data_6DC0
# 
_entry.id   6DC0 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.321 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   6DC0         
WWPDB D_1000234287 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.entry_id                        6DC0 
_pdbx_database_status.recvd_initial_deposition_date   2018-05-03 
_pdbx_database_status.SG_entry                        N 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
_audit_author.identifier_ORCID 
'Jamieson, S.A.' 1 ?                   
'Brewster, J.L.' 2 0000-0001-8569-1813 
'Mace, P.D.'     3 ?                   
# 
_citation.abstract                  ? 
_citation.abstract_id_CAS           ? 
_citation.book_id_ISBN              ? 
_citation.book_publisher            ? 
_citation.book_publisher_city       ? 
_citation.book_title                ? 
_citation.coordinate_linkage        ? 
_citation.country                   US 
_citation.database_id_Medline       ? 
_citation.details                   ? 
_citation.id                        primary 
_citation.journal_abbrev            'Sci Signal' 
_citation.journal_id_ASTM           ? 
_citation.journal_id_CSD            ? 
_citation.journal_id_ISSN           1937-9145 
_citation.journal_full              ? 
_citation.journal_issue             ? 
_citation.journal_volume            11 
_citation.language                  ? 
_citation.page_first                ? 
_citation.page_last                 ? 
_citation.title                     'Substrate binding allosterically relieves autoinhibition of the pseudokinase TRIB1.' 
_citation.year                      2018 
_citation.database_id_CSD           ? 
_citation.pdbx_database_id_DOI      10.1126/scisignal.aau0597 
_citation.pdbx_database_id_PubMed   30254053 
_citation.unpublished_flag          ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Jamieson, S.A.' 1  0000-0003-0120-4737 
primary 'Ruan, Z.'       2  0000-0002-4412-4916 
primary 'Burgess, A.E.'  3  0000-0002-3522-6347 
primary 'Curry, J.R.'    4  0000-0001-8829-9913 
primary 'McMillan, H.D.' 5  0000-0002-1384-8567 
primary 'Brewster, J.L.' 6  0000-0001-8569-1813 
primary 'Dunbier, A.K.'  7  0000-0003-4621-7419 
primary 'Axtman, A.D.'   8  0000-0003-4779-9932 
primary 'Kannan, N.'     9  ?                   
primary 'Mace, P.D.'     10 0000-0003-2175-9537 
# 
_cell.angle_alpha                  90.00 
_cell.angle_alpha_esd              ? 
_cell.angle_beta                   90.00 
_cell.angle_beta_esd               ? 
_cell.angle_gamma                  120.00 
_cell.angle_gamma_esd              ? 
_cell.entry_id                     6DC0 
_cell.details                      ? 
_cell.formula_units_Z              ? 
_cell.length_a                     98.809 
_cell.length_a_esd                 ? 
_cell.length_b                     98.809 
_cell.length_b_esd                 ? 
_cell.length_c                     332.705 
_cell.length_c_esd                 ? 
_cell.volume                       ? 
_cell.volume_esd                   ? 
_cell.Z_PDB                        24 
_cell.reciprocal_angle_alpha       ? 
_cell.reciprocal_angle_beta        ? 
_cell.reciprocal_angle_gamma       ? 
_cell.reciprocal_angle_alpha_esd   ? 
_cell.reciprocal_angle_beta_esd    ? 
_cell.reciprocal_angle_gamma_esd   ? 
_cell.reciprocal_length_a          ? 
_cell.reciprocal_length_b          ? 
_cell.reciprocal_length_c          ? 
_cell.reciprocal_length_a_esd      ? 
_cell.reciprocal_length_b_esd      ? 
_cell.reciprocal_length_c_esd      ? 
_cell.pdbx_unique_axis             ? 
# 
_symmetry.entry_id                         6DC0 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                178 
_symmetry.space_group_name_Hall            ? 
_symmetry.space_group_name_H-M             'P 61 2 2' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer man 'Tribbles homolog 1,CCAAT/enhancer-binding protein alpha' 32809.473 2  ? ? ? ? 
2 water   nat water                                                     18.015    40 ? ? ? ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'TRB-1,G-protein-coupled receptor-induced gene 2 protein,GIG-2,SKIP1,C/EBP alpha' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;SAPGPSRIADYLLLPLAEREHVSRALCIHTGRELRCKVFPIKHYQDKIRPYIQLPSHSNITGIVEVILGETKAYVFFEKD
FGDMHSYVRSRKRLREEEAARLFKQIVSAVAHCHQSAIVLGDLKLRKFVFSTEERTQLRLESLEDTHIMKGEDDALSDKH
GCPAYVSPEILNTTGTYSGKAADVWSLGVMLYTLLVGRYPFHDSDPSALFSKIRRGQFCIPEHISPKARCLIRSLLRREP
SERLTAPEILLHPWFESVLEGSGSSGGPGGGICEHETSIDISAYIDPAAFND
;
_entity_poly.pdbx_seq_one_letter_code_can   
;SAPGPSRIADYLLLPLAEREHVSRALCIHTGRELRCKVFPIKHYQDKIRPYIQLPSHSNITGIVEVILGETKAYVFFEKD
FGDMHSYVRSRKRLREEEAARLFKQIVSAVAHCHQSAIVLGDLKLRKFVFSTEERTQLRLESLEDTHIMKGEDDALSDKH
GCPAYVSPEILNTTGTYSGKAADVWSLGVMLYTLLVGRYPFHDSDPSALFSKIRRGQFCIPEHISPKARCLIRSLLRREP
SERLTAPEILLHPWFESVLEGSGSSGGPGGGICEHETSIDISAYIDPAAFND
;
_entity_poly.pdbx_strand_id                 A,B 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   SER n 
1 2   ALA n 
1 3   PRO n 
1 4   GLY n 
1 5   PRO n 
1 6   SER n 
1 7   ARG n 
1 8   ILE n 
1 9   ALA n 
1 10  ASP n 
1 11  TYR n 
1 12  LEU n 
1 13  LEU n 
1 14  LEU n 
1 15  PRO n 
1 16  LEU n 
1 17  ALA n 
1 18  GLU n 
1 19  ARG n 
1 20  GLU n 
1 21  HIS n 
1 22  VAL n 
1 23  SER n 
1 24  ARG n 
1 25  ALA n 
1 26  LEU n 
1 27  CYS n 
1 28  ILE n 
1 29  HIS n 
1 30  THR n 
1 31  GLY n 
1 32  ARG n 
1 33  GLU n 
1 34  LEU n 
1 35  ARG n 
1 36  CYS n 
1 37  LYS n 
1 38  VAL n 
1 39  PHE n 
1 40  PRO n 
1 41  ILE n 
1 42  LYS n 
1 43  HIS n 
1 44  TYR n 
1 45  GLN n 
1 46  ASP n 
1 47  LYS n 
1 48  ILE n 
1 49  ARG n 
1 50  PRO n 
1 51  TYR n 
1 52  ILE n 
1 53  GLN n 
1 54  LEU n 
1 55  PRO n 
1 56  SER n 
1 57  HIS n 
1 58  SER n 
1 59  ASN n 
1 60  ILE n 
1 61  THR n 
1 62  GLY n 
1 63  ILE n 
1 64  VAL n 
1 65  GLU n 
1 66  VAL n 
1 67  ILE n 
1 68  LEU n 
1 69  GLY n 
1 70  GLU n 
1 71  THR n 
1 72  LYS n 
1 73  ALA n 
1 74  TYR n 
1 75  VAL n 
1 76  PHE n 
1 77  PHE n 
1 78  GLU n 
1 79  LYS n 
1 80  ASP n 
1 81  PHE n 
1 82  GLY n 
1 83  ASP n 
1 84  MET n 
1 85  HIS n 
1 86  SER n 
1 87  TYR n 
1 88  VAL n 
1 89  ARG n 
1 90  SER n 
1 91  ARG n 
1 92  LYS n 
1 93  ARG n 
1 94  LEU n 
1 95  ARG n 
1 96  GLU n 
1 97  GLU n 
1 98  GLU n 
1 99  ALA n 
1 100 ALA n 
1 101 ARG n 
1 102 LEU n 
1 103 PHE n 
1 104 LYS n 
1 105 GLN n 
1 106 ILE n 
1 107 VAL n 
1 108 SER n 
1 109 ALA n 
1 110 VAL n 
1 111 ALA n 
1 112 HIS n 
1 113 CYS n 
1 114 HIS n 
1 115 GLN n 
1 116 SER n 
1 117 ALA n 
1 118 ILE n 
1 119 VAL n 
1 120 LEU n 
1 121 GLY n 
1 122 ASP n 
1 123 LEU n 
1 124 LYS n 
1 125 LEU n 
1 126 ARG n 
1 127 LYS n 
1 128 PHE n 
1 129 VAL n 
1 130 PHE n 
1 131 SER n 
1 132 THR n 
1 133 GLU n 
1 134 GLU n 
1 135 ARG n 
1 136 THR n 
1 137 GLN n 
1 138 LEU n 
1 139 ARG n 
1 140 LEU n 
1 141 GLU n 
1 142 SER n 
1 143 LEU n 
1 144 GLU n 
1 145 ASP n 
1 146 THR n 
1 147 HIS n 
1 148 ILE n 
1 149 MET n 
1 150 LYS n 
1 151 GLY n 
1 152 GLU n 
1 153 ASP n 
1 154 ASP n 
1 155 ALA n 
1 156 LEU n 
1 157 SER n 
1 158 ASP n 
1 159 LYS n 
1 160 HIS n 
1 161 GLY n 
1 162 CYS n 
1 163 PRO n 
1 164 ALA n 
1 165 TYR n 
1 166 VAL n 
1 167 SER n 
1 168 PRO n 
1 169 GLU n 
1 170 ILE n 
1 171 LEU n 
1 172 ASN n 
1 173 THR n 
1 174 THR n 
1 175 GLY n 
1 176 THR n 
1 177 TYR n 
1 178 SER n 
1 179 GLY n 
1 180 LYS n 
1 181 ALA n 
1 182 ALA n 
1 183 ASP n 
1 184 VAL n 
1 185 TRP n 
1 186 SER n 
1 187 LEU n 
1 188 GLY n 
1 189 VAL n 
1 190 MET n 
1 191 LEU n 
1 192 TYR n 
1 193 THR n 
1 194 LEU n 
1 195 LEU n 
1 196 VAL n 
1 197 GLY n 
1 198 ARG n 
1 199 TYR n 
1 200 PRO n 
1 201 PHE n 
1 202 HIS n 
1 203 ASP n 
1 204 SER n 
1 205 ASP n 
1 206 PRO n 
1 207 SER n 
1 208 ALA n 
1 209 LEU n 
1 210 PHE n 
1 211 SER n 
1 212 LYS n 
1 213 ILE n 
1 214 ARG n 
1 215 ARG n 
1 216 GLY n 
1 217 GLN n 
1 218 PHE n 
1 219 CYS n 
1 220 ILE n 
1 221 PRO n 
1 222 GLU n 
1 223 HIS n 
1 224 ILE n 
1 225 SER n 
1 226 PRO n 
1 227 LYS n 
1 228 ALA n 
1 229 ARG n 
1 230 CYS n 
1 231 LEU n 
1 232 ILE n 
1 233 ARG n 
1 234 SER n 
1 235 LEU n 
1 236 LEU n 
1 237 ARG n 
1 238 ARG n 
1 239 GLU n 
1 240 PRO n 
1 241 SER n 
1 242 GLU n 
1 243 ARG n 
1 244 LEU n 
1 245 THR n 
1 246 ALA n 
1 247 PRO n 
1 248 GLU n 
1 249 ILE n 
1 250 LEU n 
1 251 LEU n 
1 252 HIS n 
1 253 PRO n 
1 254 TRP n 
1 255 PHE n 
1 256 GLU n 
1 257 SER n 
1 258 VAL n 
1 259 LEU n 
1 260 GLU n 
1 261 GLY n 
1 262 SER n 
1 263 GLY n 
1 264 SER n 
1 265 SER n 
1 266 GLY n 
1 267 GLY n 
1 268 PRO n 
1 269 GLY n 
1 270 GLY n 
1 271 GLY n 
1 272 ILE n 
1 273 CYS n 
1 274 GLU n 
1 275 HIS n 
1 276 GLU n 
1 277 THR n 
1 278 SER n 
1 279 ILE n 
1 280 ASP n 
1 281 ILE n 
1 282 SER n 
1 283 ALA n 
1 284 TYR n 
1 285 ILE n 
1 286 ASP n 
1 287 PRO n 
1 288 ALA n 
1 289 ALA n 
1 290 PHE n 
1 291 ASN n 
1 292 ASP n 
# 
loop_
_entity_src_gen.entity_id 
_entity_src_gen.pdbx_src_id 
_entity_src_gen.pdbx_alt_source_flag 
_entity_src_gen.pdbx_seq_type 
_entity_src_gen.pdbx_beg_seq_num 
_entity_src_gen.pdbx_end_seq_num 
_entity_src_gen.gene_src_common_name 
_entity_src_gen.gene_src_genus 
_entity_src_gen.pdbx_gene_src_gene 
_entity_src_gen.gene_src_species 
_entity_src_gen.gene_src_strain 
_entity_src_gen.gene_src_tissue 
_entity_src_gen.gene_src_tissue_fraction 
_entity_src_gen.gene_src_details 
_entity_src_gen.pdbx_gene_src_fragment 
_entity_src_gen.pdbx_gene_src_scientific_name 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 
_entity_src_gen.pdbx_gene_src_variant 
_entity_src_gen.pdbx_gene_src_cell_line 
_entity_src_gen.pdbx_gene_src_atcc 
_entity_src_gen.pdbx_gene_src_organ 
_entity_src_gen.pdbx_gene_src_organelle 
_entity_src_gen.pdbx_gene_src_cell 
_entity_src_gen.pdbx_gene_src_cellular_location 
_entity_src_gen.host_org_common_name 
_entity_src_gen.pdbx_host_org_scientific_name 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 
_entity_src_gen.host_org_genus 
_entity_src_gen.pdbx_host_org_gene 
_entity_src_gen.pdbx_host_org_organ 
_entity_src_gen.host_org_species 
_entity_src_gen.pdbx_host_org_tissue 
_entity_src_gen.pdbx_host_org_tissue_fraction 
_entity_src_gen.pdbx_host_org_strain 
_entity_src_gen.pdbx_host_org_variant 
_entity_src_gen.pdbx_host_org_cell_line 
_entity_src_gen.pdbx_host_org_atcc 
_entity_src_gen.pdbx_host_org_culture_collection 
_entity_src_gen.pdbx_host_org_cell 
_entity_src_gen.pdbx_host_org_organelle 
_entity_src_gen.pdbx_host_org_cellular_location 
_entity_src_gen.pdbx_host_org_vector_type 
_entity_src_gen.pdbx_host_org_vector 
_entity_src_gen.host_org_details 
_entity_src_gen.expression_system_id 
_entity_src_gen.plasmid_name 
_entity_src_gen.plasmid_details 
_entity_src_gen.pdbx_description 
1 1 sample 'Biological sequence' 1   267 Human ? 'TRIB1, C8FW, GIG2, TRB1' ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? 
'Escherichia coli BL21(DE3)' 469008 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
1 2 sample 'Biological sequence' 268 292 Human ? 'CEBPA, CEBP'             ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? 
'Escherichia coli BL21(DE3)' 469008 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_db_isoform 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
1 UNP TRIB1_HUMAN Q96RU8 ? 1 
;RIADYLLLPLAEREHVSRALCIHTGRELRCKVFPIKHYQDKIRPYIQLPSHSNITGIVEVILGETKAYVFFEKDFGDMHS
YVRSRKRLREEEAARLFKQIVSAVAHCHQSAIVLGDLKLRKFVFSTEERTQLRLESLEDTHIMKGEDDALSDKHGCPAYV
SPEILNTTGTYSGKAADVWSLGVMLYTLLVGRYPFHDSDPSALFSKIRRGQFCIPEHISPKARCLIRSLLRREPSERLTA
PEILLHPWFESVLE
;
90 
2 UNP CEBPA_HUMAN P49715 ? 1 PLGGICEHETSIDISAYIDPAAFND 51 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 6DC0 A 7   ? 260 ? Q96RU8 90 ? 343 ? 90  485 
2 2 6DC0 A 268 ? 292 ? P49715 51 ? 75  ? 493 517 
3 1 6DC0 B 7   ? 260 ? Q96RU8 90 ? 343 ? 90  485 
4 2 6DC0 B 268 ? 292 ? P49715 51 ? 75  ? 493 517 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 6DC0 SER A 1   ? UNP Q96RU8 ?   ?  'expression tag' 84  1  
1 6DC0 ALA A 2   ? UNP Q96RU8 ?   ?  'expression tag' 85  2  
1 6DC0 PRO A 3   ? UNP Q96RU8 ?   ?  'expression tag' 86  3  
1 6DC0 GLY A 4   ? UNP Q96RU8 ?   ?  'expression tag' 87  4  
1 6DC0 PRO A 5   ? UNP Q96RU8 ?   ?  'expression tag' 88  5  
1 6DC0 SER A 6   ? UNP Q96RU8 ?   ?  'expression tag' 89  6  
1 6DC0 GLY A 261 ? UNP Q96RU8 ?   ?  linker           486 7  
1 6DC0 SER A 262 ? UNP Q96RU8 ?   ?  linker           487 8  
1 6DC0 GLY A 263 ? UNP Q96RU8 ?   ?  linker           488 9  
1 6DC0 SER A 264 ? UNP Q96RU8 ?   ?  linker           489 10 
1 6DC0 SER A 265 ? UNP Q96RU8 ?   ?  linker           490 11 
1 6DC0 GLY A 266 ? UNP Q96RU8 ?   ?  linker           491 12 
1 6DC0 GLY A 267 ? UNP Q96RU8 ?   ?  linker           492 13 
2 6DC0 GLY A 269 ? UNP P49715 LEU 52 conflict         494 14 
3 6DC0 SER B 1   ? UNP Q96RU8 ?   ?  'expression tag' 84  15 
3 6DC0 ALA B 2   ? UNP Q96RU8 ?   ?  'expression tag' 85  16 
3 6DC0 PRO B 3   ? UNP Q96RU8 ?   ?  'expression tag' 86  17 
3 6DC0 GLY B 4   ? UNP Q96RU8 ?   ?  'expression tag' 87  18 
3 6DC0 PRO B 5   ? UNP Q96RU8 ?   ?  'expression tag' 88  19 
3 6DC0 SER B 6   ? UNP Q96RU8 ?   ?  'expression tag' 89  20 
3 6DC0 GLY B 261 ? UNP Q96RU8 ?   ?  linker           486 21 
3 6DC0 SER B 262 ? UNP Q96RU8 ?   ?  linker           487 22 
3 6DC0 GLY B 263 ? UNP Q96RU8 ?   ?  linker           488 23 
3 6DC0 SER B 264 ? UNP Q96RU8 ?   ?  linker           489 24 
3 6DC0 SER B 265 ? UNP Q96RU8 ?   ?  linker           490 25 
3 6DC0 GLY B 266 ? UNP Q96RU8 ?   ?  linker           491 26 
3 6DC0 GLY B 267 ? UNP Q96RU8 ?   ?  linker           492 27 
4 6DC0 GLY B 269 ? UNP P49715 LEU 52 conflict         494 28 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER           ? 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.entry_id                   6DC0 
_exptl.crystals_number            1 
_exptl.details                    ? 
_exptl.method                     'X-RAY DIFFRACTION' 
_exptl.method_details             ? 
# 
_exptl_crystal.colour                      ? 
_exptl_crystal.density_diffrn              ? 
_exptl_crystal.density_Matthews            3.57 
_exptl_crystal.density_method              ? 
_exptl_crystal.density_percent_sol         65.57 
_exptl_crystal.description                 ? 
_exptl_crystal.F_000                       ? 
_exptl_crystal.id                          1 
_exptl_crystal.preparation                 ? 
_exptl_crystal.size_max                    ? 
_exptl_crystal.size_mid                    ? 
_exptl_crystal.size_min                    ? 
_exptl_crystal.size_rad                    ? 
_exptl_crystal.colour_lustre               ? 
_exptl_crystal.colour_modifier             ? 
_exptl_crystal.colour_primary              ? 
_exptl_crystal.density_meas                ? 
_exptl_crystal.density_meas_esd            ? 
_exptl_crystal.density_meas_gt             ? 
_exptl_crystal.density_meas_lt             ? 
_exptl_crystal.density_meas_temp           ? 
_exptl_crystal.density_meas_temp_esd       ? 
_exptl_crystal.density_meas_temp_gt        ? 
_exptl_crystal.density_meas_temp_lt        ? 
_exptl_crystal.pdbx_crystal_image_url      ? 
_exptl_crystal.pdbx_crystal_image_format   ? 
_exptl_crystal.pdbx_mosaicity              ? 
_exptl_crystal.pdbx_mosaicity_esd          ? 
# 
_exptl_crystal_grow.apparatus       ? 
_exptl_crystal_grow.atmosphere      ? 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.details         ? 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.method_ref      ? 
_exptl_crystal_grow.pH              7 
_exptl_crystal_grow.pressure        ? 
_exptl_crystal_grow.pressure_esd    ? 
_exptl_crystal_grow.seeding         ? 
_exptl_crystal_grow.seeding_ref     ? 
_exptl_crystal_grow.temp            291 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.temp_esd        ? 
_exptl_crystal_grow.time            ? 
_exptl_crystal_grow.pdbx_details    '2.8 M Na Acetate, 0.1 M BIS-TRIS prop 7 pH with 5% sodium citrate' 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.ambient_environment    ? 
_diffrn.ambient_temp           80 
_diffrn.ambient_temp_details   ? 
_diffrn.ambient_temp_esd       ? 
_diffrn.crystal_id             1 
_diffrn.crystal_support        ? 
_diffrn.crystal_treatment      ? 
_diffrn.details                ? 
_diffrn.id                     1 
_diffrn.ambient_pressure       ? 
_diffrn.ambient_pressure_esd   ? 
_diffrn.ambient_pressure_gt    ? 
_diffrn.ambient_pressure_lt    ? 
_diffrn.ambient_temp_gt        ? 
_diffrn.ambient_temp_lt        ? 
# 
_diffrn_detector.details                      ? 
_diffrn_detector.detector                     CCD 
_diffrn_detector.diffrn_id                    1 
_diffrn_detector.type                         'ADSC QUANTUM 315r' 
_diffrn_detector.area_resol_mean              ? 
_diffrn_detector.dtime                        ? 
_diffrn_detector.pdbx_frames_total            ? 
_diffrn_detector.pdbx_collection_time_total   ? 
_diffrn_detector.pdbx_collection_date         2016-02-24 
# 
_diffrn_radiation.collimation                      ? 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.filter_edge                      ? 
_diffrn_radiation.inhomogeneity                    ? 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.polarisn_norm                    ? 
_diffrn_radiation.polarisn_ratio                   ? 
_diffrn_radiation.probe                            ? 
_diffrn_radiation.type                             ? 
_diffrn_radiation.xray_symbol                      ? 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_wavelength_list             ? 
_diffrn_radiation.pdbx_wavelength                  ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_analyzer                    ? 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.9537 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.current                     ? 
_diffrn_source.details                     ? 
_diffrn_source.diffrn_id                   1 
_diffrn_source.power                       ? 
_diffrn_source.size                        ? 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.target                      ? 
_diffrn_source.type                        'AUSTRALIAN SYNCHROTRON BEAMLINE MX2' 
_diffrn_source.voltage                     ? 
_diffrn_source.take-off_angle              ? 
_diffrn_source.pdbx_wavelength_list        0.9537 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_synchrotron_beamline   MX2 
_diffrn_source.pdbx_synchrotron_site       'Australian Synchrotron' 
# 
_reflns.B_iso_Wilson_estimate            ? 
_reflns.entry_id                         6DC0 
_reflns.data_reduction_details           ? 
_reflns.data_reduction_method            ? 
_reflns.d_resolution_high                2.8 
_reflns.d_resolution_low                 48.7 
_reflns.details                          ? 
_reflns.limit_h_max                      ? 
_reflns.limit_h_min                      ? 
_reflns.limit_k_max                      ? 
_reflns.limit_k_min                      ? 
_reflns.limit_l_max                      ? 
_reflns.limit_l_min                      ? 
_reflns.number_all                       ? 
_reflns.number_obs                       24777 
_reflns.observed_criterion               ? 
_reflns.observed_criterion_F_max         ? 
_reflns.observed_criterion_F_min         ? 
_reflns.observed_criterion_I_max         ? 
_reflns.observed_criterion_I_min         ? 
_reflns.observed_criterion_sigma_F       ? 
_reflns.observed_criterion_sigma_I       ? 
_reflns.percent_possible_obs             99.4 
_reflns.R_free_details                   ? 
_reflns.Rmerge_F_all                     ? 
_reflns.Rmerge_F_obs                     ? 
_reflns.Friedel_coverage                 ? 
_reflns.number_gt                        ? 
_reflns.threshold_expression             ? 
_reflns.pdbx_redundancy                  10.4 
_reflns.pdbx_Rmerge_I_obs                ? 
_reflns.pdbx_Rmerge_I_all                ? 
_reflns.pdbx_Rsym_value                  ? 
_reflns.pdbx_netI_over_av_sigmaI         ? 
_reflns.pdbx_netI_over_sigmaI            19.8 
_reflns.pdbx_res_netI_over_av_sigmaI_2   ? 
_reflns.pdbx_res_netI_over_sigmaI_2      ? 
_reflns.pdbx_chi_squared                 ? 
_reflns.pdbx_scaling_rejects             ? 
_reflns.pdbx_d_res_high_opt              ? 
_reflns.pdbx_d_res_low_opt               ? 
_reflns.pdbx_d_res_opt_method            ? 
_reflns.phase_calculation_details        ? 
_reflns.pdbx_Rrim_I_all                  ? 
_reflns.pdbx_Rpim_I_all                  ? 
_reflns.pdbx_d_opt                       ? 
_reflns.pdbx_number_measured_all         ? 
_reflns.pdbx_diffrn_id                   1 
_reflns.pdbx_ordinal                     1 
_reflns.pdbx_CC_half                     ? 
_reflns.pdbx_R_split                     ? 
# 
_reflns_shell.d_res_high                  2.8 
_reflns_shell.d_res_low                   2.95 
_reflns_shell.meanI_over_sigI_all         ? 
_reflns_shell.meanI_over_sigI_obs         ? 
_reflns_shell.number_measured_all         ? 
_reflns_shell.number_measured_obs         ? 
_reflns_shell.number_possible             ? 
_reflns_shell.number_unique_all           ? 
_reflns_shell.number_unique_obs           ? 
_reflns_shell.percent_possible_all        ? 
_reflns_shell.percent_possible_obs        ? 
_reflns_shell.Rmerge_F_all                ? 
_reflns_shell.Rmerge_F_obs                ? 
_reflns_shell.Rmerge_I_all                ? 
_reflns_shell.Rmerge_I_obs                ? 
_reflns_shell.meanI_over_sigI_gt          ? 
_reflns_shell.meanI_over_uI_all           ? 
_reflns_shell.meanI_over_uI_gt            ? 
_reflns_shell.number_measured_gt          ? 
_reflns_shell.number_unique_gt            ? 
_reflns_shell.percent_possible_gt         ? 
_reflns_shell.Rmerge_F_gt                 ? 
_reflns_shell.Rmerge_I_gt                 ? 
_reflns_shell.pdbx_redundancy             ? 
_reflns_shell.pdbx_Rsym_value             ? 
_reflns_shell.pdbx_chi_squared            ? 
_reflns_shell.pdbx_netI_over_sigmaI_all   ? 
_reflns_shell.pdbx_netI_over_sigmaI_obs   ? 
_reflns_shell.pdbx_Rrim_I_all             ? 
_reflns_shell.pdbx_Rpim_I_all             ? 
_reflns_shell.pdbx_rejects                ? 
_reflns_shell.pdbx_ordinal                1 
_reflns_shell.pdbx_diffrn_id              1 
_reflns_shell.pdbx_CC_half                ? 
_reflns_shell.pdbx_R_split                ? 
# 
_refine.aniso_B[1][1]                            -0.41 
_refine.aniso_B[1][2]                            -0.21 
_refine.aniso_B[1][3]                            -0.00 
_refine.aniso_B[2][2]                            -0.41 
_refine.aniso_B[2][3]                            0.00 
_refine.aniso_B[3][3]                            1.34 
_refine.B_iso_max                                ? 
_refine.B_iso_mean                               113 
_refine.B_iso_min                                ? 
_refine.correlation_coeff_Fo_to_Fc               0.945 
_refine.correlation_coeff_Fo_to_Fc_free          0.922 
_refine.details                                  'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS' 
_refine.diff_density_max                         ? 
_refine.diff_density_max_esd                     ? 
_refine.diff_density_min                         ? 
_refine.diff_density_min_esd                     ? 
_refine.diff_density_rms                         ? 
_refine.diff_density_rms_esd                     ? 
_refine.entry_id                                 6DC0 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.ls_abs_structure_details                 ? 
_refine.ls_abs_structure_Flack                   ? 
_refine.ls_abs_structure_Flack_esd               ? 
_refine.ls_abs_structure_Rogers                  ? 
_refine.ls_abs_structure_Rogers_esd              ? 
_refine.ls_d_res_high                            2.80 
_refine.ls_d_res_low                             48.7 
_refine.ls_extinction_coef                       ? 
_refine.ls_extinction_coef_esd                   ? 
_refine.ls_extinction_expression                 ? 
_refine.ls_extinction_method                     ? 
_refine.ls_goodness_of_fit_all                   ? 
_refine.ls_goodness_of_fit_all_esd               ? 
_refine.ls_goodness_of_fit_obs                   ? 
_refine.ls_goodness_of_fit_obs_esd               ? 
_refine.ls_hydrogen_treatment                    ? 
_refine.ls_matrix_type                           ? 
_refine.ls_number_constraints                    ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_reflns_all                     ? 
_refine.ls_number_reflns_obs                     23461 
_refine.ls_number_reflns_R_free                  1222 
_refine.ls_number_reflns_R_work                  ? 
_refine.ls_number_restraints                     ? 
_refine.ls_percent_reflns_obs                    99.73 
_refine.ls_percent_reflns_R_free                 5.0 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_obs                          0.22254 
_refine.ls_R_factor_R_free                       0.27679 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_R_factor_R_work                       0.21990 
_refine.ls_R_Fsqd_factor_obs                     ? 
_refine.ls_R_I_factor_obs                        ? 
_refine.ls_redundancy_reflns_all                 ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.ls_restrained_S_all                      ? 
_refine.ls_restrained_S_obs                      ? 
_refine.ls_shift_over_esd_max                    ? 
_refine.ls_shift_over_esd_mean                   ? 
_refine.ls_structure_factor_coef                 ? 
_refine.ls_weighting_details                     ? 
_refine.ls_weighting_scheme                      ? 
_refine.ls_wR_factor_all                         ? 
_refine.ls_wR_factor_obs                         ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.occupancy_max                            ? 
_refine.occupancy_min                            ? 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.ls_R_factor_gt                           ? 
_refine.ls_goodness_of_fit_gt                    ? 
_refine.ls_goodness_of_fit_ref                   ? 
_refine.ls_shift_over_su_max                     ? 
_refine.ls_shift_over_su_max_lt                  ? 
_refine.ls_shift_over_su_mean                    ? 
_refine.ls_shift_over_su_mean_lt                 ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          ? 
_refine.pdbx_ls_sigma_Fsqd                       ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_starting_model                      5CEM 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_overall_ESU_R                       0.533 
_refine.pdbx_overall_ESU_R_Free                  0.340 
_refine.pdbx_solvent_vdw_probe_radii             1.00 
_refine.pdbx_solvent_ion_probe_radii             0.70 
_refine.pdbx_solvent_shrinkage_radii             0.70 
_refine.pdbx_real_space_R                        ? 
_refine.pdbx_density_correlation                 ? 
_refine.pdbx_pd_number_of_powder_patterns        ? 
_refine.pdbx_pd_number_of_points                 ? 
_refine.pdbx_pd_meas_number_of_points            ? 
_refine.pdbx_pd_proc_ls_prof_R_factor            ? 
_refine.pdbx_pd_proc_ls_prof_wR_factor           ? 
_refine.pdbx_pd_Marquardt_correlation_coeff      ? 
_refine.pdbx_pd_Fsqrd_R_factor                   ? 
_refine.pdbx_pd_ls_matrix_band_width             ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_diffrn_id                           1 
_refine.overall_SU_B                             39.462 
_refine.overall_SU_ML                            0.326 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_average_fsc_overall                 ? 
_refine.pdbx_average_fsc_work                    ? 
_refine.pdbx_average_fsc_free                    ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         1 
_refine_hist.pdbx_number_atoms_protein        4311 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         0 
_refine_hist.number_atoms_solvent             40 
_refine_hist.number_atoms_total               4351 
_refine_hist.d_res_high                       2.80 
_refine_hist.d_res_low                        48.7 
# 
loop_
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.criterion 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.number 
_refine_ls_restr.rejects 
_refine_ls_restr.type 
_refine_ls_restr.weight 
_refine_ls_restr.pdbx_restraint_function 
'X-RAY DIFFRACTION' ? 0.011  0.019  4416  ? r_bond_refined_d             ? ? 
'X-RAY DIFFRACTION' ? 0.005  0.020  4263  ? r_bond_other_d               ? ? 
'X-RAY DIFFRACTION' ? 1.654  1.967  5967  ? r_angle_refined_deg          ? ? 
'X-RAY DIFFRACTION' ? 1.338  3.000  9816  ? r_angle_other_deg            ? ? 
'X-RAY DIFFRACTION' ? 6.805  5.000  531   ? r_dihedral_angle_1_deg       ? ? 
'X-RAY DIFFRACTION' ? 35.522 22.217 203   ? r_dihedral_angle_2_deg       ? ? 
'X-RAY DIFFRACTION' ? 18.330 15.000 784   ? r_dihedral_angle_3_deg       ? ? 
'X-RAY DIFFRACTION' ? 21.916 15.000 43    ? r_dihedral_angle_4_deg       ? ? 
'X-RAY DIFFRACTION' ? 0.100  0.200  664   ? r_chiral_restr               ? ? 
'X-RAY DIFFRACTION' ? 0.008  0.021  4851  ? r_gen_planes_refined         ? ? 
'X-RAY DIFFRACTION' ? 0.005  0.020  1030  ? r_gen_planes_other           ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?     ? r_nbd_refined                ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?     ? r_nbd_other                  ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?     ? r_nbtor_refined              ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?     ? r_nbtor_other                ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?     ? r_xyhbond_nbd_refined        ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?     ? r_xyhbond_nbd_other          ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?     ? r_metal_ion_refined          ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?     ? r_metal_ion_other            ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?     ? r_symmetry_vdw_refined       ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?     ? r_symmetry_vdw_other         ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?     ? r_symmetry_hbond_refined     ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?     ? r_symmetry_hbond_other       ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?     ? r_symmetry_metal_ion_refined ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?     ? r_symmetry_metal_ion_other   ? ? 
'X-RAY DIFFRACTION' ? 3.774  6.628  2136  ? r_mcbond_it                  ? ? 
'X-RAY DIFFRACTION' ? 3.769  6.628  2135  ? r_mcbond_other               ? ? 
'X-RAY DIFFRACTION' ? 5.853  9.946  2660  ? r_mcangle_it                 ? ? 
'X-RAY DIFFRACTION' ? 5.853  9.947  2661  ? r_mcangle_other              ? ? 
'X-RAY DIFFRACTION' ? 4.115  7.090  2279  ? r_scbond_it                  ? ? 
'X-RAY DIFFRACTION' ? 4.114  7.091  2280  ? r_scbond_other               ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?     ? r_scangle_it                 ? ? 
'X-RAY DIFFRACTION' ? 6.676  10.454 3307  ? r_scangle_other              ? ? 
'X-RAY DIFFRACTION' ? 11.392 63.365 18093 ? r_long_range_B_refined       ? ? 
'X-RAY DIFFRACTION' ? 11.392 63.362 18090 ? r_long_range_B_other         ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?     ? r_rigid_bond_restr           ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?     ? r_sphericity_free            ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?     ? r_sphericity_bonded          ? ? 
# 
loop_
_refine_ls_restr_ncs.pdbx_refine_id 
_refine_ls_restr_ncs.dom_id 
_refine_ls_restr_ncs.pdbx_ens_id 
_refine_ls_restr_ncs.pdbx_ordinal 
_refine_ls_restr_ncs.ncs_model_details 
_refine_ls_restr_ncs.rms_dev_position 
_refine_ls_restr_ncs.weight_position 
_refine_ls_restr_ncs.rms_dev_B_iso 
_refine_ls_restr_ncs.weight_B_iso 
_refine_ls_restr_ncs.pdbx_auth_asym_id 
_refine_ls_restr_ncs.pdbx_number 
_refine_ls_restr_ncs.pdbx_type 
'X-RAY DIFFRACTION' 1 1 1 ? 0.13 0.05 ? ? A 30588 'interatomic distance' 
'X-RAY DIFFRACTION' 2 1 2 ? 0.13 0.05 ? ? B 30588 'interatomic distance' 
# 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.d_res_high                       2.799 
_refine_ls_shell.d_res_low                        2.872 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.number_reflns_obs                ? 
_refine_ls_shell.number_reflns_R_free             77 
_refine_ls_shell.number_reflns_R_work             1669 
_refine_ls_shell.percent_reflns_obs               98.15 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.R_factor_all                     ? 
_refine_ls_shell.R_factor_obs                     ? 
_refine_ls_shell.R_factor_R_free                  0.384 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.R_factor_R_work                  0.366 
_refine_ls_shell.redundancy_reflns_all            ? 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.wR_factor_all                    ? 
_refine_ls_shell.wR_factor_obs                    ? 
_refine_ls_shell.wR_factor_R_free                 ? 
_refine_ls_shell.wR_factor_R_work                 ? 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.pdbx_phase_error                 ? 
_refine_ls_shell.pdbx_fsc_work                    ? 
_refine_ls_shell.pdbx_fsc_free                    ? 
# 
loop_
_struct_ncs_dom.id 
_struct_ncs_dom.details 
_struct_ncs_dom.pdbx_ens_id 
1 A 1 
2 B 1 
# 
loop_
_struct_ncs_dom_lim.dom_id 
_struct_ncs_dom_lim.beg_auth_asym_id 
_struct_ncs_dom_lim.beg_auth_seq_id 
_struct_ncs_dom_lim.end_auth_asym_id 
_struct_ncs_dom_lim.end_auth_seq_id 
_struct_ncs_dom_lim.pdbx_component_id 
_struct_ncs_dom_lim.pdbx_refine_code 
_struct_ncs_dom_lim.beg_label_asym_id 
_struct_ncs_dom_lim.beg_label_comp_id 
_struct_ncs_dom_lim.beg_label_seq_id 
_struct_ncs_dom_lim.beg_label_alt_id 
_struct_ncs_dom_lim.end_label_asym_id 
_struct_ncs_dom_lim.end_label_comp_id 
_struct_ncs_dom_lim.end_label_seq_id 
_struct_ncs_dom_lim.end_label_alt_id 
_struct_ncs_dom_lim.pdbx_ens_id 
_struct_ncs_dom_lim.selection_details 
1 A 89 A 508 0 0 ? ? ? ? ? ? ? ? 1 ? 
2 B 89 B 508 0 0 ? ? ? ? ? ? ? ? 1 ? 
# 
_struct_ncs_ens.id        1 
_struct_ncs_ens.details   ? 
# 
_struct.entry_id                     6DC0 
_struct.title                        'Tribbles (TRIB1) pseudokinase fused to CCAAT-enhancer binding protein (C/EBPalpha) degron' 
_struct.pdbx_descriptor              'Tribbles homolog 1,CCAAT/enhancer-binding protein alpha' 
_struct.pdbx_model_details           ? 
_struct.pdbx_formula_weight          ? 
_struct.pdbx_formula_weight_method   ? 
_struct.pdbx_model_type_details      ? 
_struct.pdbx_CASP_flag               N 
# 
_struct_keywords.entry_id        6DC0 
_struct_keywords.text            'Tribbles, psuedokinase, CCAAT-enhancer binding protein, TRB1, SIGNALING PROTEIN' 
_struct_keywords.pdbx_keywords   'SIGNALING PROTEIN' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 2 ? 
D N N 2 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  AA1 ILE A 41  ? LEU A 54  ? ILE A 124 LEU A 137 1 ? 14 
HELX_P HELX_P2  AA2 ASP A 83  ? ARG A 91  ? ASP A 166 ARG A 174 1 ? 9  
HELX_P HELX_P3  AA3 ARG A 95  ? SER A 116 ? ARG A 178 SER A 199 1 ? 22 
HELX_P HELX_P4  AA4 LYS A 124 ? ARG A 126 ? LYS A 207 ARG A 209 5 ? 3  
HELX_P HELX_P5  AA5 CYS A 162 ? VAL A 166 ? CYS A 245 VAL A 249 5 ? 5  
HELX_P HELX_P6  AA6 SER A 167 ? THR A 173 ? SER A 250 THR A 256 1 ? 7  
HELX_P HELX_P7  AA7 GLY A 179 ? GLY A 197 ? GLY A 262 GLY A 280 1 ? 19 
HELX_P HELX_P8  AA8 ASP A 205 ? GLY A 216 ? ASP A 288 GLY A 299 1 ? 12 
HELX_P HELX_P9  AA9 SER A 225 ? LEU A 236 ? SER A 308 LEU A 319 1 ? 12 
HELX_P HELX_P10 AB1 GLU A 239 ? ARG A 243 ? GLU A 322 ARG A 326 5 ? 5  
HELX_P HELX_P11 AB2 THR A 245 ? LEU A 250 ? THR A 328 LEU A 333 1 ? 6  
HELX_P HELX_P12 AB3 PRO A 253 ? VAL A 258 ? PRO A 336 VAL A 341 1 ? 6  
HELX_P HELX_P13 AB4 SER A 282 ? TYR A 284 ? SER A 507 TYR A 509 5 ? 3  
HELX_P HELX_P14 AB5 ILE B 41  ? LEU B 54  ? ILE B 124 LEU B 137 1 ? 14 
HELX_P HELX_P15 AB6 ASP B 83  ? ARG B 91  ? ASP B 166 ARG B 174 1 ? 9  
HELX_P HELX_P16 AB7 ARG B 95  ? SER B 116 ? ARG B 178 SER B 199 1 ? 22 
HELX_P HELX_P17 AB8 LYS B 124 ? ARG B 126 ? LYS B 207 ARG B 209 5 ? 3  
HELX_P HELX_P18 AB9 CYS B 162 ? VAL B 166 ? CYS B 245 VAL B 249 5 ? 5  
HELX_P HELX_P19 AC1 SER B 167 ? THR B 173 ? SER B 250 THR B 256 1 ? 7  
HELX_P HELX_P20 AC2 GLY B 179 ? GLY B 197 ? GLY B 262 GLY B 280 1 ? 19 
HELX_P HELX_P21 AC3 ASP B 205 ? GLY B 216 ? ASP B 288 GLY B 299 1 ? 12 
HELX_P HELX_P22 AC4 SER B 225 ? LEU B 236 ? SER B 308 LEU B 319 1 ? 12 
HELX_P HELX_P23 AC5 GLU B 239 ? ARG B 243 ? GLU B 322 ARG B 326 5 ? 5  
HELX_P HELX_P24 AC6 THR B 245 ? LEU B 250 ? THR B 328 LEU B 333 1 ? 6  
HELX_P HELX_P25 AC7 PRO B 253 ? LEU B 259 ? PRO B 336 LEU B 342 1 ? 7  
HELX_P HELX_P26 AC8 SER B 282 ? ILE B 285 ? SER B 507 ILE B 510 5 ? 4  
HELX_P HELX_P27 AC9 ASP B 286 ? ASN B 291 ? ASP B 511 ASN B 516 1 ? 6  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA1 ? 6 ? 
AA2 ? 2 ? 
AA3 ? 2 ? 
AA4 ? 2 ? 
AA5 ? 2 ? 
AA6 ? 2 ? 
AA7 ? 5 ? 
AA8 ? 2 ? 
AA9 ? 2 ? 
AB1 ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA1 1 2 ? anti-parallel 
AA1 2 3 ? anti-parallel 
AA1 3 4 ? anti-parallel 
AA1 4 5 ? anti-parallel 
AA1 5 6 ? anti-parallel 
AA2 1 2 ? anti-parallel 
AA3 1 2 ? anti-parallel 
AA4 1 2 ? anti-parallel 
AA5 1 2 ? anti-parallel 
AA6 1 2 ? anti-parallel 
AA7 1 2 ? anti-parallel 
AA7 2 3 ? anti-parallel 
AA7 3 4 ? anti-parallel 
AA7 4 5 ? anti-parallel 
AA8 1 2 ? anti-parallel 
AA9 1 2 ? anti-parallel 
AB1 1 2 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA1 1 SER A 6   ? ARG A 7   ? SER A 89  ARG A 90  
AA1 2 TYR A 11  ? LEU A 14  ? TYR A 94  LEU A 97  
AA1 3 VAL A 22  ? CYS A 27  ? VAL A 105 CYS A 110 
AA1 4 GLU A 33  ? PRO A 40  ? GLU A 116 PRO A 123 
AA1 5 LYS A 72  ? PHE A 77  ? LYS A 155 PHE A 160 
AA1 6 GLU A 65  ? LEU A 68  ? GLU A 148 LEU A 151 
AA2 1 ILE A 118 ? VAL A 119 ? ILE A 201 VAL A 202 
AA2 2 HIS A 147 ? ILE A 148 ? HIS A 230 ILE A 231 
AA3 1 PHE A 128 ? PHE A 130 ? PHE A 211 PHE A 213 
AA3 2 LEU A 138 ? LEU A 140 ? LEU A 221 LEU A 223 
AA4 1 ALA A 155 ? LEU A 156 ? ALA A 238 LEU A 239 
AA4 2 TYR A 177 ? SER A 178 ? TYR A 260 SER A 261 
AA5 1 HIS A 160 ? GLY A 161 ? HIS A 243 GLY A 244 
AA5 2 ILE B 279 ? ASP B 280 ? ILE B 504 ASP B 505 
AA6 1 ILE A 279 ? ASP A 280 ? ILE A 504 ASP A 505 
AA6 2 HIS B 160 ? GLY B 161 ? HIS B 243 GLY B 244 
AA7 1 LEU B 12  ? LEU B 14  ? LEU B 95  LEU B 97  
AA7 2 VAL B 22  ? LEU B 26  ? VAL B 105 LEU B 109 
AA7 3 GLU B 33  ? PRO B 40  ? GLU B 116 PRO B 123 
AA7 4 LYS B 72  ? PHE B 77  ? LYS B 155 PHE B 160 
AA7 5 GLU B 65  ? LEU B 68  ? GLU B 148 LEU B 151 
AA8 1 ILE B 118 ? VAL B 119 ? ILE B 201 VAL B 202 
AA8 2 HIS B 147 ? ILE B 148 ? HIS B 230 ILE B 231 
AA9 1 PHE B 128 ? PHE B 130 ? PHE B 211 PHE B 213 
AA9 2 LEU B 138 ? LEU B 140 ? LEU B 221 LEU B 223 
AB1 1 ALA B 155 ? LEU B 156 ? ALA B 238 LEU B 239 
AB1 2 TYR B 177 ? SER B 178 ? TYR B 260 SER B 261 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA1 1 2 N SER A 6   ? N SER A 89  O LEU A 13  ? O LEU A 96  
AA1 2 3 N LEU A 14  ? N LEU A 97  O ARG A 24  ? O ARG A 107 
AA1 3 4 N ALA A 25  ? N ALA A 108 O LEU A 34  ? O LEU A 117 
AA1 4 5 N ARG A 35  ? N ARG A 118 O PHE A 77  ? O PHE A 160 
AA1 5 6 O PHE A 76  ? O PHE A 159 N GLU A 65  ? N GLU A 148 
AA2 1 2 N VAL A 119 ? N VAL A 202 O HIS A 147 ? O HIS A 230 
AA3 1 2 N VAL A 129 ? N VAL A 212 O ARG A 139 ? O ARG A 222 
AA4 1 2 N LEU A 156 ? N LEU A 239 O TYR A 177 ? O TYR A 260 
AA5 1 2 N GLY A 161 ? N GLY A 244 O ILE B 279 ? O ILE B 504 
AA6 1 2 N ILE A 279 ? N ILE A 504 O GLY B 161 ? O GLY B 244 
AA7 1 2 N LEU B 14  ? N LEU B 97  O ARG B 24  ? O ARG B 107 
AA7 2 3 N ALA B 25  ? N ALA B 108 O LEU B 34  ? O LEU B 117 
AA7 3 4 N ARG B 35  ? N ARG B 118 O PHE B 77  ? O PHE B 160 
AA7 4 5 O PHE B 76  ? O PHE B 159 N GLU B 65  ? N GLU B 148 
AA8 1 2 N VAL B 119 ? N VAL B 202 O HIS B 147 ? O HIS B 230 
AA9 1 2 N VAL B 129 ? N VAL B 212 O ARG B 139 ? O ARG B 222 
AB1 1 2 N LEU B 156 ? N LEU B 239 O TYR B 177 ? O TYR B 260 
# 
_atom_sites.entry_id                    6DC0 
_atom_sites.fract_transf_matrix[1][1]   0.010121 
_atom_sites.fract_transf_matrix[1][2]   0.005843 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   -0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.011686 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   -0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.003006 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N   . PRO A 1 5   ? 0.887   2.189   173.482 1.00 140.83 ? 88  PRO A N   1 
ATOM   2    C CA  . PRO A 1 5   ? 0.661   1.871   174.898 1.00 140.41 ? 88  PRO A CA  1 
ATOM   3    C C   . PRO A 1 5   ? 1.644   0.805   175.467 1.00 141.13 ? 88  PRO A C   1 
ATOM   4    O O   . PRO A 1 5   ? 1.704   -0.321  174.941 1.00 149.61 ? 88  PRO A O   1 
ATOM   5    C CB  . PRO A 1 5   ? -0.811  1.378   174.929 1.00 140.76 ? 88  PRO A CB  1 
ATOM   6    C CG  . PRO A 1 5   ? -1.197  1.116   173.514 1.00 143.29 ? 88  PRO A CG  1 
ATOM   7    C CD  . PRO A 1 5   ? -0.332  2.022   172.677 1.00 144.44 ? 88  PRO A CD  1 
ATOM   8    N N   . SER A 1 6   ? 2.393   1.168   176.518 1.00 131.19 ? 89  SER A N   1 
ATOM   9    C CA  . SER A 1 6   ? 3.331   0.262   177.208 1.00 131.91 ? 89  SER A CA  1 
ATOM   10   C C   . SER A 1 6   ? 3.196   0.340   178.734 1.00 127.28 ? 89  SER A C   1 
ATOM   11   O O   . SER A 1 6   ? 2.905   1.417   179.273 1.00 121.30 ? 89  SER A O   1 
ATOM   12   C CB  . SER A 1 6   ? 4.780   0.578   176.789 1.00 135.56 ? 89  SER A CB  1 
ATOM   13   O OG  . SER A 1 6   ? 5.057   1.977   176.797 1.00 128.63 ? 89  SER A OG  1 
ATOM   14   N N   . ARG A 1 7   ? 3.438   -0.788  179.417 1.00 123.94 ? 90  ARG A N   1 
ATOM   15   C CA  . ARG A 1 7   ? 3.306   -0.883  180.881 1.00 126.53 ? 90  ARG A CA  1 
ATOM   16   C C   . ARG A 1 7   ? 4.566   -0.414  181.617 1.00 124.86 ? 90  ARG A C   1 
ATOM   17   O O   . ARG A 1 7   ? 5.666   -0.638  181.121 1.00 126.28 ? 90  ARG A O   1 
ATOM   18   C CB  . ARG A 1 7   ? 3.071   -2.330  181.284 1.00 134.83 ? 90  ARG A CB  1 
ATOM   19   C CG  . ARG A 1 7   ? 2.794   -2.581  182.779 1.00 141.30 ? 90  ARG A CG  1 
ATOM   20   C CD  . ARG A 1 7   ? 1.467   -1.926  183.245 1.00 142.18 ? 90  ARG A CD  1 
ATOM   21   N NE  . ARG A 1 7   ? 0.603   -2.841  184.009 1.00 146.27 ? 90  ARG A NE  1 
ATOM   22   C CZ  . ARG A 1 7   ? -0.053  -3.900  183.530 1.00 150.44 ? 90  ARG A CZ  1 
ATOM   23   N NH1 . ARG A 1 7   ? 0.026   -4.263  182.253 1.00 154.72 ? 90  ARG A NH1 1 
ATOM   24   N NH2 . ARG A 1 7   ? -0.795  -4.619  184.366 1.00 154.08 ? 90  ARG A NH2 1 
ATOM   25   N N   . ILE A 1 8   ? 4.399   0.190   182.803 1.00 121.78 ? 91  ILE A N   1 
ATOM   26   C CA  . ILE A 1 8   ? 5.500   0.388   183.757 1.00 122.09 ? 91  ILE A CA  1 
ATOM   27   C C   . ILE A 1 8   ? 5.254   -0.418  185.024 1.00 130.21 ? 91  ILE A C   1 
ATOM   28   O O   . ILE A 1 8   ? 5.931   -1.422  185.259 1.00 141.11 ? 91  ILE A O   1 
ATOM   29   C CB  . ILE A 1 8   ? 5.743   1.877   184.075 1.00 118.75 ? 91  ILE A CB  1 
ATOM   30   C CG1 . ILE A 1 8   ? 6.283   2.590   182.833 1.00 119.94 ? 91  ILE A CG1 1 
ATOM   31   C CG2 . ILE A 1 8   ? 6.717   2.060   185.240 1.00 116.74 ? 91  ILE A CG2 1 
ATOM   32   C CD1 . ILE A 1 8   ? 7.652   2.130   182.371 1.00 119.07 ? 91  ILE A CD1 1 
ATOM   33   N N   . ALA A 1 9   ? 4.320   0.029   185.850 1.00 128.16 ? 92  ALA A N   1 
ATOM   34   C CA  . ALA A 1 9   ? 3.949   -0.715  187.042 1.00 128.94 ? 92  ALA A CA  1 
ATOM   35   C C   . ALA A 1 9   ? 2.629   -0.138  187.468 1.00 129.34 ? 92  ALA A C   1 
ATOM   36   O O   . ALA A 1 9   ? 2.563   0.922   188.088 1.00 126.47 ? 92  ALA A O   1 
ATOM   37   C CB  . ALA A 1 9   ? 4.993   -0.577  188.136 1.00 128.47 ? 92  ALA A CB  1 
ATOM   38   N N   . ASP A 1 10  ? 1.576   -0.819  187.042 1.00 132.42 ? 93  ASP A N   1 
ATOM   39   C CA  . ASP A 1 10  ? 0.192   -0.325  187.125 1.00 136.16 ? 93  ASP A CA  1 
ATOM   40   C C   . ASP A 1 10  ? -0.057  1.020   186.402 1.00 129.91 ? 93  ASP A C   1 
ATOM   41   O O   . ASP A 1 10  ? -1.000  1.727   186.727 1.00 119.83 ? 93  ASP A O   1 
ATOM   42   C CB  . ASP A 1 10  ? -0.290  -0.302  188.582 1.00 136.71 ? 93  ASP A CB  1 
ATOM   43   C CG  . ASP A 1 10  ? -0.371  -1.694  189.175 1.00 138.87 ? 93  ASP A CG  1 
ATOM   44   O OD1 . ASP A 1 10  ? 0.643   -2.431  189.126 1.00 139.99 ? 93  ASP A OD1 1 
ATOM   45   O OD2 . ASP A 1 10  ? -1.453  -2.059  189.667 1.00 140.30 ? 93  ASP A OD2 1 
ATOM   46   N N   . TYR A 1 11  ? 0.773   1.320   185.398 1.00 130.02 ? 94  TYR A N   1 
ATOM   47   C CA  . TYR A 1 11  ? 0.663   2.538   184.594 1.00 127.85 ? 94  TYR A CA  1 
ATOM   48   C C   . TYR A 1 11  ? 0.846   2.202   183.125 1.00 123.91 ? 94  TYR A C   1 
ATOM   49   O O   . TYR A 1 11  ? 1.777   1.484   182.782 1.00 121.42 ? 94  TYR A O   1 
ATOM   50   C CB  . TYR A 1 11  ? 1.753   3.541   184.959 1.00 128.68 ? 94  TYR A CB  1 
ATOM   51   C CG  . TYR A 1 11  ? 1.581   4.271   186.262 1.00 128.25 ? 94  TYR A CG  1 
ATOM   52   C CD1 . TYR A 1 11  ? 0.647   5.303   186.391 1.00 123.10 ? 94  TYR A CD1 1 
ATOM   53   C CD2 . TYR A 1 11  ? 2.390   3.960   187.363 1.00 125.99 ? 94  TYR A CD2 1 
ATOM   54   C CE1 . TYR A 1 11  ? 0.512   5.981   187.591 1.00 126.68 ? 94  TYR A CE1 1 
ATOM   55   C CE2 . TYR A 1 11  ? 2.265   4.632   188.557 1.00 123.78 ? 94  TYR A CE2 1 
ATOM   56   C CZ  . TYR A 1 11  ? 1.337   5.641   188.673 1.00 125.28 ? 94  TYR A CZ  1 
ATOM   57   O OH  . TYR A 1 11  ? 1.224   6.294   189.875 1.00 130.37 ? 94  TYR A OH  1 
ATOM   58   N N   . LEU A 1 12  ? -0.026  2.737   182.274 1.00 123.91 ? 95  LEU A N   1 
ATOM   59   C CA  . LEU A 1 12  ? 0.186   2.712   180.827 1.00 127.72 ? 95  LEU A CA  1 
ATOM   60   C C   . LEU A 1 12  ? 0.882   3.976   180.462 1.00 125.46 ? 95  LEU A C   1 
ATOM   61   O O   . LEU A 1 12  ? 0.519   5.042   180.945 1.00 121.99 ? 95  LEU A O   1 
ATOM   62   C CB  . LEU A 1 12  ? -1.108  2.713   180.037 1.00 130.12 ? 95  LEU A CB  1 
ATOM   63   C CG  . LEU A 1 12  ? -2.169  1.711   180.439 1.00 136.34 ? 95  LEU A CG  1 
ATOM   64   C CD1 . LEU A 1 12  ? -3.519  2.297   180.086 1.00 140.47 ? 95  LEU A CD1 1 
ATOM   65   C CD2 . LEU A 1 12  ? -1.937  0.365   179.770 1.00 138.93 ? 95  LEU A CD2 1 
ATOM   66   N N   . LEU A 1 13  ? 1.862   3.860   179.590 1.00 127.02 ? 96  LEU A N   1 
ATOM   67   C CA  . LEU A 1 13  ? 2.571   5.014   179.102 1.00 129.28 ? 96  LEU A CA  1 
ATOM   68   C C   . LEU A 1 13  ? 2.015   5.250   177.715 1.00 125.26 ? 96  LEU A C   1 
ATOM   69   O O   . LEU A 1 13  ? 1.872   4.326   176.925 1.00 129.34 ? 96  LEU A O   1 
ATOM   70   C CB  . LEU A 1 13  ? 4.083   4.751   179.105 1.00 132.75 ? 96  LEU A CB  1 
ATOM   71   C CG  . LEU A 1 13  ? 4.852   4.820   180.450 1.00 130.24 ? 96  LEU A CG  1 
ATOM   72   C CD1 . LEU A 1 13  ? 5.771   6.028   180.524 1.00 126.55 ? 96  LEU A CD1 1 
ATOM   73   C CD2 . LEU A 1 13  ? 3.982   4.795   181.704 1.00 128.62 ? 96  LEU A CD2 1 
ATOM   74   N N   . LEU A 1 14  ? 1.667   6.492   177.437 1.00 121.54 ? 97  LEU A N   1 
ATOM   75   C CA  . LEU A 1 14  ? 1.059   6.856   176.179 1.00 122.03 ? 97  LEU A CA  1 
ATOM   76   C C   . LEU A 1 14  ? 1.726   8.132   175.678 1.00 118.49 ? 97  LEU A C   1 
ATOM   77   O O   . LEU A 1 14  ? 1.894   9.076   176.448 1.00 108.95 ? 97  LEU A O   1 
ATOM   78   C CB  . LEU A 1 14  ? -0.410  7.104   176.427 1.00 129.85 ? 97  LEU A CB  1 
ATOM   79   C CG  . LEU A 1 14  ? -1.411  6.048   175.986 1.00 141.41 ? 97  LEU A CG  1 
ATOM   80   C CD1 . LEU A 1 14  ? -1.495  4.815   176.894 1.00 144.83 ? 97  LEU A CD1 1 
ATOM   81   C CD2 . LEU A 1 14  ? -2.749  6.757   175.932 1.00 143.28 ? 97  LEU A CD2 1 
ATOM   82   N N   . PRO A 1 15  ? 2.093   8.182   174.390 1.00 125.03 ? 98  PRO A N   1 
ATOM   83   C CA  . PRO A 1 15  ? 2.894   9.330   173.864 1.00 130.08 ? 98  PRO A CA  1 
ATOM   84   C C   . PRO A 1 15  ? 2.338   10.787  174.026 1.00 131.87 ? 98  PRO A C   1 
ATOM   85   O O   . PRO A 1 15  ? 1.154   10.997  174.306 1.00 135.84 ? 98  PRO A O   1 
ATOM   86   C CB  . PRO A 1 15  ? 3.085   8.984   172.370 1.00 131.59 ? 98  PRO A CB  1 
ATOM   87   C CG  . PRO A 1 15  ? 2.112   7.882   172.065 1.00 133.84 ? 98  PRO A CG  1 
ATOM   88   C CD  . PRO A 1 15  ? 1.765   7.188   173.350 1.00 128.09 ? 98  PRO A CD  1 
ATOM   89   N N   . LEU A 1 16  ? 3.222   11.766  173.845 1.00 134.76 ? 99  LEU A N   1 
ATOM   90   C CA  . LEU A 1 16  ? 2.880   13.193  173.844 1.00 135.35 ? 99  LEU A CA  1 
ATOM   91   C C   . LEU A 1 16  ? 3.829   13.901  172.870 1.00 141.42 ? 99  LEU A C   1 
ATOM   92   O O   . LEU A 1 16  ? 4.778   14.545  173.307 1.00 145.91 ? 99  LEU A O   1 
ATOM   93   C CB  . LEU A 1 16  ? 3.024   13.779  175.247 1.00 131.34 ? 99  LEU A CB  1 
ATOM   94   C CG  . LEU A 1 16  ? 1.795   13.698  176.138 1.00 144.00 ? 99  LEU A CG  1 
ATOM   95   C CD1 . LEU A 1 16  ? 2.179   14.036  177.569 1.00 151.93 ? 99  LEU A CD1 1 
ATOM   96   C CD2 . LEU A 1 16  ? 0.696   14.630  175.658 1.00 146.74 ? 99  LEU A CD2 1 
ATOM   97   N N   . ALA A 1 17  ? 3.568   13.737  171.561 1.00 149.01 ? 100 ALA A N   1 
ATOM   98   C CA  . ALA A 1 17  ? 4.362   14.311  170.427 1.00 146.00 ? 100 ALA A CA  1 
ATOM   99   C C   . ALA A 1 17  ? 5.166   15.624  170.695 1.00 145.32 ? 100 ALA A C   1 
ATOM   100  O O   . ALA A 1 17  ? 6.395   15.616  170.609 1.00 136.58 ? 100 ALA A O   1 
ATOM   101  C CB  . ALA A 1 17  ? 3.460   14.479  169.202 1.00 143.08 ? 100 ALA A CB  1 
ATOM   102  N N   . GLU A 1 18  ? 4.484   16.729  171.015 1.00 145.41 ? 101 GLU A N   1 
ATOM   103  C CA  . GLU A 1 18  ? 5.147   17.998  171.407 1.00 148.83 ? 101 GLU A CA  1 
ATOM   104  C C   . GLU A 1 18  ? 6.237   17.789  172.484 1.00 146.89 ? 101 GLU A C   1 
ATOM   105  O O   . GLU A 1 18  ? 7.335   18.347  172.372 1.00 148.08 ? 101 GLU A O   1 
ATOM   106  C CB  . GLU A 1 18  ? 4.099   19.011  171.917 1.00 153.54 ? 101 GLU A CB  1 
ATOM   107  C CG  . GLU A 1 18  ? 4.617   20.417  172.241 1.00 155.78 ? 101 GLU A CG  1 
ATOM   108  C CD  . GLU A 1 18  ? 3.909   21.058  173.433 1.00 158.62 ? 101 GLU A CD  1 
ATOM   109  O OE1 . GLU A 1 18  ? 4.092   20.568  174.572 1.00 155.84 ? 101 GLU A OE1 1 
ATOM   110  O OE2 . GLU A 1 18  ? 3.183   22.062  173.238 1.00 162.80 ? 101 GLU A OE2 1 
ATOM   111  N N   . ARG A 1 19  ? 5.916   16.978  173.503 1.00 147.99 ? 102 ARG A N   1 
ATOM   112  C CA  . ARG A 1 19  ? 6.795   16.710  174.665 1.00 137.32 ? 102 ARG A CA  1 
ATOM   113  C C   . ARG A 1 19  ? 7.881   15.649  174.430 1.00 135.02 ? 102 ARG A C   1 
ATOM   114  O O   . ARG A 1 19  ? 7.583   14.507  174.049 1.00 122.54 ? 102 ARG A O   1 
ATOM   115  C CB  . ARG A 1 19  ? 5.969   16.292  175.885 1.00 137.32 ? 102 ARG A CB  1 
ATOM   116  C CG  . ARG A 1 19  ? 5.043   17.359  176.458 1.00 141.91 ? 102 ARG A CG  1 
ATOM   117  C CD  . ARG A 1 19  ? 5.765   18.647  176.843 1.00 142.53 ? 102 ARG A CD  1 
ATOM   118  N NE  . ARG A 1 19  ? 7.039   18.387  177.530 1.00 148.31 ? 102 ARG A NE  1 
ATOM   119  C CZ  . ARG A 1 19  ? 8.265   18.743  177.112 1.00 150.35 ? 102 ARG A CZ  1 
ATOM   120  N NH1 . ARG A 1 19  ? 8.470   19.426  175.977 1.00 154.00 ? 102 ARG A NH1 1 
ATOM   121  N NH2 . ARG A 1 19  ? 9.322   18.412  177.855 1.00 144.63 ? 102 ARG A NH2 1 
ATOM   122  N N   . GLU A 1 20  ? 9.127   16.030  174.729 1.00 138.51 ? 103 GLU A N   1 
ATOM   123  C CA  . GLU A 1 20  ? 10.324  15.272  174.326 1.00 148.62 ? 103 GLU A CA  1 
ATOM   124  C C   . GLU A 1 20  ? 10.380  13.847  174.913 1.00 144.71 ? 103 GLU A C   1 
ATOM   125  O O   . GLU A 1 20  ? 10.160  12.867  174.187 1.00 155.27 ? 103 GLU A O   1 
ATOM   126  C CB  . GLU A 1 20  ? 11.611  16.080  174.642 1.00 157.23 ? 103 GLU A CB  1 
ATOM   127  C CG  . GLU A 1 20  ? 12.981  15.326  174.394 1.00 164.45 ? 103 GLU A CG  1 
ATOM   128  C CD  . GLU A 1 20  ? 13.482  15.336  172.946 1.00 165.12 ? 103 GLU A CD  1 
ATOM   129  O OE1 . GLU A 1 20  ? 13.182  16.288  172.190 1.00 168.66 ? 103 GLU A OE1 1 
ATOM   130  O OE2 . GLU A 1 20  ? 14.217  14.387  172.569 1.00 159.04 ? 103 GLU A OE2 1 
ATOM   131  N N   . HIS A 1 21  ? 10.693  13.744  176.204 1.00 130.15 ? 104 HIS A N   1 
ATOM   132  C CA  . HIS A 1 21  ? 10.727  12.464  176.910 1.00 126.88 ? 104 HIS A CA  1 
ATOM   133  C C   . HIS A 1 21  ? 9.593   12.389  177.938 1.00 120.05 ? 104 HIS A C   1 
ATOM   134  O O   . HIS A 1 21  ? 9.611   11.508  178.806 1.00 112.73 ? 104 HIS A O   1 
ATOM   135  C CB  . HIS A 1 21  ? 12.088  12.270  177.607 1.00 131.61 ? 104 HIS A CB  1 
ATOM   136  C CG  . HIS A 1 21  ? 13.228  12.001  176.675 1.00 138.14 ? 104 HIS A CG  1 
ATOM   137  N ND1 . HIS A 1 21  ? 13.317  10.849  175.918 1.00 144.72 ? 104 HIS A ND1 1 
ATOM   138  C CD2 . HIS A 1 21  ? 14.346  12.717  176.406 1.00 139.21 ? 104 HIS A CD2 1 
ATOM   139  C CE1 . HIS A 1 21  ? 14.429  10.879  175.206 1.00 149.72 ? 104 HIS A CE1 1 
ATOM   140  N NE2 . HIS A 1 21  ? 15.071  12.003  175.482 1.00 150.33 ? 104 HIS A NE2 1 
ATOM   141  N N   . VAL A 1 22  ? 8.637   13.329  177.873 1.00 115.05 ? 105 VAL A N   1 
ATOM   142  C CA  . VAL A 1 22  ? 7.394   13.210  178.651 1.00 108.87 ? 105 VAL A CA  1 
ATOM   143  C C   . VAL A 1 22  ? 6.371   12.439  177.849 1.00 108.67 ? 105 VAL A C   1 
ATOM   144  O O   . VAL A 1 22  ? 6.250   12.597  176.615 1.00 103.83 ? 105 VAL A O   1 
ATOM   145  C CB  . VAL A 1 22  ? 6.740   14.546  179.061 1.00 104.28 ? 105 VAL A CB  1 
ATOM   146  C CG1 . VAL A 1 22  ? 5.586   14.287  180.037 1.00 98.95  ? 105 VAL A CG1 1 
ATOM   147  C CG2 . VAL A 1 22  ? 7.777   15.497  179.655 1.00 102.56 ? 105 VAL A CG2 1 
ATOM   148  N N   . SER A 1 23  ? 5.662   11.587  178.577 1.00 108.00 ? 106 SER A N   1 
ATOM   149  C CA  . SER A 1 23  ? 4.553   10.845  178.051 1.00 110.57 ? 106 SER A CA  1 
ATOM   150  C C   . SER A 1 23  ? 3.488   10.884  179.138 1.00 113.65 ? 106 SER A C   1 
ATOM   151  O O   . SER A 1 23  ? 3.797   11.131  180.300 1.00 109.80 ? 106 SER A O   1 
ATOM   152  C CB  . SER A 1 23  ? 4.999   9.419   177.699 1.00 109.49 ? 106 SER A CB  1 
ATOM   153  O OG  . SER A 1 23  ? 4.958   8.569   178.824 1.00 110.11 ? 106 SER A OG  1 
ATOM   154  N N   . ARG A 1 24  ? 2.235   10.679  178.749 1.00 125.04 ? 107 ARG A N   1 
ATOM   155  C CA  . ARG A 1 24  ? 1.146   10.541  179.716 1.00 131.77 ? 107 ARG A CA  1 
ATOM   156  C C   . ARG A 1 24  ? 1.102   9.112   180.303 1.00 116.95 ? 107 ARG A C   1 
ATOM   157  O O   . ARG A 1 24  ? 1.279   8.129   179.596 1.00 103.67 ? 107 ARG A O   1 
ATOM   158  C CB  . ARG A 1 24  ? -0.200  10.929  179.080 1.00 151.32 ? 107 ARG A CB  1 
ATOM   159  C CG  . ARG A 1 24  ? -0.781  9.903   178.107 1.00 167.33 ? 107 ARG A CG  1 
ATOM   160  C CD  . ARG A 1 24  ? -2.110  10.351  177.544 1.00 175.08 ? 107 ARG A CD  1 
ATOM   161  N NE  . ARG A 1 24  ? -1.943  11.495  176.654 1.00 175.66 ? 107 ARG A NE  1 
ATOM   162  C CZ  . ARG A 1 24  ? -2.777  12.525  176.550 1.00 185.81 ? 107 ARG A CZ  1 
ATOM   163  N NH1 . ARG A 1 24  ? -3.879  12.613  177.291 1.00 188.75 ? 107 ARG A NH1 1 
ATOM   164  N NH2 . ARG A 1 24  ? -2.494  13.500  175.689 1.00 194.49 ? 107 ARG A NH2 1 
ATOM   165  N N   . ALA A 1 25  ? 0.852   9.027   181.599 1.00 112.77 ? 108 ALA A N   1 
ATOM   166  C CA  . ALA A 1 25  ? 0.728   7.761   182.284 1.00 113.78 ? 108 ALA A CA  1 
ATOM   167  C C   . ALA A 1 25  ? -0.682  7.666   182.803 1.00 115.40 ? 108 ALA A C   1 
ATOM   168  O O   . ALA A 1 25  ? -1.275  8.668   183.182 1.00 113.46 ? 108 ALA A O   1 
ATOM   169  C CB  . ALA A 1 25  ? 1.711   7.676   183.430 1.00 115.57 ? 108 ALA A CB  1 
ATOM   170  N N   . LEU A 1 26  ? -1.204  6.447   182.857 1.00 121.34 ? 109 LEU A N   1 
ATOM   171  C CA  . LEU A 1 26  ? -2.578  6.197   183.294 1.00 118.25 ? 109 LEU A CA  1 
ATOM   172  C C   . LEU A 1 26  ? -2.630  5.004   184.214 1.00 118.47 ? 109 LEU A C   1 
ATOM   173  O O   . LEU A 1 26  ? -2.192  3.926   183.843 1.00 114.92 ? 109 LEU A O   1 
ATOM   174  C CB  . LEU A 1 26  ? -3.493  5.929   182.090 1.00 121.81 ? 109 LEU A CB  1 
ATOM   175  C CG  . LEU A 1 26  ? -4.174  7.042   181.307 1.00 122.95 ? 109 LEU A CG  1 
ATOM   176  C CD1 . LEU A 1 26  ? -5.140  6.508   180.280 1.00 121.71 ? 109 LEU A CD1 1 
ATOM   177  C CD2 . LEU A 1 26  ? -4.905  7.949   182.252 1.00 123.78 ? 109 LEU A CD2 1 
ATOM   178  N N   . CYS A 1 27  ? -3.234  5.187   185.383 1.00 123.23 ? 110 CYS A N   1 
ATOM   179  C CA  . CYS A 1 27  ? -3.421  4.102   186.318 1.00 128.66 ? 110 CYS A CA  1 
ATOM   180  C C   . CYS A 1 27  ? -4.368  3.080   185.746 1.00 134.07 ? 110 CYS A C   1 
ATOM   181  O O   . CYS A 1 27  ? -5.381  3.433   185.144 1.00 138.03 ? 110 CYS A O   1 
ATOM   182  C CB  . CYS A 1 27  ? -3.963  4.590   187.655 1.00 130.20 ? 110 CYS A CB  1 
ATOM   183  S SG  . CYS A 1 27  ? -3.608  3.416   188.988 1.00 143.35 ? 110 CYS A SG  1 
ATOM   184  N N   . ILE A 1 28  ? -4.040  1.809   185.939 1.00 136.94 ? 111 ILE A N   1 
ATOM   185  C CA  . ILE A 1 28  ? -4.946  0.732   185.547 1.00 139.13 ? 111 ILE A CA  1 
ATOM   186  C C   . ILE A 1 28  ? -5.966  0.497   186.682 1.00 141.51 ? 111 ILE A C   1 
ATOM   187  O O   . ILE A 1 28  ? -7.084  0.051   186.413 1.00 139.47 ? 111 ILE A O   1 
ATOM   188  C CB  . ILE A 1 28  ? -4.147  -0.519  185.109 1.00 139.81 ? 111 ILE A CB  1 
ATOM   189  C CG1 . ILE A 1 28  ? -3.125  -0.089  184.023 1.00 134.49 ? 111 ILE A CG1 1 
ATOM   190  C CG2 . ILE A 1 28  ? -5.090  -1.625  184.630 1.00 143.03 ? 111 ILE A CG2 1 
ATOM   191  C CD1 . ILE A 1 28  ? -2.247  -1.172  183.434 1.00 133.96 ? 111 ILE A CD1 1 
ATOM   192  N N   . HIS A 1 29  ? -5.589  0.854   187.924 1.00 147.07 ? 112 HIS A N   1 
ATOM   193  C CA  . HIS A 1 29  ? -6.467  0.745   189.123 1.00 153.02 ? 112 HIS A CA  1 
ATOM   194  C C   . HIS A 1 29  ? -7.555  1.834   189.214 1.00 150.61 ? 112 HIS A C   1 
ATOM   195  O O   . HIS A 1 29  ? -8.735  1.566   188.931 1.00 156.08 ? 112 HIS A O   1 
ATOM   196  C CB  . HIS A 1 29  ? -5.618  0.696   190.412 1.00 148.61 ? 112 HIS A CB  1 
ATOM   197  C CG  . HIS A 1 29  ? -4.908  -0.604  190.590 1.00 147.01 ? 112 HIS A CG  1 
ATOM   198  N ND1 . HIS A 1 29  ? -4.948  -1.321  191.764 1.00 147.18 ? 112 HIS A ND1 1 
ATOM   199  C CD2 . HIS A 1 29  ? -4.194  -1.348  189.716 1.00 143.23 ? 112 HIS A CD2 1 
ATOM   200  C CE1 . HIS A 1 29  ? -4.254  -2.434  191.621 1.00 144.47 ? 112 HIS A CE1 1 
ATOM   201  N NE2 . HIS A 1 29  ? -3.790  -2.476  190.386 1.00 143.56 ? 112 HIS A NE2 1 
ATOM   202  N N   . THR A 1 30  ? -7.159  3.043   189.613 1.00 142.26 ? 113 THR A N   1 
ATOM   203  C CA  . THR A 1 30  ? -7.981  4.235   189.446 1.00 140.64 ? 113 THR A CA  1 
ATOM   204  C C   . THR A 1 30  ? -8.072  4.543   187.954 1.00 143.00 ? 113 THR A C   1 
ATOM   205  O O   . THR A 1 30  ? -7.494  3.833   187.131 1.00 151.09 ? 113 THR A O   1 
ATOM   206  C CB  . THR A 1 30  ? -7.358  5.448   190.165 1.00 137.39 ? 113 THR A CB  1 
ATOM   207  O OG1 . THR A 1 30  ? -6.018  5.662   189.692 1.00 124.64 ? 113 THR A OG1 1 
ATOM   208  C CG2 . THR A 1 30  ? -7.359  5.219   191.667 1.00 142.84 ? 113 THR A CG2 1 
ATOM   209  N N   . GLY A 1 31  ? -8.761  5.617   187.598 1.00 144.16 ? 114 GLY A N   1 
ATOM   210  C CA  . GLY A 1 31  ? -8.731  6.120   186.220 1.00 142.79 ? 114 GLY A CA  1 
ATOM   211  C C   . GLY A 1 31  ? -7.712  7.233   186.024 1.00 136.69 ? 114 GLY A C   1 
ATOM   212  O O   . GLY A 1 31  ? -7.793  7.988   185.051 1.00 129.61 ? 114 GLY A O   1 
ATOM   213  N N   . ARG A 1 32  ? -6.725  7.295   186.919 1.00 136.33 ? 115 ARG A N   1 
ATOM   214  C CA  . ARG A 1 32  ? -5.963  8.524   187.169 1.00 137.95 ? 115 ARG A CA  1 
ATOM   215  C C   . ARG A 1 32  ? -4.927  8.792   186.070 1.00 136.65 ? 115 ARG A C   1 
ATOM   216  O O   . ARG A 1 32  ? -4.164  7.889   185.714 1.00 139.69 ? 115 ARG A O   1 
ATOM   217  C CB  . ARG A 1 32  ? -5.285  8.403   188.537 1.00 139.20 ? 115 ARG A CB  1 
ATOM   218  C CG  . ARG A 1 32  ? -4.639  9.652   189.098 1.00 137.54 ? 115 ARG A CG  1 
ATOM   219  C CD  . ARG A 1 32  ? -3.925  9.320   190.411 1.00 141.02 ? 115 ARG A CD  1 
ATOM   220  N NE  . ARG A 1 32  ? -3.044  10.400  190.880 1.00 136.98 ? 115 ARG A NE  1 
ATOM   221  C CZ  . ARG A 1 32  ? -2.180  10.324  191.903 1.00 129.81 ? 115 ARG A CZ  1 
ATOM   222  N NH1 . ARG A 1 32  ? -2.035  9.210   192.620 1.00 126.88 ? 115 ARG A NH1 1 
ATOM   223  N NH2 . ARG A 1 32  ? -1.440  11.386  192.209 1.00 128.34 ? 115 ARG A NH2 1 
ATOM   224  N N   . GLU A 1 33  ? -4.938  10.008  185.518 1.00 138.08 ? 116 GLU A N   1 
ATOM   225  C CA  . GLU A 1 33  ? -3.986  10.418  184.473 1.00 135.57 ? 116 GLU A CA  1 
ATOM   226  C C   . GLU A 1 33  ? -2.853  11.317  185.005 1.00 130.12 ? 116 GLU A C   1 
ATOM   227  O O   . GLU A 1 33  ? -3.084  12.482  185.351 1.00 117.55 ? 116 GLU A O   1 
ATOM   228  C CB  . GLU A 1 33  ? -4.704  11.105  183.299 1.00 136.88 ? 116 GLU A CB  1 
ATOM   229  C CG  . GLU A 1 33  ? -3.864  11.119  182.014 1.00 140.01 ? 116 GLU A CG  1 
ATOM   230  C CD  . GLU A 1 33  ? -4.297  12.147  180.977 1.00 132.59 ? 116 GLU A CD  1 
ATOM   231  O OE1 . GLU A 1 33  ? -4.878  13.165  181.370 1.00 134.39 ? 116 GLU A OE1 1 
ATOM   232  O OE2 . GLU A 1 33  ? -4.013  11.960  179.770 1.00 117.51 ? 116 GLU A OE2 1 
ATOM   233  N N   . LEU A 1 34  ? -1.637  10.748  185.031 1.00 124.91 ? 117 LEU A N   1 
ATOM   234  C CA  . LEU A 1 34  ? -0.397  11.429  185.427 1.00 118.12 ? 117 LEU A CA  1 
ATOM   235  C C   . LEU A 1 34  ? 0.406   11.867  184.181 1.00 109.38 ? 117 LEU A C   1 
ATOM   236  O O   . LEU A 1 34  ? 0.153   11.395  183.072 1.00 99.79  ? 117 LEU A O   1 
ATOM   237  C CB  . LEU A 1 34  ? 0.486   10.484  186.280 1.00 117.45 ? 117 LEU A CB  1 
ATOM   238  C CG  . LEU A 1 34  ? 0.102   10.099  187.715 1.00 117.34 ? 117 LEU A CG  1 
ATOM   239  C CD1 . LEU A 1 34  ? 0.085   11.326  188.617 1.00 117.15 ? 117 LEU A CD1 1 
ATOM   240  C CD2 . LEU A 1 34  ? -1.235  9.394   187.767 1.00 116.95 ? 117 LEU A CD2 1 
ATOM   241  N N   . ARG A 1 35  ? 1.365   12.774  184.368 1.00 102.68 ? 118 ARG A N   1 
ATOM   242  C CA  . ARG A 1 35  ? 2.476   12.912  183.429 1.00 105.72 ? 118 ARG A CA  1 
ATOM   243  C C   . ARG A 1 35  ? 3.717   12.172  183.982 1.00 101.90 ? 118 ARG A C   1 
ATOM   244  O O   . ARG A 1 35  ? 3.877   12.013  185.191 1.00 98.57  ? 118 ARG A O   1 
ATOM   245  C CB  . ARG A 1 35  ? 2.784   14.385  183.132 1.00 112.28 ? 118 ARG A CB  1 
ATOM   246  C CG  . ARG A 1 35  ? 1.728   15.133  182.321 1.00 120.09 ? 118 ARG A CG  1 
ATOM   247  C CD  . ARG A 1 35  ? 1.535   14.580  180.907 1.00 130.63 ? 118 ARG A CD  1 
ATOM   248  N NE  . ARG A 1 35  ? 0.196   14.795  180.326 1.00 133.09 ? 118 ARG A NE  1 
ATOM   249  C CZ  . ARG A 1 35  ? -0.934  14.222  180.747 1.00 138.57 ? 118 ARG A CZ  1 
ATOM   250  N NH1 . ARG A 1 35  ? -0.953  13.426  181.811 1.00 140.11 ? 118 ARG A NH1 1 
ATOM   251  N NH2 . ARG A 1 35  ? -2.072  14.471  180.125 1.00 141.89 ? 118 ARG A NH2 1 
ATOM   252  N N   . CYS A 1 36  ? 4.573   11.713  183.073 1.00 103.82 ? 119 CYS A N   1 
ATOM   253  C CA  . CYS A 1 36  ? 5.730   10.873  183.400 1.00 105.34 ? 119 CYS A CA  1 
ATOM   254  C C   . CYS A 1 36  ? 6.948   11.290  182.556 1.00 106.48 ? 119 CYS A C   1 
ATOM   255  O O   . CYS A 1 36  ? 6.933   11.129  181.328 1.00 105.50 ? 119 CYS A O   1 
ATOM   256  C CB  . CYS A 1 36  ? 5.389   9.406   183.140 1.00 106.23 ? 119 CYS A CB  1 
ATOM   257  S SG  . CYS A 1 36  ? 6.702   8.228   183.542 1.00 104.55 ? 119 CYS A SG  1 
ATOM   258  N N   . LYS A 1 37  ? 7.979   11.833  183.219 1.00 104.15 ? 120 LYS A N   1 
ATOM   259  C CA  . LYS A 1 37  ? 9.283   12.114  182.589 1.00 98.93  ? 120 LYS A CA  1 
ATOM   260  C C   . LYS A 1 37  ? 10.163  10.881  182.718 1.00 95.51  ? 120 LYS A C   1 
ATOM   261  O O   . LYS A 1 37  ? 10.259  10.302  183.807 1.00 101.79 ? 120 LYS A O   1 
ATOM   262  C CB  . LYS A 1 37  ? 9.983   13.292  183.255 1.00 98.22  ? 120 LYS A CB  1 
ATOM   263  C CG  . LYS A 1 37  ? 9.102   14.521  183.382 1.00 105.49 ? 120 LYS A CG  1 
ATOM   264  C CD  . LYS A 1 37  ? 9.885   15.819  183.530 1.00 112.36 ? 120 LYS A CD  1 
ATOM   265  C CE  . LYS A 1 37  ? 8.961   16.971  183.969 1.00 118.77 ? 120 LYS A CE  1 
ATOM   266  N NZ  . LYS A 1 37  ? 9.544   18.323  183.755 1.00 121.99 ? 120 LYS A NZ  1 
ATOM   267  N N   . VAL A 1 38  ? 10.771  10.450  181.614 1.00 91.13  ? 121 VAL A N   1 
ATOM   268  C CA  . VAL A 1 38  ? 11.727  9.354   181.660 1.00 90.97  ? 121 VAL A CA  1 
ATOM   269  C C   . VAL A 1 38  ? 13.138  9.898   181.575 1.00 90.54  ? 121 VAL A C   1 
ATOM   270  O O   . VAL A 1 38  ? 13.423  10.759  180.760 1.00 91.16  ? 121 VAL A O   1 
ATOM   271  C CB  . VAL A 1 38  ? 11.529  8.300   180.555 1.00 93.47  ? 121 VAL A CB  1 
ATOM   272  C CG1 . VAL A 1 38  ? 12.208  7.002   180.958 1.00 96.06  ? 121 VAL A CG1 1 
ATOM   273  C CG2 . VAL A 1 38  ? 10.060  8.020   180.302 1.00 95.03  ? 121 VAL A CG2 1 
ATOM   274  N N   . PHE A 1 39  ? 14.010  9.420   182.460 1.00 94.17  ? 122 PHE A N   1 
ATOM   275  C CA  . PHE A 1 39  ? 15.452  9.657   182.350 1.00 91.76  ? 122 PHE A CA  1 
ATOM   276  C C   . PHE A 1 39  ? 16.216  8.347   182.321 1.00 94.26  ? 122 PHE A C   1 
ATOM   277  O O   . PHE A 1 39  ? 15.686  7.305   182.731 1.00 95.64  ? 122 PHE A O   1 
ATOM   278  C CB  . PHE A 1 39  ? 15.952  10.464  183.533 1.00 87.24  ? 122 PHE A CB  1 
ATOM   279  C CG  . PHE A 1 39  ? 15.163  11.686  183.814 1.00 85.15  ? 122 PHE A CG  1 
ATOM   280  C CD1 . PHE A 1 39  ? 15.419  12.840  183.128 1.00 87.33  ? 122 PHE A CD1 1 
ATOM   281  C CD2 . PHE A 1 39  ? 14.160  11.682  184.778 1.00 86.51  ? 122 PHE A CD2 1 
ATOM   282  C CE1 . PHE A 1 39  ? 14.693  13.996  183.381 1.00 89.69  ? 122 PHE A CE1 1 
ATOM   283  C CE2 . PHE A 1 39  ? 13.438  12.830  185.052 1.00 90.16  ? 122 PHE A CE2 1 
ATOM   284  C CZ  . PHE A 1 39  ? 13.713  14.000  184.353 1.00 89.72  ? 122 PHE A CZ  1 
ATOM   285  N N   . PRO A 1 40  ? 17.472  8.393   181.848 1.00 97.54  ? 123 PRO A N   1 
ATOM   286  C CA  . PRO A 1 40  ? 18.382  7.246   182.047 1.00 103.17 ? 123 PRO A CA  1 
ATOM   287  C C   . PRO A 1 40  ? 18.808  7.205   183.504 1.00 103.82 ? 123 PRO A C   1 
ATOM   288  O O   . PRO A 1 40  ? 19.133  8.274   184.036 1.00 97.58  ? 123 PRO A O   1 
ATOM   289  C CB  . PRO A 1 40  ? 19.562  7.594   181.148 1.00 103.91 ? 123 PRO A CB  1 
ATOM   290  C CG  . PRO A 1 40  ? 19.530  9.089   181.043 1.00 97.15  ? 123 PRO A CG  1 
ATOM   291  C CD  . PRO A 1 40  ? 18.098  9.464   181.054 1.00 92.54  ? 123 PRO A CD  1 
ATOM   292  N N   . ILE A 1 41  ? 18.789  6.023   184.147 1.00 104.84 ? 124 ILE A N   1 
ATOM   293  C CA  . ILE A 1 41  ? 18.982  5.942   185.617 1.00 102.96 ? 124 ILE A CA  1 
ATOM   294  C C   . ILE A 1 41  ? 20.205  6.712   186.060 1.00 104.98 ? 124 ILE A C   1 
ATOM   295  O O   . ILE A 1 41  ? 20.146  7.417   187.063 1.00 102.42 ? 124 ILE A O   1 
ATOM   296  C CB  . ILE A 1 41  ? 19.011  4.520   186.247 1.00 105.04 ? 124 ILE A CB  1 
ATOM   297  C CG1 . ILE A 1 41  ? 20.220  3.704   185.822 1.00 110.19 ? 124 ILE A CG1 1 
ATOM   298  C CG2 . ILE A 1 41  ? 17.735  3.731   186.028 1.00 108.68 ? 124 ILE A CG2 1 
ATOM   299  C CD1 . ILE A 1 41  ? 20.240  3.261   184.391 1.00 111.07 ? 124 ILE A CD1 1 
ATOM   300  N N   . LYS A 1 42  ? 21.286  6.614   185.284 1.00 108.74 ? 125 LYS A N   1 
ATOM   301  C CA  . LYS A 1 42  ? 22.537  7.289   185.605 1.00 113.82 ? 125 LYS A CA  1 
ATOM   302  C C   . LYS A 1 42  ? 22.430  8.776   185.869 1.00 109.93 ? 125 LYS A C   1 
ATOM   303  O O   . LYS A 1 42  ? 23.185  9.283   186.681 1.00 113.70 ? 125 LYS A O   1 
ATOM   304  C CB  . LYS A 1 42  ? 23.572  7.054   184.507 1.00 122.64 ? 125 LYS A CB  1 
ATOM   305  C CG  . LYS A 1 42  ? 24.128  5.643   184.547 1.00 131.02 ? 125 LYS A CG  1 
ATOM   306  C CD  . LYS A 1 42  ? 25.178  5.478   185.631 1.00 134.58 ? 125 LYS A CD  1 
ATOM   307  C CE  . LYS A 1 42  ? 25.384  4.019   185.981 1.00 144.12 ? 125 LYS A CE  1 
ATOM   308  N NZ  . LYS A 1 42  ? 25.623  3.162   184.790 1.00 153.12 ? 125 LYS A NZ  1 
ATOM   309  N N   . HIS A 1 43  ? 21.532  9.478   185.185 1.00 109.14 ? 126 HIS A N   1 
ATOM   310  C CA  . HIS A 1 43  ? 21.424  10.917  185.357 1.00 107.36 ? 126 HIS A CA  1 
ATOM   311  C C   . HIS A 1 43  ? 20.112  11.392  185.986 1.00 98.66  ? 126 HIS A C   1 
ATOM   312  O O   . HIS A 1 43  ? 19.925  12.583  186.167 1.00 90.10  ? 126 HIS A O   1 
ATOM   313  C CB  . HIS A 1 43  ? 21.672  11.633  184.033 1.00 114.10 ? 126 HIS A CB  1 
ATOM   314  C CG  . HIS A 1 43  ? 23.033  11.408  183.454 1.00 124.59 ? 126 HIS A CG  1 
ATOM   315  N ND1 . HIS A 1 43  ? 23.390  11.909  182.219 1.00 132.21 ? 126 HIS A ND1 1 
ATOM   316  C CD2 . HIS A 1 43  ? 24.119  10.742  183.920 1.00 129.35 ? 126 HIS A CD2 1 
ATOM   317  C CE1 . HIS A 1 43  ? 24.638  11.567  181.952 1.00 136.84 ? 126 HIS A CE1 1 
ATOM   318  N NE2 . HIS A 1 43  ? 25.100  10.854  182.965 1.00 137.65 ? 126 HIS A NE2 1 
ATOM   319  N N   . TYR A 1 44  ? 19.241  10.475  186.396 1.00 98.99  ? 127 TYR A N   1 
ATOM   320  C CA  . TYR A 1 44  ? 17.973  10.858  187.048 1.00 93.87  ? 127 TYR A CA  1 
ATOM   321  C C   . TYR A 1 44  ? 18.185  11.667  188.331 1.00 92.05  ? 127 TYR A C   1 
ATOM   322  O O   . TYR A 1 44  ? 17.467  12.601  188.577 1.00 87.00  ? 127 TYR A O   1 
ATOM   323  C CB  . TYR A 1 44  ? 17.016  9.631   187.258 1.00 93.91  ? 127 TYR A CB  1 
ATOM   324  C CG  . TYR A 1 44  ? 16.839  9.108   188.676 1.00 94.76  ? 127 TYR A CG  1 
ATOM   325  C CD1 . TYR A 1 44  ? 16.088  9.831   189.590 1.00 92.69  ? 127 TYR A CD1 1 
ATOM   326  C CD2 . TYR A 1 44  ? 17.371  7.861   189.082 1.00 92.37  ? 127 TYR A CD2 1 
ATOM   327  C CE1 . TYR A 1 44  ? 15.904  9.380   190.873 1.00 95.61  ? 127 TYR A CE1 1 
ATOM   328  C CE2 . TYR A 1 44  ? 17.178  7.387   190.373 1.00 94.37  ? 127 TYR A CE2 1 
ATOM   329  C CZ  . TYR A 1 44  ? 16.441  8.161   191.274 1.00 99.46  ? 127 TYR A CZ  1 
ATOM   330  O OH  . TYR A 1 44  ? 16.198  7.781   192.588 1.00 102.78 ? 127 TYR A OH  1 
ATOM   331  N N   . GLN A 1 45  ? 19.176  11.314  189.143 1.00 105.27 ? 128 GLN A N   1 
ATOM   332  C CA  . GLN A 1 45  ? 19.245  11.849  190.505 1.00 104.00 ? 128 GLN A CA  1 
ATOM   333  C C   . GLN A 1 45  ? 19.500  13.324  190.569 1.00 100.38 ? 128 GLN A C   1 
ATOM   334  O O   . GLN A 1 45  ? 18.893  13.982  191.389 1.00 93.22  ? 128 GLN A O   1 
ATOM   335  C CB  . GLN A 1 45  ? 20.254  11.102  191.358 1.00 104.39 ? 128 GLN A CB  1 
ATOM   336  C CG  . GLN A 1 45  ? 19.816  9.681   191.648 1.00 111.08 ? 128 GLN A CG  1 
ATOM   337  C CD  . GLN A 1 45  ? 20.122  9.305   193.089 1.00 109.98 ? 128 GLN A CD  1 
ATOM   338  O OE1 . GLN A 1 45  ? 19.213  9.194   193.933 1.00 103.75 ? 128 GLN A OE1 1 
ATOM   339  N NE2 . GLN A 1 45  ? 21.396  9.185   193.391 1.00 106.47 ? 128 GLN A NE2 1 
ATOM   340  N N   . ASP A 1 46  ? 20.362  13.849  189.705 1.00 105.18 ? 129 ASP A N   1 
ATOM   341  C CA  . ASP A 1 46  ? 20.611  15.300  189.689 1.00 108.95 ? 129 ASP A CA  1 
ATOM   342  C C   . ASP A 1 46  ? 19.423  16.084  189.192 1.00 104.66 ? 129 ASP A C   1 
ATOM   343  O O   . ASP A 1 46  ? 19.158  17.165  189.704 1.00 103.22 ? 129 ASP A O   1 
ATOM   344  C CB  . ASP A 1 46  ? 21.864  15.665  188.900 1.00 112.12 ? 129 ASP A CB  1 
ATOM   345  C CG  . ASP A 1 46  ? 23.148  15.246  189.620 1.00 124.05 ? 129 ASP A CG  1 
ATOM   346  O OD1 . ASP A 1 46  ? 23.074  14.603  190.695 1.00 122.36 ? 129 ASP A OD1 1 
ATOM   347  O OD2 . ASP A 1 46  ? 24.241  15.564  189.113 1.00 137.53 ? 129 ASP A OD2 1 
ATOM   348  N N   . LYS A 1 47  ? 18.674  15.511  188.256 1.00 105.15 ? 130 LYS A N   1 
ATOM   349  C CA  . LYS A 1 47  ? 17.434  16.117  187.782 1.00 103.76 ? 130 LYS A CA  1 
ATOM   350  C C   . LYS A 1 47  ? 16.436  16.361  188.913 1.00 103.17 ? 130 LYS A C   1 
ATOM   351  O O   . LYS A 1 47  ? 15.843  17.420  188.994 1.00 111.40 ? 130 LYS A O   1 
ATOM   352  C CB  . LYS A 1 47  ? 16.764  15.249  186.702 1.00 113.55 ? 130 LYS A CB  1 
ATOM   353  C CG  . LYS A 1 47  ? 17.485  15.276  185.360 1.00 118.62 ? 130 LYS A CG  1 
ATOM   354  C CD  . LYS A 1 47  ? 17.184  16.560  184.588 1.00 128.69 ? 130 LYS A CD  1 
ATOM   355  C CE  . LYS A 1 47  ? 18.444  17.258  184.103 1.00 134.24 ? 130 LYS A CE  1 
ATOM   356  N NZ  . LYS A 1 47  ? 19.290  16.389  183.234 1.00 140.61 ? 130 LYS A NZ  1 
ATOM   357  N N   . ILE A 1 48  ? 16.243  15.397  189.798 1.00 100.94 ? 131 ILE A N   1 
ATOM   358  C CA  . ILE A 1 48  ? 15.225  15.565  190.818 1.00 95.04  ? 131 ILE A CA  1 
ATOM   359  C C   . ILE A 1 48  ? 15.712  16.239  192.110 1.00 92.89  ? 131 ILE A C   1 
ATOM   360  O O   . ILE A 1 48  ? 14.899  16.467  192.992 1.00 87.45  ? 131 ILE A O   1 
ATOM   361  C CB  . ILE A 1 48  ? 14.475  14.238  191.102 1.00 99.70  ? 131 ILE A CB  1 
ATOM   362  C CG1 . ILE A 1 48  ? 15.290  13.243  191.937 1.00 100.15 ? 131 ILE A CG1 1 
ATOM   363  C CG2 . ILE A 1 48  ? 14.019  13.592  189.796 1.00 99.85  ? 131 ILE A CG2 1 
ATOM   364  C CD1 . ILE A 1 48  ? 14.391  12.269  192.666 1.00 100.51 ? 131 ILE A CD1 1 
ATOM   365  N N   . ARG A 1 49  ? 17.020  16.518  192.235 1.00 93.71  ? 132 ARG A N   1 
ATOM   366  C CA  . ARG A 1 49  ? 17.611  17.145  193.445 1.00 94.01  ? 132 ARG A CA  1 
ATOM   367  C C   . ARG A 1 49  ? 16.839  18.327  193.994 1.00 90.43  ? 132 ARG A C   1 
ATOM   368  O O   . ARG A 1 49  ? 16.693  18.426  195.196 1.00 100.03 ? 132 ARG A O   1 
ATOM   369  C CB  . ARG A 1 49  ? 19.077  17.582  193.220 1.00 97.76  ? 132 ARG A CB  1 
ATOM   370  C CG  . ARG A 1 49  ? 20.123  16.513  193.471 1.00 107.44 ? 132 ARG A CG  1 
ATOM   371  C CD  . ARG A 1 49  ? 21.537  17.068  193.576 1.00 112.04 ? 132 ARG A CD  1 
ATOM   372  N NE  . ARG A 1 49  ? 21.731  17.723  194.880 1.00 122.12 ? 132 ARG A NE  1 
ATOM   373  C CZ  . ARG A 1 49  ? 22.107  18.992  195.101 1.00 129.18 ? 132 ARG A CZ  1 
ATOM   374  N NH1 . ARG A 1 49  ? 22.389  19.834  194.102 1.00 138.28 ? 132 ARG A NH1 1 
ATOM   375  N NH2 . ARG A 1 49  ? 22.225  19.432  196.357 1.00 126.50 ? 132 ARG A NH2 1 
ATOM   376  N N   . PRO A 1 50  ? 16.379  19.243  193.130 1.00 86.92  ? 133 PRO A N   1 
ATOM   377  C CA  . PRO A 1 50  ? 15.642  20.422  193.606 1.00 89.68  ? 133 PRO A CA  1 
ATOM   378  C C   . PRO A 1 50  ? 14.335  20.129  194.336 1.00 88.41  ? 133 PRO A C   1 
ATOM   379  O O   . PRO A 1 50  ? 14.041  20.759  195.351 1.00 90.11  ? 133 PRO A O   1 
ATOM   380  C CB  . PRO A 1 50  ? 15.335  21.160  192.310 1.00 90.37  ? 133 PRO A CB  1 
ATOM   381  C CG  . PRO A 1 50  ? 16.450  20.781  191.393 1.00 87.43  ? 133 PRO A CG  1 
ATOM   382  C CD  . PRO A 1 50  ? 16.615  19.328  191.679 1.00 86.20  ? 133 PRO A CD  1 
ATOM   383  N N   . TYR A 1 51  ? 13.591  19.154  193.832 1.00 88.78  ? 134 TYR A N   1 
ATOM   384  C CA  . TYR A 1 51  ? 12.364  18.673  194.477 1.00 88.70  ? 134 TYR A CA  1 
ATOM   385  C C   . TYR A 1 51  ? 12.633  18.161  195.897 1.00 96.31  ? 134 TYR A C   1 
ATOM   386  O O   . TYR A 1 51  ? 11.843  18.438  196.829 1.00 101.30 ? 134 TYR A O   1 
ATOM   387  C CB  . TYR A 1 51  ? 11.700  17.561  193.644 1.00 86.04  ? 134 TYR A CB  1 
ATOM   388  C CG  . TYR A 1 51  ? 11.319  17.989  192.246 1.00 81.34  ? 134 TYR A CG  1 
ATOM   389  C CD1 . TYR A 1 51  ? 10.115  18.630  191.997 1.00 79.56  ? 134 TYR A CD1 1 
ATOM   390  C CD2 . TYR A 1 51  ? 12.165  17.741  191.174 1.00 79.70  ? 134 TYR A CD2 1 
ATOM   391  C CE1 . TYR A 1 51  ? 9.772   19.020  190.712 1.00 79.41  ? 134 TYR A CE1 1 
ATOM   392  C CE2 . TYR A 1 51  ? 11.840  18.132  189.885 1.00 78.91  ? 134 TYR A CE2 1 
ATOM   393  C CZ  . TYR A 1 51  ? 10.634  18.781  189.647 1.00 81.27  ? 134 TYR A CZ  1 
ATOM   394  O OH  . TYR A 1 51  ? 10.300  19.182  188.349 1.00 75.53  ? 134 TYR A OH  1 
ATOM   395  N N   . ILE A 1 52  ? 13.749  17.434  196.067 1.00 96.71  ? 135 ILE A N   1 
ATOM   396  C CA  . ILE A 1 52  ? 14.137  16.930  197.387 1.00 100.62 ? 135 ILE A CA  1 
ATOM   397  C C   . ILE A 1 52  ? 14.422  18.090  198.334 1.00 99.48  ? 135 ILE A C   1 
ATOM   398  O O   . ILE A 1 52  ? 13.928  18.092  199.470 1.00 100.58 ? 135 ILE A O   1 
ATOM   399  C CB  . ILE A 1 52  ? 15.381  15.999  197.344 1.00 104.97 ? 135 ILE A CB  1 
ATOM   400  C CG1 . ILE A 1 52  ? 15.033  14.631  196.759 1.00 105.13 ? 135 ILE A CG1 1 
ATOM   401  C CG2 . ILE A 1 52  ? 15.927  15.736  198.742 1.00 110.20 ? 135 ILE A CG2 1 
ATOM   402  C CD1 . ILE A 1 52  ? 15.128  14.554  195.265 1.00 108.60 ? 135 ILE A CD1 1 
ATOM   403  N N   . GLN A 1 53  ? 15.230  19.048  197.871 1.00 96.64  ? 136 GLN A N   1 
ATOM   404  C CA  . GLN A 1 53  ? 15.717  20.135  198.712 1.00 101.18 ? 136 GLN A CA  1 
ATOM   405  C C   . GLN A 1 53  ? 14.605  21.080  199.093 1.00 100.24 ? 136 GLN A C   1 
ATOM   406  O O   . GLN A 1 53  ? 14.627  21.666  200.172 1.00 103.57 ? 136 GLN A O   1 
ATOM   407  C CB  . GLN A 1 53  ? 16.861  20.930  198.033 1.00 104.60 ? 136 GLN A CB  1 
ATOM   408  C CG  . GLN A 1 53  ? 18.187  20.182  197.749 1.00 106.35 ? 136 GLN A CG  1 
ATOM   409  C CD  . GLN A 1 53  ? 18.627  19.321  198.918 1.00 110.67 ? 136 GLN A CD  1 
ATOM   410  O OE1 . GLN A 1 53  ? 19.265  19.814  199.847 1.00 126.25 ? 136 GLN A OE1 1 
ATOM   411  N NE2 . GLN A 1 53  ? 18.297  18.030  198.878 1.00 105.87 ? 136 GLN A NE2 1 
ATOM   412  N N   . LEU A 1 54  ? 13.620  21.210  198.221 1.00 98.42  ? 137 LEU A N   1 
ATOM   413  C CA  . LEU A 1 54  ? 12.525  22.115  198.456 1.00 100.54 ? 137 LEU A CA  1 
ATOM   414  C C   . LEU A 1 54  ? 11.402  21.428  199.259 1.00 95.98  ? 137 LEU A C   1 
ATOM   415  O O   . LEU A 1 54  ? 10.928  20.367  198.869 1.00 97.56  ? 137 LEU A O   1 
ATOM   416  C CB  . LEU A 1 54  ? 12.016  22.643  197.112 1.00 101.04 ? 137 LEU A CB  1 
ATOM   417  C CG  . LEU A 1 54  ? 11.139  23.923  197.122 1.00 98.96  ? 137 LEU A CG  1 
ATOM   418  C CD1 . LEU A 1 54  ? 11.870  25.143  197.652 1.00 96.93  ? 137 LEU A CD1 1 
ATOM   419  C CD2 . LEU A 1 54  ? 10.624  24.144  195.703 1.00 97.51  ? 137 LEU A CD2 1 
ATOM   420  N N   . PRO A 1 55  ? 10.976  22.038  200.385 1.00 96.52  ? 138 PRO A N   1 
ATOM   421  C CA  . PRO A 1 55  ? 9.749   21.617  201.041 1.00 96.71  ? 138 PRO A CA  1 
ATOM   422  C C   . PRO A 1 55  ? 8.563   21.747  200.127 1.00 97.21  ? 138 PRO A C   1 
ATOM   423  O O   . PRO A 1 55  ? 8.534   22.635  199.290 1.00 102.92 ? 138 PRO A O   1 
ATOM   424  C CB  . PRO A 1 55  ? 9.583   22.619  202.189 1.00 99.63  ? 138 PRO A CB  1 
ATOM   425  C CG  . PRO A 1 55  ? 10.912  23.230  202.390 1.00 102.16 ? 138 PRO A CG  1 
ATOM   426  C CD  . PRO A 1 55  ? 11.573  23.214  201.053 1.00 101.36 ? 138 PRO A CD  1 
ATOM   427  N N   . SER A 1 56  ? 7.564   20.895  200.304 1.00 105.43 ? 139 SER A N   1 
ATOM   428  C CA  . SER A 1 56  ? 6.418   20.910  199.404 1.00 106.50 ? 139 SER A CA  1 
ATOM   429  C C   . SER A 1 56  ? 5.611   22.178  199.625 1.00 101.01 ? 139 SER A C   1 
ATOM   430  O O   . SER A 1 56  ? 5.705   22.831  200.675 1.00 100.24 ? 139 SER A O   1 
ATOM   431  C CB  . SER A 1 56  ? 5.557   19.653  199.560 1.00 108.73 ? 139 SER A CB  1 
ATOM   432  O OG  . SER A 1 56  ? 4.966   19.609  200.836 1.00 116.03 ? 139 SER A OG  1 
ATOM   433  N N   . HIS A 1 57  ? 4.850   22.532  198.601 1.00 97.56  ? 140 HIS A N   1 
ATOM   434  C CA  . HIS A 1 57  ? 4.132   23.787  198.581 1.00 97.80  ? 140 HIS A CA  1 
ATOM   435  C C   . HIS A 1 57  ? 3.037   23.696  197.524 1.00 94.96  ? 140 HIS A C   1 
ATOM   436  O O   . HIS A 1 57  ? 3.276   23.242  196.409 1.00 85.39  ? 140 HIS A O   1 
ATOM   437  C CB  . HIS A 1 57  ? 5.111   24.940  198.306 1.00 97.19  ? 140 HIS A CB  1 
ATOM   438  C CG  . HIS A 1 57  ? 4.451   26.287  198.238 1.00 98.38  ? 140 HIS A CG  1 
ATOM   439  N ND1 . HIS A 1 57  ? 4.258   27.099  199.335 1.00 101.25 ? 140 HIS A ND1 1 
ATOM   440  C CD2 . HIS A 1 57  ? 3.919   26.952  197.191 1.00 98.09  ? 140 HIS A CD2 1 
ATOM   441  C CE1 . HIS A 1 57  ? 3.637   28.204  198.967 1.00 99.52  ? 140 HIS A CE1 1 
ATOM   442  N NE2 . HIS A 1 57  ? 3.410   28.134  197.670 1.00 99.53  ? 140 HIS A NE2 1 
ATOM   443  N N   . SER A 1 58  ? 1.834   24.126  197.896 1.00 100.99 ? 141 SER A N   1 
ATOM   444  C CA  . SER A 1 58  ? 0.651   24.073  197.016 1.00 100.87 ? 141 SER A CA  1 
ATOM   445  C C   . SER A 1 58  ? 0.847   24.652  195.611 1.00 100.28 ? 141 SER A C   1 
ATOM   446  O O   . SER A 1 58  ? 0.165   24.215  194.692 1.00 98.98  ? 141 SER A O   1 
ATOM   447  C CB  . SER A 1 58  ? -0.545  24.772  197.683 1.00 104.58 ? 141 SER A CB  1 
ATOM   448  O OG  . SER A 1 58  ? -0.183  26.053  198.191 1.00 105.02 ? 141 SER A OG  1 
ATOM   449  N N   . ASN A 1 59  ? 1.743   25.642  195.466 1.00 97.13  ? 142 ASN A N   1 
ATOM   450  C CA  . ASN A 1 59  ? 2.123   26.218  194.165 1.00 93.47  ? 142 ASN A CA  1 
ATOM   451  C C   . ASN A 1 59  ? 3.440   25.750  193.511 1.00 93.99  ? 142 ASN A C   1 
ATOM   452  O O   . ASN A 1 59  ? 3.879   26.356  192.526 1.00 99.64  ? 142 ASN A O   1 
ATOM   453  C CB  . ASN A 1 59  ? 2.154   27.731  194.282 1.00 94.86  ? 142 ASN A CB  1 
ATOM   454  C CG  . ASN A 1 59  ? 0.865   28.300  194.829 1.00 97.91  ? 142 ASN A CG  1 
ATOM   455  O OD1 . ASN A 1 59  ? 0.890   29.051  195.783 1.00 96.81  ? 142 ASN A OD1 1 
ATOM   456  N ND2 . ASN A 1 59  ? -0.268  27.948  194.224 1.00 100.80 ? 142 ASN A ND2 1 
ATOM   457  N N   . ILE A 1 60  ? 4.077   24.703  194.032 1.00 93.71  ? 143 ILE A N   1 
ATOM   458  C CA  . ILE A 1 60  ? 5.202   24.060  193.340 1.00 88.25  ? 143 ILE A CA  1 
ATOM   459  C C   . ILE A 1 60  ? 4.827   22.621  193.041 1.00 86.72  ? 143 ILE A C   1 
ATOM   460  O O   . ILE A 1 60  ? 4.420   21.894  193.958 1.00 90.76  ? 143 ILE A O   1 
ATOM   461  C CB  . ILE A 1 60  ? 6.488   24.011  194.193 1.00 90.86  ? 143 ILE A CB  1 
ATOM   462  C CG1 . ILE A 1 60  ? 6.780   25.345  194.895 1.00 88.95  ? 143 ILE A CG1 1 
ATOM   463  C CG2 . ILE A 1 60  ? 7.662   23.564  193.327 1.00 90.74  ? 143 ILE A CG2 1 
ATOM   464  C CD1 . ILE A 1 60  ? 7.319   26.401  193.981 1.00 92.33  ? 143 ILE A CD1 1 
ATOM   465  N N   . THR A 1 61  ? 5.013   22.196  191.794 1.00 83.27  ? 144 THR A N   1 
ATOM   466  C CA  . THR A 1 61  ? 4.718   20.817  191.383 1.00 87.88  ? 144 THR A CA  1 
ATOM   467  C C   . THR A 1 61  ? 5.672   19.777  191.997 1.00 89.17  ? 144 THR A C   1 
ATOM   468  O O   . THR A 1 61  ? 6.834   19.737  191.638 1.00 94.93  ? 144 THR A O   1 
ATOM   469  C CB  . THR A 1 61  ? 4.802   20.670  189.845 1.00 87.93  ? 144 THR A CB  1 
ATOM   470  O OG1 . THR A 1 61  ? 3.778   21.458  189.231 1.00 87.90  ? 144 THR A OG1 1 
ATOM   471  C CG2 . THR A 1 61  ? 4.644   19.221  189.404 1.00 88.52  ? 144 THR A CG2 1 
ATOM   472  N N   . GLY A 1 62  ? 5.156   18.900  192.856 1.00 95.97  ? 145 GLY A N   1 
ATOM   473  C CA  . GLY A 1 62  ? 5.938   17.803  193.446 1.00 98.25  ? 145 GLY A CA  1 
ATOM   474  C C   . GLY A 1 62  ? 6.036   16.526  192.611 1.00 95.97  ? 145 GLY A C   1 
ATOM   475  O O   . GLY A 1 62  ? 5.304   16.330  191.614 1.00 93.12  ? 145 GLY A O   1 
ATOM   476  N N   . ILE A 1 63  ? 6.996   15.684  192.991 1.00 89.97  ? 146 ILE A N   1 
ATOM   477  C CA  . ILE A 1 63  ? 7.109   14.346  192.429 1.00 90.92  ? 146 ILE A CA  1 
ATOM   478  C C   . ILE A 1 63  ? 5.999   13.534  193.086 1.00 90.76  ? 146 ILE A C   1 
ATOM   479  O O   . ILE A 1 63  ? 5.832   13.611  194.282 1.00 87.70  ? 146 ILE A O   1 
ATOM   480  C CB  . ILE A 1 63  ? 8.493   13.717  192.751 1.00 93.34  ? 146 ILE A CB  1 
ATOM   481  C CG1 . ILE A 1 63  ? 9.620   14.626  192.163 1.00 89.30  ? 146 ILE A CG1 1 
ATOM   482  C CG2 . ILE A 1 63  ? 8.547   12.247  192.277 1.00 96.44  ? 146 ILE A CG2 1 
ATOM   483  C CD1 . ILE A 1 63  ? 11.004  14.030  192.065 1.00 90.35  ? 146 ILE A CD1 1 
ATOM   484  N N   . VAL A 1 64  ? 5.258   12.757  192.303 1.00 96.66  ? 147 VAL A N   1 
