
ATOM   8638  C  CA    . LYS C 3 655  ? 145.377 135.212 109.641 1.00 46.83  ?  527  LYS C CA    1 
ATOM   8639  C  C     . LYS C 3 655  ? 145.834 135.703 108.270 1.00 38.66  ?  527  LYS C C     1 
ATOM   8640  O  O     . LYS C 3 655  ? 145.370 136.736 107.788 1.00 34.74  ?  527  LYS C O     1 
ATOM   8641  C  CB    . LYS C 3 655  ? 145.863 136.164 110.743 1.00 50.38  ?  527  LYS C CB    1 
ATOM   8642  C  CG    . LYS C 3 655  ? 145.197 137.546 110.729 1.00 50.34  ?  527  LYS C CG    1 
ATOM   8643  C  CD    . LYS C 3 655  ? 145.689 138.478 111.843 1.00 49.58  ?  527  LYS C CD    1 
ATOM   8644  C  CE    . LYS C 3 655  ? 145.160 138.049 113.197 1.00 50.10  ?  527  LYS C CE    1 
ATOM   8645  N  NZ    . LYS C 3 655  ? 145.604 138.969 114.276 1.00 47.16  ?  527  LYS C NZ    1 
ATOM   8646  N  N     . GLU C 3 656  ? 146.745 134.968 107.640 1.00 42.73  ?  528  GLU C N     1 
ATOM   8647  C  CA    . GLU C 3 656  ? 147.199 135.244 106.285 1.00 41.80  ?  528  GLU C CA    1 
ATOM   8648  C  C     . GLU C 3 656  ? 146.302 134.635 105.209 1.00 35.09  ?  528  GLU C C     1 
ATOM   8649  O  O     . GLU C 3 656  ? 146.593 134.810 104.022 1.00 33.98  ?  528  GLU C O     1 
ATOM   8650  C  CB    . GLU C 3 656  ? 148.636 134.738 106.108 1.00 59.43  ?  528  GLU C CB    1 
ATOM   8651  C  CG    . GLU C 3 656  ? 148.756 133.260 105.725 1.00 82.51  ?  528  GLU C CG    1 
ATOM   8652  C  CD    . GLU C 3 656  ? 150.193 132.731 105.813 1.00 126.88 ?  528  GLU C CD    1 
ATOM   8653  O  OE1   . GLU C 3 656  ? 151.036 133.363 106.482 1.00 119.78 ?  528  GLU C OE1   1 
ATOM   8654  O  OE2   . GLU C 3 656  ? 150.484 131.683 105.196 1.00 235.10 -1 528  GLU C OE2   1 
ATOM   8655  N  N     . LEU C 3 657  ? 145.226 133.927 105.577 1.00 27.77  ?  529  LEU C N     1 
ATOM   8656  C  CA    . LEU C 3 657  ? 144.324 133.347 104.586 1.00 22.42  ?  529  LEU C CA    1 
ATOM   8657  C  C     . LEU C 3 657  ? 142.927 133.951 104.535 1.00 23.62  ?  529  LEU C C     1 
ATOM   8658  O  O     . LEU C 3 657  ? 142.308 133.921 103.469 1.00 25.63  ?  529  LEU C O     1 
ATOM   8659  C  CB    . LEU C 3 657  ? 144.189 131.839 104.802 1.00 20.69  ?  529  LEU C CB    1 
ATOM   8660  C  CG    . LEU C 3 657  ? 145.522 131.141 104.620 1.00 18.41  ?  529  LEU C CG    1 
ATOM   8661  C  CD1   . LEU C 3 657  ? 145.278 129.676 104.603 1.00 18.08  ?  529  LEU C CD1   1 
ATOM   8662  C  CD2   . LEU C 3 657  ? 146.171 131.592 103.338 1.00 21.50  ?  529  LEU C CD2   1 
ATOM   8663  N  N     . LEU C 3 658  ? 142.406 134.483 105.637 1.00 26.39  ?  530  LEU C N     1 
ATOM   8664  C  CA    . LEU C 3 658  ? 141.105 135.134 105.605 1.00 21.19  ?  530  LEU C CA    1 
ATOM   8665  C  C     . LEU C 3 658  ? 141.166 136.394 104.751 1.00 18.22  ?  530  LEU C C     1 
ATOM   8666  O  O     . LEU C 3 658  ? 142.247 136.870 104.407 1.00 20.22  ?  530  LEU C O     1 
ATOM   8667  C  CB    . LEU C 3 658  ? 140.648 135.473 107.021 1.00 28.12  ?  530  LEU C CB    1 
ATOM   8668  C  CG    . LEU C 3 658  ? 140.303 134.311 107.945 1.00 39.75  ?  530  LEU C CG    1 
ATOM   8669  C  CD1   . LEU C 3 658  ? 139.761 134.829 109.275 1.00 54.65  ?  530  LEU C CD1   1 
ATOM   8670  C  CD2   . LEU C 3 658  ? 139.325 133.374 107.280 1.00 33.98  ?  530  LEU C CD2   1 
ATOM   8671  N  N     . PRO C 3 659  ? 140.019 136.968 104.405 1.00 17.43  ?  531  PRO C N     1 
ATOM   8672  C  CA    . PRO C 3 659  ? 140.026 138.268 103.732 1.00 15.08  ?  531  PRO C CA    1 
ATOM   8673  C  C     . PRO C 3 659  ? 140.597 139.376 104.599 1.00 14.34  ?  531  PRO C C     1 
ATOM   8674  O  O     . PRO C 3 659  ? 140.584 139.321 105.830 1.00 16.10  ?  531  PRO C O     1 
ATOM   8675  C  CB    . PRO C 3 659  ? 138.546 138.512 103.436 1.00 17.84  ?  531  PRO C CB    1 
ATOM   8676  C  CG    . PRO C 3 659  ? 137.835 137.686 104.460 1.00 19.97  ?  531  PRO C CG    1 
ATOM   8677  C  CD    . PRO C 3 659  ? 138.653 136.446 104.558 1.00 19.91  ?  531  PRO C CD    1 
ATOM   8678  N  N     . GLY C 3 660  ? 141.121 140.390 103.930 1.00 14.17  ?  532  GLY C N     1 
ATOM   8679  C  CA    . GLY C 3 660  ? 141.617 141.566 104.603 1.00 18.93  ?  532  GLY C CA    1 
ATOM   8680  C  C     . GLY C 3 660  ? 143.024 141.382 105.119 1.00 19.15  ?  532  GLY C C     1 
ATOM   8681  O  O     . GLY C 3 660  ? 143.309 141.693 106.278 1.00 22.68  ?  532  GLY C O     1 
ATOM   8682  N  N     . PHE C 3 661  ? 143.912 140.859 104.276 1.00 22.92  ?  533  PHE C N     1 
ATOM   8683  C  CA    . PHE C 3 661  ? 145.313 140.704 104.643 1.00 28.15  ?  533  PHE C CA    1 
ATOM   8684  C  C     . PHE C 3 661  ? 146.291 141.174 103.582 1.00 27.62  ?  533  PHE C C     1 
ATOM   8685  O  O     . PHE C 3 661  ? 147.446 141.447 103.923 1.00 29.87  ?  533  PHE C O     1 
ATOM   8686  C  CB    . PHE C 3 661  ? 145.636 139.241 104.966 1.00 28.24  ?  533  PHE C CB    1 
ATOM   8687  C  CG    . PHE C 3 661  ? 146.956 139.051 105.670 1.00 29.16  ?  533  PHE C CG    1 
ATOM   8688  C  CD1   . PHE C 3 661  ? 147.064 139.286 107.028 1.00 33.34  ?  533  PHE C CD1   1 
ATOM   8689  C  CD2   . PHE C 3 661  ? 148.088 138.661 104.979 1.00 27.47  ?  533  PHE C CD2   1 
ATOM   8690  C  CE1   . PHE C 3 661  ? 148.268 139.118 107.684 1.00 32.06  ?  533  PHE C CE1   1 
ATOM   8691  C  CE2   . PHE C 3 661  ? 149.296 138.497 105.637 1.00 34.12  ?  533  PHE C CE2   1 
ATOM   8692  C  CZ    . PHE C 3 661  ? 149.381 138.726 106.986 1.00 34.94  ?  533  PHE C CZ    1 
ATOM   8693  N  N     . HIS C 3 662  ? 145.886 141.281 102.324 1.00 27.86  ?  534  HIS C N     1 
ATOM   8694  C  CA    . HIS C 3 662  ? 146.784 141.689 101.256 1.00 34.60  ?  534  HIS C CA    1 
ATOM   8695  C  C     . HIS C 3 662  ? 146.481 143.105 100.795 1.00 39.90  ?  534  HIS C C     1 
ATOM   8696  O  O     . HIS C 3 662  ? 145.318 143.501 100.680 1.00 40.48  ?  534  HIS C O     1 
ATOM   8697  C  CB    . HIS C 3 662  ? 146.692 140.738 100.074 1.00 29.09  ?  534  HIS C CB    1 
ATOM   8698  C  CG    . HIS C 3 662  ? 146.921 139.313 100.444 1.00 24.29  ?  534  HIS C CG    1 
ATOM   8699  N  ND1   . HIS C 3 662  ? 148.158 138.842 100.829 1.00 24.79  ?  534  HIS C ND1   1 
ATOM   8700  C  CD2   . HIS C 3 662  ? 146.081 138.254 100.479 1.00 26.04  ?  534  HIS C CD2   1 
ATOM   8701  C  CE1   . HIS C 3 662  ? 148.069 137.551 101.088 1.00 26.97  ?  534  HIS C CE1   1 
ATOM   8702  N  NE2   . HIS C 3 662  ? 146.820 137.170 100.882 1.00 31.85  ?  534  HIS C NE2   1 
ATOM   8703  N  N     . GLN C 3 663  ? 147.539 143.862 100.528 1.00 41.07  ?  535  GLN C N     1 
ATOM   8704  C  CA    . GLN C 3 663  ? 147.375 145.142 99.873  1.00 47.86  ?  535  GLN C CA    1 
ATOM   8705  C  C     . GLN C 3 663  ? 146.970 144.920 98.420  1.00 51.54  ?  535  GLN C C     1 
ATOM   8706  O  O     . GLN C 3 663  ? 147.042 143.812 97.883  1.00 44.29  ?  535  GLN C O     1 
ATOM   8707  C  CB    . GLN C 3 663  ? 148.661 145.967 99.951  1.00 50.61  ?  535  GLN C CB    1 
ATOM   8708  C  CG    . GLN C 3 663  ? 148.435 147.464 100.012 1.00 53.51  ?  535  GLN C CG    1 
ATOM   8709  C  CD    . GLN C 3 663  ? 149.727 148.246 100.114 1.00 57.38  ?  535  GLN C CD    1 
ATOM   8710  O  OE1   . GLN C 3 663  ? 150.661 148.037 99.332  1.00 57.84  ?  535  GLN C OE1   1 