ATOM   485  C CA  . VAL A 1 64  ? 4.263   11.814  192.840 1.00 99.64  ? 147 VAL A CA  1 
ATOM   486  C C   . VAL A 1 64  ? 5.013   10.567  193.301 1.00 102.35 ? 147 VAL A C   1 
ATOM   487  O O   . VAL A 1 64  ? 4.885   10.153  194.434 1.00 103.18 ? 147 VAL A O   1 
ATOM   488  C CB  . VAL A 1 64  ? 3.195   11.413  191.787 1.00 103.15 ? 147 VAL A CB  1 
ATOM   489  C CG1 . VAL A 1 64  ? 2.118   10.538  192.414 1.00 106.27 ? 147 VAL A CG1 1 
ATOM   490  C CG2 . VAL A 1 64  ? 2.560   12.636  191.151 1.00 102.14 ? 147 VAL A CG2 1 
ATOM   491  N N   . GLU A 1 65  ? 5.811   9.993   192.407 1.00 107.54 ? 148 GLU A N   1 
ATOM   492  C CA  . GLU A 1 65  ? 6.687   8.879   192.753 1.00 115.14 ? 148 GLU A CA  1 
ATOM   493  C C   . GLU A 1 65  ? 7.723   8.691   191.643 1.00 114.50 ? 148 GLU A C   1 
ATOM   494  O O   . GLU A 1 65  ? 7.531   9.205   190.501 1.00 111.31 ? 148 GLU A O   1 
ATOM   495  C CB  . GLU A 1 65  ? 5.864   7.580   192.945 1.00 123.76 ? 148 GLU A CB  1 
ATOM   496  C CG  . GLU A 1 65  ? 5.049   7.078   191.750 1.00 130.46 ? 148 GLU A CG  1 
ATOM   497  C CD  . GLU A 1 65  ? 4.343   5.738   192.037 1.00 142.50 ? 148 GLU A CD  1 
ATOM   498  O OE1 . GLU A 1 65  ? 3.840   5.493   193.158 1.00 148.55 ? 148 GLU A OE1 1 
ATOM   499  O OE2 . GLU A 1 65  ? 4.296   4.896   191.131 1.00 143.66 ? 148 GLU A OE2 1 
ATOM   500  N N   . VAL A 1 66  ? 8.820   7.987   191.967 1.00 104.47 ? 149 VAL A N   1 
ATOM   501  C CA  . VAL A 1 66  ? 9.762   7.548   190.923 1.00 101.57 ? 149 VAL A CA  1 
ATOM   502  C C   . VAL A 1 66  ? 9.737   6.042   190.883 1.00 100.33 ? 149 VAL A C   1 
ATOM   503  O O   . VAL A 1 66  ? 9.687   5.421   191.921 1.00 113.02 ? 149 VAL A O   1 
ATOM   504  C CB  . VAL A 1 66  ? 11.207  8.142   191.023 1.00 97.64  ? 149 VAL A CB  1 
ATOM   505  C CG1 . VAL A 1 66  ? 11.201  9.497   191.720 1.00 96.37  ? 149 VAL A CG1 1 
ATOM   506  C CG2 . VAL A 1 66  ? 12.200  7.205   191.690 1.00 100.23 ? 149 VAL A CG2 1 
ATOM   507  N N   . ILE A 1 67  ? 9.697   5.467   189.682 1.00 99.72  ? 150 ILE A N   1 
ATOM   508  C CA  . ILE A 1 67  ? 9.835   4.021   189.479 1.00 101.03 ? 150 ILE A CA  1 
ATOM   509  C C   . ILE A 1 67  ? 11.152  3.795   188.738 1.00 101.86 ? 150 ILE A C   1 
ATOM   510  O O   . ILE A 1 67  ? 11.454  4.523   187.766 1.00 107.76 ? 150 ILE A O   1 
ATOM   511  C CB  . ILE A 1 67  ? 8.630   3.438   188.700 1.00 100.87 ? 150 ILE A CB  1 
ATOM   512  C CG1 . ILE A 1 67  ? 7.390   3.492   189.589 1.00 105.53 ? 150 ILE A CG1 1 
ATOM   513  C CG2 . ILE A 1 67  ? 8.901   2.002   188.249 1.00 100.62 ? 150 ILE A CG2 1 
ATOM   514  C CD1 . ILE A 1 67  ? 6.054   3.193   188.911 1.00 110.92 ? 150 ILE A CD1 1 
ATOM   515  N N   . LEU A 1 68  ? 11.915  2.787   189.165 1.00 93.75  ? 151 LEU A N   1 
ATOM   516  C CA  . LEU A 1 68  ? 13.206  2.510   188.553 1.00 94.07  ? 151 LEU A CA  1 
ATOM   517  C C   . LEU A 1 68  ? 13.146  1.236   187.766 1.00 97.52  ? 151 LEU A C   1 
ATOM   518  O O   . LEU A 1 68  ? 12.622  0.236   188.238 1.00 102.06 ? 151 LEU A O   1 
ATOM   519  C CB  . LEU A 1 68  ? 14.295  2.394   189.604 1.00 94.08  ? 151 LEU A CB  1 
ATOM   520  C CG  . LEU A 1 68  ? 14.765  3.590   190.376 1.00 94.10  ? 151 LEU A CG  1 
ATOM   521  C CD1 . LEU A 1 68  ? 14.865  4.788   189.456 1.00 94.71  ? 151 LEU A CD1 1 
ATOM   522  C CD2 . LEU A 1 68  ? 13.860  3.942   191.537 1.00 95.07  ? 151 LEU A CD2 1 
ATOM   523  N N   . GLY A 1 69  ? 13.650  1.292   186.542 1.00 101.97 ? 152 GLY A N   1 
ATOM   524  C CA  . GLY A 1 69  ? 13.853  0.104   185.733 1.00 107.76 ? 152 GLY A CA  1 
ATOM   525  C C   . GLY A 1 69  ? 15.337  -0.082  185.553 1.00 111.61 ? 152 GLY A C   1 
ATOM   526  O O   . GLY A 1 69  ? 16.124  0.649   186.134 1.00 112.17 ? 152 GLY A O   1 
ATOM   527  N N   . GLU A 1 70  ? 15.711  -1.040  184.716 1.00 116.08 ? 153 GLU A N   1 
ATOM   528  C CA  . GLU A 1 70  ? 17.116  -1.337  184.460 1.00 118.72 ? 153 GLU A CA  1 
ATOM   529  C C   . GLU A 1 70  ? 17.858  -0.155  183.878 1.00 114.03 ? 153 GLU A C   1 
ATOM   530  O O   . GLU A 1 70  ? 18.867  0.269   184.424 1.00 115.88 ? 153 GLU A O   1 
ATOM   531  C CB  . GLU A 1 70  ? 17.255  -2.518  183.502 1.00 125.55 ? 153 GLU A CB  1 
ATOM   532  C CG  . GLU A 1 70  ? 16.749  -3.837  184.112 1.00 132.19 ? 153 GLU A CG  1 
ATOM   533  C CD  . GLU A 1 70  ? 17.778  -4.536  184.979 1.00 134.99 ? 153 GLU A CD  1 
ATOM   534  O OE1 . GLU A 1 70  ? 18.995  -4.308  184.781 1.00 137.32 ? 153 GLU A OE1 1 
ATOM   535  O OE2 . GLU A 1 70  ? 17.364  -5.331  185.855 1.00 135.18 ? 153 GLU A OE2 1 
ATOM   536  N N   . THR A 1 71  ? 17.355  0.369   182.770 1.00 115.49 ? 154 THR A N   1 
ATOM   537  C CA  . THR A 1 71  ? 18.046  1.428   182.036 1.00 115.77 ? 154 THR A CA  1 
ATOM   538  C C   . THR A 1 71  ? 17.569  2.814   182.365 1.00 111.45 ? 154 THR A C   1 
ATOM   539  O O   . THR A 1 71  ? 18.348  3.757   182.237 1.00 108.04 ? 154 THR A O   1 
ATOM   540  C CB  . THR A 1 71  ? 17.862  1.257   180.528 1.00 121.27 ? 154 THR A CB  1 
ATOM   541  O OG1 . THR A 1 71  ? 18.336  -0.044  180.163 1.00 128.54 ? 154 THR A OG1 1 
ATOM   542  C CG2 . THR A 1 71  ? 18.637  2.348   179.737 1.00 121.92 ? 154 THR A CG2 1 
ATOM   543  N N   . LYS A 1 72  ? 16.292  2.939   182.742 1.00 113.10 ? 155 LYS A N   1 
ATOM   544  C CA  . LYS A 1 72  ? 15.638  4.243   182.914 1.00 109.63 ? 155 LYS A CA  1 
ATOM   545  C C   . LYS A 1 72  ? 14.970  4.443   184.271 1.00 103.08 ? 155 LYS A C   1 
ATOM   546  O O   . LYS A 1 72  ? 14.518  3.485   184.917 1.00 105.13 ? 155 LYS A O   1 
ATOM   547  C CB  . LYS A 1 72  ? 14.584  4.424   181.821 1.00 115.32 ? 155 LYS A CB  1 
ATOM   548  C CG  . LYS A 1 72  ? 15.172  4.568   180.424 1.00 121.35 ? 155 LYS A CG  1 
ATOM   549  C CD  . LYS A 1 72  ? 14.432  3.721   179.397 1.00 127.89 ? 155 LYS A CD  1 
ATOM   550  C CE  . LYS A 1 72  ? 15.028  3.897   178.006 1.00 134.37 ? 155 LYS A CE  1 
ATOM   551  N NZ  . LYS A 1 72  ? 14.912  5.302   177.503 1.00 136.46 ? 155 LYS A NZ  1 
ATOM   552  N N   . ALA A 1 73  ? 14.922  5.695   184.693 1.00 95.04  ? 156 ALA A N   1 
ATOM   553  C CA  . ALA A 1 73  ? 14.087  6.106   185.810 1.00 96.80  ? 156 ALA A CA  1 
ATOM   554  C C   . ALA A 1 73  ? 12.820  6.707   185.241 1.00 97.23  ? 156 ALA A C   1 
ATOM   555  O O   . ALA A 1 73  ? 12.856  7.325   184.186 1.00 97.91  ? 156 ALA A O   1 
ATOM   556  C CB  . ALA A 1 73  ? 14.800  7.137   186.651 1.00 97.77  ? 156 ALA A CB  1 
ATOM   557  N N   . TYR A 1 74  ? 11.706  6.505   185.936 1.00 96.57  ? 157 TYR A N   1 
ATOM   558  C CA  . TYR A 1 74  ? 10.418  7.086   185.568 1.00 94.27  ? 157 TYR A CA  1 
ATOM   559  C C   . TYR A 1 74  ? 9.943   7.957   186.718 1.00 89.85  ? 157 TYR A C   1 
ATOM   560  O O   . TYR A 1 74  ? 9.723   7.454   187.798 1.00 94.85  ? 157 TYR A O   1 
ATOM   561  C CB  . TYR A 1 74  ? 9.406   5.972   185.305 1.00 96.28  ? 157 TYR A CB  1 
ATOM   562  C CG  . TYR A 1 74  ? 9.844   5.064   184.201 1.00 97.59  ? 157 TYR A CG  1 
ATOM   563  C CD1 . TYR A 1 74  ? 10.669  3.964   184.459 1.00 97.37  ? 157 TYR A CD1 1 
ATOM   564  C CD2 . TYR A 1 74  ? 9.474   5.325   182.890 1.00 100.42 ? 157 TYR A CD2 1 
ATOM   565  C CE1 . TYR A 1 74  ? 11.091  3.124   183.442 1.00 99.99  ? 157 TYR A CE1 1 
ATOM   566  C CE2 . TYR A 1 74  ? 9.901   4.505   181.856 1.00 105.37 ? 157 TYR A CE2 1 
ATOM   567  C CZ  . TYR A 1 74  ? 10.709  3.400   182.137 1.00 104.72 ? 157 TYR A CZ  1 
ATOM   568  O OH  . TYR A 1 74  ? 11.104  2.575   181.110 1.00 107.23 ? 157 TYR A OH  1 
ATOM   569  N N   . VAL A 1 75  ? 9.819   9.249   186.499 1.00 83.55  ? 158 VAL A N   1 
ATOM   570  C CA  . VAL A 1 75  ? 9.407   10.152  187.544 1.00 85.08  ? 158 VAL A CA  1 
ATOM   571  C C   . VAL A 1 75  ? 7.996   10.638  187.236 1.00 91.41  ? 158 VAL A C   1 
ATOM   572  O O   . VAL A 1 75  ? 7.749   11.187  186.167 1.00 91.34  ? 158 VAL A O   1 
ATOM   573  C CB  . VAL A 1 75  ? 10.374  11.327  187.622 1.00 83.85  ? 158 VAL A CB  1 
ATOM   574  C CG1 . VAL A 1 75  ? 10.124  12.161  188.873 1.00 85.44  ? 158 VAL A CG1 1 
ATOM   575  C CG2 . VAL A 1 75  ? 11.802  10.797  187.617 1.00 86.00  ? 158 VAL A CG2 1 
ATOM   576  N N   . PHE A 1 76  ? 7.077   10.450  188.181 1.00 94.71  ? 159 PHE A N   1 
ATOM   577  C CA  . PHE A 1 76  ? 5.665   10.734  187.948 1.00 94.01  ? 159 PHE A CA  1 
ATOM   578  C C   . PHE A 1 76  ? 5.206   12.065  188.552 1.00 92.11  ? 159 PHE A C   1 
ATOM   579  O O   . PHE A 1 76  ? 5.581   12.429  189.655 1.00 82.67  ? 159 PHE A O   1 
ATOM   580  C CB  . PHE A 1 76  ? 4.826   9.570   188.439 1.00 99.04  ? 159 PHE A CB  1 
ATOM   581  C CG  . PHE A 1 76  ? 5.019   8.335   187.622 1.00 103.43 ? 159 PHE A CG  1 
ATOM   582  C CD1 . PHE A 1 76  ? 4.282   8.136   186.455 1.00 107.43 ? 159 PHE A CD1 1 
ATOM   583  C CD2 . PHE A 1 76  ? 5.977   7.396   187.975 1.00 105.50 ? 159 PHE A CD2 1 
ATOM   584  C CE1 . PHE A 1 76  ? 4.475   7.002   185.672 1.00 106.16 ? 159 PHE A CE1 1 
ATOM   585  C CE2 . PHE A 1 76  ? 6.182   6.269   187.189 1.00 107.65 ? 159 PHE A CE2 1 
ATOM   586  C CZ  . PHE A 1 76  ? 5.433   6.074   186.034 1.00 108.92 ? 159 PHE A CZ  1 
ATOM   587  N N   . PHE A 1 77  ? 4.408   12.784  187.762 1.00 100.55 ? 160 PHE A N   1 
ATOM   588  C CA  . PHE A 1 77  ? 3.960   14.145  188.029 1.00 98.36  ? 160 PHE A CA  1 
ATOM   589  C C   . PHE A 1 77  ? 2.461   14.233  187.777 1.00 100.28 ? 160 PHE A C   1 
ATOM   590  O O   . PHE A 1 77  ? 1.964   13.708  186.780 1.00 98.15  ? 160 PHE A O   1 
ATOM   591  C CB  . PHE A 1 77  ? 4.645   15.106  187.067 1.00 97.17  ? 160 PHE A CB  1 
ATOM   592  C CG  . PHE A 1 77  ? 6.093   15.369  187.385 1.00 103.52 ? 160 PHE A CG  1 
ATOM   593  C CD1 . PHE A 1 77  ? 6.456   16.432  188.206 1.00 105.25 ? 160 PHE A CD1 1 
ATOM   594  C CD2 . PHE A 1 77  ? 7.108   14.585  186.831 1.00 108.16 ? 160 PHE A CD2 1 
ATOM   595  C CE1 . PHE A 1 77  ? 7.783   16.715  188.479 1.00 105.86 ? 160 PHE A CE1 1 
ATOM   596  C CE2 . PHE A 1 77  ? 8.447   14.860  187.112 1.00 108.94 ? 160 PHE A CE2 1 
ATOM   597  C CZ  . PHE A 1 77  ? 8.780   15.931  187.939 1.00 107.79 ? 160 PHE A CZ  1 
ATOM   598  N N   . GLU A 1 78  ? 1.755   14.870  188.700 1.00 104.68 ? 161 GLU A N   1 
ATOM   599  C CA  . GLU A 1 78  ? 0.396   15.405  188.490 1.00 111.54 ? 161 GLU A CA  1 
ATOM   600  C C   . GLU A 1 78  ? 0.251   16.111  187.134 1.00 105.00 ? 161 GLU A C   1 
ATOM   601  O O   . GLU A 1 78  ? 1.192   16.741  186.660 1.00 116.52 ? 161 GLU A O   1 
ATOM   602  C CB  . GLU A 1 78  ? 0.075   16.420  189.635 1.00 121.93 ? 161 GLU A CB  1 
ATOM   603  C CG  . GLU A 1 78  ? 1.351   16.962  190.346 1.00 133.02 ? 161 GLU A CG  1 
ATOM   604  C CD  . GLU A 1 78  ? 1.174   18.225  191.189 1.00 138.99 ? 161 GLU A CD  1 
ATOM   605  O OE1 . GLU A 1 78  ? 0.062   18.815  191.226 1.00 155.12 ? 161 GLU A OE1 1 
ATOM   606  O OE2 . GLU A 1 78  ? 2.172   18.614  191.844 1.00 126.60 ? 161 GLU A OE2 1 
ATOM   607  N N   . LYS A 1 79  ? -0.923  16.025  186.519 1.00 105.99 ? 162 LYS A N   1 
ATOM   608  C CA  . LYS A 1 79  ? -1.169  16.668  185.220 1.00 106.20 ? 162 LYS A CA  1 
ATOM   609  C C   . LYS A 1 79  ? -1.620  18.116  185.386 1.00 99.08  ? 162 LYS A C   1 
ATOM   610  O O   . LYS A 1 79  ? -2.321  18.454  186.327 1.00 98.26  ? 162 LYS A O   1 
ATOM   611  C CB  . LYS A 1 79  ? -2.255  15.941  184.413 1.00 115.84 ? 162 LYS A CB  1 
ATOM   612  C CG  . LYS A 1 79  ? -2.500  16.551  183.039 1.00 123.22 ? 162 LYS A CG  1 
ATOM   613  C CD  . LYS A 1 79  ? -3.754  16.059  182.331 1.00 122.23 ? 162 LYS A CD  1 
ATOM   614  C CE  . LYS A 1 79  ? -5.031  16.726  182.816 1.00 122.40 ? 162 LYS A CE  1 
ATOM   615  N NZ  . LYS A 1 79  ? -6.205  16.112  182.136 1.00 132.34 ? 162 LYS A NZ  1 
ATOM   616  N N   . ASP A 1 80  ? -1.251  18.946  184.421 1.00 96.53  ? 163 ASP A N   1 
ATOM   617  C CA  . ASP A 1 80  ? -1.688  20.323  184.373 1.00 98.73  ? 163 ASP A CA  1 
ATOM   618  C C   . ASP A 1 80  ? -2.833  20.525  183.383 1.00 100.90 ? 163 ASP A C   1 
ATOM   619  O O   . ASP A 1 80  ? -3.050  19.706  182.477 1.00 105.43 ? 163 ASP A O   1 
ATOM   620  C CB  . ASP A 1 80  ? -0.535  21.233  183.988 1.00 101.63 ? 163 ASP A CB  1 
ATOM   621  C CG  . ASP A 1 80  ? -0.131  21.098  182.518 1.00 105.60 ? 163 ASP A CG  1 
ATOM   622  O OD1 . ASP A 1 80  ? 0.581   20.125  182.223 1.00 102.72 ? 163 ASP A OD1 1 
ATOM   623  O OD2 . ASP A 1 80  ? -0.492  21.968  181.680 1.00 111.06 ? 163 ASP A OD2 1 
ATOM   624  N N   . PHE A 1 81  ? -3.544  21.637  183.554 1.00 95.86  ? 164 PHE A N   1 
ATOM   625  C CA  . PHE A 1 81  ? -4.662  22.003  182.689 1.00 96.30  ? 164 PHE A CA  1 
ATOM   626  C C   . PHE A 1 81  ? -4.383  23.377  182.065 1.00 97.51  ? 164 PHE A C   1 
ATOM   627  O O   . PHE A 1 81  ? -5.175  24.312  182.183 1.00 101.29 ? 164 PHE A O   1 
ATOM   628  C CB  . PHE A 1 81  ? -5.965  21.982  183.478 1.00 95.57  ? 164 PHE A CB  1 
ATOM   629  C CG  . PHE A 1 81  ? -6.258  20.659  184.104 1.00 95.31  ? 164 PHE A CG  1 
ATOM   630  C CD1 . PHE A 1 81  ? -5.615  20.280  185.290 1.00 92.60  ? 164 PHE A CD1 1 
ATOM   631  C CD2 . PHE A 1 81  ? -7.166  19.792  183.528 1.00 95.39  ? 164 PHE A CD2 1 
ATOM   632  C CE1 . PHE A 1 81  ? -5.862  19.061  185.876 1.00 93.96  ? 164 PHE A CE1 1 
ATOM   633  C CE2 . PHE A 1 81  ? -7.428  18.565  184.127 1.00 100.58 ? 164 PHE A CE2 1 
ATOM   634  C CZ  . PHE A 1 81  ? -6.780  18.201  185.303 1.00 98.31  ? 164 PHE A CZ  1 
ATOM   635  N N   . GLY A 1 82  ? -3.230  23.471  181.404 1.00 89.71  ? 165 GLY A N   1 
ATOM   636  C CA  . GLY A 1 82  ? -2.839  24.640  180.677 1.00 82.67  ? 165 GLY A CA  1 
ATOM   637  C C   . GLY A 1 82  ? -1.875  25.475  181.480 1.00 81.47  ? 165 GLY A C   1 
ATOM   638  O O   . GLY A 1 82  ? -1.791  25.349  182.699 1.00 81.27  ? 165 GLY A O   1 
ATOM   639  N N   . ASP A 1 83  ? -1.172  26.339  180.752 1.00 80.09  ? 166 ASP A N   1 
ATOM   640  C CA  . ASP A 1 83  ? -0.122  27.190  181.260 1.00 80.61  ? 166 ASP A CA  1 
ATOM   641  C C   . ASP A 1 83  ? -0.548  28.642  181.188 1.00 83.91  ? 166 ASP A C   1 
ATOM   642  O O   . ASP A 1 83  ? -1.416  29.003  180.376 1.00 92.46  ? 166 ASP A O   1 
ATOM   643  C CB  . ASP A 1 83  ? 1.171   26.949  180.452 1.00 84.52  ? 166 ASP A CB  1 
ATOM   644  C CG  . ASP A 1 83  ? 1.108   27.473  178.993 1.00 87.87  ? 166 ASP A CG  1 
ATOM   645  O OD1 . ASP A 1 83  ? 1.418   28.653  178.758 1.00 87.46  ? 166 ASP A OD1 1 
ATOM   646  O OD2 . ASP A 1 83  ? 0.787   26.695  178.068 1.00 93.63  ? 166 ASP A OD2 1 
ATOM   647  N N   . MET A 1 84  ? 0.091   29.485  181.993 1.00 80.98  ? 167 MET A N   1 
ATOM   648  C CA  . MET A 1 84  ? -0.276  30.895  182.057 1.00 78.85  ? 167 MET A CA  1 
ATOM   649  C C   . MET A 1 84  ? 0.064   31.733  180.834 1.00 81.99  ? 167 MET A C   1 
ATOM   650  O O   . MET A 1 84  ? -0.423  32.867  180.713 1.00 89.03  ? 167 MET A O   1 
ATOM   651  C CB  . MET A 1 84  ? 0.317   31.552  183.302 1.00 80.34  ? 167 MET A CB  1 
ATOM   652  C CG  . MET A 1 84  ? -0.457  31.223  184.556 1.00 85.42  ? 167 MET A CG  1 
ATOM   653  S SD  . MET A 1 84  ? -2.136  31.865  184.436 1.00 95.41  ? 167 MET A SD  1 
ATOM   654  C CE  . MET A 1 84  ? -1.866  33.632  184.515 1.00 92.40  ? 167 MET A CE  1 
ATOM   655  N N   . HIS A 1 85  ? 0.894   31.218  179.935 1.00 81.20  ? 168 HIS A N   1 
ATOM   656  C CA  . HIS A 1 85  ? 1.251   31.978  178.738 1.00 81.34  ? 168 HIS A CA  1 
ATOM   657  C C   . HIS A 1 85  ? 0.162   31.879  177.685 1.00 85.78  ? 168 HIS A C   1 
ATOM   658  O O   . HIS A 1 85  ? -0.250  32.873  177.125 1.00 83.28  ? 168 HIS A O   1 
ATOM   659  C CB  . HIS A 1 85  ? 2.587   31.509  178.179 1.00 82.40  ? 168 HIS A CB  1 
ATOM   660  C CG  . HIS A 1 85  ? 2.828   31.925  176.775 1.00 81.01  ? 168 HIS A CG  1 
ATOM   661  N ND1 . HIS A 1 85  ? 3.179   33.215  176.422 1.00 78.42  ? 168 HIS A ND1 1 
ATOM   662  C CD2 . HIS A 1 85  ? 2.731   31.222  175.628 1.00 81.72  ? 168 HIS A CD2 1 
ATOM   663  C CE1 . HIS A 1 85  ? 3.303   33.282  175.110 1.00 80.20  ? 168 HIS A CE1 1 
ATOM   664  N NE2 . HIS A 1 85  ? 3.028   32.089  174.604 1.00 85.28  ? 168 HIS A NE2 1 
ATOM   665  N N   . SER A 1 86  ? -0.313  30.667  177.424 1.00 93.39  ? 169 SER A N   1 
ATOM   666  C CA  . SER A 1 86  ? -1.458  30.486  176.544 1.00 92.92  ? 169 SER A CA  1 
ATOM   667  C C   . SER A 1 86  ? -2.689  31.150  177.135 1.00 91.12  ? 169 SER A C   1 
ATOM   668  O O   . SER A 1 86  ? -3.515  31.665  176.383 1.00 91.39  ? 169 SER A O   1 
ATOM   669  C CB  . SER A 1 86  ? -1.726  29.003  176.278 1.00 93.94  ? 169 SER A CB  1 
ATOM   670  O OG  . SER A 1 86  ? -0.521  28.367  175.907 1.00 91.48  ? 169 SER A OG  1 
ATOM   671  N N   . TYR A 1 87  ? -2.798  31.141  178.469 1.00 86.82  ? 170 TYR A N   1 
ATOM   672  C CA  . TYR A 1 87  ? -3.905  31.775  179.156 1.00 84.15  ? 170 TYR A CA  1 
ATOM   673  C C   . TYR A 1 87  ? -4.003  33.227  178.775 1.00 87.59  ? 170 TYR A C   1 
ATOM   674  O O   . TYR A 1 87  ? -5.076  33.687  178.385 1.00 92.64  ? 170 TYR A O   1 
ATOM   675  C CB  . TYR A 1 87  ? -3.789  31.670  180.668 1.00 78.69  ? 170 TYR A CB  1 
ATOM   676  C CG  . TYR A 1 87  ? -5.104  31.902  181.375 1.00 76.05  ? 170 TYR A CG  1 
ATOM   677  C CD1 . TYR A 1 87  ? -6.238  31.241  180.978 1.00 74.70  ? 170 TYR A CD1 1 
ATOM   678  C CD2 . TYR A 1 87  ? -5.218  32.802  182.446 1.00 76.30  ? 170 TYR A CD2 1 
ATOM   679  C CE1 . TYR A 1 87  ? -7.445  31.436  181.626 1.00 76.74  ? 170 TYR A CE1 1 
ATOM   680  C CE2 . TYR A 1 87  ? -6.437  33.011  183.098 1.00 76.02  ? 170 TYR A CE2 1 
ATOM   681  C CZ  . TYR A 1 87  ? -7.549  32.303  182.670 1.00 76.02  ? 170 TYR A CZ  1 
ATOM   682  O OH  . TYR A 1 87  ? -8.796  32.414  183.236 1.00 78.16  ? 170 TYR A OH  1 
ATOM   683  N N   . VAL A 1 88  ? -2.889  33.936  178.854 1.00 89.44  ? 171 VAL A N   1 
ATOM   684  C CA  . VAL A 1 88  ? -2.886  35.363  178.515 1.00 92.35  ? 171 VAL A CA  1 
ATOM   685  C C   . VAL A 1 88  ? -3.123  35.615  177.025 1.00 90.45  ? 171 VAL A C   1 
ATOM   686  O O   . VAL A 1 88  ? -3.705  36.616  176.672 1.00 93.31  ? 171 VAL A O   1 
ATOM   687  C CB  . VAL A 1 88  ? -1.590  36.060  178.941 1.00 93.82  ? 171 VAL A CB  1 
ATOM   688  C CG1 . VAL A 1 88  ? -1.615  37.535  178.551 1.00 98.06  ? 171 VAL A CG1 1 
ATOM   689  C CG2 . VAL A 1 88  ? -1.408  35.940  180.438 1.00 98.53  ? 171 VAL A CG2 1 
ATOM   690  N N   . ARG A 1 89  ? -2.672  34.740  176.140 1.00 88.95  ? 172 ARG A N   1 
ATOM   691  C CA  . ARG A 1 89  ? -2.999  34.910  174.732 1.00 91.96  ? 172 ARG A CA  1 
ATOM   692  C C   . ARG A 1 89  ? -4.488  34.693  174.502 1.00 93.91  ? 172 ARG A C   1 
ATOM   693  O O   . ARG A 1 89  ? -5.137  35.545  173.912 1.00 93.85  ? 172 ARG A O   1 
ATOM   694  C CB  . ARG A 1 89  ? -2.149  34.012  173.863 1.00 99.62  ? 172 ARG A CB  1 
ATOM   695  C CG  . ARG A 1 89  ? -0.724  34.532  173.803 1.00 106.25 ? 172 ARG A CG  1 
ATOM   696  C CD  . ARG A 1 89  ? 0.226   33.570  173.126 1.00 112.06 ? 172 ARG A CD  1 
ATOM   697  N NE  . ARG A 1 89  ? 0.002   33.464  171.683 1.00 117.47 ? 172 ARG A NE  1 
ATOM   698  C CZ  . ARG A 1 89  ? -0.265  32.339  171.013 1.00 122.25 ? 172 ARG A CZ  1 
ATOM   699  N NH1 . ARG A 1 89  ? -0.346  31.144  171.619 1.00 124.12 ? 172 ARG A NH1 1 
ATOM   700  N NH2 . ARG A 1 89  ? -0.443  32.411  169.697 1.00 131.00 ? 172 ARG A NH2 1 
ATOM   701  N N   . SER A 1 90  ? -5.019  33.578  175.012 1.00 92.93  ? 173 SER A N   1 
ATOM   702  C CA  . SER A 1 90  ? -6.471  33.282  175.018 1.00 90.53  ? 173 SER A CA  1 
ATOM   703  C C   . SER A 1 90  ? -7.327  34.449  175.526 1.00 90.00  ? 173 SER A C   1 
ATOM   704  O O   . SER A 1 90  ? -8.242  34.903  174.853 1.00 92.89  ? 173 SER A O   1 
ATOM   705  C CB  . SER A 1 90  ? -6.749  32.038  175.861 1.00 87.75  ? 173 SER A CB  1 
ATOM   706  O OG  . SER A 1 90  ? -8.102  31.973  176.268 1.00 91.00  ? 173 SER A OG  1 
ATOM   707  N N   . ARG A 1 91  ? -7.006  34.904  176.718 1.00 88.45  ? 174 ARG A N   1 
ATOM   708  C CA  . ARG A 1 91  ? -7.654  36.004  177.366 1.00 89.15  ? 174 ARG A CA  1 
ATOM   709  C C   . ARG A 1 91  ? -6.811  37.236  177.087 1.00 99.09  ? 174 ARG A C   1 
ATOM   710  O O   . ARG A 1 91  ? -5.722  37.337  177.650 1.00 123.82 ? 174 ARG A O   1 
ATOM   711  C CB  . ARG A 1 91  ? -7.606  35.719  178.879 1.00 88.71  ? 174 ARG A CB  1 
ATOM   712  C CG  . ARG A 1 91  ? -8.848  36.032  179.633 1.00 92.43  ? 174 ARG A CG  1 
ATOM   713  C CD  . ARG A 1 91  ? -9.247  34.955  180.571 1.00 89.68  ? 174 ARG A CD  1 
ATOM   714  N NE  . ARG A 1 91  ? -10.253 35.493  181.460 1.00 86.53  ? 174 ARG A NE  1 
ATOM   715  C CZ  . ARG A 1 91  ? -11.471 35.830  181.082 1.00 91.36  ? 174 ARG A CZ  1 
ATOM   716  N NH1 . ARG A 1 91  ? -11.860 35.727  179.807 1.00 91.97  ? 174 ARG A NH1 1 
ATOM   717  N NH2 . ARG A 1 91  ? -12.333 36.261  182.003 1.00 100.85 ? 174 ARG A NH2 1 
ATOM   718  N N   . LYS A 1 92  ? -7.245  38.195  176.284 1.00 100.18 ? 175 LYS A N   1 
ATOM   719  C CA  . LYS A 1 92  ? -6.291  39.276  175.867 1.00 102.95 ? 175 LYS A CA  1 
ATOM   720  C C   . LYS A 1 92  ? -5.484  39.938  177.017 1.00 98.17  ? 175 LYS A C   1 
ATOM   721  O O   . LYS A 1 92  ? -4.266  40.161  176.913 1.00 86.31  ? 175 LYS A O   1 
ATOM   722  C CB  . LYS A 1 92  ? -7.001  40.358  175.054 1.00 111.30 ? 175 LYS A CB  1 
ATOM   723  C CG  . LYS A 1 92  ? -7.759  39.854  173.837 1.00 121.79 ? 175 LYS A CG  1 
ATOM   724  C CD  . LYS A 1 92  ? -6.980  38.778  173.101 1.00 125.88 ? 175 LYS A CD  1 
ATOM   725  C CE  . LYS A 1 92  ? -7.622  38.416  171.783 1.00 134.60 ? 175 LYS A CE  1 
ATOM   726  N NZ  . LYS A 1 92  ? -6.707  37.617  170.927 1.00 137.98 ? 175 LYS A NZ  1 
ATOM   727  N N   . ARG A 1 93  ? -6.178  40.246  178.104 1.00 97.72  ? 176 ARG A N   1 
ATOM   728  C CA  . ARG A 1 93  ? -5.551  40.719  179.331 1.00 99.06  ? 176 ARG A CA  1 
ATOM   729  C C   . ARG A 1 93  ? -6.430  40.258  180.467 1.00 97.73  ? 176 ARG A C   1 
ATOM   730  O O   . ARG A 1 93  ? -7.622  40.034  180.271 1.00 96.28  ? 176 ARG A O   1 
ATOM   731  C CB  . ARG A 1 93  ? -5.399  42.253  179.333 1.00 102.32 ? 176 ARG A CB  1 
ATOM   732  C CG  . ARG A 1 93  ? -6.683  42.987  179.045 1.00 107.81 ? 176 ARG A CG  1 
ATOM   733  C CD  . ARG A 1 93  ? -6.515  44.476  178.910 1.00 111.88 ? 176 ARG A CD  1 
ATOM   734  N NE  . ARG A 1 93  ? -7.645  45.132  179.584 1.00 126.47 ? 176 ARG A NE  1 
ATOM   735  C CZ  . ARG A 1 93  ? -7.898  46.431  179.525 1.00 140.92 ? 176 ARG A CZ  1 
ATOM   736  N NH1 . ARG A 1 93  ? -7.102  47.230  178.822 1.00 148.41 ? 176 ARG A NH1 1 
ATOM   737  N NH2 . ARG A 1 93  ? -8.950  46.940  180.169 1.00 150.70 ? 176 ARG A NH2 1 
ATOM   738  N N   . LEU A 1 94  ? -5.854  40.156  181.655 1.00 95.25  ? 177 LEU A N   1 
ATOM   739  C CA  . LEU A 1 94  ? -6.619  39.757  182.814 1.00 96.85  ? 177 LEU A CA  1 
ATOM   740  C C   . LEU A 1 94  ? -7.120  40.965  183.647 1.00 93.70  ? 177 LEU A C   1 
ATOM   741  O O   . LEU A 1 94  ? -6.422  41.976  183.816 1.00 86.73  ? 177 LEU A O   1 
ATOM   742  C CB  . LEU A 1 94  ? -5.788  38.792  183.672 1.00 96.04  ? 177 LEU A CB  1 
ATOM   743  C CG  . LEU A 1 94  ? -5.187  37.572  182.989 1.00 92.87  ? 177 LEU A CG  1 
ATOM   744  C CD1 . LEU A 1 94  ? -4.569  36.675  184.036 1.00 92.31  ? 177 LEU A CD1 1 
ATOM   745  C CD2 . LEU A 1 94  ? -6.197  36.762  182.192 1.00 98.08  ? 177 LEU A CD2 1 
ATOM   746  N N   . ARG A 1 95  ? -8.323  40.818  184.193 1.00 94.83  ? 178 ARG A N   1 
ATOM   747  C CA  . ARG A 1 95  ? -8.877  41.815  185.106 1.00 102.65 ? 178 ARG A CA  1 
ATOM   748  C C   . ARG A 1 95  ? -8.123  41.666  186.437 1.00 101.63 ? 178 ARG A C   1 
ATOM   749  O O   . ARG A 1 95  ? -7.791  40.545  186.850 1.00 103.96 ? 178 ARG A O   1 
ATOM   750  C CB  . ARG A 1 95  ? -10.417 41.679  185.268 1.00 107.95 ? 178 ARG A CB  1 
ATOM   751  C CG  . ARG A 1 95  ? -11.165 41.632  183.938 1.00 109.98 ? 178 ARG A CG  1 
ATOM   752  C CD  . ARG A 1 95  ? -12.678 41.787  184.048 1.00 118.09 ? 178 ARG A CD  1 
ATOM   753  N NE  . ARG A 1 95  ? -13.330 41.117  182.924 1.00 123.49 ? 178 ARG A NE  1 
ATOM   754  C CZ  . ARG A 1 95  ? -13.637 39.813  182.865 1.00 131.13 ? 178 ARG A CZ  1 
ATOM   755  N NH1 . ARG A 1 95  ? -13.389 38.966  183.879 1.00 131.55 ? 178 ARG A NH1 1 
ATOM   756  N NH2 . ARG A 1 95  ? -14.206 39.339  181.760 1.00 134.32 ? 178 ARG A NH2 1 
ATOM   757  N N   . GLU A 1 96  ? -7.849  42.790  187.100 1.00 99.44  ? 179 GLU A N   1 
ATOM   758  C CA  . GLU A 1 96  ? -6.948  42.806  188.257 1.00 99.88  ? 179 GLU A CA  1 
ATOM   759  C C   . GLU A 1 96  ? -7.281  41.769  189.318 1.00 100.14 ? 179 GLU A C   1 
ATOM   760  O O   . GLU A 1 96  ? -6.379  41.183  189.908 1.00 103.23 ? 179 GLU A O   1 
ATOM   761  C CB  . GLU A 1 96  ? -6.885  44.186  188.900 1.00 103.59 ? 179 GLU A CB  1 
ATOM   762  C CG  . GLU A 1 96  ? -6.231  45.242  188.022 1.00 107.01 ? 179 GLU A CG  1 
ATOM   763  C CD  . GLU A 1 96  ? -5.756  46.466  188.788 1.00 113.30 ? 179 GLU A CD  1 
ATOM   764  O OE1 . GLU A 1 96  ? -6.157  46.659  189.971 1.00 121.42 ? 179 GLU A OE1 1 
ATOM   765  O OE2 . GLU A 1 96  ? -4.968  47.242  188.195 1.00 116.30 ? 179 GLU A OE2 1 
ATOM   766  N N   . GLU A 1 97  ? -8.571  41.526  189.529 1.00 104.76 ? 180 GLU A N   1 
ATOM   767  C CA  . GLU A 1 97  ? -9.052  40.529  190.493 1.00 106.76 ? 180 GLU A CA  1 
ATOM   768  C C   . GLU A 1 97  ? -8.389  39.187  190.258 1.00 104.98 ? 180 GLU A C   1 
ATOM   769  O O   . GLU A 1 97  ? -7.855  38.563  191.187 1.00 103.93 ? 180 GLU A O   1 
ATOM   770  C CB  . GLU A 1 97  ? -10.580 40.367  190.373 1.00 108.74 ? 180 GLU A CB  1 
ATOM   771  C CG  . GLU A 1 97  ? -11.193 39.541  191.486 1.00 116.83 ? 180 GLU A CG  1 
ATOM   772  C CD  . GLU A 1 97  ? -11.550 38.099  191.131 1.00 121.42 ? 180 GLU A CD  1 
ATOM   773  O OE1 . GLU A 1 97  ? -11.766 37.745  189.947 1.00 123.18 ? 180 GLU A OE1 1 
ATOM   774  O OE2 . GLU A 1 97  ? -11.655 37.296  192.080 1.00 127.23 ? 180 GLU A OE2 1 
ATOM   775  N N   . GLU A 1 98  ? -8.402  38.789  188.990 1.00 104.70 ? 181 GLU A N   1 
ATOM   776  C CA  . GLU A 1 98  ? -7.894  37.493  188.561 1.00 104.19 ? 181 GLU A CA  1 
ATOM   777  C C   . GLU A 1 98  ? -6.383  37.552  188.544 1.00 105.63 ? 181 GLU A C   1 
ATOM   778  O O   . GLU A 1 98  ? -5.735  36.664  189.109 1.00 108.19 ? 181 GLU A O   1 
ATOM   779  C CB  . GLU A 1 98  ? -8.440  37.113  187.178 1.00 103.60 ? 181 GLU A CB  1 
ATOM   780  C CG  . GLU A 1 98  ? -7.841  35.853  186.586 1.00 99.40  ? 181 GLU A CG  1 
ATOM   781  C CD  . GLU A 1 98  ? -8.601  35.331  185.387 1.00 100.80 ? 181 GLU A CD  1 
ATOM   782  O OE1 . GLU A 1 98  ? -9.115  36.132  184.579 1.00 107.03 ? 181 GLU A OE1 1 
ATOM   783  O OE2 . GLU A 1 98  ? -8.651  34.102  185.235 1.00 105.01 ? 181 GLU A OE2 1 
ATOM   784  N N   . ALA A 1 99  ? -5.835  38.584  187.891 1.00 99.38  ? 182 ALA A N   1 
ATOM   785  C CA  . ALA A 1 99  ? -4.390  38.803  187.846 1.00 98.58  ? 182 ALA A CA  1 
ATOM   786  C C   . ALA A 1 99  ? -3.787  38.710  189.245 1.00 98.71  ? 182 ALA A C   1 
ATOM   787  O O   . ALA A 1 99  ? -2.844  37.969  189.462 1.00 104.21 ? 182 ALA A O   1 
ATOM   788  C CB  . ALA A 1 99  ? -4.069  40.145  187.214 1.00 98.81  ? 182 ALA A CB  1 
ATOM   789  N N   . ALA A 1 100 ? -4.374  39.411  190.204 1.00 98.06  ? 183 ALA A N   1 
ATOM   790  C CA  . ALA A 1 100 ? -3.883  39.374  191.580 1.00 98.25  ? 183 ALA A CA  1 
ATOM   791  C C   . ALA A 1 100 ? -3.971  37.974  192.195 1.00 95.68  ? 183 ALA A C   1 
ATOM   792  O O   . ALA A 1 100 ? -3.034  37.526  192.845 1.00 89.44  ? 183 ALA A O   1 
ATOM   793  C CB  . ALA A 1 100 ? -4.632  40.388  192.442 1.00 101.93 ? 183 ALA A CB  1 
ATOM   794  N N   . ARG A 1 101 ? -5.096  37.294  192.008 1.00 98.35  ? 184 ARG A N   1 
ATOM   795  C CA  . ARG A 1 101 ? -5.252  35.959  192.606 1.00 102.88 ? 184 ARG A CA  1 
ATOM   796  C C   . ARG A 1 101 ? -4.162  35.062  192.084 1.00 97.68  ? 184 ARG A C   1 
ATOM   797  O O   . ARG A 1 101 ? -3.553  34.352  192.862 1.00 98.18  ? 184 ARG A O   1 
ATOM   798  C CB  . ARG A 1 101 ? -6.583  35.290  192.312 1.00 107.05 ? 184 ARG A CB  1 
ATOM   799  C CG  . ARG A 1 101 ? -7.777  35.664  193.166 1.00 114.20 ? 184 ARG A CG  1 
ATOM   800  C CD  . ARG A 1 101 ? -8.975  34.753  192.903 1.00 123.30 ? 184 ARG A CD  1 
ATOM   801  N NE  . ARG A 1 101 ? -9.803  35.143  191.740 1.00 123.46 ? 184 ARG A NE  1 
ATOM   802  C CZ  . ARG A 1 101 ? -9.606  34.788  190.460 1.00 119.67 ? 184 ARG A CZ  1 
ATOM   803  N NH1 . ARG A 1 101 ? -8.575  34.030  190.079 1.00 117.97 ? 184 ARG A NH1 1 
ATOM   804  N NH2 . ARG A 1 101 ? -10.455 35.217  189.525 1.00 118.77 ? 184 ARG A NH2 1 
ATOM   805  N N   . LEU A 1 102 ? -3.940  35.108  190.770 1.00 93.33  ? 185 LEU A N   1 
ATOM   806  C CA  . LEU A 1 102 ? -2.998  34.217  190.103 1.00 91.96  ? 185 LEU A CA  1 
ATOM   807  C C   . LEU A 1 102 ? -1.556  34.627  190.337 1.00 92.05  ? 185 LEU A C   1 
ATOM   808  O O   . LEU A 1 102 ? -0.710  33.770  190.620 1.00 91.07  ? 185 LEU A O   1 
ATOM   809  C CB  . LEU A 1 102 ? -3.277  34.154  188.593 1.00 89.33  ? 185 LEU A CB  1 
ATOM   810  C CG  . LEU A 1 102 ? -4.644  33.573  188.223 1.00 92.54  ? 185 LEU A CG  1 
ATOM   811  C CD1 . LEU A 1 102 ? -4.852  33.649  186.723 1.00 90.71  ? 185 LEU A CD1 1 
ATOM   812  C CD2 . LEU A 1 102 ? -4.818  32.145  188.722 1.00 93.48  ? 185 LEU A CD2 1 
ATOM   813  N N   . PHE A 1 103 ? -1.268  35.919  190.198 1.00 87.98  ? 186 PHE A N   1 
ATOM   814  C CA  . PHE A 1 103 ? 0.100   36.404  190.350 1.00 87.37  ? 186 PHE A CA  1 
ATOM   815  C C   . PHE A 1 103 ? 0.601   36.185  191.770 1.00 88.86  ? 186 PHE A C   1 
ATOM   816  O O   . PHE A 1 103 ? 1.796   36.017  191.984 1.00 91.40  ? 186 PHE A O   1 
ATOM   817  C CB  . PHE A 1 103 ? 0.208   37.875  189.958 1.00 85.54  ? 186 PHE A CB  1 
ATOM   818  C CG  . PHE A 1 103 ? 1.601   38.436  190.065 1.00 83.44  ? 186 PHE A CG  1 
ATOM   819  C CD1 . PHE A 1 103 ? 2.597   38.012  189.213 1.00 83.03  ? 186 PHE A CD1 1 
ATOM   820  C CD2 . PHE A 1 103 ? 1.911   39.402  191.012 1.00 84.77  ? 186 PHE A CD2 1 
ATOM   821  C CE1 . PHE A 1 103 ? 3.876   38.543  189.295 1.00 84.32  ? 186 PHE A CE1 1 
ATOM   822  C CE2 . PHE A 1 103 ? 3.187   39.931  191.106 1.00 83.49  ? 186 PHE A CE2 1 
ATOM   823  C CZ  . PHE A 1 103 ? 4.173   39.501  190.244 1.00 83.52  ? 186 PHE A CZ  1 
ATOM   824  N N   . LYS A 1 104 ? -0.301  36.192  192.740 1.00 91.48  ? 187 LYS A N   1 
ATOM   825  C CA  . LYS A 1 104 ? 0.105   35.943  194.122 1.00 94.47  ? 187 LYS A CA  1 
ATOM   826  C C   . LYS A 1 104 ? 0.615   34.526  194.322 1.00 92.85  ? 187 LYS A C   1 
ATOM   827  O O   . LYS A 1 104 ? 1.563   34.308  195.078 1.00 92.88  ? 187 LYS A O   1 
ATOM   828  C CB  . LYS A 1 104 ? -1.029  36.219  195.101 1.00 95.84  ? 187 LYS A CB  1 
ATOM   829  C CG  . LYS A 1 104 ? -0.526  36.299  196.523 1.00 102.32 ? 187 LYS A CG  1 
ATOM   830  C CD  . LYS A 1 104 ? -1.511  36.976  197.441 1.00 112.36 ? 187 LYS A CD  1 
ATOM   831  C CE  . LYS A 1 104 ? -0.865  37.262  198.785 1.00 121.89 ? 187 LYS A CE  1 
ATOM   832  N NZ  . LYS A 1 104 ? -1.896  37.392  199.849 1.00 131.54 ? 187 LYS A NZ  1 
ATOM   833  N N   . GLN A 1 105 ? -0.020  33.578  193.640 1.00 93.50  ? 188 GLN A N   1 
ATOM   834  C CA  . GLN A 1 105 ? 0.381   32.178  193.703 1.00 93.32  ? 188 GLN A CA  1 
ATOM   835  C C   . GLN A 1 105 ? 1.742   31.989  193.064 1.00 91.18  ? 188 GLN A C   1 
ATOM   836  O O   . GLN A 1 105 ? 2.600   31.286  193.601 1.00 93.93  ? 188 GLN A O   1 
ATOM   837  C CB  . GLN A 1 105 ? -0.612  31.283  192.977 1.00 90.80  ? 188 GLN A CB  1 
ATOM   838  C CG  . GLN A 1 105 ? -2.014  31.277  193.556 1.00 91.87  ? 188 GLN A CG  1 
ATOM   839  C CD  . GLN A 1 105 ? -2.946  30.411  192.744 1.00 89.58  ? 188 GLN A CD  1 
ATOM   840  O OE1 . GLN A 1 105 ? -2.765  29.223  192.695 1.00 85.49  ? 188 GLN A OE1 1 
ATOM   841  N NE2 . GLN A 1 105 ? -3.903  31.007  192.072 1.00 94.53  ? 188 GLN A NE2 1 
ATOM   842  N N   . ILE A 1 106 ? 1.907   32.626  191.908 1.00 88.92  ? 189 ILE A N   1 
ATOM   843  C CA  . ILE A 1 106 ? 3.181   32.706  191.201 1.00 85.72  ? 189 ILE A CA  1 
ATOM   844  C C   . ILE A 1 106 ? 4.297   33.233  192.110 1.00 87.72  ? 189 ILE A C   1 
ATOM   845  O O   . ILE A 1 106 ? 5.403   32.692  192.118 1.00 90.82  ? 189 ILE A O   1 
ATOM   846  C CB  . ILE A 1 106 ? 3.052   33.586  189.938 1.00 84.94  ? 189 ILE A CB  1 
ATOM   847  C CG1 . ILE A 1 106 ? 2.234   32.839  188.862 1.00 85.49  ? 189 ILE A CG1 1 
ATOM   848  C CG2 . ILE A 1 106 ? 4.420   33.964  189.390 1.00 85.01  ? 189 ILE A CG2 1 
ATOM   849  C CD1 . ILE A 1 106 ? 1.967   33.603  187.574 1.00 84.22  ? 189 ILE A CD1 1 
ATOM   850  N N   . VAL A 1 107 ? 4.007   34.281  192.870 1.00 87.66  ? 190 VAL A N   1 
ATOM   851  C CA  . VAL A 1 107 ? 5.021   34.899  193.714 1.00 88.38  ? 190 VAL A CA  1 
ATOM   852  C C   . VAL A 1 107 ? 5.297   34.039  194.945 1.00 93.82  ? 190 VAL A C   1 
ATOM   853  O O   . VAL A 1 107 ? 6.449   33.924  195.370 1.00 96.55  ? 190 VAL A O   1 
ATOM   854  C CB  . VAL A 1 107 ? 4.628   36.333  194.088 1.00 86.21  ? 190 VAL A CB  1 
ATOM   855  C CG1 . VAL A 1 107 ? 5.594   36.911  195.103 1.00 87.36  ? 190 VAL A CG1 1 
ATOM   856  C CG2 . VAL A 1 107 ? 4.615   37.205  192.835 1.00 86.79  ? 190 VAL A CG2 1 
ATOM   857  N N   . SER A 1 108 ? 4.257   33.421  195.506 1.00 97.49  ? 191 SER A N   1 
ATOM   858  C CA  . SER A 1 108 ? 4.438   32.513  196.647 1.00 98.88  ? 191 SER A CA  1 
ATOM   859  C C   . SER A 1 108 ? 5.338   31.369  196.288 1.00 97.42  ? 191 SER A C   1 
ATOM   860  O O   . SER A 1 108 ? 6.132   30.942  197.107 1.00 103.55 ? 191 SER A O   1 
ATOM   861  C CB  . SER A 1 108 ? 3.119   31.932  197.126 1.00 99.24  ? 191 SER A CB  1 
ATOM   862  O OG  . SER A 1 108 ? 2.155   32.944  197.277 1.00 103.10 ? 191 SER A OG  1 
ATOM   863  N N   . ALA A 1 109 ? 5.210   30.885  195.056 1.00 94.76  ? 192 ALA A N   1 
ATOM   864  C CA  . ALA A 1 109 ? 6.078   29.831  194.550 1.00 90.11  ? 192 ALA A CA  1 
ATOM   865  C C   . ALA A 1 109 ? 7.523   30.294  194.565 1.00 89.24  ? 192 ALA A C   1 
ATOM   866  O O   . ALA A 1 109 ? 8.388   29.627  195.124 1.00 87.66  ? 192 ALA A O   1 
ATOM   867  C CB  . ALA A 1 109 ? 5.661   29.413  193.139 1.00 85.87  ? 192 ALA A CB  1 
ATOM   868  N N   . VAL A 1 110 ? 7.765   31.456  193.962 1.00 92.12  ? 193 VAL A N   1 
ATOM   869  C CA  . VAL A 1 110 ? 9.114   32.002  193.830 1.00 89.87  ? 193 VAL A CA  1 
ATOM   870  C C   . VAL A 1 110 ? 9.689   32.327  195.191 1.00 91.68  ? 193 VAL A C   1 
ATOM   871  O O   . VAL A 1 110 ? 10.886  32.112  195.422 1.00 98.85  ? 193 VAL A O   1 
ATOM   872  C CB  . VAL A 1 110 ? 9.135   33.251  192.931 1.00 92.06  ? 193 VAL A CB  1 
ATOM   873  C CG1 . VAL A 1 110 ? 10.484  33.987  192.998 1.00 94.16  ? 193 VAL A CG1 1 
ATOM   874  C CG2 . VAL A 1 110 ? 8.796   32.858  191.494 1.00 93.14  ? 193 VAL A CG2 1 
ATOM   875  N N   . ALA A 1 111 ? 8.855   32.861  196.074 1.00 88.88  ? 194 ALA A N   1 
ATOM   876  C CA  . ALA A 1 111 ? 9.329   33.296  197.378 1.00 94.40  ? 194 ALA A CA  1 
ATOM   877  C C   . ALA A 1 111 ? 9.814   32.099  198.168 1.00 98.05  ? 194 ALA A C   1 
ATOM   878  O O   . ALA A 1 111 ? 10.920  32.106  198.710 1.00 99.04  ? 194 ALA A O   1 
ATOM   879  C CB  . ALA A 1 111 ? 8.230   34.020  198.129 1.00 95.58  ? 194 ALA A CB  1 
ATOM   880  N N   . HIS A 1 112 ? 8.968   31.073  198.173 1.00 102.27 ? 195 HIS A N   1 
ATOM   881  C CA  . HIS A 1 112 ? 9.212   29.782  198.822 1.00 100.00 ? 195 HIS A CA  1 
ATOM   882  C C   . HIS A 1 112 ? 10.494  29.098  198.347 1.00 97.99  ? 195 HIS A C   1 
ATOM   883  O O   . HIS A 1 112 ? 11.180  28.474  199.151 1.00 98.71  ? 195 HIS A O   1 
ATOM   884  C CB  . HIS A 1 112 ? 8.001   28.877  198.553 1.00 99.87  ? 195 HIS A CB  1 
ATOM   885  C CG  . HIS A 1 112 ? 8.122   27.502  199.115 1.00 98.82  ? 195 HIS A CG  1 
ATOM   886  N ND1 . HIS A 1 112 ? 7.902   27.222  200.440 1.00 98.60  ? 195 HIS A ND1 1 
ATOM   887  C CD2 . HIS A 1 112 ? 8.419   26.325  198.522 1.00 97.57  ? 195 HIS A CD2 1 
ATOM   888  C CE1 . HIS A 1 112 ? 8.057   25.928  200.640 1.00 99.80  ? 195 HIS A CE1 1 
ATOM   889  N NE2 . HIS A 1 112 ? 8.389   25.365  199.494 1.00 96.00  ? 195 HIS A NE2 1 
ATOM   890  N N   . CYS A 1 113 ? 10.776  29.183  197.046 1.00 95.16  ? 196 CYS A N   1 
ATOM   891  C CA  . CYS A 1 113 ? 12.039  28.711  196.483 1.00 94.66  ? 196 CYS A CA  1 
ATOM   892  C C   . CYS A 1 113 ? 13.202  29.515  197.023 1.00 97.26  ? 196 CYS A C   1 
ATOM   893  O O   . CYS A 1 113 ? 14.146  28.950  197.557 1.00 104.63 ? 196 CYS A O   1 
ATOM   894  C CB  . CYS A 1 113 ? 12.045  28.822  194.962 1.00 93.02  ? 196 CYS A CB  1 
ATOM   895  S SG  . CYS A 1 113 ? 10.995  27.630  194.121 1.00 91.15  ? 196 CYS A SG  1 
ATOM   896  N N   . HIS A 1 114 ? 13.125  30.835  196.896 1.00 99.38  ? 197 HIS A N   1 
ATOM   897  C CA  . HIS A 1 114 ? 14.188  31.726  197.381 1.00 98.84  ? 197 HIS A CA  1 
ATOM   898  C C   . HIS A 1 114 ? 14.471  31.551  198.877 1.00 105.44 ? 197 HIS A C   1 
ATOM   899  O O   . HIS A 1 114 ? 15.632  31.590  199.285 1.00 103.42 ? 197 HIS A O   1 
ATOM   900  C CB  . HIS A 1 114 ? 13.843  33.182  197.091 1.00 94.98  ? 197 HIS A CB  1 
ATOM   901  C CG  . HIS A 1 114 ? 13.914  33.554  195.642 1.00 91.09  ? 197 HIS A CG  1 
ATOM   902  N ND1 . HIS A 1 114 ? 13.848  34.859  195.209 1.00 90.45  ? 197 HIS A ND1 1 
ATOM   903  C CD2 . HIS A 1 114 ? 14.082  32.801  194.531 1.00 90.34  ? 197 HIS A CD2 1 
ATOM   904  C CE1 . HIS A 1 114 ? 13.952  34.891  193.893 1.00 87.96  ? 197 HIS A CE1 1 
ATOM   905  N NE2 . HIS A 1 114 ? 14.105  33.656  193.457 1.00 84.95  ? 197 HIS A NE2 1 
ATOM   906  N N   . GLN A 1 115 ? 13.429  31.319  199.685 1.00 114.42 ? 198 GLN A N   1 
ATOM   907  C CA  . GLN A 1 115 ? 13.616  31.008  201.134 1.00 121.63 ? 198 GLN A CA  1 
ATOM   908  C C   . GLN A 1 115 ? 14.419  29.734  201.356 1.00 112.04 ? 198 GLN A C   1 
ATOM   909  O O   . GLN A 1 115 ? 15.133  29.649  202.330 1.00 112.72 ? 198 GLN A O   1 
ATOM   910  C CB  . GLN A 1 115 ? 12.293  30.842  201.923 1.00 130.57 ? 198 GLN A CB  1 
ATOM   911  C CG  . GLN A 1 115 ? 11.263  31.979  201.871 1.00 139.94 ? 198 GLN A CG  1 
ATOM   912  C CD  . GLN A 1 115 ? 11.831  33.375  202.121 1.00 141.30 ? 198 GLN A CD  1 
ATOM   913  O OE1 . GLN A 1 115 ? 12.460  33.974  201.244 1.00 146.20 ? 198 GLN A OE1 1 
ATOM   914  N NE2 . GLN A 1 115 ? 11.572  33.909  203.308 1.00 137.96 ? 198 GLN A NE2 1 
ATOM   915  N N   . SER A 1 116 ? 14.263  28.752  200.462 1.00 108.94 ? 199 SER A N   1 
ATOM   916  C CA  . SER A 1 116 ? 15.037  27.508  200.475 1.00 106.43 ? 199 SER A CA  1 
ATOM   917  C C   . SER A 1 116 ? 16.278  27.528  199.572 1.00 106.28 ? 199 SER A C   1 
ATOM   918  O O   . SER A 1 116 ? 16.780  26.467  199.218 1.00 108.92 ? 199 SER A O   1 
ATOM   919  C CB  . SER A 1 116 ? 14.137  26.335  200.069 1.00 107.12 ? 199 SER A CB  1 
ATOM   920  O OG  . SER A 1 116 ? 13.023  26.218  200.935 1.00 113.43 ? 199 SER A OG  1 
ATOM   921  N N   . ALA A 1 117 ? 16.768  28.715  199.203 1.00 108.89 ? 200 ALA A N   1 
ATOM   922  C CA  . ALA A 1 117 ? 17.971  28.868  198.379 1.00 108.71 ? 200 ALA A CA  1 
ATOM   923  C C   . ALA A 1 117 ? 17.909  28.127  197.047 1.00 106.79 ? 200 ALA A C   1 
ATOM   924  O O   . ALA A 1 117 ? 18.894  27.542  196.606 1.00 116.95 ? 200 ALA A O   1 
ATOM   925  C CB  . ALA A 1 117 ? 19.205  28.447  199.166 1.00 110.26 ? 200 ALA A CB  1 
ATOM   926  N N   . ILE A 1 118 ? 16.742  28.119  196.424 1.00 101.37 ? 201 ILE A N   1 
ATOM   927  C CA  . ILE A 1 118 ? 16.618  27.667  195.054 1.00 100.42 ? 201 ILE A CA  1 
ATOM   928  C C   . ILE A 1 118 ? 16.375  28.963  194.289 1.00 98.64  ? 201 ILE A C   1 
ATOM   929  O O   . ILE A 1 118 ? 15.457  29.702  194.617 1.00 98.09  ? 201 ILE A O   1 
ATOM   930  C CB  . ILE A 1 118 ? 15.496  26.594  194.888 1.00 97.24  ? 201 ILE A CB  1 
ATOM   931  C CG1 . ILE A 1 118 ? 16.097  25.199  195.178 1.00 98.42  ? 201 ILE A CG1 1 
ATOM   932  C CG2 . ILE A 1 118 ? 14.947  26.568  193.459 1.00 96.32  ? 201 ILE A CG2 1 
ATOM   933  C CD1 . ILE A 1 118 ? 15.137  24.147  195.685 1.00 100.94 ? 201 ILE A CD1 1 
ATOM   934  N N   . VAL A 1 119 ? 17.244  29.255  193.328 1.00 94.90  ? 202 VAL A N   1 
ATOM   935  C CA  . VAL A 1 119 ? 17.039  30.341  192.379 1.00 94.57  ? 202 VAL A CA  1 
ATOM   936  C C   . VAL A 1 119 ? 16.463  29.709  191.116 1.00 96.10  ? 202 VAL A C   1 
ATOM   937  O O   . VAL A 1 119 ? 16.964  28.679  190.669 1.00 96.56  ? 202 VAL A O   1 
ATOM   938  C CB  . VAL A 1 119 ? 18.362  31.054  192.048 1.00 93.55  ? 202 VAL A CB  1 
ATOM   939  C CG1 . VAL A 1 119 ? 18.213  31.952  190.830 1.00 93.67  ? 202 VAL A CG1 1 
ATOM   940  C CG2 . VAL A 1 119 ? 18.821  31.853  193.246 1.00 93.75  ? 202 VAL A CG2 1 
ATOM   941  N N   . LEU A 1 120 ? 15.442  30.343  190.530 1.00 93.76  ? 203 LEU A N   1 
ATOM   942  C CA  . LEU A 1 120 ? 14.707  29.741  189.427 1.00 87.20  ? 203 LEU A CA  1 
ATOM   943  C C   . LEU A 1 120 ? 15.493  29.845  188.135 1.00 88.32  ? 203 LEU A C   1 
ATOM   944  O O   . LEU A 1 120 ? 15.637  28.862  187.428 1.00 92.13  ? 203 LEU A O   1 
ATOM   945  C CB  . LEU A 1 120 ? 13.302  30.338  189.277 1.00 86.61  ? 203 LEU A CB  1 
ATOM   946  C CG  . LEU A 1 120 ? 12.220  30.041  190.331 1.00 86.98  ? 203 LEU A CG  1 
ATOM   947  C CD1 . LEU A 1 120 ? 12.207  28.584  190.741 1.00 88.96  ? 203 LEU A CD1 1 
ATOM   948  C CD2 . LEU A 1 120 ? 12.366  30.881  191.587 1.00 90.10  ? 203 LEU A CD2 1 
ATOM   949  N N   . GLY A 1 121 ? 15.981  31.033  187.809 1.00 89.65  ? 204 GLY A N   1 
ATOM   950  C CA  . GLY A 1 121 ? 16.804  31.214  186.615 1.00 91.74  ? 204 GLY A CA  1 
ATOM   951  C C   . GLY A 1 121 ? 16.084  31.463  185.304 1.00 92.40  ? 204 GLY A C   1 
ATOM   952  O O   . GLY A 1 121 ? 16.544  32.265  184.480 1.00 110.87 ? 204 GLY A O   1 
ATOM   953  N N   . ASP A 1 122 ? 14.970  30.782  185.092 1.00 92.89  ? 205 ASP A N   1 
ATOM   954  C CA  . ASP A 1 122 ? 14.255  30.817  183.818 1.00 93.00  ? 205 ASP A CA  1 
ATOM   955  C C   . ASP A 1 122 ? 12.765  30.935  184.120 1.00 89.53  ? 205 ASP A C   1 
ATOM   956  O O   . ASP A 1 122 ? 11.994  30.062  183.765 1.00 90.13  ? 205 ASP A O   1 
ATOM   957  C CB  . ASP A 1 122 ? 14.567  29.534  183.016 1.00 96.75  ? 205 ASP A CB  1 
ATOM   958  C CG  . ASP A 1 122 ? 14.003  29.540  181.585 1.00 102.75 ? 205 ASP A CG  1 
ATOM   959  O OD1 . ASP A 1 122 ? 13.376  30.544  181.155 1.00 117.73 ? 205 ASP A OD1 1 
ATOM   960  O OD2 . ASP A 1 122 ? 14.200  28.521  180.879 1.00 100.72 ? 205 ASP A OD2 1 
ATOM   961  N N   . LEU A 1 123 ? 12.384  32.026  184.776 1.00 85.56  ? 206 LEU A N   1 
ATOM   962  C CA  . LEU A 1 123 ? 10.986  32.356  184.977 1.00 86.24  ? 206 LEU A CA  1 
ATOM   963  C C   . LEU A 1 123 ? 10.326  32.933  183.702 1.00 89.02  ? 206 LEU A C   1 
ATOM   964  O O   . LEU A 1 123 ? 10.898  33.771  182.984 1.00 89.46  ? 206 LEU A O   1 
ATOM   965  C CB  . LEU A 1 123 ? 10.803  33.341  186.125 1.00 87.71  ? 206 LEU A CB  1 
ATOM   966  C CG  . LEU A 1 123 ? 10.861  32.784  187.535 1.00 93.41  ? 206 LEU A CG  1 
ATOM   967  C CD1 . LEU A 1 123 ? 10.674  33.934  188.512 1.00 97.04  ? 206 LEU A CD1 1 
ATOM   968  C CD2 . LEU A 1 123 ? 9.793   31.723  187.770 1.00 95.32  ? 206 LEU A CD2 1 
ATOM   969  N N   . LYS A 1 124 ? 9.099   32.479  183.468 1.00 86.72  ? 207 LYS A N   1 
ATOM   970  C CA  . LYS A 1 124 ? 8.269   32.903  182.348 1.00 85.25  ? 207 LYS A CA  1 
ATOM   971  C C   . LYS A 1 124 ? 6.853   32.353  182.550 1.00 84.21  ? 207 LYS A C   1 
ATOM   972  O O   . LYS A 1 124 ? 6.638   31.419  183.332 1.00 85.13  ? 207 LYS A O   1 
ATOM   973  C CB  . LYS A 1 124 ? 8.834   32.399  181.033 1.00 81.36  ? 207 LYS A CB  1 
ATOM   974  C CG  . LYS A 1 124 ? 9.080   30.904  180.994 1.00 78.42  ? 207 LYS A CG  1 
ATOM   975  C CD  . LYS A 1 124 ? 9.690   30.508  179.667 1.00 77.31  ? 207 LYS A CD  1 
ATOM   976  C CE  . LYS A 1 124 ? 10.254  29.104  179.682 1.00 79.71  ? 207 LYS A CE  1 
ATOM   977  N NZ  . LYS A 1 124 ? 10.911  28.838  178.372 1.00 81.32  ? 207 LYS A NZ  1 
ATOM   978  N N   . LEU A 1 125 ? 5.886   32.952  181.875 1.00 79.45  ? 208 LEU A N   1 
ATOM   979  C CA  . LEU A 1 125 ? 4.511   32.566  182.080 1.00 78.51  ? 208 LEU A CA  1 
ATOM   980  C C   . LEU A 1 125 ? 4.299   31.079  181.766 1.00 77.26  ? 208 LEU A C   1 
ATOM   981  O O   . LEU A 1 125 ? 3.507   30.433  182.428 1.00 75.19  ? 208 LEU A O   1 
ATOM   982  C CB  . LEU A 1 125 ? 3.573   33.460  181.251 1.00 80.01  ? 208 LEU A CB  1 
ATOM   983  C CG  . LEU A 1 125 ? 3.349   34.885  181.766 1.00 81.43  ? 208 LEU A CG  1 
ATOM   984  C CD1 . LEU A 1 125 ? 2.547   35.682  180.760 1.00 86.59  ? 208 LEU A CD1 1 
ATOM   985  C CD2 . LEU A 1 125 ? 2.617   34.865  183.096 1.00 83.83  ? 208 LEU A CD2 1 
ATOM   986  N N   . ARG A 1 126 ? 5.035   30.544  180.788 1.00 79.90  ? 209 ARG A N   1 
ATOM   987  C CA  . ARG A 1 126 ? 4.898   29.135  180.379 1.00 82.54  ? 209 ARG A CA  1 
ATOM   988  C C   . ARG A 1 126 ? 5.208   28.162  181.508 1.00 81.07  ? 209 ARG A C   1 
ATOM   989  O O   . ARG A 1 126 ? 4.694   27.049  181.504 1.00 80.13  ? 209 ARG A O   1 
ATOM   990  C CB  . ARG A 1 126 ? 5.792   28.795  179.162 1.00 87.00  ? 209 ARG A CB  1 
ATOM   991  C CG  . ARG A 1 126 ? 5.062   28.044  178.053 1.00 99.84  ? 209 ARG A CG  1 
ATOM   992  C CD  . ARG A 1 126 ? 5.685   26.744  177.565 1.00 110.37 ? 209 ARG A CD  1 
ATOM   993  N NE  . ARG A 1 126 ? 6.659   27.001  176.500 1.00 122.00 ? 209 ARG A NE  1 
ATOM   994  C CZ  . ARG A 1 126 ? 7.986   26.774  176.528 1.00 130.89 ? 209 ARG A CZ  1 
ATOM   995  N NH1 . ARG A 1 126 ? 8.625   26.221  177.576 1.00 130.64 ? 209 ARG A NH1 1 
ATOM   996  N NH2 . ARG A 1 126 ? 8.702   27.097  175.449 1.00 136.35 ? 209 ARG A NH2 1 
ATOM   997  N N   . LYS A 1 127 ? 6.034   28.586  182.468 1.00 79.04  ? 210 LYS A N   1 
ATOM   998  C CA  . LYS A 1 127 ? 6.466   27.722  183.568 1.00 83.41  ? 210 LYS A CA  1 
ATOM   999  C C   . LYS A 1 127 ? 5.423   27.572  184.671 1.00 84.18  ? 210 LYS A C   1 
ATOM   1000 O O   . LYS A 1 127 ? 5.651   26.818  185.605 1.00 89.68  ? 210 LYS A O   1 
ATOM   1001 C CB  . LYS A 1 127 ? 7.783   28.222  184.183 1.00 81.79  ? 210 LYS A CB  1 
ATOM   1002 C CG  . LYS A 1 127 ? 8.921   28.296  183.185 1.00 89.20  ? 210 LYS A CG  1 
ATOM   1003 C CD  . LYS A 1 127 ? 9.717   27.013  183.045 1.00 96.83  ? 210 LYS A CD  1 
ATOM   1004 C CE  . LYS A 1 127 ? 11.090  27.127  183.678 1.00 103.78 ? 210 LYS A CE  1 
ATOM   1005 N NZ  . LYS A 1 127 ? 11.620  25.802  184.085 1.00 116.57 ? 210 LYS A NZ  1 
ATOM   1006 N N   . PHE A 1 128 ? 4.304   28.288  184.598 1.00 83.33  ? 211 PHE A N   1 
ATOM   1007 C CA  . PHE A 1 128 ? 3.246   28.164  185.598 1.00 83.90  ? 211 PHE A CA  1 
ATOM   1008 C C   . PHE A 1 128 ? 2.028   27.550  184.968 1.00 85.86  ? 211 PHE A C   1 
ATOM   1009 O O   . PHE A 1 128 ? 1.560   28.014  183.915 1.00 81.60  ? 211 PHE A O   1 
ATOM   1010 C CB  . PHE A 1 128 ? 2.950   29.517  186.232 1.00 82.64  ? 211 PHE A CB  1 
ATOM   1011 C CG  . PHE A 1 128 ? 4.043   29.956  187.141 1.00 83.10  ? 211 PHE A CG  1 
ATOM   1012 C CD1 . PHE A 1 128 ? 4.048   29.556  188.458 1.00 87.94  ? 211 PHE A CD1 1 
ATOM   1013 C CD2 . PHE A 1 128 ? 5.124   30.655  186.656 1.00 82.32  ? 211 PHE A CD2 1 
ATOM   1014 C CE1 . PHE A 1 128 ? 5.087   29.896  189.298 1.00 87.94  ? 211 PHE A CE1 1 
ATOM   1015 C CE2 . PHE A 1 128 ? 6.155   31.012  187.488 1.00 83.32  ? 211 PHE A CE2 1 
ATOM   1016 C CZ  . PHE A 1 128 ? 6.138   30.638  188.810 1.00 86.66  ? 211 PHE A CZ  1 
ATOM   1017 N N   . VAL A 1 129 ? 1.519   26.497  185.611 1.00 84.95  ? 212 VAL A N   1 
ATOM   1018 C CA  . VAL A 1 129 ? 0.410   25.713  185.045 1.00 87.85  ? 212 VAL A CA  1 
ATOM   1019 C C   . VAL A 1 129 ? -0.763  25.550  186.002 1.00 87.67  ? 212 VAL A C   1 
ATOM   1020 O O   . VAL A 1 129 ? -0.577  25.448  187.217 1.00 97.43  ? 212 VAL A O   1 
ATOM   1021 C CB  . VAL A 1 129 ? 0.876   24.321  184.567 1.00 88.41  ? 212 VAL A CB  1 
ATOM   1022 C CG1 . VAL A 1 129 ? 1.852   24.459  183.415 1.00 85.33  ? 212 VAL A CG1 1 
ATOM   1023 C CG2 . VAL A 1 129 ? 1.482   23.486  185.701 1.00 87.47  ? 212 VAL A CG2 1 
ATOM   1024 N N   . PHE A 1 130 ? -1.966  25.510  185.444 1.00 88.27  ? 213 PHE A N   1 
ATOM   1025 C CA  . PHE A 1 130 ? -3.167  25.260  186.238 1.00 87.52  ? 213 PHE A CA  1 
ATOM   1026 C C   . PHE A 1 130 ? -3.140  23.826  186.722 1.00 84.63  ? 213 PHE A C   1 
ATOM   1027 O O   . PHE A 1 130 ? -2.859  22.913  185.966 1.00 84.51  ? 213 PHE A O   1 
ATOM   1028 C CB  . PHE A 1 130 ? -4.444  25.526  185.428 1.00 88.49  ? 213 PHE A CB  1 
ATOM   1029 C CG  . PHE A 1 130 ? -4.658  26.973  185.093 1.00 88.17  ? 213 PHE A CG  1 
ATOM   1030 C CD1 . PHE A 1 130 ? -4.891  27.903  186.096 1.00 89.19  ? 213 PHE A CD1 1 
ATOM   1031 C CD2 . PHE A 1 130 ? -4.630  27.412  183.779 1.00 94.67  ? 213 PHE A CD2 1 
ATOM   1032 C CE1 . PHE A 1 130 ? -5.093  29.238  185.791 1.00 91.16  ? 213 PHE A CE1 1 
ATOM   1033 C CE2 . PHE A 1 130 ? -4.830  28.758  183.459 1.00 94.37  ? 213 PHE A CE2 1 
ATOM   1034 C CZ  . PHE A 1 130 ? -5.067  29.667  184.470 1.00 91.86  ? 213 PHE A CZ  1 
ATOM   1035 N N   . SER A 1 131 ? -3.484  23.633  187.977 1.00 86.53  ? 214 SER A N   1 
ATOM   1036 C CA  . SER A 1 131 ? -3.497  22.308  188.580 1.00 89.08  ? 214 SER A CA  1 
ATOM   1037 C C   . SER A 1 131 ? -4.851  21.516  188.495 1.00 91.54  ? 214 SER A C   1 
ATOM   1038 O O   . SER A 1 131 ? -4.851  20.331  188.753 1.00 96.16  ? 214 SER A O   1 
ATOM   1039 C CB  . SER A 1 131 ? -3.053  22.447  190.023 1.00 88.41  ? 214 SER A CB  1 
ATOM   1040 O OG  . SER A 1 131 ? -3.985  23.203  190.741 1.00 90.60  ? 214 SER A OG  1 
ATOM   1041 N N   . THR A 1 132 ? -5.969  22.170  188.173 1.00 96.17  ? 215 THR A N   1 
ATOM   1042 C CA  . THR A 1 132 ? -7.276  21.535  187.947 1.00 102.33 ? 215 THR A CA  1 
ATOM   1043 C C   . THR A 1 132 ? -8.026  22.158  186.796 1.00 105.12 ? 215 THR A C   1 
ATOM   1044 O O   . THR A 1 132 ? -7.653  23.256  186.368 1.00 106.40 ? 215 THR A O   1 
ATOM   1045 C CB  . THR A 1 132 ? -8.154  21.783  189.177 1.00 106.77 ? 215 THR A CB  1 
ATOM   1046 O OG1 . THR A 1 132 ? -7.772  23.028  189.778 1.00 109.31 ? 215 THR A OG1 1 
ATOM   1047 C CG2 . THR A 1 132 ? -7.981  20.639  190.133 1.00 110.22 ? 215 THR A CG2 1 
ATOM   1048 N N   . GLU A 1 133 ? -9.092  21.505  186.309 1.00 109.22 ? 216 GLU A N   1 
ATOM   1049 C CA  . GLU A 1 133 ? -9.923  22.137  185.250 1.00 117.27 ? 216 GLU A CA  1 
ATOM   1050 C C   . GLU A 1 133 ? -10.579 23.405  185.766 1.00 113.68 ? 216 GLU A C   1 
ATOM   1051 O O   . GLU A 1 133 ? -10.982 24.225  184.952 1.00 113.95 ? 216 GLU A O   1 
ATOM   1052 C CB  . GLU A 1 133 ? -11.076 21.291  184.641 1.00 128.89 ? 216 GLU A CB  1 
ATOM   1053 C CG  . GLU A 1 133 ? -10.847 19.812  184.465 1.00 137.03 ? 216 GLU A CG  1 
ATOM   1054 C CD  . GLU A 1 133 ? -11.410 19.016  185.625 1.00 147.08 ? 216 GLU A CD  1 
ATOM   1055 O OE1 . GLU A 1 133 ? -10.572 18.691  186.494 1.00 151.15 ? 216 GLU A OE1 1 
ATOM   1056 O OE2 . GLU A 1 133 ? -12.653 18.763  185.688 1.00 149.04 ? 216 GLU A OE2 1 
ATOM   1057 N N   . GLU A 1 134 ? -10.759 23.524  187.086 1.00 111.08 ? 217 GLU A N   1 
ATOM   1058 C CA  . GLU A 1 134 ? -11.096 24.811  187.722 1.00 112.71 ? 217 GLU A CA  1 
ATOM   1059 C C   . GLU A 1 134 ? -10.307 25.962  187.099 1.00 108.54 ? 217 GLU A C   1 
ATOM   1060 O O   . GLU A 1 134 ? -10.878 26.992  186.735 1.00 108.23 ? 217 GLU A O   1 
ATOM   1061 C CB  . GLU A 1 134 ? -10.818 24.787  189.235 1.00 117.08 ? 217 GLU A CB  1 
ATOM   1062 C CG  . GLU A 1 134 ? -12.032 24.494  190.115 1.00 122.41 ? 217 GLU A CG  1 
ATOM   1063 C CD  . GLU A 1 134 ? -12.504 23.056  190.018 1.00 127.57 ? 217 GLU A CD  1 
ATOM   1064 O OE1 . GLU A 1 134 ? -11.641 22.137  189.935 1.00 131.13 ? 217 GLU A OE1 1 
ATOM   1065 O OE2 . GLU A 1 134 ? -13.741 22.838  190.029 1.00 134.65 ? 217 GLU A OE2 1 
ATOM   1066 N N   . ARG A 1 135 ? -8.995  25.763  186.981 1.00 102.44 ? 218 ARG A N   1 
ATOM   1067 C CA  . ARG A 1 135 ? -8.098  26.738  186.399 1.00 93.90  ? 218 ARG A CA  1 
ATOM   1068 C C   . ARG A 1 135 ? -8.163  28.058  187.175 1.00 96.18  ? 218 ARG A C   1 
ATOM   1069 O O   . ARG A 1 135 ? -8.280  29.153  186.615 1.00 93.46  ? 218 ARG A O   1 
ATOM   1070 C CB  . ARG A 1 135 ? -8.396  26.904  184.925 1.00 90.35  ? 218 ARG A CB  1 
ATOM   1071 C CG  . ARG A 1 135 ? -8.047  25.686  184.117 1.00 86.89  ? 218 ARG A CG  1 
ATOM   1072 C CD  . ARG A 1 135 ? -8.417  26.025  182.732 1.00 88.85  ? 218 ARG A CD  1 
ATOM   1073 N NE  . ARG A 1 135 ? -7.974  25.075  181.733 1.00 91.45  ? 218 ARG A NE  1 
ATOM   1074 C CZ  . ARG A 1 135 ? -8.635  23.964  181.393 1.00 89.03  ? 218 ARG A CZ  1 
ATOM   1075 N NH1 . ARG A 1 135 ? -9.747  23.622  182.034 1.00 90.57  ? 218 ARG A NH1 1 
ATOM   1076 N NH2 . ARG A 1 135 ? -8.166  23.166  180.436 1.00 85.40  ? 218 ARG A NH2 1 
ATOM   1077 N N   . THR A 1 136 ? -8.106  27.882  188.490 1.00 100.80 ? 219 THR A N   1 
ATOM   1078 C CA  . THR A 1 136 ? -8.050  28.927  189.493 1.00 103.59 ? 219 THR A CA  1 
ATOM   1079 C C   . THR A 1 136 ? -6.751  28.893  190.307 1.00 104.05 ? 219 THR A C   1 
ATOM   1080 O O   . THR A 1 136 ? -6.473  29.842  191.035 1.00 103.60 ? 219 THR A O   1 
ATOM   1081 C CB  . THR A 1 136 ? -9.174  28.689  190.514 1.00 109.21 ? 219 THR A CB  1 
ATOM   1082 O OG1 . THR A 1 136 ? -9.023  27.376  191.087 1.00 114.74 ? 219 THR A OG1 1 
ATOM   1083 C CG2 . THR A 1 136 ? -10.549 28.802  189.848 1.00 112.30 ? 219 THR A CG2 1 
ATOM   1084 N N   . GLN A 1 137 ? -5.991  27.793  190.188 1.00 103.81 ? 220 GLN A N   1 
ATOM   1085 C CA  . GLN A 1 137 ? -4.862  27.457  191.042 1.00 99.32  ? 220 GLN A CA  1 
ATOM   1086 C C   . GLN A 1 137 ? -3.634  27.139  190.176 1.00 92.98  ? 220 GLN A C   1 
ATOM   1087 O O   . GLN A 1 137 ? -3.670  26.220  189.365 1.00 91.91  ? 220 GLN A O   1 
ATOM   1088 C CB  . GLN A 1 137 ? -5.257  26.247  191.882 1.00 104.34 ? 220 GLN A CB  1 
ATOM   1089 C CG  . GLN A 1 137 ? -4.112  25.415  192.463 1.00 109.23 ? 220 GLN A CG  1 
ATOM   1090 C CD  . GLN A 1 137 ? -3.580  25.905  193.784 1.00 117.33 ? 220 GLN A CD  1 
ATOM   1091 O OE1 . GLN A 1 137 ? -3.923  26.987  194.260 1.00 129.91 ? 220 GLN A OE1 1 
ATOM   1092 N NE2 . GLN A 1 137 ? -2.750  25.081  194.408 1.00 122.14 ? 220 GLN A NE2 1 
ATOM   1093 N N   . LEU A 1 138 ? -2.547  27.878  190.364 1.00 91.60  ? 221 LEU A N   1 
ATOM   1094 C CA  . LEU A 1 138 ? -1.306  27.675  189.604 1.00 87.60  ? 221 LEU A CA  1 
ATOM   1095 C C   . LEU A 1 138 ? -0.268  26.891  190.385 1.00 85.51  ? 221 LEU A C   1 
ATOM   1096 O O   . LEU A 1 138 ? -0.275  26.853  191.617 1.00 86.04  ? 221 LEU A O   1 
ATOM   1097 C CB  . LEU A 1 138 ? -0.692  29.010  189.217 1.00 84.26  ? 221 LEU A CB  1 
ATOM   1098 C CG  . LEU A 1 138 ? -1.520  29.787  188.214 1.00 88.62  ? 221 LEU A CG  1 
ATOM   1099 C CD1 . LEU A 1 138 ? -0.889  31.145  188.001 1.00 88.52  ? 221 LEU A CD1 1 
ATOM   1100 C CD2 . LEU A 1 138 ? -1.646  29.061  186.881 1.00 92.21  ? 221 LEU A CD2 1 
ATOM   1101 N N   . ARG A 1 139 ? 0.637   26.276  189.646 1.00 81.48  ? 222 ARG A N   1 
ATOM   1102 C CA  . ARG A 1 139 ? 1.828   25.700  190.243 1.00 81.73  ? 222 ARG A CA  1 
ATOM   1103 C C   . ARG A 1 139 ? 2.985   25.829  189.241 1.00 80.64  ? 222 ARG A C   1 
ATOM   1104 O O   . ARG A 1 139 ? 2.780   25.780  188.004 1.00 77.46  ? 222 ARG A O   1 
ATOM   1105 C CB  . ARG A 1 139 ? 1.616   24.277  190.775 1.00 84.07  ? 222 ARG A CB  1 
ATOM   1106 C CG  . ARG A 1 139 ? 1.003   23.358  189.765 1.00 87.57  ? 222 ARG A CG  1 
ATOM   1107 C CD  . ARG A 1 139 ? 1.026   21.893  190.198 1.00 87.17  ? 222 ARG A CD  1 
ATOM   1108 N NE  . ARG A 1 139 ? 1.272   21.077  189.005 1.00 91.05  ? 222 ARG A NE  1 
ATOM   1109 C CZ  . ARG A 1 139 ? 0.391   20.265  188.417 1.00 95.21  ? 222 ARG A CZ  1 
ATOM   1110 N NH1 . ARG A 1 139 ? -0.840  20.091  188.910 1.00 103.60 ? 222 ARG A NH1 1 
ATOM   1111 N NH2 . ARG A 1 139 ? 0.746   19.593  187.324 1.00 92.18  ? 222 ARG A NH2 1 
ATOM   1112 N N   . LEU A 1 140 ? 4.170   26.097  189.791 1.00 79.09  ? 223 LEU A N   1 
ATOM   1113 C CA  . LEU A 1 140 ? 5.409   26.056  189.038 1.00 78.41  ? 223 LEU A CA  1 
ATOM   1114 C C   . LEU A 1 140 ? 5.558   24.657  188.463 1.00 80.67  ? 223 LEU A C   1 
ATOM   1115 O O   . LEU A 1 140 ? 5.588   23.675  189.189 1.00 88.30  ? 223 LEU A O   1 
ATOM   1116 C CB  . LEU A 1 140 ? 6.591   26.409  189.933 1.00 79.19  ? 223 LEU A CB  1 
ATOM   1117 C CG  . LEU A 1 140 ? 7.979   26.353  189.311 1.00 79.66  ? 223 LEU A CG  1 
ATOM   1118 C CD1 . LEU A 1 140 ? 8.082   27.196  188.059 1.00 78.39  ? 223 LEU A CD1 1 
ATOM   1119 C CD2 . LEU A 1 140 ? 8.984   26.815  190.340 1.00 83.50  ? 223 LEU A CD2 1 
ATOM   1120 N N   . GLU A 1 141 ? 5.622   24.588  187.145 1.00 87.46  ? 224 GLU A N   1 
ATOM   1121 C CA  . GLU A 1 141 ? 5.481   23.354  186.381 1.00 92.23  ? 224 GLU A CA  1 
ATOM   1122 C C   . GLU A 1 141 ? 6.568   22.378  186.699 1.00 93.46  ? 224 GLU A C   1 
ATOM   1123 O O   . GLU A 1 141 ? 6.319   21.168  186.817 1.00 107.49 ? 224 GLU A O   1 
ATOM   1124 C CB  . GLU A 1 141 ? 5.572   23.682  184.902 1.00 99.75  ? 224 GLU A CB  1 
ATOM   1125 C CG  . GLU A 1 141 ? 5.325   22.531  183.947 1.00 115.03 ? 224 GLU A CG  1 
ATOM   1126 C CD  . GLU A 1 141 ? 5.555   22.937  182.497 1.00 129.59 ? 224 GLU A CD  1 
ATOM   1127 O OE1 . GLU A 1 141 ? 6.446   23.797  182.243 1.00 127.26 ? 224 GLU A OE1 1 
ATOM   1128 O OE2 . GLU A 1 141 ? 4.840   22.390  181.616 1.00 139.15 ? 224 GLU A OE2 1 
ATOM   1129 N N   . SER A 1 142 ? 7.767   22.915  186.864 1.00 89.40  ? 225 SER A N   1 
ATOM   1130 C CA  . SER A 1 142 ? 8.954   22.128  186.829 1.00 92.17  ? 225 SER A CA  1 
ATOM   1131 C C   . SER A 1 142 ? 10.081  22.833  187.545 1.00 90.88  ? 225 SER A C   1 
ATOM   1132 O O   . SER A 1 142 ? 10.194  24.050  187.487 1.00 95.77  ? 225 SER A O   1 
ATOM   1133 C CB  . SER A 1 142 ? 9.327   21.913  185.371 1.00 95.47  ? 225 SER A CB  1 
ATOM   1134 O OG  . SER A 1 142 ? 10.507  21.149  185.264 1.00 107.10 ? 225 SER A OG  1 
ATOM   1135 N N   . LEU A 1 143 ? 10.907  22.054  188.232 1.00 93.10  ? 226 LEU A N   1 
ATOM   1136 C CA  . LEU A 1 143 ? 12.169  22.542  188.782 1.00 92.03  ? 226 LEU A CA  1 
ATOM   1137 C C   . LEU A 1 143 ? 13.380  22.037  188.001 1.00 93.72  ? 226 LEU A C   1 
ATOM   1138 O O   . LEU A 1 143 ? 14.484  22.373  188.362 1.00 85.08  ? 226 LEU A O   1 
ATOM   1139 C CB  . LEU A 1 143 ? 12.297  22.125  190.237 1.00 91.08  ? 226 LEU A CB  1 
ATOM   1140 C CG  . LEU A 1 143 ? 11.205  22.624  191.188 1.00 91.09  ? 226 LEU A CG  1 
ATOM   1141 C CD1 . LEU A 1 143 ? 11.345  22.003  192.570 1.00 92.51  ? 226 LEU A CD1 1 
ATOM   1142 C CD2 . LEU A 1 143 ? 11.232  24.139  191.292 1.00 89.78  ? 226 LEU A CD2 1 
ATOM   1143 N N   . GLU A 1 144 ? 13.167  21.310  186.897 1.00 107.93 ? 227 GLU A N   1 
ATOM   1144 C CA  . GLU A 1 144 ? 14.247  20.599  186.179 1.00 119.53 ? 227 GLU A CA  1 
ATOM   1145 C C   . GLU A 1 144 ? 15.526  21.408  186.020 1.00 118.26 ? 227 GLU A C   1 
ATOM   1146 O O   . GLU A 1 144 ? 16.610  20.846  186.116 1.00 115.55 ? 227 GLU A O   1 
ATOM   1147 C CB  . GLU A 1 144 ? 13.844  20.153  184.749 1.00 135.92 ? 227 GLU A CB  1 
ATOM   1148 C CG  . GLU A 1 144 ? 12.743  19.109  184.532 1.00 141.45 ? 227 GLU A CG  1 
ATOM   1149 C CD  . GLU A 1 144 ? 12.609  18.049  185.614 1.00 152.15 ? 227 GLU A CD  1 
ATOM   1150 O OE1 . GLU A 1 144 ? 13.523  17.202  185.737 1.00 154.75 ? 227 GLU A OE1 1 
ATOM   1151 O OE2 . GLU A 1 144 ? 11.563  18.041  186.312 1.00 150.86 ? 227 GLU A OE2 1 
ATOM   1152 N N   . ASP A 1 145 ? 15.413  22.700  185.717 1.00 118.95 ? 228 ASP A N   1 
ATOM   1153 C CA  . ASP A 1 145 ? 16.618  23.528  185.587 1.00 126.08 ? 228 ASP A CA  1 
ATOM   1154 C C   . ASP A 1 145 ? 16.512  24.846  186.345 1.00 120.13 ? 228 ASP A C   1 
ATOM   1155 O O   . ASP A 1 145 ? 16.385  25.944  185.782 1.00 134.84 ? 228 ASP A O   1 
ATOM   1156 C CB  . ASP A 1 145 ? 17.020  23.697  184.115 1.00 135.21 ? 228 ASP A CB  1 
ATOM   1157 C CG  . ASP A 1 145 ? 17.878  22.534  183.607 1.00 138.07 ? 228 ASP A CG  1 
ATOM   1158 O OD1 . ASP A 1 145 ? 19.015  22.348  184.111 1.00 142.46 ? 228 ASP A OD1 1 
ATOM   1159 O OD2 . ASP A 1 145 ? 17.428  21.820  182.691 1.00 134.39 ? 228 ASP A OD2 1 
ATOM   1160 N N   . THR A 1 146 ? 16.541  24.678  187.655 1.00 105.48 ? 229 THR A N   1 
ATOM   1161 C CA  . THR A 1 146 ? 16.682  25.746  188.597 1.00 96.35  ? 229 THR A CA  1 
ATOM   1162 C C   . THR A 1 146 ? 18.083  25.539  189.165 1.00 94.20  ? 229 THR A C   1 
ATOM   1163 O O   . THR A 1 146 ? 18.801  24.654  188.699 1.00 84.92  ? 229 THR A O   1 
ATOM   1164 C CB  . THR A 1 146 ? 15.590  25.655  189.680 1.00 92.14  ? 229 THR A CB  1 
ATOM   1165 O OG1 . THR A 1 146 ? 15.607  24.356  190.267 1.00 92.29  ? 229 THR A OG1 1 
ATOM   1166 C CG2 . THR A 1 146 ? 14.215  25.893  189.089 1.00 91.16  ? 229 THR A CG2 1 
ATOM   1167 N N   . HIS A 1 147 ? 18.451  26.354  190.154 1.00 93.80  ? 230 HIS A N   1 
ATOM   1168 C CA  . HIS A 1 147 ? 19.810  26.448  190.664 1.00 93.48  ? 230 HIS A CA  1 
ATOM   1169 C C   . HIS A 1 147 ? 19.825  26.331  192.174 1.00 96.28  ? 230 HIS A C   1 
ATOM   1170 O O   . HIS A 1 147 ? 19.291  27.182  192.880 1.00 96.17  ? 230 HIS A O   1 
ATOM   1171 C CB  . HIS A 1 147 ? 20.416  27.787  190.257 1.00 94.79  ? 230 HIS A CB  1 
ATOM   1172 C CG  . HIS A 1 147 ? 20.481  27.991  188.773 1.00 95.87  ? 230 HIS A CG  1 
ATOM   1173 N ND1 . HIS A 1 147 ? 21.482  27.459  187.988 1.00 99.63  ? 230 HIS A ND1 1 
ATOM   1174 C CD2 . HIS A 1 147 ? 19.661  28.658  187.930 1.00 91.69  ? 230 HIS A CD2 1 
ATOM   1175 C CE1 . HIS A 1 147 ? 21.279  27.799  186.727 1.00 96.46  ? 230 HIS A CE1 1 
ATOM   1176 N NE2 . HIS A 1 147 ? 20.176  28.519  186.665 1.00 92.04  ? 230 HIS A NE2 1 
ATOM   1177 N N   . ILE A 1 148 ? 20.454  25.276  192.678 1.00 98.68  ? 231 ILE A N   1 
ATOM   1178 C CA  . ILE A 1 148 ? 20.463  25.026  194.104 1.00 100.48 ? 231 ILE A CA  1 
ATOM   1179 C C   . ILE A 1 148 ? 21.617  25.794  194.729 1.00 103.11 ? 231 ILE A C   1 
ATOM   1180 O O   . ILE A 1 148 ? 22.773  25.501  194.461 1.00 100.81 ? 231 ILE A O   1 
ATOM   1181 C CB  . ILE A 1 148 ? 20.590  23.492  194.362 1.00 101.56 ? 231 ILE A CB  1 
ATOM   1182 C CG1 . ILE A 1 148 ? 19.366  22.779  193.815 1.00 102.17 ? 231 ILE A CG1 1 
ATOM   1183 C CG2 . ILE A 1 148 ? 20.885  23.166  195.813 1.00 103.99 ? 231 ILE A CG2 1 
ATOM   1184 C CD1 . ILE A 1 148 ? 19.176  21.336  194.220 1.00 104.16 ? 231 ILE A CD1 1 
ATOM   1185 N N   . MET A 1 149 ? 21.278  26.749  195.585 1.00 107.05 ? 232 MET A N   1 
ATOM   1186 C CA  . MET A 1 149 ? 22.252  27.614  196.230 1.00 116.12 ? 232 MET A CA  1 
ATOM   1187 C C   . MET A 1 149 ? 22.612  27.111  197.607 1.00 120.63 ? 232 MET A C   1 
ATOM   1188 O O   . MET A 1 149 ? 21.975  26.200  198.133 1.00 120.77 ? 232 MET A O   1 
ATOM   1189 C CB  . MET A 1 149 ? 21.713  29.056  196.305 1.00 119.53 ? 232 MET A CB  1 
ATOM   1190 C CG  . MET A 1 149 ? 22.173  29.957  195.179 1.00 119.95 ? 232 MET A CG  1 
ATOM   1191 S SD  . MET A 1 149 ? 22.591  29.106  193.656 1.00 125.99 ? 232 MET A SD  1 
ATOM   1192 C CE  . MET A 1 149 ? 22.574  30.458  192.483 1.00 124.02 ? 232 MET A CE  1 
ATOM   1193 N N   . LYS A 1 150 ? 23.641  27.744  198.172 1.00 132.29 ? 233 LYS A N   1 
ATOM   1194 C CA  . LYS A 1 150 ? 24.238  27.383  199.470 1.00 138.42 ? 233 LYS A CA  1 
ATOM   1195 C C   . LYS A 1 150 ? 24.020  28.561  200.406 1.00 139.10 ? 233 LYS A C   1 
ATOM   1196 O O   . LYS A 1 150 ? 24.708  29.588  200.309 1.00 132.48 ? 233 LYS A O   1 
ATOM   1197 C CB  . LYS A 1 150 ? 25.733  27.007  199.363 1.00 139.40 ? 233 LYS A CB  1 
ATOM   1198 C CG  . LYS A 1 150 ? 26.324  27.071  197.979 1.00 141.51 ? 233 LYS A CG  1 
ATOM   1199 C CD  . LYS A 1 150 ? 27.667  26.385  197.878 1.00 145.90 ? 233 LYS A CD  1 
ATOM   1200 C CE  . LYS A 1 150 ? 28.434  26.903  196.667 1.00 149.46 ? 233 LYS A CE  1 
ATOM   1201 N NZ  . LYS A 1 150 ? 29.906  26.827  196.867 1.00 154.87 ? 233 LYS A NZ  1 
ATOM   1202 N N   . GLY A 1 151 ? 23.002  28.406  201.253 1.00 142.85 ? 234 GLY A N   1 
ATOM   1203 C CA  . GLY A 1 151 ? 22.659  29.362  202.295 1.00 145.59 ? 234 GLY A CA  1 
ATOM   1204 C C   . GLY A 1 151 ? 22.024  30.638  201.771 1.00 141.67 ? 234 GLY A C   1 
ATOM   1205 O O   . GLY A 1 151 ? 20.924  30.618  201.219 1.00 139.90 ? 234 GLY A O   1 
ATOM   1206 N N   . GLU A 1 152 ? 22.740  31.743  201.947 1.00 141.85 ? 235 GLU A N   1 
ATOM   1207 C CA  . GLU A 1 152 ? 22.279  33.083  201.567 1.00 139.47 ? 235 GLU A CA  1 
ATOM   1208 C C   . GLU A 1 152 ? 22.834  33.529  200.199 1.00 136.93 ? 235 GLU A C   1 
ATOM   1209 O O   . GLU A 1 152 ? 22.372  34.528  199.644 1.00 135.67 ? 235 GLU A O   1 
ATOM   1210 C CB  . GLU A 1 152 ? 22.648  34.103  202.658 1.00 142.05 ? 235 GLU A CB  1 
ATOM   1211 C CG  . GLU A 1 152 ? 24.097  34.017  203.146 1.00 145.70 ? 235 GLU A CG  1 
ATOM   1212 C CD  . GLU A 1 152 ? 24.571  35.245  203.896 1.00 151.66 ? 235 GLU A CD  1 
ATOM   1213 O OE1 . GLU A 1 152 ? 24.129  36.371  203.584 1.00 159.05 ? 235 GLU A OE1 1 
ATOM   1214 O OE2 . GLU A 1 152 ? 25.413  35.088  204.801 1.00 155.25 ? 235 GLU A OE2 1 
ATOM   1215 N N   . ASP A 1 153 ? 23.813  32.796  199.658 1.00 135.50 ? 236 ASP A N   1 
ATOM   1216 C CA  . ASP A 1 153 ? 24.391  33.111  198.350 1.00 128.77 ? 236 ASP A CA  1 
ATOM   1217 C C   . ASP A 1 153 ? 23.367  32.926  197.220 1.00 124.47 ? 236 ASP A C   1 
ATOM   1218 O O   . ASP A 1 153 ? 22.480  32.073  197.308 1.00 126.95 ? 236 ASP A O   1 
ATOM   1219 C CB  . ASP A 1 153 ? 25.615  32.234  198.088 1.00 128.61 ? 236 ASP A CB  1 
ATOM   1220 C CG  . ASP A 1 153 ? 26.265  32.539  196.760 1.00 128.28 ? 236 ASP A CG  1 
ATOM   1221 O OD1 . ASP A 1 153 ? 26.898  33.611  196.624 1.00 133.29 ? 236 ASP A OD1 1 
ATOM   1222 O OD2 . ASP A 1 153 ? 26.118  31.716  195.845 1.00 122.34 ? 236 ASP A OD2 1 
ATOM   1223 N N   . ASP A 1 154 ? 23.466  33.757  196.186 1.00 115.11 ? 237 ASP A N   1 
ATOM   1224 C CA  . ASP A 1 154 ? 22.602  33.640  195.001 1.00 106.72 ? 237 ASP A CA  1 
ATOM   1225 C C   . ASP A 1 154 ? 23.245  34.085  193.672 1.00 104.85 ? 237 ASP A C   1 
ATOM   1226 O O   . ASP A 1 154 ? 22.545  34.322  192.690 1.00 99.84  ? 237 ASP A O   1 
ATOM   1227 C CB  . ASP A 1 154 ? 21.281  34.394  195.259 1.00 107.32 ? 237 ASP A CB  1 
ATOM   1228 C CG  . ASP A 1 154 ? 21.367  35.904  194.969 1.00 107.20 ? 237 ASP A CG  1 
ATOM   1229 O OD1 . ASP A 1 154 ? 22.387  36.556  195.280 1.00 110.23 ? 237 ASP A OD1 1 
ATOM   1230 O OD2 . ASP A 1 154 ? 20.389  36.434  194.407 1.00 107.04 ? 237 ASP A OD2 1 
ATOM   1231 N N   . ALA A 1 155 ? 24.570  34.199  193.640 1.00 110.69 ? 238 ALA A N   1 
ATOM   1232 C CA  . ALA A 1 155 ? 25.266  34.758  192.487 1.00 108.76 ? 238 ALA A CA  1 
ATOM   1233 C C   . ALA A 1 155 ? 25.383  33.653  191.465 1.00 105.02 ? 238 ALA A C   1 
ATOM   1234 O O   . ALA A 1 155 ? 25.676  32.533  191.808 1.00 105.90 ? 238 ALA A O   1 
ATOM   1235 C CB  . ALA A 1 155 ? 26.635  35.275  192.885 1.00 112.39 ? 238 ALA A CB  1 
ATOM   1236 N N   . LEU A 1 156 ? 25.094  33.954  190.216 1.00 106.19 ? 239 LEU A N   1 
ATOM   1237 C CA  . LEU A 1 156 ? 25.243  32.967  189.170 1.00 104.09 ? 239 LEU A CA  1 
ATOM   1238 C C   . LEU A 1 156 ? 25.573  33.669  187.866 1.00 104.10 ? 239 LEU A C   1 
ATOM   1239 O O   . LEU A 1 156 ? 25.299  34.864  187.729 1.00 110.39 ? 239 LEU A O   1 
ATOM   1240 C CB  . LEU A 1 156 ? 23.984  32.095  189.103 1.00 105.01 ? 239 LEU A CB  1 
ATOM   1241 C CG  . LEU A 1 156 ? 22.625  32.714  188.739 1.00 105.88 ? 239 LEU A CG  1 
ATOM   1242 C CD1 . LEU A 1 156 ? 22.330  32.532  187.266 1.00 106.35 ? 239 LEU A CD1 1 
ATOM   1243 C CD2 . LEU A 1 156 ? 21.493  32.071  189.518 1.00 104.68 ? 239 LEU A CD2 1 
ATOM   1244 N N   . SER A 1 157 ? 26.181  32.936  186.934 1.00 103.54 ? 240 SER A N   1 
ATOM   1245 C CA  . SER A 1 157 ? 26.621  33.477  185.635 1.00 107.83 ? 240 SER A CA  1 
ATOM   1246 C C   . SER A 1 157 ? 26.129  32.757  184.355 1.00 110.27 ? 240 SER A C   1 
ATOM   1247 O O   . SER A 1 157 ? 26.465  33.205  183.265 1.00 110.85 ? 240 SER A O   1 
ATOM   1248 C CB  . SER A 1 157 ? 28.150  33.589  185.626 1.00 113.57 ? 240 SER A CB  1 
ATOM   1249 O OG  . SER A 1 157 ? 28.717  32.798  186.643 1.00 118.39 ? 240 SER A OG  1 
ATOM   1250 N N   . ASP A 1 158 ? 25.337  31.687  184.488 1.00 113.48 ? 241 ASP A N   1 
ATOM   1251 C CA  . ASP A 1 158 ? 24.694  30.942  183.344 1.00 119.63 ? 241 ASP A CA  1 
ATOM   1252 C C   . ASP A 1 158 ? 24.228  31.775  182.118 1.00 109.89 ? 241 ASP A C   1 
ATOM   1253 O O   . ASP A 1 158 ? 24.685  31.569  180.979 1.00 111.27 ? 241 ASP A O   1 
ATOM   1254 C CB  . ASP A 1 158 ? 23.486  30.138  183.913 1.00 134.15 ? 241 ASP A CB  1 
ATOM   1255 C CG  . ASP A 1 158 ? 22.868  29.142  182.910 1.00 141.36 ? 241 ASP A CG  1 
ATOM   1256 O OD1 . ASP A 1 158 ? 23.240  29.121  181.703 1.00 139.80 ? 241 ASP A OD1 1 
ATOM   1257 O OD2 . ASP A 1 158 ? 21.982  28.371  183.367 1.00 142.89 ? 241 ASP A OD2 1 
ATOM   1258 N N   . LYS A 1 159 ? 23.311  32.693  182.345 1.00 98.88  ? 242 LYS A N   1 
ATOM   1259 C CA  . LYS A 1 159 ? 22.668  33.469  181.250 1.00 97.29  ? 242 LYS A CA  1 
ATOM   1260 C C   . LYS A 1 159 ? 21.918  32.685  180.163 1.00 94.35  ? 242 LYS A C   1 
ATOM   1261 O O   . LYS A 1 159 ? 22.252  32.705  178.973 1.00 99.38  ? 242 LYS A O   1 
ATOM   1262 C CB  . LYS A 1 159 ? 23.584  34.545  180.619 1.00 93.79  ? 242 LYS A CB  1 
ATOM   1263 C CG  . LYS A 1 159 ? 24.160  35.445  181.686 1.00 98.03  ? 242 LYS A CG  1 
ATOM   1264 C CD  . LYS A 1 159 ? 24.971  36.622  181.176 1.00 101.68 ? 242 LYS A CD  1 
ATOM   1265 C CE  . LYS A 1 159 ? 25.320  37.519  182.359 1.00 103.58 ? 242 LYS A CE  1 
ATOM   1266 N NZ  . LYS A 1 159 ? 26.327  38.555  182.045 1.00 107.42 ? 242 LYS A NZ  1 
ATOM   1267 N N   . HIS A 1 160 ? 20.868  32.029  180.613 1.00 92.05  ? 243 HIS A N   1 
ATOM   1268 C CA  . HIS A 1 160 ? 19.969  31.296  179.756 1.00 94.07  ? 243 HIS A CA  1 
ATOM   1269 C C   . HIS A 1 160 ? 18.535  31.594  180.201 1.00 91.95  ? 243 HIS A C   1 
ATOM   1270 O O   . HIS A 1 160 ? 18.251  31.634  181.409 1.00 92.37  ? 243 HIS A O   1 
ATOM   1271 C CB  . HIS A 1 160 ? 20.273  29.817  179.862 1.00 97.46  ? 243 HIS A CB  1 
ATOM   1272 C CG  . HIS A 1 160 ? 19.459  28.961  178.946 1.00 101.42 ? 243 HIS A CG  1 
ATOM   1273 N ND1 . HIS A 1 160 ? 19.854  28.671  177.657 1.00 103.70 ? 243 HIS A ND1 1 
ATOM   1274 C CD2 . HIS A 1 160 ? 18.288  28.306  179.141 1.00 100.19 ? 243 HIS A CD2 1 
ATOM   1275 C CE1 . HIS A 1 160 ? 18.953  27.891  177.087 1.00 101.26 ? 243 HIS A CE1 1 
ATOM   1276 N NE2 . HIS A 1 160 ? 17.997  27.649  177.968 1.00 103.97 ? 243 HIS A NE2 1 
ATOM   1277 N N   . GLY A 1 161 ? 17.659  31.832  179.221 1.00 86.96  ? 244 GLY A N   1 
ATOM   1278 C CA  . GLY A 1 161 ? 16.276  32.206  179.483 1.00 87.39  ? 244 GLY A CA  1 
ATOM   1279 C C   . GLY A 1 161 ? 15.569  32.753  178.250 1.00 88.83  ? 244 GLY A C   1 
ATOM   1280 O O   . GLY A 1 161 ? 16.172  32.938  177.207 1.00 89.51  ? 244 GLY A O   1 
ATOM   1281 N N   . CYS A 1 162 ? 14.267  32.973  178.372 1.00 89.00  ? 245 CYS A N   1 
ATOM   1282 C CA  . CYS A 1 162 ? 13.447  33.518  177.288 1.00 84.42  ? 245 CYS A CA  1 
ATOM   1283 C C   . CYS A 1 162 ? 13.640  35.039  177.240 1.00 82.95  ? 245 CYS A C   1 
ATOM   1284 O O   . CYS A 1 162 ? 13.451  35.702  178.267 1.00 82.08  ? 245 CYS A O   1 
ATOM   1285 C CB  . CYS A 1 162 ? 11.973  33.169  177.539 1.00 84.47  ? 245 CYS A CB  1 
ATOM   1286 S SG  . CYS A 1 162 ? 10.753  34.092  176.600 1.00 86.67  ? 245 CYS A SG  1 
ATOM   1287 N N   . PRO A 1 163 ? 13.986  35.603  176.060 1.00 80.92  ? 246 PRO A N   1 
ATOM   1288 C CA  . PRO A 1 163 ? 14.360  37.029  175.948 1.00 82.43  ? 246 PRO A CA  1 
ATOM   1289 C C   . PRO A 1 163 ? 13.435  38.074  176.592 1.00 83.09  ? 246 PRO A C   1 
ATOM   1290 O O   . PRO A 1 163 ? 13.940  38.980  177.245 1.00 89.14  ? 246 PRO A O   1 
ATOM   1291 C CB  . PRO A 1 163 ? 14.414  37.261  174.444 1.00 84.12  ? 246 PRO A CB  1 
ATOM   1292 C CG  . PRO A 1 163 ? 14.797  35.934  173.913 1.00 83.99  ? 246 PRO A CG  1 
ATOM   1293 C CD  . PRO A 1 163 ? 14.044  34.946  174.745 1.00 81.41  ? 246 PRO A CD  1 
ATOM   1294 N N   . ALA A 1 164 ? 12.118  37.968  176.428 1.00 78.39  ? 247 ALA A N   1 
ATOM   1295 C CA  . ALA A 1 164 ? 11.234  38.959  177.033 1.00 76.93  ? 247 ALA A CA  1 
ATOM   1296 C C   . ALA A 1 164 ? 11.408  39.075  178.537 1.00 78.44  ? 247 ALA A C   1 
ATOM   1297 O O   . ALA A 1 164 ? 11.180  40.125  179.104 1.00 81.16  ? 247 ALA A O   1 
ATOM   1298 C CB  . ALA A 1 164 ? 9.795   38.677  176.700 1.00 81.18  ? 247 ALA A CB  1 
ATOM   1299 N N   . TYR A 1 165 ? 11.824  38.002  179.197 1.00 82.70  ? 248 TYR A N   1 
ATOM   1300 C CA  . TYR A 1 165 ? 11.965  38.029  180.653 1.00 79.60  ? 248 TYR A CA  1 
ATOM   1301 C C   . TYR A 1 165 ? 13.365  38.367  181.178 1.00 80.66  ? 248 TYR A C   1 
ATOM   1302 O O   . TYR A 1 165 ? 13.560  38.386  182.392 1.00 84.59  ? 248 TYR A O   1 
ATOM   1303 C CB  . TYR A 1 165 ? 11.487  36.697  181.210 1.00 75.76  ? 248 TYR A CB  1 
ATOM   1304 C CG  . TYR A 1 165 ? 10.060  36.419  180.869 1.00 73.83  ? 248 TYR A CG  1 
ATOM   1305 C CD1 . TYR A 1 165 ? 9.029   36.879  181.687 1.00 71.90  ? 248 TYR A CD1 1 
ATOM   1306 C CD2 . TYR A 1 165 ? 9.727   35.722  179.712 1.00 75.24  ? 248 TYR A CD2 1 
ATOM   1307 C CE1 . TYR A 1 165 ? 7.710   36.624  181.384 1.00 71.60  ? 248 TYR A CE1 1 
ATOM   1308 C CE2 . TYR A 1 165 ? 8.406   35.457  179.398 1.00 74.54  ? 248 TYR A CE2 1 
ATOM   1309 C CZ  . TYR A 1 165 ? 7.400   35.903  180.249 1.00 74.16  ? 248 TYR A CZ  1 
ATOM   1310 O OH  . TYR A 1 165 ? 6.069   35.663  179.969 1.00 76.28  ? 248 TYR A OH  1 
ATOM   1311 N N   . VAL A 1 166 ? 14.332  38.636  180.296 1.00 82.43  ? 249 VAL A N   1 
ATOM   1312 C CA  . VAL A 1 166 ? 15.720  38.831  180.729 1.00 84.89  ? 249 VAL A CA  1 
ATOM   1313 C C   . VAL A 1 166 ? 15.919  40.233  181.260 1.00 88.09  ? 249 VAL A C   1 
ATOM   1314 O O   . VAL A 1 166 ? 15.474  41.186  180.651 1.00 97.37  ? 249 VAL A O   1 
ATOM   1315 C CB  . VAL A 1 166 ? 16.737  38.555  179.614 1.00 85.02  ? 249 VAL A CB  1 
ATOM   1316 C CG1 . VAL A 1 166 ? 18.143  38.830  180.106 1.00 88.73  ? 249 VAL A CG1 1 
ATOM   1317 C CG2 . VAL A 1 166 ? 16.651  37.102  179.170 1.00 89.58  ? 249 VAL A CG2 1 
ATOM   1318 N N   . SER A 1 167 ? 16.584  40.328  182.410 1.00 95.23  ? 250 SER A N   1 
ATOM   1319 C CA  . SER A 1 167 ? 16.819  41.593  183.109 1.00 96.80  ? 250 SER A CA  1 
ATOM   1320 C C   . SER A 1 167 ? 18.002  42.351  182.492 1.00 99.90  ? 250 SER A C   1 
ATOM   1321 O O   . SER A 1 167 ? 18.835  41.731  181.845 1.00 104.32 ? 250 SER A O   1 
ATOM   1322 C CB  . SER A 1 167 ? 17.054  41.326  184.601 1.00 98.15  ? 250 SER A CB  1 
ATOM   1323 O OG  . SER A 1 167 ? 18.277  40.648  184.829 1.00 96.99  ? 250 SER A OG  1 
ATOM   1324 N N   . PRO A 1 168 ? 18.076  43.690  182.677 1.00 100.10 ? 251 PRO A N   1 
ATOM   1325 C CA  . PRO A 1 168 ? 19.143  44.467  182.029 1.00 97.67  ? 251 PRO A CA  1 
ATOM   1326 C C   . PRO A 1 168 ? 20.533  44.038  182.498 1.00 99.95  ? 251 PRO A C   1 
ATOM   1327 O O   . PRO A 1 168 ? 21.444  43.911  181.681 1.00 100.61 ? 251 PRO A O   1 
ATOM   1328 C CB  . PRO A 1 168 ? 18.870  45.900  182.485 1.00 97.11  ? 251 PRO A CB  1 
ATOM   1329 C CG  . PRO A 1 168 ? 17.494  45.895  183.046 1.00 99.55  ? 251 PRO A CG  1 
ATOM   1330 C CD  . PRO A 1 168 ? 17.278  44.529  183.586 1.00 99.34  ? 251 PRO A CD  1 
ATOM   1331 N N   . GLU A 1 169 ? 20.672  43.788  183.798 1.00 95.68  ? 252 GLU A N   1 
ATOM   1332 C CA  . GLU A 1 169 ? 21.956  43.443  184.374 1.00 97.31  ? 252 GLU A CA  1 
ATOM   1333 C C   . GLU A 1 169 ? 22.558  42.183  183.751 1.00 95.67  ? 252 GLU A C   1 
ATOM   1334 O O   . GLU A 1 169 ? 23.769  42.023  183.749 1.00 91.86  ? 252 GLU A O   1 
ATOM   1335 C CB  . GLU A 1 169 ? 21.873  43.334  185.914 1.00 101.98 ? 252 GLU A CB  1 
ATOM   1336 C CG  . GLU A 1 169 ? 21.343  42.026  186.513 1.00 108.94 ? 252 GLU A CG  1 
ATOM   1337 C CD  . GLU A 1 169 ? 19.860  42.030  186.880 1.00 115.06 ? 252 GLU A CD  1 
ATOM   1338 O OE1 . GLU A 1 169 ? 19.079  42.780  186.245 1.00 109.42 ? 252 GLU A OE1 1 
ATOM   1339 O OE2 . GLU A 1 169 ? 19.482  41.255  187.812 1.00 118.69 ? 252 GLU A OE2 1 
ATOM   1340 N N   . ILE A 1 170 ? 21.720  41.268  183.264 1.00 91.89  ? 253 ILE A N   1 
ATOM   1341 C CA  . ILE A 1 170 ? 22.217  40.068  182.565 1.00 89.78  ? 253 ILE A CA  1 
ATOM   1342 C C   . ILE A 1 170 ? 22.845  40.463  181.230 1.00 88.46  ? 253 ILE A C   1 
ATOM   1343 O O   . ILE A 1 170 ? 23.823  39.869  180.797 1.00 87.27  ? 253 ILE A O   1 
ATOM   1344 C CB  . ILE A 1 170 ? 21.097  39.000  182.418 1.00 87.08  ? 253 ILE A CB  1 
ATOM   1345 C CG1 . ILE A 1 170 ? 20.847  38.326  183.775 1.00 88.86  ? 253 ILE A CG1 1 
ATOM   1346 C CG2 . ILE A 1 170 ? 21.443  37.950  181.372 1.00 85.17  ? 253 ILE A CG2 1 
ATOM   1347 C CD1 . ILE A 1 170 ? 19.519  37.623  183.901 1.00 87.77  ? 253 ILE A CD1 1 
ATOM   1348 N N   . LEU A 1 171 ? 22.286  41.494  180.609 1.00 94.25  ? 254 LEU A N   1 
ATOM   1349 C CA  . LEU A 1 171 ? 22.738  41.979  179.310 1.00 95.53  ? 254 LEU A CA  1 
ATOM   1350 C C   . LEU A 1 171 ? 23.930  42.929  179.400 1.00 97.41  ? 254 LEU A C   1 
ATOM   1351 O O   . LEU A 1 171 ? 24.684  43.030  178.457 1.00 103.35 ? 254 LEU A O   1 
ATOM   1352 C CB  . LEU A 1 171 ? 21.568  42.667  178.583 1.00 96.96  ? 254 LEU A CB  1 
ATOM   1353 C CG  . LEU A 1 171 ? 20.276  41.835  178.427 1.00 94.74  ? 254 LEU A CG  1 
ATOM   1354 C CD1 . LEU A 1 171 ? 19.129  42.665  177.854 1.00 92.55  ? 254 LEU A CD1 1 
ATOM   1355 C CD2 . LEU A 1 171 ? 20.536  40.614  177.552 1.00 92.33  ? 254 LEU A CD2 1 
ATOM   1356 N N   . ASN A 1 172 ? 24.081  43.638  180.516 1.00 97.01  ? 255 ASN A N   1 
ATOM   1357 C CA  . ASN A 1 172 ? 25.054  44.722  180.666 1.00 98.80  ? 255 ASN A CA  1 
ATOM   1358 C C   . ASN A 1 172 ? 26.280  44.452  181.506 1.00 102.13 ? 255 ASN A C   1 
ATOM   1359 O O   . ASN A 1 172 ? 27.302  45.123  181.356 1.00 112.46 ? 255 ASN A O   1 
ATOM   1360 C CB  . ASN A 1 172 ? 24.293  45.895  181.250 1.00 96.90  ? 255 ASN A CB  1 
ATOM   1361 C CG  . ASN A 1 172 ? 23.251  46.394  180.299 1.00 99.44  ? 255 ASN A CG  1 
ATOM   1362 O OD1 . ASN A 1 172 ? 23.226  45.997  179.124 1.00 99.51  ? 255 ASN A OD1 1 
ATOM   1363 N ND2 . ASN A 1 172 ? 22.394  47.274  180.781 1.00 99.86  ? 255 ASN A ND2 1 
ATOM   1364 N N   . THR A 1 173 ? 26.183  43.479  182.389 1.00 103.63 ? 256 THR A N   1 
ATOM   1365 C CA  . THR A 1 173 ? 27.300  43.104  183.242 1.00 104.91 ? 256 THR A CA  1 
ATOM   1366 C C   . THR A 1 173 ? 28.015  41.881  182.705 1.00 104.13 ? 256 THR A C   1 
ATOM   1367 O O   . THR A 1 173 ? 27.423  41.049  182.029 1.00 96.37  ? 256 THR A O   1 
ATOM   1368 C CB  . THR A 1 173 ? 26.869  42.829  184.699 1.00 109.00 ? 256 THR A CB  1 
ATOM   1369 O OG1 . THR A 1 173 ? 26.401  41.472  184.864 1.00 113.90 ? 256 THR A OG1 1 
ATOM   1370 C CG2 . THR A 1 173 ? 25.801  43.866  185.177 1.00 107.86 ? 256 THR A CG2 1 
ATOM   1371 N N   . THR A 1 174 ? 29.303  41.802  183.005 1.00 109.26 ? 257 THR A N   1 
ATOM   1372 C CA  . THR A 1 174 ? 30.068  40.576  182.840 1.00 111.05 ? 257 THR A CA  1 
ATOM   1373 C C   . THR A 1 174 ? 30.095  39.868  184.192 1.00 109.21 ? 257 THR A C   1 
ATOM   1374 O O   . THR A 1 174 ? 29.845  40.483  185.236 1.00 106.45 ? 257 THR A O   1 
ATOM   1375 C CB  . THR A 1 174 ? 31.519  40.848  182.384 1.00 114.02 ? 257 THR A CB  1 
ATOM   1376 O OG1 . THR A 1 174 ? 32.145  41.770  183.284 1.00 115.41 ? 257 THR A OG1 1 
ATOM   1377 C CG2 . THR A 1 174 ? 31.552  41.419  180.976 1.00 113.03 ? 257 THR A CG2 1 
ATOM   1378 N N   . GLY A 1 175 ? 30.386  38.572  184.153 1.00 109.50 ? 258 GLY A N   1 
ATOM   1379 C CA  . GLY A 1 175 ? 30.479  37.746  185.349 1.00 109.37 ? 258 GLY A CA  1 
ATOM   1380 C C   . GLY A 1 175 ? 29.134  37.429  185.976 1.00 107.23 ? 258 GLY A C   1 
ATOM   1381 O O   . GLY A 1 175 ? 28.128  37.214  185.270 1.00 107.40 ? 258 GLY A O   1 
ATOM   1382 N N   . THR A 1 176 ? 29.112  37.451  187.305 1.00 107.35 ? 259 THR A N   1 
ATOM   1383 C CA  . THR A 1 176 ? 27.950  37.033  188.069 1.00 112.01 ? 259 THR A CA  1 
ATOM   1384 C C   . THR A 1 176 ? 26.873  38.109  188.162 1.00 110.52 ? 259 THR A C   1 
ATOM   1385 O O   . THR A 1 176 ? 27.084  39.261  187.811 1.00 114.76 ? 259 THR A O   1 
ATOM   1386 C CB  . THR A 1 176 ? 28.334  36.605  189.492 1.00 116.49 ? 259 THR A CB  1 
ATOM   1387 O OG1 . THR A 1 176 ? 29.068  37.653  190.122 1.00 126.99 ? 259 THR A OG1 1 
ATOM   1388 C CG2 . THR A 1 176 ? 29.184  35.361  189.454 1.00 116.88 ? 259 THR A CG2 1 
ATOM   1389 N N   . TYR A 1 177 ? 25.685  37.676  188.574 1.00 107.17 ? 260 TYR A N   1 
ATOM   1390 C CA  . TYR A 1 177 ? 24.568  38.563  188.877 1.00 99.57  ? 260 TYR A CA  1 
ATOM   1391 C C   . TYR A 1 177 ? 23.729  37.895  189.920 1.00 98.30  ? 260 TYR A C   1 
ATOM   1392 O O   . TYR A 1 177 ? 23.788  36.674  190.080 1.00 99.47  ? 260 TYR A O   1 
ATOM   1393 C CB  . TYR A 1 177 ? 23.709  38.851  187.649 1.00 96.31  ? 260 TYR A CB  1 
ATOM   1394 C CG  . TYR A 1 177 ? 23.169  37.628  186.923 1.00 90.09  ? 260 TYR A CG  1 
ATOM   1395 C CD1 . TYR A 1 177 ? 23.925  37.000  185.942 1.00 88.37  ? 260 TYR A CD1 1 
ATOM   1396 C CD2 . TYR A 1 177 ? 21.893  37.134  187.185 1.00 88.25  ? 260 TYR A CD2 1 
ATOM   1397 C CE1 . TYR A 1 177 ? 23.448  35.904  185.257 1.00 85.44  ? 260 TYR A CE1 1 
ATOM   1398 C CE2 . TYR A 1 177 ? 21.399  36.037  186.492 1.00 85.83  ? 260 TYR A CE2 1 
ATOM   1399 C CZ  . TYR A 1 177 ? 22.192  35.425  185.535 1.00 86.05  ? 260 TYR A CZ  1 
ATOM   1400 O OH  . TYR A 1 177 ? 21.744  34.335  184.850 1.00 85.22  ? 260 TYR A OH  1 
ATOM   1401 N N   . SER A 1 178 ? 22.966  38.702  190.647 1.00 98.37  ? 261 SER A N   1 
ATOM   1402 C CA  . SER A 1 178 ? 22.036  38.178  191.642 1.00 93.46  ? 261 SER A CA  1 
ATOM   1403 C C   . SER A 1 178 ? 20.878  37.521  190.926 1.00 92.51  ? 261 SER A C   1 
ATOM   1404 O O   . SER A 1 178 ? 20.123  38.182  190.195 1.00 89.81  ? 261 SER A O   1 
ATOM   1405 C CB  . SER A 1 178 ? 21.510  39.281  192.537 1.00 93.47  ? 261 SER A CB  1 
ATOM   1406 O OG  . SER A 1 178 ? 20.444  38.789  193.293 1.00 88.82  ? 261 SER A OG  1 
ATOM   1407 N N   . GLY A 1 179 ? 20.782  36.212  191.123 1.00 95.05  ? 262 GLY A N   1 
ATOM   1408 C CA  . GLY A 1 179 ? 19.768  35.397  190.489 1.00 90.66  ? 262 GLY A CA  1 
ATOM   1409 C C   . GLY A 1 179 ? 18.385  35.593  191.072 1.00 87.09  ? 262 GLY A C   1 
ATOM   1410 O O   . GLY A 1 179 ? 17.395  35.410  190.352 1.00 80.38  ? 262 GLY A O   1 
ATOM   1411 N N   . LYS A 1 180 ? 18.310  35.961  192.355 1.00 87.40  ? 263 LYS A N   1 
ATOM   1412 C CA  . LYS A 1 180 ? 17.032  36.304  192.980 1.00 93.01  ? 263 LYS A CA  1 
ATOM   1413 C C   . LYS A 1 180 ? 16.483  37.621  192.452 1.00 97.09  ? 263 LYS A C   1 
ATOM   1414 O O   . LYS A 1 180 ? 15.291  37.711  192.108 1.00 100.32 ? 263 LYS A O   1 
ATOM   1415 C CB  . LYS A 1 180 ? 17.142  36.386  194.495 1.00 96.05  ? 263 LYS A CB  1 
ATOM   1416 C CG  . LYS A 1 180 ? 17.383  35.042  195.139 1.00 98.25  ? 263 LYS A CG  1 
ATOM   1417 C CD  . LYS A 1 180 ? 17.611  35.181  196.627 1.00 101.83 ? 263 LYS A CD  1 
ATOM   1418 C CE  . LYS A 1 180 ? 17.771  33.820  197.284 1.00 102.69 ? 263 LYS A CE  1 
ATOM   1419 N NZ  . LYS A 1 180 ? 17.339  33.836  198.703 1.00 102.77 ? 263 LYS A NZ  1 
ATOM   1420 N N   . ALA A 1 181 ? 17.347  38.633  192.360 1.00 95.88  ? 264 ALA A N   1 
ATOM   1421 C CA  . ALA A 1 181 ? 16.942  39.919  191.788 1.00 92.61  ? 264 ALA A CA  1 
ATOM   1422 C C   . ALA A 1 181 ? 16.509  39.748  190.341 1.00 87.01  ? 264 ALA A C   1 
ATOM   1423 O O   . ALA A 1 181 ? 15.549  40.389  189.911 1.00 90.76  ? 264 ALA A O   1 
ATOM   1424 C CB  . ALA A 1 181 ? 18.058  40.943  191.881 1.00 95.93  ? 264 ALA A CB  1 
ATOM   1425 N N   . ALA A 1 182 ? 17.198  38.885  189.597 1.00 82.11  ? 265 ALA A N   1 
ATOM   1426 C CA  . ALA A 1 182 ? 16.841  38.616  188.197 1.00 83.56  ? 265 ALA A CA  1 
ATOM   1427 C C   . ALA A 1 182 ? 15.471  37.947  188.091 1.00 84.04  ? 265 ALA A C   1 
ATOM   1428 O O   . ALA A 1 182 ? 14.686  38.300  187.214 1.00 84.03  ? 265 ALA A O   1 
ATOM   1429 C CB  . ALA A 1 182 ? 17.898  37.760  187.515 1.00 81.50  ? 265 ALA A CB  1 
ATOM   1430 N N   . ASP A 1 183 ? 15.218  36.990  188.990 1.00 87.02  ? 266 ASP A N   1 
ATOM   1431 C CA  . ASP A 1 183 ? 13.925  36.322  189.130 1.00 85.20  ? 266 ASP A CA  1 
ATOM   1432 C C   . ASP A 1 183 ? 12.810  37.311  189.399 1.00 83.74  ? 266 ASP A C   1 
ATOM   1433 O O   . ASP A 1 183 ? 11.737  37.192  188.826 1.00 79.89  ? 266 ASP A O   1 
ATOM   1434 C CB  . ASP A 1 183 ? 13.949  35.287  190.273 1.00 92.30  ? 266 ASP A CB  1 
ATOM   1435 C CG  . ASP A 1 183 ? 14.547  33.918  189.862 1.00 95.50  ? 266 ASP A CG  1 
ATOM   1436 O OD1 . ASP A 1 183 ? 14.873  33.689  188.670 1.00 100.35 ? 266 ASP A OD1 1 
ATOM   1437 O OD2 . ASP A 1 183 ? 14.658  33.052  190.769 1.00 91.55  ? 266 ASP A OD2 1 
ATOM   1438 N N   . VAL A 1 184 ? 13.073  38.294  190.255 1.00 84.93  ? 267 VAL A N   1 
ATOM   1439 C CA  . VAL A 1 184 ? 12.088  39.331  190.556 1.00 87.29  ? 267 VAL A CA  1 
ATOM   1440 C C   . VAL A 1 184 ? 11.761  40.212  189.335 1.00 90.67  ? 267 VAL A C   1 
ATOM   1441 O O   . VAL A 1 184 ? 10.589  40.561  189.109 1.00 93.48  ? 267 VAL A O   1 
ATOM   1442 C CB  . VAL A 1 184 ? 12.531  40.173  191.760 1.00 90.72  ? 267 VAL A CB  1 
ATOM   1443 C CG1 . VAL A 1 184 ? 11.697  41.440  191.882 1.00 95.30  ? 267 VAL A CG1 1 
ATOM   1444 C CG2 . VAL A 1 184 ? 12.412  39.341  193.021 1.00 92.16  ? 267 VAL A CG2 1 
ATOM   1445 N N   . TRP A 1 185 ? 12.772  40.553  188.539 1.00 88.72  ? 268 TRP A N   1 
ATOM   1446 C CA  . TRP A 1 185 ? 12.532  41.270  187.285 1.00 89.19  ? 268 TRP A CA  1 
ATOM   1447 C C   . TRP A 1 185 ? 11.583  40.474  186.393 1.00 85.20  ? 268 TRP A C   1 
ATOM   1448 O O   . TRP A 1 185 ? 10.648  41.027  185.814 1.00 88.71  ? 268 TRP A O   1 
ATOM   1449 C CB  . TRP A 1 185 ? 13.861  41.578  186.553 1.00 91.19  ? 268 TRP A CB  1 
ATOM   1450 C CG  . TRP A 1 185 ? 13.697  42.133  185.156 1.00 86.83  ? 268 TRP A CG  1 
ATOM   1451 C CD1 . TRP A 1 185 ? 13.413  41.430  184.029 1.00 86.01  ? 268 TRP A CD1 1 
ATOM   1452 C CD2 . TRP A 1 185 ? 13.806  43.495  184.759 1.00 89.54  ? 268 TRP A CD2 1 
ATOM   1453 N NE1 . TRP A 1 185 ? 13.336  42.267  182.947 1.00 91.40  ? 268 TRP A NE1 1 
ATOM   1454 C CE2 . TRP A 1 185 ? 13.569  43.547  183.370 1.00 91.13  ? 268 TRP A CE2 1 
ATOM   1455 C CE3 . TRP A 1 185 ? 14.080  44.684  185.441 1.00 92.45  ? 268 TRP A CE3 1 
ATOM   1456 C CZ2 . TRP A 1 185 ? 13.617  44.726  182.657 1.00 87.09  ? 268 TRP A CZ2 1 
ATOM   1457 C CZ3 . TRP A 1 185 ? 14.110  45.858  184.727 1.00 88.42  ? 268 TRP A CZ3 1 
ATOM   1458 C CH2 . TRP A 1 185 ? 13.887  45.867  183.354 1.00 89.35  ? 268 TRP A CH2 1 
ATOM   1459 N N   . SER A 1 186 ? 11.820  39.174  186.293 1.00 85.71  ? 269 SER A N   1 
ATOM   1460 C CA  . SER A 1 186 ? 10.944  38.303  185.516 1.00 87.97  ? 269 SER A CA  1 
ATOM   1461 C C   . SER A 1 186 ? 9.508   38.354  186.023 1.00 87.50  ? 269 SER A C   1 
ATOM   1462 O O   . SER A 1 186 ? 8.578   38.333  185.217 1.00 92.46  ? 269 SER A O   1 
ATOM   1463 C CB  . SER A 1 186 ? 11.456  36.868  185.520 1.00 86.48  ? 269 SER A CB  1 
ATOM   1464 O OG  . SER A 1 186 ? 12.649  36.777  184.768 1.00 87.72  ? 269 SER A OG  1 
ATOM   1465 N N   . LEU A 1 187 ? 9.336   38.417  187.345 1.00 85.87  ? 270 LEU A N   1 
ATOM   1466 C CA  . LEU A 1 187 ? 8.010   38.552  187.955 1.00 87.06  ? 270 LEU A CA  1 
ATOM   1467 C C   . LEU A 1 187 ? 7.359   39.864  187.574 1.00 88.74  ? 270 LEU A C   1 
ATOM   1468 O O   . LEU A 1 187 ? 6.133   39.931  187.464 1.00 89.36  ? 270 LEU A O   1 
ATOM   1469 C CB  . LEU A 1 187 ? 8.072   38.470  189.483 1.00 86.72  ? 270 LEU A CB  1 
ATOM   1470 C CG  . LEU A 1 187 ? 8.408   37.134  190.114 1.00 87.07  ? 270 LEU A CG  1 
ATOM   1471 C CD1 . LEU A 1 187 ? 8.555   37.325  191.616 1.00 91.79  ? 270 LEU A CD1 1 
ATOM   1472 C CD2 . LEU A 1 187 ? 7.336   36.119  189.793 1.00 85.07  ? 270 LEU A CD2 1 
ATOM   1473 N N   . GLY A 1 188 ? 8.169   40.909  187.417 1.00 85.41  ? 271 GLY A N   1 
ATOM   1474 C CA  . GLY A 1 188 ? 7.665   42.195  186.950 1.00 85.08  ? 271 GLY A CA  1 
ATOM   1475 C C   . GLY A 1 188 ? 7.177   42.114  185.520 1.00 83.21  ? 271 GLY A C   1 
ATOM   1476 O O   . GLY A 1 188 ? 6.107   42.630  185.172 1.00 85.03  ? 271 GLY A O   1 
ATOM   1477 N N   . VAL A 1 189 ? 7.960   41.447  184.688 1.00 81.40  ? 272 VAL A N   1 
ATOM   1478 C CA  . VAL A 1 189 ? 7.563   41.247  183.304 1.00 80.51  ? 272 VAL A CA  1 
ATOM   1479 C C   . VAL A 1 189 ? 6.251   40.481  183.252 1.00 81.57  ? 272 VAL A C   1 
ATOM   1480 O O   . VAL A 1 189 ? 5.392   40.806  182.452 1.00 83.58  ? 272 VAL A O   1 
ATOM   1481 C CB  . VAL A 1 189 ? 8.641   40.502  182.512 1.00 79.97  ? 272 VAL A CB  1 
ATOM   1482 C CG1 . VAL A 1 189 ? 8.142   40.162  181.118 1.00 77.39  ? 272 VAL A CG1 1 
ATOM   1483 C CG2 . VAL A 1 189 ? 9.909   41.341  182.433 1.00 80.09  ? 272 VAL A CG2 1 
ATOM   1484 N N   . MET A 1 190 ? 6.106   39.483  184.121 1.00 86.25  ? 273 MET A N   1 
ATOM   1485 C CA  . MET A 1 190 ? 4.875   38.711  184.236 1.00 90.61  ? 273 MET A CA  1 
ATOM   1486 C C   . MET A 1 190 ? 3.685   39.559  184.629 1.00 91.36  ? 273 MET A C   1 
ATOM   1487 O O   . MET A 1 190 ? 2.647   39.505  183.983 1.00 92.08  ? 273 MET A O   1 
ATOM   1488 C CB  . MET A 1 190 ? 5.030   37.589  185.257 1.00 92.03  ? 273 MET A CB  1 
ATOM   1489 C CG  . MET A 1 190 ? 5.697   36.381  184.680 1.00 92.48  ? 273 MET A CG  1 
ATOM   1490 S SD  . MET A 1 190 ? 6.116   35.292  186.028 1.00 98.86  ? 273 MET A SD  1 
ATOM   1491 C CE  . MET A 1 190 ? 6.802   33.971  185.093 1.00 97.10  ? 273 MET A CE  1 
ATOM   1492 N N   . LEU A 1 191 ? 3.839   40.333  185.693 1.00 93.66  ? 274 LEU A N   1 
ATOM   1493 C CA  . LEU A 1 191 ? 2.730   41.131  186.212 1.00 95.74  ? 274 LEU A CA  1 
ATOM   1494 C C   . LEU A 1 191 ? 2.258   42.129  185.170 1.00 91.21  ? 274 LEU A C   1 
ATOM   1495 O O   . LEU A 1 191 ? 1.055   42.229  184.922 1.00 89.81  ? 274 LEU A O   1 
ATOM   1496 C CB  . LEU A 1 191 ? 3.122   41.844  187.506 1.00 99.39  ? 274 LEU A CB  1 
ATOM   1497 C CG  . LEU A 1 191 ? 2.083   42.768  188.136 1.00 104.54 ? 274 LEU A CG  1 
ATOM   1498 C CD1 . LEU A 1 191 ? 0.808   42.020  188.496 1.00 105.83 ? 274 LEU A CD1 1 
ATOM   1499 C CD2 . LEU A 1 191 ? 2.686   43.422  189.365 1.00 107.69 ? 274 LEU A CD2 1 
ATOM   1500 N N   . TYR A 1 192 ? 3.205   42.849  184.561 1.00 87.25  ? 275 TYR A N   1 
ATOM   1501 C CA  . TYR A 1 192 ? 2.898   43.745  183.443 1.00 86.69  ? 275 TYR A CA  1 
ATOM   1502 C C   . TYR A 1 192 ? 2.031   43.016  182.413 1.00 86.74  ? 275 TYR A C   1 
ATOM   1503 O O   . TYR A 1 192 ? 0.937   43.464  182.064 1.00 88.41  ? 275 TYR A O   1 
ATOM   1504 C CB  . TYR A 1 192 ? 4.184   44.269  182.780 1.00 83.97  ? 275 TYR A CB  1 
ATOM   1505 C CG  . TYR A 1 192 ? 3.962   45.303  181.670 1.00 84.93  ? 275 TYR A CG  1 
ATOM   1506 C CD1 . TYR A 1 192 ? 3.624   44.903  180.386 1.00 86.53  ? 275 TYR A CD1 1 
ATOM   1507 C CD2 . TYR A 1 192 ? 4.082   46.681  181.913 1.00 86.21  ? 275 TYR A CD2 1 
ATOM   1508 C CE1 . TYR A 1 192 ? 3.412   45.828  179.377 1.00 90.50  ? 275 TYR A CE1 1 
ATOM   1509 C CE2 . TYR A 1 192 ? 3.872   47.617  180.905 1.00 85.61  ? 275 TYR A CE2 1 
ATOM   1510 C CZ  . TYR A 1 192 ? 3.537   47.176  179.642 1.00 89.78  ? 275 TYR A CZ  1 
ATOM   1511 O OH  . TYR A 1 192 ? 3.325   48.043  178.615 1.00 92.73  ? 275 TYR A OH  1 
ATOM   1512 N N   . THR A 1 193 ? 2.503   41.854  181.992 1.00 85.02  ? 276 THR A N   1 
ATOM   1513 C CA  . THR A 1 193 ? 1.957   41.169  180.831 1.00 82.54  ? 276 THR A CA  1 
ATOM   1514 C C   . THR A 1 193 ? 0.583   40.584  181.111 1.00 81.99  ? 276 THR A C   1 
ATOM   1515 O O   . THR A 1 193 ? -0.244  40.529  180.211 1.00 84.01  ? 276 THR A O   1 
ATOM   1516 C CB  . THR A 1 193 ? 2.927   40.058  180.383 1.00 79.59  ? 276 THR A CB  1 
ATOM   1517 O OG1 . THR A 1 193 ? 4.178   40.644  180.060 1.00 80.23  ? 276 THR A OG1 1 
ATOM   1518 C CG2 . THR A 1 193 ? 2.449   39.272  179.175 1.00 81.43  ? 276 THR A CG2 1 
ATOM   1519 N N   . LEU A 1 194 ? 0.361   40.121  182.331 1.00 82.15  ? 277 LEU A N   1 
ATOM   1520 C CA  . LEU A 1 194 ? -0.960  39.672  182.734 1.00 87.67  ? 277 LEU A CA  1 
ATOM   1521 C C   . LEU A 1 194 ? -1.973  40.810  182.669 1.00 89.28  ? 277 LEU A C   1 
ATOM   1522 O O   . LEU A 1 194 ? -3.079  40.606  182.184 1.00 94.24  ? 277 LEU A O   1 
ATOM   1523 C CB  . LEU A 1 194 ? -0.964  39.125  184.161 1.00 87.95  ? 277 LEU A CB  1 
ATOM   1524 C CG  . LEU A 1 194 ? -0.144  37.893  184.485 1.00 85.59  ? 277 LEU A CG  1 
ATOM   1525 C CD1 . LEU A 1 194 ? -0.119  37.646  185.988 1.00 89.59  ? 277 LEU A CD1 1 
ATOM   1526 C CD2 . LEU A 1 194 ? -0.708  36.708  183.753 1.00 84.52  ? 277 LEU A CD2 1 
ATOM   1527 N N   . LEU A 1 195 ? -1.607  41.980  183.188 1.00 85.83  ? 278 LEU A N   1 
ATOM   1528 C CA  . LEU A 1 195 ? -2.551  43.104  183.298 1.00 87.23  ? 278 LEU A CA  1 
ATOM   1529 C C   . LEU A 1 195 ? -2.738  43.852  181.997 1.00 88.71  ? 278 LEU A C   1 
ATOM   1530 O O   . LEU A 1 195 ? -3.845  44.338  181.719 1.00 96.09  ? 278 LEU A O   1 
ATOM   1531 C CB  . LEU A 1 195 ? -2.095  44.114  184.341 1.00 83.82  ? 278 LEU A CB  1 
ATOM   1532 C CG  . LEU A 1 195 ? -2.073  43.609  185.761 1.00 86.51  ? 278 LEU A CG  1 
ATOM   1533 C CD1 . LEU A 1 195 ? -1.327  44.599  186.648 1.00 89.38  ? 278 LEU A CD1 1 
ATOM   1534 C CD2 . LEU A 1 195 ? -3.485  43.361  186.275 1.00 87.48  ? 278 LEU A CD2 1 
ATOM   1535 N N   . VAL A 1 196 ? -1.650  43.990  181.241 1.00 83.89  ? 279 VAL A N   1 
ATOM   1536 C CA  . VAL A 1 196 ? -1.644  44.747  179.991 1.00 84.50  ? 279 VAL A CA  1 
ATOM   1537 C C   . VAL A 1 196 ? -2.034  43.879  178.801 1.00 84.54  ? 279 VAL A C   1 
ATOM   1538 O O   . VAL A 1 196 ? -2.812  44.306  177.977 1.00 95.35  ? 279 VAL A O   1 
ATOM   1539 C CB  . VAL A 1 196 ? -0.269  45.395  179.734 1.00 83.36  ? 279 VAL A CB  1 
ATOM   1540 C CG1 . VAL A 1 196 ? -0.270  46.156  178.422 1.00 83.43  ? 279 VAL A CG1 1 
ATOM   1541 C CG2 . VAL A 1 196 ? 0.103   46.324  180.883 1.00 84.80  ? 279 VAL A CG2 1 
ATOM   1542 N N   . GLY A 1 197 ? -1.510  42.670  178.726 1.00 87.22  ? 280 GLY A N   1 
ATOM   1543 C CA  . GLY A 1 197 ? -1.692  41.800  177.568 1.00 89.52  ? 280 GLY A CA  1 
ATOM   1544 C C   . GLY A 1 197 ? -0.532  41.811  176.581 1.00 89.66  ? 280 GLY A C   1 
ATOM   1545 O O   . GLY A 1 197 ? -0.553  41.075  175.619 1.00 95.03  ? 280 GLY A O   1 
ATOM   1546 N N   . ARG A 1 198 ? 0.471   42.644  176.798 1.00 89.49  ? 281 ARG A N   1 
ATOM   1547 C CA  . ARG A 1 198 ? 1.695   42.637  175.987 1.00 93.69  ? 281 ARG A CA  1 
ATOM   1548 C C   . ARG A 1 198 ? 2.877   42.631  176.932 1.00 86.76  ? 281 ARG A C   1 
ATOM   1549 O O   . ARG A 1 198 ? 2.734   43.015  178.086 1.00 83.27  ? 281 ARG A O   1 
ATOM   1550 C CB  . ARG A 1 198 ? 1.774   43.895  175.140 1.00 103.31 ? 281 ARG A CB  1 
ATOM   1551 C CG  . ARG A 1 198 ? 0.701   44.014  174.076 1.00 116.72 ? 281 ARG A CG  1 
ATOM   1552 C CD  . ARG A 1 198 ? 0.806   45.327  173.302 1.00 131.28 ? 281 ARG A CD  1 
ATOM   1553 N NE  . ARG A 1 198 ? 0.433   46.513  174.093 1.00 138.59 ? 281 ARG A NE  1 
ATOM   1554 C CZ  . ARG A 1 198 ? 1.264   47.278  174.821 1.00 142.20 ? 281 ARG A CZ  1 
ATOM   1555 N NH1 . ARG A 1 198 ? 2.572   47.018  174.921 1.00 144.97 ? 281 ARG A NH1 1 
ATOM   1556 N NH2 . ARG A 1 198 ? 0.773   48.323  175.481 1.00 141.34 ? 281 ARG A NH2 1 
ATOM   1557 N N   . TYR A 1 199 ? 4.035   42.194  176.457 1.00 84.21  ? 282 TYR A N   1 
ATOM   1558 C CA  . TYR A 1 199 ? 5.258   42.310  177.254 1.00 80.45  ? 282 TYR A CA  1 
ATOM   1559 C C   . TYR A 1 199 ? 5.634   43.792  177.378 1.00 84.10  ? 282 TYR A C   1 
ATOM   1560 O O   . TYR A 1 199 ? 5.373   44.586  176.478 1.00 87.19  ? 282 TYR A O   1 
ATOM   1561 C CB  . TYR A 1 199 ? 6.429   41.595  176.593 1.00 79.91  ? 282 TYR A CB  1 
ATOM   1562 C CG  . TYR A 1 199 ? 6.322   40.108  176.481 1.00 78.06  ? 282 TYR A CG  1 
ATOM   1563 C CD1 . TYR A 1 199 ? 6.009   39.331  177.575 1.00 78.58  ? 282 TYR A CD1 1 
ATOM   1564 C CD2 . TYR A 1 199 ? 6.592   39.464  175.275 1.00 79.49  ? 282 TYR A CD2 1 
ATOM   1565 C CE1 . TYR A 1 199 ? 5.934   37.952  177.464 1.00 81.52  ? 282 TYR A CE1 1 
ATOM   1566 C CE2 . TYR A 1 199 ? 6.522   38.083  175.151 1.00 77.43  ? 282 TYR A CE2 1 
ATOM   1567 C CZ  . TYR A 1 199 ? 6.192   37.333  176.242 1.00 78.74  ? 282 TYR A CZ  1 
ATOM   1568 O OH  . TYR A 1 199 ? 6.111   35.973  176.116 1.00 80.13  ? 282 TYR A OH  1 
ATOM   1569 N N   . PRO A 1 200 ? 6.271   44.173  178.479 1.00 85.38  ? 283 PRO A N   1 
ATOM   1570 C CA  . PRO A 1 200 ? 6.753   45.545  178.588 1.00 88.58  ? 283 PRO A CA  1 
ATOM   1571 C C   . PRO A 1 200 ? 7.810   45.898  177.536 1.00 86.90  ? 283 PRO A C   1 
ATOM   1572 O O   . PRO A 1 200 ? 7.899   47.053  177.143 1.00 97.96  ? 283 PRO A O   1 
ATOM   1573 C CB  . PRO A 1 200 ? 7.360   45.588  179.992 1.00 94.56  ? 283 PRO A CB  1 
ATOM   1574 C CG  . PRO A 1 200 ? 7.771   44.177  180.265 1.00 92.55  ? 283 PRO A CG  1 
ATOM   1575 C CD  . PRO A 1 200 ? 6.722   43.333  179.596 1.00 88.42  ? 283 PRO A CD  1 
ATOM   1576 N N   . PHE A 1 201 ? 8.604   44.919  177.113 1.00 85.69  ? 284 PHE A N   1 
ATOM   1577 C CA  . PHE A 1 201 ? 9.532   45.069  176.004 1.00 82.65  ? 284 PHE A CA  1 
ATOM   1578 C C   . PHE A 1 201 ? 9.293   43.920  175.060 1.00 82.85  ? 284 PHE A C   1 
ATOM   1579 O O   . PHE A 1 201 ? 9.305   42.771  175.492 1.00 96.72  ? 284 PHE A O   1 
ATOM   1580 C CB  . PHE A 1 201 ? 10.974  44.998  176.493 1.00 83.42  ? 284 PHE A CB  1 
ATOM   1581 C CG  . PHE A 1 201 ? 11.250  45.855  177.689 1.00 82.44  ? 284 PHE A CG  1 
ATOM   1582 C CD1 . PHE A 1 201 ? 11.620  47.185  177.540 1.00 82.80  ? 284 PHE A CD1 1 
ATOM   1583 C CD2 . PHE A 1 201 ? 11.129  45.339  178.967 1.00 81.07  ? 284 PHE A CD2 1 
ATOM   1584 C CE1 . PHE A 1 201 ? 11.865  47.983  178.643 1.00 82.57  ? 284 PHE A CE1 1 
ATOM   1585 C CE2 . PHE A 1 201 ? 11.387  46.129  180.080 1.00 82.75  ? 284 PHE A CE2 1 
ATOM   1586 C CZ  . PHE A 1 201 ? 11.754  47.457  179.919 1.00 82.76  ? 284 PHE A CZ  1 
ATOM   1587 N N   . HIS A 1 202 ? 9.070   44.233  173.791 1.00 88.17  ? 285 HIS A N   1 
ATOM   1588 C CA  . HIS A 1 202 ? 8.725   43.244  172.778 1.00 93.62  ? 285 HIS A CA  1 
ATOM   1589 C C   . HIS A 1 202 ? 9.313   43.541  171.401 1.00 90.39  ? 285 HIS A C   1 
ATOM   1590 O O   . HIS A 1 202 ? 9.332   44.690  170.961 1.00 89.56  ? 285 HIS A O   1 
ATOM   1591 C CB  . HIS A 1 202 ? 7.211   43.162  172.633 1.00 101.45 ? 285 HIS A CB  1 
ATOM   1592 C CG  . HIS A 1 202 ? 6.761   42.247  171.546 1.00 115.94 ? 285 HIS A CG  1 
ATOM   1593 N ND1 . HIS A 1 202 ? 7.054   40.898  171.546 1.00 125.98 ? 285 HIS A ND1 1 
ATOM   1594 C CD2 . HIS A 1 202 ? 6.050   42.480  170.422 1.00 123.97 ? 285 HIS A CD2 1 
ATOM   1595 C CE1 . HIS A 1 202 ? 6.540   40.338  170.468 1.00 127.87 ? 285 HIS A CE1 1 
ATOM   1596 N NE2 . HIS A 1 202 ? 5.922   41.276  169.771 1.00 132.50 ? 285 HIS A NE2 1 
ATOM   1597 N N   . ASP A 1 203 ? 9.788   42.483  170.742 1.00 86.90  ? 286 ASP A N   1 
ATOM   1598 C CA  . ASP A 1 203 ? 10.149  42.506  169.331 1.00 89.28  ? 286 ASP A CA  1 
ATOM   1599 C C   . ASP A 1 203 ? 10.250  41.071  168.820 1.00 86.76  ? 286 ASP A C   1 
ATOM   1600 O O   . ASP A 1 203 ? 10.455  40.159  169.619 1.00 86.12  ? 286 ASP A O   1 
ATOM   1601 C CB  . ASP A 1 203 ? 11.481  43.241  169.126 1.00 94.25  ? 286 ASP A CB  1 
ATOM   1602 C CG  . ASP A 1 203 ? 11.687  43.667  167.692 1.00 101.01 ? 286 ASP A CG  1 
ATOM   1603 O OD1 . ASP A 1 203 ? 12.201  42.850  166.913 1.00 104.60 ? 286 ASP A OD1 1 
ATOM   1604 O OD2 . ASP A 1 203 ? 11.313  44.809  167.334 1.00 112.44 ? 286 ASP A OD2 1 
ATOM   1605 N N   . SER A 1 204 ? 10.112  40.873  167.510 1.00 87.23  ? 287 SER A N   1 
ATOM   1606 C CA  . SER A 1 204 ? 10.287  39.543  166.906 1.00 91.75  ? 287 SER A CA  1 
ATOM   1607 C C   . SER A 1 204 ? 11.748  39.071  166.929 1.00 95.51  ? 287 SER A C   1 
ATOM   1608 O O   . SER A 1 204 ? 12.031  37.929  167.268 1.00 105.39 ? 287 SER A O   1 
ATOM   1609 C CB  . SER A 1 204 ? 9.718   39.505  165.480 1.00 93.87  ? 287 SER A CB  1 
ATOM   1610 O OG  . SER A 1 204 ? 9.833   40.757  164.843 1.00 97.90  ? 287 SER A OG  1 
ATOM   1611 N N   . ASP A 1 205 ? 12.666  39.962  166.572 1.00 100.53 ? 288 ASP A N   1 
ATOM   1612 C CA  . ASP A 1 205 ? 14.111  39.730  166.677 1.00 99.29  ? 288 ASP A CA  1 
ATOM   1613 C C   . ASP A 1 205 ? 14.508  39.788  168.169 1.00 96.87  ? 288 ASP A C   1 
ATOM   1614 O O   . ASP A 1 205 ? 14.119  40.730  168.864 1.00 92.23  ? 288 ASP A O   1 
ATOM   1615 C CB  . ASP A 1 205 ? 14.831  40.819  165.858 1.00 104.49 ? 288 ASP A CB  1 
ATOM   1616 C CG  . ASP A 1 205 ? 16.352  40.683  165.829 1.00 111.19 ? 288 ASP A CG  1 
ATOM   1617 O OD1 . ASP A 1 205 ? 16.913  39.658  166.282 1.00 112.17 ? 288 ASP A OD1 1 
ATOM   1618 O OD2 . ASP A 1 205 ? 16.990  41.646  165.321 1.00 118.28 ? 288 ASP A OD2 1 
ATOM   1619 N N   . PRO A 1 206 ? 15.261  38.782  168.673 1.00 96.01  ? 289 PRO A N   1 
ATOM   1620 C CA  . PRO A 1 206 ? 15.783  38.873  170.059 1.00 95.91  ? 289 PRO A CA  1 
ATOM   1621 C C   . PRO A 1 206 ? 16.820  39.985  170.329 1.00 94.00  ? 289 PRO A C   1 
ATOM   1622 O O   . PRO A 1 206 ? 16.763  40.615  171.389 1.00 87.43  ? 289 PRO A O   1 
ATOM   1623 C CB  . PRO A 1 206 ? 16.396  37.480  170.313 1.00 96.57  ? 289 PRO A CB  1 
ATOM   1624 C CG  . PRO A 1 206 ? 16.601  36.900  168.949 1.00 101.40 ? 289 PRO A CG  1 
ATOM   1625 C CD  . PRO A 1 206 ? 15.488  37.443  168.101 1.00 98.12  ? 289 PRO A CD  1 
ATOM   1626 N N   . SER A 1 207 ? 17.753  40.226  169.407 1.00 95.05  ? 290 SER A N   1 
ATOM   1627 C CA  . SER A 1 207 ? 18.747  41.302  169.620 1.00 100.15 ? 290 SER A CA  1 
ATOM   1628 C C   . SER A 1 207 ? 18.102  42.695  169.633 1.00 96.03  ? 290 SER A C   1 
ATOM   1629 O O   . SER A 1 207 ? 18.528  43.570  170.400 1.00 97.15  ? 290 SER A O   1 
ATOM   1630 C CB  . SER A 1 207 ? 19.922  41.212  168.635 1.00 99.77  ? 290 SER A CB  1 
ATOM   1631 O OG  . SER A 1 207 ? 19.591  40.391  167.546 1.00 106.64 ? 290 SER A OG  1 
ATOM   1632 N N   . ALA A 1 208 ? 17.070  42.890  168.818 1.00 92.38  ? 291 ALA A N   1 
ATOM   1633 C CA  . ALA A 1 208 ? 16.266  44.124  168.876 1.00 90.40  ? 291 ALA A CA  1 
ATOM   1634 C C   . ALA A 1 208 ? 15.549  44.296  170.223 1.00 87.32  ? 291 ALA A C   1 
ATOM   1635 O O   . ALA A 1 208 ? 15.469  45.419  170.763 1.00 81.46  ? 291 ALA A O   1 
ATOM   1636 C CB  . ALA A 1 208 ? 15.262  44.153  167.749 1.00 89.12  ? 291 ALA A CB  1 
ATOM   1637 N N   . LEU A 1 209 ? 15.054  43.174  170.751 1.00 84.82  ? 292 LEU A N   1 
ATOM   1638 C CA  . LEU A 1 209 ? 14.376  43.136  172.035 1.00 84.09  ? 292 LEU A CA  1 
ATOM   1639 C C   . LEU A 1 209 ? 15.364  43.457  173.167 1.00 87.01  ? 292 LEU A C   1 
ATOM   1640 O O   . LEU A 1 209 ? 15.016  44.176  174.104 1.00 86.37  ? 292 LEU A O   1 
ATOM   1641 C CB  . LEU A 1 209 ? 13.721  41.762  172.239 1.00 85.72  ? 292 LEU A CB  1 
ATOM   1642 C CG  . LEU A 1 209 ? 12.553  41.626  173.227 1.00 86.33  ? 292 LEU A CG  1 
ATOM   1643 C CD1 . LEU A 1 209 ? 11.822  40.315  172.996 1.00 89.32  ? 292 LEU A CD1 1 
ATOM   1644 C CD2 . LEU A 1 209 ? 12.992  41.693  174.676 1.00 84.52  ? 292 LEU A CD2 1 
ATOM   1645 N N   . PHE A 1 210 ? 16.594  42.943  173.073 1.00 89.75  ? 293 PHE A N   1 
ATOM   1646 C CA  . PHE A 1 210 ? 17.627  43.226  174.085 1.00 91.28  ? 293 PHE A CA  1 
ATOM   1647 C C   . PHE A 1 210 ? 18.048  44.706  174.096 1.00 91.87  ? 293 PHE A C   1 
ATOM   1648 O O   . PHE A 1 210 ? 18.304  45.287  175.159 1.00 87.87  ? 293 PHE A O   1 
ATOM   1649 C CB  . PHE A 1 210 ? 18.860  42.328  173.896 1.00 93.12  ? 293 PHE A CB  1 
ATOM   1650 C CG  . PHE A 1 210 ? 18.591  40.852  174.066 1.00 97.34  ? 293 PHE A CG  1 
ATOM   1651 C CD1 . PHE A 1 210 ? 17.800  40.368  175.117 1.00 98.56  ? 293 PHE A CD1 1 
ATOM   1652 C CD2 . PHE A 1 210 ? 19.172  39.924  173.191 1.00 100.35 ? 293 PHE A CD2 1 
ATOM   1653 C CE1 . PHE A 1 210 ? 17.577  39.008  175.261 1.00 96.57  ? 293 PHE A CE1 1 
ATOM   1654 C CE2 . PHE A 1 210 ? 18.945  38.559  173.331 1.00 96.01  ? 293 PHE A CE2 1 
ATOM   1655 C CZ  . PHE A 1 210 ? 18.151  38.106  174.367 1.00 96.27  ? 293 PHE A CZ  1 
ATOM   1656 N N   . SER A 1 211 ? 18.104  45.319  172.921 1.00 93.30  ? 294 SER A N   1 
ATOM   1657 C CA  . SER A 1 211 ? 18.390  46.753  172.834 1.00 96.70  ? 294 SER A CA  1 
ATOM   1658 C C   . SER A 1 211 ? 17.286  47.631  173.472 1.00 92.63  ? 294 SER A C   1 
ATOM   1659 O O   . SER A 1 211 ? 17.581  48.714  173.969 1.00 93.88  ? 294 SER A O   1 
ATOM   1660 C CB  . SER A 1 211 ? 18.693  47.167  171.386 1.00 96.21  ? 294 SER A CB  1 
ATOM   1661 O OG  . SER A 1 211 ? 17.540  47.123  170.577 1.00 96.83  ? 294 SER A OG  1 
ATOM   1662 N N   . LYS A 1 212 ? 16.043  47.156  173.514 1.00 89.04  ? 295 LYS A N   1 
ATOM   1663 C CA  . LYS A 1 212 ? 14.994  47.883  174.250 1.00 90.77  ? 295 LYS A CA  1 
ATOM   1664 C C   . LYS A 1 212 ? 14.951  47.628  175.739 1.00 89.96  ? 295 LYS A C   1 
ATOM   1665 O O   . LYS A 1 212 ? 14.446  48.480  176.474 1.00 100.56 ? 295 LYS A O   1 
ATOM   1666 C CB  . LYS A 1 212 ? 13.603  47.509  173.782 1.00 88.92  ? 295 LYS A CB  1 
ATOM   1667 C CG  . LYS A 1 212 ? 13.449  47.145  172.332 1.00 90.08  ? 295 LYS A CG  1 
ATOM   1668 C CD  . LYS A 1 212 ? 12.059  47.470  171.814 1.00 87.90  ? 295 LYS A CD  1 
ATOM   1669 C CE  . LYS A 1 212 ? 11.940  46.816  170.456 1.00 86.50  ? 295 LYS A CE  1 
ATOM   1670 N NZ  . LYS A 1 212 ? 10.656  47.089  169.783 1.00 89.85  ? 295 LYS A NZ  1 
ATOM   1671 N N   . ILE A 1 213 ? 15.344  46.430  176.166 1.00 84.82  ? 296 ILE A N   1 
ATOM   1672 C CA  . ILE A 1 213 ? 15.500  46.144  177.595 1.00 85.77  ? 296 ILE A CA  1 
ATOM   1673 C C   . ILE A 1 213 ? 16.665  46.977  178.161 1.00 86.83  ? 296 ILE A C   1 
ATOM   1674 O O   . ILE A 1 213 ? 16.577  47.530  179.282 1.00 83.00  ? 296 ILE A O   1 
ATOM   1675 C CB  . ILE A 1 213 ? 15.752  44.641  177.859 1.00 88.11  ? 296 ILE A CB  1 
ATOM   1676 C CG1 . ILE A 1 213 ? 14.508  43.828  177.490 1.00 89.76  ? 296 ILE A CG1 1 
ATOM   1677 C CG2 . ILE A 1 213 ? 16.123  44.382  179.330 1.00 87.69  ? 296 ILE A CG2 1 
ATOM   1678 C CD1 . ILE A 1 213 ? 14.779  42.343  177.311 1.00 91.66  ? 296 ILE A CD1 1 
ATOM   1679 N N   . ARG A 1 214 ? 17.760  47.032  177.397 1.00 85.49  ? 297 ARG A N   1 
ATOM   1680 C CA  . ARG A 1 214 ? 18.890  47.849  177.764 1.00 88.56  ? 297 ARG A CA  1 
ATOM   1681 C C   . ARG A 1 214 ? 18.479  49.291  177.937 1.00 92.84  ? 297 ARG A C   1 
ATOM   1682 O O   . ARG A 1 214 ? 18.901  49.932  178.911 1.00 100.06 ? 297 ARG A O   1 
ATOM   1683 C CB  . ARG A 1 214 ? 19.996  47.755  176.735 1.00 92.16  ? 297 ARG A CB  1 
ATOM   1684 C CG  . ARG A 1 214 ? 21.014  46.690  177.045 1.00 92.79  ? 297 ARG A CG  1 
ATOM   1685 C CD  . ARG A 1 214 ? 21.768  46.299  175.797 1.00 93.51  ? 297 ARG A CD  1 
ATOM   1686 N NE  . ARG A 1 214 ? 22.859  45.398  176.120 1.00 95.52  ? 297 ARG A NE  1 
ATOM   1687 C CZ  . ARG A 1 214 ? 23.707  44.896  175.229 1.00 99.63  ? 297 ARG A CZ  1 
ATOM   1688 N NH1 . ARG A 1 214 ? 23.576  45.160  173.928 1.00 97.55  ? 297 ARG A NH1 1 
ATOM   1689 N NH2 . ARG A 1 214 ? 24.690  44.101  175.647 1.00 103.46 ? 297 ARG A NH2 1 
ATOM   1690 N N   . ARG A 1 215 ? 17.660  49.798  177.014 1.00 94.62  ? 298 ARG A N   1 
ATOM   1691 C CA  . ARG A 1 215 ? 17.161  51.164  177.118 1.00 95.50  ? 298 ARG A CA  1 
ATOM   1692 C C   . ARG A 1 215 ? 16.212  51.332  178.289 1.00 98.00  ? 298 ARG A C   1 
ATOM   1693 O O   . ARG A 1 215 ? 16.243  52.352  178.969 1.00 98.39  ? 298 ARG A O   1 
ATOM   1694 C CB  . ARG A 1 215 ? 16.463  51.609  175.854 1.00 96.08  ? 298 ARG A CB  1 
ATOM   1695 C CG  . ARG A 1 215 ? 16.305  53.106  175.848 1.00 103.79 ? 298 ARG A CG  1 
ATOM   1696 C CD  . ARG A 1 215 ? 16.057  53.672  174.482 1.00 115.97 ? 298 ARG A CD  1 
ATOM   1697 N NE  . ARG A 1 215 ? 15.217  54.884  174.598 1.00 129.39 ? 298 ARG A NE  1 
ATOM   1698 C CZ  . ARG A 1 215 ? 15.506  56.007  175.282 1.00 132.29 ? 298 ARG A CZ  1 
ATOM   1699 N NH1 . ARG A 1 215 ? 16.648  56.171  175.964 1.00 125.16 ? 298 ARG A NH1 1 
ATOM   1700 N NH2 . ARG A 1 215 ? 14.611  57.000  175.279 1.00 136.67 ? 298 ARG A NH2 1 
ATOM   1701 N N   . GLY A 1 216 ? 15.364  50.329  178.524 1.00 101.15 ? 299 GLY A N   1 
ATOM   1702 C CA  . GLY A 1 216 ? 14.494  50.297  179.711 1.00 97.90  ? 299 GLY A CA  1 
ATOM   1703 C C   . GLY A 1 216 ? 13.247  51.161  179.622 1.00 94.39  ? 299 GLY A C   1 
ATOM   1704 O O   . GLY A 1 216 ? 12.509  51.235  180.588 1.00 95.76  ? 299 GLY A O   1 
ATOM   1705 N N   . GLN A 1 217 ? 13.050  51.826  178.484 1.00 93.67  ? 300 GLN A N   1 
ATOM   1706 C CA  A GLN A 1 217 ? 11.817  52.575  178.232 0.50 97.26  ? 300 GLN A CA  1 
ATOM   1707 C CA  B GLN A 1 217 ? 11.835  52.548  178.112 0.50 100.43 ? 300 GLN A CA  1 
ATOM   1708 C C   . GLN A 1 217 ? 10.610  51.649  178.052 1.00 97.93  ? 300 GLN A C   1 
ATOM   1709 O O   . GLN A 1 217 ? 10.547  50.791  177.161 1.00 95.18  ? 300 GLN A O   1 
ATOM   1710 C CB  A GLN A 1 217 ? 11.911  53.518  177.020 0.50 101.43 ? 300 GLN A CB  1 
ATOM   1711 C CB  B GLN A 1 217 ? 12.080  53.101  176.685 0.50 109.34 ? 300 GLN A CB  1 
ATOM   1712 C CG  A GLN A 1 217 ? 12.953  54.625  177.095 0.50 101.02 ? 300 GLN A CG  1 
ATOM   1713 C CG  B GLN A 1 217 ? 12.873  52.116  175.782 0.50 110.23 ? 300 GLN A CG  1 
ATOM   1714 C CD  A GLN A 1 217 ? 12.596  55.669  178.127 0.50 98.65  ? 300 GLN A CD  1 
ATOM   1715 C CD  B GLN A 1 217 ? 12.194  51.728  174.505 0.50 114.00 ? 300 GLN A CD  1 
ATOM   1716 O OE1 A GLN A 1 217 ? 13.194  55.738  179.200 0.50 97.93  ? 300 GLN A OE1 1 
ATOM   1717 O OE1 B GLN A 1 217 ? 11.895  50.543  174.311 0.50 113.67 ? 300 GLN A OE1 1 
ATOM   1718 N NE2 A GLN A 1 217 ? 11.595  56.475  177.815 0.50 96.42  ? 300 GLN A NE2 1 
ATOM   1719 N NE2 B GLN A 1 217 ? 11.979  52.693  173.607 0.50 111.27 ? 300 GLN A NE2 1 
ATOM   1720 N N   . PHE A 1 218 ? 9.650   51.828  178.955 1.00 96.11  ? 301 PHE A N   1 
ATOM   1721 C CA  . PHE A 1 218 ? 8.400   51.079  178.901 1.00 96.64  ? 301 PHE A CA  1 
ATOM   1722 C C   . PHE A 1 218 ? 7.303   51.903  179.542 1.00 98.54  ? 301 PHE A C   1 
ATOM   1723 O O   . PHE A 1 218 ? 7.555   52.628  180.511 1.00 95.25  ? 301 PHE A O   1 
ATOM   1724 C CB  . PHE A 1 218 ? 8.524   49.690  179.562 1.00 94.27  ? 301 PHE A CB  1 
ATOM   1725 C CG  . PHE A 1 218 ? 8.417   49.693  181.062 1.00 90.40  ? 301 PHE A CG  1 
ATOM   1726 C CD1 . PHE A 1 218 ? 9.546   49.878  181.852 1.00 89.33  ? 301 PHE A CD1 1 
ATOM   1727 C CD2 . PHE A 1 218 ? 7.186   49.482  181.687 1.00 90.80  ? 301 PHE A CD2 1 
ATOM   1728 C CE1 . PHE A 1 218 ? 9.454   49.866  183.239 1.00 89.27  ? 301 PHE A CE1 1 
ATOM   1729 C CE2 . PHE A 1 218 ? 7.080   49.478  183.074 1.00 90.79  ? 301 PHE A CE2 1 
ATOM   1730 C CZ  . PHE A 1 218 ? 8.221   49.668  183.852 1.00 92.28  ? 301 PHE A CZ  1 
ATOM   1731 N N   . CYS A 1 219 ? 6.097   51.771  178.996 1.00 100.33 ? 302 CYS A N   1 
ATOM   1732 C CA  . CYS A 1 219 ? 4.954   52.567  179.420 1.00 106.20 ? 302 CYS A CA  1 
ATOM   1733 C C   . CYS A 1 219 ? 3.857   51.689  180.022 1.00 100.60 ? 302 CYS A C   1 
ATOM   1734 O O   . CYS A 1 219 ? 3.473   50.683  179.428 1.00 101.88 ? 302 CYS A O   1 
ATOM   1735 C CB  . CYS A 1 219 ? 4.402   53.329  178.226 1.00 114.34 ? 302 CYS A CB  1 
ATOM   1736 S SG  . CYS A 1 219 ? 2.681   53.784  178.464 1.00 135.66 ? 302 CYS A SG  1 
ATOM   1737 N N   . ILE A 1 220 ? 3.359   52.065  181.197 1.00 97.22  ? 303 ILE A N   1 
ATOM   1738 C CA  . ILE A 1 220 ? 2.237   51.345  181.828 1.00 99.75  ? 303 ILE A CA  1 
ATOM   1739 C C   . ILE A 1 220 ? 0.948   52.073  181.469 1.00 101.47 ? 303 ILE A C   1 
ATOM   1740 O O   . ILE A 1 220 ? 0.744   53.199  181.934 1.00 104.09 ? 303 ILE A O   1 
ATOM   1741 C CB  . ILE A 1 220 ? 2.367   51.273  183.369 1.00 98.59  ? 303 ILE A CB  1 
ATOM   1742 C CG1 . ILE A 1 220 ? 3.666   50.557  183.760 1.00 95.53  ? 303 ILE A CG1 1 
ATOM   1743 C CG2 . ILE A 1 220 ? 1.172   50.536  183.967 1.00 97.19  ? 303 ILE A CG2 1 
ATOM   1744 C CD1 . ILE A 1 220 ? 3.975   50.562  185.242 1.00 94.20  ? 303 ILE A CD1 1 
ATOM   1745 N N   . PRO A 1 221 ? 0.067   51.451  180.656 1.00 98.81  ? 304 PRO A N   1 
ATOM   1746 C CA  . PRO A 1 221 ? -1.093  52.213  180.176 1.00 101.38 ? 304 PRO A CA  1 
ATOM   1747 C C   . PRO A 1 221 ? -2.019  52.705  181.291 1.00 101.41 ? 304 PRO A C   1 
ATOM   1748 O O   . PRO A 1 221 ? -1.992  52.187  182.405 1.00 93.97  ? 304 PRO A O   1 
ATOM   1749 C CB  . PRO A 1 221 ? -1.803  51.226  179.242 1.00 99.97  ? 304 PRO A CB  1 
ATOM   1750 C CG  . PRO A 1 221 ? -1.378  49.898  179.710 1.00 95.48  ? 304 PRO A CG  1 
ATOM   1751 C CD  . PRO A 1 221 ? 0.045   50.075  180.149 1.00 95.01  ? 304 PRO A CD  1 
ATOM   1752 N N   . GLU A 1 222 ? -2.819  53.715  180.966 1.00 110.72 ? 305 GLU A N   1 
ATOM   1753 C CA  . GLU A 1 222 ? -3.606  54.432  181.971 1.00 117.93 ? 305 GLU A CA  1 
ATOM   1754 C C   . GLU A 1 222 ? -4.620  53.534  182.703 1.00 115.70 ? 305 GLU A C   1 
ATOM   1755 O O   . GLU A 1 222 ? -4.948  53.822  183.847 1.00 115.40 ? 305 GLU A O   1 
ATOM   1756 C CB  . GLU A 1 222 ? -4.275  55.713  181.394 1.00 128.91 ? 305 GLU A CB  1 
ATOM   1757 C CG  . GLU A 1 222 ? -5.072  55.599  180.077 1.00 139.06 ? 305 GLU A CG  1 
ATOM   1758 C CD  . GLU A 1 222 ? -5.857  54.292  179.881 1.00 146.59 ? 305 GLU A CD  1 
ATOM   1759 O OE1 . GLU A 1 222 ? -5.217  53.228  179.605 1.00 137.37 ? 305 GLU A OE1 1 
ATOM   1760 O OE2 . GLU A 1 222 ? -7.119  54.331  179.991 1.00 149.57 ? 305 GLU A OE2 1 
ATOM   1761 N N   . HIS A 1 223 ? -5.074  52.437  182.075 1.00 108.51 ? 306 HIS A N   1 
ATOM   1762 C CA  . HIS A 1 223 ? -6.106  51.580  182.673 1.00 107.66 ? 306 HIS A CA  1 
ATOM   1763 C C   . HIS A 1 223 ? -5.652  50.798  183.906 1.00 104.54 ? 306 HIS A C   1 
ATOM   1764 O O   . HIS A 1 223 ? -6.492  50.359  184.681 1.00 110.56 ? 306 HIS A O   1 
ATOM   1765 C CB  . HIS A 1 223 ? -6.751  50.657  181.626 1.00 106.83 ? 306 HIS A CB  1 
ATOM   1766 C CG  . HIS A 1 223 ? -5.855  49.576  181.107 1.00 106.47 ? 306 HIS A CG  1 
ATOM   1767 N ND1 . HIS A 1 223 ? -5.679  48.370  181.758 1.00 105.97 ? 306 HIS A ND1 1 
ATOM   1768 C CD2 . HIS A 1 223 ? -5.116  49.502  179.974 1.00 105.38 ? 306 HIS A CD2 1 
ATOM   1769 C CE1 . HIS A 1 223 ? -4.858  47.607  181.059 1.00 100.60 ? 306 HIS A CE1 1 
ATOM   1770 N NE2 . HIS A 1 223 ? -4.498  48.272  179.975 1.00 101.86 ? 306 HIS A NE2 1 
ATOM   1771 N N   . ILE A 1 224 ? -4.340  50.666  184.104 1.00 104.73 ? 307 ILE A N   1 
ATOM   1772 C CA  . ILE A 1 224 ? -3.763  49.982  185.272 1.00 105.29 ? 307 ILE A CA  1 
ATOM   1773 C C   . ILE A 1 224 ? -3.977  50.828  186.528 1.00 105.78 ? 307 ILE A C   1 
ATOM   1774 O O   . ILE A 1 224 ? -3.809  52.040  186.485 1.00 108.64 ? 307 ILE A O   1 
ATOM   1775 C CB  . ILE A 1 224 ? -2.237  49.765  185.102 1.00 107.24 ? 307 ILE A CB  1 
ATOM   1776 C CG1 . ILE A 1 224 ? -1.908  48.942  183.834 1.00 103.86 ? 307 ILE A CG1 1 
ATOM   1777 C CG2 . ILE A 1 224 ? -1.633  49.122  186.349 1.00 111.75 ? 307 ILE A CG2 1 
ATOM   1778 C CD1 . ILE A 1 224 ? -2.556  47.586  183.744 1.00 101.68 ? 307 ILE A CD1 1 
ATOM   1779 N N   . SER A 1 225 ? -4.308  50.184  187.643 1.00 104.84 ? 308 SER A N   1 
ATOM   1780 C CA  . SER A 1 225 ? -4.602  50.897  188.888 1.00 111.78 ? 308 SER A CA  1 
ATOM   1781 C C   . SER A 1 225 ? -3.361  51.545  189.500 1.00 118.91 ? 308 SER A C   1 
ATOM   1782 O O   . SER A 1 225 ? -2.245  51.187  189.137 1.00 120.21 ? 308 SER A O   1 
ATOM   1783 C CB  . SER A 1 225 ? -5.198  49.950  189.914 1.00 111.00 ? 308 SER A CB  1 
ATOM   1784 O OG  . SER A 1 225 ? -4.297  48.899  190.183 1.00 108.91 ? 308 SER A OG  1 
ATOM   1785 N N   . PRO A 1 226 ? -3.551  52.495  190.441 1.00 125.06 ? 309 PRO A N   1 
ATOM   1786 C CA  . PRO A 1 226 ? -2.373  53.112  191.048 1.00 123.67 ? 309 PRO A CA  1 
ATOM   1787 C C   . PRO A 1 226 ? -1.490  52.114  191.788 1.00 119.32 ? 309 PRO A C   1 
ATOM   1788 O O   . PRO A 1 226 ? -0.277  52.135  191.605 1.00 122.96 ? 309 PRO A O   1 
ATOM   1789 C CB  . PRO A 1 226 ? -2.973  54.158  192.002 1.00 128.59 ? 309 PRO A CB  1 
ATOM   1790 C CG  . PRO A 1 226 ? -4.307  54.479  191.424 1.00 130.77 ? 309 PRO A CG  1 
ATOM   1791 C CD  . PRO A 1 226 ? -4.795  53.178  190.857 1.00 128.60 ? 309 PRO A CD  1 
ATOM   1792 N N   . LYS A 1 227 ? -2.096  51.237  192.584 1.00 119.92 ? 310 LYS A N   1 
ATOM   1793 C CA  . LYS A 1 227 ? -1.341  50.265  193.384 1.00 117.82 ? 310 LYS A CA  1 
ATOM   1794 C C   . LYS A 1 227 ? -0.629  49.207  192.545 1.00 114.55 ? 310 LYS A C   1 
ATOM   1795 O O   . LYS A 1 227 ? 0.489   48.805  192.880 1.00 118.92 ? 310 LYS A O   1 
ATOM   1796 C CB  . LYS A 1 227 ? -2.252  49.569  194.385 1.00 119.93 ? 310 LYS A CB  1 
ATOM   1797 C CG  . LYS A 1 227 ? -2.800  50.478  195.466 1.00 125.78 ? 310 LYS A CG  1 
ATOM   1798 C CD  . LYS A 1 227 ? -3.953  49.805  196.178 1.00 129.45 ? 310 LYS A CD  1 
ATOM   1799 C CE  . LYS A 1 227 ? -4.702  50.759  197.084 1.00 134.95 ? 310 LYS A CE  1 
ATOM   1800 N NZ  . LYS A 1 227 ? -3.890  51.118  198.274 1.00 137.36 ? 310 LYS A NZ  1 
ATOM   1801 N N   . ALA A 1 228 ? -1.281  48.745  191.479 1.00 109.07 ? 311 ALA A N   1 
ATOM   1802 C CA  . ALA A 1 228 ? -0.659  47.813  190.537 1.00 104.37 ? 311 ALA A CA  1 
ATOM   1803 C C   . ALA A 1 228 ? 0.457   48.468  189.724 1.00 105.62 ? 311 ALA A C   1 
ATOM   1804 O O   . ALA A 1 228 ? 1.428   47.803  189.349 1.00 102.11 ? 311 ALA A O   1 
ATOM   1805 C CB  . ALA A 1 228 ? -1.695  47.227  189.597 1.00 102.81 ? 311 ALA A CB  1 
ATOM   1806 N N   . ARG A 1 229 ? 0.310   49.757  189.431 1.00 108.21 ? 312 ARG A N   1 
ATOM   1807 C CA  . ARG A 1 229 ? 1.299   50.482  188.644 1.00 110.33 ? 312 ARG A CA  1 
ATOM   1808 C C   . ARG A 1 229 ? 2.627   50.578  189.383 1.00 110.52 ? 312 ARG A C   1 
ATOM   1809 O O   . ARG A 1 229 ? 3.692   50.391  188.781 1.00 107.61 ? 312 ARG A O   1 
ATOM   1810 C CB  . ARG A 1 229 ? 0.786   51.880  188.318 1.00 117.08 ? 312 ARG A CB  1 
ATOM   1811 C CG  . ARG A 1 229 ? 1.658   52.726  187.389 1.00 119.96 ? 312 ARG A CG  1 
ATOM   1812 C CD  . ARG A 1 229 ? 1.032   54.104  187.199 1.00 122.06 ? 312 ARG A CD  1 
ATOM   1813 N NE  . ARG A 1 229 ? -0.362  53.970  186.775 1.00 120.41 ? 312 ARG A NE  1 
ATOM   1814 C CZ  . ARG A 1 229 ? -0.774  53.842  185.513 1.00 120.32 ? 312 ARG A CZ  1 
ATOM   1815 N NH1 . ARG A 1 229 ? 0.083   53.874  184.485 1.00 116.28 ? 312 ARG A NH1 1 
ATOM   1816 N NH2 . ARG A 1 229 ? -2.071  53.699  185.273 1.00 122.63 ? 312 ARG A NH2 1 
ATOM   1817 N N   . CYS A 1 230 ? 2.582   50.873  190.677 1.00 110.66 ? 313 CYS A N   1 
ATOM   1818 C CA  . CYS A 1 230 ? 3.836   51.020  191.406 1.00 117.40 ? 313 CYS A CA  1 
ATOM   1819 C C   . CYS A 1 230 ? 4.403   49.688  191.816 1.00 118.80 ? 313 CYS A C   1 
ATOM   1820 O O   . CYS A 1 230 ? 5.581   49.608  192.101 1.00 124.54 ? 313 CYS A O   1 
ATOM   1821 C CB  . CYS A 1 230 ? 3.724   51.947  192.615 1.00 122.35 ? 313 CYS A CB  1 
ATOM   1822 S SG  . CYS A 1 230 ? 3.187   51.190  194.167 1.00 122.04 ? 313 CYS A SG  1 
ATOM   1823 N N   . LEU A 1 231 ? 3.586   48.640  191.828 1.00 117.47 ? 314 LEU A N   1 
ATOM   1824 C CA  . LEU A 1 231 ? 4.107   47.316  192.113 1.00 109.01 ? 314 LEU A CA  1 
ATOM   1825 C C   . LEU A 1 231 ? 4.972   46.917  190.952 1.00 101.08 ? 314 LEU A C   1 
ATOM   1826 O O   . LEU A 1 231 ? 6.043   46.390  191.153 1.00 96.89  ? 314 LEU A O   1 
ATOM   1827 C CB  . LEU A 1 231 ? 3.009   46.284  192.276 1.00 111.28 ? 314 LEU A CB  1 
ATOM   1828 C CG  . LEU A 1 231 ? 3.448   44.817  192.459 1.00 110.86 ? 314 LEU A CG  1 
ATOM   1829 C CD1 . LEU A 1 231 ? 4.437   44.641  193.596 1.00 113.00 ? 314 LEU A CD1 1 
ATOM   1830 C CD2 . LEU A 1 231 ? 2.218   43.951  192.705 1.00 111.75 ? 314 LEU A CD2 1 
ATOM   1831 N N   . ILE A 1 232 ? 4.490   47.200  189.743 1.00 98.11  ? 315 ILE A N   1 
ATOM   1832 C CA  . ILE A 1 232 ? 5.237   46.950  188.518 1.00 95.25  ? 315 ILE A CA  1 
ATOM   1833 C C   . ILE A 1 232 ? 6.543   47.707  188.531 1.00 97.40  ? 315 ILE A C   1 
ATOM   1834 O O   . ILE A 1 232 ? 7.601   47.107  188.323 1.00 97.31  ? 315 ILE A O   1 
ATOM   1835 C CB  . ILE A 1 232 ? 4.426   47.319  187.255 1.00 93.58  ? 315 ILE A CB  1 
ATOM   1836 C CG1 . ILE A 1 232 ? 3.307   46.294  187.057 1.00 92.57  ? 315 ILE A CG1 1 
ATOM   1837 C CG2 . ILE A 1 232 ? 5.324   47.370  186.012 1.00 92.06  ? 315 ILE A CG2 1 
ATOM   1838 C CD1 . ILE A 1 232 ? 2.208   46.732  186.116 1.00 92.93  ? 315 ILE A CD1 1 
ATOM   1839 N N   . ARG A 1 233 ? 6.478   49.009  188.794 1.00 101.54 ? 316 ARG A N   1 
ATOM   1840 C CA  . ARG A 1 233 ? 7.696   49.824  188.809 1.00 107.49 ? 316 ARG A CA  1 
ATOM   1841 C C   . ARG A 1 233 ? 8.659   49.486  189.968 1.00 104.39 ? 316 ARG A C   1 
ATOM   1842 O O   . ARG A 1 233 ? 9.854   49.705  189.827 1.00 106.57 ? 316 ARG A O   1 
ATOM   1843 C CB  . ARG A 1 233 ? 7.372   51.322  188.705 1.00 117.31 ? 316 ARG A CB  1 
ATOM   1844 C CG  . ARG A 1 233 ? 7.058   51.730  187.265 1.00 125.08 ? 316 ARG A CG  1 
ATOM   1845 C CD  . ARG A 1 233 ? 7.208   53.200  186.985 1.00 137.09 ? 316 ARG A CD  1 
ATOM   1846 N NE  . ARG A 1 233 ? 6.097   53.934  187.603 1.00 151.85 ? 316 ARG A NE  1 
ATOM   1847 C CZ  . ARG A 1 233 ? 5.043   54.507  186.990 1.00 159.72 ? 316 ARG A CZ  1 
ATOM   1848 N NH1 . ARG A 1 233 ? 4.886   54.518  185.658 1.00 156.91 ? 316 ARG A NH1 1 
ATOM   1849 N NH2 . ARG A 1 233 ? 4.116   55.112  187.739 1.00 161.50 ? 316 ARG A NH2 1 
ATOM   1850 N N   . SER A 1 234 ? 8.153   48.918  191.066 1.00 100.51 ? 317 SER A N   1 
ATOM   1851 C CA  . SER A 1 234 ? 9.003   48.324  192.118 1.00 101.82 ? 317 SER A CA  1 
ATOM   1852 C C   . SER A 1 234 ? 9.799   47.100  191.679 1.00 101.86 ? 317 SER A C   1 
ATOM   1853 O O   . SER A 1 234 ? 10.859  46.843  192.210 1.00 106.05 ? 317 SER A O   1 
ATOM   1854 C CB  . SER A 1 234 ? 8.177   47.874  193.321 1.00 102.65 ? 317 SER A CB  1 
ATOM   1855 O OG  . SER A 1 234 ? 7.391   48.920  193.843 1.00 109.02 ? 317 SER A OG  1 
ATOM   1856 N N   . LEU A 1 235 ? 9.285   46.333  190.731 1.00 102.41 ? 318 LEU A N   1 
ATOM   1857 C CA  . LEU A 1 235 ? 9.958   45.121  190.280 1.00 100.40 ? 318 LEU A CA  1 
ATOM   1858 C C   . LEU A 1 235 ? 10.850  45.371  189.046 1.00 99.98  ? 318 LEU A C   1 
ATOM   1859 O O   . LEU A 1 235 ? 11.943  44.811  188.951 1.00 93.24  ? 318 LEU A O   1 
ATOM   1860 C CB  . LEU A 1 235 ? 8.920   44.047  189.978 1.00 100.70 ? 318 LEU A CB  1 
ATOM   1861 C CG  . LEU A 1 235 ? 7.868   43.750  191.052 1.00 103.03 ? 318 LEU A CG  1 
ATOM   1862 C CD1 . LEU A 1 235 ? 6.926   42.643  190.610 1.00 98.61  ? 318 LEU A CD1 1 
ATOM   1863 C CD2 . LEU A 1 235 ? 8.478   43.400  192.389 1.00 104.47 ? 318 LEU A CD2 1 
ATOM   1864 N N   . LEU A 1 236 ? 10.400  46.219  188.118 1.00 97.34  ? 319 LEU A N   1 
ATOM   1865 C CA  . LEU A 1 236 ? 11.173  46.548  186.919 1.00 97.67  ? 319 LEU A CA  1 
ATOM   1866 C C   . LEU A 1 236 ? 12.106  47.744  187.145 1.00 97.32  ? 319 LEU A C   1 
ATOM   1867 O O   . LEU A 1 236 ? 12.185  48.631  186.311 1.00 99.84  ? 319 LEU A O   1 
ATOM   1868 C CB  . LEU A 1 236 ? 10.227  46.793  185.729 1.00 96.37  ? 319 LEU A CB  1 
ATOM   1869 C CG  . LEU A 1 236 ? 9.274   45.635  185.402 1.00 96.06  ? 319 LEU A CG  1 
ATOM   1870 C CD1 . LEU A 1 236 ? 8.396   45.938  184.190 1.00 95.62  ? 319 LEU A CD1 1 
ATOM   1871 C CD2 . LEU A 1 236 ? 10.052  44.352  185.163 1.00 94.53  ? 319 LEU A CD2 1 
ATOM   1872 N N   . ARG A 1 237 ? 12.831  47.746  188.266 1.00 101.39 ? 320 ARG A N   1 
ATOM   1873 C CA  . ARG A 1 237 ? 13.860  48.755  188.553 1.00 103.36 ? 320 ARG A CA  1 
ATOM   1874 C C   . ARG A 1 237 ? 15.127  48.367  187.834 1.00 102.23 ? 320 ARG A C   1 
ATOM   1875 O O   . ARG A 1 237 ? 15.418  47.188  187.706 1.00 93.79  ? 320 ARG A O   1 
ATOM   1876 C CB  . ARG A 1 237 ? 14.178  48.847  190.044 1.00 106.55 ? 320 ARG A CB  1 
ATOM   1877 C CG  . ARG A 1 237 ? 13.009  49.266  190.910 1.00 112.85 ? 320 ARG A CG  1 
ATOM   1878 C CD  . ARG A 1 237 ? 12.907  50.784  190.999 1.00 118.37 ? 320 ARG A CD  1 
ATOM   1879 N NE  . ARG A 1 237 ? 11.658  51.276  191.601 1.00 129.82 ? 320 ARG A NE  1 
ATOM   1880 C CZ  . ARG A 1 237 ? 11.405  51.473  192.901 1.00 136.87 ? 320 ARG A CZ  1 
ATOM   1881 N NH1 . ARG A 1 237 ? 12.323  51.252  193.842 1.00 137.97 ? 320 ARG A NH1 1 
ATOM   1882 N NH2 . ARG A 1 237 ? 10.193  51.921  193.265 1.00 140.33 ? 320 ARG A NH2 1 
ATOM   1883 N N   . ARG A 1 238 ? 15.893  49.369  187.416 1.00 108.06 ? 321 ARG A N   1 
ATOM   1884 C CA  . ARG A 1 238 ? 17.070  49.144  186.581 1.00 111.48 ? 321 ARG A CA  1 
ATOM   1885 C C   . ARG A 1 238 ? 18.182  48.559  187.447 1.00 109.76 ? 321 ARG A C   1 
ATOM   1886 O O   . ARG A 1 238 ? 18.828  47.596  187.059 1.00 102.69 ? 321 ARG A O   1 
ATOM   1887 C CB  . ARG A 1 238 ? 17.553  50.427  185.911 1.00 121.53 ? 321 ARG A CB  1 
ATOM   1888 C CG  . ARG A 1 238 ? 16.456  51.375  185.471 1.00 130.73 ? 321 ARG A CG  1 
ATOM   1889 C CD  . ARG A 1 238 ? 15.643  50.943  184.252 1.00 138.78 ? 321 ARG A CD  1 
ATOM   1890 N NE  . ARG A 1 238 ? 16.396  50.050  183.359 1.00 143.31 ? 321 ARG A NE  1 
ATOM   1891 C CZ  . ARG A 1 238 ? 17.458  50.438  182.643 1.00 139.51 ? 321 ARG A CZ  1 
ATOM   1892 N NH1 . ARG A 1 238 ? 17.911  51.695  182.697 1.00 142.37 ? 321 ARG A NH1 1 
ATOM   1893 N NH2 . ARG A 1 238 ? 18.093  49.569  181.868 1.00 132.31 ? 321 ARG A NH2 1 
ATOM   1894 N N   . GLU A 1 239 ? 18.392  49.157  188.618 1.00 114.24 ? 322 GLU A N   1 
ATOM   1895 C CA  . GLU A 1 239 ? 19.387  48.648  189.572 1.00 121.08 ? 322 GLU A CA  1 
ATOM   1896 C C   . GLU A 1 239 ? 18.736  47.471  190.298 1.00 116.29 ? 322 GLU A C   1 
ATOM   1897 O O   . GLU A 1 239 ? 17.613  47.592  190.825 1.00 114.46 ? 322 GLU A O   1 
ATOM   1898 C CB  . GLU A 1 239 ? 19.992  49.693  190.545 1.00 133.44 ? 322 GLU A CB  1 
ATOM   1899 C CG  . GLU A 1 239 ? 19.059  50.455  191.479 1.00 143.41 ? 322 GLU A CG  1 
ATOM   1900 C CD  . GLU A 1 239 ? 18.199  51.552  190.801 1.00 151.79 ? 322 GLU A CD  1 
ATOM   1901 O OE1 . GLU A 1 239 ? 16.955  51.384  190.564 1.00 140.05 ? 322 GLU A OE1 1 
ATOM   1902 O OE2 . GLU A 1 239 ? 18.788  52.616  190.515 1.00 156.36 ? 322 GLU A OE2 1 
ATOM   1903 N N   . PRO A 1 240 ? 19.410  46.309  190.284 1.00 110.97 ? 323 PRO A N   1 
ATOM   1904 C CA  . PRO A 1 240 ? 18.807  45.126  190.890 1.00 109.67 ? 323 PRO A CA  1 
ATOM   1905 C C   . PRO A 1 240 ? 18.521  45.235  192.375 1.00 112.48 ? 323 PRO A C   1 
ATOM   1906 O O   . PRO A 1 240 ? 17.513  44.700  192.846 1.00 117.74 ? 323 PRO A O   1 
ATOM   1907 C CB  . PRO A 1 240 ? 19.845  44.033  190.625 1.00 105.38 ? 323 PRO A CB  1 
ATOM   1908 C CG  . PRO A 1 240 ? 20.550  44.500  189.401 1.00 102.37 ? 323 PRO A CG  1 
ATOM   1909 C CD  . PRO A 1 240 ? 20.656  45.971  189.574 1.00 106.41 ? 323 PRO A CD  1 
ATOM   1910 N N   . SER A 1 241 ? 19.399  45.918  193.099 1.00 116.43 ? 324 SER A N   1 
ATOM   1911 C CA  . SER A 1 241 ? 19.274  46.048  194.551 1.00 117.29 ? 324 SER A CA  1 
ATOM   1912 C C   . SER A 1 241 ? 18.073  46.895  194.971 1.00 118.79 ? 324 SER A C   1 
ATOM   1913 O O   . SER A 1 241 ? 17.609  46.760  196.099 1.00 110.89 ? 324 SER A O   1 
ATOM   1914 C CB  . SER A 1 241 ? 20.563  46.621  195.138 1.00 122.63 ? 324 SER A CB  1 
ATOM   1915 O OG  . SER A 1 241 ? 20.994  47.746  194.382 1.00 123.36 ? 324 SER A OG  1 
ATOM   1916 N N   . GLU A 1 242 ? 17.575  47.758  194.072 1.00 125.29 ? 325 GLU A N   1 
ATOM   1917 C CA  . GLU A 1 242 ? 16.362  48.549  194.344 1.00 126.33 ? 325 GLU A CA  1 
ATOM   1918 C C   . GLU A 1 242 ? 15.078  47.716  194.282 1.00 116.19 ? 325 GLU A C   1 
ATOM   1919 O O   . GLU A 1 242 ? 14.108  48.052  194.942 1.00 114.37 ? 325 GLU A O   1 
ATOM   1920 C CB  . GLU A 1 242 ? 16.249  49.770  193.420 1.00 130.69 ? 325 GLU A CB  1 
ATOM   1921 C CG  . GLU A 1 242 ? 17.059  50.997  193.898 1.00 142.08 ? 325 GLU A CG  1 
ATOM   1922 C CD  . GLU A 1 242 ? 16.383  51.879  194.952 1.00 154.45 ? 325 GLU A CD  1 
ATOM   1923 O OE1 . GLU A 1 242 ? 15.466  51.426  195.675 1.00 164.50 ? 325 GLU A OE1 1 
ATOM   1924 O OE2 . GLU A 1 242 ? 16.798  53.059  195.075 1.00 164.02 ? 325 GLU A OE2 1 
ATOM   1925 N N   . ARG A 1 243 ? 15.079  46.625  193.521 1.00 108.77 ? 326 ARG A N   1 
ATOM   1926 C CA  . ARG A 1 243 ? 13.882  45.782  193.365 1.00 99.54  ? 326 ARG A CA  1 
ATOM   1927 C C   . ARG A 1 243 ? 13.450  45.123  194.654 1.00 100.25 ? 326 ARG A C   1 
ATOM   1928 O O   . ARG A 1 243 ? 14.273  44.881  195.531 1.00 108.68 ? 326 ARG A O   1 
ATOM   1929 C CB  . ARG A 1 243 ? 14.146  44.668  192.376 1.00 93.59  ? 326 ARG A CB  1 
ATOM   1930 C CG  . ARG A 1 243 ? 14.465  45.148  190.983 1.00 92.02  ? 326 ARG A CG  1 
ATOM   1931 C CD  . ARG A 1 243 ? 14.882  44.012  190.086 1.00 86.28  ? 326 ARG A CD  1 
ATOM   1932 N NE  . ARG A 1 243 ? 15.667  44.542  188.991 1.00 86.57  ? 326 ARG A NE  1 
ATOM   1933 C CZ  . ARG A 1 243 ? 16.561  43.861  188.286 1.00 89.10  ? 326 ARG A CZ  1 
ATOM   1934 N NH1 . ARG A 1 243 ? 16.817  42.581  188.548 1.00 90.06  ? 326 ARG A NH1 1 
ATOM   1935 N NH2 . ARG A 1 243 ? 17.223  44.481  187.312 1.00 89.42  ? 326 ARG A NH2 1 
ATOM   1936 N N   . LEU A 1 244 ? 12.164  44.820  194.770 1.00 97.34  ? 327 LEU A N   1 
ATOM   1937 C CA  . LEU A 1 244 ? 11.663  44.131  195.956 1.00 102.24 ? 327 LEU A CA  1 
ATOM   1938 C C   . LEU A 1 244 ? 12.155  42.675  195.990 1.00 101.50 ? 327 LEU A C   1 
ATOM   1939 O O   . LEU A 1 244 ? 12.474  42.093  194.951 1.00 97.85  ? 327 LEU A O   1 
ATOM   1940 C CB  . LEU A 1 244 ? 10.127  44.190  196.012 1.00 106.03 ? 327 LEU A CB  1 
ATOM   1941 C CG  . LEU A 1 244 ? 9.447   45.567  196.105 1.00 111.08 ? 327 LEU A CG  1 
ATOM   1942 C CD1 . LEU A 1 244 ? 7.959   45.459  195.820 1.00 110.92 ? 327 LEU A CD1 1 
ATOM   1943 C CD2 . LEU A 1 244 ? 9.662   46.214  197.463 1.00 116.00 ? 327 LEU A CD2 1 
ATOM   1944 N N   . THR A 1 245 ? 12.238  42.121  197.198 1.00 103.59 ? 328 THR A N   1 
ATOM   1945 C CA  . THR A 1 245 ? 12.423  40.669  197.400 1.00 103.69 ? 328 THR A CA  1 
ATOM   1946 C C   . THR A 1 245 ? 11.061  40.005  197.217 1.00 106.21 ? 328 THR A C   1 
ATOM   1947 O O   . THR A 1 245 ? 10.011  40.633  197.400 1.00 104.51 ? 328 THR A O   1 
ATOM   1948 C CB  . THR A 1 245 ? 12.984  40.240  198.771 1.00 103.88 ? 328 THR A CB  1 
ATOM   1949 O OG1 . THR A 1 245 ? 12.026  40.498  199.787 1.00 109.31 ? 328 THR A OG1 1 
ATOM   1950 C CG2 . THR A 1 245 ? 14.256  40.919  199.118 1.00 104.19 ? 328 THR A CG2 1 
ATOM   1951 N N   . ALA A 1 246 ? 11.077  38.733  196.848 1.00 109.13 ? 329 ALA A N   1 
ATOM   1952 C CA  . ALA A 1 246 ? 9.830   37.994  196.643 1.00 110.79 ? 329 ALA A CA  1 
ATOM   1953 C C   . ALA A 1 246 ? 8.988   37.907  197.939 1.00 114.49 ? 329 ALA A C   1 
ATOM   1954 O O   . ALA A 1 246 ? 7.755   37.959  197.875 1.00 120.32 ? 329 ALA A O   1 
ATOM   1955 C CB  . ALA A 1 246 ? 10.101  36.613  196.051 1.00 104.96 ? 329 ALA A CB  1 
ATOM   1956 N N   . PRO A 1 247 ? 9.641   37.769  199.110 1.00 116.55 ? 330 PRO A N   1 
ATOM   1957 C CA  . PRO A 1 247 ? 8.916   37.891  200.368 1.00 115.23 ? 330 PRO A CA  1 
ATOM   1958 C C   . PRO A 1 247 ? 8.109   39.160  200.551 1.00 113.51 ? 330 PRO A C   1 
ATOM   1959 O O   . PRO A 1 247 ? 6.975   39.095  201.047 1.00 108.18 ? 330 PRO A O   1 
ATOM   1960 C CB  . PRO A 1 247 ? 10.038  37.807  201.400 1.00 117.54 ? 330 PRO A CB  1 
ATOM   1961 C CG  . PRO A 1 247 ? 11.017  36.861  200.786 1.00 118.60 ? 330 PRO A CG  1 
ATOM   1962 C CD  . PRO A 1 247 ? 10.788  36.857  199.288 1.00 120.64 ? 330 PRO A CD  1 
ATOM   1963 N N   . GLU A 1 248 ? 8.676   40.298  200.148 1.00 114.62 ? 331 GLU A N   1 
ATOM   1964 C CA  . GLU A 1 248 ? 8.006   41.581  200.363 1.00 115.84 ? 331 GLU A CA  1 
ATOM   1965 C C   . GLU A 1 248 ? 7.005   41.928  199.258 1.00 112.45 ? 331 GLU A C   1 
ATOM   1966 O O   . GLU A 1 248 ? 6.031   42.619  199.529 1.00 114.82 ? 331 GLU A O   1 
ATOM   1967 C CB  . GLU A 1 248 ? 8.996   42.712  200.711 1.00 119.38 ? 331 GLU A CB  1 
ATOM   1968 C CG  . GLU A 1 248 ? 9.988   43.178  199.649 1.00 121.82 ? 331 GLU A CG  1 
ATOM   1969 C CD  . GLU A 1 248 ? 11.253  43.863  200.226 1.00 124.32 ? 331 GLU A CD  1 
ATOM   1970 O OE1 . GLU A 1 248 ? 11.348  44.051  201.457 1.00 126.98 ? 331 GLU A OE1 1 
ATOM   1971 O OE2 . GLU A 1 248 ? 12.183  44.210  199.454 1.00 120.17 ? 331 GLU A OE2 1 
ATOM   1972 N N   . ILE A 1 249 ? 7.160   41.375  198.055 1.00 110.79 ? 332 ILE A N   1 
ATOM   1973 C CA  . ILE A 1 249 ? 6.089   41.477  197.044 1.00 105.81 ? 332 ILE A CA  1 
ATOM   1974 C C   . ILE A 1 249 ? 4.785   40.962  197.632 1.00 108.34 ? 332 ILE A C   1 
ATOM   1975 O O   . ILE A 1 249 ? 3.757   41.603  197.480 1.00 113.73 ? 332 ILE A O   1 
ATOM   1976 C CB  . ILE A 1 249 ? 6.349   40.647  195.774 1.00 101.21 ? 332 ILE A CB  1 
ATOM   1977 C CG1 . ILE A 1 249 ? 7.549   41.182  195.010 1.00 104.57 ? 332 ILE A CG1 1 
ATOM   1978 C CG2 . ILE A 1 249 ? 5.131   40.684  194.849 1.00 98.80  ? 332 ILE A CG2 1 
ATOM   1979 C CD1 . ILE A 1 249 ? 8.038   40.250  193.923 1.00 102.11 ? 332 ILE A CD1 1 
ATOM   1980 N N   . LEU A 1 250 ? 4.843   39.807  198.301 1.00 108.45 ? 333 LEU A N   1 
ATOM   1981 C CA  . LEU A 1 250 ? 3.656   39.153  198.899 1.00 111.24 ? 333 LEU A CA  1 
ATOM   1982 C C   . LEU A 1 250 ? 2.848   40.007  199.873 1.00 115.61 ? 333 LEU A C   1 
ATOM   1983 O O   . LEU A 1 250 ? 1.674   39.700  200.133 1.00 112.64 ? 333 LEU A O   1 
ATOM   1984 C CB  . LEU A 1 250 ? 4.053   37.860  199.626 1.00 112.32 ? 333 LEU A CB  1 
ATOM   1985 C CG  . LEU A 1 250 ? 4.423   36.637  198.780 1.00 111.83 ? 333 LEU A CG  1 
ATOM   1986 C CD1 . LEU A 1 250 ? 4.864   35.515  199.710 1.00 114.59 ? 333 LEU A CD1 1 
ATOM   1987 C CD2 . LEU A 1 250 ? 3.282   36.178  197.869 1.00 107.78 ? 333 LEU A CD2 1 
ATOM   1988 N N   . LEU A 1 251 ? 3.503   41.027  200.437 1.00 120.35 ? 334 LEU A N   1 
ATOM   1989 C CA  . LEU A 1 251 ? 2.903   41.958  201.387 1.00 124.37 ? 334 LEU A CA  1 
ATOM   1990 C C   . LEU A 1 251 ? 2.636   43.336  200.776 1.00 120.81 ? 334 LEU A C   1 
ATOM   1991 O O   . LEU A 1 251 ? 2.528   44.300  201.512 1.00 125.75 ? 334 LEU A O   1 
ATOM   1992 C CB  . LEU A 1 251 ? 3.845   42.126  202.603 1.00 130.35 ? 334 LEU A CB  1 
ATOM   1993 C CG  . LEU A 1 251 ? 4.522   40.881  203.204 1.00 134.71 ? 334 LEU A CG  1 
ATOM   1994 C CD1 . LEU A 1 251 ? 5.561   41.267  204.255 1.00 137.39 ? 334 LEU A CD1 1 
ATOM   1995 C CD2 . LEU A 1 251 ? 3.484   39.918  203.782 1.00 136.00 ? 334 LEU A CD2 1 
ATOM   1996 N N   . HIS A 1 252 ? 2.528   43.452  199.456 1.00 115.91 ? 335 HIS A N   1 
ATOM   1997 C CA  . HIS A 1 252 ? 2.371   44.766  198.842 1.00 118.58 ? 335 HIS A CA  1 
ATOM   1998 C C   . HIS A 1 252 ? 0.878   45.093  198.659 1.00 121.74 ? 335 HIS A C   1 
ATOM   1999 O O   . HIS A 1 252 ? 0.151   44.296  198.081 1.00 127.46 ? 335 HIS A O   1 
ATOM   2000 C CB  . HIS A 1 252 ? 3.175   44.861  197.534 1.00 116.76 ? 335 HIS A CB  1 
ATOM   2001 C CG  . HIS A 1 252 ? 2.800   46.043  196.685 1.00 122.12 ? 335 HIS A CG  1 
ATOM   2002 N ND1 . HIS A 1 252 ? 3.579   47.174  196.503 1.00 121.47 ? 335 HIS A ND1 1 
ATOM   2003 C CD2 . HIS A 1 252 ? 1.683   46.243  195.959 1.00 122.98 ? 335 HIS A CD2 1 
ATOM   2004 C CE1 . HIS A 1 252 ? 2.947   48.010  195.697 1.00 120.25 ? 335 HIS A CE1 1 
ATOM   2005 N NE2 . HIS A 1 252 ? 1.789   47.473  195.364 1.00 121.22 ? 335 HIS A NE2 1 
ATOM   2006 N N   . PRO A 1 253 ? 0.427   46.285  199.117 1.00 125.07 ? 336 PRO A N   1 
ATOM   2007 C CA  . PRO A 1 253 ? -0.987  46.704  199.168 1.00 124.67 ? 336 PRO A CA  1 
ATOM   2008 C C   . PRO A 1 253 ? -1.923  46.243  198.048 1.00 122.16 ? 336 PRO A C   1 
ATOM   2009 O O   . PRO A 1 253 ? -3.042  45.837  198.320 1.00 122.40 ? 336 PRO A O   1 
ATOM   2010 C CB  . PRO A 1 253 ? -0.870  48.214  199.123 1.00 125.94 ? 336 PRO A CB  1 
ATOM   2011 C CG  . PRO A 1 253 ? 0.315   48.464  199.974 1.00 128.85 ? 336 PRO A CG  1 
ATOM   2012 C CD  . PRO A 1 253 ? 1.289   47.366  199.635 1.00 126.61 ? 336 PRO A CD  1 
ATOM   2013 N N   . TRP A 1 254 ? -1.475  46.325  196.804 1.00 119.19 ? 337 TRP A N   1 
ATOM   2014 C CA  . TRP A 1 254 ? -2.261  45.863  195.655 1.00 113.92 ? 337 TRP A CA  1 
ATOM   2015 C C   . TRP A 1 254 ? -3.131  44.640  195.917 1.00 112.57 ? 337 TRP A C   1 
ATOM   2016 O O   . TRP A 1 254 ? -4.326  44.674  195.646 1.00 115.71 ? 337 TRP A O   1 
ATOM   2017 C CB  . TRP A 1 254 ? -1.368  45.595  194.444 1.00 108.59 ? 337 TRP A CB  1 
ATOM   2018 C CG  . TRP A 1 254 ? -2.163  45.237  193.232 1.00 105.77 ? 337 TRP A CG  1 
ATOM   2019 C CD1 . TRP A 1 254 ? -3.194  45.940  192.696 1.00 106.66 ? 337 TRP A CD1 1 
ATOM   2020 C CD2 . TRP A 1 254 ? -2.006  44.076  192.419 1.00 102.58 ? 337 TRP A CD2 1 
ATOM   2021 N NE1 . TRP A 1 254 ? -3.692  45.295  191.594 1.00 102.58 ? 337 TRP A NE1 1 
ATOM   2022 C CE2 . TRP A 1 254 ? -2.975  44.149  191.397 1.00 101.65 ? 337 TRP A CE2 1 
ATOM   2023 C CE3 . TRP A 1 254 ? -1.127  42.986  192.443 1.00 100.27 ? 337 TRP A CE3 1 
ATOM   2024 C CZ2 . TRP A 1 254 ? -3.097  43.172  190.413 1.00 103.00 ? 337 TRP A CZ2 1 
ATOM   2025 C CZ3 . TRP A 1 254 ? -1.245  42.027  191.471 1.00 99.12  ? 337 TRP A CZ3 1 
ATOM   2026 C CH2 . TRP A 1 254 ? -2.226  42.118  190.467 1.00 99.65  ? 337 TRP A CH2 1 
ATOM   2027 N N   . PHE A 1 255 ? -2.539  43.586  196.474 1.00 110.03 ? 338 PHE A N   1 
ATOM   2028 C CA  . PHE A 1 255 ? -3.233  42.290  196.632 1.00 113.02 ? 338 PHE A CA  1 
ATOM   2029 C C   . PHE A 1 255 ? -4.509  42.355  197.484 1.00 118.43 ? 338 PHE A C   1 
ATOM   2030 O O   . PHE A 1 255 ? -5.579  41.899  197.059 1.00 117.28 ? 338 PHE A O   1 
ATOM   2031 C CB  . PHE A 1 255 ? -2.278  41.223  197.186 1.00 109.54 ? 338 PHE A CB  1 
ATOM   2032 C CG  . PHE A 1 255 ? -1.182  40.849  196.235 1.00 103.66 ? 338 PHE A CG  1 
ATOM   2033 C CD1 . PHE A 1 255 ? -1.447  40.029  195.143 1.00 102.54 ? 338 PHE A CD1 1 
ATOM   2034 C CD2 . PHE A 1 255 ? 0.107   41.334  196.406 1.00 102.55 ? 338 PHE A CD2 1 
ATOM   2035 C CE1 . PHE A 1 255 ? -0.442  39.687  194.248 1.00 100.27 ? 338 PHE A CE1 1 
ATOM   2036 C CE2 . PHE A 1 255 ? 1.114   40.999  195.517 1.00 101.77 ? 338 PHE A CE2 1 
ATOM   2037 C CZ  . PHE A 1 255 ? 0.840   40.171  194.439 1.00 101.02 ? 338 PHE A CZ  1 
ATOM   2038 N N   . GLU A 1 256 ? -4.386  42.949  198.665 1.00 125.23 ? 339 GLU A N   1 
ATOM   2039 C CA  . GLU A 1 256 ? -5.543  43.209  199.523 1.00 131.72 ? 339 GLU A CA  1 
ATOM   2040 C C   . GLU A 1 256 ? -6.519  44.214  198.883 1.00 130.46 ? 339 GLU A C   1 
ATOM   2041 O O   . GLU A 1 256 ? -7.734  44.053  199.004 1.00 133.74 ? 339 GLU A O   1 
ATOM   2042 C CB  . GLU A 1 256 ? -5.096  43.648  200.929 1.00 142.47 ? 339 GLU A CB  1 
ATOM   2043 C CG  . GLU A 1 256 ? -4.345  44.979  200.994 1.00 153.45 ? 339 GLU A CG  1 
ATOM   2044 C CD  . GLU A 1 256 ? -3.268  45.031  202.073 1.00 161.72 ? 339 GLU A CD  1 
ATOM   2045 O OE1 . GLU A 1 256 ? -2.396  44.139  202.103 1.00 168.73 ? 339 GLU A OE1 1 
ATOM   2046 O OE2 . GLU A 1 256 ? -3.274  45.984  202.877 1.00 163.84 ? 339 GLU A OE2 1 
ATOM   2047 N N   . SER A 1 257 ? -5.991  45.224  198.187 1.00 127.30 ? 340 SER A N   1 
ATOM   2048 C CA  . SER A 1 257 ? -6.824  46.221  197.497 1.00 130.08 ? 340 SER A CA  1 
ATOM   2049 C C   . SER A 1 257 ? -7.758  45.649  196.429 1.00 130.27 ? 340 SER A C   1 
ATOM   2050 O O   . SER A 1 257 ? -8.731  46.297  196.066 1.00 134.36 ? 340 SER A O   1 
ATOM   2051 C CB  . SER A 1 257 ? -5.970  47.326  196.866 1.00 129.73 ? 340 SER A CB  1 
ATOM   2052 O OG  . SER A 1 257 ? -5.740  47.106  195.487 1.00 127.17 ? 340 SER A OG  1 
ATOM   2053 N N   . VAL A 1 258 ? -7.445  44.471  195.900 1.00 129.65 ? 341 VAL A N   1 
ATOM   2054 C CA  . VAL A 1 258 ? -8.368  43.757  195.029 1.00 124.54 ? 341 VAL A CA  1 
ATOM   2055 C C   . VAL A 1 258 ? -8.240  42.255  195.330 1.00 117.05 ? 341 VAL A C   1 
ATOM   2056 O O   . VAL A 1 258 ? -9.109  41.646  195.951 1.00 118.58 ? 341 VAL A O   1 
ATOM   2057 C CB  . VAL A 1 258 ? -8.163  44.094  193.497 1.00 121.61 ? 341 VAL A CB  1 
ATOM   2058 C CG1 . VAL A 1 258 ? -6.985  45.020  193.152 1.00 118.86 ? 341 VAL A CG1 1 
ATOM   2059 C CG2 . VAL A 1 258 ? -8.017  42.834  192.683 1.00 120.54 ? 341 VAL A CG2 1 
ATOM   2060 N N   . GLU A 1 274 ? 27.101  58.782  143.286 1.00 166.84 ? 499 GLU A N   1 
ATOM   2061 C CA  . GLU A 1 274 ? 27.109  59.523  142.033 1.00 174.36 ? 499 GLU A CA  1 
ATOM   2062 C C   . GLU A 1 274 ? 26.717  60.967  142.392 1.00 173.93 ? 499 GLU A C   1 
ATOM   2063 O O   . GLU A 1 274 ? 27.547  61.888  142.345 1.00 177.15 ? 499 GLU A O   1 
ATOM   2064 C CB  . GLU A 1 274 ? 26.185  58.836  140.980 1.00 175.60 ? 499 GLU A CB  1 
ATOM   2065 C CG  . GLU A 1 274 ? 26.123  57.300  141.089 1.00 172.97 ? 499 GLU A CG  1 
ATOM   2066 C CD  . GLU A 1 274 ? 25.232  56.773  142.207 1.00 165.01 ? 499 GLU A CD  1 
ATOM   2067 O OE1 . GLU A 1 274 ? 25.653  55.939  143.059 1.00 162.63 ? 499 GLU A OE1 1 
ATOM   2068 O OE2 . GLU A 1 274 ? 24.077  57.199  142.216 1.00 162.10 ? 499 GLU A OE2 1 
ATOM   2069 N N   . HIS A 1 275 ? 25.464  61.118  142.820 1.00 170.87 ? 500 HIS A N   1 
ATOM   2070 C CA  . HIS A 1 275 ? 24.905  62.347  143.365 1.00 168.21 ? 500 HIS A CA  1 
ATOM   2071 C C   . HIS A 1 275 ? 23.889  61.996  144.452 1.00 167.03 ? 500 HIS A C   1 
ATOM   2072 O O   . HIS A 1 275 ? 22.982  61.209  144.174 1.00 174.81 ? 500 HIS A O   1 
ATOM   2073 C CB  . HIS A 1 275 ? 24.187  63.072  142.243 1.00 169.55 ? 500 HIS A CB  1 
ATOM   2074 C CG  . HIS A 1 275 ? 25.112  63.632  141.208 1.00 178.14 ? 500 HIS A CG  1 
ATOM   2075 N ND1 . HIS A 1 275 ? 26.083  64.563  141.510 1.00 179.49 ? 500 HIS A ND1 1 
ATOM   2076 C CD2 . HIS A 1 275 ? 25.217  63.400  139.877 1.00 182.63 ? 500 HIS A CD2 1 
ATOM   2077 C CE1 . HIS A 1 275 ? 26.750  64.875  140.415 1.00 185.63 ? 500 HIS A CE1 1 
ATOM   2078 N NE2 . HIS A 1 275 ? 26.244  64.185  139.409 1.00 187.65 ? 500 HIS A NE2 1 
ATOM   2079 N N   . GLU A 1 276 ? 24.045  62.520  145.678 1.00 162.58 ? 501 GLU A N   1 
ATOM   2080 C CA  . GLU A 1 276 ? 22.992  62.422  146.726 1.00 154.52 ? 501 GLU A CA  1 
ATOM   2081 C C   . GLU A 1 276 ? 22.246  63.739  146.827 1.00 156.01 ? 501 GLU A C   1 
ATOM   2082 O O   . GLU A 1 276 ? 22.333  64.459  147.822 1.00 153.34 ? 501 GLU A O   1 
ATOM   2083 C CB  . GLU A 1 276 ? 23.547  62.056  148.101 1.00 148.92 ? 501 GLU A CB  1 
ATOM   2084 C CG  . GLU A 1 276 ? 24.101  60.660  148.165 1.00 147.61 ? 501 GLU A CG  1 
ATOM   2085 C CD  . GLU A 1 276 ? 24.158  60.075  149.574 1.00 140.39 ? 501 GLU A CD  1 
ATOM   2086 O OE1 . GLU A 1 276 ? 24.484  60.785  150.545 1.00 137.72 ? 501 GLU A OE1 1 
ATOM   2087 O OE2 . GLU A 1 276 ? 23.904  58.872  149.697 1.00 135.75 ? 501 GLU A OE2 1 
ATOM   2088 N N   . THR A 1 277 ? 21.489  64.031  145.782 1.00 158.55 ? 502 THR A N   1 
ATOM   2089 C CA  . THR A 1 277 ? 20.797  65.293  145.651 1.00 157.47 ? 502 THR A CA  1 
ATOM   2090 C C   . THR A 1 277 ? 19.397  65.227  146.297 1.00 153.46 ? 502 THR A C   1 
ATOM   2091 O O   . THR A 1 277 ? 18.653  64.261  146.088 1.00 152.66 ? 502 THR A O   1 
ATOM   2092 C CB  . THR A 1 277 ? 20.759  65.680  144.173 1.00 160.99 ? 502 THR A CB  1 
ATOM   2093 O OG1 . THR A 1 277 ? 20.637  67.094  144.071 1.00 164.88 ? 502 THR A OG1 1 
ATOM   2094 C CG2 . THR A 1 277 ? 19.630  64.981  143.406 1.00 160.95 ? 502 THR A CG2 1 
ATOM   2095 N N   . SER A 1 278 ? 19.067  66.231  147.116 1.00 150.59 ? 503 SER A N   1 
ATOM   2096 C CA  . SER A 1 278 ? 17.748  66.312  147.791 1.00 144.17 ? 503 SER A CA  1 
ATOM   2097 C C   . SER A 1 278 ? 16.728  67.041  146.928 1.00 142.91 ? 503 SER A C   1 
ATOM   2098 O O   . SER A 1 278 ? 17.061  68.004  146.265 1.00 142.81 ? 503 SER A O   1 
ATOM   2099 C CB  . SER A 1 278 ? 17.853  67.012  149.145 1.00 140.70 ? 503 SER A CB  1 
ATOM   2100 O OG  . SER A 1 278 ? 18.334  66.114  150.116 1.00 138.72 ? 503 SER A OG  1 
ATOM   2101 N N   . ILE A 1 279 ? 15.488  66.564  146.935 1.00 140.79 ? 504 ILE A N   1 
ATOM   2102 C CA  . ILE A 1 279 ? 14.428  67.125  146.107 1.00 144.17 ? 504 ILE A CA  1 
ATOM   2103 C C   . ILE A 1 279 ? 13.086  67.176  146.823 1.00 145.21 ? 504 ILE A C   1 
ATOM   2104 O O   . ILE A 1 279 ? 12.910  66.573  147.885 1.00 142.16 ? 504 ILE A O   1 
ATOM   2105 C CB  . ILE A 1 279 ? 14.268  66.342  144.780 1.00 145.49 ? 504 ILE A CB  1 
ATOM   2106 C CG1 . ILE A 1 279 ? 13.773  64.908  145.017 1.00 142.25 ? 504 ILE A CG1 1 
ATOM   2107 C CG2 . ILE A 1 279 ? 15.573  66.350  143.996 1.00 148.68 ? 504 ILE A CG2 1 
ATOM   2108 C CD1 . ILE A 1 279 ? 13.417  64.179  143.741 1.00 143.54 ? 504 ILE A CD1 1 
ATOM   2109 N N   . ASP A 1 280 ? 12.145  67.883  146.198 1.00 154.24 ? 505 ASP A N   1 
ATOM   2110 C CA  . ASP A 1 280 ? 10.773  67.974  146.670 1.00 157.14 ? 505 ASP A CA  1 
ATOM   2111 C C   . ASP A 1 280 ? 10.046  66.676  146.326 1.00 159.15 ? 505 ASP A C   1 
ATOM   2112 O O   . ASP A 1 280 ? 9.624   66.473  145.183 1.00 164.62 ? 505 ASP A O   1 
ATOM   2113 C CB  . ASP A 1 280 ? 10.068  69.170  146.019 1.00 162.30 ? 505 ASP A CB  1 
ATOM   2114 C CG  . ASP A 1 280 ? 8.668   69.398  146.558 1.00 163.49 ? 505 ASP A CG  1 
ATOM   2115 O OD1 . ASP A 1 280 ? 8.388   69.006  147.720 1.00 165.22 ? 505 ASP A OD1 1 
ATOM   2116 O OD2 . ASP A 1 280 ? 7.852   69.985  145.814 1.00 163.73 ? 505 ASP A OD2 1 
ATOM   2117 N N   . ILE A 1 281 ? 9.900   65.808  147.320 1.00 157.71 ? 506 ILE A N   1 
ATOM   2118 C CA  . ILE A 1 281 ? 9.297   64.491  147.106 1.00 161.11 ? 506 ILE A CA  1 
ATOM   2119 C C   . ILE A 1 281 ? 7.752   64.693  146.979 1.00 166.09 ? 506 ILE A C   1 
ATOM   2120 O O   . ILE A 1 281 ? 7.115   63.986  146.200 1.00 173.76 ? 506 ILE A O   1 
ATOM   2121 C CB  . ILE A 1 281 ? 9.853   63.392  148.105 1.00 159.64 ? 506 ILE A CB  1 
ATOM   2122 C CG1 . ILE A 1 281 ? 9.043   63.271  149.395 1.00 157.71 ? 506 ILE A CG1 1 
ATOM   2123 C CG2 . ILE A 1 281 ? 11.331  63.630  148.456 1.00 159.33 ? 506 ILE A CG2 1 
ATOM   2124 C CD1 . ILE A 1 281 ? 7.664   62.662  149.238 1.00 160.01 ? 506 ILE A CD1 1 
ATOM   2125 N N   . SER A 1 282 ? 7.157   65.688  147.661 1.00 168.66 ? 507 SER A N   1 
ATOM   2126 C CA  . SER A 1 282 ? 5.721   66.077  147.454 1.00 168.57 ? 507 SER A CA  1 
ATOM   2127 C C   . SER A 1 282 ? 5.259   66.032  146.005 1.00 168.28 ? 507 SER A C   1 
ATOM   2128 O O   . SER A 1 282 ? 4.174   65.540  145.709 1.00 163.82 ? 507 SER A O   1 
ATOM   2129 C CB  . SER A 1 282 ? 5.436   67.493  147.959 1.00 168.27 ? 507 SER A CB  1 
ATOM   2130 O OG  . SER A 1 282 ? 5.798   67.616  149.316 1.00 169.25 ? 507 SER A OG  1 
ATOM   2131 N N   . ALA A 1 283 ? 6.115   66.508  145.104 1.00 170.27 ? 508 ALA A N   1 
ATOM   2132 C CA  . ALA A 1 283 ? 5.854   66.458  143.671 1.00 171.55 ? 508 ALA A CA  1 
ATOM   2133 C C   . ALA A 1 283 ? 5.504   65.055  143.097 1.00 172.06 ? 508 ALA A C   1 
ATOM   2134 O O   . ALA A 1 283 ? 5.216   64.962  141.920 1.00 176.26 ? 508 ALA A O   1 
ATOM   2135 C CB  . ALA A 1 283 ? 7.021   67.102  142.919 1.00 173.00 ? 508 ALA A CB  1 
ATOM   2136 N N   . TYR A 1 284 ? 5.507   63.995  143.921 1.00 168.30 ? 509 TYR A N   1 
ATOM   2137 C CA  . TYR A 1 284 ? 5.071   62.644  143.536 1.00 167.59 ? 509 TYR A CA  1 
ATOM   2138 C C   . TYR A 1 284 ? 3.885   62.213  144.391 1.00 158.82 ? 509 TYR A C   1 
ATOM   2139 O O   . TYR A 1 284 ? 4.066   61.680  145.484 1.00 148.92 ? 509 TYR A O   1 
ATOM   2140 C CB  . TYR A 1 284 ? 6.249   61.645  143.683 1.00 169.91 ? 509 TYR A CB  1 
ATOM   2141 C CG  . TYR A 1 284 ? 7.417   61.996  142.764 1.00 180.41 ? 509 TYR A CG  1 
ATOM   2142 C CD1 . TYR A 1 284 ? 8.295   63.050  143.074 1.00 182.08 ? 509 TYR A CD1 1 
ATOM   2143 C CD2 . TYR A 1 284 ? 7.621   61.314  141.560 1.00 185.64 ? 509 TYR A CD2 1 
ATOM   2144 C CE1 . TYR A 1 284 ? 9.334   63.407  142.215 1.00 185.07 ? 509 TYR A CE1 1 
ATOM   2145 C CE2 . TYR A 1 284 ? 8.663   61.665  140.700 1.00 188.89 ? 509 TYR A CE2 1 
ATOM   2146 C CZ  . TYR A 1 284 ? 9.516   62.711  141.030 1.00 187.16 ? 509 TYR A CZ  1 
ATOM   2147 O OH  . TYR A 1 284 ? 10.546  63.053  140.184 1.00 187.27 ? 509 TYR A OH  1 
ATOM   2148 N N   . SER B 1 6   ? 40.023  88.573  150.772 1.00 156.76 ? 89  SER B N   1 
ATOM   2149 C CA  . SER B 1 6   ? 39.380  89.725  151.481 1.00 158.22 ? 89  SER B CA  1 
ATOM   2150 C C   . SER B 1 6   ? 39.323  89.500  152.998 1.00 154.03 ? 89  SER B C   1 
ATOM   2151 O O   . SER B 1 6   ? 39.170  88.373  153.453 1.00 154.89 ? 89  SER B O   1 
ATOM   2152 C CB  . SER B 1 6   ? 37.971  89.991  150.922 1.00 156.45 ? 89  SER B CB  1 
ATOM   2153 O OG  . SER B 1 6   ? 37.218  88.795  150.797 1.00 152.67 ? 89  SER B OG  1 
ATOM   2154 N N   . ARG B 1 7   ? 39.434  90.589  153.758 1.00 157.69 ? 90  ARG B N   1 
ATOM   2155 C CA  . ARG B 1 7   ? 39.454  90.562  155.227 1.00 156.95 ? 90  ARG B CA  1 
ATOM   2156 C C   . ARG B 1 7   ? 38.057  90.572  155.818 1.00 162.35 ? 90  ARG B C   1 
ATOM   2157 O O   . ARG B 1 7   ? 37.168  91.221  155.263 1.00 157.77 ? 90  ARG B O   1 
ATOM   2158 C CB  . ARG B 1 7   ? 40.163  91.803  155.763 1.00 161.91 ? 90  ARG B CB  1 
ATOM   2159 C CG  . ARG B 1 7   ? 40.323  91.900  157.275 1.00 158.77 ? 90  ARG B CG  1 
ATOM   2160 C CD  . ARG B 1 7   ? 41.243  90.857  157.789 1.00 158.46 ? 90  ARG B CD  1 
ATOM   2161 N NE  . ARG B 1 7   ? 42.525  90.965  157.148 1.00 162.47 ? 90  ARG B NE  1 
ATOM   2162 C CZ  . ARG B 1 7   ? 43.362  89.963  156.892 1.00 165.44 ? 90  ARG B CZ  1 
ATOM   2163 N NH1 . ARG B 1 7   ? 44.513  90.243  156.289 1.00 180.15 ? 90  ARG B NH1 1 
ATOM   2164 N NH2 . ARG B 1 7   ? 43.091  88.709  157.225 1.00 161.09 ? 90  ARG B NH2 1 
ATOM   2165 N N   . ILE B 1 8   ? 37.879  89.877  156.954 1.00 170.72 ? 91  ILE B N   1 
ATOM   2166 C CA  . ILE B 1 8   ? 36.689  90.041  157.805 1.00 168.14 ? 91  ILE B CA  1 
ATOM   2167 C C   . ILE B 1 8   ? 37.072  90.633  159.157 1.00 164.33 ? 91  ILE B C   1 
ATOM   2168 O O   . ILE B 1 8   ? 36.793  91.808  159.418 1.00 172.41 ? 91  ILE B O   1 
ATOM   2169 C CB  . ILE B 1 8   ? 35.901  88.725  157.962 1.00 164.50 ? 91  ILE B CB  1 
ATOM   2170 C CG1 . ILE B 1 8   ? 35.268  88.333  156.623 1.00 163.17 ? 91  ILE B CG1 1 
ATOM   2171 C CG2 . ILE B 1 8   ? 34.819  88.856  159.033 1.00 166.68 ? 91  ILE B CG2 1 
ATOM   2172 C CD1 . ILE B 1 8   ? 34.215  89.292  156.096 1.00 162.01 ? 91  ILE B CD1 1 
ATOM   2173 N N   . ALA B 1 9   ? 37.702  89.834  160.003 1.00 150.94 ? 92  ALA B N   1 
ATOM   2174 C CA  . ALA B 1 9   ? 38.204  90.331  161.265 1.00 150.13 ? 92  ALA B CA  1 
ATOM   2175 C C   . ALA B 1 9   ? 39.178  89.286  161.723 1.00 152.40 ? 92  ALA B C   1 
ATOM   2176 O O   . ALA B 1 9   ? 38.792  88.255  162.278 1.00 159.16 ? 92  ALA B O   1 
ATOM   2177 C CB  . ALA B 1 9   ? 37.081  90.530  162.267 1.00 146.32 ? 92  ALA B CB  1 
ATOM   2178 N N   . ASP B 1 10  ? 40.447  89.538  161.432 1.00 154.63 ? 93  ASP B N   1 
ATOM   2179 C CA  . ASP B 1 10  ? 41.527  88.556  161.600 1.00 151.84 ? 93  ASP B CA  1 
ATOM   2180 C C   . ASP B 1 10  ? 41.328  87.263  160.799 1.00 144.39 ? 93  ASP B C   1 
ATOM   2181 O O   . ASP B 1 10  ? 41.895  86.222  161.144 1.00 148.33 ? 93  ASP B O   1 
ATOM   2182 C CB  . ASP B 1 10  ? 41.801  88.291  163.090 1.00 154.06 ? 93  ASP B CB  1 
ATOM   2183 C CG  . ASP B 1 10  ? 42.345  89.526  163.799 1.00 166.16 ? 93  ASP B CG  1 
ATOM   2184 O OD1 . ASP B 1 10  ? 41.723  90.610  163.693 1.00 174.35 ? 93  ASP B OD1 1 
ATOM   2185 O OD2 . ASP B 1 10  ? 43.414  89.426  164.439 1.00 176.19 ? 93  ASP B OD2 1 
ATOM   2186 N N   . TYR B 1 11  ? 40.563  87.351  159.708 1.00 142.56 ? 94  TYR B N   1 
ATOM   2187 C CA  . TYR B 1 11  ? 40.298  86.216  158.821 1.00 143.01 ? 94  TYR B CA  1 
ATOM   2188 C C   . TYR B 1 11  ? 40.394  86.672  157.380 1.00 143.20 ? 94  TYR B C   1 
ATOM   2189 O O   . TYR B 1 11  ? 39.838  87.701  157.028 1.00 140.92 ? 94  TYR B O   1 
ATOM   2190 C CB  . TYR B 1 11  ? 38.889  85.660  159.019 1.00 141.32 ? 94  TYR B CB  1 
ATOM   2191 C CG  . TYR B 1 11  ? 38.670  84.857  160.282 1.00 143.09 ? 94  TYR B CG  1 
ATOM   2192 C CD1 . TYR B 1 11  ? 39.147  83.545  160.396 1.00 146.05 ? 94  TYR B CD1 1 
ATOM   2193 C CD2 . TYR B 1 11  ? 37.948  85.393  161.347 1.00 143.27 ? 94  TYR B CD2 1 
ATOM   2194 C CE1 . TYR B 1 11  ? 38.938  82.809  161.550 1.00 144.76 ? 94  TYR B CE1 1 
ATOM   2195 C CE2 . TYR B 1 11  ? 37.726  84.671  162.498 1.00 142.70 ? 94  TYR B CE2 1 
ATOM   2196 C CZ  . TYR B 1 11  ? 38.220  83.380  162.602 1.00 146.23 ? 94  TYR B CZ  1 
ATOM   2197 O OH  . TYR B 1 11  ? 37.977  82.663  163.753 1.00 143.77 ? 94  TYR B OH  1 
ATOM   2198 N N   . LEU B 1 12  ? 41.088  85.898  156.552 1.00 147.02 ? 95  LEU B N   1 
ATOM   2199 C CA  . LEU B 1 12  ? 41.042  86.077  155.109 1.00 153.11 ? 95  LEU B CA  1 
ATOM   2200 C C   . LEU B 1 12  ? 39.972  85.177  154.588 1.00 151.76 ? 95  LEU B C   1 
ATOM   2201 O O   . LEU B 1 12  ? 39.871  84.028  154.994 1.00 148.53 ? 95  LEU B O   1 
ATOM   2202 C CB  . LEU B 1 12  ? 42.320  85.639  154.418 1.00 160.06 ? 95  LEU B CB  1 
ATOM   2203 C CG  . LEU B 1 12  ? 43.639  86.146  154.976 1.00 165.41 ? 95  LEU B CG  1 
ATOM   2204 C CD1 . LEU B 1 12  ? 44.705  85.118  154.672 1.00 170.56 ? 95  LEU B CD1 1 
ATOM   2205 C CD2 . LEU B 1 12  ? 43.984  87.507  154.408 1.00 166.61 ? 95  LEU B CD2 1 
ATOM   2206 N N   . LEU B 1 13  ? 39.198  85.694  153.653 1.00 156.70 ? 96  LEU B N   1 
ATOM   2207 C CA  . LEU B 1 13  ? 38.172  84.915  153.007 1.00 158.40 ? 96  LEU B CA  1 
ATOM   2208 C C   . LEU B 1 13  ? 38.739  84.550  151.651 1.00 151.99 ? 96  LEU B C   1 
ATOM   2209 O O   . LEU B 1 13  ? 39.282  85.405  150.952 1.00 155.58 ? 96  LEU B O   1 
ATOM   2210 C CB  . LEU B 1 13  ? 36.871  85.728  152.912 1.00 162.80 ? 96  LEU B CB  1 
ATOM   2211 C CG  . LEU B 1 13  ? 36.006  85.882  154.185 1.00 166.23 ? 96  LEU B CG  1 
ATOM   2212 C CD1 . LEU B 1 13  ? 34.704  85.097  154.089 1.00 168.60 ? 96  LEU B CD1 1 
ATOM   2213 C CD2 . LEU B 1 13  ? 36.694  85.513  155.503 1.00 169.05 ? 96  LEU B CD2 1 
ATOM   2214 N N   . LEU B 1 14  ? 38.612  83.283  151.293 1.00 139.50 ? 97  LEU B N   1 
ATOM   2215 C CA  . LEU B 1 14  ? 39.160  82.776  150.064 1.00 142.72 ? 97  LEU B CA  1 
ATOM   2216 C C   . LEU B 1 14  ? 38.139  81.847  149.403 1.00 139.16 ? 97  LEU B C   1 
ATOM   2217 O O   . LEU B 1 14  ? 37.539  81.040  150.087 1.00 141.28 ? 97  LEU B O   1 
ATOM   2218 C CB  . LEU B 1 14  ? 40.410  82.000  150.406 1.00 149.55 ? 97  LEU B CB  1 
ATOM   2219 C CG  . LEU B 1 14  ? 41.775  82.627  150.133 1.00 154.35 ? 97  LEU B CG  1 
ATOM   2220 C CD1 . LEU B 1 14  ? 42.210  83.697  151.131 1.00 152.91 ? 97  LEU B CD1 1 
ATOM   2221 C CD2 . LEU B 1 14  ? 42.749  81.463  150.147 1.00 155.24 ? 97  LEU B CD2 1 
ATOM   2222 N N   . PRO B 1 15  ? 37.948  81.941  148.075 1.00 142.89 ? 98  PRO B N   1 
ATOM   2223 C CA  . PRO B 1 15  ? 36.795  81.270  147.403 1.00 145.48 ? 98  PRO B CA  1 
ATOM   2224 C C   . PRO B 1 15  ? 36.740  79.718  147.461 1.00 145.00 ? 98  PRO B C   1 
ATOM   2225 O O   . PRO B 1 15  ? 37.726  79.090  147.848 1.00 143.60 ? 98  PRO B O   1 
ATOM   2226 C CB  . PRO B 1 15  ? 36.881  81.766  145.944 1.00 147.19 ? 98  PRO B CB  1 
ATOM   2227 C CG  . PRO B 1 15  ? 38.209  82.425  145.806 1.00 150.15 ? 98  PRO B CG  1 
ATOM   2228 C CD  . PRO B 1 15  ? 38.672  82.847  147.167 1.00 147.22 ? 98  PRO B CD  1 
ATOM   2229 N N   . LEU B 1 16  ? 35.568  79.147  147.115 1.00 146.58 ? 99  LEU B N   1 
ATOM   2230 C CA  . LEU B 1 16  ? 35.347  77.675  147.032 1.00 146.06 ? 99  LEU B CA  1 
ATOM   2231 C C   . LEU B 1 16  ? 34.380  77.076  145.953 1.00 151.83 ? 99  LEU B C   1 
ATOM   2232 O O   . LEU B 1 16  ? 34.166  75.845  145.963 1.00 146.28 ? 99  LEU B O   1 
ATOM   2233 C CB  . LEU B 1 16  ? 34.880  77.172  148.410 1.00 141.14 ? 99  LEU B CB  1 
ATOM   2234 C CG  . LEU B 1 16  ? 35.949  76.748  149.411 1.00 140.23 ? 99  LEU B CG  1 
ATOM   2235 C CD1 . LEU B 1 16  ? 35.319  76.510  150.771 1.00 134.53 ? 99  LEU B CD1 1 
ATOM   2236 C CD2 . LEU B 1 16  ? 36.670  75.497  148.933 1.00 142.86 ? 99  LEU B CD2 1 
ATOM   2237 N N   . ALA B 1 17  ? 33.842  77.909  145.040 1.00 154.41 ? 100 ALA B N   1 
ATOM   2238 C CA  . ALA B 1 17  ? 32.725  77.556  144.108 1.00 154.60 ? 100 ALA B CA  1 
ATOM   2239 C C   . ALA B 1 17  ? 32.604  76.079  143.673 1.00 157.60 ? 100 ALA B C   1 
ATOM   2240 O O   . ALA B 1 17  ? 31.602  75.397  143.963 1.00 156.42 ? 100 ALA B O   1 
ATOM   2241 C CB  . ALA B 1 17  ? 32.758  78.456  142.875 1.00 158.64 ? 100 ALA B CB  1 
ATOM   2242 N N   . GLU B 1 20  ? 28.742  77.378  147.203 1.00 177.07 ? 103 GLU B N   1 
ATOM   2243 C CA  . GLU B 1 20  ? 27.919  78.499  146.721 1.00 180.20 ? 103 GLU B CA  1 
ATOM   2244 C C   . GLU B 1 20  ? 28.255  79.814  147.455 1.00 176.13 ? 103 GLU B C   1 
ATOM   2245 O O   . GLU B 1 20  ? 28.902  80.691  146.879 1.00 178.96 ? 103 GLU B O   1 
ATOM   2246 C CB  . GLU B 1 20  ? 26.422  78.149  146.822 1.00 182.78 ? 103 GLU B CB  1 
ATOM   2247 C CG  . GLU B 1 20  ? 25.465  79.280  146.575 1.00 186.03 ? 103 GLU B CG  1 
ATOM   2248 C CD  . GLU B 1 20  ? 24.247  79.294  147.480 1.00 187.22 ? 103 GLU B CD  1 
ATOM   2249 O OE1 . GLU B 1 20  ? 24.276  78.720  148.596 1.00 181.29 ? 103 GLU B OE1 1 
ATOM   2250 O OE2 . GLU B 1 20  ? 23.258  79.934  147.072 1.00 192.46 ? 103 GLU B OE2 1 
ATOM   2251 N N   . HIS B 1 21  ? 27.793  79.958  148.700 1.00 167.87 ? 104 HIS B N   1 
ATOM   2252 C CA  . HIS B 1 21  ? 28.122  81.121  149.539 1.00 163.12 ? 104 HIS B CA  1 
ATOM   2253 C C   . HIS B 1 21  ? 28.992  80.698  150.721 1.00 152.72 ? 104 HIS B C   1 
ATOM   2254 O O   . HIS B 1 21  ? 29.169  81.472  151.674 1.00 145.01 ? 104 HIS B O   1 
ATOM   2255 C CB  . HIS B 1 21  ? 26.850  81.832  150.038 1.00 167.67 ? 104 HIS B CB  1 
ATOM   2256 C CG  . HIS B 1 21  ? 26.127  82.618  148.979 1.00 165.37 ? 104 HIS B CG  1 
ATOM   2257 N ND1 . HIS B 1 21  ? 26.653  83.751  148.395 1.00 169.09 ? 104 HIS B ND1 1 
ATOM   2258 C CD2 . HIS B 1 21  ? 24.906  82.443  148.422 1.00 161.76 ? 104 HIS B CD2 1 
ATOM   2259 C CE1 . HIS B 1 21  ? 25.792  84.233  147.515 1.00 167.46 ? 104 HIS B CE1 1 
ATOM   2260 N NE2 . HIS B 1 21  ? 24.724  83.455  147.511 1.00 165.55 ? 104 HIS B NE2 1 
ATOM   2261 N N   . VAL B 1 22  ? 29.546  79.481  150.656 1.00 148.32 ? 105 VAL B N   1 
ATOM   2262 C CA  . VAL B 1 22  ? 30.664  79.118  151.522 1.00 141.55 ? 105 VAL B CA  1 
ATOM   2263 C C   . VAL B 1 22  ? 31.978  79.528  150.854 1.00 138.55 ? 105 VAL B C   1 
ATOM   2264 O O   . VAL B 1 22  ? 32.165  79.402  149.632 1.00 130.24 ? 105 VAL B O   1 
ATOM   2265 C CB  . VAL B 1 22  ? 30.743  77.622  151.863 1.00 136.33 ? 105 VAL B CB  1 
ATOM   2266 C CG1 . VAL B 1 22  ? 31.811  77.401  152.935 1.00 134.72 ? 105 VAL B CG1 1 
ATOM   2267 C CG2 . VAL B 1 22  ? 29.383  77.093  152.315 1.00 136.76 ? 105 VAL B CG2 1 
ATOM   2268 N N   . SER B 1 23  ? 32.870  80.028  151.696 1.00 139.01 ? 106 SER B N   1 
ATOM   2269 C CA  . SER B 1 23  ? 34.239  80.313  151.324 1.00 147.16 ? 106 SER B CA  1 
ATOM   2270 C C   . SER B 1 23  ? 35.118  79.828  152.485 1.00 144.87 ? 106 SER B C   1 
ATOM   2271 O O   . SER B 1 23  ? 34.614  79.650  153.595 1.00 148.68 ? 106 SER B O   1 
ATOM   2272 C CB  . SER B 1 23  ? 34.401  81.813  151.063 1.00 151.93 ? 106 SER B CB  1 
ATOM   2273 O OG  . SER B 1 23  ? 34.651  82.519  152.266 1.00 154.25 ? 106 SER B OG  1 
ATOM   2274 N N   . ARG B 1 24  ? 36.399  79.572  152.218 1.00 142.61 ? 107 ARG B N   1 
ATOM   2275 C CA  . ARG B 1 24  ? 37.366  79.231  153.271 1.00 141.58 ? 107 ARG B CA  1 
ATOM   2276 C C   . ARG B 1 24  ? 37.891  80.483  153.974 1.00 141.28 ? 107 ARG B C   1 
ATOM   2277 O O   . ARG B 1 24  ? 38.136  81.514  153.338 1.00 153.86 ? 107 ARG B O   1 
ATOM   2278 C CB  . ARG B 1 24  ? 38.523  78.405  152.706 1.00 145.40 ? 107 ARG B CB  1 
ATOM   2279 C CG  . ARG B 1 24  ? 39.522  79.182  151.863 1.00 151.64 ? 107 ARG B CG  1 
ATOM   2280 C CD  . ARG B 1 24  ? 40.633  78.292  151.361 1.00 159.08 ? 107 ARG B CD  1 
ATOM   2281 N NE  . ARG B 1 24  ? 40.147  77.337  150.366 1.00 159.61 ? 107 ARG B NE  1 
ATOM   2282 C CZ  . ARG B 1 24  ? 40.554  76.080  150.227 1.00 156.74 ? 107 ARG B CZ  1 
ATOM   2283 N NH1 . ARG B 1 24  ? 41.453  75.541  151.045 1.00 160.54 ? 107 ARG B NH1 1 
ATOM   2284 N NH2 . ARG B 1 24  ? 40.032  75.341  149.262 1.00 158.44 ? 107 ARG B NH2 1 
ATOM   2285 N N   . ALA B 1 25  ? 38.028  80.403  155.290 1.00 138.86 ? 108 ALA B N   1 
ATOM   2286 C CA  . ALA B 1 25  ? 38.535  81.512  156.097 1.00 141.77 ? 108 ALA B CA  1 
ATOM   2287 C C   . ALA B 1 25  ? 39.810  81.067  156.746 1.00 144.93 ? 108 ALA B C   1 
ATOM   2288 O O   . ALA B 1 25  ? 39.954  79.886  157.042 1.00 146.53 ? 108 ALA B O   1 
ATOM   2289 C CB  . ALA B 1 25  ? 37.539  81.904  157.160 1.00 142.07 ? 108 ALA B CB  1 
ATOM   2290 N N   . LEU B 1 26  ? 40.739  82.003  156.937 1.00 148.68 ? 109 LEU B N   1 
ATOM   2291 C CA  . LEU B 1 26  ? 42.068  81.699  157.464 1.00 149.66 ? 109 LEU B CA  1 
ATOM   2292 C C   . LEU B 1 26  ? 42.538  82.716  158.445 1.00 151.62 ? 109 LEU B C   1 
ATOM   2293 O O   . LEU B 1 26  ? 42.516  83.897  158.157 1.00 146.41 ? 109 LEU B O   1 
ATOM   2294 C CB  . LEU B 1 26  ? 43.077  81.654  156.343 1.00 152.48 ? 109 LEU B CB  1 
ATOM   2295 C CG  . LEU B 1 26  ? 42.908  80.293  155.655 1.00 154.32 ? 109 LEU B CG  1 
ATOM   2296 C CD1 . LEU B 1 26  ? 42.102  80.401  154.388 1.00 156.79 ? 109 LEU B CD1 1 
ATOM   2297 C CD2 . LEU B 1 26  ? 44.261  79.741  155.333 1.00 163.70 ? 109 LEU B CD2 1 
ATOM   2298 N N   . CYS B 1 27  ? 42.962  82.250  159.612 1.00 155.44 ? 110 CYS B N   1 
ATOM   2299 C CA  . CYS B 1 27  ? 43.464  83.156  160.623 1.00 157.35 ? 110 CYS B CA  1 
ATOM   2300 C C   . CYS B 1 27  ? 44.819  83.754  160.144 1.00 153.69 ? 110 CYS B C   1 
ATOM   2301 O O   . CYS B 1 27  ? 45.404  84.655  160.754 1.00 147.43 ? 110 CYS B O   1 
ATOM   2302 C CB  . CYS B 1 27  ? 43.592  82.425  161.958 1.00 155.52 ? 110 CYS B CB  1 
ATOM   2303 S SG  . CYS B 1 27  ? 43.730  83.587  163.315 1.00 166.28 ? 110 CYS B SG  1 
ATOM   2304 N N   . THR B 1 30  ? 47.513  83.476  163.855 1.00 142.08 ? 113 THR B N   1 
ATOM   2305 C CA  . THR B 1 30  ? 47.477  81.974  163.804 1.00 143.97 ? 113 THR B CA  1 
ATOM   2306 C C   . THR B 1 30  ? 47.350  81.538  162.325 1.00 144.05 ? 113 THR B C   1 
ATOM   2307 O O   . THR B 1 30  ? 47.064  82.397  161.505 1.00 149.78 ? 113 THR B O   1 
ATOM   2308 C CB  . THR B 1 30  ? 46.269  81.391  164.635 1.00 138.44 ? 113 THR B CB  1 
ATOM   2309 O OG1 . THR B 1 30  ? 46.299  81.872  165.994 1.00 134.28 ? 113 THR B OG1 1 
ATOM   2310 C CG2 . THR B 1 30  ? 46.207  79.860  164.641 1.00 134.94 ? 113 THR B CG2 1 
ATOM   2311 N N   . GLY B 1 31  ? 47.573  80.258  161.976 1.00 140.06 ? 114 GLY B N   1 
ATOM   2312 C CA  . GLY B 1 31  ? 47.337  79.750  160.600 1.00 138.14 ? 114 GLY B CA  1 
ATOM   2313 C C   . GLY B 1 31  ? 46.112  78.876  160.387 1.00 136.84 ? 114 GLY B C   1 
ATOM   2314 O O   . GLY B 1 31  ? 46.051  78.090  159.429 1.00 135.00 ? 114 GLY B O   1 
ATOM   2315 N N   . ARG B 1 32  ? 45.120  79.025  161.261 1.00 139.43 ? 115 ARG B N   1 
ATOM   2316 C CA  . ARG B 1 32  ? 43.976  78.104  161.352 1.00 139.14 ? 115 ARG B CA  1 
ATOM   2317 C C   . ARG B 1 32  ? 43.036  78.283  160.147 1.00 139.80 ? 115 ARG B C   1 
ATOM   2318 O O   . ARG B 1 32  ? 42.673  79.418  159.828 1.00 138.02 ? 115 ARG B O   1 
ATOM   2319 C CB  . ARG B 1 32  ? 43.237  78.379  162.676 1.00 139.60 ? 115 ARG B CB  1 
ATOM   2320 C CG  . ARG B 1 32  ? 42.127  77.422  163.073 1.00 138.52 ? 115 ARG B CG  1 
ATOM   2321 C CD  . ARG B 1 32  ? 41.445  77.917  164.344 1.00 141.57 ? 115 ARG B CD  1 
ATOM   2322 N NE  . ARG B 1 32  ? 40.182  77.212  164.638 1.00 144.14 ? 115 ARG B NE  1 
ATOM   2323 C CZ  . ARG B 1 32  ? 39.294  77.555  165.584 1.00 139.69 ? 115 ARG B CZ  1 
ATOM   2324 N NH1 . ARG B 1 32  ? 39.486  78.607  166.379 1.00 140.74 ? 115 ARG B NH1 1 
ATOM   2325 N NH2 . ARG B 1 32  ? 38.191  76.834  165.752 1.00 137.51 ? 115 ARG B NH2 1 
ATOM   2326 N N   . GLU B 1 33  ? 42.650  77.174  159.495 1.00 140.04 ? 116 GLU B N   1 
ATOM   2327 C CA  . GLU B 1 33  ? 41.696  77.188  158.363 1.00 141.96 ? 116 GLU B CA  1 
ATOM   2328 C C   . GLU B 1 33  ? 40.254  76.740  158.730 1.00 142.21 ? 116 GLU B C   1 
ATOM   2329 O O   . GLU B 1 33  ? 40.008  75.560  158.994 1.00 151.22 ? 116 GLU B O   1 
ATOM   2330 C CB  . GLU B 1 33  ? 42.213  76.352  157.188 1.00 143.30 ? 116 GLU B CB  1 
ATOM   2331 C CG  . GLU B 1 33  ? 41.529  76.714  155.864 1.00 147.17 ? 116 GLU B CG  1 
ATOM   2332 C CD  . GLU B 1 33  ? 41.631  75.652  154.788 1.00 151.43 ? 116 GLU B CD  1 
ATOM   2333 O OE1 . GLU B 1 33  ? 41.762  74.472  155.130 1.00 159.95 ? 116 GLU B OE1 1 
ATOM   2334 O OE2 . GLU B 1 33  ? 41.568  75.981  153.582 1.00 149.67 ? 116 GLU B OE2 1 
ATOM   2335 N N   . LEU B 1 34  ? 39.325  77.706  158.716 1.00 142.40 ? 117 LEU B N   1 
ATOM   2336 C CA  . LEU B 1 34  ? 37.879  77.514  158.966 1.00 135.79 ? 117 LEU B CA  1 
ATOM   2337 C C   . LEU B 1 34  ? 37.090  77.495  157.644 1.00 135.29 ? 117 LEU B C   1 
ATOM   2338 O O   . LEU B 1 34  ? 37.616  77.895  156.597 1.00 139.55 ? 117 LEU B O   1 
ATOM   2339 C CB  . LEU B 1 34  ? 37.330  78.671  159.829 1.00 134.84 ? 117 LEU B CB  1 
ATOM   2340 C CG  . LEU B 1 34  ? 37.690  78.810  161.312 1.00 133.56 ? 117 LEU B CG  1 
ATOM   2341 C CD1 . LEU B 1 34  ? 37.167  77.622  162.087 1.00 132.05 ? 117 LEU B CD1 1 
ATOM   2342 C CD2 . LEU B 1 34  ? 39.184  78.960  161.525 1.00 136.81 ? 117 LEU B CD2 1 
ATOM   2343 N N   . ARG B 1 35  ? 35.848  77.005  157.678 1.00 130.08 ? 118 ARG B N   1 
ATOM   2344 C CA  . ARG B 1 35  ? 34.867  77.331  156.643 1.00 130.00 ? 118 ARG B CA  1 
ATOM   2345 C C   . ARG B 1 35  ? 33.941  78.449  157.160 1.00 132.61 ? 118 ARG B C   1 
ATOM   2346 O O   . ARG B 1 35  ? 33.743  78.601  158.367 1.00 127.35 ? 118 ARG B O   1 
ATOM   2347 C CB  . ARG B 1 35  ? 34.067  76.108  156.195 1.00 125.61 ? 118 ARG B CB  1 
ATOM   2348 C CG  . ARG B 1 35  ? 34.846  75.068  155.403 1.00 130.99 ? 118 ARG B CG  1 
ATOM   2349 C CD  . ARG B 1 35  ? 35.364  75.592  154.072 1.00 138.55 ? 118 ARG B CD  1 
ATOM   2350 N NE  . ARG B 1 35  ? 36.577  74.925  153.578 1.00 149.89 ? 118 ARG B NE  1 
ATOM   2351 C CZ  . ARG B 1 35  ? 37.795  75.000  154.133 1.00 159.85 ? 118 ARG B CZ  1 
ATOM   2352 N NH1 . ARG B 1 35  ? 38.005  75.672  155.256 1.00 161.28 ? 118 ARG B NH1 1 
ATOM   2353 N NH2 . ARG B 1 35  ? 38.825  74.366  153.576 1.00 166.30 ? 118 ARG B NH2 1 
ATOM   2354 N N   . CYS B 1 36  ? 33.406  79.243  156.226 1.00 133.62 ? 119 CYS B N   1 
ATOM   2355 C CA  . CYS B 1 36  ? 32.611  80.443  156.534 1.00 129.87 ? 119 CYS B CA  1 
ATOM   2356 C C   . CYS B 1 36  ? 31.404  80.573  155.586 1.00 121.75 ? 119 CYS B C   1 
ATOM   2357 O O   . CYS B 1 36  ? 31.585  80.769  154.387 1.00 113.99 ? 119 CYS B O   1 
ATOM   2358 C CB  . CYS B 1 36  ? 33.511  81.676  156.435 1.00 133.16 ? 119 CYS B CB  1 
ATOM   2359 S SG  . CYS B 1 36  ? 32.700  83.221  156.843 1.00 134.53 ? 119 CYS B SG  1 