ATOM   8711  N  NE2   . GLN C 3 663  ? 149.796 149.141 101.090 1.00 58.68  ?  535  GLN C NE2   1 
ATOM   8712  N  N     . PHE C 3 664  ? 146.539 145.996 97.790  1.00 59.06  ?  536  PHE C N     1 
ATOM   8713  C  CA    . PHE C 3 664  ? 146.091 146.005 96.404  1.00 64.32  ?  536  PHE C CA    1 
ATOM   8714  C  C     . PHE C 3 664  ? 145.868 147.461 96.017  1.00 66.88  ?  536  PHE C C     1 
ATOM   8715  O  O     . PHE C 3 664  ? 146.155 148.378 96.795  1.00 65.58  ?  536  PHE C O     1 
ATOM   8716  C  CB    . PHE C 3 664  ? 144.828 145.169 96.222  1.00 58.40  ?  536  PHE C CB    1 
ATOM   8717  C  CG    . PHE C 3 664  ? 143.708 145.562 97.137  1.00 55.68  ?  536  PHE C CG    1 
ATOM   8718  C  CD1   . PHE C 3 664  ? 143.584 144.994 98.387  1.00 47.70  ?  536  PHE C CD1   1 
ATOM   8719  C  CD2   . PHE C 3 664  ? 142.795 146.527 96.756  1.00 63.60  ?  536  PHE C CD2   1 
ATOM   8720  C  CE1   . PHE C 3 664  ? 142.550 145.352 99.219  1.00 49.01  ?  536  PHE C CE1   1 
ATOM   8721  C  CE2   . PHE C 3 664  ? 141.765 146.893 97.593  1.00 66.33  ?  536  PHE C CE2   1 
ATOM   8722  C  CZ    . PHE C 3 664  ? 141.644 146.301 98.824  1.00 56.57  ?  536  PHE C CZ    1 
ATOM   8723  N  N     . GLU C 3 665  ? 145.346 147.678 94.818  1.00 65.35  ?  537  GLU C N     1 
ATOM   8724  C  CA    . GLU C 3 665  ? 145.008 149.023 94.377  1.00 68.02  ?  537  GLU C CA    1 
ATOM   8725  C  C     . GLU C 3 665  ? 143.899 148.894 93.346  1.00 68.20  ?  537  GLU C C     1 
ATOM   8726  O  O     . GLU C 3 665  ? 143.561 147.793 92.914  1.00 67.09  ?  537  GLU C O     1 
ATOM   8727  C  CB    . GLU C 3 665  ? 146.241 149.735 93.814  1.00 89.25  ?  537  GLU C CB    1 
ATOM   8728  C  CG    . GLU C 3 665  ? 146.175 151.255 93.814  1.00 109.59 ?  537  GLU C CG    1 
ATOM   8729  C  CD    . GLU C 3 665  ? 147.444 151.880 93.250  1.00 139.27 ?  537  GLU C CD    1 
ATOM   8730  O  OE1   . GLU C 3 665  ? 148.489 151.195 93.241  1.00 123.80 ?  537  GLU C OE1   1 
ATOM   8731  O  OE2   . GLU C 3 665  ? 147.398 153.053 92.816  1.00 218.16 -1 537  GLU C OE2   1 
ATOM   8732  N  N     . TRP C 3 666  ? 143.336 150.023 92.936  1.00 71.47  ?  538  TRP C N     1 
ATOM   8733  C  CA    . TRP C 3 666  ? 142.317 149.934 91.901  1.00 78.49  ?  538  TRP C CA    1 
ATOM   8734  C  C     . TRP C 3 666  ? 142.394 151.196 91.051  1.00 74.47  ?  538  TRP C C     1 
ATOM   8735  O  O     . TRP C 3 666  ? 142.256 152.301 91.581  1.00 72.31  ?  538  TRP C O     1 
ATOM   8736  C  CB    . TRP C 3 666  ? 140.924 149.758 92.538  1.00 83.28  ?  538  TRP C CB    1 
ATOM   8737  C  CG    . TRP C 3 666  ? 140.052 148.821 91.738  1.00 103.00 ?  538  TRP C CG    1 
ATOM   8738  C  CD1   . TRP C 3 666  ? 139.665 148.966 90.449  1.00 143.15 ?  538  TRP C CD1   1 
ATOM   8739  C  CD2   . TRP C 3 666  ? 139.440 147.602 92.207  1.00 92.76  ?  538  TRP C CD2   1 
ATOM   8740  N  NE1   . TRP C 3 666  ? 138.874 147.909 90.071  1.00 141.70 ?  538  TRP C NE1   1 
ATOM   8741  C  CE2   . TRP C 3 666  ? 138.716 147.060 91.132  1.00 140.93 ?  538  TRP C CE2   1 
ATOM   8742  C  CE3   . TRP C 3 666  ? 139.439 146.923 93.431  1.00 77.67  ?  538  TRP C CE3   1 
ATOM   8743  C  CZ2   . TRP C 3 666  ? 138.004 145.873 91.232  1.00 138.07 ?  538  TRP C CZ2   1 
ATOM   8744  C  CZ3   . TRP C 3 666  ? 138.732 145.744 93.529  1.00 67.79  ?  538  TRP C CZ3   1 
ATOM   8745  C  CH2   . TRP C 3 666  ? 138.020 145.228 92.434  1.00 68.25  ?  538  TRP C CH2   1 
ATOM   8746  N  N     . GLN C 3 667  ? 142.611 151.033 89.750  1.00 74.30  ?  539  GLN C N     1 
ATOM   8747  C  CA    . GLN C 3 667  ? 142.834 152.150 88.829  1.00 67.17  ?  539  GLN C CA    1 
ATOM   8748  C  C     . GLN C 3 667  ? 141.805 152.106 87.709  1.00 67.85  ?  539  GLN C C     1 
ATOM   8749  O  O     . GLN C 3 667  ? 141.790 151.134 86.926  1.00 72.58  ?  539  GLN C O     1 
ATOM   8750  C  CB    . GLN C 3 667  ? 144.241 152.106 88.240  1.00 67.29  ?  539  GLN C CB    1 
ATOM   8751  C  CG    . GLN C 3 667  ? 145.374 152.060 89.258  1.00 73.89  ?  539  GLN C CG    1 
ATOM   8752  C  CD    . GLN C 3 667  ? 146.637 151.408 88.701  1.00 75.10  ?  539  GLN C CD    1 
ATOM   8753  O  OE1   . GLN C 3 667  ? 146.632 150.853 87.598  1.00 67.54  ?  539  GLN C OE1   1 
ATOM   8754  N  NE2   . GLN C 3 667  ? 147.717 151.454 89.473  1.00 83.63  ?  539  GLN C NE2   1 
ATOM   8755  N  N     . PRO C 3 668  ? 140.915 153.106 87.597  1.00 65.61  ?  540  PRO C N     1 
ATOM   8756  C  CA    . PRO C 3 668  ? 140.758 154.194 88.568  1.00 66.60  ?  540  PRO C CA    1 
ATOM   8757  C  C     . PRO C 3 668  ? 140.103 153.726 89.861  1.00 63.97  ?  540  PRO C C     1 
ATOM   8758  O  O     . PRO C 3 668  ? 139.731 152.560 89.940  1.00 67.61  ?  540  PRO C O     1 
ATOM   8759  C  CB    . PRO C 3 668  ? 139.872 155.196 87.824  1.00 65.11  ?  540  PRO C CB    1 
ATOM   8760  C  CG    . PRO C 3 668  ? 139.087 154.367 86.886  1.00 64.51  ?  540  PRO C CG    1 
ATOM   8761  C  CD    . PRO C 3 668  ? 140.021 153.278 86.437  1.00 67.65  ?  540  PRO C CD    1 
ATOM   8762  N  N     . ALA C 3 669  ? 139.985 154.600 90.858  1.00 63.46  ?  541  ALA C N     1 
ATOM   8763  C  CA    . ALA C 3 669  ? 139.415 154.193 92.137  1.00 60.69  ?  541  ALA C CA    1 
ATOM   8764  C  C     . ALA C 3 669  ? 137.961 153.758 91.968  1.00 54.99  ?  541  ALA C C     1 
ATOM   8765  O  O     . ALA C 3 669  ? 137.253 154.214 91.067  1.00 52.58  ?  541  ALA C O     1 
ATOM   8766  C  CB    . ALA C 3 669  ? 139.506 155.334 93.152  1.00 58.44  ?  541  ALA C CB    1 
ATOM   8767  N  N     . LEU C 3 670  ? 137.518 152.866 92.854  1.00 57.45  ?  542  LEU C N     1 
ATOM   8768  C  CA    . LEU C 3 670  ? 136.141 152.388 92.836  1.00 53.29  ?  542  LEU C CA    1 
ATOM   8769  C  C     . LEU C 3 670  ? 135.168 153.530 93.073  1.00 52.84  ?  542  LEU C C     1 
ATOM   8770  O  O     . LEU C 3 670  ? 135.511 154.555 93.664  1.00 57.82  ?  542  LEU C O     1 
ATOM   8771  C  CB    . LEU C 3 670  ? 135.929 151.314 93.901  1.00 52.68  ?  542  LEU C CB    1 
ATOM   8772  C  CG    . LEU C 3 670  ? 136.908 150.150 93.843  1.00 66.34  ?  542  LEU C CG    1 
ATOM   8773  C  CD1   . LEU C 3 670  ? 136.785 149.281 95.072  1.00 74.36  ?  542  LEU C CD1   1 
ATOM   8774  C  CD2   . LEU C 3 670  ? 136.628 149.341 92.602  1.00 73.33  ?  542  LEU C CD2   1 
ATOM   8775  N  N     . LYS C 3 671  ? 133.939 153.344 92.611  1.00 52.21  ?  543  LYS C N     1 
ATOM   8776  C  CA    . LYS C 3 671  ? 132.897 154.340 92.805  1.00 57.38  ?  543  LYS C CA    1 
ATOM   8777  C  C     . LYS C 3 671  ? 132.200 154.079 94.134  1.00 60.05  ?  543  LYS C C     1 
ATOM   8778  O  O     . LYS C 3 671  ? 131.684 152.983 94.364  1.00 56.85  ?  543  LYS C O     1 
ATOM   8779  C  CB    . LYS C 3 671  ? 131.893 154.320 91.653  1.00 58.94  ?  543  LYS C CB    1 
ATOM   8780  C  CG    . LYS C 3 671  ? 131.172 155.655 91.444  1.00 65.12  ?  543  LYS C CG    1 
ATOM   8781  C  CD    . LYS C 3 671  ? 132.150 156.752 91.016  1.00 70.15  ?  543  LYS C CD    1 
ATOM   8782  C  CE    . LYS C 3 671  ? 131.460 158.092 90.775  1.00 64.43  ?  543  LYS C CE    1 