ATOM   2360 N N   . LYS B 1 37  ? 30.195  80.393  156.133 1.00 120.66 ? 120 LYS B N   1 
ATOM   2361 C CA  . LYS B 1 37  ? 28.930  80.609  155.404 1.00 124.70 ? 120 LYS B CA  1 
ATOM   2362 C C   . LYS B 1 37  ? 28.553  82.067  155.558 1.00 122.27 ? 120 LYS B C   1 
ATOM   2363 O O   . LYS B 1 37  ? 28.585  82.591  156.674 1.00 116.95 ? 120 LYS B O   1 
ATOM   2364 C CB  . LYS B 1 37  ? 27.783  79.726  155.940 1.00 123.71 ? 120 LYS B CB  1 
ATOM   2365 C CG  . LYS B 1 37  ? 28.117  78.246  156.015 1.00 127.51 ? 120 LYS B CG  1 
ATOM   2366 C CD  . LYS B 1 37  ? 26.887  77.330  156.034 1.00 133.76 ? 120 LYS B CD  1 
ATOM   2367 C CE  . LYS B 1 37  ? 27.261  75.899  156.458 1.00 134.59 ? 120 LYS B CE  1 
ATOM   2368 N NZ  . LYS B 1 37  ? 26.209  74.869  156.187 1.00 136.41 ? 120 LYS B NZ  1 
ATOM   2369 N N   . VAL B 1 38  ? 28.222  82.722  154.447 1.00 123.94 ? 121 VAL B N   1 
ATOM   2370 C CA  . VAL B 1 38  ? 27.821  84.133  154.488 1.00 129.24 ? 121 VAL B CA  1 
ATOM   2371 C C   . VAL B 1 38  ? 26.333  84.330  154.157 1.00 126.61 ? 121 VAL B C   1 
ATOM   2372 O O   . VAL B 1 38  ? 25.901  83.989  153.065 1.00 121.92 ? 121 VAL B O   1 
ATOM   2373 C CB  . VAL B 1 38  ? 28.731  85.007  153.590 1.00 130.87 ? 121 VAL B CB  1 
ATOM   2374 C CG1 . VAL B 1 38  ? 28.401  84.901  152.106 1.00 131.45 ? 121 VAL B CG1 1 
ATOM   2375 C CG2 . VAL B 1 38  ? 28.629  86.454  154.025 1.00 133.62 ? 121 VAL B CG2 1 
ATOM   2376 N N   . PHE B 1 39  ? 25.575  84.879  155.110 1.00 127.20 ? 122 PHE B N   1 
ATOM   2377 C CA  . PHE B 1 39  ? 24.146  85.179  154.927 1.00 129.44 ? 122 PHE B CA  1 
ATOM   2378 C C   . PHE B 1 39  ? 23.950  86.689  154.941 1.00 130.02 ? 122 PHE B C   1 
ATOM   2379 O O   . PHE B 1 39  ? 24.805  87.416  155.452 1.00 132.59 ? 122 PHE B O   1 
ATOM   2380 C CB  . PHE B 1 39  ? 23.295  84.591  156.045 1.00 128.97 ? 122 PHE B CB  1 
ATOM   2381 C CG  . PHE B 1 39  ? 23.539  83.135  156.287 1.00 129.55 ? 122 PHE B CG  1 
ATOM   2382 C CD1 . PHE B 1 39  ? 22.908  82.174  155.514 1.00 128.78 ? 122 PHE B CD1 1 
ATOM   2383 C CD2 . PHE B 1 39  ? 24.382  82.730  157.304 1.00 130.09 ? 122 PHE B CD2 1 
ATOM   2384 C CE1 . PHE B 1 39  ? 23.112  80.829  155.744 1.00 128.31 ? 122 PHE B CE1 1 
ATOM   2385 C CE2 . PHE B 1 39  ? 24.590  81.387  157.545 1.00 131.21 ? 122 PHE B CE2 1 
ATOM   2386 C CZ  . PHE B 1 39  ? 23.957  80.428  156.764 1.00 131.30 ? 122 PHE B CZ  1 
ATOM   2387 N N   . PRO B 1 40  ? 22.828  87.172  154.383 1.00 128.30 ? 123 PRO B N   1 
ATOM   2388 C CA  . PRO B 1 40  ? 22.428  88.572  154.588 1.00 129.87 ? 123 PRO B CA  1 
ATOM   2389 C C   . PRO B 1 40  ? 21.936  88.761  156.028 1.00 131.87 ? 123 PRO B C   1 
ATOM   2390 O O   . PRO B 1 40  ? 21.180  87.871  156.499 1.00 131.00 ? 123 PRO B O   1 
ATOM   2391 C CB  . PRO B 1 40  ? 21.273  88.730  153.613 1.00 131.16 ? 123 PRO B CB  1 
ATOM   2392 C CG  . PRO B 1 40  ? 20.713  87.353  153.447 1.00 126.01 ? 123 PRO B CG  1 
ATOM   2393 C CD  . PRO B 1 40  ? 21.877  86.438  153.523 1.00 125.31 ? 123 PRO B CD  1 
ATOM   2394 N N   . ILE B 1 41  ? 22.343  89.847  156.726 1.00 134.50 ? 124 ILE B N   1 
ATOM   2395 C CA  . ILE B 1 41  ? 22.044  89.941  158.208 1.00 138.37 ? 124 ILE B CA  1 
ATOM   2396 C C   . ILE B 1 41  ? 20.594  89.642  158.530 1.00 141.36 ? 124 ILE B C   1 
ATOM   2397 O O   . ILE B 1 41  ? 20.308  88.947  159.516 1.00 142.56 ? 124 ILE B O   1 
ATOM   2398 C CB  . ILE B 1 41  ? 22.212  91.305  158.985 1.00 141.20 ? 124 ILE B CB  1 
ATOM   2399 C CG1 . ILE B 1 41  ? 23.114  92.329  158.347 1.00 142.29 ? 124 ILE B CG1 1 
ATOM   2400 C CG2 . ILE B 1 41  ? 22.682  91.023  160.409 1.00 142.48 ? 124 ILE B CG2 1 
ATOM   2401 C CD1 . ILE B 1 41  ? 24.528  91.882  158.245 1.00 142.97 ? 124 ILE B CD1 1 
ATOM   2402 N N   . LYS B 1 42  ? 19.701  90.197  157.710 1.00 144.42 ? 125 LYS B N   1 
ATOM   2403 C CA  . LYS B 1 42  ? 18.264  90.056  157.900 1.00 144.15 ? 125 LYS B CA  1 
ATOM   2404 C C   . LYS B 1 42  ? 17.771  88.631  158.083 1.00 144.18 ? 125 LYS B C   1 
ATOM   2405 O O   . LYS B 1 42  ? 16.815  88.442  158.804 1.00 151.47 ? 125 LYS B O   1 
ATOM   2406 C CB  . LYS B 1 42  ? 17.513  90.699  156.749 1.00 146.38 ? 125 LYS B CB  1 
ATOM   2407 C CG  . LYS B 1 42  ? 17.552  92.209  156.820 1.00 152.51 ? 125 LYS B CG  1 
ATOM   2408 C CD  . LYS B 1 42  ? 16.548  92.753  157.828 1.00 155.74 ? 125 LYS B CD  1 
ATOM   2409 C CE  . LYS B 1 42  ? 16.885  94.177  158.239 1.00 158.01 ? 125 LYS B CE  1 
ATOM   2410 N NZ  . LYS B 1 42  ? 17.110  95.080  157.079 1.00 160.32 ? 125 LYS B NZ  1 
ATOM   2411 N N   . HIS B 1 43  ? 18.414  87.634  157.464 1.00 142.90 ? 126 HIS B N   1 
ATOM   2412 C CA  . HIS B 1 43  ? 17.964  86.233  157.576 1.00 137.46 ? 126 HIS B CA  1 
ATOM   2413 C C   . HIS B 1 43  ? 18.941  85.274  158.222 1.00 125.61 ? 126 HIS B C   1 
ATOM   2414 O O   . HIS B 1 43  ? 18.649  84.078  158.324 1.00 130.45 ? 126 HIS B O   1 
ATOM   2415 C CB  . HIS B 1 43  ? 17.498  85.740  156.206 1.00 143.80 ? 126 HIS B CB  1 
ATOM   2416 C CG  . HIS B 1 43  ? 16.294  86.494  155.699 1.00 151.54 ? 126 HIS B CG  1 
ATOM   2417 N ND1 . HIS B 1 43  ? 16.351  87.818  155.295 1.00 155.09 ? 126 HIS B ND1 1 
ATOM   2418 C CD2 . HIS B 1 43  ? 14.994  86.129  155.593 1.00 150.46 ? 126 HIS B CD2 1 
ATOM   2419 C CE1 . HIS B 1 43  ? 15.147  88.222  154.931 1.00 153.69 ? 126 HIS B CE1 1 
ATOM   2420 N NE2 . HIS B 1 43  ? 14.307  87.216  155.102 1.00 156.52 ? 126 HIS B NE2 1 
ATOM   2421 N N   . TYR B 1 44  ? 20.052  85.783  158.741 1.00 120.32 ? 127 TYR B N   1 
ATOM   2422 C CA  . TYR B 1 44  ? 21.032  84.907  159.440 1.00 116.37 ? 127 TYR B CA  1 
ATOM   2423 C C   . TYR B 1 44  ? 20.424  84.182  160.668 1.00 112.22 ? 127 TYR B C   1 
ATOM   2424 O O   . TYR B 1 44  ? 20.708  83.022  160.899 1.00 111.92 ? 127 TYR B O   1 
ATOM   2425 C CB  . TYR B 1 44  ? 22.352  85.667  159.771 1.00 115.06 ? 127 TYR B CB  1 
ATOM   2426 C CG  . TYR B 1 44  ? 22.598  86.033  161.223 1.00 116.08 ? 127 TYR B CG  1 
ATOM   2427 C CD1 . TYR B 1 44  ? 22.898  85.037  162.156 1.00 122.76 ? 127 TYR B CD1 1 
ATOM   2428 C CD2 . TYR B 1 44  ? 22.573  87.353  161.667 1.00 117.39 ? 127 TYR B CD2 1 
ATOM   2429 C CE1 . TYR B 1 44  ? 23.124  85.324  163.498 1.00 127.10 ? 127 TYR B CE1 1 
ATOM   2430 C CE2 . TYR B 1 44  ? 22.803  87.659  163.011 1.00 121.56 ? 127 TYR B CE2 1 
ATOM   2431 C CZ  . TYR B 1 44  ? 23.084  86.630  163.923 1.00 129.51 ? 127 TYR B CZ  1 
ATOM   2432 O OH  . TYR B 1 44  ? 23.316  86.815  165.281 1.00 142.22 ? 127 TYR B OH  1 
ATOM   2433 N N   . GLN B 1 45  ? 19.571  84.849  161.433 1.00 112.84 ? 128 GLN B N   1 
ATOM   2434 C CA  . GLN B 1 45  ? 19.187  84.339  162.753 1.00 111.58 ? 128 GLN B CA  1 
ATOM   2435 C C   . GLN B 1 45  ? 18.379  83.067  162.738 1.00 113.38 ? 128 GLN B C   1 
ATOM   2436 O O   . GLN B 1 45  ? 18.613  82.184  163.562 1.00 112.35 ? 128 GLN B O   1 
ATOM   2437 C CB  . GLN B 1 45  ? 18.482  85.416  163.575 1.00 113.52 ? 128 GLN B CB  1 
ATOM   2438 C CG  . GLN B 1 45  ? 19.386  86.608  163.900 1.00 113.86 ? 128 GLN B CG  1 
ATOM   2439 C CD  . GLN B 1 45  ? 19.056  87.346  165.185 1.00 115.68 ? 128 GLN B CD  1 
ATOM   2440 O OE1 . GLN B 1 45  ? 18.008  87.972  165.298 1.00 118.88 ? 128 GLN B OE1 1 
ATOM   2441 N NE2 . GLN B 1 45  ? 19.975  87.317  166.140 1.00 116.55 ? 128 GLN B NE2 1 
ATOM   2442 N N   . ASP B 1 46  ? 17.463  82.928  161.792 1.00 121.16 ? 129 ASP B N   1 
ATOM   2443 C CA  . ASP B 1 46  ? 16.716  81.664  161.691 1.00 127.86 ? 129 ASP B CA  1 
ATOM   2444 C C   . ASP B 1 46  ? 17.600  80.501  161.254 1.00 127.37 ? 129 ASP B C   1 
ATOM   2445 O O   . ASP B 1 46  ? 17.366  79.360  161.673 1.00 124.46 ? 129 ASP B O   1 
ATOM   2446 C CB  . ASP B 1 46  ? 15.497  81.803  160.785 1.00 134.49 ? 129 ASP B CB  1 
ATOM   2447 C CG  . ASP B 1 46  ? 14.407  82.646  161.421 1.00 149.08 ? 129 ASP B CG  1 
ATOM   2448 O OD1 . ASP B 1 46  ? 14.634  83.184  162.537 1.00 157.33 ? 129 ASP B OD1 1 
ATOM   2449 O OD2 . ASP B 1 46  ? 13.323  82.787  160.806 1.00 163.22 ? 129 ASP B OD2 1 
ATOM   2450 N N   . LYS B 1 47  ? 18.593  80.786  160.405 1.00 127.92 ? 130 LYS B N   1 
ATOM   2451 C CA  . LYS B 1 47  ? 19.529  79.766  159.940 1.00 121.12 ? 130 LYS B CA  1 
ATOM   2452 C C   . LYS B 1 47  ? 20.228  79.120  161.107 1.00 117.59 ? 130 LYS B C   1 
ATOM   2453 O O   . LYS B 1 47  ? 20.365  77.888  161.144 1.00 121.20 ? 130 LYS B O   1 
ATOM   2454 C CB  . LYS B 1 47  ? 20.546  80.341  158.945 1.00 126.59 ? 130 LYS B CB  1 
ATOM   2455 C CG  . LYS B 1 47  ? 19.966  80.631  157.566 1.00 134.70 ? 130 LYS B CG  1 
ATOM   2456 C CD  . LYS B 1 47  ? 19.802  79.347  156.746 1.00 139.34 ? 130 LYS B CD  1 
ATOM   2457 C CE  . LYS B 1 47  ? 18.400  79.208  156.154 1.00 145.09 ? 130 LYS B CE  1 
ATOM   2458 N NZ  . LYS B 1 47  ? 17.991  80.359  155.295 1.00 148.83 ? 130 LYS B NZ  1 
ATOM   2459 N N   . ILE B 1 48  ? 20.644  79.913  162.082 1.00 114.61 ? 131 ILE B N   1 
ATOM   2460 C CA  . ILE B 1 48  ? 21.438  79.344  163.156 1.00 114.67 ? 131 ILE B CA  1 
ATOM   2461 C C   . ILE B 1 48  ? 20.652  78.889  164.364 1.00 112.61 ? 131 ILE B C   1 
ATOM   2462 O O   . ILE B 1 48  ? 21.233  78.275  165.244 1.00 117.01 ? 131 ILE B O   1 
ATOM   2463 C CB  . ILE B 1 48  ? 22.600  80.263  163.566 1.00 126.06 ? 131 ILE B CB  1 
ATOM   2464 C CG1 . ILE B 1 48  ? 22.136  81.450  164.403 1.00 129.12 ? 131 ILE B CG1 1 
ATOM   2465 C CG2 . ILE B 1 48  ? 23.381  80.738  162.318 1.00 130.01 ? 131 ILE B CG2 1 
ATOM   2466 C CD1 . ILE B 1 48  ? 23.261  81.989  165.245 1.00 131.72 ? 131 ILE B CD1 1 
ATOM   2467 N N   . ARG B 1 49  ? 19.332  79.092  164.370 1.00 117.61 ? 132 ARG B N   1 
ATOM   2468 C CA  . ARG B 1 49  ? 18.440  78.631  165.477 1.00 116.66 ? 132 ARG B CA  1 
ATOM   2469 C C   . ARG B 1 49  ? 18.638  77.193  166.013 1.00 109.91 ? 132 ARG B C   1 
ATOM   2470 O O   . ARG B 1 49  ? 18.631  76.993  167.205 1.00 107.70 ? 132 ARG B O   1 
ATOM   2471 C CB  . ARG B 1 49  ? 16.951  78.807  165.115 1.00 123.87 ? 132 ARG B CB  1 
ATOM   2472 C CG  . ARG B 1 49  ? 16.388  80.195  165.385 1.00 129.58 ? 132 ARG B CG  1 
ATOM   2473 C CD  . ARG B 1 49  ? 14.870  80.233  165.354 1.00 133.04 ? 132 ARG B CD  1 
ATOM   2474 N NE  . ARG B 1 49  ? 14.300  79.653  166.577 1.00 138.12 ? 132 ARG B NE  1 
ATOM   2475 C CZ  . ARG B 1 49  ? 13.422  78.641  166.653 1.00 139.70 ? 132 ARG B CZ  1 
ATOM   2476 N NH1 . ARG B 1 49  ? 12.942  78.028  165.569 1.00 140.41 ? 132 ARG B NH1 1 
ATOM   2477 N NH2 . ARG B 1 49  ? 12.996  78.236  167.849 1.00 139.40 ? 132 ARG B NH2 1 
ATOM   2478 N N   . PRO B 1 50  ? 18.802  76.194  165.137 1.00 106.62 ? 133 PRO B N   1 
ATOM   2479 C CA  . PRO B 1 50  ? 19.047  74.816  165.590 1.00 106.20 ? 133 PRO B CA  1 
ATOM   2480 C C   . PRO B 1 50  ? 20.306  74.605  166.433 1.00 104.05 ? 133 PRO B C   1 
ATOM   2481 O O   . PRO B 1 50  ? 20.299  73.825  167.393 1.00 98.77  ? 133 PRO B O   1 
ATOM   2482 C CB  . PRO B 1 50  ? 19.199  74.045  164.273 1.00 107.65 ? 133 PRO B CB  1 
ATOM   2483 C CG  . PRO B 1 50  ? 18.378  74.845  163.311 1.00 111.96 ? 133 PRO B CG  1 
ATOM   2484 C CD  . PRO B 1 50  ? 18.703  76.256  163.671 1.00 111.75 ? 133 PRO B CD  1 
ATOM   2485 N N   . TYR B 1 51  ? 21.383  75.277  166.033 1.00 104.78 ? 134 TYR B N   1 
ATOM   2486 C CA  . TYR B 1 51  ? 22.657  75.235  166.766 1.00 100.71 ? 134 TYR B CA  1 
ATOM   2487 C C   . TYR B 1 51  ? 22.468  75.751  168.214 1.00 101.09 ? 134 TYR B C   1 
ATOM   2488 O O   . TYR B 1 51  ? 23.022  75.174  169.167 1.00 96.46  ? 134 TYR B O   1 
ATOM   2489 C CB  . TYR B 1 51  ? 23.739  76.028  166.028 1.00 93.36  ? 134 TYR B CB  1 
ATOM   2490 C CG  . TYR B 1 51  ? 24.030  75.524  164.632 1.00 92.73  ? 134 TYR B CG  1 
ATOM   2491 C CD1 . TYR B 1 51  ? 24.940  74.500  164.395 1.00 91.20  ? 134 TYR B CD1 1 
ATOM   2492 C CD2 . TYR B 1 51  ? 23.407  76.091  163.533 1.00 97.64  ? 134 TYR B CD2 1 
ATOM   2493 C CE1 . TYR B 1 51  ? 25.208  74.048  163.101 1.00 94.64  ? 134 TYR B CE1 1 
ATOM   2494 C CE2 . TYR B 1 51  ? 23.680  75.666  162.230 1.00 100.92 ? 134 TYR B CE2 1 
ATOM   2495 C CZ  . TYR B 1 51  ? 24.574  74.633  162.015 1.00 98.30  ? 134 TYR B CZ  1 
ATOM   2496 O OH  . TYR B 1 51  ? 24.827  74.187  160.708 1.00 104.49 ? 134 TYR B OH  1 
ATOM   2497 N N   . ILE B 1 52  ? 21.661  76.806  168.360 1.00 102.69 ? 135 ILE B N   1 
ATOM   2498 C CA  . ILE B 1 52  ? 21.339  77.367  169.676 1.00 104.88 ? 135 ILE B CA  1 
ATOM   2499 C C   . ILE B 1 52  ? 20.592  76.346  170.528 1.00 105.75 ? 135 ILE B C   1 
ATOM   2500 O O   . ILE B 1 52  ? 20.943  76.145  171.681 1.00 108.39 ? 135 ILE B O   1 
ATOM   2501 C CB  . ILE B 1 52  ? 20.513  78.683  169.582 1.00 108.49 ? 135 ILE B CB  1 
ATOM   2502 C CG1 . ILE B 1 52  ? 21.364  79.859  169.107 1.00 112.02 ? 135 ILE B CG1 1 
ATOM   2503 C CG2 . ILE B 1 52  ? 19.942  79.070  170.936 1.00 112.34 ? 135 ILE B CG2 1 
ATOM   2504 C CD1 . ILE B 1 52  ? 21.492  80.022  167.611 1.00 114.95 ? 135 ILE B CD1 1 
ATOM   2505 N N   . GLN B 1 53  ? 19.578  75.696  169.959 1.00 110.04 ? 136 GLN B N   1 
ATOM   2506 C CA  . GLN B 1 53  ? 18.728  74.748  170.730 1.00 113.34 ? 136 GLN B CA  1 
ATOM   2507 C C   . GLN B 1 53  ? 19.455  73.475  171.110 1.00 105.13 ? 136 GLN B C   1 
ATOM   2508 O O   . GLN B 1 53  ? 19.203  72.896  172.139 1.00 106.40 ? 136 GLN B O   1 
ATOM   2509 C CB  . GLN B 1 53  ? 17.431  74.385  169.989 1.00 121.59 ? 136 GLN B CB  1 
ATOM   2510 C CG  . GLN B 1 53  ? 16.283  75.398  170.160 1.00 132.55 ? 136 GLN B CG  1 
ATOM   2511 C CD  . GLN B 1 53  ? 16.449  76.798  169.521 1.00 140.96 ? 136 GLN B CD  1 
ATOM   2512 O OE1 . GLN B 1 53  ? 16.898  77.753  170.180 1.00 137.34 ? 136 GLN B OE1 1 
ATOM   2513 N NE2 . GLN B 1 53  ? 16.033  76.937  168.256 1.00 142.19 ? 136 GLN B NE2 1 
ATOM   2514 N N   . LEU B 1 54  ? 20.378  73.057  170.273 1.00 103.74 ? 137 LEU B N   1 
ATOM   2515 C CA  . LEU B 1 54  ? 21.099  71.810  170.485 1.00 100.92 ? 137 LEU B CA  1 
ATOM   2516 C C   . LEU B 1 54  ? 22.372  72.012  171.348 1.00 103.29 ? 137 LEU B C   1 
ATOM   2517 O O   . LEU B 1 54  ? 23.168  72.936  171.086 1.00 106.01 ? 137 LEU B O   1 
ATOM   2518 C CB  . LEU B 1 54  ? 21.438  71.247  169.112 1.00 97.77  ? 137 LEU B CB  1 
ATOM   2519 C CG  . LEU B 1 54  ? 21.608  69.797  168.749 1.00 94.34  ? 137 LEU B CG  1 
ATOM   2520 C CD1 . LEU B 1 54  ? 23.039  69.542  168.396 1.00 95.22  ? 137 LEU B CD1 1 
ATOM   2521 C CD2 . LEU B 1 54  ? 21.068  68.793  169.772 1.00 94.70  ? 137 LEU B CD2 1 
ATOM   2522 N N   . PRO B 1 55  ? 22.555  71.170  172.395 1.00 105.13 ? 138 PRO B N   1 
ATOM   2523 C CA  . PRO B 1 55  ? 23.823  71.088  173.119 1.00 104.68 ? 138 PRO B CA  1 
ATOM   2524 C C   . PRO B 1 55  ? 24.911  70.542  172.221 1.00 104.22 ? 138 PRO B C   1 
ATOM   2525 O O   . PRO B 1 55  ? 24.635  69.753  171.335 1.00 99.46  ? 138 PRO B O   1 
ATOM   2526 C CB  . PRO B 1 55  ? 23.553  70.060  174.228 1.00 103.94 ? 138 PRO B CB  1 
ATOM   2527 C CG  . PRO B 1 55  ? 22.098  69.990  174.366 1.00 104.16 ? 138 PRO B CG  1 
ATOM   2528 C CD  . PRO B 1 55  ? 21.535  70.304  173.015 1.00 105.68 ? 138 PRO B CD  1 
ATOM   2529 N N   . SER B 1 56  ? 26.148  70.936  172.474 1.00 111.12 ? 139 SER B N   1 
ATOM   2530 C CA  . SER B 1 56  ? 27.268  70.505  171.639 1.00 112.89 ? 139 SER B CA  1 
ATOM   2531 C C   . SER B 1 56  ? 27.523  69.015  171.848 1.00 109.76 ? 139 SER B C   1 
ATOM   2532 O O   . SER B 1 56  ? 27.105  68.426  172.841 1.00 110.09 ? 139 SER B O   1 
ATOM   2533 C CB  . SER B 1 56  ? 28.526  71.334  171.916 1.00 115.00 ? 139 SER B CB  1 
ATOM   2534 O OG  . SER B 1 56  ? 28.976  71.118  173.240 1.00 114.85 ? 139 SER B OG  1 
ATOM   2535 N N   . HIS B 1 57  ? 28.177  68.425  170.864 1.00 106.58 ? 140 HIS B N   1 
ATOM   2536 C CA  . HIS B 1 57  ? 28.343  67.009  170.788 1.00 103.35 ? 140 HIS B CA  1 
ATOM   2537 C C   . HIS B 1 57  ? 29.423  66.698  169.758 1.00 106.62 ? 140 HIS B C   1 
ATOM   2538 O O   . HIS B 1 57  ? 29.436  67.249  168.660 1.00 112.54 ? 140 HIS B O   1 
ATOM   2539 C CB  . HIS B 1 57  ? 27.016  66.395  170.406 1.00 101.57 ? 140 HIS B CB  1 
ATOM   2540 C CG  . HIS B 1 57  ? 27.021  64.915  170.372 1.00 104.78 ? 140 HIS B CG  1 
ATOM   2541 N ND1 . HIS B 1 57  ? 27.237  64.208  169.214 1.00 108.45 ? 140 HIS B ND1 1 
ATOM   2542 C CD2 . HIS B 1 57  ? 26.789  64.002  171.336 1.00 104.71 ? 140 HIS B CD2 1 
ATOM   2543 C CE1 . HIS B 1 57  ? 27.149  62.918  169.464 1.00 106.23 ? 140 HIS B CE1 1 
ATOM   2544 N NE2 . HIS B 1 57  ? 26.879  62.765  170.746 1.00 108.61 ? 140 HIS B NE2 1 
ATOM   2545 N N   . SER B 1 58  ? 30.343  65.823  170.135 1.00 114.00 ? 141 SER B N   1 
ATOM   2546 C CA  . SER B 1 58  ? 31.504  65.470  169.306 1.00 117.04 ? 141 SER B CA  1 
ATOM   2547 C C   . SER B 1 58  ? 31.173  65.088  167.859 1.00 113.10 ? 141 SER B C   1 
ATOM   2548 O O   . SER B 1 58  ? 32.033  65.233  167.002 1.00 121.38 ? 141 SER B O   1 
ATOM   2549 C CB  . SER B 1 58  ? 32.323  64.343  169.971 1.00 119.71 ? 141 SER B CB  1 
ATOM   2550 O OG  . SER B 1 58  ? 31.482  63.284  170.418 1.00 130.28 ? 141 SER B OG  1 
ATOM   2551 N N   . ASN B 1 59  ? 29.979  64.545  167.613 1.00 108.45 ? 142 ASN B N   1 
ATOM   2552 C CA  . ASN B 1 59  ? 29.500  64.214  166.254 1.00 105.23 ? 142 ASN B CA  1 
ATOM   2553 C C   . ASN B 1 59  ? 28.491  65.167  165.606 1.00 103.59 ? 142 ASN B C   1 
ATOM   2554 O O   . ASN B 1 59  ? 27.926  64.828  164.565 1.00 104.74 ? 142 ASN B O   1 
ATOM   2555 C CB  . ASN B 1 59  ? 28.905  62.809  166.247 1.00 103.27 ? 142 ASN B CB  1 
ATOM   2556 C CG  . ASN B 1 59  ? 29.862  61.773  166.755 1.00 106.38 ? 142 ASN B CG  1 
ATOM   2557 O OD1 . ASN B 1 59  ? 31.096  61.931  166.728 1.00 117.60 ? 142 ASN B OD1 1 
ATOM   2558 N ND2 . ASN B 1 59  ? 29.303  60.692  167.216 1.00 110.09 ? 142 ASN B ND2 1 
ATOM   2559 N N   . ILE B 1 60  ? 28.279  66.350  166.182 1.00 104.10 ? 143 ILE B N   1 
ATOM   2560 C CA  . ILE B 1 60  ? 27.523  67.434  165.511 1.00 103.92 ? 143 ILE B CA  1 
ATOM   2561 C C   . ILE B 1 60  ? 28.405  68.682  165.332 1.00 101.05 ? 143 ILE B C   1 
ATOM   2562 O O   . ILE B 1 60  ? 29.007  69.143  166.303 1.00 92.36  ? 143 ILE B O   1 
ATOM   2563 C CB  . ILE B 1 60  ? 26.293  67.910  166.323 1.00 100.72 ? 143 ILE B CB  1 
ATOM   2564 C CG1 . ILE B 1 60  ? 25.506  66.739  166.901 1.00 99.61  ? 143 ILE B CG1 1 
ATOM   2565 C CG2 . ILE B 1 60  ? 25.412  68.807  165.452 1.00 100.93 ? 143 ILE B CG2 1 
ATOM   2566 C CD1 . ILE B 1 60  ? 24.658  66.000  165.898 1.00 100.73 ? 143 ILE B CD1 1 
ATOM   2567 N N   . THR B 1 61  ? 28.442  69.231  164.111 1.00 102.86 ? 144 THR B N   1 
ATOM   2568 C CA  . THR B 1 61  ? 29.245  70.431  163.786 1.00 102.48 ? 144 THR B CA  1 
ATOM   2569 C C   . THR B 1 61  ? 28.668  71.718  164.392 1.00 104.44 ? 144 THR B C   1 
ATOM   2570 O O   . THR B 1 61  ? 27.589  72.136  164.010 1.00 111.59 ? 144 THR B O   1 
ATOM   2571 C CB  . THR B 1 61  ? 29.318  70.640  162.266 1.00 103.62 ? 144 THR B CB  1 
ATOM   2572 O OG1 . THR B 1 61  ? 30.037  69.563  161.664 1.00 100.17 ? 144 THR B OG1 1 
ATOM   2573 C CG2 . THR B 1 61  ? 29.994  71.961  161.916 1.00 107.83 ? 144 THR B CG2 1 
ATOM   2574 N N   . GLY B 1 62  ? 29.395  72.347  165.312 1.00 102.39 ? 145 GLY B N   1 
ATOM   2575 C CA  . GLY B 1 62  ? 28.979  73.618  165.932 1.00 102.38 ? 145 GLY B CA  1 
ATOM   2576 C C   . GLY B 1 62  ? 29.322  74.873  165.136 1.00 106.33 ? 145 GLY B C   1 
ATOM   2577 O O   . GLY B 1 62  ? 30.122  74.844  164.196 1.00 111.08 ? 145 GLY B O   1 
ATOM   2578 N N   . ILE B 1 63  ? 28.739  75.991  165.548 1.00 106.31 ? 146 ILE B N   1 
ATOM   2579 C CA  . ILE B 1 63  ? 29.173  77.301  165.091 1.00 107.75 ? 146 ILE B CA  1 
ATOM   2580 C C   . ILE B 1 63  ? 30.431  77.623  165.896 1.00 109.73 ? 146 ILE B C   1 
ATOM   2581 O O   . ILE B 1 63  ? 30.444  77.439  167.110 1.00 108.45 ? 146 ILE B O   1 
ATOM   2582 C CB  . ILE B 1 63  ? 28.145  78.416  165.417 1.00 112.27 ? 146 ILE B CB  1 
ATOM   2583 C CG1 . ILE B 1 63  ? 26.757  78.198  164.834 1.00 111.22 ? 146 ILE B CG1 1 
ATOM   2584 C CG2 . ILE B 1 63  ? 28.667  79.798  165.034 1.00 117.22 ? 146 ILE B CG2 1 
ATOM   2585 C CD1 . ILE B 1 63  ? 26.700  77.579  163.474 1.00 111.13 ? 146 ILE B CD1 1 
ATOM   2586 N N   . VAL B 1 64  ? 31.479  78.108  165.233 1.00 110.67 ? 147 VAL B N   1 
ATOM   2587 C CA  . VAL B 1 64  ? 32.684  78.578  165.919 1.00 109.83 ? 147 VAL B CA  1 
ATOM   2588 C C   . VAL B 1 64  ? 32.438  80.014  166.399 1.00 114.83 ? 147 VAL B C   1 
ATOM   2589 O O   . VAL B 1 64  ? 32.584  80.309  167.575 1.00 121.37 ? 147 VAL B O   1 
ATOM   2590 C CB  . VAL B 1 64  ? 33.931  78.565  165.001 1.00 110.69 ? 147 VAL B CB  1 
ATOM   2591 C CG1 . VAL B 1 64  ? 35.184  78.930  165.792 1.00 111.25 ? 147 VAL B CG1 1 
ATOM   2592 C CG2 . VAL B 1 64  ? 34.127  77.220  164.310 1.00 107.97 ? 147 VAL B CG2 1 
ATOM   2593 N N   . GLU B 1 65  ? 32.093  80.892  165.460 1.00 115.69 ? 148 GLU B N   1 
ATOM   2594 C CA  . GLU B 1 65  ? 31.952  82.343  165.655 1.00 120.02 ? 148 GLU B CA  1 
ATOM   2595 C C   . GLU B 1 65  ? 30.917  82.829  164.665 1.00 118.23 ? 148 GLU B C   1 
ATOM   2596 O O   . GLU B 1 65  ? 30.900  82.301  163.556 1.00 118.31 ? 148 GLU B O   1 
ATOM   2597 C CB  . GLU B 1 65  ? 33.239  83.064  165.241 1.00 127.17 ? 148 GLU B CB  1 
ATOM   2598 C CG  . GLU B 1 65  ? 34.311  83.352  166.279 1.00 134.45 ? 148 GLU B CG  1 
ATOM   2599 C CD  . GLU B 1 65  ? 35.519  84.113  165.701 1.00 140.30 ? 148 GLU B CD  1 
ATOM   2600 O OE1 . GLU B 1 65  ? 36.654  83.860  166.174 1.00 144.52 ? 148 GLU B OE1 1 
ATOM   2601 O OE2 . GLU B 1 65  ? 35.366  84.963  164.780 1.00 145.95 ? 148 GLU B OE2 1 
ATOM   2602 N N   . VAL B 1 66  ? 30.107  83.842  165.000 1.00 116.35 ? 149 VAL B N   1 
ATOM   2603 C CA  . VAL B 1 66  ? 29.467  84.653  163.943 1.00 117.71 ? 149 VAL B CA  1 
ATOM   2604 C C   . VAL B 1 66  ? 30.061  86.053  164.042 1.00 119.16 ? 149 VAL B C   1 
ATOM   2605 O O   . VAL B 1 66  ? 30.215  86.573  165.143 1.00 118.01 ? 149 VAL B O   1 
ATOM   2606 C CB  . VAL B 1 66  ? 27.893  84.646  163.918 1.00 120.17 ? 149 VAL B CB  1 
ATOM   2607 C CG1 . VAL B 1 66  ? 27.320  83.373  164.531 1.00 116.98 ? 149 VAL B CG1 1 
ATOM   2608 C CG2 . VAL B 1 66  ? 27.262  85.872  164.583 1.00 125.67 ? 149 VAL B CG2 1 
ATOM   2609 N N   . ILE B 1 67  ? 30.405  86.635  162.895 1.00 121.15 ? 150 ILE B N   1 
ATOM   2610 C CA  . ILE B 1 67  ? 30.818  88.049  162.783 1.00 124.39 ? 150 ILE B CA  1 
ATOM   2611 C C   . ILE B 1 67  ? 29.795  88.819  161.910 1.00 122.84 ? 150 ILE B C   1 
ATOM   2612 O O   . ILE B 1 67  ? 29.309  88.287  160.910 1.00 119.23 ? 150 ILE B O   1 
ATOM   2613 C CB  . ILE B 1 67  ? 32.229  88.149  162.174 1.00 126.22 ? 150 ILE B CB  1 
ATOM   2614 C CG1 . ILE B 1 67  ? 33.251  87.584  163.161 1.00 128.36 ? 150 ILE B CG1 1 
ATOM   2615 C CG2 . ILE B 1 67  ? 32.557  89.589  161.828 1.00 129.01 ? 150 ILE B CG2 1 
ATOM   2616 C CD1 . ILE B 1 67  ? 34.662  87.379  162.627 1.00 130.16 ? 150 ILE B CD1 1 
ATOM   2617 N N   . LEU B 1 68  ? 29.448  90.044  162.309 1.00 122.95 ? 151 LEU B N   1 
ATOM   2618 C CA  . LEU B 1 68  ? 28.478  90.855  161.572 1.00 125.01 ? 151 LEU B CA  1 
ATOM   2619 C C   . LEU B 1 68  ? 29.165  91.953  160.784 1.00 129.00 ? 151 LEU B C   1 
ATOM   2620 O O   . LEU B 1 68  ? 30.001  92.677  161.312 1.00 132.33 ? 151 LEU B O   1 
ATOM   2621 C CB  . LEU B 1 68  ? 27.437  91.470  162.532 1.00 127.58 ? 151 LEU B CB  1 
ATOM   2622 C CG  . LEU B 1 68  ? 26.460  90.507  163.306 1.00 125.50 ? 151 LEU B CG  1 
ATOM   2623 C CD1 . LEU B 1 68  ? 25.063  91.099  163.487 1.00 126.74 ? 151 LEU B CD1 1 
ATOM   2624 C CD2 . LEU B 1 68  ? 26.273  89.152  162.621 1.00 123.22 ? 151 LEU B CD2 1 
ATOM   2625 N N   . GLY B 1 69  ? 28.784  92.086  159.520 1.00 131.41 ? 152 GLY B N   1 
ATOM   2626 C CA  . GLY B 1 69  ? 29.227  93.198  158.669 1.00 134.42 ? 152 GLY B CA  1 
ATOM   2627 C C   . GLY B 1 69  ? 28.041  94.058  158.333 1.00 135.74 ? 152 GLY B C   1 
ATOM   2628 O O   . GLY B 1 69  ? 26.960  93.862  158.879 1.00 134.31 ? 152 GLY B O   1 
ATOM   2629 N N   . GLU B 1 70  ? 28.241  95.022  157.444 1.00 141.98 ? 153 GLU B N   1 
ATOM   2630 C CA  . GLU B 1 70  ? 27.178  95.963  157.088 1.00 146.27 ? 153 GLU B CA  1 
ATOM   2631 C C   . GLU B 1 70  ? 25.974  95.250  156.443 1.00 146.72 ? 153 GLU B C   1 
ATOM   2632 O O   . GLU B 1 70  ? 24.854  95.420  156.905 1.00 150.70 ? 153 GLU B O   1 
ATOM   2633 C CB  . GLU B 1 70  ? 27.736  97.078  156.212 1.00 148.75 ? 153 GLU B CB  1 
ATOM   2634 C CG  . GLU B 1 70  ? 26.741  98.163  155.802 1.00 156.95 ? 153 GLU B CG  1 
ATOM   2635 C CD  . GLU B 1 70  ? 26.830  99.501  156.548 1.00 159.78 ? 153 GLU B CD  1 
ATOM   2636 O OE1 . GLU B 1 70  ? 27.316  99.528  157.700 1.00 160.18 ? 153 GLU B OE1 1 
ATOM   2637 O OE2 . GLU B 1 70  ? 26.389  100.529 155.965 1.00 154.50 ? 153 GLU B OE2 1 
ATOM   2638 N N   . THR B 1 71  ? 26.212  94.442  155.414 1.00 144.82 ? 154 THR B N   1 
ATOM   2639 C CA  . THR B 1 71  ? 25.135  93.740  154.679 1.00 141.84 ? 154 THR B CA  1 
ATOM   2640 C C   . THR B 1 71  ? 24.954  92.300  155.042 1.00 140.80 ? 154 THR B C   1 
ATOM   2641 O O   . THR B 1 71  ? 23.852  91.752  154.890 1.00 142.77 ? 154 THR B O   1 
ATOM   2642 C CB  . THR B 1 71  ? 25.433  93.759  153.186 1.00 141.78 ? 154 THR B CB  1 
ATOM   2643 O OG1 . THR B 1 71  ? 25.545  95.119  152.780 1.00 142.52 ? 154 THR B OG1 1 
ATOM   2644 C CG2 . THR B 1 71  ? 24.332  93.046  152.359 1.00 139.17 ? 154 THR B CG2 1 
ATOM   2645 N N   . LYS B 1 72  ? 26.033  91.672  155.508 1.00 143.47 ? 155 LYS B N   1 
ATOM   2646 C CA  . LYS B 1 72  ? 26.078  90.215  155.731 1.00 139.27 ? 155 LYS B CA  1 
ATOM   2647 C C   . LYS B 1 72  ? 26.472  89.767  157.139 1.00 130.66 ? 155 LYS B C   1 
ATOM   2648 O O   . LYS B 1 72  ? 27.149  90.487  157.869 1.00 126.91 ? 155 LYS B O   1 
ATOM   2649 C CB  . LYS B 1 72  ? 27.065  89.623  154.746 1.00 143.68 ? 155 LYS B CB  1 
ATOM   2650 C CG  . LYS B 1 72  ? 26.595  89.693  153.305 1.00 149.23 ? 155 LYS B CG  1 
ATOM   2651 C CD  . LYS B 1 72  ? 27.697  90.155  152.369 1.00 156.35 ? 155 LYS B CD  1 
ATOM   2652 C CE  . LYS B 1 72  ? 27.213  90.171  150.928 1.00 164.58 ? 155 LYS B CE  1 
ATOM   2653 N NZ  . LYS B 1 72  ? 26.841  88.802  150.447 1.00 163.62 ? 155 LYS B NZ  1 
ATOM   2654 N N   . ALA B 1 73  ? 25.983  88.591  157.521 1.00 126.51 ? 156 ALA B N   1 
ATOM   2655 C CA  . ALA B 1 73  ? 26.480  87.871  158.687 1.00 123.64 ? 156 ALA B CA  1 
ATOM   2656 C C   . ALA B 1 73  ? 27.472  86.858  158.170 1.00 122.55 ? 156 ALA B C   1 
ATOM   2657 O O   . ALA B 1 73  ? 27.279  86.301  157.087 1.00 124.51 ? 156 ALA B O   1 
ATOM   2658 C CB  . ALA B 1 73  ? 25.351  87.156  159.418 1.00 121.75 ? 156 ALA B CB  1 
ATOM   2659 N N   . TYR B 1 74  ? 28.514  86.603  158.955 1.00 121.74 ? 157 TYR B N   1 
ATOM   2660 C CA  . TYR B 1 74  ? 29.509  85.582  158.639 1.00 119.56 ? 157 TYR B CA  1 
ATOM   2661 C C   . TYR B 1 74  ? 29.486  84.562  159.749 1.00 115.55 ? 157 TYR B C   1 
ATOM   2662 O O   . TYR B 1 74  ? 29.774  84.897  160.885 1.00 112.82 ? 157 TYR B O   1 
ATOM   2663 C CB  . TYR B 1 74  ? 30.883  86.234  158.543 1.00 122.59 ? 157 TYR B CB  1 
ATOM   2664 C CG  . TYR B 1 74  ? 30.935  87.288  157.473 1.00 126.70 ? 157 TYR B CG  1 
ATOM   2665 C CD1 . TYR B 1 74  ? 30.565  88.603  157.744 1.00 130.69 ? 157 TYR B CD1 1 
ATOM   2666 C CD2 . TYR B 1 74  ? 31.317  86.970  156.176 1.00 127.67 ? 157 TYR B CD2 1 
ATOM   2667 C CE1 . TYR B 1 74  ? 30.591  89.579  156.751 1.00 134.31 ? 157 TYR B CE1 1 
ATOM   2668 C CE2 . TYR B 1 74  ? 31.347  87.935  155.176 1.00 131.72 ? 157 TYR B CE2 1 
ATOM   2669 C CZ  . TYR B 1 74  ? 30.982  89.241  155.463 1.00 134.72 ? 157 TYR B CZ  1 
ATOM   2670 O OH  . TYR B 1 74  ? 31.014  90.198  154.470 1.00 135.72 ? 157 TYR B OH  1 
ATOM   2671 N N   . VAL B 1 75  ? 29.137  83.320  159.435 1.00 115.33 ? 158 VAL B N   1 
ATOM   2672 C CA  . VAL B 1 75  ? 29.080  82.252  160.446 1.00 115.86 ? 158 VAL B CA  1 
ATOM   2673 C C   . VAL B 1 75  ? 30.231  81.272  160.206 1.00 115.75 ? 158 VAL B C   1 
ATOM   2674 O O   . VAL B 1 75  ? 30.357  80.722  159.115 1.00 115.65 ? 158 VAL B O   1 
ATOM   2675 C CB  . VAL B 1 75  ? 27.730  81.525  160.386 1.00 112.21 ? 158 VAL B CB  1 
ATOM   2676 C CG1 . VAL B 1 75  ? 27.545  80.624  161.587 1.00 108.42 ? 158 VAL B CG1 1 
ATOM   2677 C CG2 . VAL B 1 75  ? 26.613  82.557  160.326 1.00 116.59 ? 158 VAL B CG2 1 
ATOM   2678 N N   . PHE B 1 76  ? 31.067  81.071  161.220 1.00 116.17 ? 159 PHE B N   1 
ATOM   2679 C CA  . PHE B 1 76  ? 32.295  80.307  161.061 1.00 117.79 ? 159 PHE B CA  1 
ATOM   2680 C C   . PHE B 1 76  ? 32.160  78.882  161.570 1.00 120.39 ? 159 PHE B C   1 
ATOM   2681 O O   . PHE B 1 76  ? 31.578  78.631  162.625 1.00 120.43 ? 159 PHE B O   1 
ATOM   2682 C CB  . PHE B 1 76  ? 33.448  81.048  161.711 1.00 119.59 ? 159 PHE B CB  1 
ATOM   2683 C CG  . PHE B 1 76  ? 33.817  82.307  160.981 1.00 121.66 ? 159 PHE B CG  1 
ATOM   2684 C CD1 . PHE B 1 76  ? 34.691  82.269  159.905 1.00 123.57 ? 159 PHE B CD1 1 
ATOM   2685 C CD2 . PHE B 1 76  ? 33.260  83.516  161.337 1.00 122.03 ? 159 PHE B CD2 1 
ATOM   2686 C CE1 . PHE B 1 76  ? 35.020  83.424  159.225 1.00 125.20 ? 159 PHE B CE1 1 
ATOM   2687 C CE2 . PHE B 1 76  ? 33.576  84.672  160.654 1.00 123.69 ? 159 PHE B CE2 1 
ATOM   2688 C CZ  . PHE B 1 76  ? 34.460  84.627  159.599 1.00 125.73 ? 159 PHE B CZ  1 
ATOM   2689 N N   . PHE B 1 77  ? 32.674  77.953  160.763 1.00 125.69 ? 160 PHE B N   1 
ATOM   2690 C CA  . PHE B 1 77  ? 32.543  76.506  160.952 1.00 124.88 ? 160 PHE B CA  1 
ATOM   2691 C C   . PHE B 1 77  ? 33.942  75.873  160.829 1.00 125.87 ? 160 PHE B C   1 
ATOM   2692 O O   . PHE B 1 77  ? 34.711  76.236  159.926 1.00 119.44 ? 160 PHE B O   1 
ATOM   2693 C CB  . PHE B 1 77  ? 31.660  75.885  159.855 1.00 119.97 ? 160 PHE B CB  1 
ATOM   2694 C CG  . PHE B 1 77  ? 30.204  76.078  160.055 1.00 123.78 ? 160 PHE B CG  1 
ATOM   2695 C CD1 . PHE B 1 77  ? 29.691  77.352  160.189 1.00 128.59 ? 160 PHE B CD1 1 
ATOM   2696 C CD2 . PHE B 1 77  ? 29.317  74.999  160.083 1.00 125.39 ? 160 PHE B CD2 1 
ATOM   2697 C CE1 . PHE B 1 77  ? 28.340  77.571  160.377 1.00 123.09 ? 160 PHE B CE1 1 
ATOM   2698 C CE2 . PHE B 1 77  ? 27.949  75.219  160.273 1.00 121.46 ? 160 PHE B CE2 1 
ATOM   2699 C CZ  . PHE B 1 77  ? 27.468  76.516  160.417 1.00 119.01 ? 160 PHE B CZ  1 
ATOM   2700 N N   . GLU B 1 78  ? 34.268  74.943  161.734 1.00 123.87 ? 161 GLU B N   1 
ATOM   2701 C CA  . GLU B 1 78  ? 35.384  73.974  161.512 1.00 122.85 ? 161 GLU B CA  1 
ATOM   2702 C C   . GLU B 1 78  ? 35.319  73.302  160.147 1.00 120.91 ? 161 GLU B C   1 
ATOM   2703 O O   . GLU B 1 78  ? 34.246  73.113  159.603 1.00 117.28 ? 161 GLU B O   1 
ATOM   2704 C CB  . GLU B 1 78  ? 35.420  72.872  162.547 1.00 122.28 ? 161 GLU B CB  1 
ATOM   2705 C CG  . GLU B 1 78  ? 35.711  73.308  163.969 1.00 125.69 ? 161 GLU B CG  1 
ATOM   2706 C CD  . GLU B 1 78  ? 36.977  74.130  164.189 1.00 132.04 ? 161 GLU B CD  1 
ATOM   2707 O OE1 . GLU B 1 78  ? 37.899  74.205  163.339 1.00 135.75 ? 161 GLU B OE1 1 
ATOM   2708 O OE2 . GLU B 1 78  ? 37.041  74.739  165.273 1.00 134.05 ? 161 GLU B OE2 1 
ATOM   2709 N N   . LYS B 1 79  ? 36.470  72.952  159.586 1.00 123.82 ? 162 LYS B N   1 
ATOM   2710 C CA  . LYS B 1 79  ? 36.474  72.326  158.253 1.00 123.46 ? 162 LYS B CA  1 
ATOM   2711 C C   . LYS B 1 79  ? 36.403  70.784  158.295 1.00 121.19 ? 162 LYS B C   1 
ATOM   2712 O O   . LYS B 1 79  ? 36.864  70.147  159.244 1.00 121.43 ? 162 LYS B O   1 
ATOM   2713 C CB  . LYS B 1 79  ? 37.636  72.805  157.408 1.00 123.97 ? 162 LYS B CB  1 
ATOM   2714 C CG  . LYS B 1 79  ? 38.988  72.694  158.054 1.00 128.19 ? 162 LYS B CG  1 
ATOM   2715 C CD  . LYS B 1 79  ? 40.054  72.945  157.017 1.00 139.19 ? 162 LYS B CD  1 
ATOM   2716 C CE  . LYS B 1 79  ? 40.310  71.685  156.213 1.00 143.60 ? 162 LYS B CE  1 
ATOM   2717 N NZ  . LYS B 1 79  ? 41.519  71.867  155.371 1.00 147.81 ? 162 LYS B NZ  1 
ATOM   2718 N N   . ASP B 1 80  ? 35.805  70.204  157.259 1.00 118.34 ? 163 ASP B N   1 
ATOM   2719 C CA  . ASP B 1 80  ? 35.711  68.755  157.100 1.00 116.09 ? 163 ASP B CA  1 
ATOM   2720 C C   . ASP B 1 80  ? 36.770  68.206  156.146 1.00 118.35 ? 163 ASP B C   1 
ATOM   2721 O O   . ASP B 1 80  ? 37.328  68.964  155.337 1.00 124.04 ? 163 ASP B O   1 
ATOM   2722 C CB  . ASP B 1 80  ? 34.322  68.346  156.604 1.00 114.87 ? 163 ASP B CB  1 
ATOM   2723 C CG  . ASP B 1 80  ? 34.064  68.676  155.117 1.00 121.45 ? 163 ASP B CG  1 
ATOM   2724 O OD1 . ASP B 1 80  ? 34.589  67.958  154.227 1.00 125.67 ? 163 ASP B OD1 1 
ATOM   2725 O OD2 . ASP B 1 80  ? 33.293  69.632  154.829 1.00 130.11 ? 163 ASP B OD2 1 
ATOM   2726 N N   . PHE B 1 81  ? 36.997  66.887  156.221 1.00 111.66 ? 164 PHE B N   1 
ATOM   2727 C CA  . PHE B 1 81  ? 37.933  66.184  155.351 1.00 112.13 ? 164 PHE B CA  1 
ATOM   2728 C C   . PHE B 1 81  ? 37.203  65.064  154.633 1.00 112.36 ? 164 PHE B C   1 
ATOM   2729 O O   . PHE B 1 81  ? 37.571  63.878  154.710 1.00 120.97 ? 164 PHE B O   1 
ATOM   2730 C CB  . PHE B 1 81  ? 39.097  65.658  156.171 1.00 115.71 ? 164 PHE B CB  1 
ATOM   2731 C CG  . PHE B 1 81  ? 39.831  66.731  156.905 1.00 119.91 ? 164 PHE B CG  1 
ATOM   2732 C CD1 . PHE B 1 81  ? 39.321  67.265  158.091 1.00 119.40 ? 164 PHE B CD1 1 
ATOM   2733 C CD2 . PHE B 1 81  ? 41.022  67.242  156.401 1.00 128.08 ? 164 PHE B CD2 1 
ATOM   2734 C CE1 . PHE B 1 81  ? 39.984  68.285  158.764 1.00 122.12 ? 164 PHE B CE1 1 
ATOM   2735 C CE2 . PHE B 1 81  ? 41.694  68.260  157.072 1.00 131.57 ? 164 PHE B CE2 1 
ATOM   2736 C CZ  . PHE B 1 81  ? 41.171  68.785  158.255 1.00 126.96 ? 164 PHE B CZ  1 
ATOM   2737 N N   . GLY B 1 82  ? 36.143  65.450  153.942 1.00 108.47 ? 165 GLY B N   1 
ATOM   2738 C CA  . GLY B 1 82  ? 35.385  64.536  153.119 1.00 107.74 ? 165 GLY B CA  1 
ATOM   2739 C C   . GLY B 1 82  ? 34.154  64.050  153.830 1.00 105.64 ? 165 GLY B C   1 
ATOM   2740 O O   . GLY B 1 82  ? 34.051  64.139  155.051 1.00 102.38 ? 165 GLY B O   1 
ATOM   2741 N N   . ASP B 1 83  ? 33.239  63.511  153.027 1.00 108.99 ? 166 ASP B N   1 
ATOM   2742 C CA  . ASP B 1 83  ? 31.916  63.070  153.438 1.00 109.09 ? 166 ASP B CA  1 
ATOM   2743 C C   . ASP B 1 83  ? 31.770  61.550  153.275 1.00 109.36 ? 166 ASP B C   1 
ATOM   2744 O O   . ASP B 1 83  ? 32.480  60.927  152.481 1.00 107.43 ? 166 ASP B O   1 
ATOM   2745 C CB  . ASP B 1 83  ? 30.851  63.811  152.608 1.00 111.16 ? 166 ASP B CB  1 
ATOM   2746 C CG  . ASP B 1 83  ? 30.808  63.369  151.126 1.00 116.77 ? 166 ASP B CG  1 
ATOM   2747 O OD1 . ASP B 1 83  ? 30.095  62.393  150.802 1.00 128.46 ? 166 ASP B OD1 1 
ATOM   2748 O OD2 . ASP B 1 83  ? 31.445  64.008  150.264 1.00 118.52 ? 166 ASP B OD2 1 
ATOM   2749 N N   . MET B 1 84  ? 30.816  60.967  154.000 1.00 107.97 ? 167 MET B N   1 
ATOM   2750 C CA  . MET B 1 84  ? 30.615  59.506  153.985 1.00 107.68 ? 167 MET B CA  1 
ATOM   2751 C C   . MET B 1 84  ? 30.049  58.918  152.701 1.00 108.65 ? 167 MET B C   1 
ATOM   2752 O O   . MET B 1 84  ? 30.088  57.696  152.515 1.00 112.72 ? 167 MET B O   1 
ATOM   2753 C CB  . MET B 1 84  ? 29.752  59.059  155.165 1.00 104.75 ? 167 MET B CB  1 
ATOM   2754 C CG  . MET B 1 84  ? 30.528  59.006  156.458 1.00 106.61 ? 167 MET B CG  1 
ATOM   2755 S SD  . MET B 1 84  ? 31.852  57.770  156.356 1.00 113.51 ? 167 MET B SD  1 
ATOM   2756 C CE  . MET B 1 84  ? 30.922  56.243  156.296 1.00 109.17 ? 167 MET B CE  1 
ATOM   2757 N N   . HIS B 1 85  ? 29.534  59.758  151.816 1.00 105.74 ? 168 HIS B N   1 
ATOM   2758 C CA  . HIS B 1 85  ? 29.011  59.251  150.570 1.00 109.71 ? 168 HIS B CA  1 
ATOM   2759 C C   . HIS B 1 85  ? 30.150  58.982  149.581 1.00 111.83 ? 168 HIS B C   1 
ATOM   2760 O O   . HIS B 1 85  ? 30.180  57.945  148.934 1.00 114.98 ? 168 HIS B O   1 
ATOM   2761 C CB  . HIS B 1 85  ? 27.964  60.199  149.993 1.00 113.33 ? 168 HIS B CB  1 
ATOM   2762 C CG  . HIS B 1 85  ? 27.622  59.897  148.576 1.00 117.99 ? 168 HIS B CG  1 
ATOM   2763 N ND1 . HIS B 1 85  ? 28.205  60.568  147.528 1.00 121.03 ? 168 HIS B ND1 1 
ATOM   2764 C CD2 . HIS B 1 85  ? 26.812  58.959  148.028 1.00 120.38 ? 168 HIS B CD2 1 
ATOM   2765 C CE1 . HIS B 1 85  ? 27.746  60.082  146.392 1.00 125.75 ? 168 HIS B CE1 1 
ATOM   2766 N NE2 . HIS B 1 85  ? 26.891  59.112  146.668 1.00 125.28 ? 168 HIS B NE2 1 
ATOM   2767 N N   . SER B 1 86  ? 31.069  59.929  149.435 1.00 115.17 ? 169 SER B N   1 
ATOM   2768 C CA  . SER B 1 86  ? 32.274  59.708  148.604 1.00 121.69 ? 169 SER B CA  1 
ATOM   2769 C C   . SER B 1 86  ? 33.140  58.592  149.182 1.00 119.16 ? 169 SER B C   1 
ATOM   2770 O O   . SER B 1 86  ? 33.717  57.803  148.438 1.00 119.00 ? 169 SER B O   1 
ATOM   2771 C CB  . SER B 1 86  ? 33.082  61.002  148.430 1.00 126.90 ? 169 SER B CB  1 
ATOM   2772 O OG  . SER B 1 86  ? 33.289  61.646  149.666 1.00 132.36 ? 169 SER B OG  1 
ATOM   2773 N N   . TYR B 1 87  ? 33.156  58.496  150.510 1.00 115.39 ? 170 TYR B N   1 
ATOM   2774 C CA  . TYR B 1 87  ? 33.862  57.423  151.202 1.00 113.26 ? 170 TYR B CA  1 
ATOM   2775 C C   . TYR B 1 87  ? 33.400  56.055  150.704 1.00 111.84 ? 170 TYR B C   1 
ATOM   2776 O O   . TYR B 1 87  ? 34.226  55.232  150.318 1.00 111.45 ? 170 TYR B O   1 
ATOM   2777 C CB  . TYR B 1 87  ? 33.660  57.541  152.718 1.00 112.45 ? 170 TYR B CB  1 
ATOM   2778 C CG  . TYR B 1 87  ? 34.729  56.895  153.571 1.00 115.02 ? 170 TYR B CG  1 
ATOM   2779 C CD1 . TYR B 1 87  ? 36.037  57.347  153.518 1.00 118.93 ? 170 TYR B CD1 1 
ATOM   2780 C CD2 . TYR B 1 87  ? 34.431  55.854  154.468 1.00 114.08 ? 170 TYR B CD2 1 
ATOM   2781 C CE1 . TYR B 1 87  ? 37.019  56.780  154.308 1.00 123.77 ? 170 TYR B CE1 1 
ATOM   2782 C CE2 . TYR B 1 87  ? 35.418  55.272  155.262 1.00 111.98 ? 170 TYR B CE2 1 
ATOM   2783 C CZ  . TYR B 1 87  ? 36.709  55.751  155.174 1.00 117.15 ? 170 TYR B CZ  1 
ATOM   2784 O OH  . TYR B 1 87  ? 37.764  55.282  155.898 1.00 120.32 ? 170 TYR B OH  1 
ATOM   2785 N N   . VAL B 1 88  ? 32.085  55.845  150.651 1.00 108.26 ? 171 VAL B N   1 
ATOM   2786 C CA  . VAL B 1 88  ? 31.544  54.560  150.212 1.00 109.47 ? 171 VAL B CA  1 
ATOM   2787 C C   . VAL B 1 88  ? 31.755  54.306  148.727 1.00 111.33 ? 171 VAL B C   1 
ATOM   2788 O O   . VAL B 1 88  ? 31.911  53.168  148.325 1.00 113.69 ? 171 VAL B O   1 
ATOM   2789 C CB  . VAL B 1 88  ? 30.050  54.393  150.554 1.00 109.99 ? 171 VAL B CB  1 
ATOM   2790 C CG1 . VAL B 1 88  ? 29.531  53.041  150.067 1.00 111.63 ? 171 VAL B CG1 1 
ATOM   2791 C CG2 . VAL B 1 88  ? 29.837  54.485  152.063 1.00 108.72 ? 171 VAL B CG2 1 
ATOM   2792 N N   . ARG B 1 89  ? 31.756  55.338  147.902 1.00 114.41 ? 172 ARG B N   1 
ATOM   2793 C CA  . ARG B 1 89  ? 32.080  55.122  146.494 1.00 121.07 ? 172 ARG B CA  1 
ATOM   2794 C C   . ARG B 1 89  ? 33.533  54.721  146.320 1.00 123.92 ? 172 ARG B C   1 
ATOM   2795 O O   . ARG B 1 89  ? 33.814  53.699  145.693 1.00 126.53 ? 172 ARG B O   1 
ATOM   2796 C CB  . ARG B 1 89  ? 31.736  56.334  145.666 1.00 125.48 ? 172 ARG B CB  1 
ATOM   2797 C CG  . ARG B 1 89  ? 30.244  56.445  145.491 1.00 128.91 ? 172 ARG B CG  1 
ATOM   2798 C CD  . ARG B 1 89  ? 29.852  57.744  144.831 1.00 134.64 ? 172 ARG B CD  1 
ATOM   2799 N NE  . ARG B 1 89  ? 30.320  57.781  143.442 1.00 140.27 ? 172 ARG B NE  1 
ATOM   2800 C CZ  . ARG B 1 89  ? 31.102  58.714  142.894 1.00 146.25 ? 172 ARG B CZ  1 
ATOM   2801 N NH1 . ARG B 1 89  ? 31.540  59.765  143.592 1.00 147.01 ? 172 ARG B NH1 1 
ATOM   2802 N NH2 . ARG B 1 89  ? 31.439  58.599  141.610 1.00 152.65 ? 172 ARG B NH2 1 
ATOM   2803 N N   . SER B 1 90  ? 34.432  55.503  146.928 1.00 125.32 ? 173 SER B N   1 
ATOM   2804 C CA  . SER B 1 90  ? 35.881  55.196  146.980 1.00 127.77 ? 173 SER B CA  1 
ATOM   2805 C C   . SER B 1 90  ? 36.164  53.768  147.439 1.00 127.66 ? 173 SER B C   1 
ATOM   2806 O O   . SER B 1 90  ? 36.871  53.025  146.762 1.00 129.43 ? 173 SER B O   1 
ATOM   2807 C CB  . SER B 1 90  ? 36.622  56.165  147.927 1.00 127.96 ? 173 SER B CB  1 
ATOM   2808 O OG  . SER B 1 90  ? 36.337  57.536  147.666 1.00 128.59 ? 173 SER B OG  1 
ATOM   2809 N N   . ARG B 1 91  ? 35.593  53.411  148.589 1.00 124.39 ? 174 ARG B N   1 
ATOM   2810 C CA  . ARG B 1 91  ? 35.725  52.087  149.194 1.00 125.38 ? 174 ARG B CA  1 
ATOM   2811 C C   . ARG B 1 91  ? 34.479  51.328  148.826 1.00 127.10 ? 174 ARG B C   1 
ATOM   2812 O O   . ARG B 1 91  ? 33.435  51.653  149.341 1.00 136.50 ? 174 ARG B O   1 
ATOM   2813 C CB  . ARG B 1 91  ? 35.822  52.230  150.727 1.00 123.21 ? 174 ARG B CB  1 
ATOM   2814 C CG  . ARG B 1 91  ? 37.187  52.655  151.216 1.00 131.25 ? 174 ARG B CG  1 
ATOM   2815 C CD  . ARG B 1 91  ? 37.215  54.041  151.832 1.00 132.61 ? 174 ARG B CD  1 
ATOM   2816 N NE  . ARG B 1 91  ? 38.567  54.525  152.239 1.00 136.80 ? 174 ARG B NE  1 
ATOM   2817 C CZ  . ARG B 1 91  ? 39.164  54.305  153.412 1.00 134.22 ? 174 ARG B CZ  1 
ATOM   2818 N NH1 . ARG B 1 91  ? 38.567  53.589  154.348 1.00 138.39 ? 174 ARG B NH1 1 
ATOM   2819 N NH2 . ARG B 1 91  ? 40.363  54.817  153.661 1.00 136.12 ? 174 ARG B NH2 1 
ATOM   2820 N N   . LYS B 1 92  ? 34.543  50.326  147.960 1.00 131.87 ? 175 LYS B N   1 
ATOM   2821 C CA  . LYS B 1 92  ? 33.290  49.717  147.436 1.00 135.32 ? 175 LYS B CA  1 
ATOM   2822 C C   . LYS B 1 92  ? 32.240  49.351  148.521 1.00 132.25 ? 175 LYS B C   1 
ATOM   2823 O O   . LYS B 1 92  ? 31.058  49.652  148.377 1.00 135.71 ? 175 LYS B O   1 
ATOM   2824 C CB  . LYS B 1 92  ? 33.580  48.485  146.571 1.00 141.15 ? 175 LYS B CB  1 
ATOM   2825 C CG  . LYS B 1 92  ? 34.548  48.697  145.418 1.00 147.85 ? 175 LYS B CG  1 
ATOM   2826 C CD  . LYS B 1 92  ? 34.313  50.023  144.721 1.00 154.32 ? 175 LYS B CD  1 
ATOM   2827 C CE  . LYS B 1 92  ? 35.142  50.148  143.458 1.00 163.33 ? 175 LYS B CE  1 
ATOM   2828 N NZ  . LYS B 1 92  ? 34.685  51.297  142.626 1.00 168.43 ? 175 LYS B NZ  1 
ATOM   2829 N N   . ARG B 1 93  ? 32.694  48.726  149.599 1.00 129.96 ? 176 ARG B N   1 
ATOM   2830 C CA  . ARG B 1 93  ? 31.873  48.466  150.780 1.00 122.54 ? 176 ARG B CA  1 
ATOM   2831 C C   . ARG B 1 93  ? 32.787  48.450  151.987 1.00 117.63 ? 176 ARG B C   1 
ATOM   2832 O O   . ARG B 1 93  ? 33.989  48.226  151.848 1.00 128.41 ? 176 ARG B O   1 
ATOM   2833 C CB  . ARG B 1 93  ? 31.153  47.132  150.655 1.00 123.50 ? 176 ARG B CB  1 
ATOM   2834 C CG  . ARG B 1 93  ? 32.068  45.976  150.335 1.00 129.81 ? 176 ARG B CG  1 
ATOM   2835 C CD  . ARG B 1 93  ? 31.326  44.692  150.018 1.00 135.04 ? 176 ARG B CD  1 
ATOM   2836 N NE  . ARG B 1 93  ? 32.106  43.510  150.354 1.00 139.76 ? 176 ARG B NE  1 
ATOM   2837 C CZ  . ARG B 1 93  ? 32.270  42.986  151.567 1.00 145.33 ? 176 ARG B CZ  1 
ATOM   2838 N NH1 . ARG B 1 93  ? 31.710  43.533  152.645 1.00 149.53 ? 176 ARG B NH1 1 
ATOM   2839 N NH2 . ARG B 1 93  ? 33.015  41.890  151.705 1.00 149.47 ? 176 ARG B NH2 1 
ATOM   2840 N N   . LEU B 1 94  ? 32.246  48.733  153.157 1.00 107.90 ? 177 LEU B N   1 
ATOM   2841 C CA  . LEU B 1 94  ? 33.051  48.808  154.363 1.00 109.63 ? 177 LEU B CA  1 
ATOM   2842 C C   . LEU B 1 94  ? 33.006  47.504  155.155 1.00 113.60 ? 177 LEU B C   1 
ATOM   2843 O O   . LEU B 1 94  ? 31.986  46.798  155.196 1.00 118.09 ? 177 LEU B O   1 
ATOM   2844 C CB  . LEU B 1 94  ? 32.617  49.987  155.234 1.00 108.27 ? 177 LEU B CB  1 
ATOM   2845 C CG  . LEU B 1 94  ? 32.573  51.399  154.611 1.00 107.03 ? 177 LEU B CG  1 
ATOM   2846 C CD1 . LEU B 1 94  ? 32.274  52.419  155.698 1.00 105.56 ? 177 LEU B CD1 1 
ATOM   2847 C CD2 . LEU B 1 94  ? 33.855  51.795  153.918 1.00 108.42 ? 177 LEU B CD2 1 
ATOM   2848 N N   . ARG B 1 95  ? 34.140  47.178  155.759 1.00 115.87 ? 178 ARG B N   1 
ATOM   2849 C CA  . ARG B 1 95  ? 34.263  46.015  156.624 1.00 118.54 ? 178 ARG B CA  1 
ATOM   2850 C C   . ARG B 1 95  ? 33.538  46.340  157.904 1.00 113.67 ? 178 ARG B C   1 
ATOM   2851 O O   . ARG B 1 95  ? 33.637  47.471  158.369 1.00 113.31 ? 178 ARG B O   1 
ATOM   2852 C CB  . ARG B 1 95  ? 35.745  45.750  156.899 1.00 128.21 ? 178 ARG B CB  1 
ATOM   2853 C CG  . ARG B 1 95  ? 36.400  46.743  157.856 1.00 134.92 ? 178 ARG B CG  1 
ATOM   2854 C CD  . ARG B 1 95  ? 37.919  46.808  157.779 1.00 146.20 ? 178 ARG B CD  1 
ATOM   2855 N NE  . ARG B 1 95  ? 38.395  47.249  159.089 1.00 153.15 ? 178 ARG B NE  1 
ATOM   2856 C CZ  . ARG B 1 95  ? 38.629  46.451  160.140 1.00 165.62 ? 178 ARG B CZ  1 
ATOM   2857 N NH1 . ARG B 1 95  ? 38.511  45.112  160.076 1.00 161.79 ? 178 ARG B NH1 1 
ATOM   2858 N NH2 . ARG B 1 95  ? 38.996  47.007  161.288 1.00 174.74 ? 178 ARG B NH2 1 
ATOM   2859 N N   . GLU B 1 96  ? 32.844  45.361  158.483 1.00 110.55 ? 179 GLU B N   1 
ATOM   2860 C CA  . GLU B 1 96  ? 31.927  45.628  159.587 1.00 109.24 ? 179 GLU B CA  1 
ATOM   2861 C C   . GLU B 1 96  ? 32.551  46.405  160.734 1.00 108.94 ? 179 GLU B C   1 
ATOM   2862 O O   . GLU B 1 96  ? 31.912  47.263  161.312 1.00 109.70 ? 179 GLU B O   1 
ATOM   2863 C CB  . GLU B 1 96  ? 31.300  44.344  160.121 1.00 111.31 ? 179 GLU B CB  1 
ATOM   2864 C CG  . GLU B 1 96  ? 30.347  43.664  159.142 1.00 111.97 ? 179 GLU B CG  1 
ATOM   2865 C CD  . GLU B 1 96  ? 29.393  42.672  159.803 1.00 114.09 ? 179 GLU B CD  1 
ATOM   2866 O OE1 . GLU B 1 96  ? 29.614  42.274  160.970 1.00 111.97 ? 179 GLU B OE1 1 
ATOM   2867 O OE2 . GLU B 1 96  ? 28.410  42.277  159.141 1.00 112.74 ? 179 GLU B OE2 1 
ATOM   2868 N N   . GLU B 1 97  ? 33.803  46.126  161.035 1.00 114.66 ? 180 GLU B N   1 
ATOM   2869 C CA  . GLU B 1 97  ? 34.540  46.823  162.099 1.00 120.17 ? 180 GLU B CA  1 
ATOM   2870 C C   . GLU B 1 97  ? 34.491  48.327  161.904 1.00 119.52 ? 180 GLU B C   1 
ATOM   2871 O O   . GLU B 1 97  ? 34.183  49.063  162.834 1.00 113.49 ? 180 GLU B O   1 
ATOM   2872 C CB  . GLU B 1 97  ? 35.982  46.338  162.155 1.00 123.78 ? 180 GLU B CB  1 
ATOM   2873 C CG  . GLU B 1 97  ? 36.062  44.862  162.562 1.00 138.47 ? 180 GLU B CG  1 
ATOM   2874 C CD  . GLU B 1 97  ? 35.820  43.857  161.427 1.00 146.93 ? 180 GLU B CD  1 
ATOM   2875 O OE1 . GLU B 1 97  ? 35.446  44.278  160.302 1.00 148.32 ? 180 GLU B OE1 1 
ATOM   2876 O OE2 . GLU B 1 97  ? 35.972  42.632  161.684 1.00 159.00 ? 180 GLU B OE2 1 
ATOM   2877 N N   . GLU B 1 98  ? 34.752  48.750  160.669 1.00 122.07 ? 181 GLU B N   1 
ATOM   2878 C CA  . GLU B 1 98  ? 34.795  50.168  160.296 1.00 121.00 ? 181 GLU B CA  1 
ATOM   2879 C C   . GLU B 1 98  ? 33.383  50.697  160.205 1.00 112.09 ? 181 GLU B C   1 
ATOM   2880 O O   . GLU B 1 98  ? 33.085  51.732  160.804 1.00 111.09 ? 181 GLU B O   1 
ATOM   2881 C CB  . GLU B 1 98  ? 35.511  50.370  158.951 1.00 126.59 ? 181 GLU B CB  1 
ATOM   2882 C CG  . GLU B 1 98  ? 35.448  51.794  158.410 1.00 130.16 ? 181 GLU B CG  1 
ATOM   2883 C CD  . GLU B 1 98  ? 36.411  52.053  157.266 1.00 134.90 ? 181 GLU B CD  1 
ATOM   2884 O OE1 . GLU B 1 98  ? 36.644  51.139  156.436 1.00 133.93 ? 181 GLU B OE1 1 
ATOM   2885 O OE2 . GLU B 1 98  ? 36.939  53.186  157.215 1.00 130.95 ? 181 GLU B OE2 1 
ATOM   2886 N N   . ALA B 1 99  ? 32.527  49.987  159.461 1.00 105.14 ? 182 ALA B N   1 
ATOM   2887 C CA  . ALA B 1 99  ? 31.114  50.330  159.358 1.00 98.89  ? 182 ALA B CA  1 
ATOM   2888 C C   . ALA B 1 99  ? 30.524  50.571  160.746 1.00 95.14  ? 182 ALA B C   1 
ATOM   2889 O O   . ALA B 1 99  ? 29.912  51.601  160.978 1.00 101.59 ? 182 ALA B O   1 
ATOM   2890 C CB  . ALA B 1 99  ? 30.342  49.247  158.624 1.00 99.34  ? 182 ALA B CB  1 
ATOM   2891 N N   . ALA B 1 100 ? 30.743  49.651  161.671 1.00 92.86  ? 183 ALA B N   1 
ATOM   2892 C CA  . ALA B 1 100 ? 30.224  49.797  163.029 1.00 91.50  ? 183 ALA B CA  1 
ATOM   2893 C C   . ALA B 1 100 ? 30.806  51.010  163.748 1.00 91.41  ? 183 ALA B C   1 
ATOM   2894 O O   . ALA B 1 100 ? 30.094  51.757  164.388 1.00 90.64  ? 183 ALA B O   1 
ATOM   2895 C CB  . ALA B 1 100 ? 30.472  48.526  163.836 1.00 90.40  ? 183 ALA B CB  1 
ATOM   2896 N N   . ARG B 1 101 ? 32.108  51.215  163.619 1.00 101.95 ? 184 ARG B N   1 
ATOM   2897 C CA  . ARG B 1 101 ? 32.806  52.350  164.252 1.00 104.72 ? 184 ARG B CA  1 
ATOM   2898 C C   . ARG B 1 101 ? 32.145  53.675  163.794 1.00 100.86 ? 184 ARG B C   1 
ATOM   2899 O O   . ARG B 1 101 ? 31.778  54.520  164.620 1.00 97.77  ? 184 ARG B O   1 
ATOM   2900 C CB  . ARG B 1 101 ? 34.330  52.314  163.878 1.00 106.92 ? 184 ARG B CB  1 
ATOM   2901 C CG  . ARG B 1 101 ? 35.234  53.168  164.764 1.00 110.75 ? 184 ARG B CG  1 
ATOM   2902 C CD  . ARG B 1 101 ? 36.284  54.056  163.992 1.00 118.72 ? 184 ARG B CD  1 
ATOM   2903 N NE  . ARG B 1 101 ? 36.737  53.693  162.618 1.00 121.65 ? 184 ARG B NE  1 
ATOM   2904 C CZ  . ARG B 1 101 ? 37.220  52.494  162.207 1.00 126.89 ? 184 ARG B CZ  1 
ATOM   2905 N NH1 . ARG B 1 101 ? 37.279  51.421  163.007 1.00 125.85 ? 184 ARG B NH1 1 
ATOM   2906 N NH2 . ARG B 1 101 ? 37.619  52.332  160.941 1.00 126.28 ? 184 ARG B NH2 1 
ATOM   2907 N N   . LEU B 1 102 ? 31.956  53.798  162.479 1.00 100.17 ? 185 LEU B N   1 
ATOM   2908 C CA  . LEU B 1 102 ? 31.441  55.012  161.845 1.00 98.27  ? 185 LEU B CA  1 
ATOM   2909 C C   . LEU B 1 102 ? 29.937  55.171  161.993 1.00 98.22  ? 185 LEU B C   1 
ATOM   2910 O O   . LEU B 1 102 ? 29.476  56.257  162.334 1.00 103.13 ? 185 LEU B O   1 
ATOM   2911 C CB  . LEU B 1 102 ? 31.807  55.032  160.364 1.00 96.18  ? 185 LEU B CB  1 
ATOM   2912 C CG  . LEU B 1 102 ? 33.309  55.067  160.091 1.00 98.88  ? 185 LEU B CG  1 
ATOM   2913 C CD1 . LEU B 1 102 ? 33.537  54.983  158.596 1.00 100.00 ? 185 LEU B CD1 1 
ATOM   2914 C CD2 . LEU B 1 102 ? 33.987  56.307  160.673 1.00 98.90  ? 185 LEU B CD2 1 
ATOM   2915 N N   . PHE B 1 103 ? 29.187  54.095  161.757 1.00 95.12  ? 186 PHE B N   1 
ATOM   2916 C CA  . PHE B 1 103 ? 27.741  54.133  161.854 1.00 93.53  ? 186 PHE B CA  1 
ATOM   2917 C C   . PHE B 1 103 ? 27.286  54.433  163.273 1.00 92.39  ? 186 PHE B C   1 
ATOM   2918 O O   . PHE B 1 103 ? 26.249  55.052  163.472 1.00 98.34  ? 186 PHE B O   1 
ATOM   2919 C CB  . PHE B 1 103 ? 27.115  52.827  161.375 1.00 94.63  ? 186 PHE B CB  1 
ATOM   2920 C CG  . PHE B 1 103 ? 25.609  52.824  161.400 1.00 94.35  ? 186 PHE B CG  1 
ATOM   2921 C CD1 . PHE B 1 103 ? 24.887  53.631  160.544 1.00 94.38  ? 186 PHE B CD1 1 
ATOM   2922 C CD2 . PHE B 1 103 ? 24.912  52.008  162.274 1.00 94.31  ? 186 PHE B CD2 1 
ATOM   2923 C CE1 . PHE B 1 103 ? 23.498  53.625  160.560 1.00 93.79  ? 186 PHE B CE1 1 
ATOM   2924 C CE2 . PHE B 1 103 ? 23.521  52.002  162.296 1.00 94.80  ? 186 PHE B CE2 1 
ATOM   2925 C CZ  . PHE B 1 103 ? 22.813  52.815  161.436 1.00 91.29  ? 186 PHE B CZ  1 
ATOM   2926 N N   . LYS B 1 104 ? 28.062  54.039  164.262 1.00 93.25  ? 187 LYS B N   1 
ATOM   2927 C CA  . LYS B 1 104 ? 27.721  54.374  165.648 1.00 98.02  ? 187 LYS B CA  1 
ATOM   2928 C C   . LYS B 1 104 ? 27.781  55.869  165.924 1.00 96.67  ? 187 LYS B C   1 
ATOM   2929 O O   . LYS B 1 104 ? 26.960  56.396  166.671 1.00 94.97  ? 187 LYS B O   1 
ATOM   2930 C CB  . LYS B 1 104 ? 28.626  53.646  166.645 1.00 101.40 ? 187 LYS B CB  1 
ATOM   2931 C CG  . LYS B 1 104 ? 28.073  53.689  168.052 1.00 104.12 ? 187 LYS B CG  1 
ATOM   2932 C CD  . LYS B 1 104 ? 28.681  52.621  168.938 1.00 108.71 ? 187 LYS B CD  1 
ATOM   2933 C CE  . LYS B 1 104 ? 27.917  52.541  170.241 1.00 113.45 ? 187 LYS B CE  1 
ATOM   2934 N NZ  . LYS B 1 104 ? 28.766  51.969  171.314 1.00 116.66 ? 187 LYS B NZ  1 
ATOM   2935 N N   . GLN B 1 105 ? 28.760  56.542  165.322 1.00 99.32  ? 188 GLN B N   1 
ATOM   2936 C CA  . GLN B 1 105 ? 28.911  57.988  165.468 1.00 97.22  ? 188 GLN B CA  1 
ATOM   2937 C C   . GLN B 1 105 ? 27.746  58.717  164.796 1.00 95.13  ? 188 GLN B C   1 
ATOM   2938 O O   . GLN B 1 105 ? 27.202  59.685  165.353 1.00 93.95  ? 188 GLN B O   1 
ATOM   2939 C CB  . GLN B 1 105 ? 30.204  58.477  164.845 1.00 96.81  ? 188 GLN B CB  1 
ATOM   2940 C CG  . GLN B 1 105 ? 31.455  57.929  165.466 1.00 96.81  ? 188 GLN B CG  1 
ATOM   2941 C CD  . GLN B 1 105 ? 32.667  58.416  164.728 1.00 101.12 ? 188 GLN B CD  1 
ATOM   2942 O OE1 . GLN B 1 105 ? 32.971  59.593  164.778 1.00 108.09 ? 188 GLN B OE1 1 
ATOM   2943 N NE2 . GLN B 1 105 ? 33.364  57.532  164.032 1.00 102.39 ? 188 GLN B NE2 1 
ATOM   2944 N N   . ILE B 1 106 ? 27.405  58.240  163.597 1.00 90.07  ? 189 ILE B N   1 
ATOM   2945 C CA  . ILE B 1 106 ? 26.253  58.695  162.850 1.00 88.08  ? 189 ILE B CA  1 
ATOM   2946 C C   . ILE B 1 106 ? 24.981  58.594  163.691 1.00 89.96  ? 189 ILE B C   1 
ATOM   2947 O O   . ILE B 1 106 ? 24.170  59.527  163.712 1.00 91.13  ? 189 ILE B O   1 
ATOM   2948 C CB  . ILE B 1 106 ? 26.107  57.891  161.549 1.00 87.35  ? 189 ILE B CB  1 
ATOM   2949 C CG1 . ILE B 1 106 ? 27.198  58.333  160.557 1.00 92.93  ? 189 ILE B CG1 1 
ATOM   2950 C CG2 . ILE B 1 106 ? 24.734  58.091  160.939 1.00 86.65  ? 189 ILE B CG2 1 
ATOM   2951 C CD1 . ILE B 1 106 ? 27.229  57.587  159.230 1.00 93.99  ? 189 ILE B CD1 1 
ATOM   2952 N N   . VAL B 1 107 ? 24.809  57.471  164.380 1.00 88.81  ? 190 VAL B N   1 
ATOM   2953 C CA  . VAL B 1 107 ? 23.606  57.238  165.167 1.00 89.16  ? 190 VAL B CA  1 
ATOM   2954 C C   . VAL B 1 107 ? 23.614  58.080  166.445 1.00 88.44  ? 190 VAL B C   1 
ATOM   2955 O O   . VAL B 1 107 ? 22.580  58.594  166.848 1.00 88.98  ? 190 VAL B O   1 
ATOM   2956 C CB  . VAL B 1 107 ? 23.415  55.733  165.464 1.00 93.03  ? 190 VAL B CB  1 
ATOM   2957 C CG1 . VAL B 1 107 ? 22.252  55.509  166.422 1.00 93.80  ? 190 VAL B CG1 1 
ATOM   2958 C CG2 . VAL B 1 107 ? 23.164  54.973  164.164 1.00 93.63  ? 190 VAL B CG2 1 
ATOM   2959 N N   . SER B 1 108 ? 24.772  58.233  167.077 1.00 91.06  ? 191 SER B N   1 
ATOM   2960 C CA  . SER B 1 108 ? 24.883  59.083  168.264 1.00 92.20  ? 191 SER B CA  1 
ATOM   2961 C C   . SER B 1 108 ? 24.487  60.504  167.936 1.00 95.77  ? 191 SER B C   1 
ATOM   2962 O O   . SER B 1 108 ? 23.906  61.176  168.769 1.00 103.95 ? 191 SER B O   1 
ATOM   2963 C CB  . SER B 1 108 ? 26.305  59.101  168.821 1.00 92.15  ? 191 SER B CB  1 
ATOM   2964 O OG  . SER B 1 108 ? 26.813  57.795  168.929 1.00 91.13  ? 191 SER B OG  1 
ATOM   2965 N N   . ALA B 1 109 ? 24.844  60.965  166.739 1.00 95.33  ? 192 ALA B N   1 
ATOM   2966 C CA  . ALA B 1 109 ? 24.484  62.306  166.287 1.00 95.98  ? 192 ALA B CA  1 
ATOM   2967 C C   . ALA B 1 109 ? 22.979  62.427  166.221 1.00 93.00  ? 192 ALA B C   1 
ATOM   2968 O O   . ALA B 1 109 ? 22.402  63.347  166.810 1.00 92.01  ? 192 ALA B O   1 
ATOM   2969 C CB  . ALA B 1 109 ? 25.103  62.618  164.921 1.00 97.46  ? 192 ALA B CB  1 
ATOM   2970 N N   . VAL B 1 110 ? 22.360  61.473  165.533 1.00 87.67  ? 193 VAL B N   1 
ATOM   2971 C CA  . VAL B 1 110 ? 20.911  61.471  165.344 1.00 86.38  ? 193 VAL B CA  1 
ATOM   2972 C C   . VAL B 1 110 ? 20.172  61.302  166.665 1.00 89.17  ? 193 VAL B C   1 
ATOM   2973 O O   . VAL B 1 110 ? 19.148  61.962  166.895 1.00 89.50  ? 193 VAL B O   1 
ATOM   2974 C CB  . VAL B 1 110 ? 20.467  60.360  164.380 1.00 83.47  ? 193 VAL B CB  1 
ATOM   2975 C CG1 . VAL B 1 110 ? 18.944  60.185  164.383 1.00 84.73  ? 193 VAL B CG1 1 
ATOM   2976 C CG2 . VAL B 1 110 ? 20.994  60.660  162.985 1.00 83.26  ? 193 VAL B CG2 1 
ATOM   2977 N N   . ALA B 1 111 ? 20.698  60.440  167.530 1.00 88.57  ? 194 ALA B N   1 
ATOM   2978 C CA  . ALA B 1 111 ? 20.056  60.172  168.802 1.00 91.32  ? 194 ALA B CA  1 
ATOM   2979 C C   . ALA B 1 111 ? 20.039  61.441  169.640 1.00 94.23  ? 194 ALA B C   1 
ATOM   2980 O O   . ALA B 1 111 ? 18.995  61.831  170.170 1.00 95.62  ? 194 ALA B O   1 
ATOM   2981 C CB  . ALA B 1 111 ? 20.772  59.058  169.538 1.00 91.88  ? 194 ALA B CB  1 
ATOM   2982 N N   . HIS B 1 112 ? 21.208  62.073  169.722 1.00 94.89  ? 195 HIS B N   1 
ATOM   2983 C CA  . HIS B 1 112 ? 21.438  63.345  170.447 1.00 96.86  ? 195 HIS B CA  1 
ATOM   2984 C C   . HIS B 1 112 ? 20.537  64.488  170.002 1.00 95.22  ? 195 HIS B C   1 
ATOM   2985 O O   . HIS B 1 112 ? 20.092  65.288  170.830 1.00 93.71  ? 195 HIS B O   1 
ATOM   2986 C CB  . HIS B 1 112 ? 22.909  63.762  170.277 1.00 96.43  ? 195 HIS B CB  1 
ATOM   2987 C CG  . HIS B 1 112 ? 23.253  65.062  170.916 1.00 95.00  ? 195 HIS B CG  1 
ATOM   2988 N ND1 . HIS B 1 112 ? 23.472  65.190  172.267 1.00 95.11  ? 195 HIS B ND1 1 
ATOM   2989 C CD2 . HIS B 1 112 ? 23.410  66.297  170.387 1.00 97.86  ? 195 HIS B CD2 1 
ATOM   2990 C CE1 . HIS B 1 112 ? 23.764  66.452  172.542 1.00 102.44 ? 195 HIS B CE1 1 
ATOM   2991 N NE2 . HIS B 1 112 ? 23.727  67.146  171.419 1.00 100.62 ? 195 HIS B NE2 1 
ATOM   2992 N N   . CYS B 1 113 ? 20.298  64.568  168.692 1.00 96.61  ? 196 CYS B N   1 
ATOM   2993 C CA  . CYS B 1 113 ? 19.321  65.508  168.131 1.00 97.62  ? 196 CYS B CA  1 
ATOM   2994 C C   . CYS B 1 113 ? 17.920  65.168  168.610 1.00 95.35  ? 196 CYS B C   1 
ATOM   2995 O O   . CYS B 1 113 ? 17.239  66.030  169.152 1.00 96.64  ? 196 CYS B O   1 
ATOM   2996 C CB  . CYS B 1 113 ? 19.338  65.486  166.603 1.00 98.42  ? 196 CYS B CB  1 
ATOM   2997 S SG  . CYS B 1 113 ? 20.804  66.232  165.873 1.00 99.45  ? 196 CYS B SG  1 
ATOM   2998 N N   . HIS B 1 114 ? 17.501  63.917  168.407 1.00 91.50  ? 197 HIS B N   1 
ATOM   2999 C CA  . HIS B 1 114 ? 16.158  63.472  168.807 1.00 89.85  ? 197 HIS B CA  1 
ATOM   3000 C C   . HIS B 1 114 ? 15.915  63.679  170.301 1.00 90.11  ? 197 HIS B C   1 
ATOM   3001 O O   . HIS B 1 114 ? 14.808  64.054  170.680 1.00 96.24  ? 197 HIS B O   1 
ATOM   3002 C CB  . HIS B 1 114 ? 15.926  62.013  168.432 1.00 90.38  ? 197 HIS B CB  1 
ATOM   3003 C CG  . HIS B 1 114 ? 15.774  61.770  166.963 1.00 90.09  ? 197 HIS B CG  1 
ATOM   3004 N ND1 . HIS B 1 114 ? 15.401  60.550  166.451 1.00 88.14  ? 197 HIS B ND1 1 
ATOM   3005 C CD2 . HIS B 1 114 ? 15.973  62.574  165.897 1.00 93.34  ? 197 HIS B CD2 1 
ATOM   3006 C CE1 . HIS B 1 114 ? 15.371  60.610  165.134 1.00 89.10  ? 197 HIS B CE1 1 
ATOM   3007 N NE2 . HIS B 1 114 ? 15.712  61.829  164.772 1.00 93.44  ? 197 HIS B NE2 1 
ATOM   3008 N N   . GLN B 1 115 ? 16.939  63.481  171.139 1.00 91.28  ? 198 GLN B N   1 
ATOM   3009 C CA  . GLN B 1 115 ? 16.820  63.756  172.591 1.00 95.91  ? 198 GLN B CA  1 
ATOM   3010 C C   . GLN B 1 115 ? 16.537  65.221  172.861 1.00 97.44  ? 198 GLN B C   1 
ATOM   3011 O O   . GLN B 1 115 ? 15.865  65.525  173.835 1.00 106.93 ? 198 GLN B O   1 
ATOM   3012 C CB  . GLN B 1 115 ? 18.070  63.375  173.415 1.00 101.42 ? 198 GLN B CB  1 
ATOM   3013 C CG  . GLN B 1 115 ? 18.613  61.948  173.318 1.00 108.50 ? 198 GLN B CG  1 
ATOM   3014 C CD  . GLN B 1 115 ? 17.573  60.852  173.476 1.00 113.13 ? 198 GLN B CD  1 
ATOM   3015 O OE1 . GLN B 1 115 ? 16.780  60.568  172.561 1.00 116.48 ? 198 GLN B OE1 1 
ATOM   3016 N NE2 . GLN B 1 115 ? 17.588  60.203  174.635 1.00 119.49 ? 198 GLN B NE2 1 
ATOM   3017 N N   . SER B 1 116 ? 17.073  66.117  172.026 1.00 95.56  ? 199 SER B N   1 
ATOM   3018 C CA  . SER B 1 116 ? 16.821  67.559  172.117 1.00 97.07  ? 199 SER B CA  1 
ATOM   3019 C C   . SER B 1 116 ? 15.723  68.047  171.177 1.00 98.54  ? 199 SER B C   1 
ATOM   3020 O O   . SER B 1 116 ? 15.662  69.243  170.887 1.00 107.30 ? 199 SER B O   1 
ATOM   3021 C CB  . SER B 1 116 ? 18.098  68.337  171.816 1.00 98.26  ? 199 SER B CB  1 
ATOM   3022 O OG  . SER B 1 116 ? 19.134  67.995  172.712 1.00 101.15 ? 199 SER B OG  1 
ATOM   3023 N N   . ALA B 1 117 ? 14.848  67.147  170.718 1.00 95.88  ? 200 ALA B N   1 
ATOM   3024 C CA  . ALA B 1 117 ? 13.709  67.505  169.866 1.00 95.98  ? 200 ALA B CA  1 
ATOM   3025 C C   . ALA B 1 117 ? 14.095  68.234  168.588 1.00 98.59  ? 200 ALA B C   1 
ATOM   3026 O O   . ALA B 1 117 ? 13.426  69.168  168.177 1.00 108.10 ? 200 ALA B O   1 
ATOM   3027 C CB  . ALA B 1 117 ? 12.690  68.320  170.662 1.00 98.41  ? 200 ALA B CB  1 
ATOM   3028 N N   . ILE B 1 118 ? 15.207  67.841  167.989 1.00 98.57  ? 201 ILE B N   1 
ATOM   3029 C CA  . ILE B 1 118 ? 15.563  68.293  166.654 1.00 101.09 ? 201 ILE B CA  1 
ATOM   3030 C C   . ILE B 1 118 ? 15.326  67.028  165.827 1.00 98.82  ? 201 ILE B C   1 
ATOM   3031 O O   . ILE B 1 118 ? 15.886  65.979  166.128 1.00 96.62  ? 201 ILE B O   1 
ATOM   3032 C CB  . ILE B 1 118 ? 17.036  68.838  166.571 1.00 105.57 ? 201 ILE B CB  1 
ATOM   3033 C CG1 . ILE B 1 118 ? 17.148  70.316  166.978 1.00 112.13 ? 201 ILE B CG1 1 
ATOM   3034 C CG2 . ILE B 1 118 ? 17.589  68.739  165.158 1.00 103.77 ? 201 ILE B CG2 1 
ATOM   3035 C CD1 . ILE B 1 118 ? 16.704  70.670  168.384 1.00 116.21 ? 201 ILE B CD1 1 
ATOM   3036 N N   . VAL B 1 119 ? 14.437  67.114  164.844 1.00 101.49 ? 202 VAL B N   1 
ATOM   3037 C CA  . VAL B 1 119 ? 14.264  66.065  163.835 1.00 99.94  ? 202 VAL B CA  1 
ATOM   3038 C C   . VAL B 1 119 ? 15.094  66.490  162.626 1.00 103.50 ? 202 VAL B C   1 
ATOM   3039 O O   . VAL B 1 119 ? 15.046  67.658  162.227 1.00 104.07 ? 202 VAL B O   1 
ATOM   3040 C CB  . VAL B 1 119 ? 12.796  65.926  163.432 1.00 99.10  ? 202 VAL B CB  1 
ATOM   3041 C CG1 . VAL B 1 119 ? 12.649  65.091  162.164 1.00 97.26  ? 202 VAL B CG1 1 
ATOM   3042 C CG2 . VAL B 1 119 ? 12.028  65.316  164.580 1.00 102.29 ? 202 VAL B CG2 1 
ATOM   3043 N N   . LEU B 1 120 ? 15.832  65.550  162.033 1.00 101.20 ? 203 LEU B N   1 
ATOM   3044 C CA  . LEU B 1 120 ? 16.791  65.886  160.987 1.00 102.76 ? 203 LEU B CA  1 
ATOM   3045 C C   . LEU B 1 120 ? 16.085  66.141  159.669 1.00 103.74 ? 203 LEU B C   1 
ATOM   3046 O O   . LEU B 1 120 ? 16.350  67.144  159.013 1.00 108.52 ? 203 LEU B O   1 
ATOM   3047 C CB  . LEU B 1 120 ? 17.884  64.808  160.830 1.00 105.21 ? 203 LEU B CB  1 
ATOM   3048 C CG  . LEU B 1 120 ? 18.960  64.634  161.924 1.00 105.29 ? 203 LEU B CG  1 
ATOM   3049 C CD1 . LEU B 1 120 ? 19.496  65.964  162.424 1.00 107.42 ? 203 LEU B CD1 1 
ATOM   3050 C CD2 . LEU B 1 120 ? 18.447  63.850  163.114 1.00 108.40 ? 203 LEU B CD2 1 
ATOM   3051 N N   . GLY B 1 121 ? 15.208  65.233  159.264 1.00 104.32 ? 204 GLY B N   1 
ATOM   3052 C CA  . GLY B 1 121 ? 14.431  65.417  158.036 1.00 110.67 ? 204 GLY B CA  1 
ATOM   3053 C C   . GLY B 1 121 ? 15.092  64.988  156.722 1.00 113.05 ? 204 GLY B C   1 
ATOM   3054 O O   . GLY B 1 121 ? 14.411  64.447  155.847 1.00 120.13 ? 204 GLY B O   1 
ATOM   3055 N N   . ASP B 1 122 ? 16.395  65.239  156.575 1.00 109.05 ? 205 ASP B N   1 
ATOM   3056 C CA  . ASP B 1 122 ? 17.112  65.003  155.329 1.00 111.90 ? 205 ASP B CA  1 
ATOM   3057 C C   . ASP B 1 122 ? 18.422  64.304  155.629 1.00 107.12 ? 205 ASP B C   1 
ATOM   3058 O O   . ASP B 1 122 ? 19.483  64.849  155.386 1.00 105.27 ? 205 ASP B O   1 
ATOM   3059 C CB  . ASP B 1 122 ? 17.349  66.343  154.619 1.00 122.56 ? 205 ASP B CB  1 
ATOM   3060 C CG  . ASP B 1 122 ? 17.937  66.196  153.203 1.00 131.93 ? 205 ASP B CG  1 
ATOM   3061 O OD1 . ASP B 1 122 ? 18.162  65.061  152.723 1.00 137.42 ? 205 ASP B OD1 1 
ATOM   3062 O OD2 . ASP B 1 122 ? 18.169  67.244  152.553 1.00 138.03 ? 205 ASP B OD2 1 
ATOM   3063 N N   . LEU B 1 123 ? 18.329  63.102  156.201 1.00 105.99 ? 206 LEU B N   1 
ATOM   3064 C CA  . LEU B 1 123 ? 19.499  62.260  156.458 1.00 101.91 ? 206 LEU B CA  1 
ATOM   3065 C C   . LEU B 1 123 ? 19.959  61.532  155.197 1.00 104.69 ? 206 LEU B C   1 
ATOM   3066 O O   . LEU B 1 123 ? 19.149  61.029  154.411 1.00 104.15 ? 206 LEU B O   1 
ATOM   3067 C CB  . LEU B 1 123 ? 19.233  61.230  157.556 1.00 99.35  ? 206 LEU B CB  1 
ATOM   3068 C CG  . LEU B 1 123 ? 19.315  61.705  159.001 1.00 100.08 ? 206 LEU B CG  1 
ATOM   3069 C CD1 . LEU B 1 123 ? 19.004  60.530  159.908 1.00 96.95  ? 206 LEU B CD1 1 
ATOM   3070 C CD2 . LEU B 1 123 ? 20.687  62.274  159.330 1.00 101.96 ? 206 LEU B CD2 1 
ATOM   3071 N N   . LYS B 1 124 ? 21.278  61.504  155.029 1.00 103.16 ? 207 LYS B N   1 
ATOM   3072 C CA  . LYS B 1 124 ? 21.942  60.862  153.908 1.00 103.92 ? 207 LYS B CA  1 
ATOM   3073 C C   . LYS B 1 124 ? 23.441  60.822  154.187 1.00 103.95 ? 207 LYS B C   1 
ATOM   3074 O O   . LYS B 1 124 ? 23.955  61.581  155.026 1.00 96.84  ? 207 LYS B O   1 
ATOM   3075 C CB  . LYS B 1 124 ? 21.674  61.609  152.607 1.00 105.67 ? 207 LYS B CB  1 
ATOM   3076 C CG  . LYS B 1 124 ? 22.018  63.090  152.649 1.00 108.71 ? 207 LYS B CG  1 
ATOM   3077 C CD  . LYS B 1 124 ? 21.659  63.758  151.323 1.00 114.06 ? 207 LYS B CD  1 
ATOM   3078 C CE  . LYS B 1 124 ? 21.670  65.271  151.413 1.00 111.46 ? 207 LYS B CE  1 
ATOM   3079 N NZ  . LYS B 1 124 ? 21.235  65.818  150.110 1.00 116.47 ? 207 LYS B NZ  1 
ATOM   3080 N N   . LEU B 1 125 ? 24.147  59.955  153.473 1.00 104.70 ? 208 LEU B N   1 
ATOM   3081 C CA  . LEU B 1 125 ? 25.567  59.777  153.736 1.00 108.15 ? 208 LEU B CA  1 
ATOM   3082 C C   . LEU B 1 125 ? 26.351  61.072  153.519 1.00 112.34 ? 208 LEU B C   1 
ATOM   3083 O O   . LEU B 1 125 ? 27.283  61.350  154.274 1.00 110.56 ? 208 LEU B O   1 
ATOM   3084 C CB  . LEU B 1 125 ? 26.146  58.634  152.893 1.00 108.85 ? 208 LEU B CB  1 
ATOM   3085 C CG  . LEU B 1 125 ? 25.789  57.207  153.319 1.00 103.20 ? 208 LEU B CG  1 
ATOM   3086 C CD1 . LEU B 1 125 ? 26.272  56.216  152.287 1.00 103.34 ? 208 LEU B CD1 1 
ATOM   3087 C CD2 . LEU B 1 125 ? 26.401  56.886  154.666 1.00 101.26 ? 208 LEU B CD2 1 
ATOM   3088 N N   . ARG B 1 126 ? 25.923  61.889  152.550 1.00 113.54 ? 209 ARG B N   1 
ATOM   3089 C CA  . ARG B 1 126 ? 26.589  63.166  152.249 1.00 116.43 ? 209 ARG B CA  1 
ATOM   3090 C C   . ARG B 1 126 ? 26.603  64.135  153.436 1.00 109.18 ? 209 ARG B C   1 
ATOM   3091 O O   . ARG B 1 126 ? 27.491  64.970  153.529 1.00 119.03 ? 209 ARG B O   1 
ATOM   3092 C CB  . ARG B 1 126 ? 25.953  63.868  151.038 1.00 127.46 ? 209 ARG B CB  1 
ATOM   3093 C CG  . ARG B 1 126 ? 26.944  64.316  149.973 1.00 143.43 ? 209 ARG B CG  1 
ATOM   3094 C CD  . ARG B 1 126 ? 26.624  65.718  149.444 1.00 156.39 ? 209 ARG B CD  1 
ATOM   3095 N NE  . ARG B 1 126 ? 26.994  66.738  150.421 1.00 168.13 ? 209 ARG B NE  1 
ATOM   3096 C CZ  . ARG B 1 126 ? 28.249  67.116  150.676 1.00 171.82 ? 209 ARG B CZ  1 
ATOM   3097 N NH1 . ARG B 1 126 ? 29.276  66.581  150.012 1.00 172.36 ? 209 ARG B NH1 1 
ATOM   3098 N NH2 . ARG B 1 126 ? 28.483  68.039  151.602 1.00 173.45 ? 209 ARG B NH2 1 
ATOM   3099 N N   . LYS B 1 127 ? 25.641  64.020  154.341 1.00 102.80 ? 210 LYS B N   1 
ATOM   3100 C CA  . LYS B 1 127 ? 25.521  64.937  155.477 1.00 104.20 ? 210 LYS B CA  1 
ATOM   3101 C C   . LYS B 1 127 ? 26.471  64.645  156.626 1.00 101.47 ? 210 LYS B C   1 
ATOM   3102 O O   . LYS B 1 127 ? 26.468  65.391  157.611 1.00 100.10 ? 210 LYS B O   1 
ATOM   3103 C CB  . LYS B 1 127 ? 24.071  64.939  156.023 1.00 108.98 ? 210 LYS B CB  1 
ATOM   3104 C CG  . LYS B 1 127 ? 23.023  65.350  154.989 1.00 112.25 ? 210 LYS B CG  1 
ATOM   3105 C CD  . LYS B 1 127 ? 22.788  66.860  154.905 1.00 115.54 ? 210 LYS B CD  1 
ATOM   3106 C CE  . LYS B 1 127 ? 21.444  67.253  155.498 1.00 116.80 ? 210 LYS B CE  1 
ATOM   3107 N NZ  . LYS B 1 127 ? 21.435  68.654  155.974 1.00 118.22 ? 210 LYS B NZ  1 
ATOM   3108 N N   . PHE B 1 128 ? 27.243  63.555  156.543 1.00 100.24 ? 211 PHE B N   1 
ATOM   3109 C CA  . PHE B 1 128 ? 28.207  63.214  157.590 1.00 94.19  ? 211 PHE B CA  1 
ATOM   3110 C C   . PHE B 1 128 ? 29.596  63.346  157.052 1.00 95.92  ? 211 PHE B C   1 
ATOM   3111 O O   . PHE B 1 128 ? 29.907  62.804  155.983 1.00 101.01 ? 211 PHE B O   1 
ATOM   3112 C CB  . PHE B 1 128 ? 27.925  61.819  158.134 1.00 91.17  ? 211 PHE B CB  1 
ATOM   3113 C CG  . PHE B 1 128 ? 26.706  61.793  158.975 1.00 89.07  ? 211 PHE B CG  1 
ATOM   3114 C CD1 . PHE B 1 128 ? 26.780  62.132  160.315 1.00 89.53  ? 211 PHE B CD1 1 
ATOM   3115 C CD2 . PHE B 1 128 ? 25.466  61.591  158.407 1.00 88.38  ? 211 PHE B CD2 1 
ATOM   3116 C CE1 . PHE B 1 128 ? 25.644  62.195  161.094 1.00 87.28  ? 211 PHE B CE1 1 
ATOM   3117 C CE2 . PHE B 1 128 ? 24.328  61.637  159.183 1.00 87.57  ? 211 PHE B CE2 1 
ATOM   3118 C CZ  . PHE B 1 128 ? 24.414  61.935  160.529 1.00 87.51  ? 211 PHE B CZ  1 
ATOM   3119 N N   . VAL B 1 129 ? 30.421  64.078  157.787 1.00 95.00  ? 212 VAL B N   1 
ATOM   3120 C CA  . VAL B 1 129 ? 31.759  64.428  157.306 1.00 100.26 ? 212 VAL B CA  1 
ATOM   3121 C C   . VAL B 1 129 ? 32.856  64.105  158.310 1.00 101.00 ? 212 VAL B C   1 
ATOM   3122 O O   . VAL B 1 129 ? 32.650  64.207  159.520 1.00 99.05  ? 212 VAL B O   1 
ATOM   3123 C CB  . VAL B 1 129 ? 31.863  65.925  156.913 1.00 99.65  ? 212 VAL B CB  1 
ATOM   3124 C CG1 . VAL B 1 129 ? 30.966  66.221  155.723 1.00 101.83 ? 212 VAL B CG1 1 
ATOM   3125 C CG2 . VAL B 1 129 ? 31.552  66.872  158.083 1.00 95.39  ? 212 VAL B CG2 1 
ATOM   3126 N N   . PHE B 1 130 ? 34.024  63.744  157.789 1.00 103.50 ? 213 PHE B N   1 
ATOM   3127 C CA  . PHE B 1 130 ? 35.189  63.480  158.623 1.00 106.03 ? 213 PHE B CA  1 
ATOM   3128 C C   . PHE B 1 130 ? 35.725  64.772  159.202 1.00 106.90 ? 213 PHE B C   1 
ATOM   3129 O O   . PHE B 1 130 ? 35.772  65.786  158.513 1.00 109.78 ? 213 PHE B O   1 
ATOM   3130 C CB  . PHE B 1 130 ? 36.276  62.794  157.831 1.00 107.34 ? 213 PHE B CB  1 
ATOM   3131 C CG  . PHE B 1 130 ? 35.924  61.399  157.411 1.00 109.98 ? 213 PHE B CG  1 
ATOM   3132 C CD1 . PHE B 1 130 ? 35.761  60.390  158.358 1.00 109.29 ? 213 PHE B CD1 1 
ATOM   3133 C CD2 . PHE B 1 130 ? 35.769  61.081  156.068 1.00 113.97 ? 213 PHE B CD2 1 
ATOM   3134 C CE1 . PHE B 1 130 ? 35.444  59.088  157.977 1.00 111.10 ? 213 PHE B CE1 1 
ATOM   3135 C CE2 . PHE B 1 130 ? 35.455  59.780  155.683 1.00 116.29 ? 213 PHE B CE2 1 
ATOM   3136 C CZ  . PHE B 1 130 ? 35.288  58.780  156.635 1.00 113.54 ? 213 PHE B CZ  1 
ATOM   3137 N N   . SER B 1 131 ? 36.082  64.743  160.477 1.00 108.66 ? 214 SER B N   1 
ATOM   3138 C CA  . SER B 1 131 ? 36.503  65.946  161.187 1.00 112.14 ? 214 SER B CA  1 
ATOM   3139 C C   . SER B 1 131 ? 38.021  66.186  161.214 1.00 117.36 ? 214 SER B C   1 
ATOM   3140 O O   . SER B 1 131 ? 38.435  67.288  161.523 1.00 118.15 ? 214 SER B O   1 
ATOM   3141 C CB  . SER B 1 131 ? 35.948  65.894  162.605 1.00 111.15 ? 214 SER B CB  1 
ATOM   3142 O OG  . SER B 1 131 ? 36.523  64.806  163.290 1.00 112.03 ? 214 SER B OG  1 
ATOM   3143 N N   . THR B 1 132 ? 38.839  65.175  160.899 1.00 126.85 ? 215 THR B N   1 
ATOM   3144 C CA  . THR B 1 132 ? 40.314  65.355  160.694 1.00 131.87 ? 215 THR B CA  1 
ATOM   3145 C C   . THR B 1 132 ? 40.784  64.517  159.495 1.00 137.94 ? 215 THR B C   1 
ATOM   3146 O O   . THR B 1 132 ? 40.042  63.658  158.987 1.00 131.02 ? 215 THR B O   1 
ATOM   3147 C CB  . THR B 1 132 ? 41.228  65.013  161.917 1.00 132.58 ? 215 THR B CB  1 
ATOM   3148 O OG1 . THR B 1 132 ? 40.471  64.895  163.116 1.00 116.87 ? 215 THR B OG1 1 
ATOM   3149 C CG2 . THR B 1 132 ? 42.359  66.074  162.136 1.00 144.40 ? 215 THR B CG2 1 
ATOM   3150 N N   . GLU B 1 133 ? 42.025  64.750  159.060 1.00 142.06 ? 216 GLU B N   1 
ATOM   3151 C CA  . GLU B 1 133 ? 42.599  63.936  157.994 1.00 146.27 ? 216 GLU B CA  1 
ATOM   3152 C C   . GLU B 1 133 ? 42.769  62.472  158.421 1.00 143.58 ? 216 GLU B C   1 
ATOM   3153 O O   . GLU B 1 133 ? 42.837  61.590  157.570 1.00 136.91 ? 216 GLU B O   1 
ATOM   3154 C CB  . GLU B 1 133 ? 43.882  64.538  157.444 1.00 161.49 ? 216 GLU B CB  1 
ATOM   3155 C CG  . GLU B 1 133 ? 45.117  64.488  158.339 1.00 175.42 ? 216 GLU B CG  1 
ATOM   3156 C CD  . GLU B 1 133 ? 45.339  65.748  159.163 1.00 185.82 ? 216 GLU B CD  1 
ATOM   3157 O OE1 . GLU B 1 133 ? 44.431  66.626  159.318 1.00 185.38 ? 216 GLU B OE1 1 
ATOM   3158 O OE2 . GLU B 1 133 ? 46.474  65.849  159.657 1.00 186.62 ? 216 GLU B OE2 1 
ATOM   3159 N N   . GLU B 1 134 ? 42.812  62.220  159.735 1.00 145.62 ? 217 GLU B N   1 
ATOM   3160 C CA  . GLU B 1 134 ? 42.603  60.869  160.302 1.00 146.09 ? 217 GLU B CA  1 
ATOM   3161 C C   . GLU B 1 134 ? 41.472  60.131  159.596 1.00 139.11 ? 217 GLU B C   1 
ATOM   3162 O O   . GLU B 1 134 ? 41.636  58.980  159.189 1.00 138.13 ? 217 GLU B O   1 
ATOM   3163 C CB  . GLU B 1 134 ? 42.280  60.918  161.812 1.00 153.52 ? 217 GLU B CB  1 
ATOM   3164 C CG  . GLU B 1 134 ? 43.473  60.708  162.740 1.00 160.35 ? 217 GLU B CG  1 
ATOM   3165 C CD  . GLU B 1 134 ? 44.440  61.885  162.746 1.00 168.26 ? 217 GLU B CD  1 
ATOM   3166 O OE1 . GLU B 1 134 ? 43.978  63.051  162.701 1.00 164.78 ? 217 GLU B OE1 1 
ATOM   3167 O OE2 . GLU B 1 134 ? 45.671  61.640  162.805 1.00 184.04 ? 217 GLU B OE2 1 
ATOM   3168 N N   . ARG B 1 135 ? 40.328  60.810  159.469 1.00 128.73 ? 218 ARG B N   1 
ATOM   3169 C CA  . ARG B 1 135 ? 39.158  60.273  158.791 1.00 120.69 ? 218 ARG B CA  1 
ATOM   3170 C C   . ARG B 1 135 ? 38.688  58.999  159.492 1.00 119.67 ? 218 ARG B C   1 
ATOM   3171 O O   . ARG B 1 135 ? 38.430  57.957  158.869 1.00 123.63 ? 218 ARG B O   1 
ATOM   3172 C CB  . ARG B 1 135 ? 39.443  60.082  157.293 1.00 119.84 ? 218 ARG B CB  1 
ATOM   3173 C CG  . ARG B 1 135 ? 39.661  61.404  156.522 1.00 115.55 ? 218 ARG B CG  1 
ATOM   3174 C CD  . ARG B 1 135 ? 40.183  61.183  155.077 1.00 115.21 ? 218 ARG B CD  1 
ATOM   3175 N NE  . ARG B 1 135 ? 39.092  61.310  154.126 1.00 112.95 ? 218 ARG B NE  1 
ATOM   3176 C CZ  . ARG B 1 135 ? 38.621  60.359  153.292 1.00 113.57 ? 218 ARG B CZ  1 
ATOM   3177 N NH1 . ARG B 1 135 ? 39.169  59.155  153.148 1.00 113.93 ? 218 ARG B NH1 1 
ATOM   3178 N NH2 . ARG B 1 135 ? 37.566  60.652  152.527 1.00 117.10 ? 218 ARG B NH2 1 
ATOM   3179 N N   . THR B 1 136 ? 38.636  59.120  160.817 1.00 118.34 ? 219 THR B N   1 
ATOM   3180 C CA  . THR B 1 136 ? 38.161  58.104  161.747 1.00 117.49 ? 219 THR B CA  1 
ATOM   3181 C C   . THR B 1 136 ? 36.931  58.557  162.518 1.00 115.56 ? 219 THR B C   1 
ATOM   3182 O O   . THR B 1 136 ? 36.281  57.732  163.165 1.00 130.26 ? 219 THR B O   1 
ATOM   3183 C CB  . THR B 1 136 ? 39.249  57.854  162.808 1.00 120.64 ? 219 THR B CB  1 
ATOM   3184 O OG1 . THR B 1 136 ? 39.574  59.094  163.457 1.00 118.74 ? 219 THR B OG1 1 
ATOM   3185 C CG2 . THR B 1 136 ? 40.524  57.270  162.172 1.00 122.93 ? 219 THR B CG2 1 
ATOM   3186 N N   . GLN B 1 137 ? 36.627  59.855  162.447 1.00 113.77 ? 220 GLN B N   1 
ATOM   3187 C CA  . GLN B 1 137 ? 35.663  60.540  163.305 1.00 111.42 ? 220 GLN B CA  1 
ATOM   3188 C C   . GLN B 1 137 ? 34.692  61.358  162.435 1.00 109.51 ? 220 GLN B C   1 
ATOM   3189 O O   . GLN B 1 137 ? 35.121  62.226  161.689 1.00 108.54 ? 220 GLN B O   1 
ATOM   3190 C CB  . GLN B 1 137 ? 36.433  61.461  164.248 1.00 114.92 ? 220 GLN B CB  1 
ATOM   3191 C CG  . GLN B 1 137 ? 35.673  62.634  164.849 1.00 116.71 ? 220 GLN B CG  1 
ATOM   3192 C CD  . GLN B 1 137 ? 34.948  62.324  166.120 1.00 124.35 ? 220 GLN B CD  1 
ATOM   3193 O OE1 . GLN B 1 137 ? 34.812  61.164  166.524 1.00 139.95 ? 220 GLN B OE1 1 
ATOM   3194 N NE2 . GLN B 1 137 ? 34.452  63.374  166.768 1.00 128.05 ? 220 GLN B NE2 1 
ATOM   3195 N N   . LEU B 1 138 ? 33.395  61.072  162.540 1.00 106.81 ? 221 LEU B N   1 
ATOM   3196 C CA  . LEU B 1 138 ? 32.368  61.736  161.753 1.00 102.15 ? 221 LEU B CA  1 
ATOM   3197 C C   . LEU B 1 138 ? 31.637  62.785  162.540 1.00 103.89 ? 221 LEU B C   1 
ATOM   3198 O O   . LEU B 1 138 ? 31.627  62.791  163.779 1.00 99.14  ? 221 LEU B O   1 
ATOM   3199 C CB  . LEU B 1 138 ? 31.331  60.752  161.246 1.00 100.14 ? 221 LEU B CB  1 
ATOM   3200 C CG  . LEU B 1 138 ? 31.853  59.773  160.219 1.00 102.00 ? 221 LEU B CG  1 
ATOM   3201 C CD1 . LEU B 1 138 ? 30.768  58.760  159.906 1.00 102.86 ? 221 LEU B CD1 1 
ATOM   3202 C CD2 . LEU B 1 138 ? 32.310  60.476  158.957 1.00 103.36 ? 221 LEU B CD2 1 
ATOM   3203 N N   . ARG B 1 139 ? 31.040  63.698  161.784 1.00 106.17 ? 222 ARG B N   1 
ATOM   3204 C CA  . ARG B 1 139 ? 30.206  64.707  162.329 1.00 108.44 ? 222 ARG B CA  1 
ATOM   3205 C C   . ARG B 1 139 ? 29.121  65.054  161.355 1.00 100.76 ? 222 ARG B C   1 
ATOM   3206 O O   . ARG B 1 139 ? 29.376  65.108  160.151 1.00 96.57  ? 222 ARG B O   1 
ATOM   3207 C CB  . ARG B 1 139 ? 31.101  65.904  162.547 1.00 121.71 ? 222 ARG B CB  1 
ATOM   3208 C CG  . ARG B 1 139 ? 30.597  66.929  163.519 1.00 142.01 ? 222 ARG B CG  1 
ATOM   3209 C CD  . ARG B 1 139 ? 31.721  67.822  164.065 1.00 162.11 ? 222 ARG B CD  1 
ATOM   3210 N NE  . ARG B 1 139 ? 31.511  68.049  165.509 1.00 178.01 ? 222 ARG B NE  1 
ATOM   3211 C CZ  . ARG B 1 139 ? 32.024  69.028  166.256 1.00 182.03 ? 222 ARG B CZ  1 
ATOM   3212 N NH1 . ARG B 1 139 ? 31.709  69.066  167.558 1.00 169.45 ? 222 ARG B NH1 1 
ATOM   3213 N NH2 . ARG B 1 139 ? 32.825  69.966  165.745 1.00 187.39 ? 222 ARG B NH2 1 
ATOM   3214 N N   . LEU B 1 140 ? 27.918  65.282  161.875 1.00 97.12  ? 223 LEU B N   1 
ATOM   3215 C CA  . LEU B 1 140 ? 26.823  65.842  161.088 1.00 101.18 ? 223 LEU B CA  1 
ATOM   3216 C C   . LEU B 1 140 ? 27.246  67.226  160.603 1.00 101.85 ? 223 LEU B C   1 
ATOM   3217 O O   . LEU B 1 140 ? 27.544  68.122  161.389 1.00 99.26  ? 223 LEU B O   1 
ATOM   3218 C CB  . LEU B 1 140 ? 25.541  65.938  161.911 1.00 98.59  ? 223 LEU B CB  1 
ATOM   3219 C CG  . LEU B 1 140 ? 24.301  66.548  161.245 1.00 97.86  ? 223 LEU B CG  1 
ATOM   3220 C CD1 . LEU B 1 140 ? 23.957  65.863  159.935 1.00 95.67  ? 223 LEU B CD1 1 
ATOM   3221 C CD2 . LEU B 1 140 ? 23.129  66.456  162.212 1.00 96.72  ? 223 LEU B CD2 1 
ATOM   3222 N N   . GLU B 1 141 ? 27.267  67.372  159.293 1.00 104.59 ? 224 GLU B N   1 
ATOM   3223 C CA  . GLU B 1 141 ? 27.893  68.511  158.628 1.00 110.24 ? 224 GLU B CA  1 
ATOM   3224 C C   . GLU B 1 141 ? 27.253  69.826  158.992 1.00 108.49 ? 224 GLU B C   1 
ATOM   3225 O O   . GLU B 1 141 ? 27.920  70.827  159.164 1.00 112.25 ? 224 GLU B O   1 
ATOM   3226 C CB  . GLU B 1 141 ? 27.764  68.305  157.122 1.00 115.30 ? 224 GLU B CB  1 
ATOM   3227 C CG  . GLU B 1 141 ? 28.485  69.304  156.254 1.00 124.14 ? 224 GLU B CG  1 
ATOM   3228 C CD  . GLU B 1 141 ? 28.212  69.073  154.778 1.00 136.78 ? 224 GLU B CD  1 
ATOM   3229 O OE1 . GLU B 1 141 ? 27.087  68.619  154.430 1.00 137.27 ? 224 GLU B OE1 1 
ATOM   3230 O OE2 . GLU B 1 141 ? 29.122  69.360  153.959 1.00 146.80 ? 224 GLU B OE2 1 
ATOM   3231 N N   . SER B 1 142 ? 25.938  69.794  159.093 1.00 108.63 ? 225 SER B N   1 
ATOM   3232 C CA  . SER B 1 142 ? 25.142  70.978  159.067 1.00 110.71 ? 225 SER B CA  1 
ATOM   3233 C C   . SER B 1 142 ? 23.783  70.705  159.701 1.00 109.44 ? 225 SER B C   1 
ATOM   3234 O O   . SER B 1 142 ? 23.220  69.628  159.532 1.00 106.39 ? 225 SER B O   1 
ATOM   3235 C CB  . SER B 1 142 ? 24.955  71.377  157.601 1.00 115.44 ? 225 SER B CB  1 
ATOM   3236 O OG  . SER B 1 142 ? 24.173  72.550  157.490 1.00 122.57 ? 225 SER B OG  1 
ATOM   3237 N N   . LEU B 1 143 ? 23.257  71.696  160.400 1.00 110.95 ? 226 LEU B N   1 
ATOM   3238 C CA  . LEU B 1 143 ? 21.876  71.683  160.840 1.00 113.74 ? 226 LEU B CA  1 
ATOM   3239 C C   . LEU B 1 143 ? 20.987  72.603  160.007 1.00 114.00 ? 226 LEU B C   1 
ATOM   3240 O O   . LEU B 1 143 ? 19.822  72.688  160.318 1.00 103.25 ? 226 LEU B O   1 
ATOM   3241 C CB  . LEU B 1 143 ? 21.810  72.082  162.319 1.00 115.80 ? 226 LEU B CB  1 
ATOM   3242 C CG  . LEU B 1 143 ? 22.593  71.174  163.281 1.00 116.89 ? 226 LEU B CG  1 
ATOM   3243 C CD1 . LEU B 1 143 ? 22.596  71.741  164.697 1.00 114.12 ? 226 LEU B CD1 1 
ATOM   3244 C CD2 . LEU B 1 143 ? 22.013  69.759  163.282 1.00 117.49 ? 226 LEU B CD2 1 
ATOM   3245 N N   . GLU B 1 144 ? 21.522  73.261  158.959 1.00 127.74 ? 227 GLU B N   1 
ATOM   3246 C CA  . GLU B 1 144 ? 20.842  74.374  158.250 1.00 140.59 ? 227 GLU B CA  1 
ATOM   3247 C C   . GLU B 1 144 ? 19.364  74.094  157.991 1.00 146.49 ? 227 GLU B C   1 
ATOM   3248 O O   . GLU B 1 144 ? 18.553  75.018  158.111 1.00 157.06 ? 227 GLU B O   1 
ATOM   3249 C CB  . GLU B 1 144 ? 21.469  74.720  156.876 1.00 153.84 ? 227 GLU B CB  1 
ATOM   3250 C CG  . GLU B 1 144 ? 22.899  75.289  156.774 1.00 163.14 ? 227 GLU B CG  1 
ATOM   3251 C CD  . GLU B 1 144 ? 23.350  76.188  157.913 1.00 164.91 ? 227 GLU B CD  1 
ATOM   3252 O OE1 . GLU B 1 144 ? 22.824  77.316  158.032 1.00 177.97 ? 227 GLU B OE1 1 
ATOM   3253 O OE2 . GLU B 1 144 ? 24.271  75.783  158.651 1.00 146.68 ? 227 GLU B OE2 1 
ATOM   3254 N N   . ASP B 1 145 ? 19.004  72.855  157.630 1.00 140.00 ? 228 ASP B N   1 
ATOM   3255 C CA  . ASP B 1 145 ? 17.575  72.522  157.423 1.00 139.83 ? 228 ASP B CA  1 
ATOM   3256 C C   . ASP B 1 145 ? 17.140  71.218  158.102 1.00 126.88 ? 228 ASP B C   1 
ATOM   3257 O O   . ASP B 1 145 ? 16.878  70.192  157.486 1.00 118.32 ? 228 ASP B O   1 
ATOM   3258 C CB  . ASP B 1 145 ? 17.205  72.599  155.935 1.00 145.71 ? 228 ASP B CB  1 
ATOM   3259 C CG  . ASP B 1 145 ? 16.830  74.024  155.495 1.00 147.43 ? 228 ASP B CG  1 
ATOM   3260 O OD1 . ASP B 1 145 ? 15.814  74.562  155.994 1.00 148.18 ? 228 ASP B OD1 1 
ATOM   3261 O OD2 . ASP B 1 145 ? 17.554  74.607  154.656 1.00 148.06 ? 228 ASP B OD2 1 
ATOM   3262 N N   . THR B 1 146 ? 17.087  71.328  159.420 1.00 117.91 ? 229 THR B N   1 
ATOM   3263 C CA  . THR B 1 146 ? 16.506  70.358  160.306 1.00 107.68 ? 229 THR B CA  1 
ATOM   3264 C C   . THR B 1 146 ? 15.260  71.038  160.845 1.00 106.02 ? 229 THR B C   1 
ATOM   3265 O O   . THR B 1 146 ? 14.936  72.141  160.397 1.00 118.11 ? 229 THR B O   1 
ATOM   3266 C CB  . THR B 1 146 ? 17.502  70.004  161.431 1.00 105.87 ? 229 THR B CB  1 
ATOM   3267 O OG1 . THR B 1 146 ? 17.929  71.197  162.090 1.00 103.71 ? 229 THR B OG1 1 
ATOM   3268 C CG2 . THR B 1 146 ? 18.724  69.302  160.868 1.00 104.18 ? 229 THR B CG2 1 
ATOM   3269 N N   . HIS B 1 147 ? 14.569  70.388  161.790 1.00 101.58 ? 230 HIS B N   1 
ATOM   3270 C CA  . HIS B 1 147 ? 13.249  70.793  162.283 1.00 102.03 ? 230 HIS B CA  1 
ATOM   3271 C C   . HIS B 1 147 ? 13.228  70.850  163.803 1.00 103.23 ? 230 HIS B C   1 
ATOM   3272 O O   . HIS B 1 147 ? 13.340  69.816  164.468 1.00 104.66 ? 230 HIS B O   1 
ATOM   3273 C CB  . HIS B 1 147 ? 12.178  69.801  161.802 1.00 101.44 ? 230 HIS B CB  1 
ATOM   3274 C CG  . HIS B 1 147 ? 12.083  69.690  160.312 1.00 104.82 ? 230 HIS B CG  1 
ATOM   3275 N ND1 . HIS B 1 147 ? 11.371  70.584  159.541 1.00 111.79 ? 230 HIS B ND1 1 
ATOM   3276 C CD2 . HIS B 1 147 ? 12.623  68.799  159.447 1.00 107.52 ? 230 HIS B CD2 1 
ATOM   3277 C CE1 . HIS B 1 147 ? 11.475  70.246  158.268 1.00 113.75 ? 230 HIS B CE1 1 
ATOM   3278 N NE2 . HIS B 1 147 ? 12.225  69.164  158.183 1.00 110.11 ? 230 HIS B NE2 1 
ATOM   3279 N N   . ILE B 1 148 ? 13.069  72.047  164.358 1.00 109.24 ? 231 ILE B N   1 
ATOM   3280 C CA  . ILE B 1 148 ? 13.095  72.187  165.814 1.00 114.80 ? 231 ILE B CA  1 
ATOM   3281 C C   . ILE B 1 148 ? 11.679  71.927  166.382 1.00 119.58 ? 231 ILE B C   1 
ATOM   3282 O O   . ILE B 1 148 ? 10.720  72.630  166.077 1.00 128.41 ? 231 ILE B O   1 
ATOM   3283 C CB  . ILE B 1 148 ? 13.962  73.375  166.391 1.00 116.70 ? 231 ILE B CB  1 
ATOM   3284 C CG1 . ILE B 1 148 ? 13.373  73.907  167.747 1.00 121.63 ? 231 ILE B CG1 1 
ATOM   3285 C CG2 . ILE B 1 148 ? 14.345  74.437  165.357 1.00 114.05 ? 231 ILE B CG2 1 
ATOM   3286 C CD1 . ILE B 1 148 ? 13.735  73.017  168.934 1.00 124.12 ? 231 ILE B CD1 1 
ATOM   3287 N N   . MET B 1 149 ? 11.572  70.856  167.173 1.00 123.07 ? 232 MET B N   1 
ATOM   3288 C CA  . MET B 1 149 ? 10.309  70.379  167.744 1.00 122.92 ? 232 MET B CA  1 
ATOM   3289 C C   . MET B 1 149 ? 10.116  70.910  169.146 1.00 128.79 ? 232 MET B C   1 
ATOM   3290 O O   . MET B 1 149 ? 11.020  71.497  169.730 1.00 128.09 ? 232 MET B O   1 
ATOM   3291 C CB  . MET B 1 149 ? 10.266  68.842  167.744 1.00 121.03 ? 232 MET B CB  1 
ATOM   3292 C CG  . MET B 1 149 ? 9.552   68.235  166.560 1.00 126.07 ? 232 MET B CG  1 
ATOM   3293 S SD  . MET B 1 149 ? 9.531   69.256  165.085 1.00 134.69 ? 232 MET B SD  1 
ATOM   3294 C CE  . MET B 1 149 ? 9.094   68.040  163.841 1.00 138.22 ? 232 MET B CE  1 
ATOM   3295 N N   . LYS B 1 150 ? 8.911   70.689  169.659 1.00 139.19 ? 233 LYS B N   1 
ATOM   3296 C CA  . LYS B 1 150 ? 8.458   71.203  170.954 1.00 145.33 ? 233 LYS B CA  1 
ATOM   3297 C C   . LYS B 1 150 ? 8.170   69.972  171.821 1.00 146.48 ? 233 LYS B C   1 
ATOM   3298 O O   . LYS B 1 150 ? 7.137   69.293  171.664 1.00 146.94 ? 233 LYS B O   1 
ATOM   3299 C CB  . LYS B 1 150 ? 7.235   72.147  170.820 1.00 149.44 ? 233 LYS B CB  1 
ATOM   3300 C CG  . LYS B 1 150 ? 6.965   72.590  169.369 1.00 152.91 ? 233 LYS B CG  1 
ATOM   3301 C CD  . LYS B 1 150 ? 6.125   71.583  168.599 1.00 156.78 ? 233 LYS B CD  1 
ATOM   3302 C CE  . LYS B 1 150 ? 6.547   71.529  167.133 1.00 156.90 ? 233 LYS B CE  1 
ATOM   3303 N NZ  . LYS B 1 150 ? 6.337   70.185  166.544 1.00 151.78 ? 233 LYS B NZ  1 
ATOM   3304 N N   . GLY B 1 151 ? 9.141   69.670  172.688 1.00 146.67 ? 234 GLY B N   1 
ATOM   3305 C CA  . GLY B 1 151 ? 9.049   68.610  173.687 1.00 144.72 ? 234 GLY B CA  1 
ATOM   3306 C C   . GLY B 1 151 ? 9.172   67.216  173.109 1.00 140.30 ? 234 GLY B C   1 
ATOM   3307 O O   . GLY B 1 151 ? 10.216  66.846  172.568 1.00 130.00 ? 234 GLY B O   1 
ATOM   3308 N N   . GLU B 1 152 ? 8.082   66.462  173.215 1.00 143.39 ? 235 GLU B N   1 
ATOM   3309 C CA  . GLU B 1 152 ? 8.017   65.069  172.766 1.00 142.22 ? 235 GLU B CA  1 
ATOM   3310 C C   . GLU B 1 152 ? 7.404   64.932  171.359 1.00 140.17 ? 235 GLU B C   1 
ATOM   3311 O O   . GLU B 1 152 ? 7.498   63.867  170.752 1.00 134.35 ? 235 GLU B O   1 
ATOM   3312 C CB  . GLU B 1 152 ? 7.236   64.219  173.778 1.00 146.48 ? 235 GLU B CB  1 
ATOM   3313 C CG  . GLU B 1 152 ? 5.904   64.821  174.229 1.00 154.07 ? 235 GLU B CG  1 
ATOM   3314 C CD  . GLU B 1 152 ? 4.960   63.822  174.879 1.00 160.71 ? 235 GLU B CD  1 
ATOM   3315 O OE1 . GLU B 1 152 ? 4.965   62.627  174.510 1.00 157.55 ? 235 GLU B OE1 1 
ATOM   3316 O OE2 . GLU B 1 152 ? 4.191   64.249  175.764 1.00 169.45 ? 235 GLU B OE2 1 
ATOM   3317 N N   . ASP B 1 153 ? 6.792   66.003  170.842 1.00 141.37 ? 236 ASP B N   1 
ATOM   3318 C CA  . ASP B 1 153 ? 6.194   65.990  169.504 1.00 140.53 ? 236 ASP B CA  1 
ATOM   3319 C C   . ASP B 1 153 ? 7.253   65.836  168.400 1.00 134.09 ? 236 ASP B C   1 
ATOM   3320 O O   . ASP B 1 153 ? 8.385   66.291  168.549 1.00 139.30 ? 236 ASP B O   1 
ATOM   3321 C CB  . ASP B 1 153 ? 5.388   67.267  169.281 1.00 145.11 ? 236 ASP B CB  1 
ATOM   3322 C CG  . ASP B 1 153 ? 4.714   67.288  167.935 1.00 152.35 ? 236 ASP B CG  1 
ATOM   3323 O OD1 . ASP B 1 153 ? 3.735   66.539  167.726 1.00 153.08 ? 236 ASP B OD1 1 
ATOM   3324 O OD2 . ASP B 1 153 ? 5.192   68.040  167.066 1.00 167.58 ? 236 ASP B OD2 1 
ATOM   3325 N N   . ASP B 1 154 ? 6.892   65.148  167.319 1.00 126.89 ? 237 ASP B N   1 
ATOM   3326 C CA  . ASP B 1 154 ? 7.784   64.985  166.159 1.00 118.28 ? 237 ASP B CA  1 
ATOM   3327 C C   . ASP B 1 154 ? 7.061   64.856  164.807 1.00 115.57 ? 237 ASP B C   1 
ATOM   3328 O O   . ASP B 1 154 ? 7.662   64.433  163.818 1.00 110.45 ? 237 ASP B O   1 
ATOM   3329 C CB  . ASP B 1 154 ? 8.712   63.780  166.386 1.00 114.69 ? 237 ASP B CB  1 
ATOM   3330 C CG  . ASP B 1 154 ? 8.070   62.430  165.999 1.00 112.95 ? 237 ASP B CG  1 
ATOM   3331 O OD1 . ASP B 1 154 ? 6.866   62.191  166.262 1.00 108.39 ? 237 ASP B OD1 1 
ATOM   3332 O OD2 . ASP B 1 154 ? 8.798   61.591  165.434 1.00 108.81 ? 237 ASP B OD2 1 
ATOM   3333 N N   . ALA B 1 155 ? 5.787   65.240  164.756 1.00 119.76 ? 238 ALA B N   1 
ATOM   3334 C CA  . ALA B 1 155 ? 4.978   65.049  163.555 1.00 121.67 ? 238 ALA B CA  1 
ATOM   3335 C C   . ALA B 1 155 ? 5.340   66.162  162.596 1.00 120.26 ? 238 ALA B C   1 
ATOM   3336 O O   . ALA B 1 155 ? 5.466   67.307  163.001 1.00 116.86 ? 238 ALA B O   1 
ATOM   3337 C CB  . ALA B 1 155 ? 3.496   65.082  163.886 1.00 122.38 ? 238 ALA B CB  1 
ATOM   3338 N N   . LEU B 1 156 ? 5.559   65.823  161.337 1.00 118.96 ? 239 LEU B N   1 
ATOM   3339 C CA  . LEU B 1 156 ? 5.830   66.834  160.349 1.00 120.98 ? 239 LEU B CA  1 
ATOM   3340 C C   . LEU B 1 156 ? 5.322   66.375  158.987 1.00 125.92 ? 239 LEU B C   1 
ATOM   3341 O O   . LEU B 1 156 ? 5.114   65.187  158.782 1.00 120.75 ? 239 LEU B O   1 
ATOM   3342 C CB  . LEU B 1 156 ? 7.312   67.188  160.368 1.00 115.60 ? 239 LEU B CB  1 
ATOM   3343 C CG  . LEU B 1 156 ? 8.339   66.131  159.989 1.00 116.60 ? 239 LEU B CG  1 
ATOM   3344 C CD1 . LEU B 1 156 ? 8.734   66.264  158.533 1.00 121.60 ? 239 LEU B CD1 1 
ATOM   3345 C CD2 . LEU B 1 156 ? 9.605   66.268  160.816 1.00 117.44 ? 239 LEU B CD2 1 
ATOM   3346 N N   . SER B 1 157 ? 5.047   67.341  158.103 1.00 133.71 ? 240 SER B N   1 
ATOM   3347 C CA  . SER B 1 157 ? 4.474   67.079  156.763 1.00 133.59 ? 240 SER B CA  1 
ATOM   3348 C C   . SER B 1 157 ? 5.252   67.642  155.566 1.00 133.91 ? 240 SER B C   1 
ATOM   3349 O O   . SER B 1 157 ? 4.837   67.432  154.425 1.00 131.59 ? 240 SER B O   1 
ATOM   3350 C CB  . SER B 1 157 ? 3.018   67.549  156.719 1.00 135.16 ? 240 SER B CB  1 
ATOM   3351 O OG  . SER B 1 157 ? 2.745   68.444  157.781 1.00 135.66 ? 240 SER B OG  1 
ATOM   3352 N N   . ASP B 1 158 ? 6.366   68.334  155.823 1.00 135.65 ? 241 ASP B N   1 
ATOM   3353 C CA  . ASP B 1 158 ? 7.253   68.818  154.779 1.00 141.61 ? 241 ASP B CA  1 
ATOM   3354 C C   . ASP B 1 158 ? 8.090   67.659  154.248 1.00 136.80 ? 241 ASP B C   1 
ATOM   3355 O O   . ASP B 1 158 ? 9.061   67.255  154.881 1.00 135.75 ? 241 ASP B O   1 
ATOM   3356 C CB  . ASP B 1 158 ? 8.213   69.908  155.279 1.00 145.57 ? 241 ASP B CB  1 
ATOM   3357 C CG  . ASP B 1 158 ? 7.542   71.260  155.554 1.00 155.23 ? 241 ASP B CG  1 
ATOM   3358 O OD1 . ASP B 1 158 ? 6.372   71.539  155.180 1.00 156.16 ? 241 ASP B OD1 1 
ATOM   3359 O OD2 . ASP B 1 158 ? 8.249   72.083  156.160 1.00 162.45 ? 241 ASP B OD2 1 
ATOM   3360 N N   . LYS B 1 159 ? 7.738   67.195  153.054 1.00 134.37 ? 242 LYS B N   1 
ATOM   3361 C CA  . LYS B 1 159 ? 8.296   65.998  152.416 1.00 131.50 ? 242 LYS B CA  1 
ATOM   3362 C C   . LYS B 1 159 ? 9.404   66.408  151.444 1.00 132.12 ? 242 LYS B C   1 
ATOM   3363 O O   . LYS B 1 159 ? 9.160   66.595  150.258 1.00 139.58 ? 242 LYS B O   1 
ATOM   3364 C CB  . LYS B 1 159 ? 7.132   65.283  151.729 1.00 129.69 ? 242 LYS B CB  1 
ATOM   3365 C CG  . LYS B 1 159 ? 6.219   64.612  152.740 1.00 125.41 ? 242 LYS B CG  1 
ATOM   3366 C CD  . LYS B 1 159 ? 5.077   63.838  152.125 1.00 124.60 ? 242 LYS B CD  1 
ATOM   3367 C CE  . LYS B 1 159 ? 4.374   63.071  153.233 1.00 126.10 ? 242 LYS B CE  1 
ATOM   3368 N NZ  . LYS B 1 159 ? 3.073   62.486  152.823 1.00 132.37 ? 242 LYS B NZ  1 
ATOM   3369 N N   . HIS B 1 160 ? 10.620  66.545  151.974 1.00 128.41 ? 243 HIS B N   1 
ATOM   3370 C CA  . HIS B 1 160 ? 11.796  66.940  151.211 1.00 130.95 ? 243 HIS B CA  1 
ATOM   3371 C C   . HIS B 1 160 ? 12.998  66.090  151.636 1.00 128.85 ? 243 HIS B C   1 
ATOM   3372 O O   . HIS B 1 160 ? 13.202  65.851  152.830 1.00 124.39 ? 243 HIS B O   1 
ATOM   3373 C CB  . HIS B 1 160 ? 12.071  68.407  151.474 1.00 137.29 ? 243 HIS B CB  1 
ATOM   3374 C CG  . HIS B 1 160 ? 13.185  68.974  150.657 1.00 148.74 ? 243 HIS B CG  1 
ATOM   3375 N ND1 . HIS B 1 160 ? 14.460  69.145  151.152 1.00 152.26 ? 243 HIS B ND1 1 
ATOM   3376 C CD2 . HIS B 1 160 ? 13.211  69.426  149.381 1.00 155.83 ? 243 HIS B CD2 1 
ATOM   3377 C CE1 . HIS B 1 160 ? 15.227  69.670  150.213 1.00 155.24 ? 243 HIS B CE1 1 
ATOM   3378 N NE2 . HIS B 1 160 ? 14.493  69.850  149.129 1.00 157.86 ? 243 HIS B NE2 1 
ATOM   3379 N N   . GLY B 1 161 ? 13.773  65.623  150.654 1.00 129.59 ? 244 GLY B N   1 
ATOM   3380 C CA  . GLY B 1 161 ? 14.932  64.739  150.895 1.00 121.55 ? 244 GLY B CA  1 
ATOM   3381 C C   . GLY B 1 161 ? 15.439  64.027  149.648 1.00 119.94 ? 244 GLY B C   1 
ATOM   3382 O O   . GLY B 1 161 ? 14.820  64.106  148.586 1.00 125.25 ? 244 GLY B O   1 
ATOM   3383 N N   . CYS B 1 162 ? 16.553  63.316  149.786 1.00 115.66 ? 245 CYS B N   1 
ATOM   3384 C CA  . CYS B 1 162 ? 17.147  62.533  148.692 1.00 116.54 ? 245 CYS B CA  1 
ATOM   3385 C C   . CYS B 1 162 ? 16.403  61.188  148.544 1.00 112.69 ? 245 CYS B C   1 
ATOM   3386 O O   . CYS B 1 162 ? 16.265  60.476  149.533 1.00 109.10 ? 245 CYS B O   1 
ATOM   3387 C CB  . CYS B 1 162 ? 18.636  62.298  148.984 1.00 117.64 ? 245 CYS B CB  1 
ATOM   3388 S SG  . CYS B 1 162 ? 19.452  61.043  147.973 1.00 124.14 ? 245 CYS B SG  1 
ATOM   3389 N N   . PRO B 1 163 ? 15.935  60.832  147.320 1.00 113.13 ? 246 PRO B N   1 
ATOM   3390 C CA  . PRO B 1 163 ? 15.014  59.692  147.115 1.00 114.04 ? 246 PRO B CA  1 
ATOM   3391 C C   . PRO B 1 163 ? 15.434  58.358  147.698 1.00 115.78 ? 246 PRO B C   1 
ATOM   3392 O O   . PRO B 1 163 ? 14.605  57.685  148.297 1.00 122.22 ? 246 PRO B O   1 
ATOM   3393 C CB  . PRO B 1 163 ? 14.930  59.575  145.602 1.00 115.96 ? 246 PRO B CB  1 
ATOM   3394 C CG  . PRO B 1 163 ? 15.102  60.969  145.146 1.00 119.78 ? 246 PRO B CG  1 
ATOM   3395 C CD  . PRO B 1 163 ? 16.147  61.553  146.055 1.00 117.24 ? 246 PRO B CD  1 
ATOM   3396 N N   . ALA B 1 164 ? 16.700  57.973  147.571 1.00 115.75 ? 247 ALA B N   1 
ATOM   3397 C CA  . ALA B 1 164 ? 17.141  56.689  148.141 1.00 113.41 ? 247 ALA B CA  1 
ATOM   3398 C C   . ALA B 1 164 ? 16.892  56.572  149.640 1.00 109.49 ? 247 ALA B C   1 
ATOM   3399 O O   . ALA B 1 164 ? 16.657  55.483  150.130 1.00 112.91 ? 247 ALA B O   1 
ATOM   3400 C CB  . ALA B 1 164 ? 18.602  56.427  147.851 1.00 114.44 ? 247 ALA B CB  1 
ATOM   3401 N N   . TYR B 1 165 ? 16.889  57.686  150.358 1.00 105.22 ? 248 TYR B N   1 
ATOM   3402 C CA  . TYR B 1 165 ? 16.668  57.649  151.798 1.00 100.20 ? 248 TYR B CA  1 
ATOM   3403 C C   . TYR B 1 165 ? 15.215  57.853  152.275 1.00 101.17 ? 248 TYR B C   1 
ATOM   3404 O O   . TYR B 1 165 ? 14.956  57.827  153.476 1.00 98.81  ? 248 TYR B O   1 
ATOM   3405 C CB  . TYR B 1 165 ? 17.583  58.670  152.448 1.00 98.35  ? 248 TYR B CB  1 
ATOM   3406 C CG  . TYR B 1 165 ? 19.031  58.409  152.155 1.00 101.17 ? 248 TYR B CG  1 
ATOM   3407 C CD1 . TYR B 1 165 ? 19.776  57.560  152.962 1.00 104.10 ? 248 TYR B CD1 1 
ATOM   3408 C CD2 . TYR B 1 165 ? 19.657  58.984  151.063 1.00 105.32 ? 248 TYR B CD2 1 
ATOM   3409 C CE1 . TYR B 1 165 ? 21.117  57.311  152.707 1.00 102.47 ? 248 TYR B CE1 1 
ATOM   3410 C CE2 . TYR B 1 165 ? 20.995  58.737  150.794 1.00 106.50 ? 248 TYR B CE2 1 
ATOM   3411 C CZ  . TYR B 1 165 ? 21.723  57.893  151.622 1.00 103.40 ? 248 TYR B CZ  1 
ATOM   3412 O OH  . TYR B 1 165 ? 23.055  57.630  151.397 1.00 101.45 ? 248 TYR B OH  1 
ATOM   3413 N N   . VAL B 1 166 ? 14.258  58.018  151.365 1.00 104.81 ? 249 VAL B N   1 
ATOM   3414 C CA  . VAL B 1 166 ? 12.887  58.326  151.777 1.00 104.69 ? 249 VAL B CA  1 
ATOM   3415 C C   . VAL B 1 166 ? 12.159  57.067  152.221 1.00 100.92 ? 249 VAL B C   1 
ATOM   3416 O O   . VAL B 1 166 ? 12.207  56.052  151.530 1.00 101.45 ? 249 VAL B O   1 
ATOM   3417 C CB  . VAL B 1 166 ? 12.090  59.035  150.659 1.00 110.80 ? 249 VAL B CB  1 
ATOM   3418 C CG1 . VAL B 1 166 ? 10.644  59.279  151.088 1.00 109.50 ? 249 VAL B CG1 1 
ATOM   3419 C CG2 . VAL B 1 166 ? 12.756  60.365  150.302 1.00 110.92 ? 249 VAL B CG2 1 
ATOM   3420 N N   . SER B 1 167 ? 11.452  57.174  153.348 1.00 97.60  ? 250 SER B N   1 
ATOM   3421 C CA  . SER B 1 167 ? 10.699  56.058  153.933 1.00 97.03  ? 250 SER B CA  1 
ATOM   3422 C C   . SER B 1 167 ? 9.351   55.841  153.237 1.00 97.98  ? 250 SER B C   1 
ATOM   3423 O O   . SER B 1 167 ? 8.840   56.765  152.617 1.00 103.04 ? 250 SER B O   1 
ATOM   3424 C CB  . SER B 1 167 ? 10.502  56.307  155.426 1.00 95.64  ? 250 SER B CB  1 
ATOM   3425 O OG  . SER B 1 167 ? 9.614   57.382  155.663 1.00 97.41  ? 250 SER B OG  1 
ATOM   3426 N N   . PRO B 1 168 ? 8.766   54.622  153.331 1.00 99.67  ? 251 PRO B N   1 
ATOM   3427 C CA  . PRO B 1 168 ? 7.500   54.337  152.613 1.00 101.20 ? 251 PRO B CA  1 
ATOM   3428 C C   . PRO B 1 168 ? 6.364   55.221  153.071 1.00 102.70 ? 251 PRO B C   1 
ATOM   3429 O O   . PRO B 1 168 ? 5.615   55.736  152.243 1.00 107.50 ? 251 PRO B O   1 
ATOM   3430 C CB  . PRO B 1 168 ? 7.186   52.883  152.974 1.00 100.46 ? 251 PRO B CB  1 
ATOM   3431 C CG  . PRO B 1 168 ? 8.443   52.340  153.555 1.00 100.82 ? 251 PRO B CG  1 
ATOM   3432 C CD  . PRO B 1 168 ? 9.144   53.494  154.195 1.00 98.72  ? 251 PRO B CD  1 
ATOM   3433 N N   . GLU B 1 169 ? 6.276   55.440  154.380 1.00 102.85 ? 252 GLU B N   1 
ATOM   3434 C CA  . GLU B 1 169 ? 5.197   56.233  154.953 1.00 106.70 ? 252 GLU B CA  1 
ATOM   3435 C C   . GLU B 1 169 ? 5.143   57.666  154.427 1.00 109.94 ? 252 GLU B C   1 
ATOM   3436 O O   . GLU B 1 169 ? 4.076   58.247  154.364 1.00 118.59 ? 252 GLU B O   1 
ATOM   3437 C CB  . GLU B 1 169 ? 5.233   56.211  156.492 1.00 105.93 ? 252 GLU B CB  1 
ATOM   3438 C CG  . GLU B 1 169 ? 6.184   57.187  157.190 1.00 104.97 ? 252 GLU B CG  1 
ATOM   3439 C CD  . GLU B 1 169 ? 7.527   56.598  157.590 1.00 101.59 ? 252 GLU B CD  1 
ATOM   3440 O OE1 . GLU B 1 169 ? 8.000   55.646  156.924 1.00 99.03  ? 252 GLU B OE1 1 
ATOM   3441 O OE2 . GLU B 1 169 ? 8.120   57.116  158.572 1.00 97.97  ? 252 GLU B OE2 1 
ATOM   3442 N N   . ILE B 1 170 ? 6.282   58.227  154.032 1.00 111.22 ? 253 ILE B N   1 
ATOM   3443 C CA  . ILE B 1 170 ? 6.302   59.549  153.380 1.00 112.48 ? 253 ILE B CA  1 
ATOM   3444 C C   . ILE B 1 170 ? 5.639   59.479  152.001 1.00 115.99 ? 253 ILE B C   1 
ATOM   3445 O O   . ILE B 1 170 ? 4.978   60.419  151.579 1.00 120.06 ? 253 ILE B O   1 
ATOM   3446 C CB  . ILE B 1 170 ? 7.743   60.115  153.314 1.00 112.09 ? 253 ILE B CB  1 
ATOM   3447 C CG1 . ILE B 1 170 ? 8.166   60.570  154.712 1.00 111.93 ? 253 ILE B CG1 1 
ATOM   3448 C CG2 . ILE B 1 170 ? 7.866   61.279  152.341 1.00 113.11 ? 253 ILE B CG2 1 
ATOM   3449 C CD1 . ILE B 1 170 ? 9.660   60.719  154.910 1.00 107.12 ? 253 ILE B CD1 1 
ATOM   3450 N N   . LEU B 1 171 ? 5.796   58.347  151.324 1.00 117.51 ? 254 LEU B N   1 
ATOM   3451 C CA  . LEU B 1 171 ? 5.259   58.140  149.984 1.00 121.99 ? 254 LEU B CA  1 
ATOM   3452 C C   . LEU B 1 171 ? 3.803   57.691  149.947 1.00 123.77 ? 254 LEU B C   1 
ATOM   3453 O O   . LEU B 1 171 ? 3.118   58.001  148.988 1.00 132.38 ? 254 LEU B O   1 
ATOM   3454 C CB  . LEU B 1 171 ? 6.114   57.118  149.233 1.00 124.02 ? 254 LEU B CB  1 
ATOM   3455 C CG  . LEU B 1 171 ? 7.621   57.409  149.168 1.00 123.72 ? 254 LEU B CG  1 
ATOM   3456 C CD1 . LEU B 1 171 ? 8.389   56.231  148.581 1.00 124.75 ? 254 LEU B CD1 1 
ATOM   3457 C CD2 . LEU B 1 171 ? 7.879   58.677  148.370 1.00 124.73 ? 254 LEU B CD2 1 
ATOM   3458 N N   . ASN B 1 172 ? 3.311   56.992  150.967 1.00 123.80 ? 255 ASN B N   1 
ATOM   3459 C CA  . ASN B 1 172 ? 1.917   56.457  150.902 1.00 128.79 ? 255 ASN B CA  1 
ATOM   3460 C C   . ASN B 1 172 ? 0.914   57.041  151.917 1.00 129.86 ? 255 ASN B C   1 
ATOM   3461 O O   . ASN B 1 172 ? -0.259  56.750  151.819 1.00 132.55 ? 255 ASN B O   1 
ATOM   3462 C CB  . ASN B 1 172 ? 1.872   54.913  150.814 1.00 130.58 ? 255 ASN B CB  1 
ATOM   3463 C CG  . ASN B 1 172 ? 2.855   54.229  151.754 1.00 133.41 ? 255 ASN B CG  1 
ATOM   3464 O OD1 . ASN B 1 172 ? 3.079   54.706  152.858 1.00 132.44 ? 255 ASN B OD1 1 
ATOM   3465 N ND2 . ASN B 1 172 ? 3.420   53.087  151.341 1.00 138.18 ? 255 ASN B ND2 1 
ATOM   3466 N N   . THR B 1 173 ? 1.380   57.874  152.851 1.00 130.69 ? 256 THR B N   1 
ATOM   3467 C CA  . THR B 1 173 ? 0.557   58.622  153.810 1.00 129.18 ? 256 THR B CA  1 
ATOM   3468 C C   . THR B 1 173 ? 0.273   60.009  153.240 1.00 128.09 ? 256 THR B C   1 
ATOM   3469 O O   . THR B 1 173 ? 1.122   60.582  152.566 1.00 126.43 ? 256 THR B O   1 
ATOM   3470 C CB  . THR B 1 173 ? 1.318   58.725  155.192 1.00 128.01 ? 256 THR B CB  1 
ATOM   3471 O OG1 . THR B 1 173 ? 0.536   58.160  156.248 1.00 131.18 ? 256 THR B OG1 1 
ATOM   3472 C CG2 . THR B 1 173 ? 1.775   60.197  155.554 1.00 127.50 ? 256 THR B CG2 1 
ATOM   3473 N N   . THR B 1 174 ? -0.922  60.535  153.495 1.00 129.89 ? 257 THR B N   1 
ATOM   3474 C CA  . THR B 1 174 ? -1.168  61.966  153.386 1.00 133.08 ? 257 THR B CA  1 
ATOM   3475 C C   . THR B 1 174 ? -0.972  62.533  154.780 1.00 131.28 ? 257 THR B C   1 
ATOM   3476 O O   . THR B 1 174 ? -1.034  61.805  155.778 1.00 124.40 ? 257 THR B O   1 
ATOM   3477 C CB  . THR B 1 174 ? -2.597  62.307  152.890 1.00 139.46 ? 257 THR B CB  1 
ATOM   3478 O OG1 . THR B 1 174 ? -3.571  61.642  153.704 1.00 142.03 ? 257 THR B OG1 1 
ATOM   3479 C CG2 . THR B 1 174 ? -2.793  61.896  151.435 1.00 142.96 ? 257 THR B CG2 1 
ATOM   3480 N N   . GLY B 1 175 ? -0.758  63.841  154.839 1.00 135.49 ? 258 GLY B N   1 
ATOM   3481 C CA  . GLY B 1 175 ? -0.633  64.555  156.099 1.00 133.80 ? 258 GLY B CA  1 
ATOM   3482 C C   . GLY B 1 175 ? 0.696   64.297  156.771 1.00 131.10 ? 258 GLY B C   1 
ATOM   3483 O O   . GLY B 1 175 ? 1.739   64.192  156.110 1.00 130.78 ? 258 GLY B O   1 
ATOM   3484 N N   . THR B 1 176 ? 0.648   64.203  158.098 1.00 129.81 ? 259 THR B N   1 
ATOM   3485 C CA  . THR B 1 176 ? 1.852   64.145  158.917 1.00 121.97 ? 259 THR B CA  1 
ATOM   3486 C C   . THR B 1 176 ? 2.445   62.754  158.949 1.00 116.84 ? 259 THR B C   1 
ATOM   3487 O O   . THR B 1 176 ? 1.825   61.781  158.537 1.00 115.32 ? 259 THR B O   1 
ATOM   3488 C CB  . THR B 1 176 ? 1.577   64.613  160.364 1.00 121.89 ? 259 THR B CB  1 
ATOM   3489 O OG1 . THR B 1 176 ? 0.474   63.886  160.908 1.00 123.95 ? 259 THR B OG1 1 
ATOM   3490 C CG2 . THR B 1 176 ? 1.241   66.090  160.396 1.00 124.83 ? 259 THR B CG2 1 
ATOM   3491 N N   . TYR B 1 177 ? 3.674   62.693  159.431 1.00 112.98 ? 260 TYR B N   1 
ATOM   3492 C CA  . TYR B 1 177 ? 4.348   61.444  159.708 1.00 106.47 ? 260 TYR B CA  1 
ATOM   3493 C C   . TYR B 1 177 ? 5.312   61.695  160.831 1.00 105.45 ? 260 TYR B C   1 
ATOM   3494 O O   . TYR B 1 177 ? 5.727   62.838  161.054 1.00 109.10 ? 260 TYR B O   1 
ATOM   3495 C CB  . TYR B 1 177 ? 5.095   60.925  158.474 1.00 104.89 ? 260 TYR B CB  1 
ATOM   3496 C CG  . TYR B 1 177 ? 6.074   61.890  157.837 1.00 105.86 ? 260 TYR B CG  1 
ATOM   3497 C CD1 . TYR B 1 177 ? 5.650   62.808  156.879 1.00 111.86 ? 260 TYR B CD1 1 
ATOM   3498 C CD2 . TYR B 1 177 ? 7.431   61.863  158.158 1.00 105.35 ? 260 TYR B CD2 1 
ATOM   3499 C CE1 . TYR B 1 177 ? 6.529   63.687  156.281 1.00 112.68 ? 260 TYR B CE1 1 
ATOM   3500 C CE2 . TYR B 1 177 ? 8.329   62.732  157.555 1.00 107.64 ? 260 TYR B CE2 1 
ATOM   3501 C CZ  . TYR B 1 177 ? 7.865   63.643  156.622 1.00 113.02 ? 260 TYR B CZ  1 
ATOM   3502 O OH  . TYR B 1 177 ? 8.731   64.515  156.019 1.00 119.01 ? 260 TYR B OH  1 
ATOM   3503 N N   . SER B 1 178 ? 5.687   60.624  161.522 1.00 102.57 ? 261 SER B N   1 
ATOM   3504 C CA  . SER B 1 178 ? 6.709   60.714  162.541 1.00 99.28  ? 261 SER B CA  1 
ATOM   3505 C C   . SER B 1 178 ? 8.062   60.935  161.877 1.00 98.95  ? 261 SER B C   1 
ATOM   3506 O O   . SER B 1 178 ? 8.564   60.071  161.135 1.00 95.77  ? 261 SER B O   1 
ATOM   3507 C CB  . SER B 1 178 ? 6.760   59.457  163.366 1.00 99.30  ? 261 SER B CB  1 
ATOM   3508 O OG  . SER B 1 178 ? 7.909   59.483  164.186 1.00 105.01 ? 261 SER B OG  1 
ATOM   3509 N N   . GLY B 1 179 ? 8.641   62.099  162.159 1.00 97.89  ? 262 GLY B N   1 
ATOM   3510 C CA  . GLY B 1 179 ? 9.921   62.493  161.602 1.00 98.04  ? 262 GLY B CA  1 
ATOM   3511 C C   . GLY B 1 179 ? 11.110  61.754  162.183 1.00 96.22  ? 262 GLY B C   1 
ATOM   3512 O O   . GLY B 1 179 ? 12.135  61.603  161.507 1.00 99.10  ? 262 GLY B O   1 
ATOM   3513 N N   . LYS B 1 180 ? 10.999  61.334  163.442 1.00 93.99  ? 263 LYS B N   1 
ATOM   3514 C CA  . LYS B 1 180 ? 12.037  60.519  164.069 1.00 92.18  ? 263 LYS B CA  1 
ATOM   3515 C C   . LYS B 1 180 ? 12.063  59.124  163.460 1.00 91.20  ? 263 LYS B C   1 
ATOM   3516 O O   . LYS B 1 180 ? 13.141  58.595  163.161 1.00 92.80  ? 263 LYS B O   1 
ATOM   3517 C CB  . LYS B 1 180 ? 11.834  60.420  165.579 1.00 92.22  ? 263 LYS B CB  1 
ATOM   3518 C CG  . LYS B 1 180 ? 12.073  61.722  166.306 1.00 94.59  ? 263 LYS B CG  1 
ATOM   3519 C CD  . LYS B 1 180 ? 11.732  61.608  167.779 1.00 93.64  ? 263 LYS B CD  1 
ATOM   3520 C CE  . LYS B 1 180 ? 12.061  62.896  168.505 1.00 97.97  ? 263 LYS B CE  1 
ATOM   3521 N NZ  . LYS B 1 180 ? 12.390  62.654  169.931 1.00 101.36 ? 263 LYS B NZ  1 
ATOM   3522 N N   . ALA B 1 181 ? 10.888  58.521  163.292 1.00 88.58  ? 264 ALA B N   1 
ATOM   3523 C CA  . ALA B 1 181 ? 10.807  57.200  162.667 1.00 90.38  ? 264 ALA B CA  1 
ATOM   3524 C C   . ALA B 1 181 ? 11.340  57.253  161.246 1.00 90.32  ? 264 ALA B C   1 
ATOM   3525 O O   . ALA B 1 181 ? 11.992  56.320  160.799 1.00 91.11  ? 264 ALA B O   1 
ATOM   3526 C CB  . ALA B 1 181 ? 9.380   56.664  162.681 1.00 91.19  ? 264 ALA B CB  1 
ATOM   3527 N N   . ALA B 1 182 ? 11.063  58.347  160.545 1.00 94.42  ? 265 ALA B N   1 
ATOM   3528 C CA  . ALA B 1 182 ? 11.547  58.523  159.179 1.00 96.23  ? 265 ALA B CA  1 
ATOM   3529 C C   . ALA B 1 182 ? 13.056  58.634  159.154 1.00 94.90  ? 265 ALA B C   1 
ATOM   3530 O O   . ALA B 1 182 ? 13.700  58.064  158.275 1.00 95.50  ? 265 ALA B O   1 
ATOM   3531 C CB  . ALA B 1 182 ? 10.919  59.753  158.543 1.00 100.17 ? 265 ALA B CB  1 
ATOM   3532 N N   . ASP B 1 183 ? 13.600  59.390  160.111 1.00 95.63  ? 266 ASP B N   1 
ATOM   3533 C CA  . ASP B 1 183 ? 15.050  59.507  160.320 1.00 97.02  ? 266 ASP B CA  1 
ATOM   3534 C C   . ASP B 1 183 ? 15.697  58.145  160.529 1.00 94.11  ? 266 ASP B C   1 
ATOM   3535 O O   . ASP B 1 183 ? 16.772  57.887  160.000 1.00 93.34  ? 266 ASP B O   1 
ATOM   3536 C CB  . ASP B 1 183 ? 15.382  60.420  161.524 1.00 97.43  ? 266 ASP B CB  1 
ATOM   3537 C CG  . ASP B 1 183 ? 15.377  61.921  161.172 1.00 104.97 ? 266 ASP B CG  1 
ATOM   3538 O OD1 . ASP B 1 183 ? 15.205  62.321  159.981 1.00 111.60 ? 266 ASP B OD1 1 
ATOM   3539 O OD2 . ASP B 1 183 ? 15.545  62.730  162.118 1.00 108.02 ? 266 ASP B OD2 1 
ATOM   3540 N N   . VAL B 1 184 ? 15.043  57.290  161.307 1.00 94.35  ? 267 VAL B N   1 
ATOM   3541 C CA  . VAL B 1 184 ? 15.551  55.945  161.571 1.00 93.23  ? 267 VAL B CA  1 
ATOM   3542 C C   . VAL B 1 184 ? 15.593  55.080  160.307 1.00 95.24  ? 267 VAL B C   1 
ATOM   3543 O O   . VAL B 1 184 ? 16.557  54.325  160.094 1.00 96.63  ? 267 VAL B O   1 
ATOM   3544 C CB  . VAL B 1 184 ? 14.769  55.271  162.711 1.00 91.08  ? 267 VAL B CB  1 
ATOM   3545 C CG1 . VAL B 1 184 ? 15.060  53.776  162.770 1.00 92.80  ? 267 VAL B CG1 1 
ATOM   3546 C CG2 . VAL B 1 184 ? 15.137  55.939  164.031 1.00 90.18  ? 267 VAL B CG2 1 
ATOM   3547 N N   . TRP B 1 185 ? 14.565  55.186  159.474 1.00 95.11  ? 268 TRP B N   1 
ATOM   3548 C CA  . TRP B 1 185 ? 14.573  54.490  158.179 1.00 95.50  ? 268 TRP B CA  1 
ATOM   3549 C C   . TRP B 1 185 ? 15.801  54.915  157.367 1.00 94.84  ? 268 TRP B C   1 
ATOM   3550 O O   . TRP B 1 185 ? 16.479  54.090  156.776 1.00 95.93  ? 268 TRP B O   1 
ATOM   3551 C CB  . TRP B 1 185 ? 13.268  54.748  157.408 1.00 94.01  ? 268 TRP B CB  1 
ATOM   3552 C CG  . TRP B 1 185 ? 13.287  54.251  156.016 1.00 94.09  ? 268 TRP B CG  1 
ATOM   3553 C CD1 . TRP B 1 185 ? 13.870  54.858  154.940 1.00 97.67  ? 268 TRP B CD1 1 
ATOM   3554 C CD2 . TRP B 1 185 ? 12.685  53.054  155.523 1.00 93.72  ? 268 TRP B CD2 1 
ATOM   3555 N NE1 . TRP B 1 185 ? 13.676  54.106  153.806 1.00 101.46 ? 268 TRP B NE1 1 
ATOM   3556 C CE2 . TRP B 1 185 ? 12.956  52.988  154.139 1.00 97.98  ? 268 TRP B CE2 1 
ATOM   3557 C CE3 . TRP B 1 185 ? 11.934  52.036  156.105 1.00 89.88  ? 268 TRP B CE3 1 
ATOM   3558 C CZ2 . TRP B 1 185 ? 12.500  51.942  153.338 1.00 96.01  ? 268 TRP B CZ2 1 
ATOM   3559 C CZ3 . TRP B 1 185 ? 11.499  50.992  155.307 1.00 90.44  ? 268 TRP B CZ3 1 
ATOM   3560 C CH2 . TRP B 1 185 ? 11.783  50.955  153.944 1.00 93.57  ? 268 TRP B CH2 1 
ATOM   3561 N N   . SER B 1 186 ? 16.084  56.210  157.357 1.00 96.12  ? 269 SER B N   1 
ATOM   3562 C CA  . SER B 1 186 ? 17.249  56.724  156.657 1.00 97.52  ? 269 SER B CA  1 
ATOM   3563 C C   . SER B 1 186 ? 18.545  56.119  157.188 1.00 96.44  ? 269 SER B C   1 
ATOM   3564 O O   . SER B 1 186 ? 19.448  55.834  156.403 1.00 95.46  ? 269 SER B O   1 
ATOM   3565 C CB  . SER B 1 186 ? 17.307  58.253  156.740 1.00 98.66  ? 269 SER B CB  1 
ATOM   3566 O OG  . SER B 1 186 ? 16.280  58.833  155.966 1.00 102.19 ? 269 SER B OG  1 
ATOM   3567 N N   . LEU B 1 187 ? 18.620  55.931  158.509 1.00 92.91  ? 270 LEU B N   1 
ATOM   3568 C CA  . LEU B 1 187 ? 19.758  55.267  159.137 1.00 90.38  ? 270 LEU B CA  1 
ATOM   3569 C C   . LEU B 1 187 ? 19.878  53.819  158.698 1.00 90.13  ? 270 LEU B C   1 
ATOM   3570 O O   . LEU B 1 187 ? 20.984  53.303  158.601 1.00 95.59  ? 270 LEU B O   1 
ATOM   3571 C CB  . LEU B 1 187 ? 19.651  55.294  160.656 1.00 88.14  ? 270 LEU B CB  1 
ATOM   3572 C CG  . LEU B 1 187 ? 19.811  56.622  161.371 1.00 86.80  ? 270 LEU B CG  1 
ATOM   3573 C CD1 . LEU B 1 187 ? 19.530  56.434  162.854 1.00 83.85  ? 270 LEU B CD1 1 
ATOM   3574 C CD2 . LEU B 1 187 ? 21.214  57.166  161.139 1.00 88.89  ? 270 LEU B CD2 1 
ATOM   3575 N N   . GLY B 1 188 ? 18.748  53.164  158.465 1.00 88.06  ? 271 GLY B N   1 
ATOM   3576 C CA  . GLY B 1 188 ? 18.743  51.815  157.917 1.00 92.03  ? 271 GLY B CA  1 
ATOM   3577 C C   . GLY B 1 188 ? 19.287  51.781  156.502 1.00 94.17  ? 271 GLY B C   1 
ATOM   3578 O O   . GLY B 1 188 ? 20.096  50.915  156.141 1.00 96.37  ? 271 GLY B O   1 
ATOM   3579 N N   . VAL B 1 189 ? 18.857  52.744  155.700 1.00 94.65  ? 272 VAL B N   1 
ATOM   3580 C CA  . VAL B 1 189 ? 19.370  52.861  154.341 1.00 98.96  ? 272 VAL B CA  1 
ATOM   3581 C C   . VAL B 1 189 ? 20.891  53.063  154.371 1.00 98.79  ? 272 VAL B C   1 
ATOM   3582 O O   . VAL B 1 189 ? 21.589  52.477  153.565 1.00 101.65 ? 272 VAL B O   1 
ATOM   3583 C CB  . VAL B 1 189 ? 18.688  54.005  153.572 1.00 95.97  ? 272 VAL B CB  1 
ATOM   3584 C CG1 . VAL B 1 189 ? 19.340  54.191  152.211 1.00 100.22 ? 272 VAL B CG1 1 
ATOM   3585 C CG2 . VAL B 1 189 ? 17.211  53.707  153.408 1.00 95.77  ? 272 VAL B CG2 1 
ATOM   3586 N N   . MET B 1 190 ? 21.368  53.884  155.309 1.00 98.32  ? 273 MET B N   1 
ATOM   3587 C CA  . MET B 1 190 ? 22.789  54.145  155.510 1.00 100.26 ? 273 MET B CA  1 
ATOM   3588 C C   . MET B 1 190 ? 23.541  52.884  155.880 1.00 104.44 ? 273 MET B C   1 
ATOM   3589 O O   . MET B 1 190 ? 24.542  52.554  155.252 1.00 108.30 ? 273 MET B O   1 
ATOM   3590 C CB  . MET B 1 190 ? 23.007  55.205  156.594 1.00 100.83 ? 273 MET B CB  1 
ATOM   3591 C CG  . MET B 1 190 ? 22.838  56.633  156.071 1.00 106.27 ? 273 MET B CG  1 
ATOM   3592 S SD  . MET B 1 190 ? 22.288  57.964  157.184 1.00 113.52 ? 273 MET B SD  1 
ATOM   3593 C CE  . MET B 1 190 ? 23.839  58.535  157.801 1.00 106.32 ? 273 MET B CE  1 
ATOM   3594 N N   . LEU B 1 191 ? 23.049  52.165  156.883 1.00 108.27 ? 274 LEU B N   1 
ATOM   3595 C CA  . LEU B 1 191 ? 23.732  50.967  157.370 1.00 107.60 ? 274 LEU B CA  1 
ATOM   3596 C C   . LEU B 1 191 ? 23.833  49.907  156.275 1.00 108.15 ? 274 LEU B C   1 
ATOM   3597 O O   . LEU B 1 191 ? 24.925  49.375  156.047 1.00 117.51 ? 274 LEU B O   1 
ATOM   3598 C CB  . LEU B 1 191 ? 23.038  50.392  158.597 1.00 108.02 ? 274 LEU B CB  1 
ATOM   3599 C CG  . LEU B 1 191 ? 23.611  49.103  159.188 1.00 108.83 ? 274 LEU B CG  1 
ATOM   3600 C CD1 . LEU B 1 191 ? 25.045  49.298  159.635 1.00 110.27 ? 274 LEU B CD1 1 
ATOM   3601 C CD2 . LEU B 1 191 ? 22.746  48.659  160.350 1.00 110.98 ? 274 LEU B CD2 1 
ATOM   3602 N N   . TYR B 1 192 ? 22.717  49.626  155.598 1.00 102.42 ? 275 TYR B N   1 
ATOM   3603 C CA  . TYR B 1 192 ? 22.721  48.741  154.427 1.00 101.49 ? 275 TYR B CA  1 
ATOM   3604 C C   . TYR B 1 192 ? 23.848  49.143  153.473 1.00 106.30 ? 275 TYR B C   1 
ATOM   3605 O O   . TYR B 1 192 ? 24.711  48.339  153.118 1.00 112.21 ? 275 TYR B O   1 
ATOM   3606 C CB  . TYR B 1 192 ? 21.370  48.795  153.693 1.00 99.08  ? 275 TYR B CB  1 
ATOM   3607 C CG  . TYR B 1 192 ? 21.239  47.824  152.531 1.00 99.84  ? 275 TYR B CG  1 
ATOM   3608 C CD1 . TYR B 1 192 ? 21.753  48.137  151.285 1.00 102.54 ? 275 TYR B CD1 1 
ATOM   3609 C CD2 . TYR B 1 192 ? 20.588  46.590  152.675 1.00 101.49 ? 275 TYR B CD2 1 
ATOM   3610 C CE1 . TYR B 1 192 ? 21.645  47.260  150.216 1.00 106.17 ? 275 TYR B CE1 1 
ATOM   3611 C CE2 . TYR B 1 192 ? 20.475  45.702  151.606 1.00 102.98 ? 275 TYR B CE2 1 
ATOM   3612 C CZ  . TYR B 1 192 ? 21.000  46.055  150.380 1.00 106.63 ? 275 TYR B CZ  1 
ATOM   3613 O OH  . TYR B 1 192 ? 20.921  45.216  149.302 1.00 113.13 ? 275 TYR B OH  1 
ATOM   3614 N N   . THR B 1 193 ? 23.869  50.420  153.129 1.00 105.00 ? 276 THR B N   1 
ATOM   3615 C CA  . THR B 1 193 ? 24.630  50.910  152.003 1.00 106.19 ? 276 THR B CA  1 
ATOM   3616 C C   . THR B 1 193 ? 26.152  50.979  152.347 1.00 104.57 ? 276 THR B C   1 
ATOM   3617 O O   . THR B 1 193 ? 27.010  50.707  151.494 1.00 103.72 ? 276 THR B O   1 
ATOM   3618 C CB  . THR B 1 193 ? 23.916  52.179  151.439 1.00 107.73 ? 276 THR B CB  1 
ATOM   3619 O OG1 . THR B 1 193 ? 23.927  52.149  150.020 1.00 115.37 ? 276 THR B OG1 1 
ATOM   3620 C CG2 . THR B 1 193 ? 24.526  53.454  151.933 1.00 107.87 ? 276 THR B CG2 1 
ATOM   3621 N N   . LEU B 1 194 ? 26.481  51.246  153.610 1.00 102.10 ? 277 LEU B N   1 
ATOM   3622 C CA  . LEU B 1 194 ? 27.865  51.096  154.096 1.00 104.82 ? 277 LEU B CA  1 
ATOM   3623 C C   . LEU B 1 194 ? 28.377  49.653  153.996 1.00 106.70 ? 277 LEU B C   1 
ATOM   3624 O O   . LEU B 1 194 ? 29.495  49.439  153.545 1.00 110.76 ? 277 LEU B O   1 
ATOM   3625 C CB  . LEU B 1 194 ? 28.001  51.520  155.563 1.00 101.15 ? 277 LEU B CB  1 
ATOM   3626 C CG  . LEU B 1 194 ? 27.705  52.964  155.945 1.00 96.56  ? 277 LEU B CG  1 
ATOM   3627 C CD1 . LEU B 1 194 ? 27.711  53.123  157.454 1.00 95.46  ? 277 LEU B CD1 1 
ATOM   3628 C CD2 . LEU B 1 194 ? 28.712  53.884  155.310 1.00 98.43  ? 277 LEU B CD2 1 
ATOM   3629 N N   . LEU B 1 195 ? 27.570  48.680  154.431 1.00 104.88 ? 278 LEU B N   1 
ATOM   3630 C CA  . LEU B 1 195 ? 28.000  47.266  154.474 1.00 106.34 ? 278 LEU B CA  1 
ATOM   3631 C C   . LEU B 1 195 ? 27.948  46.560  153.134 1.00 108.07 ? 278 LEU B C   1 
ATOM   3632 O O   . LEU B 1 195 ? 28.806  45.715  152.849 1.00 116.43 ? 278 LEU B O   1 
ATOM   3633 C CB  . LEU B 1 195 ? 27.146  46.463  155.439 1.00 103.45 ? 278 LEU B CB  1 
ATOM   3634 C CG  . LEU B 1 195 ? 27.240  46.882  156.896 1.00 101.62 ? 278 LEU B CG  1 
ATOM   3635 C CD1 . LEU B 1 195 ? 26.138  46.202  157.682 1.00 100.45 ? 278 LEU B CD1 1 
ATOM   3636 C CD2 . LEU B 1 195 ? 28.611  46.538  157.457 1.00 105.78 ? 278 LEU B CD2 1 
ATOM   3637 N N   . VAL B 1 196 ? 26.930  46.886  152.344 1.00 104.18 ? 279 VAL B N   1 
ATOM   3638 C CA  . VAL B 1 196 ? 26.709  46.265  151.049 1.00 107.15 ? 279 VAL B CA  1 
ATOM   3639 C C   . VAL B 1 196 ? 27.470  46.986  149.944 1.00 111.52 ? 279 VAL B C   1 
ATOM   3640 O O   . VAL B 1 196 ? 28.043  46.341  149.094 1.00 121.47 ? 279 VAL B O   1 
ATOM   3641 C CB  . VAL B 1 196 ? 25.202  46.219  150.704 1.00 106.94 ? 279 VAL B CB  1 
ATOM   3642 C CG1 . VAL B 1 196 ? 24.971  45.582  149.336 1.00 110.44 ? 279 VAL B CG1 1 
ATOM   3643 C CG2 . VAL B 1 196 ? 24.446  45.448  151.772 1.00 104.51 ? 279 VAL B CG2 1 
ATOM   3644 N N   . GLY B 1 197 ? 27.458  48.316  149.943 1.00 111.72 ? 280 GLY B N   1 
ATOM   3645 C CA  . GLY B 1 197 ? 28.011  49.106  148.848 1.00 112.31 ? 280 GLY B CA  1 
ATOM   3646 C C   . GLY B 1 197 ? 26.991  49.592  147.822 1.00 113.95 ? 280 GLY B C   1 
ATOM   3647 O O   . GLY B 1 197 ? 27.362  50.284  146.895 1.00 116.11 ? 280 GLY B O   1 
ATOM   3648 N N   . ARG B 1 198 ? 25.721  49.219  147.958 1.00 115.47 ? 281 ARG B N   1 
ATOM   3649 C CA  . ARG B 1 198 ? 24.640  49.725  147.110 1.00 116.82 ? 281 ARG B CA  1 
ATOM   3650 C C   . ARG B 1 198 ? 23.508  50.136  148.001 1.00 116.19 ? 281 ARG B C   1 
ATOM   3651 O O   . ARG B 1 198 ? 23.433  49.668  149.135 1.00 121.43 ? 281 ARG B O   1 
ATOM   3652 C CB  . ARG B 1 198 ? 24.126  48.630  146.184 1.00 122.47 ? 281 ARG B CB  1 
ATOM   3653 C CG  . ARG B 1 198 ? 25.122  48.163  145.140 1.00 132.40 ? 281 ARG B CG  1 
ATOM   3654 C CD  . ARG B 1 198 ? 24.556  47.047  144.265 1.00 138.71 ? 281 ARG B CD  1 
ATOM   3655 N NE  . ARG B 1 198 ? 24.405  45.772  144.980 1.00 138.01 ? 281 ARG B NE  1 
ATOM   3656 C CZ  . ARG B 1 198 ? 23.316  45.351  145.627 1.00 136.66 ? 281 ARG B CZ  1 
ATOM   3657 N NH1 . ARG B 1 198 ? 22.205  46.085  145.701 1.00 135.25 ? 281 ARG B NH1 1 
ATOM   3658 N NH2 . ARG B 1 198 ? 23.342  44.163  146.225 1.00 139.01 ? 281 ARG B NH2 1 
ATOM   3659 N N   . TYR B 1 199 ? 22.608  50.989  147.506 1.00 117.79 ? 282 TYR B N   1 
ATOM   3660 C CA  . TYR B 1 199 ? 21.378  51.305  148.259 1.00 114.52 ? 282 TYR B CA  1 
ATOM   3661 C C   . TYR B 1 199 ? 20.457  50.088  148.285 1.00 111.93 ? 282 TYR B C   1 
ATOM   3662 O O   . TYR B 1 199 ? 20.452  49.297  147.350 1.00 110.85 ? 282 TYR B O   1 
ATOM   3663 C CB  . TYR B 1 199 ? 20.592  52.448  147.619 1.00 116.43 ? 282 TYR B CB  1 
ATOM   3664 C CG  . TYR B 1 199 ? 21.268  53.795  147.609 1.00 114.80 ? 282 TYR B CG  1 
ATOM   3665 C CD1 . TYR B 1 199 ? 21.802  54.344  148.778 1.00 111.08 ? 282 TYR B CD1 1 
ATOM   3666 C CD2 . TYR B 1 199 ? 21.331  54.548  146.436 1.00 117.05 ? 282 TYR B CD2 1 
ATOM   3667 C CE1 . TYR B 1 199 ? 22.410  55.592  148.772 1.00 109.41 ? 282 TYR B CE1 1 
ATOM   3668 C CE2 . TYR B 1 199 ? 21.934  55.796  146.418 1.00 115.47 ? 282 TYR B CE2 1 
ATOM   3669 C CZ  . TYR B 1 199 ? 22.470  56.314  147.586 1.00 111.88 ? 282 TYR B CZ  1 
ATOM   3670 O OH  . TYR B 1 199 ? 23.069  57.543  147.551 1.00 110.92 ? 282 TYR B OH  1 
ATOM   3671 N N   . PRO B 1 200 ? 19.655  49.945  149.343 1.00 110.37 ? 283 PRO B N   1 
ATOM   3672 C CA  . PRO B 1 200 ? 18.695  48.841  149.366 1.00 110.96 ? 283 PRO B CA  1 
ATOM   3673 C C   . PRO B 1 200 ? 17.635  48.964  148.279 1.00 110.39 ? 283 PRO B C   1 
ATOM   3674 O O   . PRO B 1 200 ? 17.137  47.948  147.801 1.00 110.83 ? 283 PRO B O   1 
ATOM   3675 C CB  . PRO B 1 200 ? 18.067  48.958  150.754 1.00 110.81 ? 283 PRO B CB  1 
ATOM   3676 C CG  . PRO B 1 200 ? 18.217  50.394  151.113 1.00 110.83 ? 283 PRO B CG  1 
ATOM   3677 C CD  . PRO B 1 200 ? 19.532  50.812  150.525 1.00 110.12 ? 283 PRO B CD  1 
ATOM   3678 N N   . PHE B 1 201 ? 17.291  50.195  147.909 1.00 109.76 ? 284 PHE B N   1 
ATOM   3679 C CA  . PHE B 1 201 ? 16.424  50.449  146.774 1.00 113.05 ? 284 PHE B CA  1 
ATOM   3680 C C   . PHE B 1 201 ? 17.128  51.459  145.909 1.00 117.69 ? 284 PHE B C   1 
ATOM   3681 O O   . PHE B 1 201 ? 17.531  52.509  146.405 1.00 117.14 ? 284 PHE B O   1 
ATOM   3682 C CB  . PHE B 1 201 ? 15.098  51.028  147.227 1.00 111.97 ? 284 PHE B CB  1 
ATOM   3683 C CG  . PHE B 1 201 ? 14.466  50.276  148.339 1.00 111.79 ? 284 PHE B CG  1 
ATOM   3684 C CD1 . PHE B 1 201 ? 13.631  49.198  148.084 1.00 114.89 ? 284 PHE B CD1 1 
ATOM   3685 C CD2 . PHE B 1 201 ? 14.711  50.645  149.657 1.00 112.31 ? 284 PHE B CD2 1 
ATOM   3686 C CE1 . PHE B 1 201 ? 13.044  48.511  149.134 1.00 116.39 ? 284 PHE B CE1 1 
ATOM   3687 C CE2 . PHE B 1 201 ? 14.140  49.952  150.713 1.00 109.25 ? 284 PHE B CE2 1 
ATOM   3688 C CZ  . PHE B 1 201 ? 13.301  48.891  150.449 1.00 112.06 ? 284 PHE B CZ  1 
ATOM   3689 N N   . HIS B 1 202 ? 17.266  51.145  144.623 1.00 126.49 ? 285 HIS B N   1 
ATOM   3690 C CA  . HIS B 1 202 ? 17.975  52.001  143.684 1.00 134.92 ? 285 HIS B CA  1 
ATOM   3691 C C   . HIS B 1 202 ? 17.345  52.016  142.292 1.00 137.33 ? 285 HIS B C   1 
ATOM   3692 O O   . HIS B 1 202 ? 16.923  50.982  141.778 1.00 138.42 ? 285 HIS B O   1 
ATOM   3693 C CB  . HIS B 1 202 ? 19.433  51.561  143.551 1.00 142.98 ? 285 HIS B CB  1 
ATOM   3694 C CG  . HIS B 1 202 ? 20.194  52.386  142.560 1.00 155.08 ? 285 HIS B CG  1 
ATOM   3695 N ND1 . HIS B 1 202 ? 20.621  51.891  141.346 1.00 163.32 ? 285 HIS B ND1 1 
ATOM   3696 C CD2 . HIS B 1 202 ? 20.509  53.704  142.560 1.00 159.52 ? 285 HIS B CD2 1 
ATOM   3697 C CE1 . HIS B 1 202 ? 21.213  52.856  140.663 1.00 164.92 ? 285 HIS B CE1 1 
ATOM   3698 N NE2 . HIS B 1 202 ? 21.159  53.965  141.378 1.00 163.93 ? 285 HIS B NE2 1 
ATOM   3699 N N   . ASP B 1 203 ? 17.326  53.200  141.690 1.00 139.08 ? 286 ASP B N   1 
ATOM   3700 C CA  . ASP B 1 203 ? 17.043  53.371  140.267 1.00 145.19 ? 286 ASP B CA  1 
ATOM   3701 C C   . ASP B 1 203 ? 17.501  54.768  139.842 1.00 148.53 ? 286 ASP B C   1 
ATOM   3702 O O   . ASP B 1 203 ? 17.643  55.647  140.689 1.00 150.80 ? 286 ASP B O   1 
ATOM   3703 C CB  . ASP B 1 203 ? 15.557  53.204  139.987 1.00 146.41 ? 286 ASP B CB  1 
ATOM   3704 C CG  . ASP B 1 203 ? 15.272  52.968  138.524 1.00 152.96 ? 286 ASP B CG  1 
ATOM   3705 O OD1 . ASP B 1 203 ? 15.127  53.964  137.784 1.00 154.27 ? 286 ASP B OD1 1 
ATOM   3706 O OD2 . ASP B 1 203 ? 15.197  51.793  138.111 1.00 156.05 ? 286 ASP B OD2 1 
ATOM   3707 N N   . SER B 1 204 ? 17.756  54.974  138.549 1.00 152.18 ? 287 SER B N   1 
ATOM   3708 C CA  . SER B 1 204 ? 18.130  56.309  138.042 1.00 153.78 ? 287 SER B CA  1 
ATOM   3709 C C   . SER B 1 204 ? 16.951  57.287  138.080 1.00 154.54 ? 287 SER B C   1 
ATOM   3710 O O   . SER B 1 204 ? 17.106  58.435  138.492 1.00 153.65 ? 287 SER B O   1 
ATOM   3711 C CB  . SER B 1 204 ? 18.731  56.224  136.632 1.00 158.99 ? 287 SER B CB  1 
ATOM   3712 O OG  . SER B 1 204 ? 18.179  55.154  135.894 1.00 162.47 ? 287 SER B OG  1 
ATOM   3713 N N   . ASP B 1 205 ? 15.788  56.817  137.639 1.00 158.28 ? 288 ASP B N   1 
ATOM   3714 C CA  . ASP B 1 205 ? 14.535  57.569  137.711 1.00 162.98 ? 288 ASP B CA  1 
ATOM   3715 C C   . ASP B 1 205 ? 14.067  57.598  139.176 1.00 155.32 ? 288 ASP B C   1 
ATOM   3716 O O   . ASP B 1 205 ? 14.063  56.548  139.824 1.00 152.91 ? 288 ASP B O   1 
ATOM   3717 C CB  . ASP B 1 205 ? 13.501  56.877  136.799 1.00 171.67 ? 288 ASP B CB  1 
ATOM   3718 C CG  . ASP B 1 205 ? 12.148  57.590  136.734 1.00 176.20 ? 288 ASP B CG  1 
ATOM   3719 O OD1 . ASP B 1 205 ? 11.987  58.721  137.247 1.00 178.19 ? 288 ASP B OD1 1 
ATOM   3720 O OD2 . ASP B 1 205 ? 11.221  56.976  136.161 1.00 178.96 ? 288 ASP B OD2 1 
ATOM   3721 N N   . PRO B 1 206 ? 13.712  58.792  139.718 1.00 152.08 ? 289 PRO B N   1 
ATOM   3722 C CA  . PRO B 1 206 ? 13.174  58.841  141.094 1.00 148.58 ? 289 PRO B CA  1 
ATOM   3723 C C   . PRO B 1 206 ? 11.789  58.202  141.293 1.00 147.64 ? 289 PRO B C   1 
ATOM   3724 O O   . PRO B 1 206 ? 11.582  57.538  142.310 1.00 147.37 ? 289 PRO B O   1 
ATOM   3725 C CB  . PRO B 1 206 ? 13.126  60.348  141.413 1.00 148.42 ? 289 PRO B CB  1 
ATOM   3726 C CG  . PRO B 1 206 ? 13.190  61.028  140.091 1.00 152.34 ? 289 PRO B CG  1 
ATOM   3727 C CD  . PRO B 1 206 ? 14.046  60.145  139.235 1.00 153.94 ? 289 PRO B CD  1 
ATOM   3728 N N   . SER B 1 207 ? 10.862  58.374  140.350 1.00 149.26 ? 290 SER B N   1 
ATOM   3729 C CA  . SER B 1 207 ? 9.536   57.739  140.476 1.00 149.18 ? 290 SER B CA  1 
ATOM   3730 C C   . SER B 1 207 ? 9.612   56.206  140.406 1.00 149.31 ? 290 SER B C   1 
ATOM   3731 O O   . SER B 1 207 ? 8.870   55.527  141.106 1.00 148.99 ? 290 SER B O   1 
ATOM   3732 C CB  . SER B 1 207 ? 8.523   58.301  139.478 1.00 153.24 ? 290 SER B CB  1 
ATOM   3733 O OG  . SER B 1 207 ? 9.178   58.962  138.420 1.00 163.27 ? 290 SER B OG  1 
ATOM   3734 N N   . ALA B 1 208 ? 10.525  55.670  139.600 1.00 150.49 ? 291 ALA B N   1 
ATOM   3735 C CA  . ALA B 1 208 ? 10.794  54.227  139.591 1.00 149.90 ? 291 ALA B CA  1 
ATOM   3736 C C   . ALA B 1 208 ? 11.341  53.738  140.940 1.00 149.92 ? 291 ALA B C   1 
ATOM   3737 O O   . ALA B 1 208 ? 10.988  52.645  141.408 1.00 153.23 ? 291 ALA B O   1 
ATOM   3738 C CB  . ALA B 1 208 ? 11.767  53.879  138.477 1.00 151.69 ? 291 ALA B CB  1 
ATOM   3739 N N   . LEU B 1 209 ? 12.206  54.554  141.546 1.00 148.75 ? 292 LEU B N   1 
ATOM   3740 C CA  . LEU B 1 209 ? 12.812  54.268  142.853 1.00 140.57 ? 292 LEU B CA  1 
ATOM   3741 C C   . LEU B 1 209 ? 11.750  54.294  143.943 1.00 138.53 ? 292 LEU B C   1 
ATOM   3742 O O   . LEU B 1 209 ? 11.759  53.445  144.827 1.00 138.30 ? 292 LEU B O   1 
ATOM   3743 C CB  . LEU B 1 209 ? 13.929  55.282  143.157 1.00 138.80 ? 292 LEU B CB  1 
ATOM   3744 C CG  . LEU B 1 209 ? 15.037  54.923  144.156 1.00 135.29 ? 292 LEU B CG  1 
ATOM   3745 C CD1 . LEU B 1 209 ? 16.218  55.869  144.017 1.00 136.26 ? 292 LEU B CD1 1 
ATOM   3746 C CD2 . LEU B 1 209 ? 14.556  54.950  145.591 1.00 131.41 ? 292 LEU B CD2 1 
ATOM   3747 N N   . PHE B 1 210 ? 10.818  55.246  143.863 1.00 139.97 ? 293 PHE B N   1 
ATOM   3748 C CA  . PHE B 1 210 ? 9.713   55.319  144.828 1.00 137.00 ? 293 PHE B CA  1 
ATOM   3749 C C   . PHE B 1 210 ? 8.764   54.116  144.740 1.00 138.33 ? 293 PHE B C   1 
ATOM   3750 O O   . PHE B 1 210 ? 8.267   53.626  145.755 1.00 135.97 ? 293 PHE B O   1 
ATOM   3751 C CB  . PHE B 1 210 ? 8.917   56.622  144.662 1.00 137.53 ? 293 PHE B CB  1 
ATOM   3752 C CG  . PHE B 1 210 ? 9.710   57.882  144.934 1.00 137.52 ? 293 PHE B CG  1 
ATOM   3753 C CD1 . PHE B 1 210 ? 10.593  57.972  146.019 1.00 137.21 ? 293 PHE B CD1 1 
ATOM   3754 C CD2 . PHE B 1 210 ? 9.541   59.002  144.123 1.00 142.38 ? 293 PHE B CD2 1 
ATOM   3755 C CE1 . PHE B 1 210 ? 11.303  59.142  146.264 1.00 138.11 ? 293 PHE B CE1 1 
ATOM   3756 C CE2 . PHE B 1 210 ? 10.249  60.170  144.363 1.00 145.00 ? 293 PHE B CE2 1 
ATOM   3757 C CZ  . PHE B 1 210 ? 11.127  60.243  145.438 1.00 143.06 ? 293 PHE B CZ  1 
ATOM   3758 N N   . SER B 1 211 ? 8.512   53.633  143.529 1.00 147.69 ? 294 SER B N   1 
ATOM   3759 C CA  . SER B 1 211 ? 7.694   52.430  143.348 1.00 151.35 ? 294 SER B CA  1 
ATOM   3760 C C   . SER B 1 211 ? 8.348   51.161  143.943 1.00 144.48 ? 294 SER B C   1 
ATOM   3761 O O   . SER B 1 211 ? 7.628   50.264  144.363 1.00 139.02 ? 294 SER B O   1 
ATOM   3762 C CB  . SER B 1 211 ? 7.306   52.240  141.870 1.00 160.65 ? 294 SER B CB  1 
ATOM   3763 O OG  . SER B 1 211 ? 8.418   51.878  141.068 1.00 170.94 ? 294 SER B OG  1 
ATOM   3764 N N   . LYS B 1 212 ? 9.685   51.092  144.006 1.00 140.50 ? 295 LYS B N   1 
ATOM   3765 C CA  . LYS B 1 212 ? 10.337  49.944  144.665 1.00 136.56 ? 295 LYS B CA  1 
ATOM   3766 C C   . LYS B 1 212 ? 10.481  50.118  146.201 1.00 128.14 ? 295 LYS B C   1 
ATOM   3767 O O   . LYS B 1 212 ? 10.515  49.122  146.921 1.00 124.30 ? 295 LYS B O   1 
ATOM   3768 C CB  . LYS B 1 212 ? 11.598  49.400  143.924 1.00 142.72 ? 295 LYS B CB  1 
ATOM   3769 C CG  . LYS B 1 212 ? 12.783  50.303  143.637 1.00 147.15 ? 295 LYS B CG  1 
ATOM   3770 C CD  . LYS B 1 212 ? 13.944  49.484  143.041 1.00 150.82 ? 295 LYS B CD  1 
ATOM   3771 C CE  . LYS B 1 212 ? 14.451  48.322  143.918 1.00 149.81 ? 295 LYS B CE  1 
ATOM   3772 N NZ  . LYS B 1 212 ? 15.624  47.611  143.339 1.00 152.28 ? 295 LYS B NZ  1 
ATOM   3773 N N   . ILE B 1 213 ? 10.505  51.361  146.706 1.00 125.19 ? 296 ILE B N   1 
ATOM   3774 C CA  . ILE B 1 213 ? 10.401  51.633  148.169 1.00 121.83 ? 296 ILE B CA  1 
ATOM   3775 C C   . ILE B 1 213 ? 8.985   51.305  148.677 1.00 124.83 ? 296 ILE B C   1 
ATOM   3776 O O   . ILE B 1 213 ? 8.807   50.699  149.741 1.00 120.82 ? 296 ILE B O   1 
ATOM   3777 C CB  . ILE B 1 213 ? 10.750  53.105  148.537 1.00 118.41 ? 296 ILE B CB  1 
ATOM   3778 C CG1 . ILE B 1 213 ? 12.226  53.402  148.259 1.00 120.85 ? 296 ILE B CG1 1 
ATOM   3779 C CG2 . ILE B 1 213 ? 10.446  53.410  150.003 1.00 112.74 ? 296 ILE B CG2 1 
ATOM   3780 C CD1 . ILE B 1 213 ? 12.554  54.884  148.168 1.00 123.31 ? 296 ILE B CD1 1 
ATOM   3781 N N   . ARG B 1 214 ? 7.983   51.721  147.910 1.00 130.09 ? 297 ARG B N   1 
ATOM   3782 C CA  . ARG B 1 214 ? 6.594   51.374  148.205 1.00 131.27 ? 297 ARG B CA  1 
ATOM   3783 C C   . ARG B 1 214 ? 6.406   49.876  148.298 1.00 131.25 ? 297 ARG B C   1 
ATOM   3784 O O   . ARG B 1 214 ? 5.740   49.400  149.193 1.00 129.84 ? 297 ARG B O   1 
ATOM   3785 C CB  . ARG B 1 214 ? 5.647   51.932  147.147 1.00 136.97 ? 297 ARG B CB  1 
ATOM   3786 C CG  . ARG B 1 214 ? 5.123   53.296  147.492 1.00 138.51 ? 297 ARG B CG  1 
ATOM   3787 C CD  . ARG B 1 214 ? 4.677   54.024  146.248 1.00 148.11 ? 297 ARG B CD  1 
ATOM   3788 N NE  . ARG B 1 214 ? 4.308   55.397  146.556 1.00 154.59 ? 297 ARG B NE  1 
ATOM   3789 C CZ  . ARG B 1 214 ? 3.898   56.295  145.662 1.00 162.79 ? 297 ARG B CZ  1 
ATOM   3790 N NH1 . ARG B 1 214 ? 3.761   55.976  144.375 1.00 169.13 ? 297 ARG B NH1 1 
ATOM   3791 N NH2 . ARG B 1 214 ? 3.602   57.526  146.066 1.00 167.36 ? 297 ARG B NH2 1 
ATOM   3792 N N   . ARG B 1 215 ? 6.995   49.140  147.363 1.00 134.90 ? 298 ARG B N   1 
ATOM   3793 C CA  . ARG B 1 215 ? 6.919   47.689  147.395 1.00 136.61 ? 298 ARG B CA  1 
ATOM   3794 C C   . ARG B 1 215 ? 7.703   47.120  148.572 1.00 132.74 ? 298 ARG B C   1 
ATOM   3795 O O   . ARG B 1 215 ? 7.286   46.128  149.153 1.00 133.46 ? 298 ARG B O   1 
ATOM   3796 C CB  . ARG B 1 215 ? 7.420   47.082  146.084 1.00 144.26 ? 298 ARG B CB  1 
ATOM   3797 C CG  . ARG B 1 215 ? 6.980   45.642  145.904 1.00 148.54 ? 298 ARG B CG  1 
ATOM   3798 C CD  . ARG B 1 215 ? 6.997   45.225  144.440 1.00 156.08 ? 298 ARG B CD  1 
ATOM   3799 N NE  . ARG B 1 215 ? 7.165   43.794  144.179 1.00 162.45 ? 298 ARG B NE  1 
ATOM   3800 C CZ  . ARG B 1 215 ? 8.327   43.134  144.160 1.00 160.86 ? 298 ARG B CZ  1 
ATOM   3801 N NH1 . ARG B 1 215 ? 9.485   43.741  144.428 1.00 158.88 ? 298 ARG B NH1 1 
ATOM   3802 N NH2 . ARG B 1 215 ? 8.327   41.831  143.890 1.00 160.84 ? 298 ARG B NH2 1 
ATOM   3803 N N   . GLY B 1 216 ? 8.859   47.715  148.875 1.00 128.60 ? 299 GLY B N   1 
ATOM   3804 C CA  . GLY B 1 216 ? 9.645   47.356  150.051 1.00 123.53 ? 299 GLY B CA  1 
ATOM   3805 C C   . GLY B 1 216 ? 10.472  46.098  149.943 1.00 125.40 ? 299 GLY B C   1 
ATOM   3806 O O   . GLY B 1 216 ? 11.117  45.696  150.906 1.00 120.24 ? 299 GLY B O   1 
ATOM   3807 N N   . GLN B 1 217 ? 10.448  45.450  148.785 1.00 133.77 ? 300 GLN B N   1 
ATOM   3808 C CA  . GLN B 1 217 ? 11.331  44.304  148.559 1.00 136.44 ? 300 GLN B CA  1 
ATOM   3809 C C   . GLN B 1 217 ? 12.802  44.693  148.436 1.00 128.52 ? 300 GLN B C   1 
ATOM   3810 O O   . GLN B 1 217 ? 13.187  45.461  147.558 1.00 128.95 ? 300 GLN B O   1 
ATOM   3811 C CB  . GLN B 1 217 ? 10.879  43.478  147.363 1.00 146.88 ? 300 GLN B CB  1 
ATOM   3812 C CG  . GLN B 1 217 ? 9.450   42.942  147.520 1.00 151.94 ? 300 GLN B CG  1 
ATOM   3813 C CD  . GLN B 1 217 ? 9.012   42.562  148.941 1.00 154.03 ? 300 GLN B CD  1 
ATOM   3814 O OE1 . GLN B 1 217 ? 9.704   41.836  149.657 1.00 159.15 ? 300 GLN B OE1 1 
ATOM   3815 N NE2 . GLN B 1 217 ? 7.844   43.054  149.345 1.00 154.63 ? 300 GLN B NE2 1 
ATOM   3816 N N   . PHE B 1 218 ? 13.614  44.149  149.331 1.00 123.20 ? 301 PHE B N   1 
ATOM   3817 C CA  . PHE B 1 218 ? 15.051  44.357  149.293 1.00 121.10 ? 301 PHE B CA  1 
ATOM   3818 C C   . PHE B 1 218 ? 15.737  43.144  149.885 1.00 122.88 ? 301 PHE B C   1 
ATOM   3819 O O   . PHE B 1 218 ? 15.205  42.509  150.803 1.00 128.24 ? 301 PHE B O   1 
ATOM   3820 C CB  . PHE B 1 218 ? 15.437  45.652  150.021 1.00 117.31 ? 301 PHE B CB  1 
ATOM   3821 C CG  . PHE B 1 218 ? 15.479  45.535  151.517 1.00 112.43 ? 301 PHE B CG  1 
ATOM   3822 C CD1 . PHE B 1 218 ? 14.340  45.750  152.272 1.00 110.40 ? 301 PHE B CD1 1 
ATOM   3823 C CD2 . PHE B 1 218 ? 16.664  45.223  152.173 1.00 113.85 ? 301 PHE B CD2 1 
ATOM   3824 C CE1 . PHE B 1 218 ? 14.365  45.649  153.656 1.00 109.69 ? 301 PHE B CE1 1 
ATOM   3825 C CE2 . PHE B 1 218 ? 16.699  45.114  153.557 1.00 115.79 ? 301 PHE B CE2 1 
ATOM   3826 C CZ  . PHE B 1 218 ? 15.542  45.333  154.303 1.00 112.40 ? 301 PHE B CZ  1 
ATOM   3827 N N   . CYS B 1 219 ? 16.917  42.831  149.359 1.00 127.11 ? 302 CYS B N   1 
ATOM   3828 C CA  . CYS B 1 219 ? 17.658  41.633  149.747 1.00 129.47 ? 302 CYS B CA  1 
ATOM   3829 C C   . CYS B 1 219 ? 18.980  41.985  150.440 1.00 122.25 ? 302 CYS B C   1 
ATOM   3830 O O   . CYS B 1 219 ? 19.745  42.798  149.922 1.00 120.86 ? 302 CYS B O   1 
ATOM   3831 C CB  . CYS B 1 219 ? 17.940  40.789  148.510 1.00 134.55 ? 302 CYS B CB  1 
ATOM   3832 S SG  . CYS B 1 219 ? 19.346  39.688  148.759 1.00 149.03 ? 302 CYS B SG  1 
ATOM   3833 N N   . ILE B 1 220 ? 19.247  41.368  151.593 1.00 114.21 ? 303 ILE B N   1 
ATOM   3834 C CA  . ILE B 1 220 ? 20.522  41.550  152.286 1.00 111.29 ? 303 ILE B CA  1 
ATOM   3835 C C   . ILE B 1 220 ? 21.445  40.402  151.888 1.00 115.26 ? 303 ILE B C   1 
ATOM   3836 O O   . ILE B 1 220 ? 21.210  39.276  152.296 1.00 121.01 ? 303 ILE B O   1 
ATOM   3837 C CB  . ILE B 1 220 ? 20.352  41.581  153.821 1.00 106.57 ? 303 ILE B CB  1 
ATOM   3838 C CG1 . ILE B 1 220 ? 19.404  42.727  154.230 1.00 105.26 ? 303 ILE B CG1 1 
ATOM   3839 C CG2 . ILE B 1 220 ? 21.703  41.775  154.503 1.00 105.33 ? 303 ILE B CG2 1 
ATOM   3840 C CD1 . ILE B 1 220 ? 19.049  42.767  155.704 1.00 103.04 ? 303 ILE B CD1 1 
ATOM   3841 N N   . PRO B 1 221 ? 22.522  40.678  151.118 1.00 120.90 ? 304 PRO B N   1 
ATOM   3842 C CA  . PRO B 1 221 ? 23.357  39.570  150.641 1.00 122.96 ? 304 PRO B CA  1 
ATOM   3843 C C   . PRO B 1 221 ? 23.992  38.729  151.749 1.00 126.17 ? 304 PRO B C   1 
ATOM   3844 O O   . PRO B 1 221 ? 24.097  39.152  152.910 1.00 120.39 ? 304 PRO B O   1 
ATOM   3845 C CB  . PRO B 1 221 ? 24.432  40.268  149.814 1.00 122.98 ? 304 PRO B CB  1 
ATOM   3846 C CG  . PRO B 1 221 ? 24.513  41.633  150.382 1.00 121.02 ? 304 PRO B CG  1 
ATOM   3847 C CD  . PRO B 1 221 ? 23.109  41.984  150.760 1.00 120.21 ? 304 PRO B CD  1 
ATOM   3848 N N   . GLU B 1 222 ? 24.424  37.539  151.369 1.00 135.19 ? 305 GLU B N   1 
ATOM   3849 C CA  . GLU B 1 222 ? 24.840  36.538  152.346 1.00 140.44 ? 305 GLU B CA  1 
ATOM   3850 C C   . GLU B 1 222 ? 26.058  36.933  153.170 1.00 134.84 ? 305 GLU B C   1 
ATOM   3851 O O   . GLU B 1 222 ? 26.173  36.468  154.307 1.00 134.22 ? 305 GLU B O   1 
ATOM   3852 C CB  . GLU B 1 222 ? 25.057  35.170  151.675 1.00 150.48 ? 305 GLU B CB  1 
ATOM   3853 C CG  . GLU B 1 222 ? 23.807  34.296  151.564 1.00 155.91 ? 305 GLU B CG  1 
ATOM   3854 C CD  . GLU B 1 222 ? 22.503  35.093  151.411 1.00 160.19 ? 305 GLU B CD  1 
ATOM   3855 O OE1 . GLU B 1 222 ? 22.414  35.992  150.539 1.00 159.25 ? 305 GLU B OE1 1 
ATOM   3856 O OE2 . GLU B 1 222 ? 21.560  34.836  152.193 1.00 163.50 ? 305 GLU B OE2 1 
ATOM   3857 N N   . HIS B 1 223 ? 26.925  37.806  152.638 1.00 128.13 ? 306 HIS B N   1 
ATOM   3858 C CA  . HIS B 1 223 ? 28.157  38.180  153.348 1.00 126.69 ? 306 HIS B CA  1 
ATOM   3859 C C   . HIS B 1 223 ? 27.937  38.964  154.639 1.00 122.31 ? 306 HIS B C   1 
ATOM   3860 O O   . HIS B 1 223 ? 28.840  39.018  155.468 1.00 123.55 ? 306 HIS B O   1 
ATOM   3861 C CB  . HIS B 1 223 ? 29.178  38.906  152.444 1.00 129.01 ? 306 HIS B CB  1 
ATOM   3862 C CG  . HIS B 1 223 ? 28.905  40.361  152.241 1.00 128.94 ? 306 HIS B CG  1 
ATOM   3863 N ND1 . HIS B 1 223 ? 28.483  40.871  151.033 1.00 133.88 ? 306 HIS B ND1 1 
ATOM   3864 C CD2 . HIS B 1 223 ? 29.006  41.419  153.082 1.00 128.86 ? 306 HIS B CD2 1 
ATOM   3865 C CE1 . HIS B 1 223 ? 28.320  42.178  151.138 1.00 133.26 ? 306 HIS B CE1 1 
ATOM   3866 N NE2 . HIS B 1 223 ? 28.626  42.535  152.373 1.00 131.24 ? 306 HIS B NE2 1 
ATOM   3867 N N   . ILE B 1 224 ? 26.757  39.566  154.798 1.00 120.57 ? 307 ILE B N   1 
ATOM   3868 C CA  . ILE B 1 224 ? 26.414  40.357  155.989 1.00 115.54 ? 307 ILE B CA  1 
ATOM   3869 C C   . ILE B 1 224 ? 26.229  39.422  157.178 1.00 112.59 ? 307 ILE B C   1 
ATOM   3870 O O   . ILE B 1 224 ? 25.620  38.372  157.041 1.00 115.70 ? 307 ILE B O   1 
ATOM   3871 C CB  . ILE B 1 224 ? 25.092  41.142  155.792 1.00 113.25 ? 307 ILE B CB  1 
ATOM   3872 C CG1 . ILE B 1 224 ? 25.162  42.097  154.578 1.00 115.48 ? 307 ILE B CG1 1 
ATOM   3873 C CG2 . ILE B 1 224 ? 24.716  41.900  157.063 1.00 111.39 ? 307 ILE B CG2 1 
ATOM   3874 C CD1 . ILE B 1 224 ? 26.277  43.117  154.604 1.00 116.38 ? 307 ILE B CD1 1 
ATOM   3875 N N   . SER B 1 225 ? 26.717  39.828  158.349 1.00 109.04 ? 308 SER B N   1 
ATOM   3876 C CA  . SER B 1 225 ? 26.649  38.986  159.554 1.00 107.99 ? 308 SER B CA  1 
ATOM   3877 C C   . SER B 1 225 ? 25.230  38.818  160.061 1.00 104.06 ? 308 SER B C   1 
ATOM   3878 O O   . SER B 1 225 ? 24.355  39.606  159.708 1.00 102.54 ? 308 SER B O   1 
ATOM   3879 C CB  . SER B 1 225 ? 27.495  39.584  160.675 1.00 109.84 ? 308 SER B CB  1 
ATOM   3880 O OG  . SER B 1 225 ? 27.053  40.889  160.990 1.00 106.55 ? 308 SER B OG  1 
ATOM   3881 N N   . PRO B 1 226 ? 24.992  37.803  160.905 1.00 105.35 ? 309 PRO B N   1 
ATOM   3882 C CA  . PRO B 1 226 ? 23.639  37.660  161.455 1.00 104.68 ? 309 PRO B CA  1 
ATOM   3883 C C   . PRO B 1 226 ? 23.160  38.883  162.265 1.00 102.75 ? 309 PRO B C   1 
ATOM   3884 O O   . PRO B 1 226 ? 22.046  39.339  162.045 1.00 107.14 ? 309 PRO B O   1 
ATOM   3885 C CB  . PRO B 1 226 ? 23.746  36.412  162.337 1.00 103.36 ? 309 PRO B CB  1 
ATOM   3886 C CG  . PRO B 1 226 ? 24.886  35.649  161.772 1.00 104.63 ? 309 PRO B CG  1 
ATOM   3887 C CD  . PRO B 1 226 ? 25.862  36.697  161.330 1.00 106.06 ? 309 PRO B CD  1 
ATOM   3888 N N   . LYS B 1 227 ? 24.005  39.426  163.145 1.00 100.26 ? 310 LYS B N   1 
ATOM   3889 C CA  . LYS B 1 227 ? 23.624  40.573  163.986 1.00 98.25  ? 310 LYS B CA  1 
ATOM   3890 C C   . LYS B 1 227 ? 23.415  41.872  163.197 1.00 99.36  ? 310 LYS B C   1 
ATOM   3891 O O   . LYS B 1 227 ? 22.527  42.655  163.535 1.00 96.59  ? 310 LYS B O   1 
ATOM   3892 C CB  . LYS B 1 227 ? 24.657  40.829  165.073 1.00 97.25  ? 310 LYS B CB  1 
ATOM   3893 C CG  . LYS B 1 227 ? 24.742  39.740  166.104 1.00 99.80  ? 310 LYS B CG  1 
ATOM   3894 C CD  . LYS B 1 227 ? 26.023  39.868  166.902 1.00 105.53 ? 310 LYS B CD  1 
ATOM   3895 C CE  . LYS B 1 227 ? 26.288  38.638  167.764 1.00 107.56 ? 310 LYS B CE  1 
ATOM   3896 N NZ  . LYS B 1 227 ? 25.329  38.565  168.894 1.00 105.31 ? 310 LYS B NZ  1 
ATOM   3897 N N   . ALA B 1 228 ? 24.249  42.106  162.184 1.00 100.59 ? 311 ALA B N   1 
ATOM   3898 C CA  . ALA B 1 228 ? 24.088  43.262  161.290 1.00 102.12 ? 311 ALA B CA  1 
ATOM   3899 C C   . ALA B 1 228 ? 22.859  43.123  160.395 1.00 102.73 ? 311 ALA B C   1 
ATOM   3900 O O   . ALA B 1 228 ? 22.236  44.127  160.059 1.00 101.12 ? 311 ALA B O   1 
ATOM   3901 C CB  . ALA B 1 228 ? 25.321  43.462  160.428 1.00 102.47 ? 311 ALA B CB  1 
ATOM   3902 N N   . ARG B 1 229 ? 22.519  41.890  160.019 1.00 102.57 ? 312 ARG B N   1 
ATOM   3903 C CA  . ARG B 1 229 ? 21.368  41.635  159.156 1.00 103.35 ? 312 ARG B CA  1 
ATOM   3904 C C   . ARG B 1 229 ? 20.072  42.004  159.851 1.00 103.17 ? 312 ARG B C   1 
ATOM   3905 O O   . ARG B 1 229 ? 19.199  42.620  159.252 1.00 106.64 ? 312 ARG B O   1 
ATOM   3906 C CB  . ARG B 1 229 ? 21.329  40.164  158.746 1.00 105.03 ? 312 ARG B CB  1 
ATOM   3907 C CG  . ARG B 1 229 ? 20.257  39.761  157.733 1.00 103.94 ? 312 ARG B CG  1 
ATOM   3908 C CD  . ARG B 1 229 ? 20.326  38.264  157.459 1.00 105.25 ? 312 ARG B CD  1 
ATOM   3909 N NE  . ARG B 1 229 ? 21.685  37.874  157.085 1.00 106.58 ? 312 ARG B NE  1 
ATOM   3910 C CZ  . ARG B 1 229 ? 22.182  37.899  155.852 1.00 111.44 ? 312 ARG B CZ  1 
ATOM   3911 N NH1 . ARG B 1 229 ? 21.433  38.248  154.806 1.00 113.55 ? 312 ARG B NH1 1 
ATOM   3912 N NH2 . ARG B 1 229 ? 23.450  37.555  155.657 1.00 116.02 ? 312 ARG B NH2 1 
ATOM   3913 N N   . CYS B 1 230 ? 19.947  41.638  161.113 1.00 102.02 ? 313 CYS B N   1 
ATOM   3914 C CA  . CYS B 1 230 ? 18.710  41.855  161.817 1.00 108.37 ? 313 CYS B CA  1 
ATOM   3915 C C   . CYS B 1 230 ? 18.740  43.173  162.618 1.00 103.91 ? 313 CYS B C   1 
ATOM   3916 O O   . CYS B 1 230 ? 17.828  43.457  163.396 1.00 110.76 ? 313 CYS B O   1 
ATOM   3917 C CB  . CYS B 1 230 ? 18.388  40.603  162.648 1.00 115.89 ? 313 CYS B CB  1 
ATOM   3918 S SG  . CYS B 1 230 ? 19.485  40.380  164.045 1.00 129.06 ? 313 CYS B SG  1 
ATOM   3919 N N   . LEU B 1 231 ? 19.805  43.959  162.457 1.00 102.66 ? 314 LEU B N   1 
ATOM   3920 C CA  . LEU B 1 231 ? 19.792  45.400  162.782 1.00 100.14 ? 314 LEU B CA  1 
ATOM   3921 C C   . LEU B 1 231 ? 19.190  46.159  161.639 1.00 100.16 ? 314 LEU B C   1 
ATOM   3922 O O   . LEU B 1 231 ? 18.433  47.089  161.863 1.00 101.43 ? 314 LEU B O   1 
ATOM   3923 C CB  . LEU B 1 231 ? 21.201  45.970  163.041 1.00 97.72  ? 314 LEU B CB  1 
ATOM   3924 C CG  . LEU B 1 231 ? 21.360  47.479  163.331 1.00 94.15  ? 314 LEU B CG  1 
ATOM   3925 C CD1 . LEU B 1 231 ? 20.472  47.971  164.460 1.00 90.20  ? 314 LEU B CD1 1 
ATOM   3926 C CD2 . LEU B 1 231 ? 22.820  47.806  163.662 1.00 95.87  ? 314 LEU B CD2 1 
ATOM   3927 N N   . ILE B 1 232 ? 19.610  45.808  160.421 1.00 99.64  ? 315 ILE B N   1 
ATOM   3928 C CA  . ILE B 1 232 ? 19.092  46.405  159.199 1.00 96.24  ? 315 ILE B CA  1 
ATOM   3929 C C   . ILE B 1 232 ? 17.593  46.204  159.131 1.00 97.81  ? 315 ILE B C   1 
ATOM   3930 O O   . ILE B 1 232 ? 16.860  47.172  158.949 1.00 99.96  ? 315 ILE B O   1 
ATOM   3931 C CB  . ILE B 1 232 ? 19.766  45.828  157.938 1.00 98.53  ? 315 ILE B CB  1 
ATOM   3932 C CG1 . ILE B 1 232 ? 21.203  46.370  157.838 1.00 100.39 ? 315 ILE B CG1 1 
ATOM   3933 C CG2 . ILE B 1 232 ? 18.981  46.187  156.672 1.00 99.85  ? 315 ILE B CG2 1 
ATOM   3934 C CD1 . ILE B 1 232 ? 22.101  45.594  156.898 1.00 103.30 ? 315 ILE B CD1 1 
ATOM   3935 N N   . ARG B 1 233 ? 17.140  44.964  159.313 1.00 100.20 ? 316 ARG B N   1 
ATOM   3936 C CA  . ARG B 1 233 ? 15.709  44.663  159.245 1.00 96.77  ? 316 ARG B CA  1 
ATOM   3937 C C   . ARG B 1 233 ? 14.908  45.270  160.405 1.00 95.25  ? 316 ARG B C   1 
ATOM   3938 O O   . ARG B 1 233 ? 13.734  45.544  160.228 1.00 100.58 ? 316 ARG B O   1 
ATOM   3939 C CB  . ARG B 1 233 ? 15.450  43.160  159.042 1.00 97.76  ? 316 ARG B CB  1 
ATOM   3940 C CG  . ARG B 1 233 ? 15.630  42.735  157.586 1.00 104.53 ? 316 ARG B CG  1 
ATOM   3941 C CD  . ARG B 1 233 ? 14.727  41.572  157.115 1.00 111.84 ? 316 ARG B CD  1 
ATOM   3942 N NE  . ARG B 1 233 ? 15.423  40.781  156.083 1.00 122.11 ? 316 ARG B NE  1 
ATOM   3943 C CZ  . ARG B 1 233 ? 15.542  41.127  154.787 1.00 127.10 ? 316 ARG B CZ  1 
ATOM   3944 N NH1 . ARG B 1 233 ? 15.002  42.249  154.307 1.00 128.23 ? 316 ARG B NH1 1 
ATOM   3945 N NH2 . ARG B 1 233 ? 16.214  40.338  153.948 1.00 130.56 ? 316 ARG B NH2 1 
ATOM   3946 N N   . SER B 1 234 ? 15.537  45.533  161.554 1.00 92.80  ? 317 SER B N   1 
ATOM   3947 C CA  . SER B 1 234 ? 14.918  46.355  162.612 1.00 90.26  ? 317 SER B CA  1 
ATOM   3948 C C   . SER B 1 234 ? 14.647  47.812  162.202 1.00 89.28  ? 317 SER B C   1 
ATOM   3949 O O   . SER B 1 234 ? 13.775  48.441  162.763 1.00 90.92  ? 317 SER B O   1 
ATOM   3950 C CB  . SER B 1 234 ? 15.797  46.411  163.864 1.00 93.84  ? 317 SER B CB  1 
ATOM   3951 O OG  . SER B 1 234 ? 16.110  45.129  164.351 1.00 106.16 ? 317 SER B OG  1 
ATOM   3952 N N   . LEU B 1 235 ? 15.455  48.380  161.315 1.00 86.96  ? 318 LEU B N   1 
ATOM   3953 C CA  . LEU B 1 235 ? 15.334  49.783  160.962 1.00 86.45  ? 318 LEU B CA  1 
ATOM   3954 C C   . LEU B 1 235 ? 14.473  49.963  159.713 1.00 87.49  ? 318 LEU B C   1 
ATOM   3955 O O   . LEU B 1 235 ? 13.699  50.904  159.631 1.00 84.89  ? 318 LEU B O   1 
ATOM   3956 C CB  . LEU B 1 235 ? 16.728  50.394  160.761 1.00 86.46  ? 318 LEU B CB  1 
ATOM   3957 C CG  . LEU B 1 235 ? 17.757  50.216  161.880 1.00 84.12  ? 318 LEU B CG  1 
ATOM   3958 C CD1 . LEU B 1 235 ? 19.071  50.906  161.541 1.00 86.25  ? 318 LEU B CD1 1 
ATOM   3959 C CD2 . LEU B 1 235 ? 17.267  50.714  163.225 1.00 83.88  ? 318 LEU B CD2 1 
ATOM   3960 N N   . LEU B 1 236 ? 14.611  49.060  158.748 1.00 89.34  ? 319 LEU B N   1 
ATOM   3961 C CA  . LEU B 1 236 ? 13.845  49.120  157.517 1.00 90.89  ? 319 LEU B CA  1 
ATOM   3962 C C   . LEU B 1 236 ? 12.518  48.359  157.639 1.00 92.63  ? 319 LEU B C   1 
ATOM   3963 O O   . LEU B 1 236 ? 12.152  47.607  156.744 1.00 93.98  ? 319 LEU B O   1 
ATOM   3964 C CB  . LEU B 1 236 ? 14.691  48.605  156.333 1.00 93.25  ? 319 LEU B CB  1 
ATOM   3965 C CG  . LEU B 1 236 ? 16.025  49.339  156.104 1.00 95.80  ? 319 LEU B CG  1 
ATOM   3966 C CD1 . LEU B 1 236 ? 16.779  48.799  154.896 1.00 99.15  ? 319 LEU B CD1 1 
ATOM   3967 C CD2 . LEU B 1 236 ? 15.801  50.831  155.928 1.00 99.41  ? 319 LEU B CD2 1 
ATOM   3968 N N   . ARG B 1 237 ? 11.791  48.579  158.733 1.00 92.73  ? 320 ARG B N   1 
ATOM   3969 C CA  . ARG B 1 237 ? 10.461  48.008  158.912 1.00 96.74  ? 320 ARG B CA  1 
ATOM   3970 C C   . ARG B 1 237 ? 9.478   48.884  158.193 1.00 98.64  ? 320 ARG B C   1 
ATOM   3971 O O   . ARG B 1 237 ? 9.649   50.097  158.156 1.00 99.23  ? 320 ARG B O   1 
ATOM   3972 C CB  . ARG B 1 237 ? 10.058  47.962  160.383 1.00 98.24  ? 320 ARG B CB  1 
ATOM   3973 C CG  . ARG B 1 237 ? 10.940  47.100  161.262 1.00 96.38  ? 320 ARG B CG  1 
ATOM   3974 C CD  . ARG B 1 237 ? 10.485  45.672  161.475 1.00 99.75  ? 320 ARG B CD  1 
ATOM   3975 N NE  . ARG B 1 237 ? 11.092  45.274  162.742 1.00 102.09 ? 320 ARG B NE  1 
ATOM   3976 C CZ  . ARG B 1 237 ? 11.672  44.110  163.004 1.00 107.14 ? 320 ARG B CZ  1 
ATOM   3977 N NH1 . ARG B 1 237 ? 11.747  43.143  162.084 1.00 111.48 ? 320 ARG B NH1 1 
ATOM   3978 N NH2 . ARG B 1 237 ? 12.198  43.927  164.210 1.00 104.38 ? 320 ARG B NH2 1 
ATOM   3979 N N   . ARG B 1 238 ? 8.411   48.272  157.690 1.00 104.28 ? 321 ARG B N   1 
ATOM   3980 C CA  . ARG B 1 238 ? 7.431   48.964  156.843 1.00 106.66 ? 321 ARG B CA  1 
ATOM   3981 C C   . ARG B 1 238 ? 6.595   49.894  157.729 1.00 103.89 ? 321 ARG B C   1 
ATOM   3982 O O   . ARG B 1 238 ? 6.365   51.055  157.414 1.00 99.44  ? 321 ARG B O   1 
ATOM   3983 C CB  . ARG B 1 238 ? 6.511   47.974  156.087 1.00 115.37 ? 321 ARG B CB  1 
ATOM   3984 C CG  . ARG B 1 238 ? 7.078   46.557  155.676 1.00 127.00 ? 321 ARG B CG  1 
ATOM   3985 C CD  . ARG B 1 238 ? 6.412   45.918  154.436 1.00 130.94 ? 321 ARG B CD  1 
ATOM   3986 N NE  . ARG B 1 238 ? 5.663   46.860  153.600 1.00 137.15 ? 321 ARG B NE  1 
ATOM   3987 C CZ  . ARG B 1 238 ? 6.213   47.817  152.841 1.00 142.21 ? 321 ARG B CZ  1 
ATOM   3988 N NH1 . ARG B 1 238 ? 7.534   47.993  152.799 1.00 144.25 ? 321 ARG B NH1 1 
ATOM   3989 N NH2 . ARG B 1 238 ? 5.437   48.629  152.128 1.00 143.94 ? 321 ARG B NH2 1 
ATOM   3990 N N   . GLU B 1 239 ? 6.152   49.363  158.856 1.00 106.70 ? 322 GLU B N   1 
ATOM   3991 C CA  . GLU B 1 239 ? 5.398   50.116  159.837 1.00 108.11 ? 322 GLU B CA  1 
ATOM   3992 C C   . GLU B 1 239 ? 6.383   50.957  160.651 1.00 103.29 ? 322 GLU B C   1 
ATOM   3993 O O   . GLU B 1 239 ? 7.333   50.412  161.200 1.00 103.79 ? 322 GLU B O   1 
ATOM   3994 C CB  . GLU B 1 239 ? 4.638   49.133  160.723 1.00 108.92 ? 322 GLU B CB  1 
ATOM   3995 C CG  . GLU B 1 239 ? 4.018   49.733  161.969 1.00 114.55 ? 322 GLU B CG  1 
ATOM   3996 C CD  . GLU B 1 239 ? 2.929   50.757  161.653 1.00 119.63 ? 322 GLU B CD  1 
ATOM   3997 O OE1 . GLU B 1 239 ? 2.022   50.360  160.901 1.00 123.95 ? 322 GLU B OE1 1 
ATOM   3998 O OE2 . GLU B 1 239 ? 2.974   51.934  162.133 1.00 117.57 ? 322 GLU B OE2 1 
ATOM   3999 N N   . PRO B 1 240 ? 6.163   52.284  160.730 1.00 101.87 ? 323 PRO B N   1 
ATOM   4000 C CA  . PRO B 1 240 ? 7.153   53.129  161.416 1.00 98.41  ? 323 PRO B CA  1 
ATOM   4001 C C   . PRO B 1 240 ? 7.313   52.869  162.892 1.00 94.19  ? 323 PRO B C   1 
ATOM   4002 O O   . PRO B 1 240 ? 8.427   52.940  163.408 1.00 93.49  ? 323 PRO B O   1 
ATOM   4003 C CB  . PRO B 1 240 ? 6.617   54.544  161.190 1.00 100.46 ? 323 PRO B CB  1 
ATOM   4004 C CG  . PRO B 1 240 ? 5.836   54.443  159.928 1.00 101.03 ? 323 PRO B CG  1 
ATOM   4005 C CD  . PRO B 1 240 ? 5.169   53.108  160.011 1.00 101.00 ? 323 PRO B CD  1 
ATOM   4006 N N   . SER B 1 241 ? 6.211   52.550  163.556 1.00 96.55  ? 324 SER B N   1 
ATOM   4007 C CA  . SER B 1 241 ? 6.227   52.304  164.991 1.00 98.32  ? 324 SER B CA  1 
ATOM   4008 C C   . SER B 1 241 ? 6.993   51.027  165.372 1.00 96.07  ? 324 SER B C   1 
ATOM   4009 O O   . SER B 1 241 ? 7.426   50.908  166.512 1.00 99.30  ? 324 SER B O   1 
ATOM   4010 C CB  . SER B 1 241 ? 4.803   52.260  165.536 1.00 100.88 ? 324 SER B CB  1 
ATOM   4011 O OG  . SER B 1 241 ? 3.984   51.436  164.728 1.00 110.69 ? 324 SER B OG  1 
ATOM   4012 N N   . GLU B 1 242 ? 7.145   50.087  164.438 1.00 93.82  ? 325 GLU B N   1 
ATOM   4013 C CA  . GLU B 1 242 ? 7.932   48.882  164.675 1.00 93.64  ? 325 GLU B CA  1 
ATOM   4014 C C   . GLU B 1 242 ? 9.438   49.137  164.680 1.00 92.43  ? 325 GLU B C   1 
ATOM   4015 O O   . GLU B 1 242 ? 10.181  48.411  165.320 1.00 95.00  ? 325 GLU B O   1 
ATOM   4016 C CB  . GLU B 1 242 ? 7.595   47.807  163.645 1.00 100.13 ? 325 GLU B CB  1 
ATOM   4017 C CG  . GLU B 1 242 ? 6.208   47.206  163.822 1.00 110.54 ? 325 GLU B CG  1 
ATOM   4018 C CD  . GLU B 1 242 ? 5.841   46.204  162.736 1.00 121.71 ? 325 GLU B CD  1 
ATOM   4019 O OE1 . GLU B 1 242 ? 6.746   45.741  161.992 1.00 125.56 ? 325 GLU B OE1 1 
ATOM   4020 O OE2 . GLU B 1 242 ? 4.632   45.886  162.631 1.00 124.35 ? 325 GLU B OE2 1 
ATOM   4021 N N   . ARG B 1 243 ? 9.896   50.171  163.990 1.00 92.81  ? 326 ARG B N   1 
ATOM   4022 C CA  . ARG B 1 243 ? 11.332  50.487  163.923 1.00 87.63  ? 326 ARG B CA  1 
ATOM   4023 C C   . ARG B 1 243 ? 11.923  50.839  165.280 1.00 87.92  ? 326 ARG B C   1 
ATOM   4024 O O   . ARG B 1 243 ? 11.227  51.361  166.135 1.00 94.39  ? 326 ARG B O   1 
ATOM   4025 C CB  . ARG B 1 243 ? 11.563  51.681  163.001 1.00 87.75  ? 326 ARG B CB  1 
ATOM   4026 C CG  . ARG B 1 243 ? 11.162  51.431  161.570 1.00 87.08  ? 326 ARG B CG  1 
ATOM   4027 C CD  . ARG B 1 243 ? 11.247  52.688  160.750 1.00 87.64  ? 326 ARG B CD  1 
ATOM   4028 N NE  . ARG B 1 243 ? 10.373  52.555  159.600 1.00 90.88  ? 326 ARG B NE  1 
ATOM   4029 C CZ  . ARG B 1 243 ? 9.821   53.565  158.934 1.00 97.02  ? 326 ARG B CZ  1 
ATOM   4030 N NH1 . ARG B 1 243 ? 10.056  54.839  159.276 1.00 99.81  ? 326 ARG B NH1 1 
ATOM   4031 N NH2 . ARG B 1 243 ? 9.018   53.299  157.910 1.00 99.32  ? 326 ARG B NH2 1 
ATOM   4032 N N   . LEU B 1 244 ? 13.220  50.625  165.450 1.00 87.09  ? 327 LEU B N   1 
ATOM   4033 C CA  . LEU B 1 244 ? 13.893  51.054  166.659 1.00 89.11  ? 327 LEU B CA  1 
ATOM   4034 C C   . LEU B 1 244 ? 14.039  52.590  166.745 1.00 90.08  ? 327 LEU B C   1 
ATOM   4035 O O   . LEU B 1 244 ? 13.971  53.312  165.771 1.00 95.66  ? 327 LEU B O   1 
ATOM   4036 C CB  . LEU B 1 244 ? 15.278  50.425  166.748 1.00 95.41  ? 327 LEU B CB  1 
ATOM   4037 C CG  . LEU B 1 244 ? 15.371  48.898  166.780 1.00 96.13  ? 327 LEU B CG  1 
ATOM   4038 C CD1 . LEU B 1 244 ? 16.810  48.453  166.541 1.00 96.13  ? 327 LEU B CD1 1 
ATOM   4039 C CD2 . LEU B 1 244 ? 14.871  48.330  168.093 1.00 96.04  ? 327 LEU B CD2 1 
ATOM   4040 N N   . THR B 1 245 ? 14.138  53.060  167.969 1.00 88.81  ? 328 THR B N   1 
ATOM   4041 C CA  . THR B 1 245 ? 14.478  54.407  168.339 1.00 89.27  ? 328 THR B CA  1 
ATOM   4042 C C   . THR B 1 245 ? 15.963  54.583  168.175 1.00 90.19  ? 328 THR B C   1 
ATOM   4043 O O   . THR B 1 245 ? 16.681  53.629  168.357 1.00 102.55 ? 328 THR B O   1 
ATOM   4044 C CB  . THR B 1 245 ? 14.094  54.493  169.848 1.00 90.00  ? 328 THR B CB  1 
ATOM   4045 O OG1 . THR B 1 245 ? 12.706  54.751  169.968 1.00 93.54  ? 328 THR B OG1 1 
ATOM   4046 C CG2 . THR B 1 245 ? 14.827  55.489  170.619 1.00 92.78  ? 328 THR B CG2 1 
ATOM   4047 N N   . ALA B 1 246 ? 16.431  55.797  167.893 1.00 89.15  ? 329 ALA B N   1 
ATOM   4048 C CA  . ALA B 1 246 ? 17.862  56.026  167.772 1.00 91.44  ? 329 ALA B CA  1 
ATOM   4049 C C   . ALA B 1 246 ? 18.610  55.735  169.090 1.00 95.10  ? 329 ALA B C   1 
ATOM   4050 O O   . ALA B 1 246 ? 19.739  55.237  169.057 1.00 95.64  ? 329 ALA B O   1 
ATOM   4051 C CB  . ALA B 1 246 ? 18.161  57.437  167.265 1.00 92.70  ? 329 ALA B CB  1 
ATOM   4052 N N   . PRO B 1 247 ? 18.018  56.092  170.244 1.00 93.63  ? 330 PRO B N   1 
ATOM   4053 C CA  . PRO B 1 247 ? 18.591  55.647  171.504 1.00 98.11  ? 330 PRO B CA  1 
ATOM   4054 C C   . PRO B 1 247 ? 18.832  54.147  171.636 1.00 103.95 ? 330 PRO B C   1 
ATOM   4055 O O   . PRO B 1 247 ? 19.881  53.751  172.171 1.00 112.54 ? 330 PRO B O   1 
ATOM   4056 C CB  . PRO B 1 247 ? 17.552  56.110  172.525 1.00 98.77  ? 330 PRO B CB  1 
ATOM   4057 C CG  . PRO B 1 247 ? 17.034  57.379  171.945 1.00 100.38 ? 330 PRO B CG  1 
ATOM   4058 C CD  . PRO B 1 247 ? 17.306  57.363  170.449 1.00 96.82  ? 330 PRO B CD  1 
ATOM   4059 N N   . GLU B 1 248 ? 17.887  53.329  171.171 1.00 98.74  ? 331 GLU B N   1 
ATOM   4060 C CA  . GLU B 1 248 ? 18.022  51.898  171.324 1.00 98.01  ? 331 GLU B CA  1 
ATOM   4061 C C   . GLU B 1 248 ? 18.888  51.258  170.227 1.00 101.58 ? 331 GLU B C   1 
ATOM   4062 O O   . GLU B 1 248 ? 19.499  50.222  170.471 1.00 108.17 ? 331 GLU B O   1 
ATOM   4063 C CB  . GLU B 1 248 ? 16.670  51.204  171.565 1.00 96.83  ? 331 GLU B CB  1 
ATOM   4064 C CG  . GLU B 1 248 ? 15.636  51.183  170.451 1.00 98.35  ? 331 GLU B CG  1 
ATOM   4065 C CD  . GLU B 1 248 ? 14.175  51.035  170.965 1.00 103.87 ? 331 GLU B CD  1 
ATOM   4066 O OE1 . GLU B 1 248 ? 13.947  50.904  172.187 1.00 106.41 ? 331 GLU B OE1 1 
ATOM   4067 O OE2 . GLU B 1 248 ? 13.219  51.063  170.142 1.00 105.64 ? 331 GLU B OE2 1 
ATOM   4068 N N   . ILE B 1 249 ? 19.001  51.867  169.049 1.00 98.15  ? 332 ILE B N   1 
ATOM   4069 C CA  . ILE B 1 249 ? 19.985  51.390  168.062 1.00 94.77  ? 332 ILE B CA  1 
ATOM   4070 C C   . ILE B 1 249 ? 21.357  51.345  168.712 1.00 92.87  ? 332 ILE B C   1 
ATOM   4071 O O   . ILE B 1 249 ? 22.071  50.372  168.547 1.00 97.93  ? 332 ILE B O   1 
ATOM   4072 C CB  . ILE B 1 249 ? 20.112  52.303  166.834 1.00 95.89  ? 332 ILE B CB  1 
ATOM   4073 C CG1 . ILE B 1 249 ? 18.847  52.280  166.003 1.00 93.93  ? 332 ILE B CG1 1 
ATOM   4074 C CG2 . ILE B 1 249 ? 21.275  51.854  165.945 1.00 100.15 ? 332 ILE B CG2 1 
ATOM   4075 C CD1 . ILE B 1 249 ? 18.801  53.383  164.970 1.00 97.47  ? 332 ILE B CD1 1 
ATOM   4076 N N   . LEU B 1 250 ? 21.707  52.403  169.445 1.00 90.76  ? 333 LEU B N   1 
ATOM   4077 C CA  . LEU B 1 250 ? 23.013  52.534  170.116 1.00 92.03  ? 333 LEU B CA  1 
ATOM   4078 C C   . LEU B 1 250 ? 23.385  51.403  171.074 1.00 95.19  ? 333 LEU B C   1 
ATOM   4079 O O   . LEU B 1 250 ? 24.578  51.212  171.363 1.00 95.86  ? 333 LEU B O   1 
ATOM   4080 C CB  . LEU B 1 250 ? 23.102  53.847  170.914 1.00 89.20  ? 333 LEU B CB  1 
ATOM   4081 C CG  . LEU B 1 250 ? 23.270  55.157  170.138 1.00 85.92  ? 333 LEU B CG  1 
ATOM   4082 C CD1 . LEU B 1 250 ? 23.241  56.319  171.127 1.00 83.64  ? 333 LEU B CD1 1 
ATOM   4083 C CD2 . LEU B 1 250 ? 24.543  55.187  169.285 1.00 83.70  ? 333 LEU B CD2 1 
ATOM   4084 N N   . LEU B 1 251 ? 22.365  50.693  171.568 1.00 93.46  ? 334 LEU B N   1 
ATOM   4085 C CA  . LEU B 1 251 ? 22.518  49.558  172.460 1.00 90.19  ? 334 LEU B CA  1 
ATOM   4086 C C   . LEU B 1 251 ? 22.266  48.202  171.774 1.00 86.98  ? 334 LEU B C   1 
ATOM   4087 O O   . LEU B 1 251 ? 21.936  47.247  172.457 1.00 94.99  ? 334 LEU B O   1 
ATOM   4088 C CB  . LEU B 1 251 ? 21.526  49.709  173.633 1.00 91.87  ? 334 LEU B CB  1 
ATOM   4089 C CG  . LEU B 1 251 ? 21.357  51.091  174.287 1.00 92.68  ? 334 LEU B CG  1 
ATOM   4090 C CD1 . LEU B 1 251 ? 20.208  51.095  175.294 1.00 90.55  ? 334 LEU B CD1 1 
ATOM   4091 C CD2 . LEU B 1 251 ? 22.658  51.542  174.943 1.00 92.97  ? 334 LEU B CD2 1 
ATOM   4092 N N   . HIS B 1 252 ? 22.413  48.092  170.457 1.00 84.86  ? 335 HIS B N   1 
ATOM   4093 C CA  . HIS B 1 252 ? 22.072  46.843  169.759 1.00 89.77  ? 335 HIS B CA  1 
ATOM   4094 C C   . HIS B 1 252 ? 23.326  45.969  169.584 1.00 93.04  ? 335 HIS B C   1 
ATOM   4095 O O   . HIS B 1 252 ? 24.325  46.447  169.066 1.00 93.26  ? 335 HIS B O   1 
ATOM   4096 C CB  . HIS B 1 252 ? 21.331  47.153  168.433 1.00 91.56  ? 335 HIS B CB  1 
ATOM   4097 C CG  . HIS B 1 252 ? 20.955  45.954  167.613 1.00 91.12  ? 335 HIS B CG  1 
ATOM   4098 N ND1 . HIS B 1 252 ? 21.901  45.169  167.007 1.00 90.80  ? 335 HIS B ND1 1 
ATOM   4099 C CD2 . HIS B 1 252 ? 19.750  45.447  167.239 1.00 90.43  ? 335 HIS B CD2 1 
ATOM   4100 C CE1 . HIS B 1 252 ? 21.314  44.212  166.319 1.00 90.82  ? 335 HIS B CE1 1 
ATOM   4101 N NE2 . HIS B 1 252 ? 20.004  44.360  166.435 1.00 93.35  ? 335 HIS B NE2 1 
ATOM   4102 N N   . PRO B 1 253 ? 23.266  44.680  170.014 1.00 95.23  ? 336 PRO B N   1 
ATOM   4103 C CA  . PRO B 1 253 ? 24.382  43.744  170.044 1.00 97.38  ? 336 PRO B CA  1 
ATOM   4104 C C   . PRO B 1 253 ? 25.459  43.879  168.974 1.00 100.61 ? 336 PRO B C   1 
ATOM   4105 O O   . PRO B 1 253 ? 26.639  43.771  169.290 1.00 109.54 ? 336 PRO B O   1 
ATOM   4106 C CB  . PRO B 1 253 ? 23.678  42.401  169.890 1.00 100.85 ? 336 PRO B CB  1 
ATOM   4107 C CG  . PRO B 1 253 ? 22.465  42.587  170.733 1.00 99.67  ? 336 PRO B CG  1 
ATOM   4108 C CD  . PRO B 1 253 ? 22.030  44.003  170.465 1.00 97.14  ? 336 PRO B CD  1 
ATOM   4109 N N   . TRP B 1 254 ? 25.069  44.041  167.716 1.00 98.67  ? 337 TRP B N   1 
ATOM   4110 C CA  . TRP B 1 254 ? 26.036  44.199  166.612 1.00 96.76  ? 337 TRP B CA  1 
ATOM   4111 C C   . TRP B 1 254 ? 27.309  44.955  166.986 1.00 97.63  ? 337 TRP B C   1 
ATOM   4112 O O   . TRP B 1 254 ? 28.410  44.462  166.737 1.00 97.46  ? 337 TRP B O   1 
ATOM   4113 C CB  . TRP B 1 254 ? 25.381  44.848  165.395 1.00 92.55  ? 337 TRP B CB  1 
ATOM   4114 C CG  . TRP B 1 254 ? 26.302  44.938  164.234 1.00 94.44  ? 337 TRP B CG  1 
ATOM   4115 C CD1 . TRP B 1 254 ? 26.990  43.918  163.668 1.00 97.73  ? 337 TRP B CD1 1 
ATOM   4116 C CD2 . TRP B 1 254 ? 26.639  46.124  163.481 1.00 96.74  ? 337 TRP B CD2 1 
ATOM   4117 N NE1 . TRP B 1 254 ? 27.759  44.387  162.617 1.00 103.03 ? 337 TRP B NE1 1 
ATOM   4118 C CE2 . TRP B 1 254 ? 27.546  45.736  162.476 1.00 100.00 ? 337 TRP B CE2 1 
ATOM   4119 C CE3 . TRP B 1 254 ? 26.258  47.470  163.560 1.00 93.44  ? 337 TRP B CE3 1 
ATOM   4120 C CZ2 . TRP B 1 254 ? 28.083  46.646  161.559 1.00 100.38 ? 337 TRP B CZ2 1 
ATOM   4121 C CZ3 . TRP B 1 254 ? 26.792  48.364  162.661 1.00 93.92  ? 337 TRP B CZ3 1 
ATOM   4122 C CH2 . TRP B 1 254 ? 27.692  47.951  161.667 1.00 97.01  ? 337 TRP B CH2 1 
ATOM   4123 N N   . PHE B 1 255 ? 27.149  46.125  167.601 1.00 99.95  ? 338 PHE B N   1 
ATOM   4124 C CA  . PHE B 1 255 ? 28.277  47.043  167.851 1.00 103.12 ? 338 PHE B CA  1 
ATOM   4125 C C   . PHE B 1 255 ? 29.365  46.401  168.726 1.00 106.06 ? 338 PHE B C   1 
ATOM   4126 O O   . PHE B 1 255 ? 30.551  46.438  168.373 1.00 116.13 ? 338 PHE B O   1 
ATOM   4127 C CB  . PHE B 1 255 ? 27.788  48.389  168.439 1.00 99.28  ? 338 PHE B CB  1 
ATOM   4128 C CG  . PHE B 1 255 ? 26.960  49.206  167.475 1.00 96.15  ? 338 PHE B CG  1 
ATOM   4129 C CD1 . PHE B 1 255 ? 27.569  49.934  166.454 1.00 96.62  ? 338 PHE B CD1 1 
ATOM   4130 C CD2 . PHE B 1 255 ? 25.581  49.248  167.581 1.00 92.24  ? 338 PHE B CD2 1 
ATOM   4131 C CE1 . PHE B 1 255 ? 26.818  50.680  165.565 1.00 91.28  ? 338 PHE B CE1 1 
ATOM   4132 C CE2 . PHE B 1 255 ? 24.821  49.980  166.686 1.00 89.36  ? 338 PHE B CE2 1 
ATOM   4133 C CZ  . PHE B 1 255 ? 25.443  50.697  165.686 1.00 91.22  ? 338 PHE B CZ  1 
ATOM   4134 N N   . GLU B 1 256 ? 28.959  45.824  169.858 1.00 102.43 ? 339 GLU B N   1 
ATOM   4135 C CA  . GLU B 1 256 ? 29.884  45.091  170.745 1.00 101.32 ? 339 GLU B CA  1 
ATOM   4136 C C   . GLU B 1 256 ? 30.425  43.810  170.091 1.00 100.28 ? 339 GLU B C   1 
ATOM   4137 O O   . GLU B 1 256 ? 31.613  43.500  170.225 1.00 107.12 ? 339 GLU B O   1 
ATOM   4138 C CB  . GLU B 1 256 ? 29.238  44.798  172.102 1.00 99.52  ? 339 GLU B CB  1 
ATOM   4139 C CG  . GLU B 1 256 ? 28.032  43.861  172.048 1.00 101.59 ? 339 GLU B CG  1 
ATOM   4140 C CD  . GLU B 1 256 ? 26.978  44.158  173.094 1.00 99.47  ? 339 GLU B CD  1 
ATOM   4141 O OE1 . GLU B 1 256 ? 26.526  45.319  173.192 1.00 105.64 ? 339 GLU B OE1 1 
ATOM   4142 O OE2 . GLU B 1 256 ? 26.597  43.235  173.828 1.00 97.57  ? 339 GLU B OE2 1 
ATOM   4143 N N   . SER B 1 257 ? 29.585  43.127  169.316 1.00 95.72  ? 340 SER B N   1 
ATOM   4144 C CA  . SER B 1 257 ? 30.006  41.944  168.561 1.00 95.56  ? 340 SER B CA  1 
ATOM   4145 C C   . SER B 1 257 ? 31.138  42.168  167.552 1.00 101.91 ? 340 SER B C   1 
ATOM   4146 O O   . SER B 1 257 ? 31.795  41.198  167.188 1.00 111.94 ? 340 SER B O   1 
ATOM   4147 C CB  . SER B 1 257 ? 28.824  41.307  167.820 1.00 94.07  ? 340 SER B CB  1 
ATOM   4148 O OG  . SER B 1 257 ? 28.766  41.669  166.448 1.00 89.93  ? 340 SER B OG  1 
ATOM   4149 N N   . VAL B 1 258 ? 31.324  43.404  167.054 1.00 108.12 ? 341 VAL B N   1 
ATOM   4150 C CA  . VAL B 1 258 ? 32.417  43.728  166.083 1.00 108.47 ? 341 VAL B CA  1 
ATOM   4151 C C   . VAL B 1 258 ? 33.473  44.749  166.465 1.00 109.21 ? 341 VAL B C   1 
ATOM   4152 O O   . VAL B 1 258 ? 34.359  44.981  165.679 1.00 108.49 ? 341 VAL B O   1 
ATOM   4153 C CB  . VAL B 1 258 ? 31.879  44.033  164.684 1.00 106.28 ? 341 VAL B CB  1 
ATOM   4154 C CG1 . VAL B 1 258 ? 31.023  42.878  164.234 1.00 106.41 ? 341 VAL B CG1 1 
ATOM   4155 C CG2 . VAL B 1 258 ? 31.073  45.304  164.660 1.00 106.39 ? 341 VAL B CG2 1 
ATOM   4156 N N   . LEU B 1 259 ? 33.396  45.307  167.667 1.00 112.70 ? 342 LEU B N   1 
ATOM   4157 C CA  . LEU B 1 259 ? 34.464  46.147  168.264 1.00 116.64 ? 342 LEU B CA  1 
ATOM   4158 C C   . LEU B 1 259 ? 35.933  45.540  168.329 1.00 124.73 ? 342 LEU B C   1 
ATOM   4159 O O   . LEU B 1 259 ? 36.981  46.195  168.114 1.00 126.32 ? 342 LEU B O   1 
ATOM   4160 C CB  . LEU B 1 259 ? 33.993  46.498  169.674 1.00 119.78 ? 342 LEU B CB  1 
ATOM   4161 C CG  . LEU B 1 259 ? 34.673  47.670  170.362 1.00 124.37 ? 342 LEU B CG  1 
ATOM   4162 C CD1 . LEU B 1 259 ? 33.924  48.948  170.020 1.00 122.66 ? 342 LEU B CD1 1 
ATOM   4163 C CD2 . LEU B 1 259 ? 34.721  47.424  171.868 1.00 132.11 ? 342 LEU B CD2 1 
ATOM   4164 N N   . ILE B 1 272 ? 2.987   40.508  173.397 1.00 145.50 ? 497 ILE B N   1 
ATOM   4165 C CA  . ILE B 1 272 ? 3.126   39.065  173.595 1.00 144.90 ? 497 ILE B CA  1 
ATOM   4166 C C   . ILE B 1 272 ? 3.467   38.339  172.302 1.00 151.93 ? 497 ILE B C   1 
ATOM   4167 O O   . ILE B 1 272 ? 3.070   38.756  171.211 1.00 161.57 ? 497 ILE B O   1 
ATOM   4168 C CB  . ILE B 1 272 ? 1.870   38.400  174.234 1.00 137.27 ? 497 ILE B CB  1 
ATOM   4169 C CG1 . ILE B 1 272 ? 2.316   37.513  175.408 1.00 135.09 ? 497 ILE B CG1 1 
ATOM   4170 C CG2 . ILE B 1 272 ? 1.008   37.647  173.203 1.00 133.72 ? 497 ILE B CG2 1 
ATOM   4171 C CD1 . ILE B 1 272 ? 1.279   36.566  175.957 1.00 137.23 ? 497 ILE B CD1 1 
ATOM   4172 N N   . CYS B 1 273 ? 4.175   37.226  172.468 1.00 153.78 ? 498 CYS B N   1 
ATOM   4173 C CA  . CYS B 1 273 ? 4.631   36.376  171.384 1.00 144.73 ? 498 CYS B CA  1 
ATOM   4174 C C   . CYS B 1 273 ? 3.761   35.124  171.399 1.00 139.15 ? 498 CYS B C   1 
ATOM   4175 O O   . CYS B 1 273 ? 2.980   34.946  172.326 1.00 136.48 ? 498 CYS B O   1 
ATOM   4176 C CB  . CYS B 1 273 ? 6.097   36.034  171.620 1.00 140.65 ? 498 CYS B CB  1 
ATOM   4177 S SG  . CYS B 1 273 ? 6.904   35.277  170.213 1.00 141.15 ? 498 CYS B SG  1 
ATOM   4178 N N   . GLU B 1 274 ? 3.845   34.296  170.359 1.00 135.81 ? 499 GLU B N   1 
ATOM   4179 C CA  . GLU B 1 274 ? 3.158   33.011  170.341 1.00 137.26 ? 499 GLU B CA  1 
ATOM   4180 C C   . GLU B 1 274 ? 3.931   31.900  171.023 1.00 134.24 ? 499 GLU B C   1 
ATOM   4181 O O   . GLU B 1 274 ? 3.320   30.884  171.343 1.00 137.22 ? 499 GLU B O   1 
ATOM   4182 C CB  . GLU B 1 274 ? 2.767   32.566  168.922 1.00 141.81 ? 499 GLU B CB  1 
ATOM   4183 C CG  . GLU B 1 274 ? 3.856   32.096  167.947 1.00 146.29 ? 499 GLU B CG  1 
ATOM   4184 C CD  . GLU B 1 274 ? 4.677   33.233  167.338 1.00 151.13 ? 499 GLU B CD  1 
ATOM   4185 O OE1 . GLU B 1 274 ? 4.104   33.942  166.488 1.00 154.92 ? 499 GLU B OE1 1 
ATOM   4186 O OE2 . GLU B 1 274 ? 5.878   33.435  167.686 1.00 153.30 ? 499 GLU B OE2 1 
ATOM   4187 N N   . HIS B 1 275 ? 5.250   32.079  171.206 1.00 126.01 ? 500 HIS B N   1 
ATOM   4188 C CA  . HIS B 1 275 ? 6.129   31.089  171.847 1.00 118.65 ? 500 HIS B CA  1 
ATOM   4189 C C   . HIS B 1 275 ? 7.045   31.777  172.853 1.00 112.40 ? 500 HIS B C   1 
ATOM   4190 O O   . HIS B 1 275 ? 7.651   32.803  172.517 1.00 102.56 ? 500 HIS B O   1 
ATOM   4191 C CB  . HIS B 1 275 ? 6.965   30.332  170.807 1.00 118.96 ? 500 HIS B CB  1 
ATOM   4192 C CG  . HIS B 1 275 ? 6.218   29.212  170.152 1.00 124.21 ? 500 HIS B CG  1 
ATOM   4193 N ND1 . HIS B 1 275 ? 5.688   28.151  170.864 1.00 125.32 ? 500 HIS B ND1 1 
ATOM   4194 C CD2 . HIS B 1 275 ? 5.886   28.998  168.857 1.00 124.78 ? 500 HIS B CD2 1 
ATOM   4195 C CE1 . HIS B 1 275 ? 5.074   27.327  170.034 1.00 126.94 ? 500 HIS B CE1 1 
ATOM   4196 N NE2 . HIS B 1 275 ? 5.174   27.821  168.812 1.00 128.29 ? 500 HIS B NE2 1 
ATOM   4197 N N   . GLU B 1 276 ? 7.141   31.203  174.070 1.00 107.16 ? 501 GLU B N   1 
ATOM   4198 C CA  . GLU B 1 276 ? 8.098   31.665  175.107 1.00 103.35 ? 501 GLU B CA  1 
ATOM   4199 C C   . GLU B 1 276 ? 9.284   30.714  175.201 1.00 104.04 ? 501 GLU B C   1 
ATOM   4200 O O   . GLU B 1 276 ? 9.468   29.997  176.176 1.00 111.35 ? 501 GLU B O   1 
ATOM   4201 C CB  . GLU B 1 276 ? 7.436   31.794  176.468 1.00 101.06 ? 501 GLU B CB  1 
ATOM   4202 C CG  . GLU B 1 276 ? 6.385   32.856  176.514 1.00 98.13  ? 501 GLU B CG  1 
ATOM   4203 C CD  . GLU B 1 276 ? 6.068   33.344  177.911 1.00 98.20  ? 501 GLU B CD  1 
ATOM   4204 O OE1 . GLU B 1 276 ? 5.991   32.526  178.867 1.00 97.19  ? 501 GLU B OE1 1 
ATOM   4205 O OE2 . GLU B 1 276 ? 5.866   34.571  178.039 1.00 94.97  ? 501 GLU B OE2 1 
ATOM   4206 N N   . THR B 1 277 ? 10.092  30.736  174.163 1.00 103.95 ? 502 THR B N   1 
ATOM   4207 C CA  . THR B 1 277 ? 11.179  29.807  174.011 1.00 105.85 ? 502 THR B CA  1 
ATOM   4208 C C   . THR B 1 277 ? 12.450  30.352  174.701 1.00 103.89 ? 502 THR B C   1 
ATOM   4209 O O   . THR B 1 277 ? 12.810  31.522  174.521 1.00 99.88  ? 502 THR B O   1 
ATOM   4210 C CB  . THR B 1 277 ? 11.370  29.512  172.508 1.00 108.34 ? 502 THR B CB  1 
ATOM   4211 O OG1 . THR B 1 277 ? 11.969  28.232  172.354 1.00 114.75 ? 502 THR B OG1 1 
ATOM   4212 C CG2 . THR B 1 277 ? 12.210  30.589  171.792 1.00 110.10 ? 502 THR B CG2 1 
ATOM   4213 N N   . SER B 1 278 ? 13.112  29.503  175.498 1.00 105.72 ? 503 SER B N   1 
ATOM   4214 C CA  . SER B 1 278 ? 14.353  29.884  176.213 1.00 103.12 ? 503 SER B CA  1 
ATOM   4215 C C   . SER B 1 278 ? 15.600  29.629  175.379 1.00 99.72  ? 503 SER B C   1 
ATOM   4216 O O   . SER B 1 278 ? 15.679  28.637  174.683 1.00 98.98  ? 503 SER B O   1 
ATOM   4217 C CB  . SER B 1 278 ? 14.463  29.142  177.535 1.00 105.08 ? 503 SER B CB  1 
ATOM   4218 O OG  . SER B 1 278 ? 13.633  29.742  178.506 1.00 106.47 ? 503 SER B OG  1 
ATOM   4219 N N   . ILE B 1 279 ? 16.562  30.538  175.450 1.00 99.14  ? 504 ILE B N   1 
ATOM   4220 C CA  . ILE B 1 279 ? 17.769  30.449  174.646 1.00 99.17  ? 504 ILE B CA  1 
ATOM   4221 C C   . ILE B 1 279 ? 19.020  30.903  175.392 1.00 101.41 ? 504 ILE B C   1 
ATOM   4222 O O   . ILE B 1 279 ? 18.944  31.472  176.487 1.00 100.33 ? 504 ILE B O   1 
ATOM   4223 C CB  . ILE B 1 279 ? 17.647  31.284  173.353 1.00 95.23  ? 504 ILE B CB  1 
ATOM   4224 C CG1 . ILE B 1 279 ? 17.562  32.787  173.659 1.00 90.87  ? 504 ILE B CG1 1 
ATOM   4225 C CG2 . ILE B 1 279 ? 16.470  30.805  172.521 1.00 93.76  ? 504 ILE B CG2 1 
ATOM   4226 C CD1 . ILE B 1 279 ? 17.644  33.638  172.425 1.00 89.28  ? 504 ILE B CD1 1 
ATOM   4227 N N   . ASP B 1 280 ? 20.166  30.645  174.760 1.00 104.15 ? 505 ASP B N   1 
ATOM   4228 C CA  . ASP B 1 280 ? 21.473  31.064  175.259 1.00 106.61 ? 505 ASP B CA  1 
ATOM   4229 C C   . ASP B 1 280 ? 21.656  32.526  174.954 1.00 101.87 ? 505 ASP B C   1 
ATOM   4230 O O   . ASP B 1 280 ? 21.954  32.899  173.823 1.00 101.77 ? 505 ASP B O   1 
ATOM   4231 C CB  . ASP B 1 280 ? 22.586  30.228  174.604 1.00 111.80 ? 505 ASP B CB  1 
ATOM   4232 C CG  . ASP B 1 280 ? 23.975  30.549  175.140 1.00 116.17 ? 505 ASP B CG  1 
ATOM   4233 O OD1 . ASP B 1 280 ? 24.111  31.000  176.303 1.00 118.07 ? 505 ASP B OD1 1 