ATOM   8783  N  NZ    . LYS C 3 671  ? 130.854 158.637 92.016  1.00 63.00  ?  543  LYS C NZ    1 
ATOM   8784  N  N     . ASN C 3 672  ? 132.183 155.094 94.992  1.00 62.90  ?  544  ASN C N     1 
ATOM   8785  C  CA    . ASN C 3 672  ? 131.569 155.069 96.325  1.00 65.69  ?  544  ASN C CA    1 
ATOM   8786  C  C     . ASN C 3 672  ? 131.842 153.762 97.072  1.00 63.54  ?  544  ASN C C     1 
ATOM   8787  O  O     . ASN C 3 672  ? 130.936 153.037 97.471  1.00 57.55  ?  544  ASN C O     1 
ATOM   8788  C  CB    . ASN C 3 672  ? 130.066 155.360 96.245  1.00 60.71  ?  544  ASN C CB    1 
ATOM   8789  C  CG    . ASN C 3 672  ? 129.299 154.313 95.468  1.00 54.76  ?  544  ASN C CG    1 
ATOM   8790  O  OD1   . ASN C 3 672  ? 129.116 154.434 94.256  1.00 57.85  ?  544  ASN C OD1   1 
ATOM   8791  N  ND2   . ASN C 3 672  ? 128.843 153.278 96.165  1.00 49.51  ?  544  ASN C ND2   1 
ATOM   8792  N  N     . VAL C 3 673  ? 133.127 153.497 97.286  1.00 68.12  ?  545  VAL C N     1 
ATOM   8793  C  CA    . VAL C 3 673  ? 133.597 152.337 98.039  1.00 69.83  ?  545  VAL C CA    1 
ATOM   8794  C  C     . VAL C 3 673  ? 134.734 152.797 98.946  1.00 68.27  ?  545  VAL C C     1 
ATOM   8795  O  O     . VAL C 3 673  ? 135.670 153.457 98.480  1.00 67.86  ?  545  VAL C O     1 
ATOM   8796  C  CB    . VAL C 3 673  ? 134.075 151.205 97.108  1.00 68.80  ?  545  VAL C CB    1 
ATOM   8797  C  CG1   . VAL C 3 673  ? 134.560 150.022 97.914  1.00 77.14  ?  545  VAL C CG1   1 
ATOM   8798  C  CG2   . VAL C 3 673  ? 132.985 150.795 96.138  1.00 65.73  ?  545  VAL C CG2   1 
ATOM   8799  N  N     . SER C 3 674  ? 134.655 152.455 100.236 1.00 61.59  ?  546  SER C N     1 
ATOM   8800  C  CA    . SER C 3 674  ? 135.661 152.906 101.195 1.00 56.51  ?  546  SER C CA    1 
ATOM   8801  C  C     . SER C 3 674  ? 137.060 152.500 100.745 1.00 55.74  ?  546  SER C C     1 
ATOM   8802  O  O     . SER C 3 674  ? 137.303 151.346 100.383 1.00 52.54  ?  546  SER C O     1 
ATOM   8803  C  CB    . SER C 3 674  ? 135.367 152.341 102.586 1.00 50.82  ?  546  SER C CB    1 
ATOM   8804  O  OG    . SER C 3 674  ? 135.600 150.948 102.638 1.00 52.61  ?  546  SER C OG    1 
ATOM   8805  N  N     . THR C 3 675  ? 137.983 153.463 100.768 1.00 59.14  ?  547  THR C N     1 
ATOM   8806  C  CA    . THR C 3 675  ? 139.344 153.225 100.305 1.00 59.52  ?  547  THR C CA    1 
ATOM   8807  C  C     . THR C 3 675  ? 140.108 152.263 101.198 1.00 55.88  ?  547  THR C C     1 
ATOM   8808  O  O     . THR C 3 675  ? 141.142 151.739 100.774 1.00 51.94  ?  547  THR C O     1 
ATOM   8809  C  CB    . THR C 3 675  ? 140.109 154.550 100.215 1.00 65.00  ?  547  THR C CB    1 
ATOM   8810  O  OG1   . THR C 3 675  ? 140.435 155.011 101.535 1.00 59.17  ?  547  THR C OG1   1 
ATOM   8811  C  CG2   . THR C 3 675  ? 139.282 155.611 99.501  1.00 68.41  ?  547  THR C CG2   1 
ATOM   8812  N  N     . SER C 3 676  ? 139.621 152.017 102.409 1.00 55.48  ?  548  SER C N     1 
ATOM   8813  C  CA    . SER C 3 676  ? 140.283 151.093 103.313 1.00 57.65  ?  548  SER C CA    1 
ATOM   8814  C  C     . SER C 3 676  ? 140.358 149.705 102.688 1.00 49.76  ?  548  SER C C     1 
ATOM   8815  O  O     . SER C 3 676  ? 139.532 149.325 101.856 1.00 49.34  ?  548  SER C O     1 
ATOM   8816  C  CB    . SER C 3 676  ? 139.537 151.046 104.652 1.00 58.19  ?  548  SER C CB    1 
ATOM   8817  O  OG    . SER C 3 676  ? 140.160 150.165 105.573 1.00 60.23  ?  548  SER C OG    1 
ATOM   8818  N  N     . TRP C 3 677  ? 141.373 148.952 103.096 1.00 46.85  ?  549  TRP C N     1 
ATOM   8819  C  CA    . TRP C 3 677  ? 141.679 147.659 102.508 1.00 45.55  ?  549  TRP C CA    1 
ATOM   8820  C  C     . TRP C 3 677  ? 141.899 146.556 103.527 1.00 46.03  ?  549  TRP C C     1 
ATOM   8821  O  O     . TRP C 3 677  ? 141.902 145.384 103.139 1.00 44.96  ?  549  TRP C O     1 
ATOM   8822  C  CB    . TRP C 3 677  ? 142.929 147.757 101.620 1.00 52.39  ?  549  TRP C CB    1 
ATOM   8823  C  CG    . TRP C 3 677  ? 144.201 148.041 102.365 1.00 54.75  ?  549  TRP C CG    1 
ATOM   8824  C  CD1   . TRP C 3 677  ? 144.710 149.263 102.692 1.00 54.24  ?  549  TRP C CD1   1 
ATOM   8825  C  CD2   . TRP C 3 677  ? 145.092 147.074 102.926 1.00 54.66  ?  549  TRP C CD2   1 
ATOM   8826  N  NE1   . TRP C 3 677  ? 145.883 149.118 103.391 1.00 53.07  ?  549  TRP C NE1   1 
ATOM   8827  C  CE2   . TRP C 3 677  ? 146.135 147.783 103.554 1.00 54.62  ?  549  TRP C CE2   1 
ATOM   8828  C  CE3   . TRP C 3 677  ? 145.112 145.677 102.950 1.00 49.11  ?  549  TRP C CE3   1 
ATOM   8829  C  CZ2   . TRP C 3 677  ? 147.184 147.145 104.196 1.00 50.60  ?  549  TRP C CZ2   1 
ATOM   8830  C  CZ3   . TRP C 3 677  ? 146.146 145.048 103.584 1.00 46.00  ?  549  TRP C CZ3   1 
ATOM   8831  C  CH2   . TRP C 3 677  ? 147.172 145.778 104.201 1.00 50.19  ?  549  TRP C CH2   1 
ATOM   8832  N  N     . ASP C 3 678  ? 142.077 146.885 104.804 1.00 54.40  ?  550  ASP C N     1 
ATOM   8833  C  CA    . ASP C 3 678  ? 142.487 145.948 105.842 1.00 54.95  ?  550  ASP C CA    1 
ATOM   8834  C  C     . ASP C 3 678  ? 141.322 145.359 106.627 1.00 45.16  ?  550  ASP C C     1 
ATOM   8835  O  O     . ASP C 3 678  ? 141.553 144.572 107.547 1.00 40.88  ?  550  ASP C O     1 
ATOM   8836  C  CB    . ASP C 3 678  ? 143.447 146.642 106.820 1.00 70.30  ?  550  ASP C CB    1 
ATOM   8837  C  CG    . ASP C 3 678  ? 143.023 148.077 107.149 1.00 92.70  ?  550  ASP C CG    1 
ATOM   8838  O  OD1   . ASP C 3 678  ? 142.469 148.760 106.265 1.00 74.55  ?  550  ASP C OD1   1 
ATOM   8839  O  OD2   . ASP C 3 678  ? 143.243 148.518 108.303 1.00 170.86 -1 550  ASP C OD2   1 
ATOM   8840  N  N     . VAL C 3 679  ? 140.082 145.719 106.295 1.00 42.49  ?  551  VAL C N     1 
ATOM   8841  C  CA    . VAL C 3 679  ? 138.949 145.240 107.074 1.00 29.81  ?  551  VAL C CA    1 
ATOM   8842  C  C     . VAL C 3 679  ? 138.725 143.756 106.819 1.00 25.72  ?  551  VAL C C     1 
ATOM   8843  O  O     . VAL C 3 679  ? 139.219 143.179 105.850 1.00 27.24  ?  551  VAL C O     1 
ATOM   8844  C  CB    . VAL C 3 679  ? 137.686 146.054 106.754 1.00 33.64  ?  551  VAL C CB    1 
ATOM   8845  C  CG1   . VAL C 3 679  ? 137.966 147.543 106.898 1.00 63.69  ?  551  VAL C CG1   1 
ATOM   8846  C  CG2   . VAL C 3 679  ? 137.175 145.730 105.364 1.00 30.75  ?  551  VAL C CG2   1 
ATOM   8847  N  N     . GLY C 3 680  ? 137.982 143.130 107.725 1.00 22.45  ?  552  GLY C N     1 
ATOM   8848  C  CA    . GLY C 3 680  ? 137.636 141.725 107.615 1.00 21.87  ?  552  GLY C CA    1 
ATOM   8849  C  C     . GLY C 3 680  ? 136.148 141.435 107.662 1.00 15.81  ?  552  GLY C C     1 
ATOM   8850  O  O     . GLY C 3 680  ? 135.384 141.931 106.833 1.00 15.57  ?  552  GLY C O     1 
ATOM   8851  N  N     . ILE C 3 681  ? 135.725 140.645 108.645 1.00 12.99  ?  553  ILE C N     1 
ATOM   8852  C  CA    . ILE C 3 681  ? 134.361 140.133 108.715 1.00 9.32   ?  553  ILE C CA    1 
ATOM   8853  C  C     . ILE C 3 681  ? 133.447 141.253 109.184 1.00 30.52  ?  553  ILE C C     1 
ATOM   8854  O  O     . ILE C 3 681  ? 133.494 141.656 110.346 1.00 12.02  ?  553  ILE C O     1 
ATOM   8855  C  CB    . ILE C 3 681  ? 134.269 138.931 109.654 1.00 15.67  ?  553  ILE C CB    1 
ATOM   8856  C  CG1   . ILE C 3 681  ? 135.111 137.771 109.109 1.00 12.31  ?  553  ILE C CG1   1 
ATOM   8857  C  CG2   . ILE C 3 681  ? 132.825 138.545 109.838 1.00 16.19  ?  553  ILE C CG2   1 
ATOM   8858  C  CD1   . ILE C 3 681  ? 135.201 136.573 110.036 1.00 16.84  ?  553  ILE C CD1   1 
ATOM   8859  N  N     . ILE C 3 682  ? 132.595 141.737 108.295 1.00 15.78  ?  554  ILE C N     1 
ATOM   8860  C  CA    . ILE C 3 682  ? 131.769 142.885 108.577 1.00 16.62  ?  554  ILE C CA    1 
ATOM   8861  C  C     . ILE C 3 682  ? 130.365 142.414 108.927 1.00 22.19  ?  554  ILE C C     1 
ATOM   8862  O  O     . ILE C 3 682  ? 130.015 141.251 108.752 1.00 26.28  ?  554  ILE C O     1 
ATOM   8863  C  CB    . ILE C 3 682  ? 131.764 143.888 107.401 1.00 18.78  ?  554  ILE C CB    1 
ATOM   8864  C  CG1   . ILE C 3 682  ? 131.302 145.274 107.871 1.00 23.00  ?  554  ILE C CG1   1 
ATOM   8865  C  CG2   . ILE C 3 682  ? 130.909 143.367 106.272 1.00 18.81  ?  554  ILE C CG2   1 
ATOM   8866  C  CD1   . ILE C 3 682  ? 131.030 146.273 106.764 1.00 29.37  ?  554  ILE C CD1   1 
ATOM   8867  N  N     . ASP C 3 683  ? 129.554 143.324 109.459 1.00 23.18  ?  555  ASP C N     1 
ATOM   8868  C  CA    . ASP C 3 683  ? 128.153 143.058 109.758 1.00 25.09  ?  555  ASP C CA    1 
ATOM   8869  C  C     . ASP C 3 683  ? 127.310 143.570 108.596 1.00 22.56  ?  555  ASP C C     1 
ATOM   8870  O  O     . ASP C 3 683  ? 127.433 144.734 108.210 1.00 23.24  ?  555  ASP C O     1 
ATOM   8871  C  CB    . ASP C 3 683  ? 127.737 143.737 111.062 1.00 31.52  ?  555  ASP C CB    1 
ATOM   8872  C  CG    . ASP C 3 683  ? 128.012 142.880 112.282 1.00 62.71  ?  555  ASP C CG    1 
ATOM   8873  O  OD1   . ASP C 3 683  ? 129.129 142.950 112.842 1.00 58.79  ?  555  ASP C OD1   1 
ATOM   8874  O  OD2   . ASP C 3 683  ? 127.106 142.122 112.674 1.00 163.11 -1 555  ASP C OD2   1 
ATOM   8875  N  N     . GLY C 3 684  ? 126.465 142.708 108.039 1.00 22.31  ?  556  GLY C N     1 
ATOM   8876  C  CA    . GLY C 3 684  ? 125.697 143.031 106.849 1.00 17.86  ?  556  GLY C CA    1 
ATOM   8877  C  C     . GLY C 3 684  ? 124.519 143.955 107.057 1.00 18.02  ?  556  GLY C C     1 
ATOM   8878  O  O     . GLY C 3 684  ? 123.822 144.267 106.089 1.00 19.47  ?  556  GLY C O     1 
ATOM   8879  N  N     . LEU C 3 685  ? 124.265 144.398 108.288 1.00 18.51  ?  557  LEU C N     1 
ATOM   8880  C  CA    . LEU C 3 685  ? 123.220 145.391 108.503 1.00 19.32  ?  557  LEU C CA    1 
ATOM   8881  C  C     . LEU C 3 685  ? 123.544 146.697 107.800 1.00 24.53  ?  557  LEU C C     1 
ATOM   8882  O  O     . LEU C 3 685  ? 122.633 147.455 107.455 1.00 28.62  ?  557  LEU C O     1 
ATOM   8883  C  CB    . LEU C 3 685  ? 123.044 145.656 109.993 1.00 22.46  ?  557  LEU C CB    1 
ATOM   8884  C  CG    . LEU C 3 685  ? 122.733 144.470 110.891 1.00 18.04  ?  557  LEU C CG    1 
ATOM   8885  C  CD1   . LEU C 3 685  ? 124.006 143.936 111.530 1.00 22.22  ?  557  LEU C CD1   1 
ATOM   8886  C  CD2   . LEU C 3 685  ? 121.723 144.873 111.946 1.00 27.24  ?  557  LEU C CD2   1 
ATOM   8887  N  N     . SER C 3 686  ? 124.835 146.987 107.613 1.00 27.42  ?  558  SER C N     1 
ATOM   8888  C  CA    . SER C 3 686  ? 125.309 148.197 106.936 1.00 34.03  ?  558  SER C CA    1 
ATOM   8889  C  C     . SER C 3 686  ? 124.921 149.463 107.702 1.00 37.93  ?  558  SER C C     1 
ATOM   8890  O  O     . SER C 3 686  ? 124.430 150.433 107.122 1.00 39.50  ?  558  SER C O     1 
ATOM   8891  C  CB    . SER C 3 686  ? 124.811 148.252 105.488 1.00 31.83  ?  558  SER C CB    1 
ATOM   8892  O  OG    . SER C 3 686  ? 124.832 149.573 104.982 1.00 33.50  ?  558  SER C OG    1 
ATOM   8893  N  N     . GLY C 3 687  ? 125.140 149.449 109.018 1.00 38.86  ?  559  GLY C N     1 
ATOM   8894  C  CA    . GLY C 3 687  ? 124.862 150.598 109.861 1.00 40.06  ?  559  GLY C CA    1 
ATOM   8895  C  C     . GLY C 3 687  ? 123.391 150.945 109.960 1.00 35.39  ?  559  GLY C C     1 
ATOM   8896  O  O     . GLY C 3 687  ? 123.010 152.110 109.821 1.00 34.62  ?  559  GLY C O     1 
ATOM   8897  N  N     . TRP C 3 688  ? 122.548 149.939 110.184 1.00 34.90  ?  560  TRP C N     1 
ATOM   8898  C  CA    . TRP C 3 688  ? 121.103 150.149 110.184 1.00 32.69  ?  560  TRP C CA    1 
ATOM   8899  C  C     . TRP C 3 688  ? 120.714 150.909 111.442 1.00 28.42  ?  560  TRP C C     1 
ATOM   8900  O  O     . TRP C 3 688  ? 120.828 150.371 112.547 1.00 31.87  ?  560  TRP C O     1 
ATOM   8901  C  CB    . TRP C 3 688  ? 120.376 148.801 110.116 1.00 32.08  ?  560  TRP C CB    1 
ATOM   8902  C  CG    . TRP C 3 688  ? 119.195 148.777 109.194 1.00 31.01  ?  560  TRP C CG    1 
ATOM   8903  C  CD1   . TRP C 3 688  ? 118.597 149.848 108.605 1.00 33.97  ?  560  TRP C CD1   1 
ATOM   8904  C  CD2   . TRP C 3 688  ? 118.463 147.620 108.761 1.00 31.76  ?  560  TRP C CD2   1 
ATOM   8905  N  NE1   . TRP C 3 688  ? 117.540 149.437 107.834 1.00 42.95  ?  560  TRP C NE1   1 
ATOM   8906  C  CE2   . TRP C 3 688  ? 117.436 148.074 107.910 1.00 35.48  ?  560  TRP C CE2   1 
ATOM   8907  C  CE3   . TRP C 3 688  ? 118.577 146.249 109.008 1.00 33.42  ?  560  TRP C CE3   1 
ATOM   8908  C  CZ2   . TRP C 3 688  ? 116.533 147.214 107.306 1.00 29.23  ?  560  TRP C CZ2   1 
ATOM   8909  C  CZ3   . TRP C 3 688  ? 117.679 145.396 108.406 1.00 31.26  ?  560  TRP C CZ3   1 
ATOM   8910  C  CH2   . TRP C 3 688  ? 116.667 145.881 107.563 1.00 26.28  ?  560  TRP C CH2   1 
ATOM   8911  N  N     . THR C 3 689  ? 120.259 152.153 111.277 1.00 30.72  ?  561  THR C N     1 
ATOM   8912  C  CA    . THR C 3 689  ? 119.916 152.990 112.421 1.00 33.42  ?  561  THR C CA    1 
ATOM   8913  C  C     . THR C 3 689  ? 118.862 152.273 113.252 1.00 25.18  ?  561  THR C C     1 
ATOM   8914  O  O     . THR C 3 689  ? 117.732 152.064 112.808 1.00 28.86  ?  561  THR C O     1 
ATOM   8915  C  CB    . THR C 3 689  ? 119.436 154.392 111.988 1.00 35.63  ?  561  THR C CB    1 
ATOM   8916  O  OG1   . THR C 3 689  ? 118.275 154.278 111.156 1.00 35.95  ?  561  THR C OG1   1 
ATOM   8917  C  CG2   . THR C 3 689  ? 120.529 155.144 111.228 1.00 34.79  ?  561  THR C CG2   1 
ATOM   8918  N  N     . VAL C 3 690  ? 119.241 151.881 114.462 1.00 23.36  ?  562  VAL C N     1 
ATOM   8919  C  CA    . VAL C 3 690  ? 118.537 150.857 115.222 1.00 24.03  ?  562  VAL C CA    1 
ATOM   8920  C  C     . VAL C 3 690  ? 117.222 151.381 115.791 1.00 32.17  ?  562  VAL C C     1 
ATOM   8921  O  O     . VAL C 3 690  ? 116.519 150.665 116.516 1.00 33.40  ?  562  VAL C O     1 
ATOM   8922  C  CB    . VAL C 3 690  ? 119.459 150.314 116.331 1.00 26.28  ?  562  VAL C CB    1 
ATOM   8923  C  CG1   . VAL C 3 690  ? 119.556 151.300 117.476 1.00 22.31  ?  562  VAL C CG1   1 
ATOM   8924  C  CG2   . VAL C 3 690  ? 119.003 148.938 116.810 1.00 24.07  ?  562  VAL C CG2   1 
ATOM   8925  N  N     . SER C 3 691  ? 116.871 152.623 115.454 1.00 36.21  ?  563  SER C N     1 
ATOM   8926  C  CA    . SER C 3 691  ? 115.694 153.274 116.033 1.00 45.44  ?  563  SER C CA    1 
ATOM   8927  C  C     . SER C 3 691  ? 114.449 152.393 115.934 1.00 40.02  ?  563  SER C C     1 
ATOM   8928  O  O     . SER C 3 691  ? 114.103 151.898 114.859 1.00 45.06  ?  563  SER C O     1 