ATOM   4234 O OD2 . ASP B 1 280 ? 24.942  30.320  174.387 1.00 117.82 ? 505 ASP B OD2 1 
ATOM   4235 N N   . ILE B 1 281 ? 21.491  33.345  175.986 1.00 101.48 ? 506 ILE B N   1 
ATOM   4236 C CA  . ILE B 1 281 ? 21.601  34.810  175.872 1.00 97.26  ? 506 ILE B CA  1 
ATOM   4237 C C   . ILE B 1 281 ? 23.053  35.209  175.608 1.00 99.69  ? 506 ILE B C   1 
ATOM   4238 O O   . ILE B 1 281 ? 23.298  36.125  174.837 1.00 98.73  ? 506 ILE B O   1 
ATOM   4239 C CB  . ILE B 1 281 ? 21.130  35.488  177.183 1.00 94.81  ? 506 ILE B CB  1 
ATOM   4240 C CG1 . ILE B 1 281 ? 19.701  35.039  177.610 1.00 94.41  ? 506 ILE B CG1 1 
ATOM   4241 C CG2 . ILE B 1 281 ? 21.166  36.985  177.085 1.00 90.45  ? 506 ILE B CG2 1 
ATOM   4242 C CD1 . ILE B 1 281 ? 18.606  35.210  176.559 1.00 91.62  ? 506 ILE B CD1 1 
ATOM   4243 N N   . SER B 1 282 ? 24.004  34.532  176.260 1.00 103.87 ? 507 SER B N   1 
ATOM   4244 C CA  . SER B 1 282 ? 25.433  34.753  176.011 1.00 105.89 ? 507 SER B CA  1 
ATOM   4245 C C   . SER B 1 282 ? 25.763  34.989  174.548 1.00 105.97 ? 507 SER B C   1 
ATOM   4246 O O   . SER B 1 282 ? 26.579  35.844  174.235 1.00 114.44 ? 507 SER B O   1 
ATOM   4247 C CB  . SER B 1 282 ? 26.254  33.568  176.472 1.00 110.86 ? 507 SER B CB  1 
ATOM   4248 O OG  . SER B 1 282 ? 26.012  33.308  177.829 1.00 123.55 ? 507 SER B OG  1 
ATOM   4249 N N   . ALA B 1 283 ? 25.142  34.218  173.663 1.00 104.94 ? 508 ALA B N   1 
ATOM   4250 C CA  . ALA B 1 283 ? 25.361  34.320  172.217 1.00 104.87 ? 508 ALA B CA  1 
ATOM   4251 C C   . ALA B 1 283 ? 25.005  35.663  171.578 1.00 106.26 ? 508 ALA B C   1 
ATOM   4252 O O   . ALA B 1 283 ? 25.407  35.917  170.443 1.00 110.01 ? 508 ALA B O   1 
ATOM   4253 C CB  . ALA B 1 283 ? 24.560  33.253  171.508 1.00 105.09 ? 508 ALA B CB  1 
ATOM   4254 N N   . TYR B 1 284 ? 24.210  36.487  172.258 1.00 105.10 ? 509 TYR B N   1 
ATOM   4255 C CA  . TYR B 1 284 ? 23.746  37.749  171.714 1.00 99.63  ? 509 TYR B CA  1 
ATOM   4256 C C   . TYR B 1 284 ? 24.443  38.967  172.337 1.00 101.94 ? 509 TYR B C   1 
ATOM   4257 O O   . TYR B 1 284 ? 24.069  40.102  172.087 1.00 105.42 ? 509 TYR B O   1 
ATOM   4258 C CB  . TYR B 1 284 ? 22.252  37.832  171.939 1.00 98.42  ? 509 TYR B CB  1 
ATOM   4259 C CG  . TYR B 1 284 ? 21.481  36.792  171.171 1.00 101.46 ? 509 TYR B CG  1 
ATOM   4260 C CD1 . TYR B 1 284 ? 21.232  35.544  171.711 1.00 103.77 ? 509 TYR B CD1 1 
ATOM   4261 C CD2 . TYR B 1 284 ? 20.972  37.069  169.906 1.00 103.57 ? 509 TYR B CD2 1 
ATOM   4262 C CE1 . TYR B 1 284 ? 20.501  34.598  171.006 1.00 104.18 ? 509 TYR B CE1 1 
ATOM   4263 C CE2 . TYR B 1 284 ? 20.241  36.130  169.198 1.00 102.26 ? 509 TYR B CE2 1 
ATOM   4264 C CZ  . TYR B 1 284 ? 20.009  34.899  169.751 1.00 101.47 ? 509 TYR B CZ  1 
ATOM   4265 O OH  . TYR B 1 284 ? 19.299  33.970  169.041 1.00 101.53 ? 509 TYR B OH  1 
ATOM   4266 N N   . ILE B 1 285 ? 25.491  38.739  173.107 1.00 105.19 ? 510 ILE B N   1 
ATOM   4267 C CA  . ILE B 1 285 ? 25.885  39.657  174.150 1.00 108.94 ? 510 ILE B CA  1 
ATOM   4268 C C   . ILE B 1 285 ? 27.418  39.632  174.263 1.00 110.45 ? 510 ILE B C   1 
ATOM   4269 O O   . ILE B 1 285 ? 28.043  38.583  174.116 1.00 110.56 ? 510 ILE B O   1 
ATOM   4270 C CB  . ILE B 1 285 ? 25.117  39.223  175.451 1.00 118.75 ? 510 ILE B CB  1 
ATOM   4271 C CG1 . ILE B 1 285 ? 23.672  39.748  175.456 1.00 122.86 ? 510 ILE B CG1 1 
ATOM   4272 C CG2 . ILE B 1 285 ? 25.775  39.661  176.741 1.00 121.69 ? 510 ILE B CG2 1 
ATOM   4273 C CD1 . ILE B 1 285 ? 23.531  41.262  175.477 1.00 122.62 ? 510 ILE B CD1 1 
ATOM   4274 N N   . ASP B 1 286 ? 28.017  40.806  174.434 1.00 113.27 ? 511 ASP B N   1 
ATOM   4275 C CA  . ASP B 1 286 ? 29.436  40.940  174.763 1.00 119.75 ? 511 ASP B CA  1 
ATOM   4276 C C   . ASP B 1 286 ? 29.548  42.062  175.768 1.00 114.93 ? 511 ASP B C   1 
ATOM   4277 O O   . ASP B 1 286 ? 30.141  43.091  175.480 1.00 115.29 ? 511 ASP B O   1 
ATOM   4278 C CB  . ASP B 1 286 ? 30.322  41.268  173.547 1.00 128.59 ? 511 ASP B CB  1 
ATOM   4279 C CG  . ASP B 1 286 ? 30.471  40.107  172.571 1.00 138.52 ? 511 ASP B CG  1 
ATOM   4280 O OD1 . ASP B 1 286 ? 29.471  39.802  171.859 1.00 133.31 ? 511 ASP B OD1 1 
ATOM   4281 O OD2 . ASP B 1 286 ? 31.608  39.542  172.498 1.00 147.76 ? 511 ASP B OD2 1 
ATOM   4282 N N   . PRO B 1 287 ? 29.004  41.862  176.973 1.00 112.29 ? 512 PRO B N   1 
ATOM   4283 C CA  . PRO B 1 287 ? 28.995  42.976  177.916 1.00 113.17 ? 512 PRO B CA  1 
ATOM   4284 C C   . PRO B 1 287 ? 30.374  43.609  178.094 1.00 113.40 ? 512 PRO B C   1 
ATOM   4285 O O   . PRO B 1 287 ? 30.454  44.823  178.272 1.00 110.83 ? 512 PRO B O   1 
ATOM   4286 C CB  . PRO B 1 287 ? 28.501  42.344  179.228 1.00 114.28 ? 512 PRO B CB  1 
ATOM   4287 C CG  . PRO B 1 287 ? 28.088  40.963  178.891 1.00 113.16 ? 512 PRO B CG  1 
ATOM   4288 C CD  . PRO B 1 287 ? 28.833  40.580  177.659 1.00 111.84 ? 512 PRO B CD  1 
ATOM   4289 N N   . ALA B 1 288 ? 31.421  42.773  178.034 1.00 116.12 ? 513 ALA B N   1 
ATOM   4290 C CA  . ALA B 1 288 ? 32.815  43.187  178.029 1.00 117.69 ? 513 ALA B CA  1 
ATOM   4291 C C   . ALA B 1 288 ? 33.035  44.365  177.105 1.00 119.06 ? 513 ALA B C   1 
ATOM   4292 O O   . ALA B 1 288 ? 33.508  45.410  177.532 1.00 122.82 ? 513 ALA B O   1 
ATOM   4293 C CB  . ALA B 1 288 ? 33.685  42.024  177.584 1.00 121.18 ? 513 ALA B CB  1 
ATOM   4294 N N   . ALA B 1 289 ? 32.661  44.191  175.841 1.00 118.04 ? 514 ALA B N   1 
ATOM   4295 C CA  . ALA B 1 289 ? 32.828  45.234  174.817 1.00 115.63 ? 514 ALA B CA  1 
ATOM   4296 C C   . ALA B 1 289 ? 31.825  46.390  174.937 1.00 117.78 ? 514 ALA B C   1 
ATOM   4297 O O   . ALA B 1 289 ? 32.103  47.508  174.497 1.00 118.60 ? 514 ALA B O   1 
ATOM   4298 C CB  . ALA B 1 289 ? 32.747  44.609  173.429 1.00 113.54 ? 514 ALA B CB  1 
ATOM   4299 N N   . PHE B 1 290 ? 30.653  46.091  175.493 1.00 121.36 ? 515 PHE B N   1 
ATOM   4300 C CA  . PHE B 1 290 ? 29.549  47.047  175.701 1.00 120.31 ? 515 PHE B CA  1 
ATOM   4301 C C   . PHE B 1 290 ? 29.894  48.176  176.682 1.00 125.62 ? 515 PHE B C   1 
ATOM   4302 O O   . PHE B 1 290 ? 29.597  49.351  176.405 1.00 125.03 ? 515 PHE B O   1 
ATOM   4303 C CB  . PHE B 1 290 ? 28.336  46.245  176.205 1.00 116.10 ? 515 PHE B CB  1 
ATOM   4304 C CG  . PHE B 1 290 ? 27.109  47.057  176.513 1.00 110.02 ? 515 PHE B CG  1 
ATOM   4305 C CD1 . PHE B 1 290 ? 26.305  47.550  175.494 1.00 103.63 ? 515 PHE B CD1 1 
ATOM   4306 C CD2 . PHE B 1 290 ? 26.712  47.264  177.838 1.00 110.07 ? 515 PHE B CD2 1 
ATOM   4307 C CE1 . PHE B 1 290 ? 25.153  48.269  175.788 1.00 102.95 ? 515 PHE B CE1 1 
ATOM   4308 C CE2 . PHE B 1 290 ? 25.554  47.984  178.134 1.00 107.51 ? 515 PHE B CE2 1 
ATOM   4309 C CZ  . PHE B 1 290 ? 24.771  48.488  177.109 1.00 101.87 ? 515 PHE B CZ  1 
ATOM   4310 N N   . ASN B 1 291 ? 30.522  47.787  177.803 1.00 127.93 ? 516 ASN B N   1 
ATOM   4311 C CA  . ASN B 1 291 ? 30.881  48.656  178.945 1.00 130.30 ? 516 ASN B CA  1 
ATOM   4312 C C   . ASN B 1 291 ? 29.643  49.031  179.760 1.00 123.39 ? 516 ASN B C   1 
ATOM   4313 O O   . ASN B 1 291 ? 29.352  48.398  180.777 1.00 117.23 ? 516 ASN B O   1 
ATOM   4314 C CB  . ASN B 1 291 ? 31.676  49.922  178.530 1.00 136.88 ? 516 ASN B CB  1 
ATOM   4315 C CG  . ASN B 1 291 ? 33.068  49.615  177.967 1.00 141.22 ? 516 ASN B CG  1 
ATOM   4316 O OD1 . ASN B 1 291 ? 33.894  50.519  177.814 1.00 143.98 ? 516 ASN B OD1 1 
ATOM   4317 N ND2 . ASN B 1 291 ? 33.334  48.352  177.658 1.00 144.48 ? 516 ASN B ND2 1 
HETATM 4318 O O   . HOH C 2 .   ? -3.563  47.328  177.900 1.00 87.89  ? 601 HOH A O   1 
HETATM 4319 O O   . HOH C 2 .   ? 22.761  8.859   191.190 1.00 78.63  ? 602 HOH A O   1 
HETATM 4320 O O   . HOH C 2 .   ? -9.775  38.416  183.424 1.00 91.76  ? 603 HOH A O   1 
HETATM 4321 O O   . HOH C 2 .   ? 1.365   26.540  200.339 1.00 84.65  ? 604 HOH A O   1 
HETATM 4322 O O   . HOH C 2 .   ? -9.625  38.427  177.601 1.00 87.12  ? 605 HOH A O   1 
HETATM 4323 O O   . HOH C 2 .   ? 8.779   43.268  165.292 1.00 91.34  ? 606 HOH A O   1 
HETATM 4324 O O   . HOH C 2 .   ? -10.055 29.934  183.255 1.00 75.50  ? 607 HOH A O   1 
HETATM 4325 O O   . HOH C 2 .   ? -8.393  32.271  187.878 1.00 91.25  ? 608 HOH A O   1 
HETATM 4326 O O   . HOH C 2 .   ? -1.291  21.036  192.383 1.00 85.57  ? 609 HOH A O   1 
HETATM 4327 O O   . HOH C 2 .   ? -2.420  39.003  174.975 1.00 81.21  ? 610 HOH A O   1 
HETATM 4328 O O   . HOH C 2 .   ? -2.640  30.778  173.431 1.00 94.65  ? 611 HOH A O   1 
HETATM 4329 O O   . HOH C 2 .   ? 25.396  41.706  187.687 1.00 92.84  ? 612 HOH A O   1 
HETATM 4330 O O   . HOH C 2 .   ? 13.301  27.838  185.863 1.00 79.28  ? 613 HOH A O   1 
HETATM 4331 O O   . HOH C 2 .   ? 8.642   38.453  172.285 1.00 79.87  ? 614 HOH A O   1 
HETATM 4332 O O   . HOH C 2 .   ? 9.533   48.680  174.491 1.00 85.41  ? 615 HOH A O   1 
HETATM 4333 O O   . HOH C 2 .   ? 23.083  24.966  188.912 1.00 115.08 ? 616 HOH A O   1 
HETATM 4334 O O   . HOH C 2 .   ? 25.327  29.592  186.839 1.00 79.62  ? 617 HOH A O   1 
HETATM 4335 O O   . HOH C 2 .   ? -2.646  54.637  177.931 1.00 81.62  ? 618 HOH A O   1 
HETATM 4336 O O   . HOH C 2 .   ? 14.573  52.206  188.320 1.00 89.79  ? 619 HOH A O   1 
HETATM 4337 O O   . HOH C 2 .   ? 5.783   45.601  171.275 1.00 85.38  ? 620 HOH A O   1 
HETATM 4338 O O   . HOH D 2 .   ? 12.851  45.054  157.823 1.00 100.68 ? 601 HOH B O   1 
HETATM 4339 O O   . HOH D 2 .   ? 14.301  68.640  156.668 1.00 80.34  ? 602 HOH B O   1 
HETATM 4340 O O   . HOH D 2 .   ? 32.235  72.265  166.875 1.00 86.71  ? 603 HOH B O   1 
HETATM 4341 O O   . HOH D 2 .   ? 39.437  56.924  151.587 1.00 72.27  ? 604 HOH B O   1 
HETATM 4342 O O   . HOH D 2 .   ? 2.246   58.657  158.246 1.00 96.98  ? 605 HOH B O   1 
HETATM 4343 O O   . HOH D 2 .   ? 12.259  27.007  175.957 1.00 90.83  ? 606 HOH B O   1 
HETATM 4344 O O   . HOH D 2 .   ? 32.708  74.489  165.088 1.00 94.28  ? 607 HOH B O   1 
HETATM 4345 O O   . HOH D 2 .   ? 37.414  58.878  150.348 1.00 78.47  ? 608 HOH B O   1 
HETATM 4346 O O   . HOH D 2 .   ? 10.896  65.863  169.824 1.00 88.95  ? 609 HOH B O   1 
HETATM 4347 O O   . HOH D 2 .   ? 46.699  86.119  162.884 1.00 76.35  ? 610 HOH B O   1 
HETATM 4348 O O   . HOH D 2 .   ? 25.057  67.536  152.670 1.00 108.81 ? 611 HOH B O   1 
HETATM 4349 O O   . HOH D 2 .   ? 29.089  38.257  169.435 1.00 97.54  ? 612 HOH B O   1 
HETATM 4350 O O   . HOH D 2 .   ? 38.725  62.245  161.576 1.00 97.30  ? 613 HOH B O   1 
HETATM 4351 O O   . HOH D 2 .   ? 14.623  58.179  168.320 1.00 68.74  ? 614 HOH B O   1 
HETATM 4352 O O   . HOH D 2 .   ? 33.305  40.431  169.690 1.00 95.98  ? 615 HOH B O   1 
HETATM 4353 O O   . HOH D 2 .   ? 30.448  58.815  169.348 1.00 84.82  ? 616 HOH B O   1 
HETATM 4354 O O   . HOH D 2 .   ? 31.401  70.296  157.307 1.00 94.25  ? 617 HOH B O   1 
HETATM 4355 O O   . HOH D 2 .   ? 13.875  59.853  170.636 1.00 84.44  ? 618 HOH B O   1 
HETATM 4356 O O   . HOH D 2 .   ? 15.650  85.169  159.933 1.00 95.63  ? 619 HOH B O   1 
HETATM 4357 O O   . HOH D 2 .   ? 10.169  58.045  168.830 1.00 82.49  ? 620 HOH B O   1 
# 
loop_
_atom_site_anisotrop.id 
_atom_site_anisotrop.type_symbol 
_atom_site_anisotrop.pdbx_label_atom_id 
_atom_site_anisotrop.pdbx_label_alt_id 
_atom_site_anisotrop.pdbx_label_comp_id 
_atom_site_anisotrop.pdbx_label_asym_id 
_atom_site_anisotrop.pdbx_label_seq_id 
_atom_site_anisotrop.pdbx_PDB_ins_code 
_atom_site_anisotrop.U[1][1] 
_atom_site_anisotrop.U[2][2] 
_atom_site_anisotrop.U[3][3] 
_atom_site_anisotrop.U[1][2] 
_atom_site_anisotrop.U[1][3] 
_atom_site_anisotrop.U[2][3] 
_atom_site_anisotrop.pdbx_auth_seq_id 
_atom_site_anisotrop.pdbx_auth_comp_id 
_atom_site_anisotrop.pdbx_auth_asym_id 
_atom_site_anisotrop.pdbx_auth_atom_id 
1    N N   . PRO A 5   ? 2.0046 1.3998 1.9465 -0.0969 -0.2768 -0.0272 88  PRO A N   
2    C CA  . PRO A 5   ? 1.9730 1.3900 1.9718 -0.1157 -0.2589 -0.0067 88  PRO A CA  
3    C C   . PRO A 5   ? 2.0019 1.3818 1.9786 -0.1032 -0.2387 -0.0004 88  PRO A C   
4    O O   . PRO A 5   ? 2.1399 1.4583 2.0862 -0.0998 -0.2528 -0.0159 88  PRO A O   
5    C CB  . PRO A 5   ? 1.9638 1.3711 2.0131 -0.1485 -0.2875 -0.0122 88  PRO A CB  
6    C CG  . PRO A 5   ? 2.0236 1.3877 2.0328 -0.1458 -0.3241 -0.0387 88  PRO A CG  
7    C CD  . PRO A 5   ? 2.0538 1.4289 2.0051 -0.1160 -0.3163 -0.0450 88  PRO A CD  
8    N N   . SER A 6   ? 1.8596 1.2742 1.8506 -0.0963 -0.2080 0.0218  89  SER A N   
9    C CA  . SER A 6   ? 1.8819 1.2699 1.8600 -0.0850 -0.1880 0.0327  89  SER A CA  
10   C C   . SER A 6   ? 1.7962 1.2179 1.8220 -0.1013 -0.1681 0.0583  89  SER A C   
11   O O   . SER A 6   ? 1.6933 1.1680 1.7475 -0.1094 -0.1591 0.0702  89  SER A O   
12   C CB  . SER A 6   ? 1.9440 1.3325 1.8739 -0.0504 -0.1697 0.0346  89  SER A CB  
13   O OG  . SER A 6   ? 1.8354 1.2806 1.7711 -0.0437 -0.1595 0.0435  89  SER A OG  
14   N N   . ARG A 7   ? 1.7639 1.1515 1.7937 -0.1043 -0.1604 0.0668  90  ARG A N   
15   C CA  . ARG A 7   ? 1.7767 1.1864 1.8444 -0.1191 -0.1416 0.0916  90  ARG A CA  
16   C C   . ARG A 7   ? 1.7524 1.1878 1.8036 -0.0997 -0.1169 0.1108  90  ARG A C   
17   O O   . ARG A 7   ? 1.7889 1.2060 1.8030 -0.0742 -0.1124 0.1074  90  ARG A O   
18   C CB  . ARG A 7   ? 1.8956 1.2545 1.9728 -0.1299 -0.1446 0.0942  90  ARG A CB  
19   C CG  . ARG A 7   ? 1.9601 1.3338 2.0748 -0.1471 -0.1261 0.1206  90  ARG A CG  
20   C CD  . ARG A 7   ? 1.9407 1.3537 2.1075 -0.1747 -0.1272 0.1272  90  ARG A CD  
21   N NE  . ARG A 7   ? 1.9854 1.3787 2.1933 -0.1992 -0.1251 0.1395  90  ARG A NE  
22   C CZ  . ARG A 7   ? 2.0478 1.3967 2.2714 -0.2134 -0.1449 0.1286  90  ARG A CZ  
23   N NH1 . ARG A 7   ? 2.1235 1.4360 2.3189 -0.2054 -0.1706 0.1026  90  ARG A NH1 
24   N NH2 . ARG A 7   ? 2.0834 1.4212 2.3497 -0.2359 -0.1386 0.1449  90  ARG A NH2 
25   N N   . ILE A 8   ? 1.6910 1.1658 1.7699 -0.1114 -0.1014 0.1314  91  ILE A N   
26   C CA  . ILE A 8   ? 1.6935 1.1842 1.7608 -0.0984 -0.0814 0.1527  91  ILE A CA  
27   C C   . ILE A 8   ? 1.7953 1.2705 1.8814 -0.1131 -0.0706 0.1720  91  ILE A C   
28   O O   . ILE A 8   ? 1.9500 1.3899 2.0214 -0.1034 -0.0668 0.1788  91  ILE A O   
29   C CB  . ILE A 8   ? 1.6318 1.1776 1.7022 -0.0954 -0.0725 0.1607  91  ILE A CB  
30   C CG1 . ILE A 8   ? 1.6510 1.2086 1.6974 -0.0758 -0.0800 0.1457  91  ILE A CG1 
31   C CG2 . ILE A 8   ? 1.6041 1.1645 1.6669 -0.0879 -0.0558 0.1842  91  ILE A CG2 
32   C CD1 . ILE A 8   ? 1.6581 1.1946 1.6712 -0.0480 -0.0751 0.1467  91  ILE A CD1 
33   N N   . ALA A 9   ? 1.7504 1.2511 1.8677 -0.1346 -0.0636 0.1823  92  ALA A N   
34   C CA  . ALA A 9   ? 1.7597 1.2448 1.8947 -0.1497 -0.0515 0.2017  92  ALA A CA  
35   C C   . ALA A 9   ? 1.7423 1.2555 1.9164 -0.1733 -0.0469 0.2053  92  ALA A C   
36   O O   . ALA A 9   ? 1.6924 1.2438 1.8689 -0.1749 -0.0343 0.2145  92  ALA A O   
37   C CB  . ALA A 9   ? 1.7583 1.2516 1.8713 -0.1383 -0.0350 0.2240  92  ALA A CB  
38   N N   . ASP A 10  ? 1.7775 1.2705 1.9834 -0.1910 -0.0586 0.1968  93  ASP A N   
39   C CA  . ASP A 10  ? 1.7999 1.3199 2.0536 -0.2134 -0.0589 0.1970  93  ASP A CA  
40   C C   . ASP A 10  ? 1.7056 1.2678 1.9626 -0.2093 -0.0668 0.1835  93  ASP A C   
41   O O   . ASP A 10  ? 1.5549 1.1501 1.8481 -0.2231 -0.0599 0.1890  93  ASP A O   
42   C CB  . ASP A 10  ? 1.7950 1.3280 2.0712 -0.2272 -0.0326 0.2232  93  ASP A CB  
43   C CG  . ASP A 10  ? 1.8339 1.3241 2.1185 -0.2364 -0.0274 0.2367  93  ASP A CG  
44   O OD1 . ASP A 10  ? 1.8708 1.3277 2.1202 -0.2218 -0.0307 0.2368  93  ASP A OD1 
45   O OD2 . ASP A 10  ? 1.8371 1.3270 2.1665 -0.2579 -0.0195 0.2483  93  ASP A OD2 
46   N N   . TYR A 11  ? 1.7204 1.2791 1.9407 -0.1894 -0.0804 0.1668  94  TYR A N   
47   C CA  . TYR A 11  ? 1.6822 1.2758 1.8996 -0.1829 -0.0893 0.1539  94  TYR A CA  
48   C C   . TYR A 11  ? 1.6488 1.2161 1.8429 -0.1725 -0.1147 0.1299  94  TYR A C   
49   O O   . TYR A 11  ? 1.6413 1.1738 1.7983 -0.1562 -0.1169 0.1248  94  TYR A O   
50   C CB  . TYR A 11  ? 1.6937 1.3156 1.8796 -0.1641 -0.0746 0.1617  94  TYR A CB  
51   C CG  . TYR A 11  ? 1.6738 1.3264 1.8727 -0.1715 -0.0522 0.1812  94  TYR A CG  
52   C CD1 . TYR A 11  ? 1.5863 1.2757 1.8152 -0.1825 -0.0477 0.1817  94  TYR A CD1 
53   C CD2 . TYR A 11  ? 1.6556 1.2984 1.8328 -0.1660 -0.0357 0.1994  94  TYR A CD2 
54   C CE1 . TYR A 11  ? 1.6227 1.3345 1.8561 -0.1871 -0.0252 0.1985  94  TYR A CE1 
55   C CE2 . TYR A 11  ? 1.6198 1.2844 1.7989 -0.1716 -0.0162 0.2161  94  TYR A CE2 
56   C CZ  . TYR A 11  ? 1.6193 1.3167 1.8241 -0.1817 -0.0100 0.2149  94  TYR A CZ  
57   O OH  . TYR A 11  ? 1.6802 1.3932 1.8801 -0.1855 0.0110  0.2305  94  TYR A OH  
58   N N   . LEU A 12  ? 1.6374 1.2198 1.8507 -0.1807 -0.1331 0.1160  95  LEU A N   
59   C CA  . LEU A 12  ? 1.7033 1.2651 1.8843 -0.1680 -0.1572 0.0928  95  LEU A CA  
60   C C   . LEU A 12  ? 1.6715 1.2686 1.8268 -0.1490 -0.1504 0.0917  95  LEU A C   
61   O O   . LEU A 12  ? 1.6042 1.2460 1.7846 -0.1550 -0.1403 0.1013  95  LEU A O   
62   C CB  . LEU A 12  ? 1.7234 1.2840 1.9364 -0.1864 -0.1847 0.0789  95  LEU A CB  
63   C CG  . LEU A 12  ? 1.7935 1.3325 2.0541 -0.2130 -0.1940 0.0828  95  LEU A CG  
64   C CD1 . LEU A 12  ? 1.8181 1.3873 2.1316 -0.2331 -0.2119 0.0800  95  LEU A CD1 
65   C CD2 . LEU A 12  ? 1.8575 1.3319 2.0890 -0.2109 -0.2140 0.0670  95  LEU A CD2 
66   N N   . LEU A 13  ? 1.7149 1.2902 1.8209 -0.1257 -0.1549 0.0804  96  LEU A N   
67   C CA  . LEU A 13  ? 1.7416 1.3473 1.8230 -0.1066 -0.1492 0.0797  96  LEU A CA  
68   C C   . LEU A 13  ? 1.6989 1.2947 1.7656 -0.1045 -0.1747 0.0587  96  LEU A C   
69   O O   . LEU A 13  ? 1.7739 1.3231 1.8172 -0.1027 -0.1930 0.0423  96  LEU A O   
70   C CB  . LEU A 13  ? 1.8042 1.3953 1.8442 -0.0805 -0.1339 0.0851  96  LEU A CB  
71   C CG  . LEU A 13  ? 1.7633 1.3726 1.8126 -0.0787 -0.1102 0.1083  96  LEU A CG  
72   C CD1 . LEU A 13  ? 1.7069 1.3559 1.7455 -0.0630 -0.0976 0.1183  96  LEU A CD1 
73   C CD2 . LEU A 13  ? 1.7238 1.3487 1.8144 -0.1035 -0.1027 0.1219  96  LEU A CD2 
74   N N   . LEU A 14  ? 1.6340 1.2709 1.7130 -0.1052 -0.1770 0.0593  97  LEU A N   
75   C CA  . LEU A 14  ? 1.6454 1.2780 1.7130 -0.1043 -0.2025 0.0419  97  LEU A CA  
76   C C   . LEU A 14  ? 1.5976 1.2627 1.6418 -0.0849 -0.1941 0.0445  97  LEU A C   
77   O O   . LEU A 14  ? 1.4545 1.1627 1.5223 -0.0864 -0.1760 0.0599  97  LEU A O   
78   C CB  . LEU A 14  ? 1.7177 1.3729 1.8430 -0.1314 -0.2169 0.0431  97  LEU A CB  
79   C CG  . LEU A 14  ? 1.8710 1.4886 2.0130 -0.1500 -0.2456 0.0300  97  LEU A CG  
80   C CD1 . LEU A 14  ? 1.9169 1.5064 2.0793 -0.1634 -0.2373 0.0372  97  LEU A CD1 
81   C CD2 . LEU A 14  ? 1.8635 1.5179 2.0624 -0.1705 -0.2610 0.0324  97  LEU A CD2 
82   N N   . PRO A 15  ? 1.7041 1.3465 1.7000 -0.0666 -0.2069 0.0298  98  PRO A N   
83   C CA  . PRO A 15  ? 1.7677 1.4374 1.7372 -0.0451 -0.1957 0.0345  98  PRO A CA  
84   C C   . PRO A 15  ? 1.7605 1.4846 1.7653 -0.0532 -0.1949 0.0433  98  PRO A C   
85   O O   . PRO A 15  ? 1.7904 1.5318 1.8391 -0.0747 -0.2074 0.0430  98  PRO A O   
86   C CB  . PRO A 15  ? 1.8207 1.4482 1.7310 -0.0270 -0.2133 0.0151  98  PRO A CB  
87   C CG  . PRO A 15  ? 1.8630 1.4470 1.7752 -0.0439 -0.2413 -0.0019 98  PRO A CG  
88   C CD  . PRO A 15  ? 1.7729 1.3601 1.7337 -0.0649 -0.2328 0.0083  98  PRO A CD  
89   N N   . LEU A 16  ? 1.7943 1.5439 1.7818 -0.0352 -0.1793 0.0523  99  LEU A N   
90   C CA  . LEU A 16  ? 1.7785 1.5740 1.7901 -0.0381 -0.1777 0.0600  99  LEU A CA  
91   C C   . LEU A 16  ? 1.8684 1.6674 1.8374 -0.0125 -0.1718 0.0611  99  LEU A C   
92   O O   . LEU A 16  ? 1.9167 1.7399 1.8872 -0.0022 -0.1506 0.0758  99  LEU A O   
93   C CB  . LEU A 16  ? 1.7024 1.5343 1.7537 -0.0482 -0.1563 0.0779  99  LEU A CB  
94   C CG  . LEU A 16  ? 1.8410 1.6866 1.9437 -0.0739 -0.1596 0.0805  99  LEU A CG  
95   C CD1 . LEU A 16  ? 1.9268 1.7946 2.0511 -0.0796 -0.1353 0.0974  99  LEU A CD1 
96   C CD2 . LEU A 16  ? 1.8572 1.7294 1.9886 -0.0826 -0.1742 0.0772  99  LEU A CD2 
97   N N   . ALA A 17  ? 1.9862 1.7586 1.9167 -0.0029 -0.1912 0.0461  100 ALA A N   
98   C CA  . ALA A 17  ? 1.9660 1.7338 1.8474 0.0232  -0.1867 0.0457  100 ALA A CA  
99   C C   . ALA A 17  ? 1.9379 1.7507 1.8327 0.0336  -0.1642 0.0652  100 ALA A C   
100  O O   . ALA A 17  ? 1.8356 1.6462 1.7075 0.0535  -0.1435 0.0746  100 ALA A O   
101  C CB  . ALA A 17  ? 1.9429 1.6937 1.7995 0.0229  -0.2161 0.0302  100 ALA A CB  
102  N N   . GLU A 18  ? 1.9128 1.7651 1.8469 0.0205  -0.1683 0.0720  101 GLU A N   
103  C CA  . GLU A 18  ? 1.9361 1.8296 1.8889 0.0263  -0.1491 0.0901  101 GLU A CA  
104  C C   . GLU A 18  ? 1.9047 1.8069 1.8696 0.0288  -0.1253 0.1044  101 GLU A C   
105  O O   . GLU A 18  ? 1.9181 1.8343 1.8739 0.0445  -0.1089 0.1176  101 GLU A O   
106  C CB  . GLU A 18  ? 1.9678 1.8972 1.9686 0.0075  -0.1563 0.0940  101 GLU A CB  
107  C CG  . GLU A 18  ? 1.9773 1.9450 1.9965 0.0119  -0.1408 0.1104  101 GLU A CG  
108  C CD  . GLU A 18  ? 1.9867 1.9834 2.0568 -0.0081 -0.1365 0.1166  101 GLU A CD  
109  O OE1 . GLU A 18  ? 1.9467 1.9418 2.0326 -0.0179 -0.1255 0.1205  101 GLU A OE1 
110  O OE2 . GLU A 18  ? 2.0246 2.0440 2.1169 -0.0127 -0.1430 0.1182  101 GLU A OE2 
111  N N   . ARG A 19  ? 1.9142 1.8076 1.9010 0.0129  -0.1248 0.1028  102 ARG A N   
112  C CA  . ARG A 19  ? 1.7725 1.6722 1.7726 0.0119  -0.1064 0.1164  102 ARG A CA  
113  C C   . ARG A 19  ? 1.7640 1.6336 1.7325 0.0296  -0.0972 0.1174  102 ARG A C   
114  O O   . ARG A 19  ? 1.6254 1.4574 1.5729 0.0306  -0.1059 0.1041  102 ARG A O   
115  C CB  . ARG A 19  ? 1.7607 1.6620 1.7948 -0.0117 -0.1080 0.1163  102 ARG A CB  
116  C CG  . ARG A 19  ? 1.7955 1.7293 1.8669 -0.0282 -0.1094 0.1198  102 ARG A CG  
117  C CD  . ARG A 19  ? 1.7903 1.7557 1.8695 -0.0228 -0.0965 0.1341  102 ARG A CD  
118  N NE  . ARG A 19  ? 1.8672 1.8304 1.9375 -0.0153 -0.0826 0.1468  102 ARG A NE  
119  C CZ  . ARG A 19  ? 1.8956 1.8658 1.9508 0.0022  -0.0749 0.1567  102 ARG A CZ  
120  N NH1 . ARG A 19  ? 1.9433 1.9223 1.9855 0.0161  -0.0768 0.1560  102 ARG A NH1 
121  N NH2 . ARG A 19  ? 1.8236 1.7927 1.8787 0.0063  -0.0648 0.1694  102 ARG A NH2 
122  N N   . GLU A 20  ? 1.8022 1.6884 1.7718 0.0426  -0.0798 0.1342  103 GLU A N   
123  C CA  . GLU A 20  ? 1.9464 1.8113 1.8891 0.0653  -0.0673 0.1392  103 GLU A CA  
124  C C   . GLU A 20  ? 1.9093 1.7410 1.8478 0.0618  -0.0671 0.1350  103 GLU A C   
125  O O   . GLU A 20  ? 2.0668 1.8586 1.9742 0.0696  -0.0733 0.1200  103 GLU A O   
126  C CB  . GLU A 20  ? 2.0396 1.9365 1.9978 0.0770  -0.0501 0.1619  103 GLU A CB  
127  C CG  . GLU A 20  ? 2.1412 2.0231 2.0839 0.1015  -0.0333 0.1728  103 GLU A CG  
128  C CD  . GLU A 20  ? 2.1672 2.0344 2.0722 0.1288  -0.0242 0.1701  103 GLU A CD  
129  O OE1 . GLU A 20  ? 2.2099 2.0917 2.1066 0.1318  -0.0269 0.1685  103 GLU A OE1 
130  O OE2 . GLU A 20  ? 2.1071 1.9465 1.9889 0.1491  -0.0125 0.1708  103 GLU A OE2 
131  N N   . HIS A 21  ? 1.7112 1.5562 1.6775 0.0506  -0.0607 0.1482  104 HIS A N   
132  C CA  . HIS A 21  ? 1.6794 1.4956 1.6459 0.0455  -0.0600 0.1475  104 HIS A CA  
133  C C   . HIS A 21  ? 1.5828 1.4028 1.5756 0.0176  -0.0683 0.1445  104 HIS A C   
134  O O   . HIS A 21  ? 1.4935 1.2965 1.4930 0.0098  -0.0659 0.1488  104 HIS A O   
135  C CB  . HIS A 21  ? 1.7337 1.5582 1.7086 0.0571  -0.0453 0.1682  104 HIS A CB  
136  C CG  . HIS A 21  ? 1.8272 1.6415 1.7801 0.0862  -0.0332 0.1731  104 HIS A CG  
137  N ND1 . HIS A 21  ? 1.9358 1.7064 1.8563 0.1017  -0.0315 0.1610  104 HIS A ND1 
138  C CD2 . HIS A 21  ? 1.8294 1.6703 1.7894 0.1035  -0.0205 0.1901  104 HIS A CD2 
139  C CE1 . HIS A 21  ? 2.0041 1.7746 1.9100 0.1290  -0.0159 0.1700  104 HIS A CE1 
140  N NE2 . HIS A 21  ? 1.9881 1.8030 1.9207 0.1302  -0.0087 0.1888  104 HIS A NE2 
141  N N   . VAL A 22  ? 1.5064 1.3493 1.5154 0.0039  -0.0761 0.1392  105 VAL A N   
142  C CA  . VAL A 22  ? 1.4191 1.2635 1.4540 -0.0206 -0.0826 0.1348  105 VAL A CA  
143  C C   . VAL A 22  ? 1.4280 1.2441 1.4567 -0.0267 -0.0989 0.1162  105 VAL A C   
144  O O   . VAL A 22  ? 1.3767 1.1845 1.3838 -0.0161 -0.1094 0.1044  105 VAL A O   
145  C CB  . VAL A 22  ? 1.3397 1.2212 1.4010 -0.0332 -0.0822 0.1388  105 VAL A CB  
146  C CG1 . VAL A 22  ? 1.2629 1.1441 1.3525 -0.0563 -0.0825 0.1382  105 VAL A CG1 
147  C CG2 . VAL A 22  ? 1.3083 1.2164 1.3721 -0.0266 -0.0703 0.1552  105 VAL A CG2 
148  N N   . SER A 23  ? 1.4192 1.2185 1.4657 -0.0439 -0.1015 0.1148  106 SER A N   
149  C CA  . SER A 23  ? 1.4581 1.2326 1.5104 -0.0559 -0.1191 0.0994  106 SER A CA  
150  C C   . SER A 23  ? 1.4775 1.2669 1.5736 -0.0807 -0.1165 0.1059  106 SER A C   
151  O O   . SER A 23  ? 1.4196 1.2245 1.5277 -0.0853 -0.0998 0.1208  106 SER A O   
152  C CB  . SER A 23  ? 1.4700 1.1958 1.4940 -0.0472 -0.1229 0.0916  106 SER A CB  
153  O OG  . SER A 23  ? 1.4765 1.1892 1.5178 -0.0590 -0.1146 0.1009  106 SER A OG  
154  N N   . ARG A 24  ? 1.6153 1.4002 1.7352 -0.0962 -0.1331 0.0956  107 ARG A N   
155  C CA  . ARG A 24  ? 1.6815 1.4773 1.8477 -0.1195 -0.1289 0.1028  107 ARG A CA  
156  C C   . ARG A 24  ? 1.5049 1.2646 1.6740 -0.1285 -0.1268 0.1051  107 ARG A C   
157  O O   . ARG A 24  ? 1.3567 1.0784 1.5038 -0.1237 -0.1406 0.0935  107 ARG A O   
158  C CB  . ARG A 24  ? 1.9128 1.7229 2.1134 -0.1331 -0.1480 0.0939  107 ARG A CB  
159  C CG  . ARG A 24  ? 2.1291 1.9027 2.3257 -0.1390 -0.1756 0.0774  107 ARG A CG  
160  C CD  . ARG A 24  ? 2.2079 1.9997 2.4444 -0.1537 -0.1971 0.0714  107 ARG A CD  
161  N NE  . ARG A 24  ? 2.2141 2.0279 2.4321 -0.1400 -0.2050 0.0662  107 ARG A NE  
162  C CZ  . ARG A 24  ? 2.3180 2.1689 2.5728 -0.1468 -0.2098 0.0698  107 ARG A CZ  
163  N NH1 . ARG A 24  ? 2.3273 2.2009 2.6433 -0.1667 -0.2058 0.0791  107 ARG A NH1 
164  N NH2 . ARG A 24  ? 2.4310 2.2966 2.6621 -0.1322 -0.2171 0.0656  107 ARG A NH2 
165  N N   . ALA A 25  ? 1.4404 1.2099 1.6344 -0.1409 -0.1088 0.1205  108 ALA A N   
166  C CA  . ALA A 25  ? 1.4609 1.1994 1.6625 -0.1511 -0.1042 0.1265  108 ALA A CA  
167  C C   . ALA A 25  ? 1.4601 1.2099 1.7146 -0.1750 -0.1032 0.1318  108 ALA A C   
168  O O   . ALA A 25  ? 1.4146 1.2002 1.6959 -0.1811 -0.0941 0.1382  108 ALA A O   
169  C CB  . ALA A 25  ? 1.4904 1.2279 1.6725 -0.1440 -0.0822 0.1433  108 ALA A CB  
170  N N   . LEU A 26  ? 1.5400 1.2584 1.8119 -0.1882 -0.1110 0.1306  109 LEU A N   
171  C CA  . LEU A 26  ? 1.4785 1.2056 1.8086 -0.2123 -0.1108 0.1376  109 LEU A CA  
172  C C   . LEU A 26  ? 1.4878 1.1856 1.8279 -0.2230 -0.0987 0.1504  109 LEU A C   
173  O O   . LEU A 26  ? 1.4639 1.1204 1.7821 -0.2200 -0.1104 0.1432  109 LEU A O   
174  C CB  . LEU A 26  ? 1.5182 1.2366 1.8731 -0.2225 -0.1432 0.1207  109 LEU A CB  
175  C CG  . LEU A 26  ? 1.5139 1.2673 1.8902 -0.2233 -0.1580 0.1128  109 LEU A CG  
176  C CD1 . LEU A 26  ? 1.4944 1.2315 1.8982 -0.2374 -0.1932 0.0988  109 LEU A CD1 
177  C CD2 . LEU A 26  ? 1.4940 1.2918 1.9171 -0.2327 -0.1350 0.1300  109 LEU A CD2 
178  N N   . CYS A 27  ? 1.5306 1.2474 1.9041 -0.2355 -0.0749 0.1696  110 CYS A N   
179  C CA  . CYS A 27  ? 1.6033 1.2945 1.9908 -0.2474 -0.0609 0.1850  110 CYS A CA  
180  C C   . CYS A 27  ? 1.6654 1.3332 2.0954 -0.2663 -0.0823 0.1789  110 CYS A C   
181  O O   . CYS A 27  ? 1.6941 1.3819 2.1683 -0.2784 -0.0979 0.1725  110 CYS A O   
182  C CB  . CYS A 27  ? 1.6058 1.3224 2.0185 -0.2560 -0.0287 0.2075  110 CYS A CB  
183  S SG  . CYS A 27  ? 1.7887 1.4700 2.1878 -0.2607 -0.0053 0.2298  110 CYS A SG  
184  N N   . ILE A 28  ? 1.7201 1.3444 2.1386 -0.2693 -0.0846 0.1815  111 ILE A N   
185  C CA  . ILE A 28  ? 1.7428 1.3392 2.2041 -0.2900 -0.1043 0.1780  111 ILE A CA  
186  C C   . ILE A 28  ? 1.7479 1.3591 2.2695 -0.3116 -0.0806 0.2034  111 ILE A C   
187  O O   . ILE A 28  ? 1.7025 1.3128 2.2840 -0.3333 -0.0945 0.2047  111 ILE A O   
188  C CB  . ILE A 28  ? 1.7843 1.3227 2.2050 -0.2824 -0.1194 0.1671  111 ILE A CB  
189  C CG1 . ILE A 28  ? 1.7398 1.2702 2.0999 -0.2575 -0.1358 0.1445  111 ILE A CG1 
190  C CG2 . ILE A 28  ? 1.8222 1.3265 2.2855 -0.3051 -0.1441 0.1611  111 ILE A CG2 
191  C CD1 . ILE A 28  ? 1.7675 1.2414 2.0807 -0.2442 -0.1492 0.1310  111 ILE A CD1 
192  N N   . HIS A 29  ? 1.8190 1.4444 2.3245 -0.3052 -0.0455 0.2240  112 HIS A N   
193  C CA  . HIS A 29  ? 1.8738 1.5135 2.4264 -0.3214 -0.0152 0.2508  112 HIS A CA  
194  C C   . HIS A 29  ? 1.8090 1.4991 2.4144 -0.3298 -0.0046 0.2567  112 HIS A C   
195  O O   . HIS A 29  ? 1.8516 1.5521 2.5266 -0.3498 -0.0137 0.2605  112 HIS A O   
196  C CB  . HIS A 29  ? 1.8372 1.4665 2.3425 -0.3097 0.0169  0.2700  112 HIS A CB  
197  C CG  . HIS A 29  ? 1.8429 1.4228 2.3199 -0.3078 0.0122  0.2735  112 HIS A CG  
198  N ND1 . HIS A 29  ? 1.8513 1.4113 2.3295 -0.3141 0.0375  0.2986  112 HIS A ND1 
199  C CD2 . HIS A 29  ? 1.8165 1.3604 2.2650 -0.2998 -0.0141 0.2557  112 HIS A CD2 
200  C CE1 . HIS A 29  ? 1.8403 1.3555 2.2932 -0.3102 0.0258  0.2964  112 HIS A CE1 
201  N NE2 . HIS A 29  ? 1.8386 1.3427 2.2733 -0.3011 -0.0047 0.2701  112 HIS A NE2 
202  N N   . THR A 30  ? 1.7034 1.4233 2.2784 -0.3146 0.0140  0.2583  113 THR A N   
203  C CA  . THR A 30  ? 1.6547 1.4207 2.2683 -0.3165 0.0192  0.2579  113 THR A CA  
204  C C   . THR A 30  ? 1.6793 1.4535 2.3005 -0.3149 -0.0202 0.2330  113 THR A C   
205  O O   . THR A 30  ? 1.8022 1.5440 2.3943 -0.3116 -0.0480 0.2164  113 THR A O   
206  C CB  . THR A 30  ? 1.6218 1.4093 2.1891 -0.2985 0.0452  0.2623  113 THR A CB  
207  O OG1 . THR A 30  ? 1.4876 1.2611 1.9870 -0.2797 0.0295  0.2463  113 THR A OG1 
208  C CG2 . THR A 30  ? 1.6982 1.4758 2.2531 -0.2999 0.0842  0.2871  113 THR A CG2 
209  N N   . GLY A 31  ? 1.6690 1.4838 2.3243 -0.3153 -0.0220 0.2302  114 GLY A N   
210  C CA  . GLY A 31  ? 1.6502 1.4745 2.3007 -0.3099 -0.0577 0.2074  114 GLY A CA  
211  C C   . GLY A 31  ? 1.5888 1.4264 2.1784 -0.2866 -0.0539 0.1972  114 GLY A C   
212  O O   . GLY A 31  ? 1.4931 1.3490 2.0822 -0.2804 -0.0749 0.1830  114 GLY A O   
213  N N   . ARG A 32  ? 1.6054 1.4313 2.1430 -0.2742 -0.0295 0.2049  115 ARG A N   
214  C CA  . ARG A 32  ? 1.6334 1.4798 2.1281 -0.2560 -0.0159 0.2034  115 ARG A CA  
215  C C   . ARG A 32  ? 1.6361 1.4744 2.0816 -0.2392 -0.0410 0.1837  115 ARG A C   
216  O O   . ARG A 32  ? 1.6969 1.5017 2.1089 -0.2340 -0.0539 0.1765  115 ARG A O   
217  C CB  . ARG A 32  ? 1.6663 1.4991 2.1233 -0.2505 0.0150  0.2196  115 ARG A CB  
218  C CG  . ARG A 32  ? 1.6523 1.5033 2.0701 -0.2356 0.0325  0.2221  115 ARG A CG  
219  C CD  . ARG A 32  ? 1.7181 1.5470 2.0931 -0.2316 0.0566  0.2375  115 ARG A CD  
220  N NE  . ARG A 32  ? 1.6802 1.5177 2.0065 -0.2168 0.0658  0.2375  115 ARG A NE  
221  C CZ  . ARG A 32  ? 1.6121 1.4306 1.8894 -0.2102 0.0795  0.2481  115 ARG A CZ  
222  N NH1 . ARG A 32  ? 1.5882 1.3775 1.8549 -0.2154 0.0882  0.2610  115 ARG A NH1 
223  N NH2 . ARG A 32  ? 1.6034 1.4309 1.8418 -0.1985 0.0826  0.2463  115 ARG A NH2 
224  N N   . GLU A 33  ? 1.6449 1.5129 2.0884 -0.2301 -0.0465 0.1760  116 GLU A N   
225  C CA  . GLU A 33  ? 1.6293 1.4938 2.0277 -0.2130 -0.0665 0.1598  116 GLU A CA  
226  C C   . GLU A 33  ? 1.5724 1.4468 1.9245 -0.1960 -0.0493 0.1643  116 GLU A C   
227  O O   . GLU A 33  ? 1.4007 1.3040 1.7616 -0.1935 -0.0365 0.1688  116 GLU A O   
228  C CB  . GLU A 33  ? 1.6296 1.5165 2.0544 -0.2139 -0.0899 0.1476  116 GLU A CB  
229  C CG  . GLU A 33  ? 1.6898 1.5613 2.0683 -0.1983 -0.1149 0.1299  116 GLU A CG  
230  C CD  . GLU A 33  ? 1.5837 1.4811 1.9728 -0.1936 -0.1331 0.1206  116 GLU A CD  
231  O OE1 . GLU A 33  ? 1.5843 1.5165 2.0053 -0.1964 -0.1208 0.1288  116 GLU A OE1 
232  O OE2 . GLU A 33  ? 1.4076 1.2883 1.7688 -0.1854 -0.1585 0.1054  116 GLU A OE2 
233  N N   . LEU A 34  ? 1.5307 1.3794 1.8359 -0.1845 -0.0508 0.1631  117 LEU A N   
234  C CA  . LEU A 34  ? 1.4573 1.3114 1.7191 -0.1686 -0.0404 0.1676  117 LEU A CA  
235  C C   . LEU A 34  ? 1.3545 1.2122 1.5889 -0.1518 -0.0584 0.1545  117 LEU A C   
236  O O   . LEU A 34  ? 1.2365 1.0820 1.4731 -0.1508 -0.0785 0.1413  117 LEU A O   
237  C CB  . LEU A 34  ? 1.4684 1.2935 1.7006 -0.1656 -0.0304 0.1781  117 LEU A CB  
238  C CG  . LEU A 34  ? 1.4670 1.2838 1.7074 -0.1773 -0.0079 0.1952  117 LEU A CG  
239  C CD1 . LEU A 34  ? 1.4595 1.2994 1.6922 -0.1759 0.0108  0.2040  117 LEU A CD1 
240  C CD2 . LEU A 34  ? 1.4480 1.2598 1.7358 -0.1957 -0.0066 0.1972  117 LEU A CD2 
241  N N   . ARG A 35  ? 1.2738 1.1461 1.4814 -0.1387 -0.0513 0.1587  118 ARG A N   
242  C CA  . ARG A 35  ? 1.3242 1.1929 1.4995 -0.1203 -0.0620 0.1521  118 ARG A CA  
243  C C   . ARG A 35  ? 1.2933 1.1401 1.4383 -0.1109 -0.0552 0.1612  118 ARG A C   
244  O O   . ARG A 35  ? 1.2531 1.0959 1.3960 -0.1170 -0.0419 0.1741  118 ARG A O   
245  C CB  . ARG A 35  ? 1.3983 1.2983 1.5696 -0.1115 -0.0608 0.1523  118 ARG A CB  
246  C CG  . ARG A 35  ? 1.4815 1.4023 1.6791 -0.1161 -0.0711 0.1430  118 ARG A CG  
247  C CD  . ARG A 35  ? 1.6222 1.5283 1.8127 -0.1108 -0.0929 0.1284  118 ARG A CD  
248  N NE  . ARG A 35  ? 1.6382 1.5554 1.8631 -0.1221 -0.1070 0.1204  118 ARG A NE  
249  C CZ  . ARG A 35  ? 1.6959 1.6099 1.9591 -0.1402 -0.1086 0.1213  118 ARG A CZ  
250  N NH1 . ARG A 35  ? 1.7178 1.6173 1.9882 -0.1496 -0.0942 0.1302  118 ARG A NH1 
251  N NH2 . ARG A 35  ? 1.7220 1.6491 2.0201 -0.1494 -0.1243 0.1154  118 ARG A NH2 
252  N N   . CYS A 36  ? 1.3307 1.1623 1.4516 -0.0952 -0.0643 0.1550  119 CYS A N   
253  C CA  . CYS A 36  ? 1.3654 1.1745 1.4624 -0.0840 -0.0596 0.1632  119 CYS A CA  
254  C C   . CYS A 36  ? 1.3853 1.2014 1.4589 -0.0617 -0.0617 0.1628  119 CYS A C   
255  O O   . CYS A 36  ? 1.3802 1.1866 1.4418 -0.0514 -0.0711 0.1499  119 CYS A O   
256  C CB  . CYS A 36  ? 1.3900 1.1605 1.4856 -0.0877 -0.0661 0.1563  119 CYS A CB  
257  S SG  . CYS A 36  ? 1.3878 1.1263 1.4581 -0.0734 -0.0599 0.1669  119 CYS A SG  
258  N N   . LYS A 37  ? 1.3526 1.1846 1.4197 -0.0545 -0.0534 0.1778  120 LYS A N   
259  C CA  . LYS A 37  ? 1.2891 1.1287 1.3410 -0.0332 -0.0524 0.1830  120 LYS A CA  
260  C C   . LYS A 37  ? 1.2595 1.0710 1.2982 -0.0216 -0.0492 0.1898  120 LYS A C   
261  O O   . LYS A 37  ? 1.3419 1.1419 1.3834 -0.0297 -0.0455 0.2004  120 LYS A O   
262  C CB  . LYS A 37  ? 1.2678 1.1383 1.3255 -0.0327 -0.0479 0.1974  120 LYS A CB  
263  C CG  . LYS A 37  ? 1.3471 1.2425 1.4184 -0.0452 -0.0488 0.1927  120 LYS A CG  
264  C CD  . LYS A 37  ? 1.4238 1.3478 1.4976 -0.0400 -0.0476 0.2028  120 LYS A CD  
265  C CE  . LYS A 37  ? 1.4946 1.4373 1.5808 -0.0541 -0.0465 0.1992  120 LYS A CE  
266  N NZ  . LYS A 37  ? 1.5254 1.4942 1.6155 -0.0487 -0.0477 0.2048  120 LYS A NZ  
267  N N   . VAL A 38  ? 1.2142 1.0116 1.2365 -0.0018 -0.0497 0.1838  121 VAL A N   
268  C CA  . VAL A 38  ? 1.2246 0.9963 1.2354 0.0134  -0.0444 0.1914  121 VAL A CA  
269  C C   . VAL A 38  ? 1.2109 1.0055 1.2237 0.0325  -0.0367 0.2081  121 VAL A C   
270  O O   . VAL A 38  ? 1.2123 1.0278 1.2233 0.0429  -0.0351 0.2065  121 VAL A O   
271  C CB  . VAL A 38  ? 1.2771 1.0088 1.2654 0.0252  -0.0476 0.1744  121 VAL A CB  
272  C CG1 . VAL A 38  ? 1.3231 1.0219 1.3046 0.0345  -0.0420 0.1823  121 VAL A CG1 
273  C CG2 . VAL A 38  ? 1.3017 1.0165 1.2922 0.0060  -0.0600 0.1556  121 VAL A CG2 
274  N N   . PHE A 39  ? 1.2553 1.0473 1.2751 0.0362  -0.0327 0.2263  122 PHE A N   
275  C CA  . PHE A 39  ? 1.2163 1.0260 1.2441 0.0564  -0.0260 0.2448  122 PHE A CA  
276  C C   . PHE A 39  ? 1.2597 1.0397 1.2818 0.0736  -0.0196 0.2520  122 PHE A C   
277  O O   . PHE A 39  ? 1.2911 1.0379 1.3048 0.0658  -0.0219 0.2464  122 PHE A O   
278  C CB  . PHE A 39  ? 1.1426 0.9822 1.1897 0.0453  -0.0303 0.2643  122 PHE A CB  
279  C CG  . PHE A 39  ? 1.1068 0.9701 1.1583 0.0268  -0.0360 0.2580  122 PHE A CG  
280  C CD1 . PHE A 39  ? 1.1221 1.0145 1.1814 0.0327  -0.0354 0.2581  122 PHE A CD1 
281  C CD2 . PHE A 39  ? 1.1277 0.9830 1.1762 0.0045  -0.0400 0.2533  122 PHE A CD2 
282  C CE1 . PHE A 39  ? 1.1437 1.0562 1.2077 0.0167  -0.0402 0.2524  122 PHE A CE1 
283  C CE2 . PHE A 39  ? 1.1657 1.0414 1.2185 -0.0103 -0.0428 0.2480  122 PHE A CE2 
284  C CZ  . PHE A 39  ? 1.1480 1.0521 1.2088 -0.0042 -0.0436 0.2471  122 PHE A CZ  
285  N N   . PRO A 40  ? 1.2949 1.0865 1.3248 0.0975  -0.0104 0.2662  123 PRO A N   
286  C CA  . PRO A 40  ? 1.3725 1.1420 1.4053 0.1150  -0.0032 0.2794  123 PRO A CA  
287  C C   . PRO A 40  ? 1.3699 1.1515 1.4233 0.1024  -0.0112 0.3011  123 PRO A C   
288  O O   . PRO A 40  ? 1.2727 1.0905 1.3440 0.0933  -0.0177 0.3136  123 PRO A O   
289  C CB  . PRO A 40  ? 1.3723 1.1608 1.4148 0.1431  0.0103  0.2911  123 PRO A CB  
290  C CG  . PRO A 40  ? 1.2674 1.0993 1.3242 0.1341  0.0062  0.2944  123 PRO A CG  
291  C CD  . PRO A 40  ? 1.2175 1.0423 1.2563 0.1109  -0.0042 0.2718  123 PRO A CD  
292  N N   . ILE A 41  ? 1.3951 1.1446 1.4436 0.1011  -0.0122 0.3056  124 ILE A N   
293  C CA  . ILE A 41  ? 1.3660 1.1207 1.4252 0.0859  -0.0220 0.3245  124 ILE A CA  
294  C C   . ILE A 41  ? 1.3699 1.1629 1.4558 0.0925  -0.0267 0.3498  124 ILE A C   
295  O O   . ILE A 41  ? 1.3301 1.1411 1.4202 0.0744  -0.0389 0.3591  124 ILE A O   
296  C CB  . ILE A 41  ? 1.4077 1.1229 1.4604 0.0874  -0.0214 0.3313  124 ILE A CB  
297  C CG1 . ILE A 41  ? 1.4724 1.1773 1.5368 0.1163  -0.0124 0.3456  124 ILE A CG1 
298  C CG2 . ILE A 41  ? 1.4741 1.1499 1.5052 0.0754  -0.0201 0.3089  124 ILE A CG2 
299  C CD1 . ILE A 41  ? 1.4950 1.1789 1.5460 0.1385  0.0014  0.3282  124 ILE A CD1 
300  N N   . LYS A 42  ? 1.4078 1.2122 1.5116 0.1183  -0.0170 0.3606  125 LYS A N   
301  C CA  . LYS A 42  ? 1.4475 1.2905 1.5863 0.1261  -0.0216 0.3873  125 LYS A CA  
302  C C   . LYS A 42  ? 1.3825 1.2630 1.5313 0.1091  -0.0327 0.3890  125 LYS A C   
303  O O   . LYS A 42  ? 1.4145 1.3189 1.5865 0.1033  -0.0460 0.4105  125 LYS A O   
304  C CB  . LYS A 42  ? 1.5497 1.4014 1.7083 0.1580  -0.0040 0.3967  125 LYS A CB  
305  C CG  . LYS A 42  ? 1.6656 1.4862 1.8262 0.1779  0.0047  0.4061  125 LYS A CG  
306  C CD  . LYS A 42  ? 1.6930 1.5314 1.8890 0.1788  -0.0072 0.4385  125 LYS A CD  
307  C CE  . LYS A 42  ? 1.8284 1.6282 2.0192 0.1905  -0.0032 0.4452  125 LYS A CE  
308  N NZ  . LYS A 42  ? 1.9542 1.7268 2.1368 0.2206  0.0209  0.4361  125 LYS A NZ  
309  N N   . HIS A 43  ? 1.3766 1.2611 1.5088 0.1015  -0.0288 0.3671  126 HIS A N   
310  C CA  . HIS A 43  ? 1.3397 1.2576 1.4817 0.0870  -0.0378 0.3680  126 HIS A CA  
311  C C   . HIS A 43  ? 1.2407 1.1496 1.3583 0.0604  -0.0464 0.3502  126 HIS A C   
312  O O   . HIS A 43  ? 1.1231 1.0549 1.2452 0.0481  -0.0534 0.3490  126 HIS A O   
313  C CB  . HIS A 43  ? 1.4147 1.3544 1.5662 0.1025  -0.0256 0.3637  126 HIS A CB  
314  C CG  . HIS A 43  ? 1.5320 1.4880 1.7135 0.1290  -0.0142 0.3853  126 HIS A CG  
315  N ND1 . HIS A 43  ? 1.6206 1.5932 1.8096 0.1476  0.0013  0.3851  126 HIS A ND1 
316  C CD2 . HIS A 43  ? 1.5827 1.5414 1.7905 0.1414  -0.0146 0.4093  126 HIS A CD2 
317  C CE1 . HIS A 43  ? 1.6645 1.6502 1.8844 0.1706  0.0124  0.4084  126 HIS A CE1 
318  N NE2 . HIS A 43  ? 1.6725 1.6510 1.9066 0.1674  0.0022  0.4234  126 HIS A NE2 
319  N N   . TYR A 44  ? 1.2637 1.1391 1.3582 0.0514  -0.0455 0.3386  127 TYR A N   
320  C CA  . TYR A 44  ? 1.2080 1.0751 1.2835 0.0272  -0.0502 0.3243  127 TYR A CA  
321  C C   . TYR A 44  ? 1.1805 1.0609 1.2557 0.0107  -0.0632 0.3375  127 TYR A C   
322  O O   . TYR A 44  ? 1.1162 1.0056 1.1835 -0.0040 -0.0657 0.3280  127 TYR A O   
323  C CB  . TYR A 44  ? 1.2278 1.0559 1.2841 0.0205  -0.0455 0.3124  127 TYR A CB  
324  C CG  . TYR A 44  ? 1.2487 1.0577 1.2938 0.0061  -0.0507 0.3236  127 TYR A CG  
325  C CD1 . TYR A 44  ? 1.2252 1.0381 1.2582 -0.0145 -0.0545 0.3212  127 TYR A CD1 
326  C CD2 . TYR A 44  ? 1.2274 1.0111 1.2710 0.0145  -0.0502 0.3364  127 TYR A CD2 
327  C CE1 . TYR A 44  ? 1.2745 1.0672 1.2908 -0.0264 -0.0572 0.3318  127 TYR A CE1 
328  C CE2 . TYR A 44  ? 1.2638 1.0281 1.2934 0.0016  -0.0547 0.3477  127 TYR A CE2 
329  C CZ  . TYR A 44  ? 1.3321 1.1007 1.3460 -0.0189 -0.0579 0.3455  127 TYR A CZ  
330  O OH  . TYR A 44  ? 1.3882 1.1355 1.3812 -0.0314 -0.0603 0.3570  127 TYR A OH  
331  N N   . GLN A 45  ? 1.3460 1.2255 1.4283 0.0140  -0.0725 0.3594  128 GLN A N   
332  C CA  . GLN A 45  ? 1.3341 1.2134 1.4039 -0.0031 -0.0873 0.3701  128 GLN A CA  
333  C C   . GLN A 45  ? 1.2759 1.1836 1.3543 -0.0107 -0.0973 0.3716  128 GLN A C   
334  O O   . GLN A 45  ? 1.1949 1.0961 1.2509 -0.0279 -0.1032 0.3662  128 GLN A O   
335  C CB  . GLN A 45  ? 1.3408 1.2106 1.4148 0.0019  -0.0986 0.3943  128 GLN A CB  
336  C CG  . GLN A 45  ? 1.4429 1.2770 1.5004 0.0040  -0.0904 0.3932  128 GLN A CG  
337  C CD  . GLN A 45  ? 1.4414 1.2570 1.4801 -0.0052 -0.1042 0.4117  128 GLN A CD  
338  O OE1 . GLN A 45  ? 1.3811 1.1732 1.3874 -0.0211 -0.1023 0.4059  128 GLN A OE1 
339  N NE2 . GLN A 45  ? 1.3864 1.2136 1.4454 0.0045  -0.1184 0.4353  128 GLN A NE2 
340  N N   . ASP A 46  ? 1.3165 1.2535 1.4264 0.0024  -0.0975 0.3791  129 ASP A N   
341  C CA  . ASP A 46  ? 1.3510 1.3151 1.4732 -0.0052 -0.1072 0.3810  129 ASP A CA  
342  C C   . ASP A 46  ? 1.3009 1.2668 1.4088 -0.0139 -0.0980 0.3578  129 ASP A C   
343  O O   . ASP A 46  ? 1.2833 1.2551 1.3834 -0.0280 -0.1066 0.3546  129 ASP A O   
344  C CB  . ASP A 46  ? 1.3662 1.3627 1.5310 0.0109  -0.1083 0.3984  129 ASP A CB  
345  C CG  . ASP A 46  ? 1.5077 1.5100 1.6955 0.0155  -0.1240 0.4262  129 ASP A CG  
346  O OD1 . ASP A 46  ? 1.5015 1.4799 1.6675 0.0073  -0.1345 0.4313  129 ASP A OD1 
347  O OD2 . ASP A 46  ? 1.6546 1.6862 1.8844 0.0277  -0.1259 0.4446  129 ASP A OD2 
348  N N   . LYS A 47  ? 1.3118 1.2691 1.4144 -0.0062 -0.0819 0.3415  130 LYS A N   
349  C CA  . LYS A 47  ? 1.2979 1.2555 1.3889 -0.0146 -0.0744 0.3197  130 LYS A CA  
350  C C   . LYS A 47  ? 1.3045 1.2448 1.3705 -0.0350 -0.0770 0.3117  130 LYS A C   
351  O O   . LYS A 47  ? 1.4071 1.3562 1.4692 -0.0448 -0.0775 0.3028  130 LYS A O   
352  C CB  . LYS A 47  ? 1.4279 1.3722 1.5142 -0.0043 -0.0610 0.3040  130 LYS A CB  
353  C CG  . LYS A 47  ? 1.4815 1.4414 1.5840 0.0169  -0.0540 0.3065  130 LYS A CG  
354  C CD  . LYS A 47  ? 1.5985 1.5827 1.7082 0.0161  -0.0527 0.2990  130 LYS A CD  
355  C CE  . LYS A 47  ? 1.6504 1.6636 1.7863 0.0294  -0.0526 0.3172  130 LYS A CE  
356  N NZ  . LYS A 47  ? 1.7295 1.7400 1.8730 0.0537  -0.0411 0.3255  130 LYS A NZ  
357  N N   . ILE A 48  ? 1.2910 1.2051 1.3391 -0.0404 -0.0769 0.3156  131 ILE A N   
358  C CA  . ILE A 48  ? 1.2311 1.1267 1.2532 -0.0577 -0.0744 0.3086  131 ILE A CA  
359  C C   . ILE A 48  ? 1.2121 1.1025 1.2147 -0.0681 -0.0877 0.3205  131 ILE A C   
360  O O   . ILE A 48  ? 1.1582 1.0307 1.1336 -0.0808 -0.0834 0.3150  131 ILE A O   
361  C CB  . ILE A 48  ? 1.3038 1.1705 1.3136 -0.0606 -0.0642 0.3047  131 ILE A CB  
362  C CG1 . ILE A 48  ? 1.3194 1.1666 1.3191 -0.0573 -0.0708 0.3231  131 ILE A CG1 
363  C CG2 . ILE A 48  ? 1.3002 1.1673 1.3263 -0.0511 -0.0553 0.2913  131 ILE A CG2 
364  C CD1 . ILE A 48  ? 1.3412 1.1567 1.3209 -0.0666 -0.0611 0.3215  131 ILE A CD1 
365  N N   . ARG A 49  ? 1.2137 1.1175 1.2292 -0.0624 -0.1039 0.3373  132 ARG A N   
366  C CA  . ARG A 49  ? 1.2266 1.1228 1.2225 -0.0726 -0.1227 0.3495  132 ARG A CA  
367  C C   . ARG A 49  ? 1.1920 1.0814 1.1624 -0.0867 -0.1226 0.3371  132 ARG A C   
368  O O   . ARG A 49  ? 1.3346 1.1985 1.2675 -0.0969 -0.1290 0.3400  132 ARG A O   
369  C CB  . ARG A 49  ? 1.2553 1.1763 1.2825 -0.0655 -0.1419 0.3680  132 ARG A CB  
370  C CG  . ARG A 49  ? 1.3745 1.2927 1.4151 -0.0557 -0.1511 0.3891  132 ARG A CG  
371  C CD  . ARG A 49  ? 1.4144 1.3560 1.4865 -0.0529 -0.1740 0.4108  132 ARG A CD  
372  N NE  . ARG A 49  ? 1.5577 1.4825 1.5995 -0.0696 -0.1982 0.4167  132 ARG A NE  
373  C CZ  . ARG A 49  ? 1.6420 1.5775 1.6884 -0.0796 -0.2164 0.4183  132 ARG A CZ  
374  N NH1 . ARG A 49  ? 1.7333 1.7011 1.8193 -0.0751 -0.2130 0.4170  132 ARG A NH1 
375  N NH2 . ARG A 49  ? 1.6292 1.5396 1.6375 -0.0944 -0.2392 0.4219  132 ARG A NH2 
376  N N   . PRO A 50  ? 1.1348 1.0447 1.1228 -0.0860 -0.1152 0.3240  133 PRO A N   
377  C CA  . PRO A 50  ? 1.1793 1.0823 1.1458 -0.0976 -0.1137 0.3121  133 PRO A CA  
378  C C   . PRO A 50  ? 1.1836 1.0593 1.1162 -0.1060 -0.0965 0.3006  133 PRO A C   
379  O O   . PRO A 50  ? 1.2241 1.0785 1.1211 -0.1155 -0.0985 0.2983  133 PRO A O   
380  C CB  . PRO A 50  ? 1.1677 1.0996 1.1664 -0.0917 -0.1057 0.3015  133 PRO A CB  
381  C CG  . PRO A 50  ? 1.1105 1.0664 1.1447 -0.0783 -0.1121 0.3141  133 PRO A CG  
382  C CD  . PRO A 50  ? 1.1029 1.0424 1.1299 -0.0732 -0.1090 0.3212  133 PRO A CD  
383  N N   . TYR A 51  ? 1.1851 1.0594 1.1285 -0.1022 -0.0799 0.2946  134 TYR A N   
384  C CA  . TYR A 51  ? 1.1995 1.0504 1.1203 -0.1098 -0.0617 0.2875  134 TYR A CA  
385  C C   . TYR A 51  ? 1.3210 1.1388 1.1995 -0.1157 -0.0657 0.2998  134 TYR A C   
386  O O   . TYR A 51  ? 1.4032 1.1980 1.2476 -0.1238 -0.0541 0.2960  134 TYR A O   
387  C CB  . TYR A 51  ? 1.1564 1.0107 1.1018 -0.1054 -0.0484 0.2817  134 TYR A CB  
388  C CG  . TYR A 51  ? 1.0764 0.9580 1.0562 -0.0996 -0.0451 0.2688  134 TYR A CG  
389  C CD1 . TYR A 51  ? 1.0488 0.9373 1.0365 -0.1052 -0.0330 0.2552  134 TYR A CD1 
390  C CD2 . TYR A 51  ? 1.0418 0.9411 1.0450 -0.0872 -0.0535 0.2715  134 TYR A CD2 
391  C CE1 . TYR A 51  ? 1.0295 0.9416 1.0461 -0.0997 -0.0327 0.2445  134 TYR A CE1 
392  C CE2 . TYR A 51  ? 1.0167 0.9373 1.0440 -0.0807 -0.0508 0.2604  134 TYR A CE2 
393  C CZ  . TYR A 51  ? 1.0425 0.9694 1.0758 -0.0875 -0.0420 0.2467  134 TYR A CZ  
394  O OH  . TYR A 51  ? 0.9559 0.9029 1.0109 -0.0809 -0.0419 0.2364  134 TYR A OH  
395  N N   . ILE A 52  ? 1.3267 1.1413 1.2063 -0.1104 -0.0814 0.3154  135 ILE A N   
396  C CA  . ILE A 52  ? 1.4004 1.1835 1.2389 -0.1150 -0.0895 0.3295  135 ILE A CA  
397  C C   . ILE A 52  ? 1.4035 1.1725 1.2038 -0.1231 -0.1036 0.3302  135 ILE A C   
398  O O   . ILE A 52  ? 1.4451 1.1805 1.1960 -0.1300 -0.0974 0.3308  135 ILE A O   
399  C CB  . ILE A 52  ? 1.4499 1.2354 1.3028 -0.1066 -0.1068 0.3482  135 ILE A CB  
400  C CG1 . ILE A 52  ? 1.4458 1.2286 1.3199 -0.0994 -0.0919 0.3486  135 ILE A CG1 
401  C CG2 . ILE A 52  ? 1.5414 1.2958 1.3496 -0.1119 -0.1221 0.3644  135 ILE A CG2 
402  C CD1 . ILE A 52  ? 1.4647 1.2767 1.3847 -0.0888 -0.0872 0.3399  135 ILE A CD1 
403  N N   . GLN A 53  ? 1.3530 1.1445 1.1742 -0.1218 -0.1222 0.3306  136 GLN A N   
404  C CA  . GLN A 53  ? 1.4265 1.2030 1.2147 -0.1299 -0.1424 0.3323  136 GLN A CA  
405  C C   . GLN A 53  ? 1.4308 1.1904 1.1873 -0.1366 -0.1260 0.3149  136 GLN A C   
406  O O   . GLN A 53  ? 1.5009 1.2282 1.2059 -0.1438 -0.1346 0.3142  136 GLN A O   
407  C CB  . GLN A 53  ? 1.4462 1.2538 1.2743 -0.1276 -0.1663 0.3386  136 GLN A CB  
408  C CG  . GLN A 53  ? 1.4505 1.2766 1.3136 -0.1199 -0.1857 0.3597  136 GLN A CG  
409  C CD  . GLN A 53  ? 1.5277 1.3232 1.3541 -0.1225 -0.1994 0.3750  136 GLN A CD  
410  O OE1 . GLN A 53  ? 1.7408 1.5180 1.5380 -0.1306 -0.2257 0.3835  136 GLN A OE1 
411  N NE2 . GLN A 53  ? 1.4695 1.2570 1.2960 -0.1160 -0.1835 0.3791  136 GLN A NE2 
412  N N   . LEU A 54  ? 1.3916 1.1706 1.1770 -0.1336 -0.1025 0.3012  137 LEU A N   
413  C CA  . LEU A 54  ? 1.4288 1.1968 1.1944 -0.1379 -0.0844 0.2857  137 LEU A CA  
414  C C   . LEU A 54  ? 1.3918 1.1310 1.1239 -0.1404 -0.0579 0.2837  137 LEU A C   
415  O O   . LEU A 54  ? 1.4014 1.1485 1.1568 -0.1378 -0.0434 0.2861  137 LEU A O   
416  C CB  . LEU A 54  ? 1.4057 1.2105 1.2226 -0.1333 -0.0740 0.2739  137 LEU A CB  
417  C CG  . LEU A 54  ? 1.3826 1.1851 1.1921 -0.1361 -0.0615 0.2589  137 LEU A CG  
418  C CD1 . LEU A 54  ? 1.3702 1.1588 1.1537 -0.1408 -0.0824 0.2585  137 LEU A CD1 
419  C CD2 . LEU A 54  ? 1.3336 1.1739 1.1973 -0.1304 -0.0521 0.2503  137 LEU A CD2 
420  N N   . PRO A 55  ? 1.4292 1.1326 1.1055 -0.1452 -0.0508 0.2798  138 PRO A N   
421  C CA  . PRO A 55  ? 1.4481 1.1280 1.0982 -0.1462 -0.0188 0.2773  138 PRO A CA  
422  C C   . PRO A 55  ? 1.4288 1.1368 1.1277 -0.1441 0.0066  0.2659  138 PRO A C   
423  O O   . PRO A 55  ? 1.4819 1.2156 1.2128 -0.1423 0.0018  0.2559  138 PRO A O   
424  C CB  . PRO A 55  ? 1.5207 1.1602 1.1044 -0.1491 -0.0165 0.2718  138 PRO A CB  
425  C CG  . PRO A 55  ? 1.5611 1.1941 1.1263 -0.1520 -0.0544 0.2754  138 PRO A CG  
426  C CD  . PRO A 55  ? 1.5114 1.1930 1.1468 -0.1494 -0.0709 0.2769  138 PRO A CD  
427  N N   . SER A 56  ? 1.5326 1.2350 1.2382 -0.1448 0.0331  0.2684  139 SER A N   
428  C CA  . SER A 56  ? 1.5189 1.2498 1.2777 -0.1440 0.0541  0.2594  139 SER A CA  
429  C C   . SER A 56  ? 1.4539 1.1811 1.2029 -0.1430 0.0711  0.2481  139 SER A C   
430  O O   . SER A 56  ? 1.4743 1.1677 1.1665 -0.1431 0.0748  0.2474  139 SER A O   
431  C CB  . SER A 56  ? 1.5437 1.2695 1.3180 -0.1466 0.0764  0.2668  139 SER A CB  
432  O OG  . SER A 56  ? 1.6639 1.3543 1.3905 -0.1485 0.1000  0.2730  139 SER A OG  
433  N N   . HIS A 57  ? 1.3810 1.1414 1.1843 -0.1414 0.0798  0.2390  140 HIS A N   
434  C CA  . HIS A 57  ? 1.3820 1.1456 1.1881 -0.1389 0.0936  0.2283  140 HIS A CA  
435  C C   . HIS A 57  ? 1.3118 1.1117 1.1845 -0.1380 0.1073  0.2230  140 HIS A C   
436  O O   . HIS A 57  ? 1.1665 0.9954 1.0822 -0.1380 0.0916  0.2218  140 HIS A O   
437  C CB  . HIS A 57  ? 1.3774 1.1441 1.1712 -0.1370 0.0680  0.2218  140 HIS A CB  
438  C CG  . HIS A 57  ? 1.3911 1.1590 1.1878 -0.1337 0.0801  0.2105  140 HIS A CG  
439  N ND1 . HIS A 57  ? 1.4587 1.1881 1.2001 -0.1324 0.0920  0.2064  140 HIS A ND1 
440  C CD2 . HIS A 57  ? 1.3597 1.1604 1.2068 -0.1303 0.0826  0.2027  140 HIS A CD2 
441  C CE1 . HIS A 57  ? 1.4273 1.1662 1.1878 -0.1281 0.1024  0.1963  140 HIS A CE1 
442  N NE2 . HIS A 57  ? 1.3907 1.1742 1.2169 -0.1270 0.0966  0.1948  140 HIS A NE2 
443  N N   . SER A 58  ? 1.3870 1.1834 1.2668 -0.1368 0.1365  0.2205  141 SER A N   
444  C CA  . SER A 58  ? 1.3521 1.1822 1.2983 -0.1368 0.1503  0.2174  141 SER A CA  
445  C C   . SER A 58  ? 1.3173 1.1839 1.3087 -0.1341 0.1285  0.2084  141 SER A C   
446  O O   . SER A 58  ? 1.2735 1.1683 1.3190 -0.1358 0.1282  0.2073  141 SER A O   
447  C CB  . SER A 58  ? 1.4023 1.2232 1.3478 -0.1333 0.1848  0.2167  141 SER A CB  
448  O OG  . SER A 58  ? 1.4297 1.2295 1.3310 -0.1274 0.1848  0.2091  141 SER A OG  
449  N N   . ASN A 59  ? 1.2857 1.1501 1.2544 -0.1304 0.1103  0.2028  142 ASN A N   
450  C CA  . ASN A 59  ? 1.2170 1.1130 1.2212 -0.1270 0.0890  0.1966  142 ASN A CA  
451  C C   . ASN A 59  ? 1.2214 1.1262 1.2234 -0.1265 0.0602  0.1995  142 ASN A C   
452  O O   . ASN A 59  ? 1.2784 1.2056 1.3018 -0.1223 0.0443  0.1959  142 ASN A O   
453  C CB  . ASN A 59  ? 1.2402 1.1320 1.2319 -0.1226 0.0898  0.1897  142 ASN A CB  
454  C CG  . ASN A 59  ? 1.2794 1.1639 1.2768 -0.1200 0.1202  0.1867  142 ASN A CG  
455  O OD1 . ASN A 59  ? 1.2899 1.1441 1.2441 -0.1177 0.1313  0.1841  142 ASN A OD1 
456  N ND2 . ASN A 59  ? 1.2893 1.2002 1.3405 -0.1199 0.1333  0.1875  142 ASN A ND2 
457  N N   . ILE A 60  ? 1.2315 1.1194 1.2094 -0.1295 0.0546  0.2074  143 ILE A N   
458  C CA  . ILE A 60  ? 1.1565 1.0551 1.1413 -0.1272 0.0315  0.2119  143 ILE A CA  
459  C C   . ILE A 60  ? 1.1301 1.0305 1.1344 -0.1292 0.0357  0.2152  143 ILE A C   
460  O O   . ILE A 60  ? 1.1945 1.0730 1.1809 -0.1341 0.0497  0.2209  143 ILE A O   
461  C CB  . ILE A 60  ? 1.2117 1.0874 1.1528 -0.1282 0.0164  0.2205  143 ILE A CB  
462  C CG1 . ILE A 60  ? 1.2036 1.0634 1.1123 -0.1294 0.0129  0.2174  143 ILE A CG1 
463  C CG2 . ILE A 60  ? 1.1985 1.0920 1.1571 -0.1233 -0.0057 0.2260  143 ILE A CG2 
464  C CD1 . ILE A 60  ? 1.2307 1.1141 1.1631 -0.1257 -0.0026 0.2136  143 ILE A CD1 
465  N N   . THR A 61  ? 1.0684 0.9906 1.1048 -0.1249 0.0235  0.2121  144 THR A N   
466  C CA  . THR A 61  ? 1.1214 1.0418 1.1757 -0.1265 0.0239  0.2134  144 THR A CA  
467  C C   . THR A 61  ? 1.1541 1.0526 1.1812 -0.1263 0.0177  0.2239  144 THR A C   
468  O O   . THR A 61  ? 1.2280 1.1305 1.2481 -0.1195 0.0017  0.2278  144 THR A O   
469  C CB  . THR A 61  ? 1.1039 1.0473 1.1896 -0.1200 0.0100  0.2061  144 THR A CB  
470  O OG1 . THR A 61  ? 1.0872 1.0504 1.2020 -0.1209 0.0145  0.1974  144 THR A OG1 
471  C CG2 . THR A 61  ? 1.1104 1.0449 1.2078 -0.1210 0.0070  0.2059  144 THR A CG2 
472  N N   . GLY A 62  ? 1.2510 1.1279 1.2674 -0.1329 0.0310  0.2300  145 GLY A N   
473  C CA  . GLY A 62  ? 1.2953 1.1496 1.2880 -0.1327 0.0260  0.2414  145 GLY A CA  
474  C C   . GLY A 62  ? 1.2586 1.1130 1.2745 -0.1301 0.0192  0.2409  145 GLY A C   
475  O O   . GLY A 62  ? 1.2068 1.0749 1.2564 -0.1307 0.0191  0.2311  145 GLY A O   
476  N N   . ILE A 63  ? 1.1950 1.0320 1.1912 -0.1265 0.0113  0.2516  146 ILE A N   
477  C CA  . ILE A 63  ? 1.2055 1.0328 1.2162 -0.1238 0.0073  0.2526  146 ILE A CA  
478  C C   . ILE A 63  ? 1.2082 1.0163 1.2238 -0.1351 0.0242  0.2561  146 ILE A C   
479  O O   . ILE A 63  ? 1.1833 0.9753 1.1734 -0.1407 0.0360  0.2659  146 ILE A O   
480  C CB  . ILE A 63  ? 1.2476 1.0615 1.2374 -0.1154 -0.0046 0.2656  146 ILE A CB  
481  C CG1 . ILE A 63  ? 1.1884 1.0249 1.1795 -0.1047 -0.0198 0.2655  146 ILE A CG1 
482  C CG2 . ILE A 63  ? 1.2884 1.0855 1.2902 -0.1119 -0.0059 0.2670  146 ILE A CG2 
483  C CD1 . ILE A 63  ? 1.2042 1.0372 1.1913 -0.0933 -0.0326 0.2776  146 ILE A CD1 
484  N N   . VAL A 64  ? 1.2725 1.0806 1.3195 -0.1385 0.0249  0.2488  147 VAL A N   
485  C CA  . VAL A 64  ? 1.3121 1.1016 1.3720 -0.1501 0.0394  0.2544  147 VAL A CA  
486  C C   . VAL A 64  ? 1.3626 1.1230 1.4031 -0.1474 0.0361  0.2665  147 VAL A C   
487  O O   . VAL A 64  ? 1.3864 1.1262 1.4075 -0.1531 0.0487  0.2804  147 VAL A O   
488  C CB  . VAL A 64  ? 1.3385 1.1371 1.4434 -0.1565 0.0367  0.2422  147 VAL A CB  
489  C CG1 . VAL A 64  ? 1.3766 1.1590 1.5022 -0.1705 0.0526  0.2505  147 VAL A CG1 
490  C CG2 . VAL A 64  ? 1.3082 1.1376 1.4350 -0.1568 0.0357  0.2304  147 VAL A CG2 
491  N N   . GLU A 65  ? 1.4281 1.1856 1.4720 -0.1374 0.0201  0.2619  148 GLU A N   
492  C CA  . GLU A 65  ? 1.5388 1.2702 1.5656 -0.1314 0.0155  0.2737  148 GLU A CA  
493  C C   . GLU A 65  ? 1.5282 1.2647 1.5573 -0.1154 -0.0007 0.2669  148 GLU A C   
494  O O   . GLU A 65  ? 1.4761 1.2317 1.5215 -0.1110 -0.0073 0.2515  148 GLU A O   
495  C CB  . GLU A 65  ? 1.6517 1.3562 1.6943 -0.1416 0.0238  0.2774  148 GLU A CB  
496  C CG  . GLU A 65  ? 1.7246 1.4293 1.8027 -0.1459 0.0176  0.2611  148 GLU A CG  
497  C CD  . GLU A 65  ? 1.8817 1.5560 1.9765 -0.1574 0.0238  0.2672  148 GLU A CD  
498  O OE1 . GLU A 65  ? 1.9627 1.6261 2.0552 -0.1679 0.0405  0.2824  148 GLU A OE1 
499  O OE2 . GLU A 65  ? 1.8971 1.5553 2.0060 -0.1556 0.0122  0.2571  148 GLU A OE2 
500  N N   . VAL A 66  ? 1.4123 1.1322 1.4248 -0.1054 -0.0061 0.2796  149 VAL A N   
501  C CA  . VAL A 66  ? 1.3744 1.0934 1.3915 -0.0883 -0.0168 0.2753  149 VAL A CA  
502  C C   . VAL A 66  ? 1.3696 1.0536 1.3886 -0.0866 -0.0157 0.2785  149 VAL A C   
503  O O   . VAL A 66  ? 1.5406 1.2040 1.5495 -0.0933 -0.0100 0.2931  149 VAL A O   
504  C CB  . VAL A 66  ? 1.3227 1.0586 1.3286 -0.0738 -0.0255 0.2865  149 VAL A CB  
505  C CG1 . VAL A 66  ? 1.3022 1.0610 1.2982 -0.0812 -0.0262 0.2902  149 VAL A CG1 
506  C CG2 . VAL A 66  ? 1.3662 1.0811 1.3608 -0.0656 -0.0288 0.3055  149 VAL A CG2 
507  N N   . ILE A 67  ? 1.3619 1.0356 1.3911 -0.0782 -0.0208 0.2643  150 ILE A N   
508  C CA  . ILE A 67  ? 1.3914 1.0272 1.4201 -0.0732 -0.0216 0.2653  150 ILE A CA  
509  C C   . ILE A 67  ? 1.4052 1.0391 1.4257 -0.0488 -0.0267 0.2664  150 ILE A C   
510  O O   . ILE A 67  ? 1.4725 1.1278 1.4939 -0.0379 -0.0304 0.2555  150 ILE A O   
511  C CB  . ILE A 67  ? 1.3900 1.0074 1.4350 -0.0840 -0.0240 0.2467  150 ILE A CB  
512  C CG1 . ILE A 67  ? 1.4436 1.0620 1.5039 -0.1076 -0.0155 0.2516  150 ILE A CG1 
513  C CG2 . ILE A 67  ? 1.4026 0.9769 1.4436 -0.0758 -0.0276 0.2438  150 ILE A CG2 
514  C CD1 . ILE A 67  ? 1.5055 1.1163 1.5925 -0.1225 -0.0197 0.2354  150 ILE A CD1 
515  N N   . LEU A 68  ? 1.3133 0.9217 1.3272 -0.0392 -0.0256 0.2806  151 LEU A N   
516  C CA  . LEU A 68  ? 1.3190 0.9257 1.3295 -0.0141 -0.0274 0.2853  151 LEU A CA  
517  C C   . LEU A 68  ? 1.3777 0.9427 1.3847 -0.0039 -0.0265 0.2746  151 LEU A C   
518  O O   . LEU A 68  ? 1.4463 0.9778 1.4535 -0.0138 -0.0252 0.2771  151 LEU A O   
519  C CB  . LEU A 68  ? 1.3186 0.9296 1.3263 -0.0072 -0.0283 0.3118  151 LEU A CB  
520  C CG  . LEU A 68  ? 1.3071 0.9543 1.3137 -0.0120 -0.0330 0.3252  151 LEU A CG  
521  C CD1 . LEU A 68  ? 1.3007 0.9829 1.3149 -0.0068 -0.0348 0.3126  151 LEU A CD1 
522  C CD2 . LEU A 68  ? 1.3234 0.9697 1.3190 -0.0352 -0.0312 0.3294  151 LEU A CD2 
523  N N   . GLY A 69  ? 1.4359 1.0005 1.4377 0.0158  -0.0265 0.2623  152 GLY A N   
524  C CA  . GLY A 69  ? 1.5274 1.0481 1.5186 0.0316  -0.0249 0.2523  152 GLY A CA  
525  C C   . GLY A 69  ? 1.5752 1.0996 1.5656 0.0601  -0.0181 0.2674  152 GLY A C   
526  O O   . GLY A 69  ? 1.5664 1.1271 1.5684 0.0639  -0.0175 0.2865  152 GLY A O   
527  N N   . GLU A 70  ? 1.6489 1.1348 1.6264 0.0806  -0.0132 0.2587  153 GLU A N   
528  C CA  . GLU A 70  ? 1.6815 1.1676 1.6616 0.1111  -0.0033 0.2737  153 GLU A CA  
529  C C   . GLU A 70  ? 1.6046 1.1365 1.5915 0.1256  0.0014  0.2777  153 GLU A C   
530  O O   . GLU A 70  ? 1.6102 1.1745 1.6181 0.1343  0.0036  0.3017  153 GLU A O   
531  C CB  . GLU A 70  ? 1.7933 1.2247 1.7521 0.1320  0.0033  0.2588  153 GLU A CB  
532  C CG  . GLU A 70  ? 1.8949 1.2764 1.8511 0.1212  -0.0004 0.2594  153 GLU A CG  
533  C CD  . GLU A 70  ? 1.9274 1.3025 1.8988 0.1348  0.0057  0.2879  153 GLU A CD  
534  O OE1 . GLU A 70  ? 1.9466 1.3428 1.9280 0.1605  0.0148  0.3032  153 GLU A OE1 
535  O OE2 . GLU A 70  ? 1.9372 1.2861 1.9128 0.1200  0.0015  0.2964  153 GLU A OE2 
536  N N   . THR A 71  ? 1.6280 1.1616 1.5982 0.1277  0.0016  0.2552  154 THR A N   
537  C CA  . THR A 71  ? 1.6176 1.1895 1.5917 0.1441  0.0086  0.2581  154 THR A CA  
538  C C   . THR A 71  ? 1.5428 1.1619 1.5296 0.1234  0.0001  0.2588  154 THR A C   
539  O O   . THR A 71  ? 1.4812 1.1403 1.4832 0.1329  0.0044  0.2717  154 THR A O   
540  C CB  . THR A 71  ? 1.7071 1.2513 1.6490 0.1623  0.0150  0.2341  154 THR A CB  
541  O OG1 . THR A 71  ? 1.8214 1.3157 1.7466 0.1844  0.0244  0.2318  154 THR A OG1 
542  C CG2 . THR A 71  ? 1.7011 1.2845 1.6465 0.1815  0.0257  0.2402  154 THR A CG2 
543  N N   . LYS A 72  ? 1.5669 1.1805 1.5496 0.0959  -0.0107 0.2452  155 LYS A N   
544  C CA  . LYS A 72  ? 1.5072 1.1597 1.4985 0.0767  -0.0177 0.2412  155 LYS A CA  
545  C C   . LYS A 72  ? 1.4167 1.0793 1.4206 0.0494  -0.0246 0.2497  155 LYS A C   
546  O O   . LYS A 72  ? 1.4532 1.0858 1.4553 0.0389  -0.0260 0.2511  155 LYS A O   
547  C CB  . LYS A 72  ? 1.5894 1.2292 1.5630 0.0717  -0.0229 0.2140  155 LYS A CB  
548  C CG  . LYS A 72  ? 1.6741 1.3089 1.6275 0.0984  -0.0156 0.2048  155 LYS A CG  
549  C CD  . LYS A 72  ? 1.7839 1.3696 1.7058 0.1021  -0.0209 0.1787  155 LYS A CD  
550  C CE  . LYS A 72  ? 1.8787 1.4553 1.7714 0.1306  -0.0119 0.1697  155 LYS A CE  
551  N NZ  . LYS A 72  ? 1.8899 1.5090 1.7858 0.1292  -0.0130 0.1688  155 LYS A NZ  
552  N N   . ALA A 73  ? 1.2979 1.0005 1.3126 0.0388  -0.0276 0.2557  156 ALA A N   
553  C CA  . ALA A 73  ? 1.3153 1.0272 1.3353 0.0132  -0.0320 0.2588  156 ALA A CA  
554  C C   . ALA A 73  ? 1.3184 1.0374 1.3385 -0.0008 -0.0351 0.2381  156 ALA A C   
555  O O   . ALA A 73  ? 1.3230 1.0561 1.3407 0.0085  -0.0360 0.2271  156 ALA A O   
556  C CB  . ALA A 73  ? 1.3132 1.0598 1.3417 0.0105  -0.0346 0.2773  156 ALA A CB  
557  N N   . TYR A 74  ? 1.3118 1.0209 1.3362 -0.0225 -0.0359 0.2345  157 TYR A N   
558  C CA  . TYR A 74  ? 1.2766 0.9959 1.3094 -0.0381 -0.0391 0.2182  157 TYR A CA  
559  C C   . TYR A 74  ? 1.2103 0.9524 1.2510 -0.0555 -0.0351 0.2276  157 TYR A C   
560  O O   . TYR A 74  ? 1.2788 1.0068 1.3183 -0.0663 -0.0303 0.2385  157 TYR A O   
561  C CB  . TYR A 74  ? 1.3125 0.9967 1.3489 -0.0485 -0.0423 0.2058  157 TYR A CB  
562  C CG  . TYR A 74  ? 1.3446 0.9976 1.3658 -0.0311 -0.0467 0.1945  157 TYR A CG  
563  C CD1 . TYR A 74  ? 1.3550 0.9780 1.3663 -0.0188 -0.0426 0.2041  157 TYR A CD1 
564  C CD2 . TYR A 74  ? 1.3837 1.0348 1.3968 -0.0249 -0.0548 0.1747  157 TYR A CD2 
565  C CE1 . TYR A 74  ? 1.4053 0.9950 1.3988 -0.0003 -0.0443 0.1930  157 TYR A CE1 
566  C CE2 . TYR A 74  ? 1.4655 1.0822 1.4559 -0.0067 -0.0578 0.1630  157 TYR A CE2 
567  C CZ  . TYR A 74  ? 1.4710 1.0561 1.4514 0.0059  -0.0515 0.1717  157 TYR A CZ  
568  O OH  . TYR A 74  ? 1.5244 1.0706 1.4790 0.0254  -0.0525 0.1591  157 TYR A OH  
569  N N   . VAL A 75  ? 1.1182 0.8924 1.1637 -0.0571 -0.0362 0.2239  158 VAL A N   
570  C CA  . VAL A 75  ? 1.1305 0.9230 1.1788 -0.0712 -0.0316 0.2311  158 VAL A CA  
571  C C   . VAL A 75  ? 1.2018 1.0042 1.2670 -0.0851 -0.0302 0.2173  158 VAL A C   
572  O O   . VAL A 75  ? 1.1936 1.0106 1.2662 -0.0804 -0.0362 0.2046  158 VAL A O   
573  C CB  . VAL A 75  ? 1.1072 0.9277 1.1508 -0.0627 -0.0345 0.2391  158 VAL A CB  
574  C CG1 . VAL A 75  ? 1.1264 0.9563 1.1634 -0.0760 -0.0306 0.2476  158 VAL A CG1 
575  C CG2 . VAL A 75  ? 1.1388 0.9534 1.1754 -0.0462 -0.0378 0.2526  158 VAL A CG2 
576  N N   . PHE A 76  ? 1.2439 1.0386 1.3161 -0.1016 -0.0215 0.2214  159 PHE A N   
577  C CA  . PHE A 76  ? 1.2238 1.0273 1.3208 -0.1154 -0.0188 0.2111  159 PHE A CA  
578  C C   . PHE A 76  ? 1.1898 1.0188 1.2909 -0.1221 -0.0101 0.2136  159 PHE A C   
579  O O   . PHE A 76  ? 1.0768 0.9045 1.1595 -0.1240 -0.0016 0.2255  159 PHE A O   
580  C CB  . PHE A 76  ? 1.2916 1.0694 1.4018 -0.1288 -0.0129 0.2143  159 PHE A CB  
581  C CG  . PHE A 76  ? 1.3564 1.1067 1.4667 -0.1235 -0.0237 0.2069  159 PHE A CG  
582  C CD1 . PHE A 76  ? 1.4019 1.1498 1.5299 -0.1262 -0.0361 0.1898  159 PHE A CD1 
583  C CD2 . PHE A 76  ? 1.3979 1.1225 1.4880 -0.1147 -0.0231 0.2166  159 PHE A CD2 
584  C CE1 . PHE A 76  ? 1.3988 1.1147 1.5200 -0.1206 -0.0473 0.1808  159 PHE A CE1 
585  C CE2 . PHE A 76  ? 1.4360 1.1311 1.5232 -0.1079 -0.0321 0.2086  159 PHE A CE2 
586  C CZ  . PHE A 76  ? 1.4498 1.1386 1.5500 -0.1107 -0.0440 0.1897  159 PHE A CZ  
587  N N   . PHE A 77  ? 1.2824 1.1322 1.4056 -0.1248 -0.0138 0.2016  160 PHE A N   
588  C CA  . PHE A 77  ? 1.2438 1.1191 1.3742 -0.1280 -0.0071 0.2009  160 PHE A CA  
589  C C   . PHE A 77  ? 1.2524 1.1377 1.4199 -0.1402 -0.0033 0.1942  160 PHE A C   
590  O O   . PHE A 77  ? 1.2194 1.1027 1.4068 -0.1417 -0.0158 0.1841  160 PHE A O   
591  C CB  . PHE A 77  ? 1.2235 1.1199 1.3484 -0.1152 -0.0183 0.1943  160 PHE A CB  
592  C CG  . PHE A 77  ? 1.3132 1.2091 1.4109 -0.1041 -0.0210 0.2038  160 PHE A CG  
593  C CD1 . PHE A 77  ? 1.3358 1.2421 1.4211 -0.1054 -0.0163 0.2110  160 PHE A CD1 
594  C CD2 . PHE A 77  ? 1.3796 1.2641 1.4656 -0.0918 -0.0291 0.2057  160 PHE A CD2 
595  C CE1 . PHE A 77  ? 1.3494 1.2571 1.4156 -0.0970 -0.0225 0.2207  160 PHE A CE1 
596  C CE2 . PHE A 77  ? 1.3936 1.2820 1.4633 -0.0816 -0.0320 0.2170  160 PHE A CE2 
597  C CZ  . PHE A 77  ? 1.3774 1.2787 1.4393 -0.0853 -0.0303 0.2249  160 PHE A CZ  
598  N N   . GLU A 78  ? 1.3025 1.1962 1.4786 -0.1484 0.0134  0.2003  161 GLU A N   
599  C CA  . GLU A 78  ? 1.3694 1.2828 1.5857 -0.1570 0.0195  0.1961  161 GLU A CA  
600  C C   . GLU A 78  ? 1.2734 1.2095 1.5065 -0.1508 0.0018  0.1832  161 GLU A C   
601  O O   . GLU A 78  ? 1.4248 1.3678 1.6344 -0.1389 -0.0069 0.1799  161 GLU A O   
602  C CB  . GLU A 78  ? 1.5011 1.4218 1.7098 -0.1590 0.0417  0.2040  161 GLU A CB  
603  C CG  . GLU A 78  ? 1.6614 1.5722 1.8203 -0.1504 0.0428  0.2093  161 GLU A CG  
604  C CD  . GLU A 78  ? 1.7403 1.6565 1.8841 -0.1495 0.0582  0.2120  161 GLU A CD  
605  O OE1 . GLU A 78  ? 1.9303 1.8605 2.1027 -0.1534 0.0715  0.2100  161 GLU A OE1 
606  O OE2 . GLU A 78  ? 1.6011 1.5052 1.7037 -0.1447 0.0564  0.2165  161 GLU A OE2 
607  N N   . LYS A 79  ? 1.2680 1.2159 1.5431 -0.1589 -0.0038 0.1775  162 LYS A N   
608  C CA  . LYS A 79  ? 1.2591 1.2267 1.5493 -0.1534 -0.0225 0.1661  162 LYS A CA  
609  C C   . LYS A 79  ? 1.1546 1.1498 1.4599 -0.1512 -0.0129 0.1677  162 LYS A C   
610  O O   . LYS A 79  ? 1.1361 1.1374 1.4596 -0.1580 0.0073  0.1755  162 LYS A O   
611  C CB  . LYS A 79  ? 1.3681 1.3351 1.6981 -0.1638 -0.0384 0.1591  162 LYS A CB  
612  C CG  . LYS A 79  ? 1.4530 1.4363 1.7923 -0.1577 -0.0610 0.1475  162 LYS A CG  
613  C CD  . LYS A 79  ? 1.4241 1.4109 1.8091 -0.1702 -0.0793 0.1418  162 LYS A CD  
614  C CE  . LYS A 79  ? 1.3978 1.4135 1.8392 -0.1807 -0.0673 0.1502  162 LYS A CE  
615  N NZ  . LYS A 79  ? 1.5060 1.5246 1.9976 -0.1945 -0.0887 0.1466  162 LYS A NZ  
616  N N   . ASP A 80  ? 1.1199 1.1300 1.4177 -0.1409 -0.0268 0.1606  163 ASP A N   
617  C CA  . ASP A 80  ? 1.1339 1.1691 1.4483 -0.1378 -0.0212 0.1611  163 ASP A CA  
618  C C   . ASP A 80  ? 1.1402 1.1948 1.4985 -0.1415 -0.0358 0.1553  163 ASP A C   
619  O O   . ASP A 80  ? 1.1978 1.2448 1.5632 -0.1441 -0.0565 0.1481  163 ASP A O   
620  C CB  . ASP A 80  ? 1.1801 1.2205 1.4607 -0.1241 -0.0266 0.1597  163 ASP A CB  
621  C CG  . ASP A 80  ? 1.2326 1.2752 1.5042 -0.1147 -0.0495 0.1514  163 ASP A CG  
622  O OD1 . ASP A 80  ? 1.2107 1.2337 1.4583 -0.1110 -0.0571 0.1490  163 ASP A OD1 
623  O OD2 . ASP A 80  ? 1.2910 1.3524 1.5762 -0.1098 -0.0588 0.1478  163 ASP A OD2 
624  N N   . PHE A 81  ? 1.0596 1.1371 1.4455 -0.1412 -0.0264 0.1585  164 PHE A N   
625  C CA  . PHE A 81  ? 1.0420 1.1421 1.4748 -0.1441 -0.0402 0.1557  164 PHE A CA  
626  C C   . PHE A 81  ? 1.0538 1.1721 1.4790 -0.1318 -0.0456 0.1537  164 PHE A C   
627  O O   . PHE A 81  ? 1.0833 1.2226 1.5424 -0.1313 -0.0375 0.1577  164 PHE A O   
628  C CB  . PHE A 81  ? 1.0107 1.1236 1.4969 -0.1553 -0.0218 0.1644  164 PHE A CB  
629  C CG  . PHE A 81  ? 1.0098 1.1049 1.5065 -0.1679 -0.0149 0.1688  164 PHE A CG  
630  C CD1 . PHE A 81  ? 0.9943 1.0680 1.4558 -0.1683 0.0076  0.1750  164 PHE A CD1 
631  C CD2 . PHE A 81  ? 0.9951 1.0931 1.5362 -0.1800 -0.0323 0.1676  164 PHE A CD2 
632  C CE1 . PHE A 81  ? 1.0147 1.0706 1.4846 -0.1794 0.0149  0.1807  164 PHE A CE1 
633  C CE2 . PHE A 81  ? 1.0628 1.1429 1.6159 -0.1924 -0.0253 0.1730  164 PHE A CE2 
634  C CZ  . PHE A 81  ? 1.0529 1.1121 1.5703 -0.1917 -0.0004 0.1800  164 PHE A CZ  
635  N N   . GLY A 82  ? 0.9725 1.0818 1.3542 -0.1211 -0.0579 0.1489  165 GLY A N   
636  C CA  . GLY A 82  ? 0.8821 1.0055 1.2533 -0.1092 -0.0651 0.1480  165 GLY A CA  
637  C C   . GLY A 82  ? 0.8776 0.9980 1.2197 -0.1029 -0.0477 0.1534  165 GLY A C   
638  O O   . GLY A 82  ? 0.8807 0.9909 1.2162 -0.1083 -0.0287 0.1578  165 GLY A O   
639  N N   . ASP A 83  ? 0.8635 0.9914 1.1879 -0.0916 -0.0559 0.1535  166 ASP A N   
640  C CA  . ASP A 83  ? 0.8799 1.0051 1.1776 -0.0854 -0.0461 0.1587  166 ASP A CA  
641  C C   . ASP A 83  ? 0.9097 1.0519 1.2263 -0.0814 -0.0416 0.1613  166 ASP A C   
642  O O   . ASP A 83  ? 1.0030 1.1616 1.3481 -0.0794 -0.0510 0.1596  166 ASP A O   
643  C CB  . ASP A 83  ? 0.9427 1.0619 1.2069 -0.0750 -0.0578 0.1593  166 ASP A CB  
644  C CG  . ASP A 83  ? 0.9799 1.1123 1.2464 -0.0645 -0.0736 0.1575  166 ASP A CG  
645  O OD1 . ASP A 83  ? 0.9705 1.1148 1.2375 -0.0578 -0.0721 0.1627  166 ASP A OD1 
646  O OD2 . ASP A 83  ? 1.0553 1.1829 1.3191 -0.0626 -0.0884 0.1512  166 ASP A OD2 
647  N N   . MET A 84  ? 0.8802 1.0167 1.1799 -0.0798 -0.0295 0.1655  167 MET A N   
648  C CA  . MET A 84  ? 0.8446 0.9915 1.1595 -0.0760 -0.0233 0.1677  167 MET A CA  
649  C C   . MET A 84  ? 0.8786 1.0404 1.1962 -0.0658 -0.0375 0.1701  167 MET A C   
650  O O   . MET A 84  ? 0.9579 1.1300 1.2947 -0.0621 -0.0343 0.1721  167 MET A O   
651  C CB  . MET A 84  ? 0.8772 1.0071 1.1682 -0.0781 -0.0085 0.1702  167 MET A CB  
652  C CG  . MET A 84  ? 0.9448 1.0616 1.2390 -0.0858 0.0114  0.1688  167 MET A CG  
653  S SD  . MET A 84  ? 1.0482 1.1834 1.3933 -0.0846 0.0234  0.1682  167 MET A SD  
654  C CE  . MET A 84  ? 1.0126 1.1462 1.3517 -0.0761 0.0281  0.1691  167 MET A CE  
655  N N   . HIS A 85  ? 0.8753 1.0368 1.1729 -0.0599 -0.0512 0.1709  168 HIS A N   
656  C CA  . HIS A 85  ? 0.8736 1.0474 1.1694 -0.0489 -0.0626 0.1750  168 HIS A CA  
657  C C   . HIS A 85  ? 0.9180 1.1047 1.2364 -0.0463 -0.0762 0.1713  168 HIS A C   
658  O O   . HIS A 85  ? 0.8763 1.0764 1.2113 -0.0407 -0.0804 0.1749  168 HIS A O   
659  C CB  . HIS A 85  ? 0.8997 1.0671 1.1640 -0.0414 -0.0685 0.1791  168 HIS A CB  
660  C CG  . HIS A 85  ? 0.8809 1.0581 1.1390 -0.0288 -0.0798 0.1830  168 HIS A CG  
661  N ND1 . HIS A 85  ? 0.8429 1.0307 1.1060 -0.0221 -0.0786 0.1920  168 HIS A ND1 
662  C CD2 . HIS A 85  ? 0.8952 1.0701 1.1394 -0.0213 -0.0924 0.1793  168 HIS A CD2 
663  C CE1 . HIS A 85  ? 0.8671 1.0604 1.1196 -0.0105 -0.0886 0.1951  168 HIS A CE1 
664  N NE2 . HIS A 85  ? 0.9391 1.1235 1.1773 -0.0094 -0.0975 0.1867  168 HIS A NE2 
665  N N   . SER A 86  ? 1.0159 1.1969 1.3355 -0.0509 -0.0850 0.1644  169 SER A N   
666  C CA  . SER A 86  ? 0.9981 1.1894 1.3428 -0.0515 -0.1016 0.1604  169 SER A CA  
667  C C   . SER A 86  ? 0.9544 1.1613 1.3461 -0.0579 -0.0933 0.1625  169 SER A C   
668  O O   . SER A 86  ? 0.9437 1.1663 1.3623 -0.0548 -0.1057 0.1641  169 SER A O   
669  C CB  . SER A 86  ? 1.0177 1.1954 1.3559 -0.0577 -0.1136 0.1520  169 SER A CB  
670  O OG  . SER A 86  ? 1.0072 1.1675 1.3009 -0.0503 -0.1159 0.1505  169 SER A OG  
671  N N   . TYR A 87  ? 0.8991 1.1005 1.2991 -0.0655 -0.0718 0.1634  170 TYR A N   
672  C CA  . TYR A 87  ? 0.8473 1.0606 1.2892 -0.0694 -0.0575 0.1663  170 TYR A CA  
673  C C   . TYR A 87  ? 0.8828 1.1088 1.3364 -0.0598 -0.0570 0.1715  170 TYR A C   
674  O O   . TYR A 87  ? 0.9267 1.1710 1.4220 -0.0583 -0.0616 0.1743  170 TYR A O   
675  C CB  . TYR A 87  ? 0.7858 0.9844 1.2195 -0.0758 -0.0315 0.1669  170 TYR A CB  
676  C CG  . TYR A 87  ? 0.7340 0.9424 1.2131 -0.0801 -0.0140 0.1698  170 TYR A CG  
677  C CD1 . TYR A 87  ? 0.6964 0.9205 1.2211 -0.0864 -0.0223 0.1706  170 TYR A CD1 
678  C CD2 . TYR A 87  ? 0.7403 0.9410 1.2176 -0.0776 0.0114  0.1723  170 TYR A CD2 
679  C CE1 . TYR A 87  ? 0.7020 0.9383 1.2755 -0.0897 -0.0038 0.1761  170 TYR A CE1 
680  C CE2 . TYR A 87  ? 0.7200 0.9290 1.2393 -0.0791 0.0319  0.1762  170 TYR A CE2 
681  C CZ  . TYR A 87  ? 0.6961 0.9254 1.2670 -0.0851 0.0249  0.1792  170 TYR A CZ  
682  O OH  . TYR A 87  ? 0.7016 0.9439 1.3241 -0.0867 0.0454  0.1859  170 TYR A OH  
683  N N   . VAL A 88  ? 0.9203 1.1373 1.3408 -0.0536 -0.0530 0.1739  171 VAL A N   
684  C CA  . VAL A 88  ? 0.9511 1.1768 1.3810 -0.0447 -0.0521 0.1797  171 VAL A CA  
685  C C   . VAL A 88  ? 0.9187 1.1603 1.3577 -0.0363 -0.0745 0.1830  171 VAL A C   
686  O O   . VAL A 88  ? 0.9419 1.1963 1.4069 -0.0304 -0.0760 0.1882  171 VAL A O   
687  C CB  . VAL A 88  ? 0.9861 1.1972 1.3813 -0.0417 -0.0446 0.1828  171 VAL A CB  
688  C CG1 . VAL A 88  ? 1.0333 1.2515 1.4407 -0.0332 -0.0446 0.1893  171 VAL A CG1 
689  C CG2 . VAL A 88  ? 1.0567 1.2485 1.4383 -0.0494 -0.0249 0.1794  171 VAL A CG2 
690  N N   . ARG A 89  ? 0.9088 1.1471 1.3236 -0.0347 -0.0918 0.1804  172 ARG A N   
691  C CA  . ARG A 89  ? 0.9427 1.1915 1.3598 -0.0264 -0.1142 0.1828  172 ARG A CA  
692  C C   . ARG A 89  ? 0.9470 1.2108 1.4103 -0.0316 -0.1258 0.1810  172 ARG A C   
693  O O   . ARG A 89  ? 0.9324 1.2116 1.4216 -0.0255 -0.1347 0.1871  172 ARG A O   
694  C CB  . ARG A 89  ? 1.0587 1.2945 1.4318 -0.0217 -0.1279 0.1794  172 ARG A CB  
695  C CG  . ARG A 89  ? 1.1566 1.3852 1.4948 -0.0132 -0.1182 0.1864  172 ARG A CG  
696  C CD  . ARG A 89  ? 1.2495 1.4637 1.5444 -0.0070 -0.1248 0.1841  172 ARG A CD  
697  N NE  . ARG A 89  ? 1.3245 1.5377 1.6009 0.0035  -0.1445 0.1840  172 ARG A NE  
698  C CZ  . ARG A 89  ? 1.3966 1.5962 1.6521 0.0040  -0.1608 0.1745  172 ARG A CZ  
699  N NH1 . ARG A 89  ? 1.4250 1.6120 1.6790 -0.0058 -0.1596 0.1646  172 ARG A NH1 
700  N NH2 . ARG A 89  ? 1.5166 1.7119 1.7489 0.0148  -0.1794 0.1748  172 ARG A NH2 
701  N N   . SER A 90  ? 0.9311 1.1912 1.4086 -0.0430 -0.1255 0.1744  173 SER A N   
702  C CA  . SER A 90  ? 0.8770 1.1533 1.4094 -0.0510 -0.1337 0.1746  173 SER A CA  
703  C C   . SER A 90  ? 0.8473 1.1431 1.4289 -0.0482 -0.1186 0.1829  173 SER A C   
704  O O   . SER A 90  ? 0.8645 1.1796 1.4851 -0.0452 -0.1337 0.1883  173 SER A O   
705  C CB  . SER A 90  ? 0.8415 1.1089 1.3835 -0.0646 -0.1255 0.1690  173 SER A CB  
706  O OG  . SER A 90  ? 0.8558 1.1414 1.4604 -0.0728 -0.1219 0.1730  173 SER A OG  
707  N N   . ARG A 91  ? 0.8318 1.1198 1.4089 -0.0487 -0.0893 0.1839  174 ARG A N   
708  C CA  . ARG A 91  ? 0.8254 1.1234 1.4384 -0.0444 -0.0690 0.1902  174 ARG A CA  
709  C C   . ARG A 91  ? 0.9628 1.2546 1.5475 -0.0331 -0.0669 0.1937  174 ARG A C   
710  O O   . ARG A 91  ? 1.2967 1.5689 1.8389 -0.0333 -0.0554 0.1908  174 ARG A O   
711  C CB  . ARG A 91  ? 0.8266 1.1096 1.4343 -0.0510 -0.0379 0.1874  174 ARG A CB  
712  C CG  . ARG A 91  ? 0.8515 1.1469 1.5133 -0.0517 -0.0165 0.1928  174 ARG A CG  
713  C CD  . ARG A 91  ? 0.8153 1.1047 1.4873 -0.0627 -0.0002 0.1913  174 ARG A CD  
714  N NE  . ARG A 91  ? 0.7584 1.0553 1.4738 -0.0598 0.0293  0.1979  174 ARG A NE  
715  C CZ  . ARG A 91  ? 0.7879 1.1128 1.5705 -0.0569 0.0274  0.2066  174 ARG A CZ  
716  N NH1 . ARG A 91  ? 0.7782 1.1257 1.5905 -0.0575 -0.0063 0.2093  174 ARG A NH1 
717  N NH2 . ARG A 91  ? 0.8938 1.2233 1.7144 -0.0527 0.0601  0.2135  174 ARG A NH2 
718  N N   . LYS A 92  ? 0.9638 1.2707 1.5719 -0.0238 -0.0778 0.2010  175 LYS A N   
719  C CA  . LYS A 92  ? 1.0119 1.3109 1.5887 -0.0136 -0.0787 0.2056  175 LYS A CA  
720  C C   . LYS A 92  ? 0.9668 1.2446 1.5184 -0.0139 -0.0533 0.2037  175 LYS A C   
721  O O   . LYS A 92  ? 0.8347 1.0988 1.3457 -0.0122 -0.0549 0.2044  175 LYS A O   
722  C CB  . LYS A 92  ? 1.1002 1.4170 1.7115 -0.0031 -0.0891 0.2155  175 LYS A CB  
723  C CG  . LYS A 92  ? 1.2199 1.5552 1.8522 -0.0022 -0.1194 0.2183  175 LYS A CG  
724  C CD  . LYS A 92  ? 1.2916 1.6156 1.8756 -0.0053 -0.1388 0.2119  175 LYS A CD  
725  C CE  . LYS A 92  ? 1.3957 1.7307 1.9877 -0.0027 -0.1725 0.2139  175 LYS A CE  
726  N NZ  . LYS A 92  ? 1.4642 1.7817 1.9968 -0.0006 -0.1892 0.2083  175 LYS A NZ  
727  N N   . ARG A 93  ? 0.9542 1.2283 1.5304 -0.0157 -0.0303 0.2021  176 ARG A N   
728  C CA  . ARG A 93  ? 0.9894 1.2373 1.5370 -0.0173 -0.0071 0.1980  176 ARG A CA  
729  C C   . ARG A 93  ? 0.9672 1.2110 1.5349 -0.0223 0.0161  0.1940  176 ARG A C   
730  O O   . ARG A 93  ? 0.9253 1.1904 1.5423 -0.0216 0.0171  0.1978  176 ARG A O   
731  C CB  . ARG A 93  ? 1.0324 1.2726 1.5826 -0.0077 -0.0004 0.2028  176 ARG A CB  
732  C CG  . ARG A 93  ? 1.0778 1.3364 1.6820 0.0012  0.0038  0.2091  176 ARG A CG  
733  C CD  . ARG A 93  ? 1.1312 1.3811 1.7383 0.0115  0.0081  0.2146  176 ARG A CD  
734  N NE  . ARG A 93  ? 1.3030 1.5526 1.9496 0.0187  0.0309  0.2157  176 ARG A NE  
735  C CZ  . ARG A 93  ? 1.4823 1.7259 2.1457 0.0299  0.0383  0.2209  176 ARG A CZ  
736  N NH1 . ARG A 93  ? 1.5852 1.8231 2.2305 0.0338  0.0236  0.2262  176 ARG A NH1 
737  N NH2 . ARG A 93  ? 1.5944 1.8370 2.2944 0.0380  0.0620  0.2220  176 ARG A NH2 
738  N N   . LEU A 94  ? 0.9573 1.1735 1.4881 -0.0269 0.0346  0.1880  177 LEU A N   
739  C CA  . LEU A 94  ? 0.9769 1.1843 1.5185 -0.0302 0.0608  0.1854  177 LEU A CA  
740  C C   . LEU A 94  ? 0.9402 1.1312 1.4886 -0.0209 0.0876  0.1853  177 LEU A C   
741  O O   . LEU A 94  ? 0.8688 1.0386 1.3878 -0.0162 0.0884  0.1830  177 LEU A O   
742  C CB  . LEU A 94  ? 0.9906 1.1743 1.4839 -0.0402 0.0658  0.1792  177 LEU A CB  
743  C CG  . LEU A 94  ? 0.9519 1.1446 1.4320 -0.0481 0.0429  0.1783  177 LEU A CG  
744  C CD1 . LEU A 94  ? 0.9665 1.1348 1.4059 -0.0567 0.0531  0.1739  177 LEU A CD1 
745  C CD2 . LEU A 94  ? 0.9926 1.2137 1.5202 -0.0509 0.0310  0.1813  177 LEU A CD2 
746  N N   . ARG A 95  ? 0.9387 1.1378 1.5264 -0.0183 0.1105  0.1883  178 ARG A N   
747  C CA  . ARG A 95  ? 1.0430 1.2226 1.6344 -0.0078 0.1419  0.1877  178 ARG A CA  
748  C C   . ARG A 95  ? 1.0672 1.2026 1.5915 -0.0120 0.1605  0.1784  178 ARG A C   
749  O O   . ARG A 95  ? 1.1065 1.2363 1.6072 -0.0224 0.1597  0.1762  178 ARG A O   
750  C CB  . ARG A 95  ? 1.0793 1.2837 1.7386 -0.0021 0.1636  0.1964  178 ARG A CB  
751  C CG  . ARG A 95  ? 1.0675 1.3169 1.7940 -0.0006 0.1388  0.2064  178 ARG A CG  
752  C CD  . ARG A 95  ? 1.1357 1.4119 1.9392 0.0068  0.1587  0.2176  178 ARG A CD  
753  N NE  . ARG A 95  ? 1.1704 1.4887 2.0327 0.0005  0.1292  0.2262  178 ARG A NE  
754  C CZ  . ARG A 95  ? 1.2558 1.5892 2.1374 -0.0127 0.1204  0.2278  178 ARG A CZ  
755  N NH1 . ARG A 95  ? 1.2783 1.5911 2.1286 -0.0211 0.1411  0.2231  178 ARG A NH1 
756  N NH2 . ARG A 95  ? 1.2682 1.6355 2.1997 -0.0182 0.0887  0.2344  178 ARG A NH2 
757  N N   . GLU A 96  ? 1.0616 1.1628 1.5535 -0.0040 0.1754  0.1730  179 GLU A N   
758  C CA  . GLU A 96  ? 1.1074 1.1611 1.5263 -0.0085 0.1846  0.1632  179 GLU A CA  
759  C C   . GLU A 96  ? 1.1219 1.1619 1.5210 -0.0135 0.2076  0.1619  179 GLU A C   
760  O O   . GLU A 96  ? 1.1873 1.2027 1.5321 -0.0228 0.2012  0.1568  179 GLU A O   
761  C CB  . GLU A 96  ? 1.1768 1.1914 1.5674 0.0020  0.2009  0.1568  179 GLU A CB  
762  C CG  . GLU A 96  ? 1.2180 1.2352 1.6126 0.0044  0.1764  0.1576  179 GLU A CG  
763  C CD  . GLU A 96  ? 1.3303 1.2965 1.6778 0.0097  0.1851  0.1485  179 GLU A CD  
764  O OE1 . GLU A 96  ? 1.4568 1.3848 1.7717 0.0155  0.2143  0.1408  179 GLU A OE1 
765  O OE2 . GLU A 96  ? 1.3716 1.3338 1.7132 0.0081  0.1626  0.1492  179 GLU A OE2 
766  N N   . GLU A 97  ? 1.1585 1.2161 1.6055 -0.0073 0.2338  0.1686  180 GLU A N   
767  C CA  . GLU A 97  ? 1.1898 1.2383 1.6281 -0.0111 0.2598  0.1708  180 GLU A CA  
768  C C   . GLU A 97  ? 1.1685 1.2275 1.5924 -0.0268 0.2369  0.1715  180 GLU A C   
769  O O   . GLU A 97  ? 1.1833 1.2121 1.5534 -0.0330 0.2451  0.1679  180 GLU A O   
770  C CB  . GLU A 97  ? 1.1777 1.2599 1.6939 -0.0039 0.2844  0.1827  180 GLU A CB  
771  C CG  . GLU A 97  ? 1.2864 1.3558 1.7967 -0.0049 0.3199  0.1875  180 GLU A CG  
772  C CD  . GLU A 97  ? 1.3194 1.4223 1.8716 -0.0188 0.3099  0.1966  180 GLU A CD  
773  O OE1 . GLU A 97  ? 1.3095 1.4538 1.9169 -0.0252 0.2802  0.2013  180 GLU A OE1 
774  O OE2 . GLU A 97  ? 1.4072 1.4917 1.9351 -0.0230 0.3328  0.1993  180 GLU A OE2 
775  N N   . GLU A 98  ? 1.1368 1.2357 1.6055 -0.0322 0.2074  0.1759  181 GLU A N   
776  C CA  . GLU A 98  ? 1.1275 1.2396 1.5916 -0.0454 0.1844  0.1767  181 GLU A CA  
777  C C   . GLU A 98  ? 1.1743 1.2632 1.5759 -0.0503 0.1620  0.1694  181 GLU A C   
778  O O   . GLU A 98  ? 1.2258 1.2970 1.5879 -0.0587 0.1601  0.1676  181 GLU A O   
779  C CB  . GLU A 98  ? 1.0837 1.2410 1.6113 -0.0479 0.1595  0.1826  181 GLU A CB  
780  C CG  . GLU A 98  ? 1.0307 1.1972 1.5487 -0.0599 0.1329  0.1815  181 GLU A CG  
781  C CD  . GLU A 98  ? 1.0154 1.2201 1.5941 -0.0631 0.1112  0.1866  181 GLU A CD  
782  O OE1 . GLU A 98  ? 1.0743 1.3010 1.6914 -0.0557 0.1016  0.1900  181 GLU A OE1 
783  O OE2 . GLU A 98  ? 1.0648 1.2749 1.6500 -0.0734 0.1014  0.1872  181 GLU A OE2 
784  N N   . ALA A 99  ? 1.0963 1.1865 1.4932 -0.0451 0.1452  0.1672  182 ALA A N   
785  C CA  . ALA A 99  ? 1.1097 1.1802 1.4555 -0.0492 0.1243  0.1628  182 ALA A CA  
786  C C   . ALA A 99  ? 1.1470 1.1733 1.4303 -0.0531 0.1381  0.1571  182 ALA A C   
787  O O   . ALA A 99  ? 1.2317 1.2475 1.4801 -0.0615 0.1246  0.1565  182 ALA A O   
788  C CB  . ALA A 99  ? 1.1102 1.1820 1.4618 -0.0418 0.1131  0.1628  182 ALA A CB  
789  N N   . ALA A 100 ? 1.1529 1.1519 1.4211 -0.0460 0.1657  0.1535  183 ALA A N   
790  C CA  . ALA A 100 ? 1.1936 1.1445 1.3947 -0.0485 0.1793  0.1474  183 ALA A CA  
791  C C   . ALA A 100 ? 1.1670 1.1148 1.3533 -0.0562 0.1882  0.1508  183 ALA A C   
792  O O   . ALA A 100 ? 1.1150 1.0357 1.2475 -0.0634 0.1790  0.1484  183 ALA A O   
793  C CB  . ALA A 100 ? 1.2557 1.1751 1.4420 -0.0367 0.2108  0.1424  183 ALA A CB  
794  N N   . ARG A 101 ? 1.1751 1.1503 1.4112 -0.0551 0.2052  0.1575  184 ARG A N   
795  C CA  . ARG A 101 ? 1.2371 1.2084 1.4633 -0.0628 0.2157  0.1623  184 ARG A CA  
796  C C   . ARG A 101 ? 1.1734 1.1531 1.3849 -0.0736 0.1834  0.1627  184 ARG A C   
797  O O   . ARG A 101 ? 1.2034 1.1580 1.3688 -0.0797 0.1837  0.1630  184 ARG A O   
798  C CB  . ARG A 101 ? 1.2562 1.2611 1.5497 -0.0625 0.2333  0.1714  184 ARG A CB  
799  C CG  . ARG A 101 ? 1.3452 1.3400 1.6538 -0.0527 0.2758  0.1758  184 ARG A CG  
800  C CD  . ARG A 101 ? 1.4245 1.4553 1.8048 -0.0562 0.2898  0.1880  184 ARG A CD  
801  N NE  . ARG A 101 ? 1.3844 1.4610 1.8453 -0.0529 0.2788  0.1926  184 ARG A NE  
802  C CZ  . ARG A 101 ? 1.3132 1.4232 1.8103 -0.0601 0.2422  0.1926  184 ARG A CZ  
803  N NH1 . ARG A 101 ? 1.3043 1.4098 1.7682 -0.0702 0.2132  0.1878  184 ARG A NH1 
804  N NH2 . ARG A 101 ? 1.2663 1.4135 1.8327 -0.0558 0.2343  0.1977  184 ARG A NH2 
805  N N   . LEU A 102 ? 1.0943 1.1079 1.3439 -0.0745 0.1570  0.1635  185 LEU A N   
806  C CA  . LEU A 102 ? 1.0752 1.1005 1.3182 -0.0822 0.1286  0.1647  185 LEU A CA  
807  C C   . LEU A 102 ? 1.1014 1.1034 1.2924 -0.0840 0.1104  0.1616  185 LEU A C   
808  O O   . LEU A 102 ? 1.1025 1.0937 1.2637 -0.0905 0.0995  0.1634  185 LEU A O   
809  C CB  . LEU A 102 ? 1.0108 1.0764 1.3066 -0.0807 0.1080  0.1666  185 LEU A CB  
810  C CG  . LEU A 102 ? 1.0232 1.1155 1.3773 -0.0818 0.1177  0.1709  185 LEU A CG  
811  C CD1 . LEU A 102 ? 0.9744 1.1007 1.3713 -0.0798 0.0928  0.1718  185 LEU A CD1 
812  C CD2 . LEU A 102 ? 1.0379 1.1244 1.3892 -0.0911 0.1242  0.1741  185 LEU A CD2 
813  N N   . PHE A 103 ? 1.0545 1.0496 1.2387 -0.0786 0.1059  0.1583  186 PHE A N   
814  C CA  . PHE A 103 ? 1.0667 1.0423 1.2106 -0.0815 0.0859  0.1570  186 PHE A CA  
815  C C   . PHE A 103 ? 1.1201 1.0525 1.2034 -0.0865 0.0930  0.1543  186 PHE A C   
816  O O   . PHE A 103 ? 1.1674 1.0865 1.2188 -0.0924 0.0731  0.1560  186 PHE A O   
817  C CB  . PHE A 103 ? 1.0414 1.0154 1.1932 -0.0755 0.0809  0.1545  186 PHE A CB  
818  C CG  . PHE A 103 ? 1.0317 0.9879 1.1506 -0.0800 0.0586  0.1550  186 PHE A CG  
819  C CD1 . PHE A 103 ? 1.0155 0.9939 1.1454 -0.0833 0.0348  0.1620  186 PHE A CD1 
820  C CD2 . PHE A 103 ? 1.0757 0.9912 1.1538 -0.0807 0.0616  0.1489  186 PHE A CD2 
821  C CE1 . PHE A 103 ? 1.0429 1.0087 1.1519 -0.0878 0.0148  0.1653  186 PHE A CE1 
822  C CE2 . PHE A 103 ? 1.0729 0.9725 1.1266 -0.0868 0.0379  0.1505  186 PHE A CE2 
823  C CZ  . PHE A 103 ? 1.0575 0.9849 1.1308 -0.0907 0.0147  0.1599  186 PHE A CZ  
824  N N   . LYS A 104 ? 1.1661 1.0760 1.2334 -0.0836 0.1214  0.1513  187 LYS A N   
825  C CA  . LYS A 104 ? 1.2410 1.1053 1.2430 -0.0872 0.1295  0.1490  187 LYS A CA  
826  C C   . LYS A 104 ? 1.2239 1.0908 1.2130 -0.0953 0.1208  0.1555  187 LYS A C   
827  O O   . LYS A 104 ? 1.2513 1.0885 1.1889 -0.1008 0.1085  0.1560  187 LYS A O   
828  C CB  . LYS A 104 ? 1.2726 1.1108 1.2580 -0.0800 0.1667  0.1457  187 LYS A CB  
829  C CG  . LYS A 104 ? 1.4005 1.1821 1.3051 -0.0816 0.1730  0.1413  187 LYS A CG  
830  C CD  . LYS A 104 ? 1.5477 1.2952 1.4262 -0.0708 0.2100  0.1359  187 LYS A CD  
831  C CE  . LYS A 104 ? 1.7205 1.4038 1.5069 -0.0718 0.2102  0.1289  187 LYS A CE  
832  N NZ  . LYS A 104 ? 1.8663 1.5136 1.6180 -0.0607 0.2540  0.1269  187 LYS A NZ  
833  N N   . GLN A 105 ? 1.2049 1.1058 1.2416 -0.0963 0.1254  0.1608  188 GLN A N   
834  C CA  . GLN A 105 ? 1.2032 1.1079 1.2346 -0.1033 0.1176  0.1671  188 GLN A CA  
835  C C   . GLN A 105 ? 1.1746 1.0891 1.2005 -0.1068 0.0848  0.1694  188 GLN A C   
836  O O   . GLN A 105 ? 1.2265 1.1239 1.2185 -0.1119 0.0742  0.1737  188 GLN A O   
837  C CB  . GLN A 105 ? 1.1413 1.0794 1.2293 -0.1041 0.1261  0.1711  188 GLN A CB  
838  C CG  . GLN A 105 ? 1.1492 1.0848 1.2564 -0.1012 0.1601  0.1729  188 GLN A CG  
839  C CD  . GLN A 105 ? 1.0871 1.0582 1.2581 -0.1043 0.1623  0.1779  188 GLN A CD  
840  O OE1 . GLN A 105 ? 1.0339 1.0072 1.2071 -0.1112 0.1559  0.1822  188 GLN A OE1 
841  N NE2 . GLN A 105 ? 1.1232 1.1213 1.3468 -0.0995 0.1684  0.1773  188 GLN A NE2 
842  N N   . ILE A 106 ? 1.1248 1.0675 1.1862 -0.1032 0.0702  0.1681  189 ILE A N   
843  C CA  . ILE A 106 ? 1.0802 1.0346 1.1418 -0.1041 0.0426  0.1717  189 ILE A CA  
844  C C   . ILE A 106 ? 1.1325 1.0547 1.1455 -0.1083 0.0302  0.1725  189 ILE A C   