ATOM   8929  C  CB    . SER C 3 691  ? 115.466 154.633 115.355 1.00 46.24  ?  563  SER C CB    1 
ATOM   8930  O  OG    . SER C 3 691  ? 114.551 154.554 114.282 1.00 51.17  ?  563  SER C OG    1 
ATOM   8931  N  N     . VAL C 3 692  ? 113.788 152.197 117.079 1.00 45.34  ?  564  VAL C N     1 
ATOM   8932  C  CA    . VAL C 3 692  ? 112.731 151.194 117.197 1.00 44.30  ?  564  VAL C CA    1 
ATOM   8933  C  C     . VAL C 3 692  ? 111.592 151.498 116.237 1.00 46.38  ?  564  VAL C C     1 
ATOM   8934  O  O     . VAL C 3 692  ? 111.079 150.608 115.551 1.00 45.62  ?  564  VAL C O     1 
ATOM   8935  C  CB    . VAL C 3 692  ? 112.228 151.136 118.649 1.00 58.51  ?  564  VAL C CB    1 
ATOM   8936  C  CG1   . VAL C 3 692  ? 111.264 149.978 118.841 1.00 68.62  ?  564  VAL C CG1   1 
ATOM   8937  C  CG2   . VAL C 3 692  ? 113.394 151.033 119.623 1.00 62.48  ?  564  VAL C CG2   1 
ATOM   8938  N  N     . ASP C 3 693  ? 111.177 152.764 116.192 1.00 51.83  ?  565  ASP C N     1 
ATOM   8939  C  CA    . ASP C 3 693  ? 110.053 153.211 115.376 1.00 59.49  ?  565  ASP C CA    1 
ATOM   8940  C  C     . ASP C 3 693  ? 110.069 152.649 113.961 1.00 55.32  ?  565  ASP C C     1 
ATOM   8941  O  O     . ASP C 3 693  ? 109.054 152.150 113.466 1.00 49.88  ?  565  ASP C O     1 
ATOM   8942  C  CB    . ASP C 3 693  ? 110.065 154.737 115.335 1.00 76.20  ?  565  ASP C CB    1 
ATOM   8943  C  CG    . ASP C 3 693  ? 111.454 155.295 115.082 1.00 89.07  ?  565  ASP C CG    1 
ATOM   8944  O  OD1   . ASP C 3 693  ? 112.405 154.490 115.009 1.00 66.22  ?  565  ASP C OD1   1 
ATOM   8945  O  OD2   . ASP C 3 693  ? 111.600 156.534 114.974 1.00 238.10 -1 565  ASP C OD2   1 
ATOM   8946  N  N     . ASP C 3 694  ? 111.225 152.706 113.304 1.00 55.80  ?  566  ASP C N     1 
ATOM   8947  C  CA    . ASP C 3 694  ? 111.348 152.351 111.895 1.00 56.24  ?  566  ASP C CA    1 
ATOM   8948  C  C     . ASP C 3 694  ? 111.312 150.826 111.768 1.00 43.28  ?  566  ASP C C     1 
ATOM   8949  O  O     . ASP C 3 694  ? 111.054 150.109 112.739 1.00 43.13  ?  566  ASP C O     1 
ATOM   8950  C  CB    . ASP C 3 694  ? 112.635 152.952 111.323 1.00 64.13  ?  566  ASP C CB    1 
ATOM   8951  C  CG    . ASP C 3 694  ? 112.648 153.021 109.793 1.00 66.81  ?  566  ASP C CG    1 
ATOM   8952  O  OD1   . ASP C 3 694  ? 112.038 152.153 109.145 1.00 53.50  ?  566  ASP C OD1   1 
ATOM   8953  O  OD2   . ASP C 3 694  ? 113.304 153.933 109.241 1.00 115.77 -1 566  ASP C OD2   1 
ATOM   8954  N  N     . VAL C 3 695  ? 111.566 150.309 110.568 1.00 37.62  ?  567  VAL C N     1 
ATOM   8955  C  CA    . VAL C 3 695  ? 111.644 148.853 110.399 1.00 27.52  ?  567  VAL C CA    1 
ATOM   8956  C  C     . VAL C 3 695  ? 112.790 148.322 111.246 1.00 23.76  ?  567  VAL C C     1 
ATOM   8957  O  O     . VAL C 3 695  ? 113.901 148.876 111.197 1.00 22.70  ?  567  VAL C O     1 
ATOM   8958  C  CB    . VAL C 3 695  ? 111.829 148.481 108.916 1.00 24.54  ?  567  VAL C CB    1 
ATOM   8959  C  CG1   . VAL C 3 695  ? 112.951 149.290 108.276 1.00 30.04  ?  567  VAL C CG1   1 
ATOM   8960  C  CG2   . VAL C 3 695  ? 112.077 146.995 108.769 1.00 28.28  ?  567  VAL C CG2   1 
ATOM   8961  N  N     . PRO C 3 696  ? 112.580 147.294 112.057 1.00 19.57  ?  568  PRO C N     1 
ATOM   8962  C  CA    . PRO C 3 696  ? 113.620 146.863 112.997 1.00 24.00  ?  568  PRO C CA    1 
ATOM   8963  C  C     . PRO C 3 696  ? 114.890 146.416 112.288 1.00 23.92  ?  568  PRO C C     1 
ATOM   8964  O  O     . PRO C 3 696  ? 114.922 146.171 111.082 1.00 24.67  ?  568  PRO C O     1 
ATOM   8965  C  CB    . PRO C 3 696  ? 112.955 145.708 113.750 1.00 22.73  ?  568  PRO C CB    1 
ATOM   8966  C  CG    . PRO C 3 696  ? 111.491 145.965 113.606 1.00 19.81  ?  568  PRO C CG    1 
ATOM   8967  C  CD    . PRO C 3 696  ? 111.314 146.577 112.260 1.00 21.71  ?  568  PRO C CD    1 
ATOM   8968  N  N     . ALA C 3 697  ? 115.959 146.313 113.075 1.00 29.22  ?  569  ALA C N     1 
ATOM   8969  C  CA    . ALA C 3 697  ? 117.286 145.907 112.621 1.00 27.79  ?  569  ALA C CA    1 
ATOM   8970  C  C     . ALA C 3 697  ? 117.763 144.709 113.435 1.00 26.61  ?  569  ALA C C     1 
ATOM   8971  O  O     . ALA C 3 697  ? 118.883 144.674 113.952 1.00 26.01  ?  569  ALA C O     1 
ATOM   8972  C  CB    . ALA C 3 697  ? 118.294 147.055 112.721 1.00 27.73  ?  569  ALA C CB    1 
ATOM   8973  N  N     . ASP C 3 698  ? 116.890 143.706 113.561 1.00 31.93  ?  570  ASP C N     1 
ATOM   8974  C  CA    . ASP C 3 698  ? 117.211 142.466 114.259 1.00 38.18  ?  570  ASP C CA    1 
ATOM   8975  C  C     . ASP C 3 698  ? 117.791 141.393 113.350 1.00 37.77  ?  570  ASP C C     1 
ATOM   8976  O  O     . ASP C 3 698  ? 118.449 140.474 113.847 1.00 36.95  ?  570  ASP C O     1 
ATOM   8977  C  CB    . ASP C 3 698  ? 115.972 141.868 114.941 1.00 66.36  ?  570  ASP C CB    1 
ATOM   8978  C  CG    . ASP C 3 698  ? 115.079 141.089 113.974 1.00 84.81  ?  570  ASP C CG    1 
ATOM   8979  O  OD1   . ASP C 3 698  ? 114.951 141.493 112.801 1.00 56.44  ?  570  ASP C OD1   1 
ATOM   8980  O  OD2   . ASP C 3 698  ? 114.533 140.039 114.385 1.00 223.22 -1 570  ASP C OD2   1 
ATOM   8981  N  N     . THR C 3 699  ? 117.541 141.464 112.050 1.00 31.87  ?  571  THR C N     1 
ATOM   8982  C  CA    . THR C 3 699  ? 118.031 140.442 111.137 1.00 22.72  ?  571  THR C CA    1 
ATOM   8983  C  C     . THR C 3 699  ? 119.541 140.329 111.229 1.00 15.63  ?  571  THR C C     1 
ATOM   8984  O  O     . THR C 3 699  ? 120.259 141.296 110.972 1.00 17.08  ?  571  THR C O     1 
ATOM   8985  C  CB    . THR C 3 699  ? 117.626 140.791 109.714 1.00 28.86  ?  571  THR C CB    1 
ATOM   8986  O  OG1   . THR C 3 699  ? 116.259 140.421 109.502 1.00 22.61  ?  571  THR C OG1   1 
ATOM   8987  C  CG2   . THR C 3 699  ? 118.527 140.066 108.742 1.00 23.97  ?  571  THR C CG2   1 
ATOM   8988  N  N     . ILE C 3 700  ? 120.024 139.160 111.582 1.00 14.47  ?  572  ILE C N     1 
ATOM   8989  C  CA    . ILE C 3 700  ? 121.446 138.966 111.801 1.00 14.62  ?  572  ILE C CA    1 
ATOM   8990  C  C     . ILE C 3 700  ? 122.067 138.439 110.524 1.00 13.52  ?  572  ILE C C     1 
ATOM   8991  O  O     . ILE C 3 700  ? 121.508 137.564 109.856 1.00 16.60  ?  572  ILE C O     1 
ATOM   8992  C  CB    . ILE C 3 700  ? 121.712 138.023 112.984 1.00 14.62  ?  572  ILE C CB    1 
ATOM   8993  C  CG1   . ILE C 3 700  ? 121.111 138.621 114.257 1.00 24.75  ?  572  ILE C CG1   1 
ATOM   8994  C  CG2   . ILE C 3 700  ? 123.194 137.800 113.144 1.00 17.57  ?  572  ILE C CG2   1 
ATOM   8995  C  CD1   . ILE C 3 700  ? 121.356 137.816 115.537 1.00 39.48  ?  572  ILE C CD1   1 
ATOM   8996  N  N     . SER C 3 701  ? 123.226 138.985 110.178 1.00 18.05  ?  573  SER C N     1 
ATOM   8997  C  CA    . SER C 3 701  ? 123.902 138.640 108.943 1.00 19.94  ?  573  SER C CA    1 
ATOM   8998  C  C     . SER C 3 701  ? 125.398 138.833 109.132 1.00 61.47  ?  573  SER C C     1 
ATOM   8999  O  O     . SER C 3 701  ? 125.848 139.547 110.029 1.00 27.80  ?  573  SER C O     1 
ATOM   9000  C  CB    . SER C 3 701  ? 123.375 139.484 107.774 1.00 21.71  ?  573  SER C CB    1 
ATOM   9001  O  OG    . SER C 3 701  ? 123.827 140.819 107.850 1.00 27.75  ?  573  SER C OG    1 
ATOM   9002  N  N     . ARG C 3 702  ? 126.163 138.163 108.287 1.00 34.46  ?  574  ARG C N     1 
ATOM   9003  C  CA    . ARG C 3 702  ? 127.603 138.361 108.231 1.00 20.69  ?  574  ARG C CA    1 
ATOM   9004  C  C     . ARG C 3 702  ? 128.042 138.259 106.782 1.00 25.97  ?  574  ARG C C     1 
ATOM   9005  O  O     . ARG C 3 702  ? 127.470 137.487 106.006 1.00 22.86  ?  574  ARG C O     1 
ATOM   9006  C  CB    . ARG C 3 702  ? 128.358 137.336 109.065 1.00 23.20  ?  574  ARG C CB    1 
ATOM   9007  C  CG    . ARG C 3 702  ? 128.188 137.513 110.543 1.00 26.23  ?  574  ARG C CG    1 
ATOM   9008  C  CD    . ARG C 3 702  ? 128.899 138.761 111.001 1.00 32.69  ?  574  ARG C CD    1 
ATOM   9009  N  NE    . ARG C 3 702  ? 128.874 138.846 112.451 1.00 32.34  ?  574  ARG C NE    1 
ATOM   9010  C  CZ    . ARG C 3 702  ? 127.874 139.391 113.131 1.00 30.78  ?  574  ARG C CZ    1 
ATOM   9011  N  NH1   . ARG C 3 702  ? 126.826 139.879 112.474 1.00 32.95  ?  574  ARG C NH1   1 
ATOM   9012  N  NH2   . ARG C 3 702  ? 127.907 139.436 114.457 1.00 41.09  ?  574  ARG C NH2   1 
ATOM   9013  N  N     . ARG C 3 703  ? 129.046 139.043 106.410 1.00 19.87  ?  575  ARG C N     1 
ATOM   9014  C  CA    . ARG C 3 703  ? 129.527 138.998 105.041 1.00 18.29  ?  575  ARG C CA    1 
ATOM   9015  C  C     . ARG C 3 703  ? 130.887 139.670 104.964 1.00 13.34  ?  575  ARG C C     1 
ATOM   9016  O  O     . ARG C 3 703  ? 131.527 139.954 105.983 1.00 15.08  ?  575  ARG C O     1 
ATOM   9017  C  CB    . ARG C 3 703  ? 128.527 139.653 104.087 1.00 15.02  ?  575  ARG C CB    1 
ATOM   9018  C  CG    . ARG C 3 703  ? 128.481 141.166 104.123 1.00 16.31  ?  575  ARG C CG    1 
ATOM   9019  C  CD    . ARG C 3 703  ? 127.802 141.700 102.878 1.00 16.40  ?  575  ARG C CD    1 
ATOM   9020  N  NE    . ARG C 3 703  ? 127.865 143.156 102.785 1.00 22.27  ?  575  ARG C NE    1 
ATOM   9021  C  CZ    . ARG C 3 703  ? 128.974 143.838 102.532 1.00 21.47  ?  575  ARG C CZ    1 
ATOM   9022  N  NH1   . ARG C 3 703  ? 130.117 143.194 102.334 1.00 22.50  ?  575  ARG C NH1   1 
ATOM   9023  N  NH2   . ARG C 3 703  ? 128.933 145.164 102.466 1.00 19.92  ?  575  ARG C NH2   1 
ATOM   9024  N  N     . PHE C 3 704  ? 131.320 139.913 103.737 1.00 13.60  ?  576  PHE C N     1 
ATOM   9025  C  CA    . PHE C 3 704  ? 132.632 140.428 103.427 1.00 14.36  ?  576  PHE C CA    1 
ATOM   9026  C  C     . PHE C 3 704  ? 132.486 141.665 102.557 1.00 16.22  ?  576  PHE C C     1 
ATOM   9027  O  O     . PHE C 3 704  ? 131.470 141.862 101.888 1.00 17.22  ?  576  PHE C O     1 
ATOM   9028  C  CB    . PHE C 3 704  ? 133.469 139.380 102.685 1.00 13.66  ?  576  PHE C CB    1 
ATOM   9029  C  CG    . PHE C 3 704  ? 133.903 138.205 103.529 1.00 13.50  ?  576  PHE C CG    1 
ATOM   9030  C  CD1   . PHE C 3 704  ? 134.176 138.354 104.867 1.00 16.32  ?  576  PHE C CD1   1 
ATOM   9031  C  CD2   . PHE C 3 704  ? 134.092 136.963 102.965 1.00 15.84  ?  576  PHE C CD2   1 
ATOM   9032  C  CE1   . PHE C 3 704  ? 134.606 137.284 105.617 1.00 12.94  ?  576  PHE C CE1   1 
ATOM   9033  C  CE2   . PHE C 3 704  ? 134.519 135.900 103.723 1.00 17.30  ?  576  PHE C CE2   1 
ATOM   9034  C  CZ    . PHE C 3 704  ? 134.776 136.067 105.036 1.00 32.32  ?  576  PHE C CZ    1 
ATOM   9035  N  N     . ARG C 3 705  ? 133.512 142.508 102.565 1.00 18.76  ?  577  ARG C N     1 
ATOM   9036  C  CA    . ARG C 3 705  ? 133.665 143.467 101.476 1.00 23.78  ?  577  ARG C CA    1 
ATOM   9037  C  C     . ARG C 3 705  ? 134.023 142.656 100.241 1.00 19.38  ?  577  ARG C C     1 
ATOM   9038  O  O     . ARG C 3 705  ? 135.156 142.194 100.090 1.00 21.53  ?  577  ARG C O     1 
ATOM   9039  C  CB    . ARG C 3 705  ? 134.723 144.520 101.785 1.00 29.24  ?  577  ARG C CB    1 
ATOM   9040  C  CG    . ARG C 3 705  ? 134.172 145.773 102.458 1.00 27.56  ?  577  ARG C CG    1 
ATOM   9041  C  CD    . ARG C 3 705  ? 135.206 146.869 102.458 1.00 31.14  ?  577  ARG C CD    1 
ATOM   9042  N  NE    . ARG C 3 705  ? 135.723 147.086 101.119 1.00 46.59  ?  577  ARG C NE    1 
ATOM   9043  C  CZ    . ARG C 3 705  ? 136.547 148.070 100.783 1.00 57.62  ?  577  ARG C CZ    1 
ATOM   9044  N  NH1   . ARG C 3 705  ? 136.961 148.942 101.692 1.00 54.24  ?  577  ARG C NH1   1 
ATOM   9045  N  NH2   . ARG C 3 705  ? 136.959 148.177 99.528  1.00 65.93  ?  577  ARG C NH2   1 
ATOM   9046  N  N     . TYR C 3 706  ? 133.025 142.462 99.378  1.00 16.77  ?  578  TYR C N     1 
ATOM   9047  C  CA    . TYR C 3 706  ? 133.123 141.630 98.182  1.00 16.67  ?  578  TYR C CA    1 
ATOM   9048  C  C     . TYR C 3 706  ? 134.477 141.682 97.491  1.00 20.65  ?  578  TYR C C     1 
ATOM   9049  O  O     . TYR C 3 706  ? 135.075 140.644 97.185  1.00 22.59  ?  578  TYR C O     1 
ATOM   9050  C  CB    . TYR C 3 706  ? 132.023 142.073 97.220  1.00 15.98  ?  578  TYR C CB    1 
ATOM   9051  C  CG    . TYR C 3 706  ? 131.633 141.057 96.199  1.00 19.58  ?  578  TYR C CG    1 
ATOM   9052  C  CD1   . TYR C 3 706  ? 132.019 139.742 96.327  1.00 22.69  ?  578  TYR C CD1   1 
ATOM   9053  C  CD2   . TYR C 3 706  ? 130.877 141.417 95.098  1.00 25.21  ?  578  TYR C CD2   1 
ATOM   9054  C  CE1   . TYR C 3 706  ? 131.666 138.814 95.382  1.00 24.85  ?  578  TYR C CE1   1 
ATOM   9055  C  CE2   . TYR C 3 706  ? 130.513 140.496 94.150  1.00 24.51  ?  578  TYR C CE2   1 
ATOM   9056  C  CZ    . TYR C 3 706  ? 130.908 139.196 94.296  1.00 21.71  ?  578  TYR C CZ    1 
ATOM   9057  O  OH    . TYR C 3 706  ? 130.546 138.276 93.346  1.00 24.37  ?  578  TYR C OH    1 
ATOM   9058  N  N     . ASP C 3 707  ? 134.955 142.896 97.219  1.00 25.14  ?  579  ASP C N     1 
ATOM   9059  C  CA    . ASP C 3 707  ? 136.257 143.086 96.592  1.00 31.61  ?  579  ASP C CA    1 
ATOM   9060  C  C     . ASP C 3 707  ? 137.367 142.390 97.363  1.00 30.22  ?  579  ASP C C     1 
ATOM   9061  O  O     . ASP C 3 707  ? 138.271 141.793 96.766  1.00 29.41  ?  579  ASP C O     1 
ATOM   9062  C  CB    . ASP C 3 707  ? 136.556 144.577 96.487  1.00 40.60  ?  579  ASP C CB    1 
ATOM   9063  C  CG    . ASP C 3 707  ? 136.505 145.274 97.836  1.00 52.73  ?  579  ASP C CG    1 
ATOM   9064  O  OD1   . ASP C 3 707  ? 135.791 144.782 98.736  1.00 37.08  ?  579  ASP C OD1   1 
ATOM   9065  O  OD2   . ASP C 3 707  ? 137.213 146.287 98.014  1.00 232.38 -1 579  ASP C OD2   1 
ATOM   9066  N  N     . VAL C 3 708  ? 137.331 142.482 98.691  1.00 30.44  ?  580  VAL C N     1 
ATOM   9067  C  CA    . VAL C 3 708  ? 138.377 141.877 99.504  1.00 29.21  ?  580  VAL C CA    1 
ATOM   9068  C  C     . VAL C 3 708  ? 138.300 140.354 99.418  1.00 27.06  ?  580  VAL C C     1 
ATOM   9069  O  O     . VAL C 3 708  ? 139.327 139.667 99.350  1.00 26.33  ?  580  VAL C O     1 
ATOM   9070  C  CB    . VAL C 3 708  ? 138.270 142.394 100.952 1.00 31.48  ?  580  VAL C CB    1 
ATOM   9071  C  CG1   . VAL C 3 708  ? 139.381 141.846 101.799 1.00 25.79  ?  580  VAL C CG1   1 
ATOM   9072  C  CG2   . VAL C 3 708  ? 138.285 143.928 100.990 1.00 36.66  ?  580  VAL C CG2   1 
ATOM   9073  N  N     . ALA C 3 709  ? 137.081 139.806 99.405  1.00 24.02  ?  581  ALA C N     1 