845  O O   . ILE A 106 ? 1.1763 1.0978 1.1766 -0.1120 0.0115  0.1791  189 ILE A O   
846  C CB  . ILE A 106 ? 1.0470 1.0310 1.1490 -0.0980 0.0340  0.1708  189 ILE A CB  
847  C CG1 . ILE A 106 ? 1.0281 1.0448 1.1754 -0.0951 0.0357  0.1714  189 ILE A CG1 
848  C CG2 . ILE A 106 ? 1.0471 1.0378 1.1449 -0.0981 0.0098  0.1762  189 ILE A CG2 
849  C CD1 . ILE A 106 ? 0.9898 1.0351 1.1748 -0.0883 0.0273  0.1712  189 ILE A CD1 
850  N N   . VAL A 107 ? 1.1498 1.0443 1.1363 -0.1074 0.0397  0.1661  190 VAL A N   
851  C CA  . VAL A 107 ? 1.1864 1.0462 1.1253 -0.1124 0.0241  0.1653  190 VAL A CA  
852  C C   . VAL A 107 ? 1.2838 1.1099 1.1709 -0.1178 0.0265  0.1674  190 VAL A C   
853  O O   . VAL A 107 ? 1.3332 1.1435 1.1917 -0.1240 0.0035  0.1722  190 VAL A O   
854  C CB  . VAL A 107 ? 1.1724 1.0075 1.0954 -0.1091 0.0321  0.1562  190 VAL A CB  
855  C CG1 . VAL A 107 ? 1.2209 1.0113 1.0868 -0.1158 0.0146  0.1536  190 VAL A CG1 
856  C CG2 . VAL A 107 ? 1.1523 1.0200 1.1250 -0.1046 0.0239  0.1571  190 VAL A CG2 
857  N N   . SER A 108 ? 1.3367 1.1529 1.2146 -0.1154 0.0537  0.1656  191 SER A N   
858  C CA  . SER A 108 ? 1.3812 1.1657 1.2098 -0.1196 0.0587  0.1696  191 SER A CA  
859  C C   . SER A 108 ? 1.3530 1.1553 1.1931 -0.1245 0.0381  0.1798  191 SER A C   
860  O O   . SER A 108 ? 1.4539 1.2298 1.2507 -0.1293 0.0253  0.1849  191 SER A O   
861  C CB  . SER A 108 ? 1.3873 1.1661 1.2172 -0.1159 0.0941  0.1695  191 SER A CB  
862  O OG  . SER A 108 ? 1.4380 1.2081 1.2710 -0.1088 0.1174  0.1614  191 SER A OG  
863  N N   . ALA A 109 ? 1.2863 1.1313 1.1829 -0.1222 0.0345  0.1828  192 ALA A N   
864  C CA  . ALA A 109 ? 1.2164 1.0794 1.1279 -0.1242 0.0162  0.1919  192 ALA A CA  
865  C C   . ALA A 109 ? 1.2114 1.0703 1.1089 -0.1270 -0.0128 0.1973  192 ALA A C   
866  O O   . ALA A 109 ? 1.2042 1.0492 1.0772 -0.1308 -0.0268 0.2056  192 ALA A O   
867  C CB  . ALA A 109 ? 1.1295 1.0342 1.0987 -0.1197 0.0170  0.1917  192 ALA A CB  
868  N N   . VAL A 110 ? 1.2374 1.1087 1.1538 -0.1252 -0.0221 0.1941  193 VAL A N   
869  C CA  . VAL A 110 ? 1.2084 1.0816 1.1243 -0.1285 -0.0499 0.2011  193 VAL A CA  
870  C C   . VAL A 110 ? 1.2648 1.0940 1.1243 -0.1362 -0.0623 0.2012  193 VAL A C   
871  O O   . VAL A 110 ? 1.3592 1.1853 1.2114 -0.1411 -0.0872 0.2114  193 VAL A O   
872  C CB  . VAL A 110 ? 1.2189 1.1118 1.1672 -0.1254 -0.0547 0.1983  193 VAL A CB  
873  C CG1 . VAL A 110 ? 1.2474 1.1362 1.1939 -0.1310 -0.0827 0.2064  193 VAL A CG1 
874  C CG2 . VAL A 110 ? 1.2011 1.1369 1.2009 -0.1174 -0.0486 0.2005  193 VAL A CG2 
875  N N   . ALA A 111 ? 1.2542 1.0488 1.0739 -0.1366 -0.0455 0.1904  194 ALA A N   
876  C CA  . ALA A 111 ? 1.3619 1.1069 1.1178 -0.1431 -0.0576 0.1879  194 ALA A CA  
877  C C   . ALA A 111 ? 1.4249 1.1530 1.1475 -0.1469 -0.0648 0.1971  194 ALA A C   
878  O O   . ALA A 111 ? 1.4518 1.1623 1.1490 -0.1538 -0.0934 0.2043  194 ALA A O   
879  C CB  . ALA A 111 ? 1.4022 1.1107 1.1185 -0.1395 -0.0321 0.1740  194 ALA A CB  
880  N N   . HIS A 112 ? 1.4738 1.2097 1.2024 -0.1426 -0.0397 0.1982  195 HIS A N   
881  C CA  . HIS A 112 ? 1.4577 1.1805 1.1610 -0.1447 -0.0401 0.2080  195 HIS A CA  
882  C C   . HIS A 112 ? 1.4156 1.1620 1.1455 -0.1470 -0.0689 0.2220  195 HIS A C   
883  O O   . HIS A 112 ? 1.4437 1.1677 1.1389 -0.1510 -0.0836 0.2313  195 HIS A O   
884  C CB  . HIS A 112 ? 1.4432 1.1812 1.1699 -0.1397 -0.0077 0.2072  195 HIS A CB  
885  C CG  . HIS A 112 ? 1.4402 1.1665 1.1478 -0.1414 -0.0045 0.2178  195 HIS A CG  
886  N ND1 . HIS A 112 ? 1.4735 1.1549 1.1178 -0.1433 0.0058  0.2200  195 HIS A ND1 
887  C CD2 . HIS A 112 ? 1.4046 1.1559 1.1466 -0.1407 -0.0094 0.2271  195 HIS A CD2 
888  C CE1 . HIS A 112 ? 1.4891 1.1703 1.1326 -0.1443 0.0069  0.2315  195 HIS A CE1 
889  N NE2 . HIS A 112 ? 1.4074 1.1300 1.1102 -0.1429 -0.0029 0.2355  195 HIS A NE2 
890  N N   . CYS A 113 ? 1.3449 1.1355 1.1353 -0.1432 -0.0748 0.2243  196 CYS A N   
891  C CA  . CYS A 113 ? 1.3201 1.1354 1.1411 -0.1430 -0.0995 0.2383  196 CYS A CA  
892  C C   . CYS A 113 ? 1.3644 1.1639 1.1669 -0.1504 -0.1307 0.2443  196 CYS A C   
893  O O   . CYS A 113 ? 1.4655 1.2557 1.2543 -0.1540 -0.1516 0.2569  196 CYS A O   
894  C CB  . CYS A 113 ? 1.2632 1.1247 1.1463 -0.1358 -0.0963 0.2386  196 CYS A CB  
895  S SG  . CYS A 113 ? 1.2219 1.1060 1.1351 -0.1280 -0.0705 0.2347  196 CYS A SG  
896  N N   . HIS A 114 ? 1.3923 1.1874 1.1959 -0.1531 -0.1353 0.2360  197 HIS A N   
897  C CA  . HIS A 114 ? 1.3963 1.1739 1.1853 -0.1621 -0.1674 0.2408  197 HIS A CA  
898  C C   . HIS A 114 ? 1.5203 1.2464 1.2392 -0.1700 -0.1824 0.2410  197 HIS A C   
899  O O   . HIS A 114 ? 1.4991 1.2176 1.2127 -0.1776 -0.2156 0.2527  197 HIS A O   
900  C CB  . HIS A 114 ? 1.3469 1.1199 1.1418 -0.1636 -0.1659 0.2293  197 HIS A CB  
901  C CG  . HIS A 114 ? 1.2591 1.0806 1.1213 -0.1575 -0.1613 0.2331  197 HIS A CG  
902  N ND1 . HIS A 114 ? 1.2445 1.0686 1.1236 -0.1588 -0.1645 0.2276  197 HIS A ND1 
903  C CD2 . HIS A 114 ? 1.2180 1.0837 1.1307 -0.1493 -0.1544 0.2423  197 HIS A CD2 
904  C CE1 . HIS A 114 ? 1.1787 1.0479 1.1155 -0.1517 -0.1590 0.2344  197 HIS A CE1 
905  N NE2 . HIS A 114 ? 1.1259 1.0199 1.0819 -0.1455 -0.1529 0.2428  197 HIS A NE2 
906  N N   . GLN A 115 ? 1.6633 1.3544 1.3294 -0.1679 -0.1581 0.2300  198 GLN A N   
907  C CA  . GLN A 115 ? 1.7978 1.4357 1.3877 -0.1733 -0.1684 0.2310  198 GLN A CA  
908  C C   . GLN A 115 ? 1.6721 1.3186 1.2660 -0.1744 -0.1843 0.2490  198 GLN A C   
909  O O   . GLN A 115 ? 1.7078 1.3202 1.2549 -0.1812 -0.2103 0.2556  198 GLN A O   
910  C CB  . GLN A 115 ? 1.9418 1.5429 1.4764 -0.1683 -0.1324 0.2188  198 GLN A CB  
911  C CG  . GLN A 115 ? 2.0690 1.6555 1.5927 -0.1642 -0.1081 0.2008  198 GLN A CG  
912  C CD  . GLN A 115 ? 2.1027 1.6622 1.6037 -0.1707 -0.1338 0.1924  198 GLN A CD  
913  O OE1 . GLN A 115 ? 2.1363 1.7280 1.6905 -0.1739 -0.1533 0.1956  198 GLN A OE1 
914  N NE2 . GLN A 115 ? 2.1080 1.6055 1.5282 -0.1721 -0.1323 0.1816  198 GLN A NE2 
915  N N   . SER A 116 ? 1.6012 1.2897 1.2481 -0.1671 -0.1688 0.2564  199 SER A N   
916  C CA  . SER A 116 ? 1.5600 1.2617 1.2220 -0.1657 -0.1815 0.2742  199 SER A CA  
917  C C   . SER A 116 ? 1.5229 1.2668 1.2483 -0.1651 -0.2071 0.2887  199 SER A C   
918  O O   . SER A 116 ? 1.5391 1.3050 1.2941 -0.1598 -0.2095 0.3025  199 SER A O   
919  C CB  . SER A 116 ? 1.5579 1.2748 1.2372 -0.1576 -0.1491 0.2737  199 SER A CB  
920  O OG  . SER A 116 ? 1.6676 1.3480 1.2942 -0.1579 -0.1233 0.2644  199 SER A OG  
921  N N   . ALA A 117 ? 1.5452 1.2995 1.2924 -0.1697 -0.2245 0.2868  200 ALA A N   
922  C CA  . ALA A 117 ? 1.5088 1.3031 1.3186 -0.1693 -0.2472 0.3028  200 ALA A CA  
923  C C   . ALA A 117 ? 1.4479 1.2903 1.3191 -0.1565 -0.2271 0.3085  200 ALA A C   
924  O O   . ALA A 117 ? 1.5541 1.4234 1.4658 -0.1520 -0.2395 0.3263  200 ALA A O   
925  C CB  . ALA A 117 ? 1.5358 1.3181 1.3353 -0.1759 -0.2828 0.3216  200 ALA A CB  
926  N N   . ILE A 118 ? 1.3747 1.2256 1.2512 -0.1500 -0.1961 0.2936  201 ILE A N   
927  C CA  . ILE A 118 ? 1.3309 1.2235 1.2609 -0.1384 -0.1793 0.2956  201 ILE A CA  
928  C C   . ILE A 118 ? 1.2945 1.2040 1.2494 -0.1385 -0.1762 0.2876  201 ILE A C   
929  O O   . ILE A 118 ? 1.3030 1.1926 1.2314 -0.1424 -0.1655 0.2722  201 ILE A O   
930  C CB  . ILE A 118 ? 1.2951 1.1843 1.2153 -0.1319 -0.1508 0.2864  201 ILE A CB  
931  C CG1 . ILE A 118 ? 1.3113 1.1977 1.2302 -0.1281 -0.1561 0.3004  201 ILE A CG1 
932  C CG2 . ILE A 118 ? 1.2575 1.1808 1.2212 -0.1219 -0.1321 0.2798  201 ILE A CG2 
933  C CD1 . ILE A 118 ? 1.3607 1.2247 1.2499 -0.1277 -0.1359 0.2945  201 ILE A CD1 
934  N N   . VAL A 119 ? 1.2186 1.1630 1.2239 -0.1337 -0.1853 0.2998  202 VAL A N   
935  C CA  . VAL A 119 ? 1.1971 1.1630 1.2331 -0.1312 -0.1795 0.2953  202 VAL A CA  
936  C C   . VAL A 119 ? 1.1975 1.1920 1.2617 -0.1173 -0.1556 0.2917  202 VAL A C   
937  O O   . VAL A 119 ? 1.1919 1.2022 1.2744 -0.1086 -0.1534 0.3019  202 VAL A O   
938  C CB  . VAL A 119 ? 1.1638 1.1506 1.2397 -0.1341 -0.2027 0.3134  202 VAL A CB  
939  C CG1 . VAL A 119 ? 1.1430 1.1582 1.2577 -0.1280 -0.1925 0.3128  202 VAL A CG1 
940  C CG2 . VAL A 119 ? 1.1871 1.1414 1.2334 -0.1499 -0.2299 0.3139  202 VAL A CG2 
941  N N   . LEU A 120 ? 1.1652 1.1646 1.2326 -0.1147 -0.1394 0.2777  203 LEU A N   
942  C CA  . LEU A 120 ? 1.0694 1.0890 1.1548 -0.1031 -0.1192 0.2715  203 LEU A CA  
943  C C   . LEU A 120 ? 1.0583 1.1120 1.1854 -0.0920 -0.1204 0.2839  203 LEU A C   
944  O O   . LEU A 120 ? 1.0983 1.1651 1.2371 -0.0811 -0.1125 0.2875  203 LEU A O   
945  C CB  . LEU A 120 ? 1.0669 1.0803 1.1434 -0.1041 -0.1030 0.2538  203 LEU A CB  
946  C CG  . LEU A 120 ? 1.0939 1.0772 1.1334 -0.1107 -0.0913 0.2408  203 LEU A CG  
947  C CD1 . LEU A 120 ? 1.1269 1.1006 1.1522 -0.1100 -0.0871 0.2436  203 LEU A CD1 
948  C CD2 . LEU A 120 ? 1.1559 1.1072 1.1600 -0.1213 -0.1006 0.2382  203 LEU A CD2 
949  N N   . GLY A 121 ? 1.0640 1.1298 1.2121 -0.0940 -0.1289 0.2905  204 GLY A N   
950  C CA  . GLY A 121 ? 1.0665 1.1645 1.2547 -0.0830 -0.1281 0.3056  204 GLY A CA  
951  C C   . GLY A 121 ? 1.0647 1.1806 1.2654 -0.0714 -0.1114 0.2988  204 GLY A C   
952  O O   . GLY A 121 ? 1.2828 1.4191 1.5107 -0.0662 -0.1114 0.3091  204 GLY A O   
953  N N   . ASP A 122 ? 1.0796 1.1878 1.2619 -0.0676 -0.0984 0.2830  205 ASP A N   
954  C CA  . ASP A 122 ? 1.0732 1.1960 1.2640 -0.0562 -0.0858 0.2762  205 ASP A CA  
955  C C   . ASP A 122 ? 1.0397 1.1483 1.2134 -0.0623 -0.0785 0.2568  205 ASP A C   
956  O O   . ASP A 122 ? 1.0506 1.1566 1.2171 -0.0581 -0.0706 0.2470  205 ASP A O   
957  C CB  . ASP A 122 ? 1.1180 1.2480 1.3097 -0.0422 -0.0786 0.2796  205 ASP A CB  
958  C CG  . ASP A 122 ? 1.1888 1.3311 1.3839 -0.0287 -0.0688 0.2740  205 ASP A CG  
959  O OD1 . ASP A 122 ? 1.3743 1.5234 1.5753 -0.0297 -0.0677 0.2692  205 ASP A OD1 
960  O OD2 . ASP A 122 ? 1.1650 1.3075 1.3544 -0.0163 -0.0628 0.2744  205 ASP A OD2 
961  N N   . LEU A 123 ? 0.9942 1.0928 1.1636 -0.0719 -0.0813 0.2520  206 LEU A N   
962  C CA  . LEU A 123 ? 1.0089 1.0979 1.1699 -0.0755 -0.0718 0.2363  206 LEU A CA  
963  C C   . LEU A 123 ? 1.0306 1.1396 1.2122 -0.0664 -0.0663 0.2333  206 LEU A C   
964  O O   . LEU A 123 ? 1.0255 1.1494 1.2240 -0.0613 -0.0704 0.2428  206 LEU A O   
965  C CB  . LEU A 123 ? 1.0400 1.1070 1.1854 -0.0866 -0.0745 0.2318  206 LEU A CB  
966  C CG  . LEU A 123 ? 1.1326 1.1709 1.2454 -0.0961 -0.0761 0.2286  206 LEU A CG  
967  C CD1 . LEU A 123 ? 1.1940 1.2067 1.2861 -0.1048 -0.0786 0.2228  206 LEU A CD1 
968  C CD2 . LEU A 123 ? 1.1631 1.1939 1.2647 -0.0957 -0.0614 0.2187  206 LEU A CD2 
969  N N   . LYS A 124 ? 1.0018 1.1101 1.1828 -0.0651 -0.0578 0.2212  207 LYS A N   
970  C CA  . LYS A 124 ? 0.9723 1.0966 1.1703 -0.0575 -0.0550 0.2169  207 LYS A CA  
971  C C   . LYS A 124 ? 0.9603 1.0793 1.1599 -0.0611 -0.0473 0.2038  207 LYS A C   
972  O O   . LYS A 124 ? 0.9807 1.0857 1.1681 -0.0673 -0.0431 0.1994  207 LYS A O   
973  C CB  . LYS A 124 ? 0.9160 1.0563 1.1187 -0.0449 -0.0585 0.2236  207 LYS A CB  
974  C CG  . LYS A 124 ? 0.8855 1.0188 1.0751 -0.0423 -0.0582 0.2217  207 LYS A CG  
975  C CD  . LYS A 124 ? 0.8680 1.0126 1.0567 -0.0272 -0.0595 0.2281  207 LYS A CD  
976  C CE  . LYS A 124 ? 0.9063 1.0410 1.0811 -0.0227 -0.0586 0.2288  207 LYS A CE  
977  N NZ  . LYS A 124 ? 0.9258 1.0684 1.0957 -0.0053 -0.0569 0.2356  207 LYS A NZ  
978  N N   . LEU A 125 ? 0.8901 1.0207 1.1079 -0.0574 -0.0457 0.1992  208 LEU A N   
979  C CA  . LEU A 125 ? 0.8748 1.0041 1.1040 -0.0615 -0.0389 0.1892  208 LEU A CA  
980  C C   . LEU A 125 ? 0.8610 0.9882 1.0863 -0.0619 -0.0417 0.1850  208 LEU A C   
981  O O   . LEU A 125 ? 0.8364 0.9551 1.0653 -0.0693 -0.0346 0.1794  208 LEU A O   
982  C CB  . LEU A 125 ? 0.8798 1.0254 1.1346 -0.0562 -0.0401 0.1875  208 LEU A CB  
983  C CG  . LEU A 125 ? 0.8961 1.0387 1.1589 -0.0571 -0.0333 0.1887  208 LEU A CG  
984  C CD1 . LEU A 125 ? 0.9464 1.1073 1.2361 -0.0497 -0.0368 0.1895  208 LEU A CD1 
985  C CD2 . LEU A 125 ? 0.9334 1.0589 1.1927 -0.0652 -0.0183 0.1822  208 LEU A CD2 
986  N N   . ARG A 126 ? 0.8955 1.0279 1.1123 -0.0534 -0.0508 0.1884  209 ARG A N   
987  C CA  . ARG A 126 ? 0.9337 1.0592 1.1430 -0.0522 -0.0550 0.1833  209 ARG A CA  
988  C C   . ARG A 126 ? 0.9257 1.0332 1.1212 -0.0603 -0.0490 0.1833  209 ARG A C   
989  O O   . ARG A 126 ? 0.9169 1.0154 1.1124 -0.0638 -0.0496 0.1775  209 ARG A O   
990  C CB  . ARG A 126 ? 0.9937 1.1229 1.1889 -0.0387 -0.0627 0.1875  209 ARG A CB  
991  C CG  . ARG A 126 ? 1.1576 1.2849 1.3509 -0.0337 -0.0720 0.1784  209 ARG A CG  
992  C CD  . ARG A 126 ? 1.3041 1.4156 1.4736 -0.0264 -0.0753 0.1762  209 ARG A CD  
993  N NE  . ARG A 126 ? 1.4559 1.5715 1.6078 -0.0097 -0.0763 0.1835  209 ARG A NE  
994  C CZ  . ARG A 126 ? 1.5735 1.6870 1.7126 -0.0007 -0.0696 0.1941  209 ARG A CZ  
995  N NH1 . ARG A 126 ? 1.5728 1.6788 1.7119 -0.0065 -0.0641 0.1988  209 ARG A NH1 
996  N NH2 . ARG A 126 ? 1.6449 1.7640 1.7715 0.0156  -0.0679 0.2017  209 ARG A NH2 
997  N N   . LYS A 127 ? 0.9063 1.0069 1.0900 -0.0637 -0.0451 0.1904  210 LYS A N   
998  C CA  . LYS A 127 ? 0.9736 1.0556 1.1397 -0.0705 -0.0414 0.1928  210 LYS A CA  
999  C C   . LYS A 127 ? 0.9878 1.0567 1.1539 -0.0816 -0.0300 0.1873  210 LYS A C   
1000 O O   . LYS A 127 ? 1.0689 1.1202 1.2181 -0.0873 -0.0259 0.1896  210 LYS A O   
1001 C CB  . LYS A 127 ? 0.9591 1.0371 1.1113 -0.0704 -0.0453 0.2036  210 LYS A CB  
1002 C CG  . LYS A 127 ? 1.0469 1.1389 1.2034 -0.0589 -0.0530 0.2130  210 LYS A CG  
1003 C CD  . LYS A 127 ? 1.1488 1.2343 1.2957 -0.0531 -0.0550 0.2181  210 LYS A CD  
1004 C CE  . LYS A 127 ? 1.2384 1.3228 1.3816 -0.0533 -0.0603 0.2326  210 LYS A CE  
1005 N NZ  . LYS A 127 ? 1.4086 1.4797 1.5406 -0.0518 -0.0607 0.2368  210 LYS A NZ  
1006 N N   . PHE A 128 ? 0.9678 1.0449 1.1532 -0.0837 -0.0237 0.1816  211 PHE A N   
1007 C CA  . PHE A 128 ? 0.9772 1.0436 1.1669 -0.0923 -0.0086 0.1781  211 PHE A CA  
1008 C C   . PHE A 128 ? 0.9881 1.0655 1.2085 -0.0942 -0.0077 0.1727  211 PHE A C   
1009 O O   . PHE A 128 ? 0.9203 1.0163 1.1638 -0.0893 -0.0158 0.1697  211 PHE A O   
1010 C CB  . PHE A 128 ? 0.9627 1.0263 1.1508 -0.0930 0.0008  0.1775  211 PHE A CB  
1011 C CG  . PHE A 128 ? 0.9862 1.0308 1.1401 -0.0950 -0.0011 0.1820  211 PHE A CG  
1012 C CD1 . PHE A 128 ? 1.0656 1.0844 1.1911 -0.1016 0.0088  0.1829  211 PHE A CD1 
1013 C CD2 . PHE A 128 ? 0.9755 1.0270 1.1253 -0.0905 -0.0148 0.1870  211 PHE A CD2 
1014 C CE1 . PHE A 128 ? 1.0839 1.0824 1.1748 -0.1043 0.0021  0.1872  211 PHE A CE1 
1015 C CE2 . PHE A 128 ? 1.0030 1.0372 1.1256 -0.0940 -0.0208 0.1922  211 PHE A CE2 
1016 C CZ  . PHE A 128 ? 1.0646 1.0715 1.1563 -0.1012 -0.0140 0.1916  211 PHE A CZ  
1017 N N   . VAL A 129 ? 0.9803 1.0453 1.2018 -0.1019 0.0006  0.1725  212 VAL A N   
1018 C CA  . VAL A 129 ? 1.0035 1.0767 1.2577 -0.1063 -0.0015 0.1684  212 VAL A CA  
1019 C C   . VAL A 129 ? 0.9953 1.0649 1.2706 -0.1152 0.0183  0.1704  212 VAL A C   
1020 O O   . VAL A 129 ? 1.1329 1.1839 1.3850 -0.1188 0.0343  0.1749  212 VAL A O   
1021 C CB  . VAL A 129 ? 1.0175 1.0799 1.2614 -0.1069 -0.0136 0.1669  212 VAL A CB  
1022 C CG1 . VAL A 129 ? 0.9818 1.0498 1.2104 -0.0955 -0.0306 0.1651  212 VAL A CG1 
1023 C CG2 . VAL A 129 ? 1.0228 1.0613 1.2392 -0.1116 -0.0043 0.1726  212 VAL A CG2 
1024 N N   . PHE A 130 ? 0.9824 1.0695 1.3019 -0.1183 0.0169  0.1684  213 PHE A N   
1025 C CA  . PHE A 130 ? 0.9622 1.0502 1.3128 -0.1265 0.0371  0.1728  213 PHE A CA  
1026 C C   . PHE A 130 ? 0.9338 1.0036 1.2779 -0.1354 0.0401  0.1758  213 PHE A C   
1027 O O   . PHE A 130 ? 0.9335 0.9999 1.2774 -0.1372 0.0212  0.1720  213 PHE A O   
1028 C CB  . PHE A 130 ? 0.9464 1.0611 1.3547 -0.1282 0.0311  0.1719  213 PHE A CB  
1029 C CG  . PHE A 130 ? 0.9325 1.0646 1.3528 -0.1193 0.0324  0.1711  213 PHE A CG  
1030 C CD1 . PHE A 130 ? 0.9486 1.0760 1.3640 -0.1159 0.0577  0.1748  213 PHE A CD1 
1031 C CD2 . PHE A 130 ? 1.0046 1.1544 1.4378 -0.1135 0.0087  0.1669  213 PHE A CD2 
1032 C CE1 . PHE A 130 ? 0.9653 1.1057 1.3923 -0.1073 0.0591  0.1740  213 PHE A CE1 
1033 C CE2 . PHE A 130 ? 0.9917 1.1567 1.4371 -0.1050 0.0098  0.1676  213 PHE A CE2 
1034 C CZ  . PHE A 130 ? 0.9617 1.1223 1.4062 -0.1021 0.0350  0.1711  213 PHE A CZ  
1035 N N   . SER A 131 ? 0.9645 1.0204 1.3026 -0.1403 0.0650  0.1830  214 SER A N   
1036 C CA  . SER A 131 ? 1.0054 1.0420 1.3371 -0.1489 0.0714  0.1885  214 SER A CA  
1037 C C   . SER A 131 ? 1.0140 1.0609 1.4031 -0.1600 0.0777  0.1934  214 SER A C   
1038 O O   . SER A 131 ? 1.0777 1.1092 1.4666 -0.1680 0.0778  0.1974  214 SER A O   
1039 C CB  . SER A 131 ? 1.0201 1.0316 1.3073 -0.1481 0.0944  0.1955  214 SER A CB  
1040 O OG  . SER A 131 ? 1.0412 1.0569 1.3442 -0.1474 0.1209  0.1999  214 SER A OG  
1041 N N   . THR A 132 ? 1.0471 1.1196 1.4871 -0.1607 0.0829  0.1945  215 THR A N   
1042 C CA  . THR A 132 ? 1.0979 1.1863 1.6037 -0.1718 0.0845  0.2004  215 THR A CA  
1043 C C   . THR A 132 ? 1.1061 1.2256 1.6621 -0.1705 0.0652  0.1959  215 THR A C   
1044 O O   . THR A 132 ? 1.1244 1.2535 1.6645 -0.1597 0.0589  0.1901  215 THR A O   
1045 C CB  . THR A 132 ? 1.1467 1.2360 1.6740 -0.1737 0.1232  0.2136  215 THR A CB  
1046 O OG1 . THR A 132 ? 1.1928 1.2772 1.6832 -0.1615 0.1411  0.2122  215 THR A OG1 
1047 C CG2 . THR A 132 ? 1.2062 1.2688 1.7128 -0.1816 0.1391  0.2225  215 THR A CG2 
1048 N N   . GLU A 133 ? 1.1323 1.2671 1.7502 -0.1819 0.0548  0.1996  216 GLU A N   
1049 C CA  . GLU A 133 ? 1.2063 1.3723 1.8770 -0.1812 0.0347  0.1973  216 GLU A CA  
1050 C C   . GLU A 133 ? 1.1444 1.3318 1.8429 -0.1729 0.0610  0.2052  216 GLU A C   
1051 O O   . GLU A 133 ? 1.1305 1.3414 1.8575 -0.1675 0.0462  0.2028  216 GLU A O   
1052 C CB  . GLU A 133 ? 1.3247 1.5059 2.0665 -0.1963 0.0155  0.2014  216 GLU A CB  
1053 C CG  . GLU A 133 ? 1.4388 1.5958 2.1717 -0.2089 -0.0014 0.1980  216 GLU A CG  
1054 C CD  . GLU A 133 ? 1.5589 1.7088 2.3206 -0.2205 0.0278  0.2129  216 GLU A CD  
1055 O OE1 . GLU A 133 ? 1.6375 1.7609 2.3446 -0.2169 0.0475  0.2142  216 GLU A OE1 
1056 O OE2 . GLU A 133 ? 1.5512 1.7222 2.3893 -0.2322 0.0319  0.2247  216 GLU A OE2 
1057 N N   . GLU A 134 ? 1.1169 1.2948 1.8086 -0.1716 0.0999  0.2150  217 GLU A N   
1058 C CA  . GLU A 134 ? 1.1336 1.3201 1.8286 -0.1597 0.1293  0.2198  217 GLU A CA  
1059 C C   . GLU A 134 ? 1.0931 1.2807 1.7500 -0.1469 0.1133  0.2085  217 GLU A C   
1060 O O   . GLU A 134 ? 1.0708 1.2804 1.7610 -0.1392 0.1148  0.2100  217 GLU A O   
1061 C CB  . GLU A 134 ? 1.2129 1.3714 1.8639 -0.1565 0.1690  0.2264  217 GLU A CB  
1062 C CG  . GLU A 134 ? 1.2604 1.4271 1.9636 -0.1608 0.2057  0.2433  217 GLU A CG  
1063 C CD  . GLU A 134 ? 1.3112 1.4805 2.0550 -0.1776 0.1979  0.2516  217 GLU A CD  
1064 O OE1 . GLU A 134 ? 1.3787 1.5245 2.0791 -0.1841 0.1799  0.2454  217 GLU A OE1 
1065 O OE2 . GLU A 134 ? 1.3663 1.5610 2.1888 -0.1843 0.2099  0.2653  217 GLU A OE2 
1066 N N   . ARG A 135 ? 1.0457 1.2100 1.6364 -0.1445 0.0984  0.1990  218 ARG A N   
1067 C CA  . ARG A 135 ? 0.9505 1.1139 1.5032 -0.1336 0.0828  0.1900  218 ARG A CA  
1068 C C   . ARG A 135 ? 0.9850 1.1447 1.5244 -0.1229 0.1093  0.1921  218 ARG A C   
1069 O O   . ARG A 135 ? 0.9415 1.1160 1.4936 -0.1142 0.1031  0.1898  218 ARG A O   
1070 C CB  . ARG A 135 ? 0.8862 1.0740 1.4725 -0.1326 0.0501  0.1855  218 ARG A CB  
1071 C CG  . ARG A 135 ? 0.8473 1.0281 1.4258 -0.1405 0.0213  0.1797  218 ARG A CG  
1072 C CD  . ARG A 135 ? 0.8562 1.0578 1.4620 -0.1378 -0.0089 0.1753  218 ARG A CD  
1073 N NE  . ARG A 135 ? 0.8990 1.0898 1.4856 -0.1413 -0.0403 0.1668  218 ARG A NE  
1074 C CZ  . ARG A 135 ? 0.8584 1.0477 1.4765 -0.1537 -0.0561 0.1660  218 ARG A CZ  
1075 N NH1 . ARG A 135 ? 0.8550 1.0561 1.5301 -0.1648 -0.0416 0.1757  218 ARG A NH1 
1076 N NH2 . ARG A 135 ? 0.8266 0.9999 1.4181 -0.1548 -0.0853 0.1561  218 ARG A NH2 
1077 N N   . THR A 136 ? 1.0609 1.1970 1.5721 -0.1237 0.1392  0.1967  219 THR A N   
1078 C CA  . THR A 136 ? 1.1122 1.2309 1.5929 -0.1142 0.1676  0.1973  219 THR A CA  
1079 C C   . THR A 136 ? 1.1571 1.2385 1.5578 -0.1132 0.1691  0.1925  219 THR A C   
1080 O O   . THR A 136 ? 1.1708 1.2317 1.5339 -0.1054 0.1848  0.1900  219 THR A O   
1081 C CB  . THR A 136 ? 1.1742 1.2910 1.6841 -0.1153 0.2059  0.2085  219 THR A CB  
1082 O OG1 . THR A 136 ? 1.2548 1.3554 1.7495 -0.1257 0.2114  0.2139  219 THR A OG1 
1083 C CG2 . THR A 136 ? 1.1709 1.3268 1.7692 -0.1162 0.2076  0.2164  219 THR A CG2 
1084 N N   . GLN A 137 ? 1.1655 1.2368 1.5419 -0.1209 0.1519  0.1917  220 GLN A N   
1085 C CA  . GLN A 137 ? 1.1423 1.1798 1.4514 -0.1220 0.1529  0.1908  220 GLN A CA  
1086 C C   . GLN A 137 ? 1.0688 1.1081 1.3558 -0.1226 0.1192  0.1851  220 GLN A C   
1087 O O   . GLN A 137 ? 1.0430 1.0950 1.3539 -0.1275 0.1018  0.1847  220 GLN A O   
1088 C CB  . GLN A 137 ? 1.2113 1.2340 1.5190 -0.1301 0.1711  0.1996  220 GLN A CB  
1089 C CG  . GLN A 137 ? 1.3022 1.2954 1.5524 -0.1340 0.1629  0.2008  220 GLN A CG  
1090 C CD  . GLN A 137 ? 1.4385 1.3956 1.6239 -0.1299 0.1806  0.2022  220 GLN A CD  
1091 O OE1 . GLN A 137 ? 1.6041 1.5538 1.7780 -0.1228 0.1981  0.1998  220 GLN A OE1 
1092 N NE2 . GLN A 137 ? 1.5230 1.4544 1.6632 -0.1339 0.1756  0.2063  220 GLN A NE2 
1093 N N   . LEU A 138 ? 1.0714 1.0960 1.3130 -0.1175 0.1106  0.1813  221 LEU A N   
1094 C CA  . LEU A 138 ? 1.0263 1.0535 1.2485 -0.1162 0.0824  0.1785  221 LEU A CA  
1095 C C   . LEU A 138 ? 1.0245 1.0250 1.1994 -0.1198 0.0791  0.1823  221 LEU A C   
1096 O O   . LEU A 138 ? 1.0509 1.0254 1.1926 -0.1220 0.0962  0.1857  221 LEU A O   
1097 C CB  . LEU A 138 ? 0.9862 1.0180 1.1971 -0.1089 0.0722  0.1747  221 LEU A CB  
1098 C CG  . LEU A 138 ? 1.0166 1.0768 1.2736 -0.1038 0.0691  0.1720  221 LEU A CG  
1099 C CD1 . LEU A 138 ? 1.0204 1.0800 1.2627 -0.0970 0.0620  0.1698  221 LEU A CD1 
1100 C CD2 . LEU A 138 ? 1.0437 1.1275 1.3322 -0.1044 0.0483  0.1708  221 LEU A CD2 
1101 N N   . ARG A 139 ? 0.9732 0.9790 1.1435 -0.1191 0.0572  0.1822  222 ARG A N   
1102 C CA  . ARG A 139 ? 0.9975 0.9817 1.1260 -0.1203 0.0495  0.1870  222 ARG A CA  
1103 C C   . ARG A 139 ? 0.9799 0.9770 1.1069 -0.1141 0.0258  0.1866  222 ARG A C   
1104 O O   . ARG A 139 ? 0.9228 0.9416 1.0787 -0.1100 0.0155  0.1827  222 ARG A O   
1105 C CB  . ARG A 139 ? 1.0338 1.0029 1.1575 -0.1267 0.0567  0.1923  222 ARG A CB  
1106 C CG  . ARG A 139 ? 1.0593 1.0447 1.2232 -0.1288 0.0500  0.1897  222 ARG A CG  
1107 C CD  . ARG A 139 ? 1.0624 1.0297 1.2199 -0.1350 0.0529  0.1953  222 ARG A CD  
1108 N NE  . ARG A 139 ? 1.1027 1.0786 1.2782 -0.1331 0.0336  0.1909  222 ARG A NE  
1109 C CZ  . ARG A 139 ? 1.1421 1.1232 1.3521 -0.1387 0.0310  0.1878  222 ARG A CZ  
1110 N NH1 . ARG A 139 ? 1.2379 1.2210 1.4774 -0.1476 0.0476  0.1911  222 ARG A NH1 
1111 N NH2 . ARG A 139 ? 1.1016 1.0839 1.3169 -0.1352 0.0117  0.1820  222 ARG A NH2 
1112 N N   . LEU A 140 ? 0.9762 0.9594 1.0693 -0.1131 0.0175  0.1915  223 LEU A N   
1113 C CA  . LEU A 140 ? 0.9647 0.9580 1.0562 -0.1073 -0.0019 0.1953  223 LEU A CA  
1114 C C   . LEU A 140 ? 0.9899 0.9848 1.0902 -0.1055 -0.0070 0.1968  223 LEU A C   
1115 O O   . LEU A 140 ? 1.0976 1.0742 1.1831 -0.1100 -0.0023 0.2008  223 LEU A O   
1116 C CB  . LEU A 140 ? 0.9917 0.9677 1.0493 -0.1089 -0.0103 0.2027  223 LEU A CB  
1117 C CG  . LEU A 140 ? 0.9929 0.9803 1.0534 -0.1030 -0.0289 0.2108  223 LEU A CG  
1118 C CD1 . LEU A 140 ? 0.9589 0.9727 1.0466 -0.0956 -0.0349 0.2088  223 LEU A CD1 
1119 C CD2 . LEU A 140 ? 1.0573 1.0268 1.0886 -0.1074 -0.0391 0.2186  223 LEU A CD2 
1120 N N   . GLU A 141 ? 1.0624 1.0765 1.1842 -0.0983 -0.0163 0.1934  224 GLU A N   
1121 C CA  . GLU A 141 ? 1.1196 1.1332 1.2513 -0.0957 -0.0209 0.1907  224 GLU A CA  
1122 C C   . GLU A 141 ? 1.1469 1.1455 1.2584 -0.0928 -0.0258 0.1985  224 GLU A C   
1123 O O   . GLU A 141 ? 1.3299 1.3141 1.4401 -0.0955 -0.0237 0.1980  224 GLU A O   
1124 C CB  . GLU A 141 ? 1.2033 1.2362 1.3503 -0.0859 -0.0314 0.1861  224 GLU A CB  
1125 C CG  . GLU A 141 ? 1.3965 1.4250 1.5491 -0.0820 -0.0383 0.1800  224 GLU A CG  
1126 C CD  . GLU A 141 ? 1.5748 1.6177 1.7313 -0.0700 -0.0486 0.1763  224 GLU A CD  
1127 O OE1 . GLU A 141 ? 1.5432 1.5978 1.6939 -0.0619 -0.0503 0.1830  224 GLU A OE1 
1128 O OE2 . GLU A 141 ? 1.6938 1.7348 1.8583 -0.0690 -0.0558 0.1672  224 GLU A OE2 
1129 N N   . SER A 142 ? 1.0987 1.1005 1.1976 -0.0878 -0.0327 0.2069  225 SER A N   
1130 C CA  . SER A 142 ? 1.1392 1.1347 1.2281 -0.0812 -0.0399 0.2162  225 SER A CA  
1131 C C   . SER A 142 ? 1.1267 1.1227 1.2037 -0.0816 -0.0471 0.2279  225 SER A C   
1132 O O   . SER A 142 ? 1.1832 1.1909 1.2647 -0.0824 -0.0501 0.2279  225 SER A O   
1133 C CB  . SER A 142 ? 1.1721 1.1815 1.2736 -0.0679 -0.0453 0.2139  225 SER A CB  
1134 O OG  . SER A 142 ? 1.3233 1.3275 1.4183 -0.0586 -0.0494 0.2239  225 SER A OG  
1135 N N   . LEU A 143 ? 1.1641 1.1461 1.2271 -0.0815 -0.0516 0.2384  226 LEU A N   
1136 C CA  . LEU A 143 ? 1.1521 1.1358 1.2088 -0.0811 -0.0638 0.2520  226 LEU A CA  
1137 C C   . LEU A 143 ? 1.1634 1.1607 1.2369 -0.0678 -0.0707 0.2636  226 LEU A C   
1138 O O   . LEU A 143 ? 1.0507 1.0536 1.1281 -0.0669 -0.0820 0.2775  226 LEU A O   
1139 C CB  . LEU A 143 ? 1.1585 1.1159 1.1861 -0.0905 -0.0662 0.2584  226 LEU A CB  
1140 C CG  . LEU A 143 ? 1.1724 1.1116 1.1769 -0.1020 -0.0561 0.2495  226 LEU A CG  
1141 C CD1 . LEU A 143 ? 1.2123 1.1211 1.1814 -0.1090 -0.0566 0.2570  226 LEU A CD1 
1142 C CD2 . LEU A 143 ? 1.1543 1.1000 1.1569 -0.1054 -0.0607 0.2459  226 LEU A CD2 
1143 N N   . GLU A 144 ? 1.3380 1.3403 1.4224 -0.0570 -0.0641 0.2581  227 GLU A N   
1144 C CA  . GLU A 144 ? 1.4790 1.4878 1.5745 -0.0415 -0.0657 0.2685  227 GLU A CA  
1145 C C   . GLU A 144 ? 1.4495 1.4802 1.5635 -0.0352 -0.0736 0.2850  227 GLU A C   
1146 O O   . GLU A 144 ? 1.4114 1.4443 1.5346 -0.0270 -0.0774 0.3003  227 GLU A O   
1147 C CB  . GLU A 144 ? 1.6838 1.6961 1.7843 -0.0285 -0.0578 0.2579  227 GLU A CB  
1148 C CG  . GLU A 144 ? 1.7646 1.7557 1.8541 -0.0313 -0.0525 0.2427  227 GLU A CG  
1149 C CD  . GLU A 144 ? 1.9123 1.8788 1.9898 -0.0395 -0.0517 0.2457  227 GLU A CD  
1150 O OE1 . GLU A 144 ? 1.9488 1.9063 2.0244 -0.0307 -0.0528 0.2565  227 GLU A OE1 
1151 O OE2 . GLU A 144 ? 1.9015 1.8574 1.9730 -0.0539 -0.0485 0.2383  227 GLU A OE2 
1152 N N   . ASP A 145 ? 1.4493 1.4970 1.5732 -0.0384 -0.0758 0.2833  228 ASP A N   
1153 C CA  . ASP A 145 ? 1.5248 1.5938 1.6716 -0.0346 -0.0841 0.3006  228 ASP A CA  
1154 C C   . ASP A 145 ? 1.4495 1.5198 1.5947 -0.0495 -0.0946 0.3005  228 ASP A C   
1155 O O   . ASP A 145 ? 1.6266 1.7120 1.7847 -0.0494 -0.0940 0.2988  228 ASP A O   
1156 C CB  . ASP A 145 ? 1.6265 1.7173 1.7935 -0.0170 -0.0751 0.3048  228 ASP A CB  
1157 C CG  . ASP A 145 ? 1.6604 1.7511 1.8345 0.0003  -0.0686 0.3155  228 ASP A CG  
1158 O OD1 . ASP A 145 ? 1.7077 1.8054 1.8995 0.0025  -0.0755 0.3347  228 ASP A OD1 
1159 O OD2 . ASP A 145 ? 1.6203 1.7028 1.7827 0.0123  -0.0573 0.3049  228 ASP A OD2 
1160 N N   . THR A 146 ? 1.2777 1.3276 1.4026 -0.0618 -0.1040 0.3020  229 THR A N   
1161 C CA  . THR A 146 ? 1.1678 1.2099 1.2831 -0.0757 -0.1176 0.3038  229 THR A CA  
1162 C C   . THR A 146 ? 1.1355 1.1806 1.2628 -0.0765 -0.1360 0.3248  229 THR A C   
1163 O O   . THR A 146 ? 1.0076 1.0645 1.1545 -0.0646 -0.1338 0.3369  229 THR A O   
1164 C CB  . THR A 146 ? 1.1378 1.1493 1.2137 -0.0878 -0.1133 0.2893  229 THR A CB  
1165 O OG1 . THR A 146 ? 1.1514 1.1452 1.2098 -0.0873 -0.1115 0.2924  229 THR A OG1 
1166 C CG2 . THR A 146 ? 1.1254 1.1385 1.1996 -0.0868 -0.0958 0.2712  229 THR A CG2 
1167 N N   . HIS A 147 ? 1.1383 1.1715 1.2541 -0.0900 -0.1548 0.3291  230 HIS A N   
1168 C CA  . HIS A 147 ? 1.1262 1.1653 1.2602 -0.0935 -0.1783 0.3503  230 HIS A CA  
1169 C C   . HIS A 147 ? 1.1874 1.1917 1.2791 -0.1074 -0.1961 0.3498  230 HIS A C   
1170 O O   . HIS A 147 ? 1.2044 1.1854 1.2639 -0.1195 -0.2019 0.3380  230 HIS A O   
1171 C CB  . HIS A 147 ? 1.1255 1.1846 1.2915 -0.0975 -0.1898 0.3584  230 HIS A CB  
1172 C CG  . HIS A 147 ? 1.1151 1.2074 1.3199 -0.0829 -0.1722 0.3616  230 HIS A CG  
1173 N ND1 . HIS A 147 ? 1.1398 1.2600 1.3854 -0.0686 -0.1684 0.3813  230 HIS A ND1 
1174 C CD2 . HIS A 147 ? 1.0592 1.1592 1.2653 -0.0793 -0.1568 0.3486  230 HIS A CD2 
1175 C CE1 . HIS A 147 ? 1.0860 1.2274 1.3515 -0.0566 -0.1505 0.3796  230 HIS A CE1 
1176 N NE2 . HIS A 147 ? 1.0415 1.1715 1.2837 -0.0633 -0.1448 0.3600  230 HIS A NE2 
1177 N N   . ILE A 148 ? 1.2205 1.2188 1.3098 -0.1047 -0.2046 0.3631  231 ILE A N   
1178 C CA  . ILE A 148 ? 1.2707 1.2331 1.3140 -0.1164 -0.2211 0.3640  231 ILE A CA  
1179 C C   . ILE A 148 ? 1.3004 1.2628 1.3545 -0.1269 -0.2555 0.3799  231 ILE A C   
1180 O O   . ILE A 148 ? 1.2484 1.2354 1.3464 -0.1219 -0.2696 0.4018  231 ILE A O   
1181 C CB  . ILE A 148 ? 1.2897 1.2438 1.3253 -0.1084 -0.2154 0.3723  231 ILE A CB  
1182 C CG1 . ILE A 148 ? 1.3030 1.2522 1.3264 -0.1011 -0.1844 0.3551  231 ILE A CG1 
1183 C CG2 . ILE A 148 ? 1.3464 1.2661 1.3387 -0.1187 -0.2368 0.3798  231 ILE A CG2 
1184 C CD1 . ILE A 148 ? 1.3406 1.2713 1.3458 -0.0964 -0.1764 0.3586  231 ILE A CD1 
1185 N N   . MET A 149 ? 1.3737 1.3063 1.3872 -0.1414 -0.2689 0.3691  232 MET A N   
1186 C CA  . MET A 149 ? 1.4898 1.4151 1.5070 -0.1545 -0.3052 0.3806  232 MET A CA  
1187 C C   . MET A 149 ? 1.5753 1.4635 1.5446 -0.1634 -0.3302 0.3873  232 MET A C   
1188 O O   . MET A 149 ? 1.5992 1.4635 1.5258 -0.1600 -0.3160 0.3811  232 MET A O   
1189 C CB  . MET A 149 ? 1.5445 1.4541 1.5429 -0.1647 -0.3073 0.3637  232 MET A CB  
1190 C CG  . MET A 149 ? 1.5162 1.4645 1.5767 -0.1623 -0.3071 0.3706  232 MET A CG  
1191 S SD  . MET A 149 ? 1.5511 1.5547 1.6813 -0.1420 -0.2834 0.3860  232 MET A SD  
1192 C CE  . MET A 149 ? 1.5012 1.5342 1.6766 -0.1406 -0.2751 0.3849  232 MET A CE  
1193 N N   . LYS A 150 ? 1.7219 1.6048 1.6996 -0.1754 -0.3689 0.4009  233 LYS A N   
1194 C CA  . LYS A 150 ? 1.8246 1.6735 1.7613 -0.1852 -0.4027 0.4115  233 LYS A CA  
1195 C C   . LYS A 150 ? 1.8677 1.6708 1.7467 -0.2021 -0.4258 0.3969  233 LYS A C   
1196 O O   . LYS A 150 ? 1.7718 1.5821 1.6795 -0.2127 -0.4529 0.4025  233 LYS A O   
1197 C CB  . LYS A 150 ? 1.8054 1.6864 1.8046 -0.1847 -0.4337 0.4429  233 LYS A CB  
1198 C CG  . LYS A 150 ? 1.7828 1.7226 1.8713 -0.1733 -0.4202 0.4574  233 LYS A CG  
1199 C CD  . LYS A 150 ? 1.8069 1.7791 1.9572 -0.1677 -0.4409 0.4899  233 LYS A CD  
1200 C CE  . LYS A 150 ? 1.8045 1.8307 2.0433 -0.1609 -0.4354 0.5068  233 LYS A CE  
1201 N NZ  . LYS A 150 ? 1.8431 1.8959 2.1451 -0.1642 -0.4705 0.5405  233 LYS A NZ  
1202 N N   . GLY A 151 ? 1.9580 1.7131 1.7562 -0.2036 -0.4115 0.3779  234 GLY A N   
1203 C CA  . GLY A 151 ? 2.0360 1.7353 1.7604 -0.2167 -0.4285 0.3615  234 GLY A CA  
1204 C C   . GLY A 151 ? 1.9847 1.6836 1.7143 -0.2193 -0.4140 0.3420  234 GLY A C   
1205 O O   . GLY A 151 ? 1.9601 1.6669 1.6883 -0.2098 -0.3739 0.3264  234 GLY A O   
1206 N N   . GLU A 152 ? 1.9871 1.6765 1.7257 -0.2326 -0.4489 0.3443  235 GLU A N   
1207 C CA  . GLU A 152 ? 1.9586 1.6408 1.6998 -0.2371 -0.4423 0.3273  235 GLU A CA  
1208 C C   . GLU A 152 ? 1.8736 1.6170 1.7121 -0.2342 -0.4397 0.3403  235 GLU A C   
1209 O O   . GLU A 152 ? 1.8518 1.5989 1.7039 -0.2346 -0.4270 0.3282  235 GLU A O   
1210 C CB  . GLU A 152 ? 2.0299 1.6543 1.7128 -0.2545 -0.4825 0.3193  235 GLU A CB  
1211 C CG  . GLU A 152 ? 2.0684 1.6941 1.7731 -0.2681 -0.5368 0.3426  235 GLU A CG  
1212 C CD  . GLU A 152 ? 2.1720 1.7496 1.8407 -0.2873 -0.5810 0.3355  235 GLU A CD  
1213 O OE1 . GLU A 152 ? 2.2699 1.8356 1.9376 -0.2906 -0.5728 0.3192  235 GLU A OE1 
1214 O OE2 . GLU A 152 ? 2.2356 1.7857 1.8775 -0.2995 -0.6266 0.3467  235 GLU A OE2 
1215 N N   . ASP A 153 ? 1.8178 1.6077 1.7226 -0.2299 -0.4497 0.3658  236 ASP A N   
1216 C CA  . ASP A 153 ? 1.6828 1.5311 1.6786 -0.2246 -0.4435 0.3813  236 ASP A CA  
1217 C C   . ASP A 153 ? 1.6130 1.4892 1.6268 -0.2080 -0.3951 0.3690  236 ASP A C   
1218 O O   . ASP A 153 ? 1.6594 1.5261 1.6379 -0.1981 -0.3673 0.3574  236 ASP A O   
1219 C CB  . ASP A 153 ? 1.6466 1.5354 1.7043 -0.2205 -0.4601 0.4120  236 ASP A CB  
1220 C CG  . ASP A 153 ? 1.5921 1.5398 1.7421 -0.2132 -0.4509 0.4305  236 ASP A CG  
1221 O OD1 . ASP A 153 ? 1.6407 1.5960 1.8275 -0.2251 -0.4744 0.4391  236 ASP A OD1 
1222 O OD2 . ASP A 153 ? 1.4938 1.4774 1.6769 -0.1952 -0.4192 0.4361  236 ASP A OD2 
1223 N N   . ASP A 154 ? 1.4662 1.3741 1.5334 -0.2058 -0.3866 0.3719  237 ASP A N   
1224 C CA  . ASP A 154 ? 1.3427 1.2798 1.4321 -0.1901 -0.3453 0.3628  237 ASP A CA  
1225 C C   . ASP A 154 ? 1.2756 1.2640 1.4441 -0.1834 -0.3393 0.3802  237 ASP A C   
1226 O O   . ASP A 154 ? 1.2010 1.2082 1.3840 -0.1728 -0.3106 0.3718  237 ASP A O   
1227 C CB  . ASP A 154 ? 1.3797 1.2817 1.4161 -0.1922 -0.3272 0.3346  237 ASP A CB  
1228 C CG  . ASP A 154 ? 1.3732 1.2718 1.4280 -0.2008 -0.3375 0.3311  237 ASP A CG  
1229 O OD1 . ASP A 154 ? 1.4058 1.3007 1.4816 -0.2140 -0.3717 0.3442  237 ASP A OD1 
1230 O OD2 . ASP A 154 ? 1.3722 1.2718 1.4229 -0.1943 -0.3117 0.3157  237 ASP A OD2 
1231 N N   . ALA A 155 ? 1.3248 1.3359 1.5451 -0.1891 -0.3663 0.4060  238 ALA A N   
1232 C CA  . ALA A 155 ? 1.2599 1.3167 1.5557 -0.1842 -0.3618 0.4256  238 ALA A CA  
1233 C C   . ALA A 155 ? 1.1874 1.2846 1.5182 -0.1626 -0.3321 0.4371  238 ALA A C   
1234 O O   . ALA A 155 ? 1.2002 1.2985 1.5248 -0.1568 -0.3336 0.4441  238 ALA A O   
1235 C CB  . ALA A 155 ? 1.2870 1.3531 1.6298 -0.1991 -0.4018 0.4508  238 ALA A CB  
1236 N N   . LEU A 156 ? 1.1823 1.3084 1.5438 -0.1498 -0.3046 0.4377  239 LEU A N   
1237 C CA  . LEU A 156 ? 1.1346 1.2949 1.5252 -0.1280 -0.2765 0.4480  239 LEU A CA  
1238 C C   . LEU A 156 ? 1.1046 1.3016 1.5488 -0.1183 -0.2601 0.4620  239 LEU A C   
1239 O O   . LEU A 156 ? 1.1851 1.3767 1.6322 -0.1275 -0.2643 0.4566  239 LEU A O   
1240 C CB  . LEU A 156 ? 1.1706 1.3119 1.5072 -0.1178 -0.2507 0.4229  239 LEU A CB  
1241 C CG  . LEU A 156 ? 1.1981 1.3244 1.5005 -0.1173 -0.2313 0.3970  239 LEU A CG  
1242 C CD1 . LEU A 156 ? 1.1861 1.3421 1.5126 -0.0982 -0.2017 0.3982  239 LEU A CD1 
1243 C CD2 . LEU A 156 ? 1.2151 1.3062 1.4557 -0.1200 -0.2239 0.3729  239 LEU A CD2 
1244 N N   . SER A 157 ? 1.0726 1.3043 1.5571 -0.0992 -0.2407 0.4809  240 SER A N   
1245 C CA  . SER A 157 ? 1.0977 1.3658 1.6335 -0.0865 -0.2214 0.4987  240 SER A CA  
1246 C C   . SER A 157 ? 1.1266 1.4093 1.6537 -0.0608 -0.1831 0.4936  240 SER A C   
1247 O O   . SER A 157 ? 1.1134 1.4228 1.6755 -0.0488 -0.1654 0.5084  240 SER A O   
1248 C CB  . SER A 157 ? 1.1352 1.4359 1.7437 -0.0880 -0.2365 0.5354  240 SER A CB  
1249 O OG  . SER A 157 ? 1.1996 1.4917 1.8068 -0.0945 -0.2595 0.5426  240 SER A OG  
1250 N N   . ASP A 158 ? 1.1898 1.4526 1.6691 -0.0529 -0.1713 0.4731  241 ASP A N   
1251 C CA  . ASP A 158 ? 1.2731 1.5399 1.7321 -0.0304 -0.1389 0.4625  241 ASP A CA  
1252 C C   . ASP A 158 ? 1.1441 1.4236 1.6075 -0.0211 -0.1194 0.4597  241 ASP A C   
1253 O O   . ASP A 158 ? 1.1467 1.4486 1.6323 -0.0010 -0.0976 0.4743  241 ASP A O   
1254 C CB  . ASP A 158 ? 1.4884 1.7215 1.8870 -0.0339 -0.1370 0.4327  241 ASP A CB  
1255 C CG  . ASP A 158 ? 1.5880 1.8193 1.9636 -0.0131 -0.1100 0.4210  241 ASP A CG  
1256 O OD1 . ASP A 158 ? 1.5547 1.8066 1.9503 0.0055  -0.0907 0.4320  241 ASP A OD1 
1257 O OD2 . ASP A 158 ? 1.6294 1.8354 1.9640 -0.0161 -0.1088 0.4003  241 ASP A OD2 
1258 N N   . LYS A 159 ? 1.0179 1.2813 1.4576 -0.0342 -0.1260 0.4415  242 LYS A N   
1259 C CA  . LYS A 159 ? 0.9963 1.2671 1.4329 -0.0261 -0.1093 0.4359  242 LYS A CA  
1260 C C   . LYS A 159 ? 0.9695 1.2388 1.3764 -0.0056 -0.0843 0.4229  242 LYS A C   
1261 O O   . LYS A 159 ? 1.0225 1.3101 1.4432 0.0126  -0.0655 0.4354  242 LYS A O   
1262 C CB  . LYS A 159 ? 0.9255 1.2238 1.4141 -0.0248 -0.1083 0.4627  242 LYS A CB  
1263 C CG  . LYS A 159 ? 0.9721 1.2661 1.4865 -0.0482 -0.1373 0.4717  242 LYS A CG  
1264 C CD  . LYS A 159 ? 0.9923 1.3101 1.5610 -0.0514 -0.1398 0.4973  242 LYS A CD  
1265 C CE  . LYS A 159 ? 1.0168 1.3192 1.5993 -0.0780 -0.1738 0.4991  242 LYS A CE  
1266 N NZ  . LYS A 159 ? 1.0365 1.3625 1.6823 -0.0848 -0.1822 0.5283  242 LYS A NZ  
1267 N N   . HIS A 160 ? 0.9630 1.2076 1.3269 -0.0096 -0.0853 0.3976  243 HIS A N   
1268 C CA  . HIS A 160 ? 1.0019 1.2385 1.3336 0.0048  -0.0682 0.3808  243 HIS A CA  
1269 C C   . HIS A 160 ? 0.9931 1.2082 1.2922 -0.0075 -0.0735 0.3544  243 HIS A C   
1270 O O   . HIS A 160 ? 1.0079 1.2060 1.2956 -0.0241 -0.0866 0.3456  243 HIS A O   
1271 C CB  . HIS A 160 ? 1.0514 1.2803 1.3710 0.0149  -0.0626 0.3803  243 HIS A CB  
1272 C CG  . HIS A 160 ? 1.1168 1.3337 1.4030 0.0300  -0.0472 0.3636  243 HIS A CG  
1273 N ND1 . HIS A 160 ? 1.1423 1.3688 1.4287 0.0526  -0.0292 0.3722  243 HIS A ND1 
1274 C CD2 . HIS A 160 ? 1.1205 1.3146 1.3717 0.0256  -0.0482 0.3393  243 HIS A CD2 
1275 C CE1 . HIS A 160 ? 1.1303 1.3375 1.3793 0.0609  -0.0224 0.3521  243 HIS A CE1 
1276 N NE2 . HIS A 160 ? 1.1765 1.3658 1.4078 0.0441  -0.0343 0.3327  243 HIS A NE2 
1277 N N   . GLY A 161 ? 0.9344 1.1502 1.2193 0.0010  -0.0630 0.3435  244 GLY A N   
1278 C CA  . GLY A 161 ? 0.9521 1.1529 1.2153 -0.0085 -0.0661 0.3215  244 GLY A CA  
1279 C C   . GLY A 161 ? 0.9692 1.1776 1.2281 0.0020  -0.0576 0.3169  244 GLY A C   
1280 O O   . GLY A 161 ? 0.9695 1.1930 1.2384 0.0165  -0.0489 0.3312  244 GLY A O   
1281 N N   . CYS A 162 ? 0.9801 1.1775 1.2238 -0.0044 -0.0596 0.2980  245 CYS A N   
1282 C CA  . CYS A 162 ? 0.9215 1.1247 1.1611 0.0039  -0.0554 0.2928  245 CYS A CA  
1283 C C   . CYS A 162 ? 0.8920 1.1055 1.1541 -0.0004 -0.0581 0.3036  245 CYS A C   
1284 O O   . CYS A 162 ? 0.8816 1.0865 1.1505 -0.0154 -0.0654 0.2995  245 CYS A O   
1285 C CB  . CYS A 162 ? 0.9322 1.1218 1.1555 -0.0025 -0.0580 0.2705  245 CYS A CB  
1286 S SG  . CYS A 162 ? 0.9571 1.1531 1.1829 0.0017  -0.0587 0.2632  245 CYS A SG  
1287 N N   . PRO A 163 ? 0.8585 1.0868 1.1290 0.0127  -0.0516 0.3172  246 PRO A N   
1288 C CA  . PRO A 163 ? 0.8657 1.1042 1.1618 0.0092  -0.0534 0.3318  246 PRO A CA  
1289 C C   . PRO A 163 ? 0.8758 1.1043 1.1767 -0.0041 -0.0610 0.3204  246 PRO A C   
1290 O O   . PRO A 163 ? 0.9468 1.1731 1.2668 -0.0150 -0.0674 0.3285  246 PRO A O   
1291 C CB  . PRO A 163 ? 0.8842 1.1352 1.1766 0.0280  -0.0431 0.3427  246 PRO A CB  
1292 C CG  . PRO A 163 ? 0.8900 1.1397 1.1614 0.0420  -0.0348 0.3423  246 PRO A CG  
1293 C CD  . PRO A 163 ? 0.8692 1.1019 1.1218 0.0325  -0.0419 0.3200  246 PRO A CD  
1294 N N   . ALA A 164 ? 0.8238 1.0449 1.1094 -0.0033 -0.0609 0.3027  247 ALA A N   
1295 C CA  . ALA A 164 ? 0.8062 1.0178 1.0987 -0.0135 -0.0649 0.2931  247 ALA A CA  
1296 C C   . ALA A 164 ? 0.8318 1.0256 1.1228 -0.0299 -0.0705 0.2865  247 ALA A C   
1297 O O   . ALA A 164 ? 0.8674 1.0505 1.1658 -0.0382 -0.0737 0.2844  247 ALA A O   
1298 C CB  . ALA A 164 ? 0.8644 1.0733 1.1466 -0.0101 -0.0636 0.2765  247 ALA A CB  
1299 N N   . TYR A 165 ? 0.8922 1.0794 1.1703 -0.0342 -0.0719 0.2831  248 TYR A N   
1300 C CA  . TYR A 165 ? 0.8631 1.0295 1.1316 -0.0492 -0.0784 0.2766  248 TYR A CA  
1301 C C   . TYR A 165 ? 0.8727 1.0384 1.1535 -0.0567 -0.0891 0.2926  248 TYR A C   
1302 O O   . TYR A 165 ? 0.9335 1.0787 1.2015 -0.0694 -0.0978 0.2876  248 TYR A O   
1303 C CB  . TYR A 165 ? 0.8254 0.9814 1.0717 -0.0511 -0.0751 0.2638  248 TYR A CB  
1304 C CG  . TYR A 165 ? 0.8031 0.9585 1.0435 -0.0474 -0.0673 0.2485  248 TYR A CG  
1305 C CD1 . TYR A 165 ? 0.7857 0.9254 1.0206 -0.0551 -0.0633 0.2355  248 TYR A CD1 
1306 C CD2 . TYR A 165 ? 0.8163 0.9855 1.0571 -0.0356 -0.0640 0.2476  248 TYR A CD2 
1307 C CE1 . TYR A 165 ? 0.7798 0.9225 1.0180 -0.0521 -0.0563 0.2241  248 TYR A CE1 
1308 C CE2 . TYR A 165 ? 0.8077 0.9769 1.0476 -0.0339 -0.0608 0.2345  248 TYR A CE2 
1309 C CZ  . TYR A 165 ? 0.8055 0.9639 1.0483 -0.0426 -0.0569 0.2237  248 TYR A CZ  
1310 O OH  . TYR A 165 ? 0.8285 0.9902 1.0792 -0.0414 -0.0537 0.2132  248 TYR A OH  
1311 N N   . VAL A 166 ? 0.8799 1.0668 1.1852 -0.0491 -0.0889 0.3125  249 VAL A N   
1312 C CA  . VAL A 166 ? 0.9026 1.0940 1.2288 -0.0560 -0.0999 0.3310  249 VAL A CA  
1313 C C   . VAL A 166 ? 0.9424 1.1219 1.2825 -0.0690 -0.1118 0.3347  249 VAL A C   
1314 O O   . VAL A 166 ? 1.0554 1.2382 1.4057 -0.0656 -0.1072 0.3357  249 VAL A O   
1315 C CB  . VAL A 166 ? 0.8860 1.1058 1.2383 -0.0421 -0.0923 0.3539  249 VAL A CB  
1316 C CG1 . VAL A 166 ? 0.9199 1.1474 1.3037 -0.0507 -0.1047 0.3754  249 VAL A CG1 
1317 C CG2 . VAL A 166 ? 0.9481 1.1732 1.2823 -0.0290 -0.0817 0.3494  249 VAL A CG2 
1318 N N   . SER A 167 ? 1.0392 1.2019 1.3772 -0.0839 -0.1285 0.3364  250 SER A N   
1319 C CA  . SER A 167 ? 1.0637 1.2060 1.4080 -0.0988 -0.1443 0.3372  250 SER A CA  
1320 C C   . SER A 167 ? 1.0800 1.2439 1.4719 -0.1002 -0.1517 0.3641  250 SER A C   
1321 O O   . SER A 167 ? 1.1179 1.3103 1.5353 -0.0915 -0.1467 0.3830  250 SER A O   
1322 C CB  . SER A 167 ? 1.1005 1.2117 1.4168 -0.1143 -0.1620 0.3277  250 SER A CB  
1323 O OG  . SER A 167 ? 1.0755 1.1997 1.4098 -0.1177 -0.1746 0.3450  250 SER A OG  
1324 N N   . PRO A 168 ? 1.0827 1.2324 1.4882 -0.1104 -0.1623 0.3668  251 PRO A N   
1325 C CA  . PRO A 168 ? 1.0277 1.1991 1.4841 -0.1123 -0.1679 0.3944  251 PRO A CA  
1326 C C   . PRO A 168 ? 1.0431 1.2260 1.5284 -0.1215 -0.1854 0.4143  251 PRO A C   
1327 O O   . PRO A 168 ? 1.0255 1.2422 1.5547 -0.1139 -0.1790 0.4407  251 PRO A O   
1328 C CB  . PRO A 168 ? 1.0302 1.1724 1.4871 -0.1255 -0.1806 0.3882  251 PRO A CB  
1329 C CG  . PRO A 168 ? 1.0878 1.1993 1.4952 -0.1242 -0.1735 0.3579  251 PRO A CG  
1330 C CD  . PRO A 168 ? 1.0963 1.2063 1.4718 -0.1215 -0.1701 0.3458  251 PRO A CD  
1331 N N   . GLU A 169 ? 1.0070 1.1615 1.4669 -0.1365 -0.2064 0.4026  252 GLU A N   
1332 C CA  . GLU A 169 ? 1.0161 1.1781 1.5031 -0.1474 -0.2286 0.4210  252 GLU A CA  
1333 C C   . GLU A 169 ? 0.9759 1.1749 1.4842 -0.1320 -0.2144 0.4375  252 GLU A C   
1334 O O   . GLU A 169 ? 0.9054 1.1262 1.4587 -0.1355 -0.2257 0.4628  252 GLU A O   
1335 C CB  . GLU A 169 ? 1.1039 1.2230 1.5476 -0.1649 -0.2544 0.4030  252 GLU A CB  
1336 C CG  . GLU A 169 ? 1.2117 1.3196 1.6077 -0.1593 -0.2475 0.3859  252 GLU A CG  
1337 C CD  . GLU A 169 ? 1.3190 1.3955 1.6570 -0.1557 -0.2324 0.3550  252 GLU A CD  
1338 O OE1 . GLU A 169 ? 1.2470 1.3238 1.5866 -0.1495 -0.2171 0.3475  252 GLU A OE1 
1339 O OE2 . GLU A 169 ? 1.3881 1.4404 1.6811 -0.1586 -0.2351 0.3400  252 GLU A OE2 
1340 N N   . ILE A 170 ? 0.9367 1.1408 1.4136 -0.1153 -0.1906 0.4234  253 ILE A N   
1341 C CA  . ILE A 170 ? 0.8949 1.1294 1.3867 -0.0981 -0.1742 0.4369  253 ILE A CA  
1342 C C   . ILE A 170 ? 0.8505 1.1207 1.3897 -0.0844 -0.1572 0.4631  253 ILE A C   
1343 O O   . ILE A 170 ? 0.8147 1.1125 1.3883 -0.0748 -0.1505 0.4862  253 ILE A O   
1344 C CB  . ILE A 170 ? 0.8803 1.1051 1.3230 -0.0855 -0.1558 0.4129  253 ILE A CB  
1345 C CG1 . ILE A 170 ? 0.9253 1.1207 1.3300 -0.0974 -0.1710 0.3961  253 ILE A CG1 
1346 C CG2 . ILE A 170 ? 0.8430 1.0955 1.2972 -0.0641 -0.1343 0.4248  253 ILE A CG2 
1347 C CD1 . ILE A 170 ? 0.9340 1.1111 1.2898 -0.0916 -0.1567 0.3694  253 ILE A CD1 
1348 N N   . LEU A 171 ? 0.9237 1.1923 1.4649 -0.0829 -0.1495 0.4608  254 LEU A N   
1349 C CA  . LEU A 171 ? 0.9175 1.2157 1.4965 -0.0691 -0.1312 0.4851  254 LEU A CA  
1350 C C   . LEU A 171 ? 0.9160 1.2289 1.5561 -0.0816 -0.1455 0.5146  254 LEU A C   
1351 O O   . LEU A 171 ? 0.9670 1.3107 1.6489 -0.0699 -0.1298 0.5426  254 LEU A O   
1352 C CB  . LEU A 171 ? 0.9471 1.2362 1.5007 -0.0616 -0.1175 0.4707  254 LEU A CB  
1353 C CG  . LEU A 171 ? 0.9416 1.2171 1.4407 -0.0506 -0.1053 0.4421  254 LEU A CG  
1354 C CD1 . LEU A 171 ? 0.9229 1.1890 1.4044 -0.0463 -0.0976 0.4296  254 LEU A CD1 
1355 C CD2 . LEU A 171 ? 0.9067 1.2023 1.3991 -0.0295 -0.0855 0.4490  254 LEU A CD2 
1356 N N   . ASN A 172 ? 0.9177 1.2064 1.5618 -0.1053 -0.1748 0.5088  255 ASN A N   
1357 C CA  . ASN A 172 ? 0.9193 1.2147 1.6199 -0.1214 -0.1937 0.5334  255 ASN A CA  
1358 C C   . ASN A 172 ? 0.9461 1.2487 1.6857 -0.1366 -0.2205 0.5516  255 ASN A C   
1359 O O   . ASN A 172 ? 1.0494 1.3710 1.8522 -0.1459 -0.2316 0.5808  255 ASN A O   
1360 C CB  . ASN A 172 ? 0.9164 1.1731 1.5920 -0.1376 -0.2099 0.5131  255 ASN A CB  
1361 C CG  . ASN A 172 ? 0.9557 1.2115 1.6109 -0.1231 -0.1854 0.5035  255 ASN A CG  
1362 O OD1 . ASN A 172 ? 0.9439 1.2288 1.6079 -0.1023 -0.1585 0.5158  255 ASN A OD1 
1363 N ND2 . ASN A 172 ? 0.9822 1.2029 1.6088 -0.1329 -0.1945 0.4821  255 ASN A ND2 
1364 N N   . THR A 173 ? 0.9815 1.2694 1.6865 -0.1397 -0.2319 0.5359  256 THR A N   
1365 C CA  . THR A 173 ? 0.9852 1.2785 1.7224 -0.1534 -0.2600 0.5523  256 THR A CA  
1366 C C   . THR A 173 ? 0.9530 1.2844 1.7190 -0.1346 -0.2415 0.5729  256 THR A C   
1367 O O   . THR A 173 ? 0.8626 1.2014 1.5976 -0.1131 -0.2118 0.5628  256 THR A O   
1368 C CB  . THR A 173 ? 1.0708 1.3196 1.7509 -0.1701 -0.2884 0.5248  256 THR A CB  
1369 O OG1 . THR A 173 ? 1.1480 1.3949 1.7848 -0.1564 -0.2741 0.5098  256 THR A OG1 
1370 C CG2 . THR A 173 ? 1.0882 1.2914 1.7186 -0.1818 -0.2963 0.4957  256 THR A CG2 
1371 N N   . THR A 174 ? 0.9898 1.3441 1.8173 -0.1430 -0.2605 0.6026  257 THR A N   
1372 C CA  . THR A 174 ? 0.9936 1.3778 1.8477 -0.1281 -0.2502 0.6215  257 THR A CA  
1373 C C   . THR A 174 ? 0.9906 1.3480 1.8106 -0.1416 -0.2809 0.6066  257 THR A C   
1374 O O   . THR A 174 ? 0.9772 1.2982 1.7690 -0.1647 -0.3138 0.5903  257 THR A O   
1375 C CB  . THR A 174 ? 0.9841 1.4135 1.9344 -0.1279 -0.2520 0.6670  257 THR A CB  
1376 O OG1 . THR A 174 ? 0.9930 1.4118 1.9802 -0.1574 -0.2952 0.6773  257 THR A OG1 
1377 C CG2 . THR A 174 ? 0.9515 1.4091 1.9340 -0.1107 -0.2160 0.6856  257 THR A CG2 
1378 N N   . GLY A 175 ? 0.9898 1.3622 1.8085 -0.1259 -0.2690 0.6121  258 GLY A N   
1379 C CA  . GLY A 175 ? 1.0056 1.3559 1.7939 -0.1352 -0.2947 0.6022  258 GLY A CA  
1380 C C   . GLY A 175 ? 1.0241 1.3286 1.7215 -0.1379 -0.2936 0.5613  258 GLY A C   
1381 O O   . GLY A 175 ? 1.0407 1.3404 1.6993 -0.1226 -0.2624 0.5418  258 GLY A O   
1382 N N   . THR A 176 ? 1.0483 1.3181 1.7122 -0.1579 -0.3284 0.5494  259 THR A N   
1383 C CA  . THR A 176 ? 1.1501 1.3758 1.7297 -0.1606 -0.3278 0.5144  259 THR A CA  
1384 C C   . THR A 176 ? 1.1567 1.3499 1.6925 -0.1695 -0.3255 0.4879  259 THR A C   
1385 O O   . THR A 176 ? 1.1982 1.3966 1.7655 -0.1775 -0.3316 0.4956  259 THR A O   
1386 C CB  . THR A 176 ? 1.2256 1.4223 1.7781 -0.1767 -0.3645 0.5125  259 THR A CB  
1387 O OG1 . THR A 176 ? 1.3532 1.5393 1.9323 -0.1998 -0.4039 0.5239  259 THR A OG1 
1388 C CG2 . THR A 176 ? 1.2101 1.4347 1.7958 -0.1649 -0.3633 0.5348  259 THR A CG2 
1389 N N   . TYR A 177 ? 1.1483 1.3093 1.6141 -0.1662 -0.3133 0.4578  260 TYR A N   
1390 C CA  . TYR A 177 ? 1.0806 1.2050 1.4974 -0.1739 -0.3108 0.4304  260 TYR A CA  
1391 C C   . TYR A 177 ? 1.1020 1.1862 1.4466 -0.1768 -0.3121 0.4054  260 TYR A C   
1392 O O   . TYR A 177 ? 1.1186 1.2088 1.4517 -0.1684 -0.3054 0.4072  260 TYR A O   
1393 C CB  . TYR A 177 ? 1.0319 1.1741 1.4533 -0.1580 -0.2760 0.4226  260 TYR A CB  
1394 C CG  . TYR A 177 ? 0.9509 1.1118 1.3602 -0.1368 -0.2448 0.4173  260 TYR A CG  
1395 C CD1 . TYR A 177 ? 0.9003 1.1016 1.3554 -0.1210 -0.2301 0.4400  260 TYR A CD1 
1396 C CD2 . TYR A 177 ? 0.9544 1.0910 1.3074 -0.1324 -0.2294 0.3901  260 TYR A CD2 
1397 C CE1 . TYR A 177 ? 0.8645 1.0772 1.3044 -0.1016 -0.2034 0.4338  260 TYR A CE1 
1398 C CE2 . TYR A 177 ? 0.9219 1.0732 1.2660 -0.1148 -0.2040 0.3851  260 TYR A CE2 
1399 C CZ  . TYR A 177 ? 0.8992 1.0863 1.2841 -0.0997 -0.1924 0.4061  260 TYR A CZ  
1400 O OH  . TYR A 177 ? 0.8900 1.0861 1.2618 -0.0822 -0.1692 0.4001  260 TYR A OH  
1401 N N   . SER A 178 ? 1.1335 1.1747 1.4294 -0.1880 -0.3197 0.3830  261 SER A N   
1402 C CA  . SER A 178 ? 1.1095 1.1091 1.3324 -0.1896 -0.3158 0.3585  261 SER A CA  
1403 C C   . SER A 178 ? 1.0983 1.1104 1.3063 -0.1720 -0.2773 0.3443  261 SER A C   
1404 O O   . SER A 178 ? 1.0598 1.0784 1.2741 -0.1658 -0.2581 0.3351  261 SER A O   
1405 C CB  . SER A 178 ? 1.1426 1.0913 1.3172 -0.2036 -0.3299 0.3387  261 SER A CB  
1406 O OG  . SER A 178 ? 1.1182 1.0312 1.2251 -0.2006 -0.3154 0.3156  261 SER A OG  
1407 N N   . GLY A 179 ? 1.1348 1.1505 1.3262 -0.1645 -0.2685 0.3442  262 GLY A N   
1408 C CA  . GLY A 179 ? 1.0793 1.1062 1.2590 -0.1492 -0.2361 0.3323  262 GLY A CA  
1409 C C   . GLY A 179 ? 1.0639 1.0557 1.1892 -0.1511 -0.2216 0.3061  262 GLY A C   
1410 O O   . GLY A 179 ? 0.9748 0.9780 1.1010 -0.1404 -0.1957 0.2953  262 GLY A O   
1411 N N   . LYS A 180 ? 1.0980 1.0464 1.1762 -0.1640 -0.2381 0.2967  263 LYS A N   
1412 C CA  . LYS A 180 ? 1.1987 1.1103 1.2248 -0.1651 -0.2224 0.2731  263 LYS A CA  
1413 C C   . LYS A 180 ? 1.2463 1.1571 1.2853 -0.1646 -0.2146 0.2642  263 LYS A C   
1414 O O   . LYS A 180 ? 1.2898 1.2009 1.3208 -0.1563 -0.1885 0.2501  263 LYS A O   
1415 C CB  . LYS A 180 ? 1.2749 1.1347 1.2397 -0.1773 -0.2411 0.2656  263 LYS A CB  
1416 C CG  . LYS A 180 ? 1.3129 1.1662 1.2536 -0.1765 -0.2439 0.2715  263 LYS A CG  
1417 C CD  . LYS A 180 ? 1.3977 1.1975 1.2738 -0.1885 -0.2662 0.2663  263 LYS A CD  
1418 C CE  . LYS A 180 ? 1.4204 1.2119 1.2694 -0.1868 -0.2672 0.2731  263 LYS A CE  
1419 N NZ  . LYS A 180 ? 1.4683 1.2005 1.2357 -0.1932 -0.2714 0.2608  263 LYS A NZ  
1420 N N   . ALA A 181 ? 1.2227 1.1340 1.2861 -0.1735 -0.2375 0.2740  264 ALA A N   
1421 C CA  . ALA A 181 ? 1.1753 1.0868 1.2565 -0.1729 -0.2316 0.2686  264 ALA A CA  
1422 C C   . ALA A 181 ? 1.0740 1.0314 1.2004 -0.1579 -0.2069 0.2738  264 ALA A C   
1423 O O   . ALA A 181 ? 1.1223 1.0778 1.2481 -0.1519 -0.1894 0.2624  264 ALA A O   
1424 C CB  . ALA A 181 ? 1.2103 1.1170 1.3174 -0.1861 -0.2622 0.2816  264 ALA A CB  
1425 N N   . ALA A 182 ? 0.9869 0.9830 1.1498 -0.1508 -0.2056 0.2910  265 ALA A N   
1426 C CA  . ALA A 182 ? 0.9805 1.0161 1.1783 -0.1352 -0.1833 0.2959  265 ALA A CA  
1427 C C   . ALA A 182 ? 0.9971 1.0280 1.1678 -0.1260 -0.1588 0.2773  265 ALA A C   
1428 O O   . ALA A 182 ? 0.9877 1.0331 1.1719 -0.1170 -0.1425 0.2720  265 ALA A O   
1429 C CB  . ALA A 182 ? 0.9301 1.0014 1.1651 -0.1280 -0.1857 0.3174  265 ALA A CB  
1430 N N   . ASP A 183 ? 1.0533 1.0643 1.1884 -0.1288 -0.1577 0.2694  266 ASP A N   
1431 C CA  . ASP A 183 ? 1.0420 1.0439 1.1513 -0.1232 -0.1360 0.2529  266 ASP A CA  
1432 C C   . ASP A 183 ? 1.0363 1.0170 1.1283 -0.1244 -0.1247 0.2367  266 ASP A C   
1433 O O   . ASP A 183 ? 0.9812 0.9732 1.0811 -0.1161 -0.1052 0.2281  266 ASP A O   
1434 C CB  . ASP A 183 ? 1.1531 1.1301 1.2235 -0.1285 -0.1387 0.2494  266 ASP A CB  
1435 C CG  . ASP A 183 ? 1.1808 1.1803 1.2671 -0.1221 -0.1389 0.2612  266 ASP A CG  
1436 O OD1 . ASP A 183 ? 1.2186 1.2517 1.3423 -0.1121 -0.1342 0.2704  266 ASP A OD1 
1437 O OD2 . ASP A 183 ? 1.1471 1.1270 1.2043 -0.1261 -0.1425 0.2610  266 ASP A OD2 
1438 N N   . VAL A 184 ? 1.0695 1.0183 1.1392 -0.1343 -0.1379 0.2329  267 VAL A N   
1439 C CA  . VAL A 184 ? 1.1136 1.0374 1.1654 -0.1341 -0.1266 0.2178  267 VAL A CA  
1440 C C   . VAL A 184 ? 1.1332 1.0842 1.2275 -0.1264 -0.1192 0.2208  267 VAL A C   
1441 O O   . VAL A 184 ? 1.1691 1.1187 1.2639 -0.1194 -0.1000 0.2098  267 VAL A O   
1442 C CB  . VAL A 184 ? 1.1860 1.0627 1.1980 -0.1463 -0.1447 0.2121  267 VAL A CB  
1443 C CG1 . VAL A 184 ? 1.2560 1.1078 1.2568 -0.1444 -0.1342 0.1987  267 VAL A CG1 
1444 C CG2 . VAL A 184 ? 1.2337 1.0765 1.1914 -0.1509 -0.1446 0.2050  267 VAL A CG2 
1445 N N   . TRP A 185 ? 1.0876 1.0640 1.2193 -0.1270 -0.1333 0.2373  268 TRP A N   
1446 C CA  . TRP A 185 ? 1.0712 1.0754 1.2421 -0.1183 -0.1257 0.2433  268 TRP A CA  
1447 C C   . TRP A 185 ? 1.0078 1.0391 1.1902 -0.1051 -0.1053 0.2393  268 TRP A C   
1448 O O   . TRP A 185 ? 1.0462 1.0841 1.2402 -0.0978 -0.0930 0.2334  268 TRP A O   
1449 C CB  . TRP A 185 ? 1.0748 1.1047 1.2851 -0.1199 -0.1413 0.2655  268 TRP A CB  
1450 C CG  . TRP A 185 ? 0.9965 1.0576 1.2448 -0.1089 -0.1316 0.2751  268 TRP A CG  
1451 C CD1 . TRP A 185 ? 0.9700 1.0632 1.2345 -0.0951 -0.1179 0.2798  268 TRP A CD1 
1452 C CD2 . TRP A 185 ? 1.0242 1.0833 1.2945 -0.1106 -0.1358 0.2812  268 TRP A CD2 
1453 N NE1 . TRP A 185 ? 1.0229 1.1345 1.3152 -0.0874 -0.1131 0.2890  268 TRP A NE1 
1454 C CE2 . TRP A 185 ? 1.0238 1.1162 1.3226 -0.0967 -0.1232 0.2908  268 TRP A CE2 
1455 C CE3 . TRP A 185 ? 1.0725 1.1013 1.3386 -0.1224 -0.1500 0.2794  268 TRP A CE3 
1456 C CZ2 . TRP A 185 ? 0.9615 1.0604 1.2868 -0.0942 -0.1231 0.3006  268 TRP A CZ2 
1457 C CZ3 . TRP A 185 ? 1.0098 1.0446 1.3049 -0.1205 -0.1499 0.2881  268 TRP A CZ3 
1458 C CH2 . TRP A 185 ? 0.9995 1.0704 1.3250 -0.1064 -0.1360 0.2995  268 TRP A CH2 
1459 N N   . SER A 186 ? 1.0107 1.0557 1.1901 -0.1022 -0.1035 0.2425  269 SER A N   
1460 C CA  . SER A 186 ? 1.0300 1.0955 1.2166 -0.0915 -0.0878 0.2374  269 SER A CA  
1461 C C   . SER A 186 ? 1.0353 1.0840 1.2051 -0.0913 -0.0724 0.2202  269 SER A C   
1462 O O   . SER A 186 ? 1.0866 1.1524 1.2738 -0.0830 -0.0615 0.2161  269 SER A O   
1463 C CB  . SER A 186 ? 1.0101 1.0844 1.1910 -0.0897 -0.0892 0.2422  269 SER A CB  
1464 O OG  . SER A 186 ? 1.0104 1.1072 1.2152 -0.0853 -0.0979 0.2598  269 SER A OG  
1465 N N   . LEU A 187 ? 1.0372 1.0521 1.1734 -0.0997 -0.0715 0.2113  270 LEU A N   
1466 C CA  . LEU A 187 ? 1.0639 1.0600 1.1838 -0.0986 -0.0532 0.1967  270 LEU A CA  
1467 C C   . LEU A 187 ? 1.0798 1.0753 1.2164 -0.0940 -0.0468 0.1928  270 LEU A C   
1468 O O   . LEU A 187 ? 1.0836 1.0823 1.2293 -0.0880 -0.0295 0.1849  270 LEU A O   
1469 C CB  . LEU A 187 ? 1.0893 1.0435 1.1619 -0.1072 -0.0525 0.1892  270 LEU A CB  
1470 C CG  . LEU A 187 ? 1.1038 1.0512 1.1530 -0.1114 -0.0543 0.1913  270 LEU A CG  
1471 C CD1 . LEU A 187 ? 1.1969 1.0976 1.1930 -0.1195 -0.0565 0.1849  270 LEU A CD1 
1472 C CD2 . LEU A 187 ? 1.0690 1.0325 1.1306 -0.1057 -0.0351 0.1871  270 LEU A CD2 
1473 N N   . GLY A 188 ? 1.0371 1.0275 1.1803 -0.0971 -0.0609 0.1992  271 GLY A N   
1474 C CA  . GLY A 188 ? 1.0267 1.0168 1.1889 -0.0921 -0.0566 0.1978  271 GLY A CA  
1475 C C   . GLY A 188 ? 0.9766 1.0063 1.1785 -0.0811 -0.0513 0.2043  271 GLY A C   
1476 O O   . GLY A 188 ? 0.9930 1.0274 1.2105 -0.0738 -0.0392 0.1992  271 GLY A O   
1477 N N   . VAL A 189 ? 0.9397 0.9965 1.1566 -0.0791 -0.0604 0.2162  272 VAL A N   
1478 C CA  . VAL A 189 ? 0.9078 0.9980 1.1529 -0.0679 -0.0570 0.2221  272 VAL A CA  
1479 C C   . VAL A 189 ? 0.9189 1.0153 1.1650 -0.0635 -0.0442 0.2109  272 VAL A C   
1480 O O   . VAL A 189 ? 0.9318 1.0441 1.1998 -0.0556 -0.0396 0.2103  272 VAL A O   
1481 C CB  . VAL A 189 ? 0.8910 1.0037 1.1437 -0.0648 -0.0658 0.2356  272 VAL A CB  
1482 C CG1 . VAL A 189 ? 0.8434 0.9837 1.1134 -0.0522 -0.0619 0.2390  272 VAL A CG1 
1483 C CG2 . VAL A 189 ? 0.8889 1.0015 1.1526 -0.0688 -0.0777 0.2505  272 VAL A CG2 
1484 N N   . MET A 190 ? 0.9896 1.0731 1.2143 -0.0692 -0.0395 0.2035  273 MET A N   
1485 C CA  . MET A 190 ? 1.0422 1.1294 1.2708 -0.0674 -0.0267 0.1942  273 MET A CA  
1486 C C   . MET A 190 ? 1.0517 1.1294 1.2898 -0.0650 -0.0124 0.1865  273 MET A C   
1487 O O   . MET A 190 ? 1.0455 1.1420 1.3111 -0.0589 -0.0065 0.1849  273 MET A O   
1488 C CB  . MET A 190 ? 1.0750 1.1451 1.2765 -0.0748 -0.0229 0.1897  273 MET A CB  
1489 C CG  . MET A 190 ? 1.0756 1.1609 1.2770 -0.0739 -0.0318 0.1954  273 MET A CG  
1490 S SD  . MET A 190 ? 1.1765 1.2364 1.3431 -0.0831 -0.0297 0.1931  273 MET A SD  
1491 C CE  . MET A 190 ? 1.1450 1.2251 1.3193 -0.0785 -0.0389 0.2000  273 MET A CE  
1492 N N   . LEU A 191 ? 1.0990 1.1457 1.3139 -0.0694 -0.0075 0.1818  274 LEU A N   
1493 C CA  . LEU A 191 ? 1.1290 1.1606 1.3480 -0.0653 0.0100  0.1740  274 LEU A CA  
1494 C C   . LEU A 191 ? 1.0527 1.1043 1.3084 -0.0563 0.0084  0.1785  274 LEU A C   
1495 O O   . LEU A 191 ? 1.0219 1.0858 1.3045 -0.0495 0.0210  0.1761  274 LEU A O   
1496 C CB  . LEU A 191 ? 1.2035 1.1910 1.3818 -0.0707 0.0134  0.1672  274 LEU A CB  
1497 C CG  . LEU A 191 ? 1.2778 1.2415 1.4526 -0.0645 0.0343  0.1584  274 LEU A CG  
1498 C CD1 . LEU A 191 ? 1.2886 1.2587 1.4736 -0.0601 0.0582  0.1540  274 LEU A CD1 
1499 C CD2 . LEU A 191 ? 1.3514 1.2649 1.4752 -0.0703 0.0328  0.1509  274 LEU A CD2 
1500 N N   . TYR A 192 ? 0.9999 1.0555 1.2596 -0.0563 -0.0069 0.1869  275 TYR A N   
1501 C CA  . TYR A 192 ? 0.9749 1.0507 1.2679 -0.0474 -0.0105 0.1943  275 TYR A CA  
1502 C C   . TYR A 192 ? 0.9546 1.0645 1.2766 -0.0402 -0.0100 0.1966  275 TYR A C   
1503 O O   . TYR A 192 ? 0.9631 1.0834 1.3125 -0.0328 -0.0027 0.1957  275 TYR A O   
1504 C CB  . TYR A 192 ? 0.9378 1.0196 1.2327 -0.0489 -0.0276 0.2069  275 TYR A CB  
1505 C CG  . TYR A 192 ? 0.9345 1.0328 1.2596 -0.0397 -0.0309 0.2167  275 TYR A CG  
1506 C CD1 . TYR A 192 ? 0.9369 1.0676 1.2832 -0.0308 -0.0350 0.2242  275 TYR A CD1 
1507 C CD2 . TYR A 192 ? 0.9563 1.0339 1.2853 -0.0397 -0.0307 0.2184  275 TYR A CD2 
1508 C CE1 . TYR A 192 ? 0.9749 1.1189 1.3449 -0.0217 -0.0385 0.2344  275 TYR A CE1 
1509 C CE2 . TYR A 192 ? 0.9347 1.0264 1.2916 -0.0308 -0.0334 0.2290  275 TYR A CE2 
1510 C CZ  . TYR A 192 ? 0.9695 1.0953 1.3464 -0.0217 -0.0370 0.2376  275 TYR A CZ  
1511 O OH  . TYR A 192 ? 0.9944 1.1336 1.3951 -0.0122 -0.0404 0.2494  275 TYR A OH  
1512 N N   . THR A 193 ? 0.9302 1.0549 1.2453 -0.0425 -0.0184 0.1990  276 THR A N   
1513 C CA  . THR A 193 ? 0.8823 1.0356 1.2182 -0.0362 -0.0246 0.2019  276 THR A CA  
1514 C C   . THR A 193 ? 0.8673 1.0264 1.2214 -0.0364 -0.0143 0.1938  276 THR A C   
1515 O O   . THR A 193 ? 0.8765 1.0570 1.2585 -0.0304 -0.0194 0.1958  276 THR A O   
1516 C CB  . THR A 193 ? 0.8483 1.0091 1.1663 -0.0380 -0.0351 0.2056  276 THR A CB  
1517 O OG1 . THR A 193 ? 0.8595 1.0194 1.1694 -0.0368 -0.0430 0.2163  276 THR A OG1 
1518 C CG2 . THR A 193 ? 0.8605 1.0434 1.1899 -0.0313 -0.0435 0.2066  276 THR A CG2 
1519 N N   . LEU A 194 ? 0.8806 1.0207 1.2196 -0.0434 -0.0010 0.1861  277 LEU A N   
1520 C CA  . LEU A 194 ? 0.9418 1.0864 1.3028 -0.0437 0.0130  0.1807  277 LEU A CA  
1521 C C   . LEU A 194 ? 0.9501 1.0992 1.3428 -0.0357 0.0235  0.1817  277 LEU A C   
1522 O O   . LEU A 194 ? 0.9927 1.1636 1.4240 -0.0321 0.0250  0.1833  277 LEU A O   
1523 C CB  . LEU A 194 ? 0.9630 1.0817 1.2968 -0.0512 0.0295  0.1741  277 LEU A CB  
1524 C CG  . LEU A 194 ? 0.9455 1.0565 1.2497 -0.0593 0.0230  0.1733  277 LEU A CG  
1525 C CD1 . LEU A 194 ? 1.0176 1.0973 1.2890 -0.0654 0.0398  0.1681  277 LEU A CD1 
1526 C CD2 . LEU A 194 ? 0.9167 1.0504 1.2442 -0.0604 0.0166  0.1737  277 LEU A CD2 
1527 N N   . LEU A 195 ? 0.9186 1.0458 1.2967 -0.0333 0.0301  0.1810  278 LEU A N   
1528 C CA  . LEU A 195 ? 0.9281 1.0529 1.3330 -0.0244 0.0438  0.1812  278 LEU A CA  
1529 C C   . LEU A 195 ? 0.9279 1.0769 1.3655 -0.0157 0.0297  0.1903  278 LEU A C   
1530 O O   . LEU A 195 ? 1.0037 1.1666 1.4806 -0.0075 0.0369  0.1932  278 LEU A O   
1531 C CB  . LEU A 195 ? 0.9090 0.9944 1.2813 -0.0245 0.0553  0.1757  278 LEU A CB  
1532 C CG  . LEU A 195 ? 0.9663 1.0199 1.3006 -0.0305 0.0725  0.1664  278 LEU A CG  
1533 C CD1 . LEU A 195 ? 1.0316 1.0414 1.3229 -0.0323 0.0746  0.1604  278 LEU A CD1 
1534 C CD2 . LEU A 195 ? 0.9688 1.0264 1.3284 -0.0248 0.0988  0.1640  278 LEU A CD2 
1535 N N   . VAL A 196 ? 0.8706 1.0239 1.2928 -0.0168 0.0109  0.1964  279 VAL A N   
1536 C CA  . VAL A 196 ? 0.8646 1.0369 1.3092 -0.0081 -0.0025 0.2070  279 VAL A CA  
1537 C C   . VAL A 196 ? 0.8489 1.0522 1.3110 -0.0053 -0.0180 0.2115  279 VAL A C   
1538 O O   . VAL A 196 ? 0.9692 1.1910 1.4624 0.0028  -0.0243 0.2177  279 VAL A O   
1539 C CB  . VAL A 196 ? 0.8618 1.0227 1.2828 -0.0097 -0.0128 0.2140  279 VAL A CB  
1540 C CG1 . VAL A 196 ? 0.8494 1.0290 1.2916 0.0000  -0.0246 0.2271  279 VAL A CG1 
1541 C CG2 . VAL A 196 ? 0.8978 1.0235 1.3004 -0.0137 -0.0020 0.2087  279 VAL A CG2 
1542 N N   . GLY A 197 ? 0.8890 1.0950 1.3296 -0.0117 -0.0251 0.2084  280 GLY A N   
1543 C CA  . GLY A 197 ? 0.9092 1.1368 1.3551 -0.0092 -0.0422 0.2110  280 GLY A CA  
1544 C C   . GLY A 197 ? 0.9183 1.1489 1.3392 -0.0047 -0.0561 0.2193  280 GLY A C   
1545 O O   . GLY A 197 ? 0.9846 1.2267 1.3992 -0.0012 -0.0696 0.2205  280 GLY A O   
1546 N N   . ARG A 198 ? 0.9248 1.1438 1.3316 -0.0043 -0.0526 0.2256  281 ARG A N   
1547 C CA  . ARG A 198 ? 0.9838 1.2059 1.3698 -0.0003 -0.0614 0.2361  281 ARG A CA  
1548 C C   . ARG A 198 ? 0.9087 1.1134 1.2743 -0.0089 -0.0556 0.2363  281 ARG A C   
1549 O O   . ARG A 198 ? 0.8704 1.0577 1.2358 -0.0162 -0.0466 0.2294  281 ARG A O   
1550 C CB  . ARG A 198 ? 1.0992 1.3277 1.4982 0.0090  -0.0654 0.2495  281 ARG A CB  
1551 C CG  . ARG A 198 ? 1.2571 1.5029 1.6748 0.0187  -0.0752 0.2525  281 ARG A CG  
1552 C CD  . ARG A 198 ? 1.4362 1.6860 1.8658 0.0284  -0.0783 0.2676  281 ARG A CD  
1553 N NE  . ARG A 198 ? 1.5247 1.7633 1.9776 0.0267  -0.0679 0.2673  281 ARG A NE  
1554 C CZ  . ARG A 198 ? 1.5785 1.7985 2.0256 0.0213  -0.0598 0.2697  281 ARG A CZ  
1555 N NH1 . ARG A 198 ? 1.6231 1.8371 2.0478 0.0160  -0.0608 0.2745  281 ARG A NH1 
1556 N NH2 . ARG A 198 ? 1.5664 1.7720 2.0315 0.0213  -0.0510 0.2674  281 ARG A NH2 
1557 N N   . TYR A 199 ? 0.8811 1.0894 1.2291 -0.0074 -0.0607 0.2445  282 TYR A N   
1558 C CA  . TYR A 199 ? 0.8421 1.0370 1.1776 -0.0154 -0.0588 0.2485  282 TYR A CA  
1559 C C   . TYR A 199 ? 0.8865 1.0736 1.2351 -0.0162 -0.0585 0.2577  282 TYR A C   
1560 O O   . TYR A 199 ? 0.9172 1.1144 1.2809 -0.0075 -0.0603 0.2669  282 TYR A O   
1561 C CB  . TYR A 199 ? 0.8366 1.0409 1.1585 -0.0112 -0.0629 0.2590  282 TYR A CB  
1562 C CG  . TYR A 199 ? 0.8179 1.0248 1.1229 -0.0103 -0.0639 0.2508  282 TYR A CG  
1563 C CD1 . TYR A 199 ? 0.8315 1.0259 1.1281 -0.0202 -0.0607 0.2381  282 TYR A CD1 
1564 C CD2 . TYR A 199 ? 0.8361 1.0542 1.1297 0.0011  -0.0674 0.2565  282 TYR A CD2 
1565 C CE1 . TYR A 199 ? 0.8733 1.0680 1.1558 -0.0197 -0.0619 0.2315  282 TYR A CE1 
1566 C CE2 . TYR A 199 ? 0.8168 1.0325 1.0926 0.0023  -0.0690 0.2481  282 TYR A CE2 
1567 C CZ  . TYR A 199 ? 0.8380 1.0428 1.1107 -0.0086 -0.0667 0.2359  282 TYR A CZ  
1568 O OH  . TYR A 199 ? 0.8624 1.0628 1.1192 -0.0079 -0.0687 0.2282  282 TYR A OH  
1569 N N   . PRO A 200 ? 0.9119 1.0786 1.2533 -0.0269 -0.0578 0.2558  283 PRO A N   
1570 C CA  . PRO A 200 ? 0.9523 1.1078 1.3055 -0.0292 -0.0603 0.2648  283 PRO A CA  
1571 C C   . PRO A 200 ? 0.9212 1.0938 1.2866 -0.0239 -0.0658 0.2859  283 PRO A C   
1572 O O   . PRO A 200 ? 1.0561 1.2272 1.4385 -0.0214 -0.0669 0.2963  283 PRO A O   
1573 C CB  . PRO A 200 ? 1.0432 1.1709 1.3787 -0.0432 -0.0627 0.2576  283 PRO A CB  
1574 C CG  . PRO A 200 ? 1.0216 1.1553 1.3395 -0.0465 -0.0640 0.2542  283 PRO A CG  
1575 C CD  . PRO A 200 ? 0.9625 1.1142 1.2826 -0.0374 -0.0576 0.2474  283 PRO A CD  
1576 N N   . PHE A 201 ? 0.9038 1.0909 1.2610 -0.0216 -0.0676 0.2930  284 PHE A N   
1577 C CA  . PHE A 201 ? 0.8558 1.0616 1.2229 -0.0131 -0.0680 0.3142  284 PHE A CA  
1578 C C   . PHE A 201 ? 0.8580 1.0802 1.2094 -0.0009 -0.0650 0.3130  284 PHE A C   
1579 O O   . PHE A 201 ? 1.0399 1.2596 1.3752 -0.0038 -0.0649 0.3025  284 PHE A O   
1580 C CB  . PHE A 201 ? 0.8639 1.0684 1.2373 -0.0217 -0.0721 0.3266  284 PHE A CB  
1581 C CG  . PHE A 201 ? 0.8572 1.0379 1.2371 -0.0374 -0.0798 0.3228  284 PHE A CG  
1582 C CD1 . PHE A 201 ? 0.8562 1.0313 1.2585 -0.0406 -0.0836 0.3357  284 PHE A CD1 
1583 C CD2 . PHE A 201 ? 0.8533 1.0133 1.2134 -0.0488 -0.0838 0.3064  284 PHE A CD2 
1584 C CE1 . PHE A 201 ? 0.8621 1.0093 1.2659 -0.0554 -0.0931 0.3304  284 PHE A CE1 
1585 C CE2 . PHE A 201 ? 0.8849 1.0168 1.2422 -0.0627 -0.0925 0.3015  284 PHE A CE2 
1586 C CZ  . PHE A 201 ? 0.8805 1.0047 1.2591 -0.0663 -0.0981 0.3126  284 PHE A CZ  
1587 N N   . HIS A 202 ? 0.9205 1.1557 1.2736 0.0127  -0.0633 0.3235  285 HIS A N   
1588 C CA  . HIS A 202 ? 0.9935 1.2385 1.3252 0.0256  -0.0629 0.3209  285 HIS A CA  
1589 C C   . HIS A 202 ? 0.9502 1.2072 1.2767 0.0414  -0.0587 0.3415  285 HIS A C   
1590 O O   . HIS A 202 ? 0.9335 1.1937 1.2757 0.0448  -0.0578 0.3552  285 HIS A O   
1591 C CB  . HIS A 202 ? 1.0937 1.3372 1.4236 0.0274  -0.0682 0.3052  285 HIS A CB  
1592 C CG  . HIS A 202 ? 1.2828 1.5324 1.5898 0.0394  -0.0727 0.3016  285 HIS A CG  
1593 N ND1 . HIS A 202 ? 1.4187 1.6651 1.7028 0.0403  -0.0725 0.2936  285 HIS A ND1 
1594 C CD2 . HIS A 202 ? 1.3849 1.6401 1.6854 0.0511  -0.0793 0.3047  285 HIS A CD2 
1595 C CE1 . HIS A 202 ? 1.4494 1.6969 1.7119 0.0517  -0.0790 0.2905  285 HIS A CE1 
1596 N NE2 . HIS A 202 ? 1.5033 1.7564 1.7744 0.0582  -0.0843 0.2972  285 HIS A NE2 
1597 N N   . ASP A 203 ? 0.9129 1.1739 1.2151 0.0517  -0.0547 0.3437  286 ASP A N   
1598 C CA  . ASP A 203 ? 0.9468 1.2146 1.2306 0.0704  -0.0489 0.3597  286 ASP A CA  
1599 C C   . ASP A 203 ? 0.9287 1.1916 1.1762 0.0806  -0.0470 0.3510  286 ASP A C   
1600 O O   . ASP A 203 ? 0.9228 1.1809 1.1682 0.0726  -0.0473 0.3395  286 ASP A O   
1601 C CB  . ASP A 203 ? 0.9998 1.2772 1.3040 0.0733  -0.0374 0.3867  286 ASP A CB  
1602 C CG  . ASP A 203 ? 1.0885 1.3716 1.3776 0.0926  -0.0292 0.4065  286 ASP A CG  
1603 O OD1 . ASP A 203 ? 1.1435 1.4269 1.4038 0.1078  -0.0196 0.4122  286 ASP A OD1 
1604 O OD2 . ASP A 203 ? 1.2280 1.5129 1.5310 0.0938  -0.0315 0.4164  286 ASP A OD2 
1605 N N   . SER A 204 ? 0.9459 1.2066 1.1617 0.0987  -0.0455 0.3565  287 SER A N   
1606 C CA  . SER A 204 ? 1.0204 1.2705 1.1950 0.1109  -0.0430 0.3486  287 SER A CA  
1607 C C   . SER A 204 ? 1.0669 1.3210 1.2410 0.1182  -0.0248 0.3640  287 SER A C   
1608 O O   . SER A 204 ? 1.1991 1.4455 1.3596 0.1181  -0.0228 0.3538  287 SER A O   
1609 C CB  . SER A 204 ? 1.0641 1.3051 1.1974 0.1290  -0.0481 0.3494  287 SER A CB  
1610 O OG  . SER A 204 ? 1.1088 1.3585 1.2521 0.1362  -0.0438 0.3700  287 SER A OG  
1611 N N   . ASP A 205 ? 1.1199 1.3867 1.3131 0.1246  -0.0115 0.3901  288 ASP A N   
1612 C CA  . ASP A 205 ? 1.0956 1.3724 1.3044 0.1299  0.0063  0.4101  288 ASP A CA  
1613 C C   . ASP A 205 ? 1.0485 1.3323 1.2995 0.1077  -0.0001 0.4067  288 ASP A C   
1614 O O   . ASP A 205 ? 0.9795 1.2659 1.2588 0.0917  -0.0105 0.4046  288 ASP A O   
1615 C CB  . ASP A 205 ? 1.1522 1.4418 1.3760 0.1411  0.0210  0.4410  288 ASP A CB  
1616 C CG  . ASP A 205 ? 1.2241 1.5283 1.4721 0.1485  0.0419  0.4672  288 ASP A CG  
1617 O OD1 . ASP A 205 ? 1.2370 1.5406 1.4843 0.1489  0.0464  0.4624  288 ASP A OD1 
1618 O OD2 . ASP A 205 ? 1.3017 1.6191 1.5734 0.1542  0.0543  0.4950  288 ASP A OD2 
1619 N N   . PRO A 206 ? 1.0372 1.3210 1.2895 0.1074  0.0051  0.4057  289 PRO A N   
1620 C CA  . PRO A 206 ? 1.0215 1.3109 1.3116 0.0873  -0.0022 0.4061  289 PRO A CA  
1621 C C   . PRO A 206 ? 0.9755 1.2822 1.3137 0.0801  0.0010  0.4330  289 PRO A C   
1622 O O   . PRO A 206 ? 0.8840 1.1889 1.2487 0.0600  -0.0124 0.4292  289 PRO A O   
1623 C CB  . PRO A 206 ? 1.0353 1.3209 1.3130 0.0929  0.0037  0.4024  289 PRO A CB  
1624 C CG  . PRO A 206 ? 1.1094 1.3913 1.3519 0.1187  0.0203  0.4089  289 PRO A CG  
1625 C CD  . PRO A 206 ? 1.0801 1.3534 1.2945 0.1242  0.0146  0.3996  289 PRO A CD  
1626 N N   . SER A 207 ? 0.9804 1.3014 1.3294 0.0960  0.0187  0.4601  290 SER A N   
1627 C CA  . SER A 207 ? 1.0216 1.3604 1.4232 0.0881  0.0213  0.4883  290 SER A CA  
1628 C C   . SER A 207 ? 0.9659 1.3013 1.3814 0.0776  0.0114  0.4888  290 SER A C   
1629 O O   . SER A 207 ? 0.9652 1.3043 1.4217 0.0599  0.0012  0.4980  290 SER A O   
1630 C CB  . SER A 207 ? 1.0060 1.3630 1.4215 0.1084  0.0461  0.5204  290 SER A CB  
1631 O OG  . SER A 207 ? 1.1137 1.4610 1.4772 0.1327  0.0615  0.5142  290 SER A OG  
1632 N N   . ALA A 208 ? 0.9342 1.2603 1.3153 0.0881  0.0124  0.4786  291 ALA A N   
1633 C CA  . ALA A 208 ? 0.9077 1.2279 1.2991 0.0791  0.0019  0.4755  291 ALA A CA  
1634 C C   . ALA A 208 ? 0.8706 1.1770 1.2701 0.0569  -0.0175 0.4510  291 ALA A C   
1635 O O   . ALA A 208 ? 0.7887 1.0906 1.2157 0.0433  -0.0261 0.4542  291 ALA A O   
1636 C CB  . ALA A 208 ? 0.9070 1.2202 1.2588 0.0955  0.0044  0.4689  291 ALA A CB  
1637 N N   . LEU A 209 ? 0.8505 1.1478 1.2244 0.0542  -0.0230 0.4272  292 LEU A N   
1638 C CA  . LEU A 209 ? 0.8459 1.1284 1.2208 0.0357  -0.0375 0.4040  292 LEU A CA  
1639 C C   . LEU A 209 ? 0.8726 1.1544 1.2790 0.0184  -0.0447 0.4122  292 LEU A C   
1640 O O   . LEU A 209 ? 0.8659 1.1335 1.2823 0.0025  -0.0562 0.4028  292 LEU A O   
1641 C CB  . LEU A 209 ? 0.8804 1.1546 1.2220 0.0382  -0.0393 0.3808  292 LEU A CB  
1642 C CG  . LEU A 209 ? 0.8964 1.1547 1.2289 0.0247  -0.0500 0.3544  292 LEU A CG  
1643 C CD1 . LEU A 209 ? 0.9463 1.1993 1.2479 0.0311  -0.0500 0.3360  292 LEU A CD1 
1644 C CD2 . LEU A 209 ? 0.8724 1.1205 1.2183 0.0063  -0.0574 0.3496  292 LEU A CD2 
1645 N N   . PHE A 210 ? 0.8977 1.1932 1.3192 0.0220  -0.0386 0.4304  293 PHE A N   
1646 C CA  . PHE A 210 ? 0.9051 1.2020 1.3608 0.0054  -0.0489 0.4415  293 PHE A CA  
1647 C C   . PHE A 210 ? 0.8993 1.1981 1.3929 -0.0041 -0.0544 0.4598  293 PHE A C   
1648 O O   . PHE A 210 ? 0.8471 1.1330 1.3586 -0.0236 -0.0712 0.4571  293 PHE A O   
1649 C CB  . PHE A 210 ? 0.9174 1.2325 1.3883 0.0133  -0.0403 0.4601  293 PHE A CB  
1650 C CG  . PHE A 210 ? 0.9841 1.2932 1.4211 0.0203  -0.0372 0.4427  293 PHE A CG  
1651 C CD1 . PHE A 210 ? 1.0144 1.3031 1.4273 0.0075  -0.0502 0.4158  293 PHE A CD1 
1652 C CD2 . PHE A 210 ? 1.0205 1.3424 1.4498 0.0405  -0.0196 0.4544  293 PHE A CD2 
1653 C CE1 . PHE A 210 ? 1.0005 1.2830 1.3854 0.0134  -0.0471 0.4018  293 PHE A CE1 
1654 C CE2 . PHE A 210 ? 0.9788 1.2918 1.3771 0.0471  -0.0170 0.4384  293 PHE A CE2 
1655 C CZ  . PHE A 210 ? 0.9951 1.2892 1.3733 0.0327  -0.0316 0.4126  293 PHE A CZ  
1656 N N   . SER A 211 ? 0.9103 1.2217 1.4129 0.0094  -0.0412 0.4781  294 SER A N   
1657 C CA  . SER A 211 ? 0.9415 1.2528 1.4796 0.0012  -0.0454 0.4959  294 SER A CA  
1658 C C   . SER A 211 ? 0.9023 1.1878 1.4293 -0.0109 -0.0589 0.4741  294 SER A C   
1659 O O   . SER A 211 ? 0.9122 1.1874 1.4673 -0.0253 -0.0698 0.4813  294 SER A O   
1660 C CB  . SER A 211 ? 0.9261 1.2560 1.4734 0.0203  -0.0256 0.5226  294 SER A CB  
1661 O OG  . SER A 211 ? 0.9493 1.2725 1.4573 0.0350  -0.0191 0.5094  294 SER A OG  
1662 N N   . LYS A 212 ? 0.8734 1.1474 1.3622 -0.0057 -0.0586 0.4478  295 LYS A N   
1663 C CA  . LYS A 212 ? 0.9064 1.1558 1.3865 -0.0162 -0.0689 0.4267  295 LYS A CA  
1664 C C   . LYS A 212 ? 0.9066 1.1339 1.3775 -0.0342 -0.0825 0.4068  295 LYS A C   
1665 O O   . LYS A 212 ? 1.0490 1.2522 1.5196 -0.0449 -0.0909 0.3951  295 LYS A O   
1666 C CB  . LYS A 212 ? 0.8943 1.1409 1.3432 -0.0044 -0.0636 0.4075  295 LYS A CB  
1667 C CG  . LYS A 212 ? 0.9071 1.1723 1.3433 0.0162  -0.0516 0.4187  295 LYS A CG  
1668 C CD  . LYS A 212 ? 0.8864 1.1464 1.3069 0.0246  -0.0523 0.4063  295 LYS A CD  
1669 C CE  . LYS A 212 ? 0.8722 1.1460 1.2684 0.0446  -0.0440 0.4137  295 LYS A CE  
1670 N NZ  . LYS A 212 ? 0.9201 1.1915 1.3020 0.0541  -0.0478 0.4053  295 LYS A NZ  
1671 N N   . ILE A 213 ? 0.8443 1.0763 1.3020 -0.0355 -0.0834 0.4012  296 ILE A N   
1672 C CA  . ILE A 213 ? 0.8669 1.0775 1.3143 -0.0525 -0.0973 0.3864  296 ILE A CA  
1673 C C   . ILE A 213 ? 0.8714 1.0761 1.3513 -0.0682 -0.1124 0.4034  296 ILE A C   
1674 O O   . ILE A 213 ? 0.8353 1.0104 1.3076 -0.0845 -0.1277 0.3912  296 ILE A O   
1675 C CB  . ILE A 213 ? 0.9003 1.1184 1.3288 -0.0494 -0.0951 0.3801  296 ILE A CB  
1676 C CG1 . ILE A 213 ? 0.9323 1.1498 1.3284 -0.0380 -0.0846 0.3600  296 ILE A CG1 
1677 C CG2 . ILE A 213 ? 0.9055 1.1016 1.3244 -0.0672 -0.1111 0.3700  296 ILE A CG2 
1678 C CD1 . ILE A 213 ? 0.9580 1.1863 1.3384 -0.0301 -0.0789 0.3581  296 ILE A CD1 
1679 N N   . ARG A 214 ? 0.8338 1.0651 1.3491 -0.0633 -0.1081 0.4319  297 ARG A N   
1680 C CA  . ARG A 214 ? 0.8590 1.0900 1.4157 -0.0781 -0.1227 0.4525  297 ARG A CA  
1681 C C   . ARG A 214 ? 0.9181 1.1258 1.4836 -0.0875 -0.1308 0.4499  297 ARG A C   
1682 O O   . ARG A 214 ? 1.0143 1.1979 1.5894 -0.1068 -0.1517 0.4477  297 ARG A O   
1683 C CB  . ARG A 214 ? 0.8788 1.1457 1.4772 -0.0679 -0.1109 0.4865  297 ARG A CB  
1684 C CG  . ARG A 214 ? 0.8762 1.1606 1.4885 -0.0686 -0.1135 0.4974  297 ARG A CG  
1685 C CD  . ARG A 214 ? 0.8644 1.1849 1.5034 -0.0492 -0.0908 0.5263  297 ARG A CD  
1686 N NE  . ARG A 214 ? 0.8760 1.2145 1.5385 -0.0498 -0.0932 0.5407  297 ARG A NE  
1687 C CZ  . ARG A 214 ? 0.9089 1.2783 1.5980 -0.0329 -0.0730 0.5673  297 ARG A CZ  
1688 N NH1 . ARG A 214 ? 0.8781 1.2620 1.5664 -0.0133 -0.0480 0.5815  297 ARG A NH1 
1689 N NH2 . ARG A 214 ? 0.9438 1.3286 1.6585 -0.0342 -0.0769 0.5804  297 ARG A NH2 
1690 N N   . ARG A 215 ? 0.9410 1.1529 1.5012 -0.0740 -0.1161 0.4498  298 ARG A N   
1691 C CA  . ARG A 215 ? 0.9575 1.1459 1.5251 -0.0803 -0.1216 0.4469  298 ARG A CA  
1692 C C   . ARG A 215 ? 1.0140 1.1637 1.5456 -0.0898 -0.1312 0.4149  298 ARG A C   
1693 O O   . ARG A 215 ? 1.0276 1.1465 1.5642 -0.1032 -0.1446 0.4104  298 ARG A O   
1694 C CB  . ARG A 215 ? 0.9597 1.1620 1.5288 -0.0621 -0.1041 0.4550  298 ARG A CB  
1695 C CG  . ARG A 215 ? 1.0569 1.2391 1.6473 -0.0689 -0.1100 0.4615  298 ARG A CG  
1696 C CD  . ARG A 215 ? 1.2003 1.4010 1.8050 -0.0522 -0.0945 0.4815  298 ARG A CD  
1697 N NE  . ARG A 215 ? 1.3788 1.5528 1.9844 -0.0541 -0.0979 0.4736  298 ARG A NE  
1698 C CZ  . ARG A 215 ? 1.4185 1.5634 2.0443 -0.0703 -0.1117 0.4748  298 ARG A CZ  
1699 N NH1 . ARG A 215 ? 1.3225 1.4603 1.9725 -0.0890 -0.1275 0.4843  298 ARG A NH1 
1700 N NH2 . ARG A 215 ? 1.4833 1.6040 2.1055 -0.0674 -0.1110 0.4663  298 ARG A NH2 
1701 N N   . GLY A 216 ? 1.0666 1.2155 1.5611 -0.0823 -0.1234 0.3931  299 GLY A N   
1702 C CA  . GLY A 216 ? 1.0494 1.1628 1.5073 -0.0900 -0.1286 0.3638  299 GLY A CA  
1703 C C   . GLY A 216 ? 1.0145 1.1089 1.4628 -0.0836 -0.1205 0.3501  299 GLY A C   
1704 O O   . GLY A 216 ? 1.0517 1.1153 1.4714 -0.0882 -0.1212 0.3274  299 GLY A O   
1705 N N   . GLN A 217 ? 0.9917 1.1034 1.4639 -0.0725 -0.1121 0.3655  300 GLN A N   
1706 C CA  A GLN A 217 ? 1.0425 1.1422 1.5106 -0.0633 -0.1034 0.3555  300 GLN A CA  
1707 C CA  B GLN A 217 ? 1.0809 1.1840 1.5506 -0.0622 -0.1026 0.3573  300 GLN A CA  
1708 C C   . GLN A 217 ? 1.0549 1.1660 1.4997 -0.0509 -0.0911 0.3382  300 GLN A C   
1709 O O   . GLN A 217 ? 1.0104 1.1517 1.4543 -0.0397 -0.0846 0.3447  300 GLN A O   
1710 C CB  A GLN A 217 ? 1.0798 1.1950 1.5788 -0.0539 -0.0987 0.3785  300 GLN A CB  
1711 C CB  B GLN A 217 ? 1.1751 1.3048 1.6745 -0.0503 -0.0962 0.3834  300 GLN A CB  
1712 C CG  A GLN A 217 ? 1.0683 1.1714 1.5983 -0.0660 -0.1096 0.3979  300 GLN A CG  
1713 C CG  B GLN A 217 ? 1.1721 1.3389 1.6773 -0.0422 -0.0905 0.4017  300 GLN A CG  
1714 C CD  A GLN A 217 ? 1.0561 1.1131 1.5790 -0.0776 -0.1190 0.3820  300 GLN A CD  
1715 C CD  B GLN A 217 ? 1.2142 1.4055 1.7115 -0.0221 -0.0779 0.4069  300 GLN A CD  
1716 O OE1 A GLN A 217 ? 1.0589 1.0890 1.5729 -0.0944 -0.1340 0.3738  300 GLN A OE1 
1717 O OE1 B GLN A 217 ? 1.2131 1.4178 1.6879 -0.0148 -0.0733 0.3972  300 GLN A OE1 
1718 N NE2 A GLN A 217 ? 1.0313 1.0763 1.5556 -0.0676 -0.1107 0.3771  300 GLN A NE2 
1719 N NE2 B GLN A 217 ? 1.1727 1.3683 1.6867 -0.0132 -0.0736 0.4228  300 GLN A NE2 
1720 N N   . PHE A 218 ? 1.0475 1.1312 1.4729 -0.0531 -0.0881 0.3159  301 PHE A N   
1721 C CA  . PHE A 218 ? 1.0562 1.1486 1.4670 -0.0430 -0.0766 0.3000  301 PHE A CA  
1722 C C   . PHE A 218 ? 1.0912 1.1550 1.4976 -0.0410 -0.0694 0.2844  301 PHE A C   
1723 O O   . PHE A 218 ? 1.0656 1.0926 1.4608 -0.0508 -0.0737 0.2767  301 PHE A O   
1724 C CB  . PHE A 218 ? 1.0337 1.1289 1.4191 -0.0483 -0.0765 0.2879  301 PHE A CB  
1725 C CG  . PHE A 218 ? 1.0063 1.0642 1.3642 -0.0599 -0.0781 0.2693  301 PHE A CG  
1726 C CD1 . PHE A 218 ? 1.0029 1.0398 1.3513 -0.0745 -0.0923 0.2720  301 PHE A CD1 
1727 C CD2 . PHE A 218 ? 1.0217 1.0651 1.3628 -0.0560 -0.0654 0.2502  301 PHE A CD2 
1728 C CE1 . PHE A 218 ? 1.0265 1.0242 1.3408 -0.0847 -0.0954 0.2545  301 PHE A CE1 
1729 C CE2 . PHE A 218 ? 1.0450 1.0504 1.3538 -0.0648 -0.0641 0.2336  301 PHE A CE2 
1730 C CZ  . PHE A 218 ? 1.0782 1.0586 1.3694 -0.0791 -0.0798 0.2350  301 PHE A CZ  
1731 N N   . CYS A 219 ? 1.1059 1.1852 1.5208 -0.0279 -0.0591 0.2801  302 CYS A N   
1732 C CA  . CYS A 219 ? 1.1857 1.2441 1.6052 -0.0220 -0.0489 0.2687  302 CYS A CA  
1733 C C   . CYS A 219 ? 1.1187 1.1779 1.5257 -0.0187 -0.0367 0.2507  302 CYS A C   
1734 O O   . CYS A 219 ? 1.1231 1.2126 1.5350 -0.0138 -0.0360 0.2518  302 CYS A O   
1735 C CB  . CYS A 219 ? 1.2722 1.3496 1.7225 -0.0084 -0.0476 0.2830  302 CYS A CB  
1736 S SG  . CYS A 219 ? 1.5398 1.6099 2.0046 0.0041  -0.0326 0.2706  302 CYS A SG  
1737 N N   . ILE A 220 ? 1.0932 1.1170 1.4833 -0.0213 -0.0266 0.2347  303 ILE A N   
1738 C CA  . ILE A 220 ? 1.1282 1.1512 1.5106 -0.0171 -0.0105 0.2197  303 ILE A CA  
1739 C C   . ILE A 220 ? 1.1378 1.1662 1.5512 -0.0027 0.0023  0.2200  303 ILE A C   
1740 O O   . ILE A 220 ? 1.1819 1.1787 1.5944 0.0005  0.0093  0.2162  303 ILE A O   
1741 C CB  . ILE A 220 ? 1.1418 1.1209 1.4832 -0.0258 -0.0029 0.2025  303 ILE A CB  
1742 C CG1 . ILE A 220 ? 1.1141 1.0882 1.4273 -0.0404 -0.0186 0.2037  303 ILE A CG1 
1743 C CG2 . ILE A 220 ? 1.1249 1.1054 1.4622 -0.0201 0.0175  0.1903  303 ILE A CG2 
1744 C CD1 . ILE A 220 ? 1.1286 1.0552 1.3952 -0.0502 -0.0170 0.1887  303 ILE A CD1 
1745 N N   . PRO A 221 ? 1.0823 1.1484 1.5237 0.0059  0.0044  0.2246  304 PRO A N   
1746 C CA  . PRO A 221 ? 1.0991 1.1748 1.5777 0.0200  0.0128  0.2290  304 PRO A CA  
1747 C C   . PRO A 221 ? 1.1097 1.1556 1.5875 0.0255  0.0358  0.2159  304 PRO A C   
1748 O O   . PRO A 221 ? 1.0332 1.0563 1.4806 0.0192  0.0471  0.2023  304 PRO A O   
1749 C CB  . PRO A 221 ? 1.0582 1.1778 1.5621 0.0250  0.0069  0.2346  304 PRO A CB  
1750 C CG  . PRO A 221 ? 1.0093 1.1320 1.4864 0.0143  0.0054  0.2262  304 PRO A CG  
1751 C CD  . PRO A 221 ? 1.0230 1.1218 1.4649 0.0035  -0.0020 0.2260  304 PRO A CD  
1752 N N   . GLU A 222 ? 1.2172 1.2623 1.7272 0.0386  0.0435  0.2212  305 GLU A N   
1753 C CA  . GLU A 222 ? 1.3203 1.3312 1.8291 0.0470  0.0677  0.2104  305 GLU A CA  
1754 C C   . GLU A 222 ? 1.2880 1.3062 1.8016 0.0499  0.0891  0.2008  305 GLU A C   
1755 O O   . GLU A 222 ? 1.3043 1.2850 1.7952 0.0532  0.1116  0.1884  305 GLU A O   
1756 C CB  . GLU A 222 ? 1.4465 1.4568 1.9945 0.0624  0.0720  0.2203  305 GLU A CB  
1757 C CG  . GLU A 222 ? 1.5403 1.6010 2.1422 0.0729  0.0624  0.2371  305 GLU A CG  
1758 C CD  . GLU A 222 ? 1.6154 1.7158 2.2384 0.0722  0.0631  0.2365  305 GLU A CD  
1759 O OE1 . GLU A 222 ? 1.4999 1.6173 2.1022 0.0605  0.0485  0.2356  305 GLU A OE1 
1760 O OE2 . GLU A 222 ? 1.6349 1.7494 2.2985 0.0835  0.0784  0.2378  305 GLU A OE2 
1761 N N   . HIS A 223 ? 1.1736 1.2361 1.7132 0.0485  0.0823  0.2065  306 HIS A N   
1762 C CA  . HIS A 223 ? 1.1539 1.2279 1.7087 0.0507  0.1021  0.2008  306 HIS A CA  
1763 C C   . HIS A 223 ? 1.1408 1.1861 1.6451 0.0399  0.1138  0.1868  306 HIS A C   
1764 O O   . HIS A 223 ? 1.2166 1.2579 1.7263 0.0436  0.1378  0.1814  306 HIS A O   
1765 C CB  . HIS A 223 ? 1.1110 1.2377 1.7104 0.0509  0.0880  0.2110  306 HIS A CB  
1766 C CG  . HIS A 223 ? 1.1091 1.2522 1.6841 0.0378  0.0651  0.2115  306 HIS A CG  
1767 N ND1 . HIS A 223 ? 1.1114 1.2523 1.6624 0.0272  0.0697  0.2030  306 HIS A ND1 
1768 C CD2 . HIS A 223 ? 1.0903 1.2517 1.6616 0.0352  0.0393  0.2205  306 HIS A CD2 
1769 C CE1 . HIS A 223 ? 1.0438 1.2001 1.5783 0.0188  0.0472  0.2059  306 HIS A CE1 
1770 N NE2 . HIS A 223 ? 1.0522 1.2208 1.5973 0.0239  0.0296  0.2163  306 HIS A NE2 
1771 N N   . ILE A 224 ? 1.1656 1.1905 1.6231 0.0275  0.0978  0.1826  307 ILE A N   
1772 C CA  . ILE A 224 ? 1.2006 1.1948 1.6050 0.0166  0.1043  0.1704  307 ILE A CA  
1773 C C   . ILE A 224 ? 1.2364 1.1765 1.6060 0.0222  0.1276  0.1581  307 ILE A C   
1774 O O   . ILE A 224 ? 1.2817 1.1970 1.6490 0.0277  0.1264  0.1575  307 ILE A O   
1775 C CB  . ILE A 224 ? 1.2396 1.2264 1.6086 0.0025  0.0781  0.1717  307 ILE A CB  
1776 C CG1 . ILE A 224 ? 1.1722 1.2068 1.5671 -0.0010 0.0566  0.1835  307 ILE A CG1 
1777 C CG2 . ILE A 224 ? 1.3266 1.2792 1.6402 -0.0083 0.0823  0.1601  307 ILE A CG2 
1778 C CD1 . ILE A 224 ? 1.1303 1.1936 1.5394 -0.0028 0.0610  0.1827  307 ILE A CD1 
1779 N N   . SER A 225 ? 1.2420 1.1605 1.5807 0.0208  0.1485  0.1483  308 SER A N   
1780 C CA  . SER A 225 ? 1.3622 1.2248 1.6599 0.0283  0.1743  0.1355  308 SER A CA  
1781 C C   . SER A 225 ? 1.4908 1.3007 1.7262 0.0186  0.1577  0.1257  308 SER A C   
1782 O O   . SER A 225 ? 1.5081 1.3278 1.7313 0.0043  0.1288  0.1294  308 SER A O   
1783 C CB  . SER A 225 ? 1.3634 1.2155 1.6383 0.0291  0.2010  0.1293  308 SER A CB  
1784 O OG  . SER A 225 ? 1.3492 1.2013 1.5873 0.0130  0.1838  0.1274  308 SER A OG  
1785 N N   . PRO A 226 ? 1.6011 1.3532 1.7972 0.0267  0.1757  0.1133  309 PRO A N   
1786 C CA  . PRO A 226 ? 1.6214 1.3196 1.7575 0.0156  0.1557  0.1033  309 PRO A CA  
1787 C C   . PRO A 226 ? 1.5894 1.2724 1.6716 -0.0005 0.1420  0.0978  309 PRO A C   
1788 O O   . PRO A 226 ? 1.6419 1.3212 1.7088 -0.0156 0.1101  0.1003  309 PRO A O   
1789 C CB  . PRO A 226 ? 1.7169 1.3524 1.8163 0.0298  0.1827  0.0890  309 PRO A CB  
1790 C CG  . PRO A 226 ? 1.7123 1.3806 1.8756 0.0494  0.2097  0.0972  309 PRO A CG  
1791 C CD  . PRO A 226 ? 1.6476 1.3809 1.8574 0.0468  0.2120  0.1092  309 PRO A CD  
1792 N N   . LYS A 227 ? 1.6070 1.2839 1.6655 0.0029  0.1662  0.0927  310 LYS A N   
1793 C CA  . LYS A 227 ? 1.6048 1.2633 1.6085 -0.0107 0.1558  0.0881  310 LYS A CA  
1794 C C   . LYS A 227 ? 1.5348 1.2474 1.5700 -0.0242 0.1290  0.1008  310 LYS A C   
1795 O O   . LYS A 227 ? 1.6070 1.3055 1.6056 -0.0387 0.1046  0.1000  310 LYS A O   
1796 C CB  . LYS A 227 ? 1.6471 1.2878 1.6216 -0.0022 0.1918  0.0822  310 LYS A CB  
1797 C CG  . LYS A 227 ? 1.7608 1.3351 1.6829 0.0115  0.2208  0.0676  310 LYS A CG  
1798 C CD  . LYS A 227 ? 1.8099 1.3823 1.7262 0.0243  0.2642  0.0675  310 LYS A CD  
1799 C CE  . LYS A 227 ? 1.9129 1.4255 1.7887 0.0434  0.3009  0.0552  310 LYS A CE  
1800 N NZ  . LYS A 227 ? 2.0050 1.4367 1.7774 0.0381  0.2924  0.0379  310 LYS A NZ  
1801 N N   . ALA A 228 ? 1.4235 1.1956 1.5251 -0.0190 0.1332  0.1126  311 ALA A N   
1802 C CA  . ALA A 228 ? 1.3370 1.1589 1.4693 -0.0291 0.1088  0.1242  311 ALA A CA  
1803 C C   . ALA A 228 ? 1.3461 1.1764 1.4904 -0.0364 0.0774  0.1314  311 ALA A C   
1804 O O   . ALA A 228 ? 1.2954 1.1453 1.4389 -0.0473 0.0546  0.1384  311 ALA A O   
1805 C CB  . ALA A 228 ? 1.2780 1.1548 1.4736 -0.0213 0.1195  0.1336  311 ALA A CB  
1806 N N   . ARG A 229 ? 1.3789 1.1951 1.5374 -0.0296 0.0777  0.1311  312 ARG A N   
1807 C CA  . ARG A 229 ? 1.3979 1.2214 1.5727 -0.0358 0.0507  0.1402  312 ARG A CA  
1808 C C   . ARG A 229 ? 1.4289 1.2148 1.5556 -0.0514 0.0280  0.1361  312 ARG A C   
1809 O O   . ARG A 229 ? 1.3800 1.1878 1.5207 -0.0614 0.0031  0.1475  312 ARG A O   
1810 C CB  . ARG A 229 ? 1.4807 1.2898 1.6776 -0.0249 0.0581  0.1403  312 ARG A CB  
1811 C CG  . ARG A 229 ? 1.5053 1.3248 1.7279 -0.0295 0.0337  0.1527  312 ARG A CG  
1812 C CD  . ARG A 229 ? 1.5324 1.3314 1.7738 -0.0175 0.0440  0.1519  312 ARG A CD  
1813 N NE  . ARG A 229 ? 1.4888 1.3172 1.7690 -0.0008 0.0678  0.1541  312 ARG A NE  
1814 C CZ  . ARG A 229 ? 1.4525 1.3326 1.7863 0.0060  0.0635  0.1691  312 ARG A CZ  
1815 N NH1 . ARG A 229 ? 1.3857 1.2935 1.7388 -0.0001 0.0399  0.1836  312 ARG A NH1 
1816 N NH2 . ARG A 229 ? 1.4623 1.3657 1.8311 0.0200  0.0833  0.1705  312 ARG A NH2 
1817 N N   . CYS A 230 ? 1.4687 1.1972 1.5387 -0.0530 0.0361  0.1208  313 CYS A N   
1818 C CA  . CYS A 230 ? 1.5827 1.2719 1.6060 -0.0689 0.0100  0.1168  313 CYS A CA  
1819 C C   . CYS A 230 ? 1.6042 1.3051 1.6044 -0.0789 0.0008  0.1190  313 CYS A C   
1820 O O   . CYS A 230 ? 1.6882 1.3757 1.6681 -0.0931 -0.0266 0.1221  313 CYS A O   
1821 C CB  . CYS A 230 ? 1.6903 1.3051 1.6532 -0.0679 0.0157  0.0989  313 CYS A CB  
1822 S SG  . CYS A 230 ? 1.7280 1.2947 1.6142 -0.0648 0.0388  0.0818  313 CYS A SG  
1823 N N   . LEU A 231 ? 1.5762 1.3030 1.5839 -0.0720 0.0224  0.1189  314 LEU A N   
1824 C CA  . LEU A 231 ? 1.4699 1.2108 1.4610 -0.0808 0.0139  0.1227  314 LEU A CA  
1825 C C   . LEU A 231 ? 1.3375 1.1285 1.3745 -0.0869 -0.0092 0.1390  314 LEU A C   
1826 O O   . LEU A 231 ? 1.2894 1.0802 1.3118 -0.0982 -0.0308 0.1445  314 LEU A O   