ATOM   9074  C  CA    . ALA C 3 709  ? 136.907 138.368 99.220  1.00 21.12  ?  581  ALA C CA    1 
ATOM   9075  C  C     . ALA C 3 709  ? 137.511 137.920 97.899  1.00 19.46  ?  581  ALA C C     1 
ATOM   9076  O  O     . ALA C 3 709  ? 138.199 136.889 97.818  1.00 20.66  ?  581  ALA C O     1 
ATOM   9077  C  CB    . ALA C 3 709  ? 135.422 138.020 99.273  1.00 20.87  ?  581  ALA C CB    1 
ATOM   9078  N  N     . LEU C 3 710  ? 137.222 138.671 96.841  1.00 17.48  ?  582  LEU C N     1 
ATOM   9079  C  CA    . LEU C 3 710  ? 137.898 138.453 95.577  1.00 16.30  ?  582  LEU C CA    1 
ATOM   9080  C  C     . LEU C 3 710  ? 139.407 138.412 95.770  1.00 19.31  ?  582  LEU C C     1 
ATOM   9081  O  O     . LEU C 3 710  ? 140.029 137.362 95.593  1.00 20.52  ?  582  LEU C O     1 
ATOM   9082  C  CB    . LEU C 3 710  ? 137.495 139.544 94.601  1.00 16.58  ?  582  LEU C CB    1 
ATOM   9083  C  CG    . LEU C 3 710  ? 136.323 139.172 93.706  1.00 19.48  ?  582  LEU C CG    1 
ATOM   9084  C  CD1   . LEU C 3 710  ? 136.331 140.036 92.467  1.00 26.38  ?  582  LEU C CD1   1 
ATOM   9085  C  CD2   . LEU C 3 710  ? 136.437 137.726 93.322  1.00 22.91  ?  582  LEU C CD2   1 
ATOM   9086  N  N     . VAL C 3 711  ? 140.000 139.532 96.206  1.00 20.38  ?  583  VAL C N     1 
ATOM   9087  C  CA    . VAL C 3 711  ? 141.461 139.629 96.220  1.00 22.89  ?  583  VAL C CA    1 
ATOM   9088  C  C     . VAL C 3 711  ? 142.060 138.496 97.036  1.00 23.81  ?  583  VAL C C     1 
ATOM   9089  O  O     . VAL C 3 711  ? 143.152 138.010 96.728  1.00 26.96  ?  583  VAL C O     1 
ATOM   9090  C  CB    . VAL C 3 711  ? 141.956 141.007 96.720  1.00 25.13  ?  583  VAL C CB    1 
ATOM   9091  C  CG1   . VAL C 3 711  ? 141.350 142.145 95.910  1.00 28.97  ?  583  VAL C CG1   1 
ATOM   9092  C  CG2   . VAL C 3 711  ? 141.721 141.195 98.199  1.00 24.24  ?  583  VAL C CG2   1 
ATOM   9093  N  N     . SER C 3 712  ? 141.327 138.005 98.031  1.00 22.62  ?  584  SER C N     1 
ATOM   9094  C  CA    . SER C 3 712  ? 141.755 136.817 98.758  1.00 24.14  ?  584  SER C CA    1 
ATOM   9095  C  C     . SER C 3 712  ? 141.794 135.596 97.843  1.00 25.07  ?  584  SER C C     1 
ATOM   9096  O  O     . SER C 3 712  ? 142.825 134.921 97.722  1.00 26.20  ?  584  SER C O     1 
ATOM   9097  C  CB    . SER C 3 712  ? 140.810 136.590 99.938  1.00 27.51  ?  584  SER C CB    1 
ATOM   9098  O  OG    . SER C 3 712  ? 141.359 135.735 100.929 1.00 24.36  ?  584  SER C OG    1 
ATOM   9099  N  N     . ALA C 3 713  ? 140.657 135.277 97.218  1.00 22.68  ?  585  ALA C N     1 
ATOM   9100  C  CA    . ALA C 3 713  ? 140.589 134.080 96.380  1.00 25.06  ?  585  ALA C CA    1 
ATOM   9101  C  C     . ALA C 3 713  ? 141.604 134.141 95.245  1.00 30.78  ?  585  ALA C C     1 
ATOM   9102  O  O     . ALA C 3 713  ? 142.207 133.126 94.863  1.00 34.16  ?  585  ALA C O     1 
ATOM   9103  C  CB    . ALA C 3 713  ? 139.177 133.920 95.830  1.00 25.89  ?  585  ALA C CB    1 
ATOM   9104  N  N     . LEU C 3 714  ? 141.805 135.331 94.695  1.00 27.42  ?  586  LEU C N     1 
ATOM   9105  C  CA    . LEU C 3 714  ? 142.767 135.490 93.618  1.00 31.02  ?  586  LEU C CA    1 
ATOM   9106  C  C     . LEU C 3 714  ? 144.191 135.321 94.136  1.00 36.49  ?  586  LEU C C     1 
ATOM   9107  O  O     . LEU C 3 714  ? 145.013 134.652 93.498  1.00 45.78  ?  586  LEU C O     1 
ATOM   9108  C  CB    . LEU C 3 714  ? 142.577 136.846 92.944  1.00 25.01  ?  586  LEU C CB    1 
ATOM   9109  C  CG    . LEU C 3 714  ? 142.917 136.897 91.455  1.00 28.80  ?  586  LEU C CG    1 
ATOM   9110  C  CD1   . LEU C 3 714  ? 141.891 136.133 90.646  1.00 27.11  ?  586  LEU C CD1   1 
ATOM   9111  C  CD2   . LEU C 3 714  ? 143.067 138.322 90.934  1.00 32.70  ?  586  LEU C CD2   1 
ATOM   9112  N  N     . LYS C 3 715  ? 144.516 135.935 95.281  1.00 32.55  ?  587  LYS C N     1 
ATOM   9113  C  CA    . LYS C 3 715  ? 145.854 135.765 95.836  1.00 39.32  ?  587  LYS C CA    1 
ATOM   9114  C  C     . LYS C 3 715  ? 146.113 134.316 96.207  1.00 47.35  ?  587  LYS C C     1 
ATOM   9115  O  O     . LYS C 3 715  ? 147.270 133.887 96.273  1.00 57.43  ?  587  LYS C O     1 
ATOM   9116  C  CB    . LYS C 3 715  ? 146.058 136.671 97.049  1.00 35.56  ?  587  LYS C CB    1 
ATOM   9117  C  CG    . LYS C 3 715  ? 147.527 136.792 97.452  1.00 37.99  ?  587  LYS C CG    1 
ATOM   9118  C  CD    . LYS C 3 715  ? 147.959 138.223 97.685  1.00 43.73  ?  587  LYS C CD    1 
ATOM   9119  C  CE    . LYS C 3 715  ? 147.991 139.034 96.407  1.00 54.33  ?  587  LYS C CE    1 
ATOM   9120  N  NZ    . LYS C 3 715  ? 148.877 138.457 95.355  1.00 61.97  ?  587  LYS C NZ    1 
ATOM   9121  N  N     . ASP C 3 716  ? 145.053 133.555 96.466  1.00 49.57  ?  588  ASP C N     1 
ATOM   9122  C  CA    . ASP C 3 716  ? 145.188 132.107 96.575  1.00 62.49  ?  588  ASP C CA    1 
ATOM   9123  C  C     . ASP C 3 716  ? 145.583 131.502 95.239  1.00 59.94  ?  588  ASP C C     1 
ATOM   9124  O  O     . ASP C 3 716  ? 146.631 130.859 95.114  1.00 63.82  ?  588  ASP C O     1 
ATOM   9125  C  CB    . ASP C 3 716  ? 143.879 131.488 97.071  1.00 72.98  ?  588  ASP C CB    1 
ATOM   9126  C  CG    . ASP C 3 716  ? 143.929 129.959 97.137  1.00 111.76 ?  588  ASP C CG    1 
ATOM   9127  O  OD1   . ASP C 3 716  ? 144.218 129.304 96.112  1.00 74.37  ?  588  ASP C OD1   1 
ATOM   9128  O  OD2   . ASP C 3 716  ? 143.694 129.402 98.233  1.00 248.27 -1 588  ASP C OD2   1 
ATOM   9129  N  N     . LEU C 3 717  ? 144.754 131.696 94.237  1.00 53.50  ?  589  LEU C N     1 
ATOM   9130  C  CA    . LEU C 3 717  ? 144.987 130.970 92.995  1.00 61.70  ?  589  LEU C CA    1 
ATOM   9131  C  C     . LEU C 3 717  ? 146.183 131.517 92.187  1.00 74.92  ?  589  LEU C C     1 
ATOM   9132  O  O     . LEU C 3 717  ? 146.417 131.071 91.051  1.00 82.88  ?  589  LEU C O     1 
ATOM   9133  C  CB    . LEU C 3 717  ? 143.714 130.971 92.150  1.00 63.37  ?  589  LEU C CB    1 
ATOM   9134  C  CG    . LEU C 3 717  ? 142.720 129.849 92.479  1.00 63.30  ?  589  LEU C CG    1 
ATOM   9135  C  CD1   . LEU C 3 717  ? 142.096 130.038 93.855  1.00 58.58  ?  589  LEU C CD1   1 
ATOM   9136  C  CD2   . LEU C 3 717  ? 141.643 129.696 91.410  1.00 56.55  ?  589  LEU C CD2   1 
ATOM   9137  N  N     . GLU C 3 718  ? 146.853 132.484 92.823  1.00 78.29  ?  590  GLU C N     1 
ATOM   9138  C  CA    . GLU C 3 718  ? 148.138 132.992 92.341  1.00 93.64  ?  590  GLU C CA    1 
ATOM   9139  C  C     . GLU C 3 718  ? 149.091 131.871 91.942  1.00 96.65  ?  590  GLU C C     1 
ATOM   9140  O  O     . GLU C 3 718  ? 149.710 131.912 90.870  1.00 96.21  ?  590  GLU C O     1 
ATOM   9141  C  CB    . GLU C 3 718  ? 148.768 133.868 93.434  1.00 99.57  ?  590  GLU C CB    1 
ATOM   9142  C  CG    . GLU C 3 718  ? 150.276 134.081 93.311  1.00 109.39 ?  590  GLU C CG    1 
ATOM   9143  C  CD    . GLU C 3 718  ? 151.092 133.099 94.126  1.00 134.90 ?  590  GLU C CD    1 
ATOM   9144  O  OE1   . GLU C 3 718  ? 150.487 132.235 94.803  1.00 121.01 ?  590  GLU C OE1   1 
ATOM   9145  O  OE2   . GLU C 3 718  ? 152.342 133.180 94.090  1.00 211.11 -1 590  GLU C OE2   1 
ATOM   9146  N  N     . GLU C 3 719  ? 149.253 130.879 92.818  1.00 93.21  ?  591  GLU C N     1 
ATOM   9147  C  CA    . GLU C 3 719  ? 150.160 129.774 92.529  1.00 97.73  ?  591  GLU C CA    1 
ATOM   9148  C  C     . GLU C 3 719  ? 149.807 129.095 91.209  1.00 99.00  ?  591  GLU C C     1 
ATOM   9149  O  O     . GLU C 3 719  ? 150.679 128.869 90.353  1.00 100.15 ?  591  GLU C O     1 
ATOM   9150  C  CB    . GLU C 3 719  ? 150.119 128.795 93.706  1.00 99.81  ?  591  GLU C CB    1 
ATOM   9151  C  CG    . GLU C 3 719  ? 150.817 127.476 93.480  1.00 125.69 ?  591  GLU C CG    1 
ATOM   9152  C  CD    . GLU C 3 719  ? 149.835 126.357 93.234  1.00 149.90 ?  591  GLU C CD    1 
ATOM   9153  O  OE1   . GLU C 3 719  ? 148.682 126.667 92.869  1.00 141.66 ?  591  GLU C OE1   1 
ATOM   9154  O  OE2   . GLU C 3 719  ? 150.198 125.169 93.400  1.00 225.67 -1 591  GLU C OE2   1 
ATOM   9155  N  N     . ASP C 3 720  ? 148.520 128.813 91.009  1.00 101.35 ?  592  ASP C N     1 
ATOM   9156  C  CA    . ASP C 3 720  ? 148.082 128.121 89.805  1.00 106.21 ?  592  ASP C CA    1 
ATOM   9157  C  C     . ASP C 3 720  ? 148.229 129.001 88.569  1.00 97.08  ?  592  ASP C C     1 
ATOM   9158  O  O     . ASP C 3 720  ? 148.632 128.516 87.508  1.00 101.06 ?  592  ASP C O     1 
ATOM   9159  C  CB    . ASP C 3 720  ? 146.635 127.657 89.976  1.00 124.04 ?  592  ASP C CB    1 
ATOM   9160  C  CG    . ASP C 3 720  ? 146.514 126.399 90.844  1.00 163.25 ?  592  ASP C CG    1 
ATOM   9161  O  OD1   . ASP C 3 720  ? 147.450 125.569 90.858  1.00 219.50 -1 592  ASP C OD1   1 
ATOM   9162  O  OD2   . ASP C 3 720  ? 145.475 126.248 91.527  1.00 194.45 -1 592  ASP C OD2   1 
ATOM   9163  N  N     . ILE C 3 721  ? 147.892 130.289 88.673  1.00 85.77  ?  593  ILE C N     1 
ATOM   9164  C  CA    . ILE C 3 721  ? 148.016 131.139 87.491  1.00 81.82  ?  593  ILE C CA    1 
ATOM   9165  C  C     . ILE C 3 721  ? 149.482 131.291 87.100  1.00 81.91  ?  593  ILE C C     1 
ATOM   9166  O  O     . ILE C 3 721  ? 149.810 131.357 85.908  1.00 82.25  ?  593  ILE C O     1 
ATOM   9167  C  CB    . ILE C 3 721  ? 147.336 132.507 87.703  1.00 78.09  ?  593  ILE C CB    1 
ATOM   9168  C  CG1   . ILE C 3 721  ? 148.146 133.380 88.661  1.00 83.68  ?  593  ILE C CG1   1 
ATOM   9169  C  CG2   . ILE C 3 721  ? 145.898 132.334 88.179  1.00 68.03  ?  593  ILE C CG2   1 
ATOM   9170  C  CD1   . ILE C 3 721  ? 147.482 134.686 89.057  1.00 85.73  ?  593  ILE C CD1   1 
ATOM   9171  N  N     . MET C 3 722  ? 150.390 131.290 88.076  1.00 81.98  ?  594  MET C N     1 
ATOM   9172  C  CA    . MET C 3 722  ? 151.807 131.406 87.753  1.00 81.62  ?  594  MET C CA    1 
ATOM   9173  C  C     . MET C 3 722  ? 152.310 130.135 87.078  1.00 86.92  ?  594  MET C C     1 
ATOM   9174  O  O     . MET C 3 722  ? 153.008 130.190 86.055  1.00 92.10  ?  594  MET C O     1 
ATOM   9175  C  CB    . MET C 3 722  ? 152.605 131.696 89.024  1.00 82.62  ?  594  MET C CB    1 
ATOM   9176  C  CG    . MET C 3 722  ? 153.842 132.553 88.829  1.00 84.12  ?  594  MET C CG    1 
ATOM   9177  S  SD    . MET C 3 722  ? 153.450 134.243 88.304  1.00 84.18  ?  594  MET C SD    1 
ATOM   9178  C  CE    . MET C 3 722  ? 152.391 134.773 89.649  1.00 71.39  ?  594  MET C CE    1 
ATOM   9179  N  N     . GLU C 3 723  ? 151.950 128.969 87.627  1.00 91.54  ?  595  GLU C N     1 
ATOM   9180  C  CA    . GLU C 3 723  ? 152.364 127.726 86.982  1.00 97.48  ?  595  GLU C CA    1 
ATOM   9181  C  C     . GLU C 3 723  ? 151.752 127.599 85.589  1.00 102.56 ?  595  GLU C C     1 
ATOM   9182  O  O     . GLU C 3 723  ? 152.364 127.006 84.689  1.00 106.69 ?  595  GLU C O     1 
ATOM   9183  C  CB    . GLU C 3 723  ? 151.994 126.512 87.847  1.00 98.00  ?  595  GLU C CB    1 
ATOM   9184  C  CG    . GLU C 3 723  ? 150.557 126.008 87.692  1.00 114.46 ?  595  GLU C CG    1 
ATOM   9185  C  CD    . GLU C 3 723  ? 150.372 125.093 86.486  1.00 130.68 ?  595  GLU C CD    1 
ATOM   9186  O  OE1   . GLU C 3 723  ? 151.353 124.423 86.096  1.00 128.41 ?  595  GLU C OE1   1 
ATOM   9187  O  OE2   . GLU C 3 723  ? 149.270 125.085 85.898  1.00 177.23 -1 595  GLU C OE2   1 
ATOM   9188  N  N     . GLY C 3 724  ? 150.551 128.144 85.390  1.00 98.58  ?  596  GLY C N     1 
ATOM   9189  C  CA    . GLY C 3 724  ? 149.923 128.050 84.087  1.00 91.59  ?  596  GLY C CA    1 
ATOM   9190  C  C     . GLY C 3 724  ? 150.590 128.952 83.074  1.00 96.56  ?  596  GLY C C     1 
ATOM   9191  O  O     . GLY C 3 724  ? 150.729 128.588 81.903  1.00 102.30 ?  596  GLY C O     1 
ATOM   9192  N  N     . LEU C 3 725  ? 151.006 130.145 83.510  1.00 94.01  ?  597  LEU C N     1 
ATOM   9193  C  CA    . LEU C 3 725  ? 151.877 130.970 82.682  1.00 96.34  ?  597  LEU C CA    1 
ATOM   9194  C  C     . LEU C 3 725  ? 153.184 130.255 82.373  1.00 107.04 ?  597  LEU C C     1 
ATOM   9195  O  O     . LEU C 3 725  ? 153.803 130.517 81.335  1.00 107.17 ?  597  LEU C O     1 
ATOM   9196  C  CB    . LEU C 3 725  ? 152.149 132.298 83.383  1.00 87.99  ?  597  LEU C CB    1 
ATOM   9197  C  CG    . LEU C 3 725  ? 150.930 133.196 83.561  1.00 85.92  ?  597  LEU C CG    1 
ATOM   9198  C  CD1   . LEU C 3 725  ? 151.308 134.473 84.278  1.00 90.24  ?  597  LEU C CD1   1 
ATOM   9199  C  CD2   . LEU C 3 725  ? 150.331 133.510 82.205  1.00 84.63  ?  597  LEU C CD2   1 
ATOM   9200  N  N     . ARG C 3 726  ? 153.626 129.364 83.266  1.00 111.36 ?  598  ARG C N     1 
ATOM   9201  C  CA    . ARG C 3 726  ? 154.845 128.602 83.000  1.00 118.67 ?  598  ARG C CA    1 
ATOM   9202  C  C     . ARG C 3 726  ? 154.633 127.502 81.962  1.00 117.36 ?  598  ARG C C     1 
ATOM   9203  O  O     . ARG C 3 726  ? 155.523 127.244 81.143  1.00 118.10 ?  598  ARG C O     1 
ATOM   9204  C  CB    . ARG C 3 726  ? 155.400 128.008 84.296  1.00 116.90 ?  598  ARG C CB    1 
ATOM   9205  C  CG    . ARG C 3 726  ? 155.882 129.059 85.270  1.00 122.23 ?  598  ARG C CG    1 
ATOM   9206  C  CD    . ARG C 3 726  ? 156.643 130.116 84.499  1.00 136.81 ?  598  ARG C CD    1 
ATOM   9207  N  NE    . ARG C 3 726  ? 157.132 131.203 85.333  1.00 152.61 ?  598  ARG C NE    1 
ATOM   9208  C  CZ    . ARG C 3 726  ? 157.739 132.281 84.851  1.00 173.85 ?  598  ARG C CZ    1 
ATOM   9209  N  NH1   . ARG C 3 726  ? 157.925 132.411 83.544  1.00 170.87 ?  598  ARG C NH1   1 
ATOM   9210  N  NH2   . ARG C 3 726  ? 158.155 133.232 85.675  1.00 188.64 ?  598  ARG C NH2   1 
ATOM   9211  N  N     . GLU C 3 727  ? 153.477 126.834 81.973  1.00 113.99 ?  599  GLU C N     1 
ATOM   9212  C  CA    . GLU C 3 727  ? 153.230 125.813 80.956  1.00 115.68 ?  599  GLU C CA    1 
ATOM   9213  C  C     . GLU C 3 727  ? 153.030 126.449 79.585  1.00 114.91 ?  599  GLU C C     1 
ATOM   9214  O  O     . GLU C 3 727  ? 153.625 126.011 78.594  1.00 116.12 ?  599  GLU C O     1 
ATOM   9215  C  CB    . GLU C 3 727  ? 152.025 124.949 81.341  1.00 116.51 ?  599  GLU C CB    1 
ATOM   9216  C  CG    . GLU C 3 727  ? 151.657 123.884 80.301  1.00 125.76 ?  599  GLU C CG    1 
ATOM   9217  C  CD    . GLU C 3 727  ? 150.821 124.425 79.149  1.00 146.89 ?  599  GLU C CD    1 
ATOM   9218  O  OE1   . GLU C 3 727  ? 150.219 125.509 79.291  1.00 130.64 ?  599  GLU C OE1   1 
ATOM   9219  O  OE2   . GLU C 3 727  ? 150.814 123.782 78.080  1.00 285.07 -1 59