1827 C CB  . LEU A 231 ? 1.4905 1.2503 1.4870 -0.0724 0.0421  0.1208  314 LEU A CB  
1828 C CG  . LEU A 231 ? 1.4827 1.2607 1.4685 -0.0804 0.0353  0.1261  314 LEU A CG  
1829 C CD1 . LEU A 231 ? 1.5460 1.2788 1.4685 -0.0921 0.0182  0.1214  314 LEU A CD1 
1830 C CD2 . LEU A 231 ? 1.4876 1.2780 1.4804 -0.0722 0.0661  0.1239  314 LEU A CD2 
1831 N N   . ILE A 232 ? 1.2681 1.1000 1.3595 -0.0781 -0.0040 0.1474  315 ILE A N   
1832 C CA  . ILE A 232 ? 1.2027 1.0802 1.3361 -0.0806 -0.0224 0.1635  315 ILE A CA  
1833 C C   . ILE A 232 ? 1.2366 1.0982 1.3657 -0.0914 -0.0484 0.1706  315 ILE A C   
1834 O O   . ILE A 232 ? 1.2281 1.1070 1.3621 -0.0997 -0.0667 0.1812  315 ILE A O   
1835 C CB  . ILE A 232 ? 1.1515 1.0673 1.3366 -0.0681 -0.0129 0.1707  315 ILE A CB  
1836 C CG1 . ILE A 232 ? 1.1249 1.0674 1.3247 -0.0604 0.0057  0.1678  315 ILE A CG1 
1837 C CG2 . ILE A 232 ? 1.1087 1.0609 1.3282 -0.0695 -0.0318 0.1880  315 ILE A CG2 
1838 C CD1 . ILE A 232 ? 1.1053 1.0755 1.3500 -0.0476 0.0171  0.1714  315 ILE A CD1 
1839 N N   . ARG A 233 ? 1.3026 1.1306 1.4249 -0.0913 -0.0499 0.1655  316 ARG A N   
1840 C CA  . ARG A 233 ? 1.3832 1.1940 1.5067 -0.1033 -0.0765 0.1730  316 ARG A CA  
1841 C C   . ARG A 233 ? 1.3717 1.1460 1.4485 -0.1187 -0.0969 0.1680  316 ARG A C   
1842 O O   . ARG A 233 ? 1.3939 1.1712 1.4838 -0.1307 -0.1230 0.1799  316 ARG A O   
1843 C CB  . ARG A 233 ? 1.5141 1.2972 1.6458 -0.0994 -0.0743 0.1695  316 ARG A CB  
1844 C CG  . ARG A 233 ? 1.5781 1.4064 1.7678 -0.0890 -0.0687 0.1846  316 ARG A CG  
1845 C CD  . ARG A 233 ? 1.7317 1.5385 1.9385 -0.0890 -0.0754 0.1886  316 ARG A CD  
1846 N NE  . ARG A 233 ? 1.9391 1.7062 2.1243 -0.0789 -0.0554 0.1715  316 ARG A NE  
1847 C CZ  . ARG A 233 ? 2.0250 1.8041 2.2394 -0.0633 -0.0364 0.1725  316 ARG A CZ  
1848 N NH1 . ARG A 233 ? 1.9559 1.7848 2.2212 -0.0555 -0.0362 0.1898  316 ARG A NH1 
1849 N NH2 . ARG A 233 ? 2.0692 1.8072 2.2598 -0.0540 -0.0169 0.1564  316 ARG A NH2 
1850 N N   . SER A 234 ? 1.3501 1.0927 1.3759 -0.1181 -0.0854 0.1528  317 SER A N   
1851 C CA  . SER A 234 ? 1.3920 1.1055 1.3712 -0.1313 -0.1046 0.1497  317 SER A CA  
1852 C C   . SER A 234 ? 1.3698 1.1276 1.3725 -0.1364 -0.1169 0.1651  317 SER A C   
1853 O O   . SER A 234 ? 1.4330 1.1777 1.4185 -0.1492 -0.1421 0.1702  317 SER A O   
1854 C CB  . SER A 234 ? 1.4366 1.1090 1.3543 -0.1268 -0.0844 0.1319  317 SER A CB  
1855 O OG  . SER A 234 ? 1.5424 1.1685 1.4313 -0.1194 -0.0684 0.1165  317 SER A OG  
1856 N N   . LEU A 235 ? 1.3475 1.1553 1.3881 -0.1262 -0.1002 0.1724  318 LEU A N   
1857 C CA  . LEU A 235 ? 1.3026 1.1493 1.3628 -0.1285 -0.1084 0.1856  318 LEU A CA  
1858 C C   . LEU A 235 ? 1.2651 1.1537 1.3799 -0.1289 -0.1225 0.2056  318 LEU A C   
1859 O O   . LEU A 235 ? 1.1705 1.0754 1.2968 -0.1356 -0.1399 0.2190  318 LEU A O   
1860 C CB  . LEU A 235 ? 1.2960 1.1683 1.3617 -0.1176 -0.0835 0.1815  318 LEU A CB  
1861 C CG  . LEU A 235 ? 1.3516 1.1901 1.3730 -0.1144 -0.0622 0.1649  318 LEU A CG  
1862 C CD1 . LEU A 235 ? 1.2786 1.1492 1.3186 -0.1057 -0.0407 0.1647  318 LEU A CD1 
1863 C CD2 . LEU A 235 ? 1.4031 1.1987 1.3675 -0.1249 -0.0743 0.1596  318 LEU A CD2 
1864 N N   . LEU A 236 ? 1.2149 1.1200 1.3634 -0.1209 -0.1141 0.2091  319 LEU A N   
1865 C CA  . LEU A 236 ? 1.1906 1.1326 1.3878 -0.1195 -0.1236 0.2293  319 LEU A CA  
1866 C C   . LEU A 236 ? 1.1905 1.1102 1.3968 -0.1313 -0.1453 0.2370  319 LEU A C   
1867 O O   . LEU A 236 ? 1.2066 1.1394 1.4472 -0.1280 -0.1453 0.2473  319 LEU A O   
1868 C CB  . LEU A 236 ? 1.1536 1.1258 1.3818 -0.1045 -0.1049 0.2316  319 LEU A CB  
1869 C CG  . LEU A 236 ? 1.1429 1.1383 1.3684 -0.0941 -0.0868 0.2249  319 LEU A CG  
1870 C CD1 . LEU A 236 ? 1.1173 1.1414 1.3743 -0.0803 -0.0742 0.2285  319 LEU A CD1 
1871 C CD2 . LEU A 236 ? 1.1146 1.1346 1.3423 -0.0955 -0.0932 0.2341  319 LEU A CD2 
1872 N N   . ARG A 237 ? 1.2638 1.1488 1.4395 -0.1457 -0.1656 0.2329  320 ARG A N   
1873 C CA  . ARG A 237 ? 1.2928 1.1554 1.4788 -0.1604 -0.1925 0.2413  320 ARG A CA  
1874 C C   . ARG A 237 ? 1.2482 1.1533 1.4826 -0.1650 -0.2075 0.2674  320 ARG A C   
1875 O O   . ARG A 237 ? 1.1312 1.0635 1.3686 -0.1615 -0.2046 0.2738  320 ARG A O   
1876 C CB  . ARG A 237 ? 1.3701 1.1769 1.5014 -0.1747 -0.2125 0.2271  320 ARG A CB  
1877 C CG  . ARG A 237 ? 1.4852 1.2417 1.5607 -0.1695 -0.1963 0.2012  320 ARG A CG  
1878 C CD  . ARG A 237 ? 1.5681 1.2866 1.6426 -0.1732 -0.2031 0.1951  320 ARG A CD  
1879 N NE  . ARG A 237 ? 1.7424 1.4177 1.7723 -0.1631 -0.1801 0.1719  320 ARG A NE  
1880 C CZ  . ARG A 237 ? 1.8755 1.4878 1.8371 -0.1670 -0.1825 0.1515  320 ARG A CZ  
1881 N NH1 . ARG A 237 ? 1.9134 1.4924 1.8364 -0.1828 -0.2118 0.1496  320 ARG A NH1 
1882 N NH2 . ARG A 237 ? 1.9403 1.5207 1.8707 -0.1537 -0.1547 0.1333  320 ARG A NH2 
1883 N N   . ARG A 238 ? 1.3083 1.2163 1.5809 -0.1727 -0.2229 0.2832  321 ARG A N   
1884 C CA  . ARG A 238 ? 1.3181 1.2707 1.6466 -0.1748 -0.2321 0.3120  321 ARG A CA  
1885 C C   . ARG A 238 ? 1.3005 1.2456 1.6241 -0.1898 -0.2592 0.3190  321 ARG A C   
1886 O O   . ARG A 238 ? 1.1904 1.1729 1.5383 -0.1859 -0.2581 0.3350  321 ARG A O   
1887 C CB  . ARG A 238 ? 1.4285 1.3858 1.8031 -0.1795 -0.2397 0.3292  321 ARG A CB  
1888 C CG  . ARG A 238 ? 1.5516 1.4948 1.9206 -0.1697 -0.2219 0.3183  321 ARG A CG  
1889 C CD  . ARG A 238 ? 1.6349 1.6190 2.0188 -0.1484 -0.1924 0.3222  321 ARG A CD  
1890 N NE  . ARG A 238 ? 1.6646 1.6987 2.0818 -0.1416 -0.1875 0.3445  321 ARG A NE  
1891 C CZ  . ARG A 238 ? 1.5912 1.6514 2.0581 -0.1445 -0.1941 0.3725  321 ARG A CZ  
1892 N NH1 . ARG A 238 ? 1.6246 1.6675 2.1173 -0.1559 -0.2083 0.3824  321 ARG A NH1 
1893 N NH2 . ARG A 238 ? 1.4774 1.5801 1.9696 -0.1356 -0.1857 0.3917  321 ARG A NH2 
1894 N N   . GLU A 239 ? 1.3855 1.2795 1.6756 -0.2063 -0.2841 0.3069  322 GLU A N   
1895 C CA  . GLU A 239 ? 1.4808 1.3606 1.7591 -0.2219 -0.3146 0.3118  322 GLU A CA  
1896 C C   . GLU A 239 ? 1.4434 1.3103 1.6646 -0.2150 -0.3029 0.2936  322 GLU A C   
1897 O O   . GLU A 239 ? 1.4497 1.2812 1.6177 -0.2094 -0.2871 0.2690  322 GLU A O   
1898 C CB  . GLU A 239 ? 1.6601 1.4875 1.9225 -0.2438 -0.3518 0.3075  322 GLU A CB  
1899 C CG  . GLU A 239 ? 1.8318 1.5916 2.0252 -0.2464 -0.3516 0.2768  322 GLU A CG  
1900 C CD  . GLU A 239 ? 1.9364 1.6894 2.1414 -0.2370 -0.3299 0.2698  322 GLU A CD  
1901 O OE1 . GLU A 239 ? 1.7955 1.5494 1.9763 -0.2195 -0.2964 0.2541  322 GLU A OE1 
1902 O OE2 . GLU A 239 ? 1.9842 1.7304 2.2262 -0.2478 -0.3478 0.2815  322 GLU A OE2 
1903 N N   . PRO A 240 ? 1.3614 1.2582 1.5967 -0.2141 -0.3078 0.3073  323 PRO A N   
1904 C CA  . PRO A 240 ? 1.3644 1.2519 1.5505 -0.2071 -0.2952 0.2927  323 PRO A CA  
1905 C C   . PRO A 240 ? 1.4450 1.2700 1.5584 -0.2178 -0.3107 0.2715  323 PRO A C   
1906 O O   . PRO A 240 ? 1.5349 1.3401 1.5982 -0.2094 -0.2896 0.2526  323 PRO A O   
1907 C CB  . PRO A 240 ? 1.2846 1.2126 1.5067 -0.2065 -0.3041 0.3153  323 PRO A CB  
1908 C CG  . PRO A 240 ? 1.2070 1.1806 1.5019 -0.2031 -0.3020 0.3401  323 PRO A CG  
1909 C CD  . PRO A 240 ? 1.2653 1.2106 1.5670 -0.2159 -0.3188 0.3381  323 PRO A CD  
1910 N N   . SER A 241 ? 1.5078 1.3008 1.6151 -0.2361 -0.3473 0.2753  324 SER A N   
1911 C CA  . SER A 241 ? 1.5660 1.2932 1.5971 -0.2471 -0.3672 0.2560  324 SER A CA  
1912 C C   . SER A 241 ? 1.6202 1.2969 1.5961 -0.2419 -0.3485 0.2286  324 SER A C   
1913 O O   . SER A 241 ? 1.5628 1.1864 1.4639 -0.2435 -0.3496 0.2091  324 SER A O   
1914 C CB  . SER A 241 ? 1.6372 1.3424 1.6795 -0.2692 -0.4158 0.2679  324 SER A CB  
1915 O OG  . SER A 241 ? 1.6223 1.3421 1.7228 -0.2755 -0.4248 0.2800  324 SER A OG  
1916 N N   . GLU A 242 ? 1.6854 1.3776 1.6972 -0.2346 -0.3301 0.2283  325 GLU A N   
1917 C CA  . GLU A 242 ? 1.7270 1.3773 1.6956 -0.2263 -0.3075 0.2042  325 GLU A CA  
1918 C C   . GLU A 242 ? 1.6032 1.2649 1.5464 -0.2077 -0.2667 0.1914  325 GLU A C   
1919 O O   . GLU A 242 ? 1.6127 1.2302 1.5025 -0.2014 -0.2491 0.1701  325 GLU A O   
1920 C CB  . GLU A 242 ? 1.7622 1.4240 1.7793 -0.2244 -0.3027 0.2095  325 GLU A CB  
1921 C CG  . GLU A 242 ? 1.9223 1.5393 1.9367 -0.2433 -0.3396 0.2099  325 GLU A CG  
1922 C CD  . GLU A 242 ? 2.1305 1.6676 2.0700 -0.2452 -0.3409 0.1816  325 GLU A CD  
1923 O OE1 . GLU A 242 ? 2.2894 1.7959 2.1648 -0.2348 -0.3190 0.1612  325 GLU A OE1 
1924 O OE2 . GLU A 242 ? 2.2621 1.7636 2.2064 -0.2572 -0.3641 0.1802  325 GLU A OE2 
1925 N N   . ARG A 243 ? 1.4779 1.1961 1.4587 -0.1989 -0.2519 0.2045  326 ARG A N   
1926 C CA  . ARG A 243 ? 1.3608 1.0942 1.3271 -0.1829 -0.2156 0.1945  326 ARG A CA  
1927 C C   . ARG A 243 ? 1.4081 1.0981 1.3028 -0.1837 -0.2107 0.1791  326 ARG A C   
1928 O O   . ARG A 243 ? 1.5352 1.1974 1.3966 -0.1959 -0.2377 0.1810  326 ARG A O   
1929 C CB  . ARG A 243 ? 1.2483 1.0440 1.2636 -0.1757 -0.2072 0.2117  326 ARG A CB  
1930 C CG  . ARG A 243 ? 1.1903 1.0328 1.2731 -0.1708 -0.2053 0.2283  326 ARG A CG  
1931 C CD  . ARG A 243 ? 1.0865 0.9828 1.2088 -0.1635 -0.1993 0.2452  326 ARG A CD  
1932 N NE  . ARG A 243 ? 1.0587 0.9911 1.2395 -0.1629 -0.2067 0.2659  326 ARG A NE  
1933 C CZ  . ARG A 243 ? 1.0637 1.0373 1.2844 -0.1601 -0.2109 0.2866  326 ARG A CZ  
1934 N NH1 . ARG A 243 ? 1.0759 1.0603 1.2858 -0.1579 -0.2103 0.2892  326 ARG A NH1 
1935 N NH2 . ARG A 243 ? 1.0406 1.0435 1.3131 -0.1588 -0.2143 0.3063  326 ARG A NH2 
1936 N N   . LEU A 244 ? 1.3806 1.0651 1.2528 -0.1707 -0.1765 0.1655  327 LEU A N   
1937 C CA  . LEU A 244 ? 1.4780 1.1233 1.2831 -0.1694 -0.1656 0.1529  327 LEU A CA  
1938 C C   . LEU A 244 ? 1.4571 1.1312 1.2680 -0.1713 -0.1709 0.1651  327 LEU A C   
1939 O O   . LEU A 244 ? 1.3734 1.1023 1.2419 -0.1681 -0.1703 0.1799  327 LEU A O   
1940 C CB  . LEU A 244 ? 1.5338 1.1708 1.3240 -0.1542 -0.1244 0.1384  327 LEU A CB  
1941 C CG  . LEU A 244 ? 1.6133 1.2160 1.3913 -0.1486 -0.1125 0.1245  327 LEU A CG  
1942 C CD1 . LEU A 244 ? 1.6024 1.2190 1.3928 -0.1317 -0.0706 0.1171  327 LEU A CD1 
1943 C CD2 . LEU A 244 ? 1.7276 1.2535 1.4261 -0.1554 -0.1252 0.1091  327 LEU A CD2 
1944 N N   . THR A 245 ? 1.5186 1.1514 1.2659 -0.1759 -0.1762 0.1591  328 THR A N   
1945 C CA  . THR A 245 ? 1.5153 1.1668 1.2574 -0.1752 -0.1740 0.1682  328 THR A CA  
1946 C C   . THR A 245 ? 1.5424 1.2079 1.2852 -0.1615 -0.1324 0.1609  328 THR A C   
1947 O O   . THR A 245 ? 1.5339 1.1782 1.2589 -0.1538 -0.1074 0.1472  328 THR A O   
1948 C CB  . THR A 245 ? 1.5576 1.1596 1.2297 -0.1845 -0.1948 0.1665  328 THR A CB  
1949 O OG1 . THR A 245 ? 1.6687 1.2154 1.2690 -0.1794 -0.1731 0.1483  328 THR A OG1 
1950 C CG2 . THR A 245 ? 1.5706 1.1513 1.2367 -0.1997 -0.2392 0.1725  328 THR A CG2 
1951 N N   . ALA A 246 ? 1.5595 1.2606 1.3262 -0.1583 -0.1252 0.1710  329 ALA A N   
1952 C CA  . ALA A 246 ? 1.5726 1.2897 1.3469 -0.1475 -0.0892 0.1662  329 ALA A CA  
1953 C C   . ALA A 246 ? 1.6599 1.3250 1.3651 -0.1450 -0.0677 0.1539  329 ALA A C   
1954 O O   . ALA A 246 ? 1.7316 1.3983 1.4415 -0.1355 -0.0346 0.1461  329 ALA A O   
1955 C CB  . ALA A 246 ? 1.4735 1.2321 1.2823 -0.1458 -0.0892 0.1791  329 ALA A CB  
1956 N N   . PRO A 247 ? 1.7227 1.3415 1.3642 -0.1528 -0.0860 0.1533  330 PRO A N   
1957 C CA  . PRO A 247 ? 1.7504 1.3114 1.3162 -0.1493 -0.0659 0.1410  330 PRO A CA  
1958 C C   . PRO A 247 ? 1.7455 1.2754 1.2917 -0.1424 -0.0470 0.1251  330 PRO A C   
1959 O O   . PRO A 247 ? 1.6940 1.2033 1.2130 -0.1322 -0.0104 0.1171  330 PRO A O   
1960 C CB  . PRO A 247 ? 1.8148 1.3316 1.3193 -0.1608 -0.1010 0.1437  330 PRO A CB  
1961 C CG  . PRO A 247 ? 1.7965 1.3597 1.3498 -0.1669 -0.1249 0.1620  330 PRO A CG  
1962 C CD  . PRO A 247 ? 1.7719 1.3997 1.4121 -0.1613 -0.1145 0.1676  330 PRO A CD  
1963 N N   . GLU A 248 ? 1.7550 1.2818 1.3180 -0.1473 -0.0699 0.1219  331 GLU A N   
1964 C CA  . GLU A 248 ? 1.7899 1.2806 1.3308 -0.1408 -0.0548 0.1064  331 GLU A CA  
1965 C C   . GLU A 248 ? 1.7089 1.2451 1.3183 -0.1291 -0.0263 0.1061  331 GLU A C   
1966 O O   . GLU A 248 ? 1.7531 1.2639 1.3455 -0.1184 0.0015  0.0945  331 GLU A O   
1967 C CB  . GLU A 248 ? 1.8583 1.3076 1.3697 -0.1521 -0.0924 0.1007  331 GLU A CB  
1968 C CG  . GLU A 248 ? 1.8522 1.3439 1.4323 -0.1617 -0.1248 0.1125  331 GLU A CG  
1969 C CD  . GLU A 248 ? 1.9083 1.3593 1.4561 -0.1782 -0.1711 0.1124  331 GLU A CD  
1970 O OE1 . GLU A 248 ? 1.9915 1.3761 1.4569 -0.1822 -0.1808 0.1007  331 GLU A OE1 
1971 O OE2 . GLU A 248 ? 1.8257 1.3099 1.4303 -0.1875 -0.1993 0.1251  331 GLU A OE2 
1972 N N   . ILE A 249 ? 1.6416 1.2428 1.3249 -0.1294 -0.0306 0.1191  332 ILE A N   
1973 C CA  . ILE A 249 ? 1.5437 1.1884 1.2879 -0.1178 -0.0032 0.1198  332 ILE A CA  
1974 C C   . ILE A 249 ? 1.5864 1.2191 1.3109 -0.1073 0.0366  0.1140  332 ILE A C   
1975 O O   . ILE A 249 ? 1.6498 1.2815 1.3898 -0.0965 0.0629  0.1076  332 ILE A O   
1976 C CB  . ILE A 249 ? 1.4403 1.1511 1.2538 -0.1186 -0.0111 0.1341  332 ILE A CB  
1977 C CG1 . ILE A 249 ? 1.4655 1.1966 1.3110 -0.1262 -0.0443 0.1431  332 ILE A CG1 
1978 C CG2 . ILE A 249 ? 1.3788 1.1283 1.2467 -0.1070 0.0157  0.1338  332 ILE A CG2 
1979 C CD1 . ILE A 249 ? 1.3981 1.1850 1.2966 -0.1265 -0.0537 0.1577  332 ILE A CD1 
1980 N N   . LEU A 250 ? 1.6009 1.2252 1.2943 -0.1104 0.0413  0.1181  333 LEU A N   
1981 C CA  . LEU A 250 ? 1.6447 1.2598 1.3220 -0.1016 0.0803  0.1164  333 LEU A CA  
1982 C C   . LEU A 250 ? 1.7360 1.2968 1.3598 -0.0915 0.1091  0.1034  333 LEU A C   
1983 O O   . LEU A 250 ? 1.6958 1.2582 1.3256 -0.0811 0.1477  0.1035  333 LEU A O   
1984 C CB  . LEU A 250 ? 1.6745 1.2782 1.3146 -0.1079 0.0766  0.1237  333 LEU A CB  
1985 C CG  . LEU A 250 ? 1.6331 1.2897 1.3262 -0.1132 0.0640  0.1371  333 LEU A CG  
1986 C CD1 . LEU A 250 ? 1.6921 1.3249 1.3366 -0.1188 0.0598  0.1436  333 LEU A CD1 
1987 C CD2 . LEU A 250 ? 1.5431 1.2480 1.3041 -0.1061 0.0896  0.1406  333 LEU A CD2 
1988 N N   . LEU A 251 ? 1.8302 1.3413 1.4012 -0.0948 0.0901  0.0932  334 LEU A N   
1989 C CA  . LEU A 251 ? 1.9225 1.3714 1.4313 -0.0847 0.1133  0.0786  334 LEU A CA  
1990 C C   . LEU A 251 ? 1.8670 1.3161 1.4070 -0.0784 0.1142  0.0705  334 LEU A C   
1991 O O   . LEU A 251 ? 1.9684 1.3581 1.4512 -0.0730 0.1204  0.0567  334 LEU A O   
1992 C CB  . LEU A 251 ? 2.0538 1.4329 1.4661 -0.0933 0.0884  0.0707  334 LEU A CB  
1993 C CG  . LEU A 251 ? 2.1228 1.4968 1.4987 -0.1031 0.0723  0.0802  334 LEU A CG  
1994 C CD1 . LEU A 251 ? 2.2088 1.5153 1.4960 -0.1130 0.0380  0.0725  334 LEU A CD1 
1995 C CD2 . LEU A 251 ? 2.1461 1.5172 1.5039 -0.0929 0.1157  0.0846  334 LEU A CD2 
1996 N N   . HIS A 252 ? 1.7558 1.2668 1.3813 -0.0784 0.1080  0.0788  335 HIS A N   
1997 C CA  . HIS A 252 ? 1.7795 1.2907 1.4353 -0.0731 0.1055  0.0733  335 HIS A CA  
1998 C C   . HIS A 252 ? 1.8047 1.3274 1.4934 -0.0548 0.1497  0.0710  335 HIS A C   
1999 O O   . HIS A 252 ? 1.8417 1.4153 1.5858 -0.0506 0.1674  0.0810  335 HIS A O   
2000 C CB  . HIS A 252 ? 1.7157 1.2811 1.4394 -0.0825 0.0723  0.0845  335 HIS A CB  
2001 C CG  . HIS A 252 ? 1.7632 1.3428 1.5340 -0.0750 0.0753  0.0832  335 HIS A CG  
2002 N ND1 . HIS A 252 ? 1.7638 1.3214 1.5301 -0.0811 0.0490  0.0800  335 HIS A ND1 
2003 C CD2 . HIS A 252 ? 1.7438 1.3584 1.5705 -0.0618 0.1015  0.0861  335 HIS A CD2 
2004 C CE1 . HIS A 252 ? 1.7252 1.3029 1.5406 -0.0711 0.0608  0.0811  335 HIS A CE1 
2005 N NE2 . HIS A 252 ? 1.7138 1.3261 1.5656 -0.0589 0.0921  0.0847  335 HIS A NE2 
2006 N N   . PRO A 253 ? 1.8727 1.3481 1.5311 -0.0438 0.1662  0.0585  336 PRO A N   
2007 C CA  . PRO A 253 ? 1.8604 1.3355 1.5409 -0.0240 0.2116  0.0559  336 PRO A CA  
2008 C C   . PRO A 253 ? 1.7714 1.3216 1.5485 -0.0174 0.2283  0.0697  336 PRO A C   
2009 O O   . PRO A 253 ? 1.7658 1.3255 1.5592 -0.0055 0.2664  0.0732  336 PRO A O   
2010 C CB  . PRO A 253 ? 1.8937 1.3302 1.5612 -0.0183 0.2055  0.0446  336 PRO A CB  
2011 C CG  . PRO A 253 ? 1.9785 1.3538 1.5632 -0.0315 0.1739  0.0339  336 PRO A CG  
2012 C CD  . PRO A 253 ? 1.9317 1.3466 1.5321 -0.0498 0.1405  0.0459  336 PRO A CD  
2013 N N   . TRP A 254 ? 1.6958 1.2970 1.5356 -0.0247 0.1997  0.0783  337 TRP A N   
2014 C CA  . TRP A 254 ? 1.5767 1.2476 1.5041 -0.0202 0.2077  0.0912  337 TRP A CA  
2015 C C   . TRP A 254 ? 1.5455 1.2409 1.4908 -0.0175 0.2347  0.0983  337 TRP A C   
2016 O O   . TRP A 254 ? 1.5598 1.2808 1.5555 -0.0056 0.2630  0.1034  337 TRP A O   
2017 C CB  . TRP A 254 ? 1.4786 1.1973 1.4499 -0.0325 0.1690  0.1007  337 TRP A CB  
2018 C CG  . TRP A 254 ? 1.3943 1.1770 1.4473 -0.0273 0.1736  0.1121  337 TRP A CG  
2019 C CD1 . TRP A 254 ? 1.3826 1.1842 1.4858 -0.0139 0.1915  0.1147  337 TRP A CD1 
2020 C CD2 . TRP A 254 ? 1.3241 1.1573 1.4158 -0.0351 0.1587  0.1224  337 TRP A CD2 
2021 N NE1 . TRP A 254 ? 1.2885 1.1497 1.4590 -0.0139 0.1860  0.1261  337 TRP A NE1 
2022 C CE2 . TRP A 254 ? 1.2734 1.1530 1.4357 -0.0268 0.1661  0.1300  337 TRP A CE2 
2023 C CE3 . TRP A 254 ? 1.2983 1.1401 1.3712 -0.0478 0.1388  0.1259  337 TRP A CE3 
2024 C CZ2 . TRP A 254 ? 1.2582 1.1882 1.4670 -0.0315 0.1530  0.1393  337 TRP A CZ2 
2025 C CZ3 . TRP A 254 ? 1.2514 1.1430 1.3716 -0.0511 0.1289  0.1351  337 TRP A CZ3 
2026 C CH2 . TRP A 254 ? 1.2224 1.1561 1.4076 -0.0433 0.1353  0.1409  337 TRP A CH2 
2027 N N   . PHE A 255 ? 1.5294 1.2156 1.4354 -0.0285 0.2259  0.0996  338 PHE A N   
2028 C CA  . PHE A 255 ? 1.5514 1.2640 1.4786 -0.0289 0.2466  0.1086  338 PHE A CA  
2029 C C   . PHE A 255 ? 1.6296 1.3211 1.5490 -0.0141 0.2954  0.1080  338 PHE A C   
2030 O O   . PHE A 255 ? 1.5796 1.3126 1.5637 -0.0084 0.3174  0.1179  338 PHE A O   
2031 C CB  . PHE A 255 ? 1.5285 1.2267 1.4066 -0.0427 0.2279  0.1102  338 PHE A CB  
2032 C CG  . PHE A 255 ? 1.4344 1.1667 1.3375 -0.0557 0.1860  0.1154  338 PHE A CG  
2033 C CD1 . PHE A 255 ? 1.3783 1.1691 1.3487 -0.0587 0.1787  0.1255  338 PHE A CD1 
2034 C CD2 . PHE A 255 ? 1.4433 1.1487 1.3043 -0.0644 0.1539  0.1108  338 PHE A CD2 
2035 C CE1 . PHE A 255 ? 1.3333 1.1529 1.3233 -0.0680 0.1438  0.1306  338 PHE A CE1 
2036 C CE2 . PHE A 255 ? 1.4130 1.1519 1.3017 -0.0746 0.1192  0.1180  338 PHE A CE2 
2037 C CZ  . PHE A 255 ? 1.3641 1.1592 1.3149 -0.0753 0.1159  0.1277  338 PHE A CZ  
2038 N N   . GLU A 256 ? 1.7639 1.3895 1.6045 -0.0075 0.3117  0.0969  339 GLU A N   
2039 C CA  . GLU A 256 ? 1.8612 1.4579 1.6855 0.0100  0.3620  0.0956  339 GLU A CA  
2040 C C   . GLU A 256 ? 1.8165 1.4352 1.7052 0.0257  0.3819  0.0967  339 GLU A C   
2041 O O   . GLU A 256 ? 1.8381 1.4747 1.7688 0.0387  0.4216  0.1050  339 GLU A O   
2042 C CB  . GLU A 256 ? 2.0624 1.5753 1.7752 0.0143  0.3723  0.0816  339 GLU A CB  
2043 C CG  . GLU A 256 ? 2.2319 1.6987 1.8997 0.0146  0.3484  0.0660  339 GLU A CG  
2044 C CD  . GLU A 256 ? 2.3962 1.7924 1.9560 0.0058  0.3273  0.0538  339 GLU A CD  
2045 O OE1 . GLU A 256 ? 2.4865 1.8936 2.0307 -0.0105 0.2977  0.0589  339 GLU A OE1 
2046 O OE2 . GLU A 256 ? 2.4691 1.7971 1.9590 0.0154  0.3385  0.0389  339 GLU A OE2 
2047 N N   . SER A 257 ? 1.7718 1.3917 1.6732 0.0244  0.3542  0.0905  340 SER A N   
2048 C CA  . SER A 257 ? 1.7791 1.4204 1.7429 0.0390  0.3681  0.0926  340 SER A CA  
2049 C C   . SER A 257 ? 1.7213 1.4388 1.7892 0.0407  0.3735  0.1092  340 SER A C   
2050 O O   . SER A 257 ? 1.7489 1.4846 1.8714 0.0556  0.3950  0.1141  340 SER A O   
2051 C CB  . SER A 257 ? 1.7793 1.4101 1.7394 0.0348  0.3329  0.0852  340 SER A CB  
2052 O OG  . SER A 257 ? 1.7014 1.3960 1.7343 0.0260  0.3021  0.0961  340 SER A OG  
2053 N N   . VAL A 258 ? 1.6901 1.4503 1.7854 0.0255  0.3515  0.1179  341 VAL A N   
2054 C CA  . VAL A 258 ? 1.5736 1.3992 1.7591 0.0254  0.3561  0.1327  341 VAL A CA  
2055 C C   . VAL A 258 ? 1.4769 1.3158 1.6544 0.0124  0.3549  0.1390  341 VAL A C   
2056 O O   . VAL A 258 ? 1.4918 1.3322 1.6812 0.0172  0.3891  0.1462  341 VAL A O   
2057 C CB  . VAL A 258 ? 1.4980 1.3740 1.7482 0.0210  0.3197  0.1379  341 VAL A CB  
2058 C CG1 . VAL A 258 ? 1.4833 1.3363 1.6964 0.0167  0.2873  0.1290  341 VAL A CG1 
2059 C CG2 . VAL A 258 ? 1.4548 1.3801 1.7450 0.0068  0.2953  0.1469  341 VAL A CG2 
2060 N N   . GLU A 274 ? 1.9241 2.2838 2.1311 0.5497  0.6847  1.3900  499 GLU A N   
2061 C CA  . GLU A 274 ? 2.0444 2.3828 2.1975 0.5773  0.7172  1.4344  499 GLU A CA  
2062 C C   . GLU A 274 ? 2.0114 2.3579 2.2391 0.5480  0.6885  1.4508  499 GLU A C   
2063 O O   . GLU A 274 ? 2.0147 2.3854 2.3305 0.5403  0.7161  1.5022  499 GLU A O   
2064 C CB  . GLU A 274 ? 2.1320 2.4176 2.1225 0.6127  0.7130  1.4082  499 GLU A CB  
2065 C CG  . GLU A 274 ? 2.1268 2.3982 2.0468 0.6272  0.7116  1.3642  499 GLU A CG  
2066 C CD  . GLU A 274 ? 2.0205 2.2938 1.9551 0.5960  0.6505  1.3015  499 GLU A CD  
2067 O OE1 . GLU A 274 ? 1.9683 2.2630 1.9476 0.5832  0.6469  1.2779  499 GLU A OE1 
2068 O OE2 . GLU A 274 ? 2.0020 2.2547 1.9021 0.5851  0.6061  1.2769  499 GLU A OE2 
2069 N N   . HIS A 275 ? 1.9890 2.3157 2.1874 0.5304  0.6324  1.4057  500 HIS A N   
2070 C CA  . HIS A 275 ? 1.9318 2.2620 2.1974 0.5000  0.5959  1.4071  500 HIS A CA  
2071 C C   . HIS A 275 ? 1.9162 2.2427 2.1874 0.4721  0.5364  1.3445  500 HIS A C   
2072 O O   . HIS A 275 ? 2.0556 2.3558 2.2303 0.4860  0.5149  1.3049  500 HIS A O   
2073 C CB  . HIS A 275 ? 1.9862 2.2825 2.1733 0.5222  0.5973  1.4278  500 HIS A CB  
2074 C CG  . HIS A 275 ? 2.0943 2.3925 2.2817 0.5473  0.6549  1.4937  500 HIS A CG  
2075 N ND1 . HIS A 275 ? 2.0613 2.3909 2.3676 0.5296  0.6788  1.5416  500 HIS A ND1 
2076 C CD2 . HIS A 275 ? 2.1951 2.4659 2.2781 0.5888  0.6937  1.5208  500 HIS A CD2 
2077 C CE1 . HIS A 275 ? 2.1494 2.4742 2.4295 0.5591  0.7321  1.5970  500 HIS A CE1 
2078 N NE2 . HIS A 275 ? 2.2332 2.5215 2.3751 0.5962  0.7432  1.5854  500 HIS A NE2 
2079 N N   . GLU A 276 ? 1.8156 2.1660 2.1955 0.4338  0.5103  1.3351  501 GLU A N   
2080 C CA  . GLU A 276 ? 1.7128 2.0564 2.1017 0.4065  0.4543  1.2797  501 GLU A CA  
2081 C C   . GLU A 276 ? 1.7261 2.0567 2.1447 0.3912  0.4271  1.2862  501 GLU A C   
2082 O O   . GLU A 276 ? 1.6582 2.0006 2.1672 0.3590  0.4055  1.2825  501 GLU A O   
2083 C CB  . GLU A 276 ? 1.6030 1.9747 2.0803 0.3748  0.4393  1.2580  501 GLU A CB  
2084 C CG  . GLU A 276 ? 1.5928 1.9755 2.0402 0.3877  0.4576  1.2421  501 GLU A CG  
2085 C CD  . GLU A 276 ? 1.4772 1.8770 1.9799 0.3576  0.4274  1.2023  501 GLU A CD  
2086 O OE1 . GLU A 276 ? 1.4060 1.8225 2.0041 0.3256  0.4097  1.2065  501 GLU A OE1 
2087 O OE2 . GLU A 276 ? 1.4388 1.8329 1.8862 0.3667  0.4217  1.1671  501 GLU A OE2 
2088 N N   . THR A 277 ? 1.7946 2.0976 2.1318 0.4153  0.4269  1.2949  502 THR A N   
2089 C CA  . THR A 277 ? 1.7796 2.0676 2.1357 0.4076  0.4067  1.3081  502 THR A CA  
2090 C C   . THR A 277 ? 1.7407 2.0133 2.0767 0.3932  0.3533  1.2551  502 THR A C   
2091 O O   . THR A 277 ? 1.7618 2.0214 2.0173 0.4063  0.3365  1.2187  502 THR A O   
2092 C CB  . THR A 277 ? 1.8562 2.1228 2.1379 0.4420  0.4353  1.3498  502 THR A CB  
2093 O OG1 . THR A 277 ? 1.8896 2.1509 2.2239 0.4324  0.4315  1.3829  502 THR A OG1 
2094 C CG2 . THR A 277 ? 1.9078 2.1432 2.0643 0.4677  0.4152  1.3199  502 THR A CG2 
2095 N N   . SER A 278 ? 1.6785 1.9523 2.0909 0.3658  0.3275  1.2507  503 SER A N   
2096 C CA  . SER A 278 ? 1.6039 1.8643 2.0095 0.3518  0.2801  1.2045  503 SER A CA  
2097 C C   . SER A 278 ? 1.6127 1.8479 1.9691 0.3690  0.2662  1.2158  503 SER A C   
2098 O O   . SER A 278 ? 1.6087 1.8376 1.9797 0.3772  0.2854  1.2608  503 SER A O   
2099 C CB  . SER A 278 ? 1.5237 1.7924 2.0299 0.3154  0.2591  1.1911  503 SER A CB  
2100 O OG  . SER A 278 ? 1.4834 1.7703 2.0169 0.2984  0.2551  1.1618  503 SER A OG  
2101 N N   . ILE A 279 ? 1.6089 1.8307 1.9095 0.3742  0.2323  1.1765  504 ILE A N   
2102 C CA  . ILE A 279 ? 1.6764 1.8753 1.9260 0.3917  0.2140  1.1841  504 ILE A CA  
2103 C C   . ILE A 279 ? 1.6881 1.8810 1.9481 0.3783  0.1684  1.1408  504 ILE A C   
2104 O O   . ILE A 279 ? 1.6361 1.8402 1.9250 0.3587  0.1517  1.1005  504 ILE A O   
2105 C CB  . ILE A 279 ? 1.7366 1.9194 1.8718 0.4262  0.2252  1.1921  504 ILE A CB  
2106 C CG1 . ILE A 279 ? 1.7148 1.8974 1.7924 0.4285  0.2057  1.1429  504 ILE A CG1 
2107 C CG2 . ILE A 279 ? 1.7804 1.9668 1.9018 0.4435  0.2756  1.2391  504 ILE A CG2 
2108 C CD1 . ILE A 279 ? 1.7790 1.9374 1.7373 0.4613  0.2075  1.1447  504 ILE A CD1 
2109 N N   . ASP A 280 ? 1.8169 1.9919 2.0515 0.3907  0.1498  1.1515  505 ASP A N   
2110 C CA  . ASP A 280 ? 1.8539 2.0229 2.0937 0.3837  0.1081  1.1164  505 ASP A CA  
2111 C C   . ASP A 280 ? 1.9073 2.0734 2.0660 0.3965  0.0877  1.0815  505 ASP A C   
2112 O O   . ASP A 280 ? 2.0086 2.1585 2.0875 0.4214  0.0824  1.0937  505 ASP A O   
2113 C CB  . ASP A 280 ? 1.9247 2.0763 2.1657 0.3951  0.0963  1.1447  505 ASP A CB  
2114 C CG  . ASP A 280 ? 1.9342 2.0820 2.1955 0.3879  0.0555  1.1127  505 ASP A CG  
2115 O OD1 . ASP A 280 ? 1.9383 2.0972 2.2421 0.3669  0.0409  1.0731  505 ASP A OD1 
2116 O OD2 . ASP A 280 ? 1.9504 2.0841 2.1863 0.4040  0.0388  1.1290  505 ASP A OD2 
2117 N N   . ILE A 281 ? 1.8784 2.0576 2.0563 0.3790  0.0750  1.0386  506 ILE A N   
2118 C CA  . ILE A 281 ? 1.9456 2.1221 2.0536 0.3877  0.0562  1.0036  506 ILE A CA  
2119 C C   . ILE A 281 ? 2.0159 2.1837 2.1107 0.3911  0.0141  0.9847  506 ILE A C   
2120 O O   . ILE A 281 ? 2.1422 2.2983 2.1613 0.4079  -0.0044 0.9743  506 ILE A O   
2121 C CB  . ILE A 281 ? 1.9149 2.1081 2.0424 0.3703  0.0630  0.9697  506 ILE A CB  
2122 C CG1 . ILE A 281 ? 1.8691 2.0720 2.0513 0.3460  0.0343  0.9282  506 ILE A CG1 
2123 C CG2 . ILE A 281 ? 1.8904 2.0968 2.0665 0.3612  0.1008  0.9947  506 ILE A CG2 
2124 C CD1 . ILE A 281 ? 1.9139 2.1107 2.0550 0.3515  -0.0023 0.8964  506 ILE A CD1 
2125 N N   . SER A 282 ? 2.0236 2.1947 2.1896 0.3771  -0.0010 0.9832  507 SER A N   
2126 C CA  . SER A 282 ? 2.0256 2.1900 2.1892 0.3831  -0.0377 0.9742  507 SER A CA  
2127 C C   . SER A 282 ? 2.0555 2.2024 2.1359 0.4108  -0.0496 0.9960  507 SER A C   
2128 O O   . SER A 282 ? 2.0120 2.1553 2.0570 0.4176  -0.0836 0.9758  507 SER A O   
2129 C CB  . SER A 282 ? 1.9964 2.1589 2.2381 0.3736  -0.0400 0.9901  507 SER A CB  
2130 O OG  . SER A 282 ? 1.9813 2.1539 2.2954 0.3481  -0.0323 0.9691  507 SER A OG  
2131 N N   . ALA A 283 ? 2.0955 2.2306 2.1433 0.4267  -0.0214 1.0378  508 ALA A N   
2132 C CA  . ALA A 283 ? 2.1493 2.2626 2.1061 0.4552  -0.0275 1.0622  508 ALA A CA  
2133 C C   . ALA A 283 ? 2.1906 2.2935 2.0531 0.4678  -0.0450 1.0350  508 ALA A C   
2134 O O   . ALA A 283 ? 2.2792 2.3594 2.0582 0.4914  -0.0547 1.0516  508 ALA A O   
2135 C CB  . ALA A 283 ? 2.1765 2.2800 2.1165 0.4690  0.0143  1.1117  508 ALA A CB  
2136 N N   . TYR A 284 ? 2.1347 2.2510 2.0087 0.4523  -0.0506 0.9938  509 TYR A N   
2137 C CA  . TYR A 284 ? 2.1558 2.2612 1.9506 0.4602  -0.0719 0.9627  509 TYR A CA  
2138 C C   . TYR A 284 ? 2.0258 2.1457 1.8629 0.4419  -0.1123 0.9207  509 TYR A C   
2139 O O   . TYR A 284 ? 1.8781 2.0160 1.7639 0.4215  -0.1073 0.8915  509 TYR A O   
2140 C CB  . TYR A 284 ? 2.1944 2.3011 1.9600 0.4603  -0.0375 0.9540  509 TYR A CB  
2141 C CG  . TYR A 284 ? 2.3467 2.4397 2.0680 0.4812  0.0056  0.9977  509 TYR A CG  
2142 C CD1 . TYR A 284 ? 2.3399 2.4467 2.1315 0.4743  0.0392  1.0322  509 TYR A CD1 
2143 C CD2 . TYR A 284 ? 2.4606 2.5242 2.0686 0.5087  0.0129  1.0062  509 TYR A CD2 
2144 C CE1 . TYR A 284 ? 2.3927 2.4889 2.1499 0.4936  0.0802  1.0758  509 TYR A CE1 
2145 C CE2 . TYR A 284 ? 2.5200 2.5702 2.0865 0.5302  0.0560  1.0488  509 TYR A CE2 
2146 C CZ  . TYR A 284 ? 2.4659 2.5347 2.1104 0.5224  0.0904  1.0847  509 TYR A CZ  
2147 O OH  . TYR A 284 ? 2.4826 2.5405 2.0920 0.5433  0.1350  1.1294  509 TYR A OH  
2148 N N   . SER B 6   ? 1.5340 1.5545 2.8673 0.0809  0.3881  1.1683  89  SER B N   
2149 C CA  . SER B 6   ? 1.5537 1.5470 2.9106 0.0725  0.3588  1.1563  89  SER B CA  
2150 C C   . SER B 6   ? 1.4799 1.4940 2.8784 0.0560  0.3315  1.1195  89  SER B C   
2151 O O   . SER B 6   ? 1.4858 1.5291 2.8702 0.0596  0.3246  1.0962  89  SER B O   
2152 C CB  . SER B 6   ? 1.5621 1.5241 2.8579 0.0941  0.3427  1.1507  89  SER B CB  
2153 O OG  . SER B 6   ? 1.5262 1.5061 2.7682 0.1114  0.3358  1.1284  89  SER B OG  
2154 N N   . ARG B 7   ? 1.5168 1.5122 2.9624 0.0369  0.3165  1.1147  90  ARG B N   
2155 C CA  . ARG B 7   ? 1.4913 1.4985 2.9735 0.0155  0.2910  1.0813  90  ARG B CA  
2156 C C   . ARG B 7   ? 1.5761 1.5675 3.0250 0.0245  0.2660  1.0438  90  ARG B C   
2157 O O   . ARG B 7   ? 1.5365 1.4965 2.9613 0.0406  0.2636  1.0473  90  ARG B O   
2158 C CB  . ARG B 7   ? 1.5401 1.5278 3.0836 -0.0113 0.2869  1.0909  90  ARG B CB  
2159 C CG  . ARG B 7   ? 1.4864 1.4806 3.0655 -0.0394 0.2608  1.0589  90  ARG B CG  
2160 C CD  . ARG B 7   ? 1.4595 1.4984 3.0627 -0.0529 0.2591  1.0579  90  ARG B CD  
2161 N NE  . ARG B 7   ? 1.4897 1.5449 3.1384 -0.0597 0.2826  1.0968  90  ARG B NE  
2162 C CZ  . ARG B 7   ? 1.5079 1.6032 3.1747 -0.0574 0.2973  1.1118  90  ARG B CZ  
2163 N NH1 . ARG B 7   ? 1.6743 1.7804 3.3901 -0.0645 0.3222  1.1479  90  ARG B NH1 
2164 N NH2 . ARG B 7   ? 1.4518 1.5756 3.0930 -0.0485 0.2892  1.0919  90  ARG B NH2 
2165 N N   . ILE B 8   ? 1.6743 1.6868 3.1253 0.0130  0.2475  1.0092  91  ILE B N   
2166 C CA  . ILE B 8   ? 1.6529 1.6491 3.0864 0.0131  0.2251  0.9694  91  ILE B CA  
2167 C C   . ILE B 8   ? 1.5940 1.5815 3.0682 -0.0198 0.2088  0.9474  91  ILE B C   
2168 O O   . ILE B 8   ? 1.7015 1.6531 3.1960 -0.0282 0.2043  0.9417  91  ILE B O   
2169 C CB  . ILE B 8   ? 1.6140 1.6352 3.0009 0.0282  0.2176  0.9438  91  ILE B CB  
2170 C CG1 . ILE B 8   ? 1.6137 1.6327 2.9531 0.0602  0.2296  0.9611  91  ILE B CG1 
2171 C CG2 . ILE B 8   ? 1.6491 1.6573 3.0264 0.0222  0.1970  0.9004  91  ILE B CG2 
2172 C CD1 . ILE B 8   ? 1.6155 1.5978 2.9421 0.0766  0.2243  0.9633  91  ILE B CD1 
2173 N N   . ALA B 9   ? 1.4108 1.4283 2.8957 -0.0393 0.1991  0.9355  92  ALA B N   
2174 C CA  . ALA B 9   ? 1.3919 1.4017 2.9106 -0.0748 0.1815  0.9179  92  ALA B CA  
2175 C C   . ALA B 9   ? 1.4016 1.4528 2.9361 -0.0901 0.1748  0.9239  92  ALA B C   
2176 O O   . ALA B 9   ? 1.4903 1.5617 2.9953 -0.0893 0.1632  0.9013  92  ALA B O   
2177 C CB  . ALA B 9   ? 1.3602 1.3467 2.8524 -0.0819 0.1649  0.8727  92  ALA B CB  
2178 N N   . ASP B 10  ? 1.4085 1.4732 2.9935 -0.1028 0.1831  0.9568  93  ASP B N   
2179 C CA  . ASP B 10  ? 1.3487 1.4569 2.9637 -0.1125 0.1814  0.9728  93  ASP B CA  
2180 C C   . ASP B 10  ? 1.2550 1.3928 2.8383 -0.0822 0.1980  0.9804  93  ASP B C   
2181 O O   . ASP B 10  ? 1.2885 1.4611 2.8860 -0.0873 0.1921  0.9824  93  ASP B O   
2182 C CB  . ASP B 10  ? 1.3701 1.4867 2.9966 -0.1468 0.1489  0.9482  93  ASP B CB  
2183 C CG  . ASP B 10  ? 1.5186 1.6092 3.1853 -0.1816 0.1344  0.9473  93  ASP B CG  
2184 O OD1 . ASP B 10  ? 1.6396 1.6893 3.2953 -0.1801 0.1393  0.9370  93  ASP B OD1 
2185 O OD2 . ASP B 10  ? 1.6237 1.7341 3.3364 -0.2108 0.1176  0.9583  93  ASP B OD2 
2186 N N   . TYR B 11  ? 1.2505 1.3728 2.7931 -0.0518 0.2180  0.9866  94  TYR B N   
2187 C CA  . TYR B 11  ? 1.2622 1.4051 2.7663 -0.0230 0.2357  0.9931  94  TYR B CA  
2188 C C   . TYR B 11  ? 1.2731 1.4015 2.7662 -0.0020 0.2659  1.0249  94  TYR B C   
2189 O O   . TYR B 11  ? 1.2597 1.3539 2.7407 0.0026  0.2665  1.0282  94  TYR B O   
2190 C CB  . TYR B 11  ? 1.2641 1.3992 2.7060 -0.0065 0.2231  0.9593  94  TYR B CB  
2191 C CG  . TYR B 11  ? 1.2830 1.4354 2.7181 -0.0222 0.1981  0.9276  94  TYR B CG  
2192 C CD1 . TYR B 11  ? 1.3083 1.4960 2.7447 -0.0201 0.1985  0.9298  94  TYR B CD1 
2193 C CD2 . TYR B 11  ? 1.2960 1.4265 2.7208 -0.0391 0.1757  0.8950  94  TYR B CD2 
2194 C CE1 . TYR B 11  ? 1.2908 1.4916 2.7177 -0.0357 0.1742  0.9034  94  TYR B CE1 
2195 C CE2 . TYR B 11  ? 1.2895 1.4320 2.7002 -0.0558 0.1542  0.8665  94  TYR B CE2 
2196 C CZ  . TYR B 11  ? 1.3225 1.5002 2.7332 -0.0545 0.1520  0.8719  94  TYR B CZ  
2197 O OH  . TYR B 11  ? 1.2942 1.4811 2.6874 -0.0722 0.1291  0.8456  94  TYR B OH  
2198 N N   . LEU B 12  ? 1.3127 1.4648 2.8086 0.0101  0.2917  1.0483  95  LEU B N   
2199 C CA  . LEU B 12  ? 1.4051 1.5423 2.8697 0.0318  0.3227  1.0753  95  LEU B CA  
2200 C C   . LEU B 12  ? 1.4128 1.5486 2.8045 0.0577  0.3231  1.0584  95  LEU B C   
2201 O O   . LEU B 12  ? 1.3673 1.5285 2.7477 0.0612  0.3168  1.0398  95  LEU B O   
2202 C CB  . LEU B 12  ? 1.4734 1.6347 2.9733 0.0318  0.3563  1.1069  95  LEU B CB  
2203 C CG  . LEU B 12  ? 1.5065 1.6849 3.0934 0.0049  0.3574  1.1255  95  LEU B CG  
2204 C CD1 . LEU B 12  ? 1.5463 1.7635 3.1707 0.0077  0.3826  1.1421  95  LEU B CD1 
2205 C CD2 . LEU B 12  ? 1.5244 1.6735 3.1325 -0.0026 0.3719  1.1531  95  LEU B CD2 
2206 N N   . LEU B 13  ? 1.5018 1.6070 2.8451 0.0750  0.3298  1.0672  96  LEU B N   
2207 C CA  . LEU B 13  ? 1.5485 1.6495 2.8202 0.0991  0.3295  1.0550  96  LEU B CA  
2208 C C   . LEU B 13  ? 1.4776 1.5771 2.7199 0.1120  0.3659  1.0854  96  LEU B C   
2209 O O   . LEU B 13  ? 1.5258 1.6064 2.7791 0.1087  0.3855  1.1165  96  LEU B O   
2210 C CB  . LEU B 13  ? 1.6264 1.6939 2.8653 0.1087  0.3083  1.0444  96  LEU B CB  
2211 C CG  . LEU B 13  ? 1.6656 1.7323 2.9178 0.1006  0.2757  1.0062  96  LEU B CG  
2212 C CD1 . LEU B 13  ? 1.7131 1.7821 2.9104 0.1195  0.2613  0.9802  96  LEU B CD1 
2213 C CD2 . LEU B 13  ? 1.6769 1.7697 2.9762 0.0767  0.2651  0.9875  96  LEU B CD2 
2214 N N   . LEU B 14  ? 1.3267 1.4436 2.5300 0.1253  0.3765  1.0756  97  LEU B N   
2215 C CA  . LEU B 14  ? 1.3790 1.4942 2.5494 0.1364  0.4146  1.0989  97  LEU B CA  
2216 C C   . LEU B 14  ? 1.3645 1.4718 2.4511 0.1570  0.4122  1.0828  97  LEU B C   
2217 O O   . LEU B 14  ? 1.3886 1.5126 2.4668 0.1604  0.3910  1.0526  97  LEU B O   
2218 C CB  . LEU B 14  ? 1.4347 1.5856 2.6619 0.1277  0.4362  1.1033  97  LEU B CB  
2219 C CG  . LEU B 14  ? 1.4726 1.6291 2.7629 0.1142  0.4662  1.1367  97  LEU B CG  
2220 C CD1 . LEU B 14  ? 1.4286 1.5879 2.7931 0.0912  0.4437  1.1407  97  LEU B CD1 
2221 C CD2 . LEU B 14  ? 1.4599 1.6517 2.7866 0.1153  0.4923  1.1383  97  LEU B CD2 
2222 N N   . PRO B 15  ? 1.4423 1.5228 2.4642 0.1689  0.4335  1.1032  98  PRO B N   
2223 C CA  . PRO B 15  ? 1.5090 1.5745 2.4440 0.1865  0.4232  1.0889  98  PRO B CA  
2224 C C   . PRO B 15  ? 1.5040 1.5925 2.4129 0.1947  0.4312  1.0645  98  PRO B C   
2225 O O   . PRO B 15  ? 1.4615 1.5768 2.4176 0.1888  0.4517  1.0633  98  PRO B O   
2226 C CB  . PRO B 15  ? 1.5630 1.5927 2.4365 0.1920  0.4482  1.1219  98  PRO B CB  
2227 C CG  . PRO B 15  ? 1.5819 1.6131 2.5100 0.1788  0.4809  1.1517  98  PRO B CG  
2228 C CD  . PRO B 15  ? 1.5043 1.5618 2.5273 0.1641  0.4626  1.1414  98  PRO B CD  
2229 N N   . LEU B 16  ? 1.5506 1.6282 2.3904 0.2077  0.4125  1.0458  99  LEU B N   
2230 C CA  . LEU B 16  ? 1.5515 1.6437 2.3541 0.2164  0.4187  1.0220  99  LEU B CA  
2231 C C   . LEU B 16  ? 1.6660 1.7338 2.3690 0.2302  0.4164  1.0159  99  LEU B C   
2232 O O   . LEU B 16  ? 1.6012 1.6802 2.2763 0.2363  0.4199  0.9934  99  LEU B O   
2233 C CB  . LEU B 16  ? 1.4657 1.5864 2.3105 0.2125  0.3868  0.9890  99  LEU B CB  
2234 C CG  . LEU B 16  ? 1.4173 1.5713 2.3394 0.2006  0.3956  0.9845  99  LEU B CG  
2235 C CD1 . LEU B 16  ? 1.3287 1.5019 2.2806 0.1935  0.3586  0.9542  99  LEU B CD1 
2236 C CD2 . LEU B 16  ? 1.4499 1.6165 2.3614 0.2070  0.4292  0.9844  99  LEU B CD2 
2237 N N   . ALA B 17  ? 1.7274 1.7613 2.3782 0.2339  0.4096  1.0366  100 ALA B N   
2238 C CA  . ALA B 17  ? 1.7694 1.7777 2.3269 0.2444  0.3937  1.0322  100 ALA B CA  
2239 C C   . ALA B 17  ? 1.8259 1.8375 2.3247 0.2507  0.4086  1.0110  100 ALA B C   
2240 O O   . ALA B 17  ? 1.8161 1.8354 2.2917 0.2566  0.3801  0.9839  100 ALA B O   
2241 C CB  . ALA B 17  ? 1.8525 1.8206 2.3542 0.2440  0.4040  1.0683  100 ALA B CB  
2242 N N   . GLU B 20  ? 2.0112 2.0693 2.6471 0.2549  0.2524  0.9345  103 GLU B N   
2243 C CA  . GLU B 20  ? 2.0624 2.0954 2.6887 0.2606  0.2281  0.9515  103 GLU B CA  
2244 C C   . GLU B 20  ? 1.9873 2.0177 2.6869 0.2530  0.2242  0.9617  103 GLU B C   
2245 O O   . GLU B 20  ? 2.0296 2.0389 2.7310 0.2501  0.2389  0.9937  103 GLU B O   
2246 C CB  . GLU B 20  ? 2.1003 2.1371 2.7072 0.2696  0.1914  0.9283  103 GLU B CB  
2247 C CG  . GLU B 20  ? 2.1442 2.1615 2.7624 0.2765  0.1611  0.9415  103 GLU B CG  
2248 C CD  . GLU B 20  ? 2.1395 2.1738 2.8001 0.2804  0.1293  0.9110  103 GLU B CD  
2249 O OE1 . GLU B 20  ? 2.0432 2.1042 2.7405 0.2740  0.1321  0.8796  103 GLU B OE1 
2250 O OE2 . GLU B 20  ? 2.2109 2.2306 2.8710 0.2895  0.1015  0.9201  103 GLU B OE2 
2251 N N   . HIS B 21  ? 1.8578 1.9065 2.6140 0.2486  0.2055  0.9343  104 HIS B N   
2252 C CA  . HIS B 21  ? 1.7755 1.8209 2.6012 0.2386  0.2027  0.9374  104 HIS B CA  
2253 C C   . HIS B 21  ? 1.6190 1.6910 2.4926 0.2229  0.2149  0.9188  104 HIS B C   
2254 O O   . HIS B 21  ? 1.5023 1.5748 2.4323 0.2111  0.2089  0.9114  104 HIS B O   
2255 C CB  . HIS B 21  ? 1.8260 1.8642 2.6803 0.2441  0.1714  0.9213  104 HIS B CB  
2256 C CG  . HIS B 21  ? 1.8155 1.8241 2.6437 0.2573  0.1556  0.9473  104 HIS B CG  
2257 N ND1 . HIS B 21  ? 1.8689 1.8497 2.7058 0.2560  0.1634  0.9828  104 HIS B ND1 
2258 C CD2 . HIS B 21  ? 1.7823 1.7848 2.5789 0.2712  0.1298  0.9445  104 HIS B CD2 
2259 C CE1 . HIS B 21  ? 1.8656 1.8228 2.6743 0.2687  0.1424  1.0020  104 HIS B CE1 
2260 N NE2 . HIS B 21  ? 1.8446 1.8154 2.6298 0.2781  0.1207  0.9794  104 HIS B NE2 
2261 N N   . VAL B 22  ? 1.5643 1.6559 2.4153 0.2219  0.2313  0.9120  105 VAL B N   
2262 C CA  . VAL B 22  ? 1.4557 1.5701 2.3522 0.2068  0.2462  0.9068  105 VAL B CA  
2263 C C   . VAL B 22  ? 1.4161 1.5234 2.3245 0.2023  0.2765  0.9415  105 VAL B C   
2264 O O   . VAL B 22  ? 1.3320 1.4238 2.1927 0.2119  0.2956  0.9636  105 VAL B O   
2265 C CB  . VAL B 22  ? 1.3867 1.5265 2.2667 0.2071  0.2504  0.8847  105 VAL B CB  
2266 C CG1 . VAL B 22  ? 1.3392 1.5023 2.2772 0.1896  0.2572  0.8805  105 VAL B CG1 
2267 C CG2 . VAL B 22  ? 1.3975 1.5431 2.2557 0.2128  0.2237  0.8522  105 VAL B CG2 
2268 N N   . SER B 23  ? 1.3974 1.5152 2.3691 0.1857  0.2806  0.9454  106 SER B N   
2269 C CA  . SER B 23  ? 1.4901 1.6098 2.4914 0.1778  0.3096  0.9749  106 SER B CA  
2270 C C   . SER B 23  ? 1.4309 1.5815 2.4920 0.1610  0.3092  0.9634  106 SER B C   
2271 O O   . SER B 23  ? 1.4700 1.6314 2.5477 0.1527  0.2841  0.9358  106 SER B O   
2272 C CB  . SER B 23  ? 1.5514 1.6448 2.5762 0.1724  0.3096  0.9994  106 SER B CB  
2273 O OG  . SER B 23  ? 1.5577 1.6567 2.6462 0.1544  0.2939  0.9891  106 SER B OG  
2274 N N   . ARG B 24  ? 1.3874 1.5517 2.4795 0.1556  0.3369  0.9848  107 ARG B N   
2275 C CA  . ARG B 24  ? 1.3423 1.5360 2.5011 0.1380  0.3343  0.9811  107 ARG B CA  
2276 C C   . ARG B 24  ? 1.3201 1.5086 2.5392 0.1173  0.3232  0.9912  107 ARG B C   
2277 O O   . ARG B 24  ? 1.4844 1.6519 2.7095 0.1169  0.3356  1.0151  107 ARG B O   
2278 C CB  . ARG B 24  ? 1.3779 1.5910 2.5556 0.1416  0.3687  0.9998  107 ARG B CB  
2279 C CG  . ARG B 24  ? 1.4514 1.6553 2.6547 0.1390  0.4011  1.0358  107 ARG B CG  
2280 C CD  . ARG B 24  ? 1.5304 1.7553 2.7585 0.1430  0.4385  1.0509  107 ARG B CD  
2281 N NE  . ARG B 24  ? 1.5652 1.7796 2.7195 0.1633  0.4596  1.0439  107 ARG B NE  
2282 C CZ  . ARG B 24  ? 1.5221 1.7548 2.6783 0.1713  0.4796  1.0368  107 ARG B CZ  
2283 N NH1 . ARG B 24  ? 1.5336 1.7996 2.7663 0.1622  0.4793  1.0371  107 ARG B NH1 
2284 N NH2 . ARG B 24  ? 1.5746 1.7904 2.6549 0.1881  0.4984  1.0293  107 ARG B NH2 
2285 N N   . ALA B 25  ? 1.2706 1.4752 2.5300 0.0986  0.2988  0.9728  108 ALA B N   
2286 C CA  . ALA B 25  ? 1.2909 1.4899 2.6057 0.0750  0.2851  0.9779  108 ALA B CA  
2287 C C   . ALA B 25  ? 1.2996 1.5292 2.6777 0.0567  0.2861  0.9881  108 ALA B C   
2288 O O   . ALA B 25  ? 1.3121 1.5662 2.6891 0.0594  0.2839  0.9786  108 ALA B O   
2289 C CB  . ALA B 25  ? 1.3029 1.4888 2.6063 0.0648  0.2527  0.9453  108 ALA B CB  
2290 N N   . LEU B 26  ? 1.3282 1.5564 2.7644 0.0380  0.2887  1.0090  109 LEU B N   
2291 C CA  . LEU B 26  ? 1.3063 1.5652 2.8147 0.0194  0.2893  1.0249  109 LEU B CA  
2292 C C   . LEU B 26  ? 1.3160 1.5691 2.8758 -0.0110 0.2656  1.0256  109 LEU B C   
2293 O O   . LEU B 26  ? 1.2562 1.4837 2.8230 -0.0159 0.2705  1.0360  109 LEU B O   
2294 C CB  . LEU B 26  ? 1.3285 1.5978 2.8673 0.0292  0.3292  1.0601  109 LEU B CB  
2295 C CG  . LEU B 26  ? 1.3594 1.6434 2.8604 0.0535  0.3509  1.0562  109 LEU B CG  
2296 C CD1 . LEU B 26  ? 1.4254 1.6811 2.8508 0.0779  0.3741  1.0586  109 LEU B CD1 
2297 C CD2 . LEU B 26  ? 1.4464 1.7607 3.0126 0.0524  0.3790  1.0820  109 LEU B CD2 
2298 N N   . CYS B 27  ? 1.3459 1.6205 2.9393 -0.0329 0.2387  1.0149  110 CYS B N   
2299 C CA  . CYS B 27  ? 1.3570 1.6253 2.9962 -0.0663 0.2129  1.0142  110 CYS B CA  
2300 C C   . CYS B 27  ? 1.2809 1.5618 2.9965 -0.0765 0.2319  1.0526  110 CYS B C   
2301 O O   . CYS B 27  ? 1.1881 1.4627 2.9506 -0.1045 0.2157  1.0592  110 CYS B O   
2302 C CB  . CYS B 27  ? 1.3242 1.6114 2.9733 -0.0888 0.1774  0.9955  110 CYS B CB  
2303 S SG  . CYS B 27  ? 1.4611 1.7255 3.1312 -0.1317 0.1403  0.9807  110 CYS B SG  
2304 N N   . THR B 30  ? 1.0519 1.3976 2.9486 -0.1845 0.1238  1.0615  113 THR B N   
2305 C CA  . THR B 30  ? 1.0683 1.4451 2.9566 -0.1657 0.1257  1.0605  113 THR B CA  
2306 C C   . THR B 30  ? 1.0715 1.4547 2.9468 -0.1253 0.1754  1.0745  113 THR B C   
2307 O O   . THR B 30  ? 1.1587 1.5175 3.0144 -0.1139 0.2009  1.0797  113 THR B O   
2308 C CB  . THR B 30  ? 1.0315 1.3914 2.8370 -0.1670 0.0993  1.0211  113 THR B CB  
2309 O OG1 . THR B 30  ? 0.9844 1.3303 2.7874 -0.2068 0.0561  1.0048  113 THR B OG1 
2310 C CG2 . THR B 30  ? 0.9808 1.3692 2.7769 -0.1499 0.0990  1.0196  113 THR B CG2 
2311 N N   . GLY B 31  ? 1.0082 1.4204 2.8928 -0.1051 0.1894  1.0813  114 GLY B N   
2312 C CA  . GLY B 31  ? 0.9931 1.4058 2.8494 -0.0679 0.2368  1.0888  114 GLY B CA  
2313 C C   . GLY B 31  ? 1.0102 1.4104 2.7788 -0.0436 0.2396  1.0605  114 GLY B C   
2314 O O   . GLY B 31  ? 0.9906 1.3979 2.7407 -0.0159 0.2729  1.0656  114 GLY B O   
2315 N N   . ARG B 32  ? 1.0680 1.4479 2.7815 -0.0548 0.2065  1.0296  115 ARG B N   
2316 C CA  . ARG B 32  ? 1.0915 1.4642 2.7308 -0.0381 0.2005  1.0005  115 ARG B CA  
2317 C C   . ARG B 32  ? 1.1300 1.4785 2.7032 -0.0079 0.2311  0.9936  115 ARG B C   
2318 O O   . ARG B 32  ? 1.1218 1.4437 2.6785 -0.0089 0.2358  0.9941  115 ARG B O   
2319 C CB  . ARG B 32  ? 1.1143 1.4704 2.7193 -0.0629 0.1588  0.9701  115 ARG B CB  
2320 C CG  . ARG B 32  ? 1.1244 1.4760 2.6625 -0.0537 0.1461  0.9391  115 ARG B CG  
2321 C CD  . ARG B 32  ? 1.1810 1.5113 2.6864 -0.0813 0.1111  0.9097  115 ARG B CD  
2322 N NE  . ARG B 32  ? 1.2404 1.5604 2.6756 -0.0717 0.1040  0.8771  115 ARG B NE  
2323 C CZ  . ARG B 32  ? 1.2061 1.5034 2.5980 -0.0895 0.0826  0.8454  115 ARG B CZ  
2324 N NH1 . ARG B 32  ? 1.2213 1.4998 2.6260 -0.1190 0.0648  0.8391  115 ARG B NH1 
2325 N NH2 . ARG B 32  ? 1.1992 1.4912 2.5340 -0.0790 0.0804  0.8183  115 ARG B NH2 
2326 N N   . GLU B 33  ? 1.1430 1.4988 2.6790 0.0175  0.2497  0.9878  116 GLU B N   
2327 C CA  . GLU B 33  ? 1.1986 1.5313 2.6638 0.0449  0.2740  0.9802  116 GLU B CA  
2328 C C   . GLU B 33  ? 1.2311 1.5492 2.6230 0.0524  0.2535  0.9447  116 GLU B C   
2329 O O   . GLU B 33  ? 1.3465 1.6784 2.7208 0.0585  0.2477  0.9309  116 GLU B O   
2330 C CB  . GLU B 33  ? 1.2113 1.5558 2.6773 0.0684  0.3142  0.9980  116 GLU B CB  
2331 C CG  . GLU B 33  ? 1.2917 1.6080 2.6920 0.0908  0.3420  1.0007  116 GLU B CG  
2332 C CD  . GLU B 33  ? 1.3546 1.6746 2.7242 0.1145  0.3776  1.0052  116 GLU B CD  
2333 O OE1 . GLU B 33  ? 1.4530 1.7927 2.8315 0.1184  0.3752  0.9949  116 GLU B OE1 
2334 O OE2 . GLU B 33  ? 1.3513 1.6515 2.6838 0.1284  0.4085  1.0187  116 GLU B OE2 
2335 N N   . LEU B 34  ? 1.2552 1.5451 2.6102 0.0522  0.2442  0.9314  117 LEU B N   
2336 C CA  . LEU B 34  ? 1.1978 1.4716 2.4896 0.0600  0.2277  0.8989  117 LEU B CA  
2337 C C   . LEU B 34  ? 1.2160 1.4724 2.4519 0.0884  0.2486  0.9012  117 LEU B C   
2338 O O   . LEU B 34  ? 1.2706 1.5202 2.5113 0.0985  0.2745  0.9275  117 LEU B O   
2339 C CB  . LEU B 34  ? 1.1923 1.4443 2.4864 0.0412  0.2042  0.8821  117 LEU B CB  
2340 C CG  . LEU B 34  ? 1.1637 1.4217 2.4892 0.0088  0.1758  0.8689  117 LEU B CG  
2341 C CD1 . LEU B 34  ? 1.1499 1.4212 2.4462 0.0054  0.1585  0.8439  117 LEU B CD1 
2342 C CD2 . LEU B 34  ? 1.1759 1.4528 2.5693 -0.0091 0.1767  0.8973  117 LEU B CD2 
2343 N N   . ARG B 35  ? 1.1704 1.4194 2.3524 0.0997  0.2371  0.8747  118 ARG B N   
2344 C CA  . ARG B 35  ? 1.1943 1.4209 2.3242 0.1209  0.2448  0.8737  118 ARG B CA  
2345 C C   . ARG B 35  ? 1.2353 1.4399 2.3632 0.1144  0.2240  0.8578  118 ARG B C   
2346 O O   . ARG B 35  ? 1.1615 1.3687 2.3082 0.0959  0.2038  0.8363  118 ARG B O   
2347 C CB  . ARG B 35  ? 1.1552 1.3869 2.2304 0.1389  0.2463  0.8569  118 ARG B CB  
2348 C CG  . ARG B 35  ? 1.2214 1.4662 2.2894 0.1502  0.2731  0.8723  118 ARG B CG  
2349 C CD  . ARG B 35  ? 1.3261 1.5557 2.3822 0.1618  0.3030  0.9022  118 ARG B CD  
2350 N NE  . ARG B 35  ? 1.4568 1.7011 2.5370 0.1646  0.3345  0.9220  118 ARG B NE  
2351 C CZ  . ARG B 35  ? 1.5524 1.8173 2.7035 0.1504  0.3411  0.9372  118 ARG B CZ  
2352 N NH1 . ARG B 35  ? 1.5520 1.8242 2.7517 0.1298  0.3159  0.9342  118 ARG B NH1 
2353 N NH2 . ARG B 35  ? 1.6216 1.8997 2.7973 0.1559  0.3732  0.9550  118 ARG B NH2 
2354 N N   . CYS B 36  ? 1.2635 1.4444 2.3687 0.1289  0.2302  0.8694  119 CYS B N   
2355 C CA  . CYS B 36  ? 1.2217 1.3784 2.3344 0.1259  0.2148  0.8601  119 CYS B CA  
2356 C C   . CYS B 36  ? 1.1404 1.2791 2.2063 0.1491  0.2115  0.8588  119 CYS B C   
2357 O O   . CYS B 36  ? 1.0539 1.1806 2.0963 0.1627  0.2260  0.8856  119 CYS B O   
2358 C CB  . CYS B 36  ? 1.2537 1.3957 2.4100 0.1142  0.2236  0.8861  119 CYS B CB  
2359 S SG  . CYS B 36  ? 1.2759 1.3842 2.4514 0.1090  0.2078  0.8763  119 CYS B SG  
2360 N N   . LYS B 37  ? 1.1315 1.2695 2.1834 0.1522  0.1923  0.8280  120 LYS B N   
2361 C CA  . LYS B 37  ? 1.1986 1.3212 2.2183 0.1723  0.1825  0.8245  120 LYS B CA  
2362 C C   . LYS B 37  ? 1.1654 1.2620 2.2183 0.1703  0.1745  0.8284  120 LYS B C   
2363 O O   . LYS B 37  ? 1.0864 1.1799 2.1770 0.1533  0.1682  0.8094  120 LYS B O   
2364 C CB  . LYS B 37  ? 1.1885 1.3249 2.1871 0.1764  0.1668  0.7892  120 LYS B CB  
2365 C CG  . LYS B 37  ? 1.2374 1.3985 2.2088 0.1755  0.1727  0.7805  120 LYS B CG  
2366 C CD  . LYS B 37  ? 1.3249 1.4952 2.2621 0.1857  0.1595  0.7540  120 LYS B CD  
2367 C CE  . LYS B 37  ? 1.3330 1.5266 2.2540 0.1796  0.1639  0.7406  120 LYS B CE  
2368 N NZ  . LYS B 37  ? 1.3668 1.5683 2.2475 0.1910  0.1550  0.7207  120 LYS B NZ  
2369 N N   . VAL B 38  ? 1.1990 1.2739 2.2361 0.1863  0.1749  0.8534  121 VAL B N   
2370 C CA  . VAL B 38  ? 1.2641 1.3109 2.3353 0.1872  0.1669  0.8603  121 VAL B CA  
2371 C C   . VAL B 38  ? 1.2377 1.2741 2.2986 0.2057  0.1472  0.8496  121 VAL B C   
2372 O O   . VAL B 38  ? 1.1935 1.2266 2.2120 0.2226  0.1424  0.8666  121 VAL B O   
2373 C CB  . VAL B 38  ? 1.2902 1.3156 2.3666 0.1872  0.1815  0.9024  121 VAL B CB  
2374 C CG1 . VAL B 38  ? 1.3193 1.3313 2.3437 0.2071  0.1827  0.9316  121 VAL B CG1 
2375 C CG2 . VAL B 38  ? 1.3174 1.3153 2.4442 0.1801  0.1757  0.9051  121 VAL B CG2 
2376 N N   . PHE B 39  ? 1.2339 1.2644 2.3345 0.2012  0.1362  0.8214  122 PHE B N   
2377 C CA  . PHE B 39  ? 1.2624 1.2845 2.3713 0.2182  0.1180  0.8097  122 PHE B CA  
2378 C C   . PHE B 39  ? 1.2643 1.2539 2.4218 0.2202  0.1148  0.8211  122 PHE B C   
2379 O O   . PHE B 39  ? 1.2914 1.2674 2.4788 0.2038  0.1262  0.8252  122 PHE B O   
2380 C CB  . PHE B 39  ? 1.2458 1.2863 2.3680 0.2127  0.1116  0.7644  122 PHE B CB  
2381 C CG  . PHE B 39  ? 1.2563 1.3271 2.3388 0.2067  0.1153  0.7493  122 PHE B CG  
2382 C CD1 . PHE B 39  ? 1.2560 1.3411 2.2960 0.2224  0.1065  0.7510  122 PHE B CD1 
2383 C CD2 . PHE B 39  ? 1.2570 1.3400 2.3455 0.1843  0.1256  0.7336  122 PHE B CD2 
2384 C CE1 . PHE B 39  ? 1.2531 1.3633 2.2588 0.2171  0.1105  0.7363  122 PHE B CE1 
2385 C CE2 . PHE B 39  ? 1.2733 1.3825 2.3293 0.1794  0.1276  0.7211  122 PHE B CE2 
2386 C CZ  . PHE B 39  ? 1.2836 1.4061 2.2991 0.1963  0.1215  0.7219  122 PHE B CZ  
2387 N N   . PRO B 40  ? 1.2432 1.2194 2.4122 0.2397  0.0979  0.8270  123 PRO B N   
2388 C CA  . PRO B 40  ? 1.2541 1.1994 2.4808 0.2429  0.0936  0.8302  123 PRO B CA  
2389 C C   . PRO B 40  ? 1.2631 1.2109 2.5363 0.2307  0.0982  0.7833  123 PRO B C   
2390 O O   . PRO B 40  ? 1.2471 1.2195 2.5107 0.2326  0.0935  0.7522  123 PRO B O   
2391 C CB  . PRO B 40  ? 1.2737 1.2120 2.4976 0.2681  0.0709  0.8471  123 PRO B CB  
2392 C CG  . PRO B 40  ? 1.2125 1.1834 2.3918 0.2743  0.0622  0.8307  123 PRO B CG  
2393 C CD  . PRO B 40  ? 1.2135 1.2019 2.3456 0.2594  0.0802  0.8320  123 PRO B CD  
2394 N N   . ILE B 41  ? 1.2899 1.2117 2.6087 0.2168  0.1083  0.7768  124 ILE B N   
2395 C CA  . ILE B 41  ? 1.3285 1.2498 2.6791 0.1988  0.1173  0.7283  124 ILE B CA  
2396 C C   . ILE B 41  ? 1.3562 1.2882 2.7263 0.2124  0.1098  0.6966  124 ILE B C   
2397 O O   . ILE B 41  ? 1.3681 1.3178 2.7306 0.1993  0.1162  0.6579  124 ILE B O   
2398 C CB  . ILE B 41  ? 1.3585 1.2423 2.7642 0.1849  0.1276  0.7155  124 ILE B CB  
2399 C CG1 . ILE B 41  ? 1.3770 1.2320 2.7973 0.1830  0.1303  0.7551  124 ILE B CG1 
2400 C CG2 . ILE B 41  ? 1.3746 1.2628 2.7762 0.1539  0.1402  0.6760  124 ILE B CG2 
2401 C CD1 . ILE B 41  ? 1.3928 1.2609 2.7784 0.1647  0.1381  0.7752  124 ILE B CD1 
2402 N N   . LYS B 42  ? 1.3896 1.3100 2.7875 0.2374  0.0958  0.7147  125 LYS B N   
2403 C CA  . LYS B 42  ? 1.3717 1.3020 2.8031 0.2532  0.0870  0.6894  125 LYS B CA  
2404 C C   . LYS B 42  ? 1.3720 1.3413 2.7647 0.2532  0.0827  0.6668  125 LYS B C   
2405 O O   . LYS B 42  ? 1.4512 1.4303 2.8736 0.2538  0.0860  0.6306  125 LYS B O   
2406 C CB  . LYS B 42  ? 1.3952 1.3120 2.8543 0.2811  0.0658  0.7233  125 LYS B CB  
2407 C CG  . LYS B 42  ? 1.4662 1.3416 2.9868 0.2840  0.0703  0.7341  125 LYS B CG  
2408 C CD  . LYS B 42  ? 1.4863 1.3523 3.0787 0.2856  0.0804  0.6915  125 LYS B CD  
2409 C CE  . LYS B 42  ? 1.5118 1.3331 3.1586 0.2790  0.0941  0.6913  125 LYS B CE  
2410 N NZ  . LYS B 42  ? 1.5453 1.3393 3.2067 0.2953  0.0780  0.7437  125 LYS B NZ  
2411 N N   . HIS B 43  ? 1.3701 1.3602 2.6991 0.2517  0.0779  0.6864  126 HIS B N   
2412 C CA  . HIS B 43  ? 1.3024 1.3274 2.5927 0.2518  0.0731  0.6665  126 HIS B CA  
2413 C C   . HIS B 43  ? 1.1617 1.2042 2.4065 0.2293  0.0867  0.6532  126 HIS B C   
2414 O O   . HIS B 43  ? 1.2253 1.2947 2.4365 0.2283  0.0836  0.6380  126 HIS B O   
2415 C CB  . HIS B 43  ? 1.3902 1.4256 2.6480 0.2740  0.0511  0.6971  126 HIS B CB  
2416 C CG  . HIS B 43  ? 1.4748 1.4997 2.7831 0.2960  0.0318  0.7054  126 HIS B CG  
2417 N ND1 . HIS B 43  ? 1.5169 1.5095 2.8661 0.3049  0.0277  0.7312  126 HIS B ND1 
2418 C CD2 . HIS B 43  ? 1.4473 1.4899 2.7795 0.3103  0.0151  0.6909  126 HIS B CD2 
2419 C CE1 . HIS B 43  ? 1.4841 1.4751 2.8803 0.3248  0.0079  0.7342  126 HIS B CE1 
2420 N NE2 . HIS B 43  ? 1.5121 1.5343 2.9005 0.3283  -0.0001 0.7099  126 HIS B NE2 
2421 N N   . TYR B 44  ? 1.0985 1.1259 2.3469 0.2101  0.1005  0.6570  127 TYR B N   
2422 C CA  . TYR B 44  ? 1.0547 1.0989 2.2676 0.1869  0.1107  0.6460  127 TYR B CA  
2423 C C   . TYR B 44  ? 0.9976 1.0577 2.2085 0.1722  0.1150  0.6001  127 TYR B C   
2424 O O   . TYR B 44  ? 0.9988 1.0823 2.1714 0.1638  0.1150  0.5926  127 TYR B O   
2425 C CB  . TYR B 44  ? 1.0408 1.0658 2.2651 0.1673  0.1215  0.6608  127 TYR B CB  
2426 C CG  . TYR B 44  ? 1.0504 1.0643 2.2956 0.1392  0.1311  0.6270  127 TYR B CG  
2427 C CD1 . TYR B 44  ? 1.1379 1.1717 2.3547 0.1182  0.1335  0.6029  127 TYR B CD1 
2428 C CD2 . TYR B 44  ? 1.0635 1.0440 2.3525 0.1315  0.1372  0.6200  127 TYR B CD2 
2429 C CE1 . TYR B 44  ? 1.1941 1.2152 2.4197 0.0890  0.1402  0.5723  127 TYR B CE1 
2430 C CE2 . TYR B 44  ? 1.1176 1.0841 2.4169 0.1026  0.1463  0.5867  127 TYR B CE2 
2431 C CZ  . TYR B 44  ? 1.2232 1.2101 2.4872 0.0805  0.1470  0.5633  127 TYR B CZ  
2432 O OH  . TYR B 44  ? 1.3897 1.3621 2.6517 0.0483  0.1536  0.5304  127 TYR B OH  
2433 N N   . GLN B 45  ? 0.9964 1.0423 2.2485 0.1691  0.1201  0.5699  128 GLN B N   
2434 C CA  . GLN B 45  ? 0.9794 1.0327 2.2272 0.1481  0.1299  0.5257  128 GLN B CA  
2435 C C   . GLN B 45  ? 1.0004 1.0845 2.2228 0.1548  0.1243  0.5092  128 GLN B C   
2436 O O   . GLN B 45  ? 0.9934 1.0909 2.1844 0.1348  0.1292  0.4883  128 GLN B O   
2437 C CB  . GLN B 45  ? 0.9961 1.0226 2.2945 0.1422  0.1423  0.4951  128 GLN B CB  
2438 C CG  . GLN B 45  ? 1.0049 0.9973 2.3238 0.1268  0.1504  0.5031  128 GLN B CG  
2439 C CD  . GLN B 45  ? 1.0283 0.9929 2.3740 0.1052  0.1683  0.4614  128 GLN B CD  
2440 O OE1 . GLN B 45  ? 1.0580 1.0089 2.4498 0.1175  0.1762  0.4419  128 GLN B OE1 
2441 N NE2 . GLN B 45  ? 1.0520 1.0058 2.3706 0.0721  0.1747  0.4484  128 GLN B NE2 
2442 N N   . ASP B 46  ? 1.0916 1.1866 2.3253 0.1815  0.1120  0.5204  129 ASP B N   
2443 C CA  . ASP B 46  ? 1.1748 1.2998 2.3832 0.1874  0.1047  0.5066  129 ASP B CA  
2444 C C   . ASP B 46  ? 1.1825 1.3259 2.3309 0.1834  0.0997  0.5253  129 ASP B C   
2445 O O   . ASP B 46  ? 1.1481 1.3122 2.2684 0.1753  0.1001  0.5062  129 ASP B O   
2446 C CB  . ASP B 46  ? 1.2466 1.3790 2.4842 0.2151  0.0891  0.5144  129 ASP B CB  
2447 C CG  . ASP B 46  ? 1.4127 1.5347 2.7170 0.2185  0.0970  0.4862  129 ASP B CG  
2448 O OD1 . ASP B 46  ? 1.5171 1.6216 2.8390 0.1986  0.1170  0.4600  129 ASP B OD1 
2449 O OD2 . ASP B 46  ? 1.5768 1.7070 2.9177 0.2404  0.0832  0.4901  129 ASP B OD2 
2450 N N   . LYS B 47  ? 1.1980 1.3327 2.3294 0.1892  0.0969  0.5623  130 LYS B N   
2451 C CA  . LYS B 47  ? 1.1239 1.2733 2.2047 0.1864  0.0966  0.5814  130 LYS B CA  
2452 C C   . LYS B 47  ? 1.0815 1.2394 2.1468 0.1599  0.1061  0.5615  130 LYS B C   
2453 O O   . LYS B 47  ? 1.1322 1.3101 2.1624 0.1566  0.1046  0.5570  130 LYS B O   
2454 C CB  . LYS B 47  ? 1.2006 1.3360 2.2729 0.1940  0.0978  0.6230  130 LYS B CB  
2455 C CG  . LYS B 47  ? 1.3080 1.4367 2.3732 0.2198  0.0849  0.6497  130 LYS B CG  
2456 C CD  . LYS B 47  ? 1.3782 1.5257 2.3903 0.2300  0.0779  0.6566  130 LYS B CD  
2457 C CE  . LYS B 47  ? 1.4484 1.6013 2.4631 0.2483  0.0581  0.6513  130 LYS B CE  
2458 N NZ  . LYS B 47  ? 1.4950 1.6266 2.5332 0.2649  0.0453  0.6777  130 LYS B NZ  
2459 N N   . ILE B 48  ? 1.0410 1.1824 2.1311 0.1399  0.1144  0.5491  131 ILE B N   
2460 C CA  . ILE B 48  ? 1.0461 1.1931 2.1176 0.1120  0.1192  0.5357  131 ILE B CA  
2461 C C   . ILE B 48  ? 1.0204 1.1712 2.0871 0.0946  0.1227  0.4944  131 ILE B C   
2462 O O   . ILE B 48  ? 1.0820 1.2378 2.1258 0.0707  0.1235  0.4842  131 ILE B O   
2463 C CB  . ILE B 48  ? 1.1909 1.3186 2.2801 0.0936  0.1240  0.5487  131 ILE B CB  
2464 C CG1 . ILE B 48  ? 1.2274 1.3278 2.3505 0.0811  0.1306  0.5241  131 ILE B CG1 
2465 C CG2 . ILE B 48  ? 1.2404 1.3636 2.3356 0.1105  0.1238  0.5914  131 ILE B CG2 
2466 C CD1 . ILE B 48  ? 1.2642 1.3484 2.3921 0.0516  0.1332  0.5249  131 ILE B CD1 
2467 N N   . ARG B 49  ? 1.0770 1.2273 2.1643 0.1066  0.1242  0.4725  132 ARG B N   
2468 C CA  . ARG B 49  ? 1.0646 1.2192 2.1488 0.0909  0.1317  0.4311  132 ARG B CA  
2469 C C   . ARG B 49  ? 0.9874 1.1624 2.0262 0.0752  0.1292  0.4209  132 ARG B C   
2470 O O   . ARG B 49  ? 0.9660 1.1348 1.9909 0.0486  0.1364  0.3948  132 ARG B O   
2471 C CB  . ARG B 49  ? 1.1427 1.3032 2.2602 0.1121  0.1321  0.4151  132 ARG B CB  
2472 C CG  . ARG B 49  ? 1.2055 1.3412 2.3768 0.1155  0.1423  0.4015  132 ARG B CG  
2473 C CD  . ARG B 49  ? 1.2329 1.3777 2.4443 0.1309  0.1455  0.3781  132 ARG B CD  
2474 N NE  . ARG B 49  ? 1.2991 1.4486 2.5000 0.1084  0.1616  0.3365  132 ARG B NE  
2475 C CZ  . ARG B 49  ? 1.3134 1.4878 2.5067 0.1111  0.1607  0.3196  132 ARG B CZ  
2476 N NH1 . ARG B 49  ? 1.3139 1.5124 2.5085 0.1355  0.1422  0.3388  132 ARG B NH1 
2477 N NH2 . ARG B 49  ? 1.3137 1.4870 2.4955 0.0869  0.1789  0.2821  132 ARG B NH2 
2478 N N   . PRO B 50  ? 0.9470 1.1433 1.9607 0.0907  0.1193  0.4413  133 PRO B N   
2479 C CA  . PRO B 50  ? 0.9492 1.1627 1.9232 0.0772  0.1165  0.4344  133 PRO B CA  
2480 C C   . PRO B 50  ? 0.9302 1.1383 1.8846 0.0497  0.1162  0.4404  133 PRO B C   
2481 O O   . PRO B 50  ? 0.8705 1.0825 1.7998 0.0276  0.1160  0.4224  133 PRO B O   
2482 C CB  . PRO B 50  ? 0.9682 1.1983 1.9236 0.1018  0.1075  0.4613  133 PRO B CB  
2483 C CG  . PRO B 50  ? 1.0151 1.2408 1.9979 0.1274  0.1038  0.4686  133 PRO B CG  
2484 C CD  . PRO B 50  ? 1.0086 1.2113 2.0258 0.1209  0.1103  0.4706  133 PRO B CD  
2485 N N   . TYR B 51  ? 0.9383 1.1377 1.9051 0.0510  0.1146  0.4681  134 TYR B N   
2486 C CA  . TYR B 51  ? 0.8909 1.0857 1.8499 0.0251  0.1112  0.4781  134 TYR B CA  
2487 C C   . TYR B 51  ? 0.9032 1.0780 1.8598 -0.0073 0.1146  0.4472  134 TYR B C   
2488 O O   . TYR B 51  ? 0.8526 1.0277 1.7847 -0.0349 0.1083  0.4416  134 TYR B O   
2489 C CB  . TYR B 51  ? 0.7923 0.9807 1.7742 0.0331  0.1111  0.5124  134 TYR B CB  
2490 C CG  . TYR B 51  ? 0.7809 0.9847 1.7575 0.0613  0.1114  0.5427  134 TYR B CG  
2491 C CD1 . TYR B 51  ? 0.7611 0.9819 1.7220 0.0606  0.1095  0.5620  134 TYR B CD1 
2492 C CD2 . TYR B 51  ? 0.8416 1.0401 1.8282 0.0880  0.1140  0.5528  134 TYR B CD2 
2493 C CE1 . TYR B 51  ? 0.8044 1.0351 1.7562 0.0854  0.1142  0.5871  134 TYR B CE1 
2494 C CE2 . TYR B 51  ? 0.8849 1.0924 1.8572 0.1111  0.1151  0.5803  134 TYR B CE2 
2495 C CZ  . TYR B 51  ? 0.8531 1.0759 1.8058 0.1096  0.1172  0.5957  134 TYR B CZ  
2496 O OH  . TYR B 51  ? 0.9361 1.1642 1.8696 0.1315  0.1226  0.6200  134 TYR B OH  
2497 N N   . ILE B 52  ? 0.9216 1.0776 1.9023 -0.0042 0.1245  0.4273  135 ILE B N   
2498 C CA  . ILE B 52  ? 0.9588 1.0908 1.9353 -0.0340 0.1332  0.3932  135 ILE B CA  
2499 C C   . ILE B 52  ? 0.9784 1.1184 1.9210 -0.0497 0.1366  0.3634  135 ILE B C   
2500 O O   . ILE B 52  ? 1.0260 1.1537 1.9383 -0.0835 0.1356  0.3482  135 ILE B O   
2501 C CB  . ILE B 52  ? 0.9986 1.1081 2.0152 -0.0235 0.1471  0.3760  135 ILE B CB  
2502 C CG1 . ILE B 52  ? 1.0393 1.1308 2.0857 -0.0194 0.1449  0.4008  135 ILE B CG1 
2503 C CG2 . ILE B 52  ? 1.0586 1.1435 2.0660 -0.0528 0.1620  0.3332  135 ILE B CG2 
2504 C CD1 . ILE B 52  ? 1.0646 1.1689 2.1340 0.0158  0.1389  0.4371  135 ILE B CD1 
2505 N N   . GLN B 53  ? 1.0252 1.1846 1.9710 -0.0270 0.1394  0.3565  136 GLN B N   
2506 C CA  . GLN B 53  ? 1.0737 1.2407 1.9918 -0.0410 0.1454  0.3269  136 GLN B CA  
2507 C C   . GLN B 53  ? 0.9799 1.1598 1.8546 -0.0579 0.1326  0.3383  136 GLN B C   
2508 O O   . GLN B 53  ? 1.0084 1.1834 1.8508 -0.0841 0.1357  0.3165  136 GLN B O   
2509 C CB  . GLN B 53  ? 1.1649 1.3510 2.1039 -0.0127 0.1499  0.3174  136 GLN B CB  
2510 C CG  . GLN B 53  ? 1.2937 1.4669 2.2754 -0.0057 0.1672  0.2897  136 GLN B CG  
2511 C CD  . GLN B 53  ? 1.3905 1.5473 2.4178 0.0121  0.1682  0.3040  136 GLN B CD  
2512 O OE1 . GLN B 53  ? 1.3516 1.4809 2.3856 -0.0060 0.1769  0.2953  136 GLN B OE1 
2513 N NE2 . GLN B 53  ? 1.3914 1.5623 2.4488 0.0463  0.1590  0.3250  136 GLN B NE2 
2514 N N   . LEU B 54  ? 0.9572 1.1519 1.8324 -0.0432 0.1192  0.3733  137 LEU B N   
2515 C CA  . LEU B 54  ? 0.9272 1.1358 1.7711 -0.0540 0.1068  0.3880  137 LEU B CA  
2516 C C   . LEU B 54  ? 0.9654 1.1614 1.7978 -0.0851 0.0958  0.4001  137 LEU B C   
2517 O O   . LEU B 54  ? 0.9946 1.1819 1.8513 -0.0841 0.0934  0.4179  137 LEU B O   
2518 C CB  . LEU B 54  ? 0.8772 1.1069 1.7308 -0.0217 0.1012  0.4182  137 LEU B CB  
2519 C CG  . LEU B 54  ? 0.8347 1.0840 1.6657 -0.0141 0.0942  0.4296  137 LEU B CG  
2520 C CD1 . LEU B 54  ? 0.8419 1.0973 1.6786 -0.0131 0.0862  0.4638  137 LEU B CD1 
2521 C CD2 . LEU B 54  ? 0.8494 1.1002 1.6483 -0.0365 0.0926  0.4061  137 LEU B CD2 
2522 N N   . PRO B 55  ? 1.0017 1.1954 1.7973 -0.1144 0.0876  0.3914  138 PRO B N   
2523 C CA  . PRO B 55  ? 1.0020 1.1890 1.7860 -0.1430 0.0701  0.4094  138 PRO B CA  
2524 C C   . PRO B 55  ? 0.9812 1.1903 1.7881 -0.1238 0.0584  0.4493  138 PRO B C   
2525 O O   . PRO B 55  ? 0.9133 1.1416 1.7239 -0.0967 0.0623  0.4582  138 PRO B O   
2526 C CB  . PRO B 55  ? 1.0097 1.1928 1.7467 -0.1723 0.0631  0.3935  138 PRO B CB  
2527 C CG  . PRO B 55  ? 1.0181 1.1973 1.7421 -0.1673 0.0827  0.3585  138 PRO B CG  
2528 C CD  . PRO B 55  ? 1.0188 1.2141 1.7823 -0.1250 0.0937  0.3639  138 PRO B CD  
2529 N N   . SER B 56  ? 1.0645 1.2703 1.8871 -0.1394 0.0450  0.4722  139 SER B N   
2530 C CA  . SER B 56  ? 1.0696 1.2966 1.9230 -0.1219 0.0376  0.5107  139 SER B CA  
2531 C C   . SER B 56  ? 1.0303 1.2733 1.8667 -0.1251 0.0262  0.5208  139 SER B C   
2532 O O   . SER B 56  ? 1.0493 1.2844 1.8491 -0.1492 0.0180  0.5031  139 SER B O   
2533 C CB  . SER B 56  ? 1.0887 1.3096 1.9711 -0.1400 0.0257  0.5327  139 SER B CB  
2534 O OG  . SER B 56  ? 1.0984 1.3081 1.9573 -0.1804 0.0048  0.5284  139 SER B OG  
2535 N N   . HIS B 57  ? 0.9743 1.2378 1.8372 -0.0998 0.0281  0.5488  140 HIS B N   
2536 C CA  . HIS B 57  ? 0.9313 1.2098 1.7855 -0.0942 0.0223  0.5586  140 HIS B CA  
2537 C C   . HIS B 57  ? 0.9527 1.2498 1.8484 -0.0706 0.0267  0.5934  140 HIS B C   
2538 O O   . HIS B 57  ? 1.0205 1.3208 1.9346 -0.0447 0.0435  0.6016  140 HIS B O   
2539 C CB  . HIS B 57  ? 0.9186 1.1981 1.7423 -0.0769 0.0353  0.5339  140 HIS B CB  
2540 C CG  . HIS B 57  ? 0.9601 1.2508 1.7702 -0.0723 0.0306  0.5392  140 HIS B CG  
2541 N ND1 . HIS B 57  ? 0.9972 1.3020 1.8213 -0.0418 0.0407  0.5548  140 HIS B ND1 
2542 C CD2 . HIS B 57  ? 0.9702 1.2570 1.7513 -0.0948 0.0183  0.5299  140 HIS B CD2 
2543 C CE1 . HIS B 57  ? 0.9730 1.2822 1.7812 -0.0445 0.0348  0.5543  140 HIS B CE1 
2544 N NE2 . HIS B 57  ? 1.0148 1.3139 1.7977 -0.0763 0.0203  0.5407  140 HIS B NE2 
2545 N N   . SER B 58  ? 1.0373 1.3452 1.9487 -0.0807 0.0121  0.6147  141 SER B N   
2546 C CA  . SER B 58  ? 1.0538 1.3799 2.0130 -0.0617 0.0175  0.6485  141 SER B CA  
2547 C C   . SER B 58  ? 1.0014 1.3350 1.9609 -0.0229 0.0438  0.6506  141 SER B C   
2548 O O   . SER B 58  ? 1.0904 1.4339 2.0872 -0.0057 0.0568  0.6749  141 SER B O   
2549 C CB  . SER B 58  ? 1.0786 1.4152 2.0545 -0.0764 -0.0026 0.6677  141 SER B CB  
2550 O OG  . SER B 58  ? 1.2284 1.5597 2.1618 -0.0809 -0.0077 0.6491  141 SER B OG  
2551 N N   . ASN B 59  ? 0.9581 1.2864 1.8759 -0.0115 0.0514  0.6260  142 ASN B N   
2552 C CA  . ASN B 59  ? 0.9201 1.2512 1.8268 0.0222  0.0734  0.6241  142 ASN B CA  
2553 C C   . ASN B 59  ? 0.9092 1.2305 1.7960 0.0361  0.0844  0.6073  142 ASN B C   
2554 O O   . ASN B 59  ? 0.9300 1.2513 1.7980 0.0605  0.0977  0.6031  142 ASN B O   
2555 C CB  . ASN B 59  ? 0.9041 1.2372 1.7825 0.0281  0.0731  0.6115  142 ASN B CB  
2556 C CG  . ASN B 59  ? 0.9330 1.2745 1.8344 0.0186  0.0628  0.6303  142 ASN B CG  
2557 O OD1 . ASN B 59  ? 1.0570 1.4076 2.0036 0.0169  0.0614  0.6577  142 ASN B OD1 
2558 N ND2 . ASN B 59  ? 0.9896 1.3286 1.8648 0.0124  0.0553  0.6171  142 ASN B ND2 
2559 N N   . ILE B 60  ? 0.9173 1.2289 1.8090 0.0208  0.0784  0.5986  143 ILE B N   
2560 C CA  . ILE B 60  ? 0.9197 1.2215 1.8070 0.0355  0.0885  0.5894  143 ILE B CA  
2561 C C   . ILE B 60  ? 0.8735 1.1701 1.7957 0.0326  0.0915  0.6100  143 ILE B C   
2562 O O   . ILE B 60  ? 0.7589 1.0518 1.6984 0.0070  0.0798  0.6125  143 ILE B O   
2563 C CB  . ILE B 60  ? 0.8899 1.1801 1.7566 0.0215  0.0828  0.5562  143 ILE B CB  
2564 C CG1 . ILE B 60  ? 0.8851 1.1792 1.7204 0.0136  0.0773  0.5343  143 ILE B CG1 
2565 C CG2 . ILE B 60  ? 0.8949 1.1777 1.7623 0.0428  0.0926  0.5487  143 ILE B CG2 
2566 C CD1 . ILE B 60  ? 0.9035 1.2042 1.7195 0.0395  0.0853  0.5271  143 ILE B CD1 
2567 N N   . THR B 61  ? 0.8950 1.1891 1.8240 0.0567  0.1062  0.6242  144 THR B N   
2568 C CA  . THR B 61  ? 0.8811 1.1690 1.8434 0.0562  0.1119  0.6458  144 THR B CA  
2569 C C   . THR B 61  ? 0.9102 1.1802 1.8778 0.0429  0.1057  0.6293  144 THR B C   
2570 O O   . THR B 61  ? 1.0090 1.2696 1.9613 0.0559  0.1091  0.6138  144 THR B O   
2571 C CB  . THR B 61  ? 0.8973 1.1833 1.8562 0.0852  0.1305  0.6651  144 THR B CB  
2572 O OG1 . THR B 61  ? 0.8494 1.1484 1.8079 0.0966  0.1416  0.6817  144 THR B OG1 
2573 C CG2 . THR B 61  ? 0.9434 1.2197 1.9339 0.0843  0.1372  0.6864  144 THR B CG2 
2574 N N   . GLY B 62  ? 0.8779 1.1426 1.8697 0.0169  0.0962  0.6329  145 GLY B N   
2575 C CA  . GLY B 62  ? 0.8825 1.1260 1.8813 0.0017  0.0926  0.6166  145 GLY B CA  
2576 C C   . GLY B 62  ? 0.9271 1.1586 1.9542 0.0133  0.1026  0.6357  145 GLY B C   
2577 O O   . GLY B 62  ? 0.9784 1.2187 2.0231 0.0281  0.1123  0.6655  145 GLY B O   
2578 N N   . ILE B 63  ? 0.9322 1.1418 1.9651 0.0050  0.1021  0.6182  146 ILE B N   
2579 C CA  . ILE B 63  ? 0.9454 1.1388 2.0097 0.0078  0.1083  0.6354  146 ILE B CA  
2580 C C   . ILE B 63  ? 0.9620 1.1546 2.0524 -0.0220 0.0989  0.6475  146 ILE B C   
2581 O O   . ILE B 63  ? 0.9510 1.1392 2.0302 -0.0502 0.0856  0.6278  146 ILE B O   
2582 C CB  . ILE B 63  ? 1.0104 1.1772 2.0781 0.0061  0.1104  0.6101  146 ILE B CB  
2583 C CG1 . ILE B 63  ? 1.0030 1.1702 2.0526 0.0316  0.1154  0.5938  146 ILE B CG1 
2584 C CG2 . ILE B 63  ? 1.0681 1.2147 2.1709 0.0061  0.1157  0.6286  146 ILE B CG2 
2585 C CD1 . ILE B 63  ? 1.0010 1.1835 2.0377 0.0618  0.1205  0.6169  146 ILE B CD1 
2586 N N   . VAL B 64  ? 0.9615 1.1574 2.0857 -0.0177 0.1050  0.6802  147 VAL B N   
2587 C CA  . VAL B 64  ? 0.9400 1.1349 2.0982 -0.0463 0.0947  0.6943  147 VAL B CA  
2588 C C   . VAL B 64  ? 1.0098 1.1726 2.1805 -0.0623 0.0931  0.6805  147 VAL B C   
2589 O O   . VAL B 64  ? 1.0979 1.2476 2.2659 -0.0941 0.0790  0.6626  147 VAL B O   
2590 C CB  . VAL B 64  ? 0.9320 1.1441 2.1295 -0.0360 0.1051  0.7354  147 VAL B CB  
2591 C CG1 . VAL B 64  ? 0.9240 1.1399 2.1630 -0.0678 0.0905  0.7501  147 VAL B CG1 
2592 C CG2 . VAL B 64  ? 0.8920 1.1312 2.0789 -0.0150 0.1137  0.7488  147 VAL B CG2 
2593 N N   . GLU B 65  ? 1.0216 1.1697 2.2044 -0.0407 0.1076  0.6901  148 GLU B N   
2594 C CA  . GLU B 65  ? 1.0800 1.1958 2.2841 -0.0502 0.1098  0.6839  148 GLU B CA  
2595 C C   . GLU B 65  ? 1.0638 1.1663 2.2618 -0.0184 0.1230  0.6832  148 GLU B C   
2596 O O   . GLU B 65  ? 1.0626 1.1810 2.2515 0.0079  0.1314  0.7047  148 GLU B O   
2597 C CB  . GLU B 65  ? 1.1564 1.2711 2.4043 -0.0578 0.1130  0.7188  148 GLU B CB  
2598 C CG  . GLU B 65  ? 1.2407 1.3537 2.5139 -0.0961 0.0971  0.7212  148 GLU B CG  
2599 C CD  . GLU B 65  ? 1.2976 1.4113 2.6215 -0.1001 0.1030  0.7581  148 GLU B CD  
2600 O OE1 . GLU B 65  ? 1.3359 1.4667 2.6882 -0.1231 0.0908  0.7739  148 GLU B OE1 
2601 O OE2 . GLU B 65  ? 1.3698 1.4673 2.7081 -0.0816 0.1189  0.7734  148 GLU B OE2 
2602 N N   . VAL B 66  ? 1.0478 1.1201 2.2526 -0.0208 0.1247  0.6611  149 VAL B N   
2603 C CA  . VAL B 66  ? 1.0665 1.1219 2.2840 0.0071  0.1347  0.6733  149 VAL B CA  
2604 C C   . VAL B 66  ? 1.0819 1.1077 2.3379 -0.0065 0.1376  0.6847  149 VAL B C   
2605 O O   . VAL B 66  ? 1.0704 1.0775 2.3358 -0.0351 0.1325  0.6621  149 VAL B O   
2606 C CB  . VAL B 66  ? 1.1051 1.1521 2.3085 0.0258  0.1360  0.6445  149 VAL B CB  
2607 C CG1 . VAL B 66  ? 1.0690 1.1386 2.2371 0.0219  0.1307  0.6176  149 VAL B CG1 
2608 C CG2 . VAL B 66  ? 1.1783 1.1895 2.4070 0.0159  0.1391  0.6188  149 VAL B CG2 
2609 N N   . ILE B 67  ? 1.1031 1.1225 2.3774 0.0117  0.1458  0.7196  150 ILE B N   
2610 C CA  . ILE B 67  ? 1.1421 1.1293 2.4546 0.0038  0.1502  0.7336  150 ILE B CA  
2611 C C   . ILE B 67  ? 1.1280 1.0916 2.4475 0.0324  0.1554  0.7396  150 ILE B C   
2612 O O   . ILE B 67  ? 1.0853 1.0625 2.3823 0.0599  0.1570  0.7550  150 ILE B O   
2613 C CB  . ILE B 67  ? 1.1546 1.1528 2.4882 -0.0020 0.1560  0.7751  150 ILE B CB  
2614 C CG1 . ILE B 67  ? 1.1726 1.1909 2.5134 -0.0333 0.1467  0.7695  150 ILE B CG1 
2615 C CG2 . ILE B 67  ? 1.1887 1.1530 2.5600 -0.0054 0.1622  0.7942  150 ILE B CG2 
2616 C CD1 . ILE B 67  ? 1.1794 1.2194 2.5464 -0.0386 0.1526  0.8088  150 ILE B CD1 
2617 N N   . LEU B 68  ? 1.1314 1.0583 2.4816 0.0252  0.1567  0.7268  151 LEU B N   
2618 C CA  . LEU B 68  ? 1.1604 1.0624 2.5268 0.0513  0.1591  0.7331  151 LEU B CA  
2619 C C   . LEU B 68  ? 1.2094 1.0865 2.6056 0.0539  0.1647  0.7717  151 LEU B C   
2620 O O   . LEU B 68  ? 1.2485 1.1076 2.6716 0.0292  0.1674  0.7736  151 LEU B O   
2621 C CB  . LEU B 68  ? 1.1954 1.0707 2.5813 0.0453  0.1595  0.6897  151 LEU B CB  
2622 C CG  . LEU B 68  ? 1.1715 1.0661 2.5308 0.0450  0.1571  0.6477  151 LEU B CG  
2623 C CD1 . LEU B 68  ? 1.1860 1.0586 2.5708 0.0603  0.1611  0.6199  151 LEU B CD1 
2624 C CD2 . LEU B 68  ? 1.1422 1.0773 2.4623 0.0640  0.1514  0.6602  151 LEU B CD2 
2625 N N   . GLY B 69  ? 1.2431 1.1170 2.6325 0.0825  0.1652  0.8027  152 GLY B N   
2626 C CA  . GLY B 69  ? 1.2826 1.1273 2.6973 0.0882  0.1704  0.8412  152 GLY B CA  
2627 C C   . GLY B 69  ? 1.3022 1.1159 2.7394 0.1095  0.1647  0.8385  152 GLY B C   
2628 O O   . GLY B 69  ? 1.2823 1.0975 2.7232 0.1168  0.1590  0.8038  152 GLY B O   
2629 N N   . GLU B 70  ? 1.3844 1.1696 2.8404 0.1191  0.1666  0.8759  153 GLU B N   
2630 C CA  . GLU B 70  ? 1.4396 1.1914 2.9265 0.1395  0.1591  0.8790  153 GLU B CA  
2631 C C   . GLU B 70  ? 1.4480 1.2181 2.9085 0.1689  0.1456  0.8780  153 GLU B C   
2632 O O   . GLU B 70  ? 1.4918 1.2555 2.9785 0.1791  0.1389  0.8488  153 GLU B O   
2633 C CB  . GLU B 70  ? 1.4755 1.1927 2.9833 0.1421  0.1626  0.9247  153 GLU B CB  
2634 C CG  . GLU B 70  ? 1.5794 1.2575 3.1264 0.1628  0.1532  0.9344  153 GLU B CG  
2635 C CD  . GLU B 70  ? 1.6094 1.2431 3.2183 0.1483  0.1598  0.9201  153 GLU B CD  
2636 O OE1 . GLU B 70  ? 1.6102 1.2439 3.2320 0.1215  0.1692  0.8856  153 GLU B OE1 
2637 O OE2 . GLU B 70  ? 1.5433 1.1397 3.1870 0.1635  0.1545  0.9440  153 GLU B OE2 
2638 N N   . THR B 71  ? 1.4332 1.2258 2.8434 0.1809  0.1429  0.9079  154 THR B N   
2639 C CA  . THR B 71  ? 1.4005 1.2093 2.7793 0.2069  0.1273  0.9112  154 THR B CA  
2640 C C   . THR B 71  ? 1.3869 1.2376 2.7251 0.2054  0.1266  0.8838  154 THR B C   
2641 O O   . THR B 71  ? 1.4109 1.2755 2.7382 0.2225  0.1130  0.8694  154 THR B O   
2642 C CB  . THR B 71  ? 1.4158 1.2167 2.7542 0.2209  0.1238  0.9631  154 THR B CB  
2643 O OG1 . THR B 71  ? 1.4269 1.1860 2.8022 0.2233  0.1228  0.9925  154 THR B OG1 
2644 C CG2 . THR B 71  ? 1.3909 1.2056 2.6911 0.2456  0.1038  0.9688  154 THR B CG2 
2645 N N   . LYS B 72  ? 1.4203 1.2913 2.7393 0.1849  0.1401  0.8780  155 LYS B N   
2646 C CA  . LYS B 72  ? 1.3683 1.2787 2.6444 0.1826  0.1408  0.8593  155 LYS B CA  
2647 C C   . LYS B 72  ? 1.2498 1.1770 2.5376 0.1576  0.1467  0.8209  155 LYS B C   
2648 O O   . LYS B 72  ? 1.1966 1.1081 2.5170 0.1364  0.1534  0.8152  155 LYS B O   
2649 C CB  . LYS B 72  ? 1.4344 1.3576 2.6672 0.1839  0.1510  0.8953  155 LYS B CB  
2650 C CG  . LYS B 72  ? 1.5204 1.4315 2.7179 0.2073  0.1438  0.9303  155 LYS B CG  
2651 C CD  . LYS B 72  ? 1.6207 1.5156 2.8042 0.2036  0.1593  0.9756  155 LYS B CD  
2652 C CE  . LYS B 72  ? 1.7458 1.6254 2.8818 0.2241  0.1512  1.0106  155 LYS B CE  
2653 N NZ  . LYS B 72  ? 1.7453 1.6512 2.8202 0.2343  0.1477  1.0023  155 LYS B NZ  
2654 N N   . ALA B 73  ? 1.1969 1.1535 2.4563 0.1594  0.1422  0.7944  156 ALA B N   
2655 C CA  . ALA B 73  ? 1.1555 1.1325 2.4098 0.1356  0.1462  0.7653  156 ALA B CA  
2656 C C   . ALA B 73  ? 1.1442 1.1480 2.3639 0.1337  0.1526  0.7876  156 ALA B C   
2657 O O   . ALA B 73  ? 1.1773 1.1905 2.3629 0.1537  0.1526  0.8082  156 ALA B O   
2658 C CB  . ALA B 73  ? 1.1298 1.1217 2.3743 0.1379  0.1391  0.7241  156 ALA B CB  
2659 N N   . TYR B 74  ? 1.1272 1.1424 2.3559 0.1091  0.1577  0.7827  157 TYR B N   
2660 C CA  . TYR B 74  ? 1.0974 1.1406 2.3045 0.1057  0.1651  0.8004  157 TYR B CA  
2661 C C   . TYR B 74  ? 1.0425 1.1094 2.2385 0.0897  0.1583  0.7687  157 TYR B C   
2662 O O   . TYR B 74  ? 1.0026 1.0636 2.2202 0.0648  0.1534  0.7494  157 TYR B O   
2663 C CB  . TYR B 74  ? 1.1275 1.1642 2.3658 0.0897  0.1755  0.8292  157 TYR B CB  
2664 C CG  . TYR B 74  ? 1.1853 1.1951 2.4334 0.1031  0.1831  0.8624  157 TYR B CG  
2665 C CD1 . TYR B 74  ? 1.2358 1.2121 2.5174 0.0989  0.1786  0.8586  157 TYR B CD1 
2666 C CD2 . TYR B 74  ? 1.2050 1.2196 2.4261 0.1196  0.1959  0.8972  157 TYR B CD2 
2667 C CE1 . TYR B 74  ? 1.2877 1.2368 2.5785 0.1112  0.1840  0.8917  157 TYR B CE1 
2668 C CE2 . TYR B 74  ? 1.2648 1.2517 2.4882 0.1303  0.2022  0.9298  157 TYR B CE2 
2669 C CZ  . TYR B 74  ? 1.3015 1.2561 2.5611 0.1264  0.1950  0.9284  157 TYR B CZ  
2670 O OH  . TYR B 74  ? 1.3230 1.2480 2.5855 0.1365  0.1998  0.9634  157 TYR B OH  
2671 N N   . VAL B 75  ? 1.0439 1.1347 2.2032 0.1023  0.1573  0.7632  158 VAL B N   
2672 C CA  . VAL B 75  ? 1.0479 1.1607 2.1932 0.0879  0.1503  0.7352  158 VAL B CA  
2673 C C   . VAL B 75  ? 1.0402 1.1786 2.1789 0.0840  0.1572  0.7556  158 VAL B C   
2674 O O   . VAL B 75  ? 1.0435 1.1908 2.1598 0.1037  0.1673  0.7761  158 VAL B O   
2675 C CB  . VAL B 75  ? 1.0096 1.1301 2.1234 0.1038  0.1435  0.7099  158 VAL B CB  
2676 C CG1 . VAL B 75  ? 0.9605 1.0968 2.0622 0.0854  0.1362  0.6780  158 VAL B CG1 
2677 C CG2 . VAL B 75  ? 1.0678 1.1639 2.1979 0.1139  0.1392  0.6975  158 VAL B CG2 
2678 N N   . PHE B 76  ? 1.0354 1.1838 2.1944 0.0581  0.1517  0.7501  159 PHE B N   
2679 C CA  . PHE B 76  ? 1.0443 1.2166 2.2144 0.0527  0.1579  0.7728  159 PHE B CA  
2680 C C   . PHE B 76  ? 1.0772 1.2735 2.2235 0.0502  0.1507  0.7562  159 PHE B C   
2681 O O   . PHE B 76  ? 1.0820 1.2773 2.2162 0.0352  0.1362  0.7266  159 PHE B O   
2682 C CB  . PHE B 76  ? 1.0527 1.2217 2.2692 0.0260  0.1542  0.7857  159 PHE B CB  
2683 C CG  . PHE B 76  ? 1.0771 1.2252 2.3199 0.0306  0.1658  0.8106  159 PHE B CG  
2684 C CD1 . PHE B 76  ? 1.0941 1.2507 2.3501 0.0424  0.1848  0.8468  159 PHE B CD1 
2685 C CD2 . PHE B 76  ? 1.0884 1.2061 2.3419 0.0235  0.1601  0.7977  159 PHE B CD2 
2686 C CE1 . PHE B 76  ? 1.1147 1.2501 2.3922 0.0453  0.1962  0.8713  159 PHE B CE1 
2687 C CE2 . PHE B 76  ? 1.1085 1.2045 2.3866 0.0279  0.1701  0.8220  159 PHE B CE2 
2688 C CZ  . PHE B 76  ? 1.1278 1.2327 2.4166 0.0381  0.1874  0.8598  159 PHE B CZ  
2689 N N   . PHE B 77  ? 1.1408 1.3561 2.2786 0.0653  0.1632  0.7756  160 PHE B N   
2690 C CA  . PHE B 77  ? 1.1314 1.3680 2.2455 0.0691  0.1603  0.7644  160 PHE B CA  
2691 C C   . PHE B 77  ? 1.1258 1.3842 2.2725 0.0643  0.1694  0.7904  160 PHE B C   
2692 O O   . PHE B 77  ? 1.0375 1.2962 2.2045 0.0736  0.1888  0.8189  160 PHE B O   
2693 C CB  . PHE B 77  ? 1.0848 1.3202 2.1531 0.0977  0.1705  0.7613  160 PHE B CB  
2694 C CG  . PHE B 77  ? 1.1468 1.3699 2.1861 0.1036  0.1587  0.7329  160 PHE B CG  
2695 C CD1 . PHE B 77  ? 1.2104 1.4120 2.2633 0.1011  0.1539  0.7277  160 PHE B CD1 
2696 C CD2 . PHE B 77  ? 1.1763 1.4086 2.1792 0.1123  0.1534  0.7114  160 PHE B CD2 
2697 C CE1 . PHE B 77  ? 1.1496 1.3410 2.1862 0.1075  0.1447  0.7018  160 PHE B CE1 
2698 C CE2 . PHE B 77  ? 1.1356 1.3587 2.1203 0.1175  0.1432  0.6855  160 PHE B CE2 
2699 C CZ  . PHE B 77  ? 1.1046 1.3081 2.1088 0.1156  0.1393  0.6810  160 PHE B CZ  
2700 N N   . GLU B 78  ? 1.0919 1.3681 2.2462 0.0495  0.1561  0.7817  161 GLU B N   
2701 C CA  . GLU B 78  ? 1.0613 1.3618 2.2444 0.0519  0.1654  0.8036  161 GLU B CA  
2702 C C   . GLU B 78  ? 1.0438 1.3473 2.2027 0.0816  0.1925  0.8148  161 GLU B C   
2703 O O   . GLU B 78  ? 1.0184 1.3103 2.1272 0.0983  0.1957  0.7991  161 GLU B O   
2704 C CB  . GLU B 78  ? 1.0495 1.3654 2.2310 0.0374  0.1457  0.7900  161 GLU B CB  
2705 C CG  . GLU B 78  ? 1.0863 1.4004 2.2888 0.0032  0.1176  0.7821  161 GLU B CG  
2706 C CD  . GLU B 78  ? 1.1449 1.4642 2.4076 -0.0150 0.1139  0.8082  161 GLU B CD  
2707 O OE1 . GLU B 78  ? 1.1745 1.5058 2.4774 -0.0030 0.1339  0.8373  161 GLU B OE1 
2708 O OE2 . GLU B 78  ? 1.1715 1.4810 2.4408 -0.0441 0.0908  0.7982  161 GLU B OE2 
2709 N N   . LYS B 79  ? 1.0637 1.3819 2.2590 0.0872  0.2126  0.8416  162 LYS B N   
2710 C CA  . LYS B 79  ? 1.0689 1.3855 2.2365 0.1137  0.2431  0.8512  162 LYS B CA  
2711 C C   . LYS B 79  ? 1.0406 1.3710 2.1930 0.1225  0.2459  0.8405  162 LYS B C   
2712 O O   . LYS B 79  ? 1.0266 1.3746 2.2125 0.1085  0.2300  0.8386  162 LYS B O   
2713 C CB  . LYS B 79  ? 1.0610 1.3807 2.2683 0.1184  0.2724  0.8842  162 LYS B CB  
2714 C CG  . LYS B 79  ? 1.0803 1.4246 2.3657 0.1018  0.2707  0.9039  162 LYS B CG  
2715 C CD  . LYS B 79  ? 1.2061 1.5548 2.5274 0.1112  0.3080  0.9350  162 LYS B CD  
2716 C CE  . LYS B 79  ? 1.2635 1.6201 2.5724 0.1318  0.3381  0.9374  162 LYS B CE  
2717 N NZ  . LYS B 79  ? 1.2981 1.6626 2.6552 0.1374  0.3773  0.9678  162 LYS B NZ  
2718 N N   . ASP B 80  ? 1.0255 1.3453 2.1253 0.1445  0.2645  0.8339  163 ASP B N   
2719 C CA  . ASP B 80  ? 1.0009 1.3284 2.0815 0.1553  0.2721  0.8235  163 ASP B CA  
2720 C C   . ASP B 80  ? 1.0203 1.3534 2.1230 0.1691  0.3097  0.8453  163 ASP B C   
2721 O O   . ASP B 80  ? 1.0913 1.4174 2.2041 0.1740  0.3337  0.8664  163 ASP B O   
2722 C CB  . ASP B 80  ? 1.0159 1.3267 2.0217 0.1689  0.2676  0.7987  163 ASP B CB  
2723 C CG  . ASP B 80  ? 1.1220 1.4121 2.0802 0.1881  0.2930  0.8078  163 ASP B CG  
2724 O OD1 . ASP B 80  ? 1.1804 1.4678 2.1264 0.2011  0.3227  0.8167  163 ASP B OD1 
2725 O OD2 . ASP B 80  ? 1.2466 1.5204 2.1764 0.1899  0.2830  0.8054  163 ASP B OD2 
2726 N N   . PHE B 81  ? 0.9301 1.2735 2.0387 0.1754  0.3168  0.8392  164 PHE B N   
2727 C CA  . PHE B 81  ? 0.9277 1.2749 2.0577 0.1898  0.3559  0.8549  164 PHE B CA  
2728 C C   . PHE B 81  ? 0.9575 1.2892 2.0223 0.2071  0.3700  0.8345  164 PHE B C   
2729 O O   . PHE B 81  ? 1.0579 1.3973 2.1409 0.2131  0.3806  0.8307  164 PHE B O   
2730 C CB  . PHE B 81  ? 0.9350 1.3100 2.1514 0.1801  0.3520  0.8702  164 PHE B CB  
2731 C CG  . PHE B 81  ? 0.9619 1.3517 2.2423 0.1601  0.3347  0.8899  164 PHE B CG  
2732 C CD1 . PHE B 81  ? 0.9553 1.3470 2.2341 0.1389  0.2923  0.8788  164 PHE B CD1 
2733 C CD2 . PHE B 81  ? 1.0419 1.4419 2.3825 0.1610  0.3625  0.9187  164 PHE B CD2 
2734 C CE1 . PHE B 81  ? 0.9685 1.3699 2.3012 0.1181  0.2756  0.8951  164 PHE B CE1 
2735 C CE2 . PHE B 81  ? 1.0618 1.4747 2.4624 0.1407  0.3448  0.9368  164 PHE B CE2 
2736 C CZ  . PHE B 81  ? 1.0056 1.4181 2.4002 0.1189  0.3002  0.9245  164 PHE B CZ  
2737 N N   . GLY B 82  ? 0.9408 1.2494 1.9309 0.2145  0.3682  0.8216  165 GLY B N   
2738 C CA  . GLY B 82  ? 0.9615 1.2511 1.8809 0.2293  0.3804  0.8028  165 GLY B CA  
2739 C C   . GLY B 82  ? 0.9467 1.2361 1.8311 0.2246  0.3452  0.7745  165 GLY B C   
2740 O O   . GLY B 82  ? 0.8881 1.1937 1.8081 0.2099  0.3158  0.7689  165 GLY B O   
2741 N N   . ASP B 83  ? 1.0197 1.2891 1.8320 0.2359  0.3496  0.7570  166 ASP B N   
2742 C CA  . ASP B 83  ? 1.0363 1.3022 1.8062 0.2335  0.3199  0.7293  166 ASP B CA  
2743 C C   . ASP B 83  ? 1.0490 1.3104 1.7957 0.2404  0.3294  0.7120  166 ASP B C   
2744 O O   . ASP B 83  ? 1.0292 1.2813 1.7711 0.2511  0.3632  0.7189  166 ASP B O   
2745 C CB  . ASP B 83  ? 1.0905 1.3361 1.7969 0.2396  0.3114  0.7241  166 ASP B CB  
2746 C CG  . ASP B 83  ? 1.1920 1.4118 1.8330 0.2540  0.3394  0.7258  166 ASP B CG  
2747 O OD1 . ASP B 83  ? 1.3597 1.5690 1.9521 0.2589  0.3363  0.7049  166 ASP B OD1 
2748 O OD2 . ASP B 83  ? 1.2210 1.4285 1.8538 0.2588  0.3645  0.7472  166 ASP B OD2 
2749 N N   . MET B 84  ? 1.0351 1.3008 1.7663 0.2340  0.3017  0.6886  167 MET B N   
2750 C CA  . MET B 84  ? 1.0392 1.3001 1.7520 0.2383  0.3069  0.6711  167 MET B CA  
2751 C C   . MET B 84  ? 1.0845 1.3191 1.7242 0.2516  0.3244  0.6582  167 MET B C   
2752 O O   . MET B 84  ? 1.1437 1.3697 1.7695 0.2566  0.3367  0.6457  167 MET B O   
2753 C CB  . MET B 84  ? 0.9969 1.2691 1.7139 0.2253  0.2728  0.6506  167 MET B CB  
2754 C CG  . MET B 84  ? 0.9909 1.2844 1.7752 0.2109  0.2603  0.6613  167 MET B CG  
2755 S SD  . MET B 84  ? 1.0617 1.3587 1.8922 0.2186  0.2872  0.6753  167 MET B SD  
2756 C CE  . MET B 84  ? 1.0272 1.3099 1.8106 0.2225  0.2830  0.6468  167 MET B CE  
2757 N N   . HIS B 85  ? 1.0688 1.2881 1.6607 0.2564  0.3246  0.6616  168 HIS B N   
2758 C CA  . HIS B 85  ? 1.1539 1.3453 1.6693 0.2660  0.3383  0.6508  168 HIS B CA  
2759 C C   . HIS B 85  ? 1.1888 1.3634 1.6965 0.2757  0.3847  0.6654  168 HIS B C   
2760 O O   . HIS B 85  ? 1.2483 1.4032 1.7172 0.2821  0.4063  0.6524  168 HIS B O   
2761 C CB  . HIS B 85  ? 1.2205 1.4004 1.6851 0.2663  0.3166  0.6501  168 HIS B CB  
2762 C CG  . HIS B 85  ? 1.3177 1.4654 1.6996 0.2741  0.3316  0.6464  168 HIS B CG  
2763 N ND1 . HIS B 85  ? 1.3729 1.5008 1.7248 0.2792  0.3570  0.6676  168 HIS B ND1 
2764 C CD2 . HIS B 85  ? 1.3749 1.5042 1.6946 0.2756  0.3259  0.6243  168 HIS B CD2 
2765 C CE1 . HIS B 85  ? 1.4705 1.5675 1.7398 0.2828  0.3655  0.6586  168 HIS B CE1 
2766 N NE2 . HIS B 85  ? 1.4712 1.5687 1.7202 0.2807  0.3457  0.6319  168 HIS B NE2 
2767 N N   . SER B 86  ? 1.2172 1.3976 1.7608 0.2762  0.4022  0.6914  169 SER B N   
2768 C CA  . SER B 86  ? 1.3016 1.4699 1.8521 0.2843  0.4512  0.7068  169 SER B CA  
2769 C C   . SER B 86  ? 1.2442 1.4266 1.8564 0.2869  0.4695  0.7038  169 SER B C   
2770 O O   . SER B 86  ? 1.2525 1.4175 1.8511 0.2960  0.5091  0.7010  169 SER B O   
2771 C CB  . SER B 86  ? 1.3536 1.5285 1.9394 0.2823  0.4645  0.7368  169 SER B CB  
2772 O OG  . SER B 86  ? 1.3878 1.5933 2.0480 0.2723  0.4368  0.7461  169 SER B OG  
2773 N N   . TYR B 87  ? 1.1659 1.3767 1.8416 0.2782  0.4395  0.7031  170 TYR B N   
2774 C CA  . TYR B 87  ? 1.1137 1.3388 1.8508 0.2790  0.4470  0.7018  170 TYR B CA  
2775 C C   . TYR B 87  ? 1.1196 1.3218 1.8077 0.2870  0.4602  0.6771  170 TYR B C   
2776 O O   . TYR B 87  ? 1.1095 1.3039 1.8209 0.2964  0.4964  0.6790  170 TYR B O   
2777 C CB  . TYR B 87  ? 1.0762 1.3295 1.8667 0.2644  0.4042  0.7019  170 TYR B CB  
2778 C CG  . TYR B 87  ? 1.0728 1.3476 1.9497 0.2616  0.4073  0.7152  170 TYR B CG  
2779 C CD1 . TYR B 87  ? 1.0940 1.3836 2.0410 0.2634  0.4298  0.7426  170 TYR B CD1 
2780 C CD2 . TYR B 87  ? 1.0536 1.3347 1.9461 0.2560  0.3851  0.7024  170 TYR B CD2 
2781 C CE1 . TYR B 87  ? 1.1194 1.4308 2.1525 0.2604  0.4284  0.7575  170 TYR B CE1 
2782 C CE2 . TYR B 87  ? 0.9936 1.2936 1.9674 0.2528  0.3837  0.7182  170 TYR B CE2 
2783 C CZ  . TYR B 87  ? 1.0297 1.3457 2.0754 0.2553  0.4041  0.7460  170 TYR B CZ  
2784 O OH  . TYR B 87  ? 1.0330 1.3702 2.1683 0.2523  0.4015  0.7659  170 TYR B OH  
2785 N N   . VAL B 88  ? 1.1007 1.2905 1.7222 0.2834  0.4331  0.6539  171 VAL B N   
2786 C CA  . VAL B 88  ? 1.1404 1.3069 1.7120 0.2885  0.4412  0.6284  171 VAL B CA  
2787 C C   . VAL B 88  ? 1.1974 1.3285 1.7039 0.2992  0.4832  0.6240  171 VAL B C   
2788 O O   . VAL B 88  ? 1.2399 1.3507 1.7292 0.3055  0.5076  0.6088  171 VAL B O   
2789 C CB  . VAL B 88  ? 1.1645 1.3287 1.6860 0.2802  0.3999  0.6047  171 VAL B CB  
2790 C CG1 . VAL B 88  ? 1.2107 1.3491 1.6815 0.2840  0.4089  0.5784  171 VAL B CG1 
2791 C CG2 . VAL B 88  ? 1.1186 1.3134 1.6988 0.2677  0.3632  0.6056  171 VAL B CG2 
2792 N N   . ARG B 89  ? 1.2534 1.3734 1.7200 0.3001  0.4927  0.6366  172 ARG B N   
2793 C CA  . ARG B 89  ? 1.3717 1.4551 1.7730 0.3077  0.5367  0.6346  172 ARG B CA  
2794 C C   . ARG B 89  ? 1.3874 1.4721 1.8488 0.3165  0.5879  0.6476  172 ARG B C   
2795 O O   . ARG B 89  ? 1.4375 1.4963 1.8737 0.3236  0.6239  0.6326  172 ARG B O   
2796 C CB  . ARG B 89  ? 1.4520 1.5213 1.7941 0.3051  0.5330  0.6479  172 ARG B CB  
2797 C CG  . ARG B 89  ? 1.5238 1.5816 1.7924 0.2990  0.4902  0.6307  172 ARG B CG  
2798 C CD  . ARG B 89  ? 1.6151 1.6629 1.8377 0.2961  0.4776  0.6480  172 ARG B CD  
2799 N NE  . ARG B 89  ? 1.7229 1.7324 1.8741 0.2991  0.5192  0.6550  172 ARG B NE  
2800 C CZ  . ARG B 89  ? 1.8000 1.8031 1.9537 0.2999  0.5461  0.6815  172 ARG B CZ  
2801 N NH1 . ARG B 89  ? 1.7751 1.8080 2.0026 0.2984  0.5349  0.7050  172 ARG B NH1 
2802 N NH2 . ARG B 89  ? 1.9200 1.8833 1.9965 0.3006  0.5858  0.6840  172 ARG B NH2 
2803 N N   . SER B 90  ? 1.3666 1.4821 1.9126 0.3153  0.5899  0.6745  173 SER B N   
2804 C CA  . SER B 90  ? 1.3658 1.4931 1.9955 0.3229  0.6330  0.6912  173 SER B CA  
2805 C C   . SER B 90  ? 1.3496 1.4783 2.0223 0.3292  0.6424  0.6764  173 SER B C   
2806 O O   . SER B 90  ? 1.3764 1.4861 2.0552 0.3398  0.6916  0.6721  173 SER B O   
2807 C CB  . SER B 90  ? 1.3226 1.4904 2.0488 0.3165  0.6157  0.7204  173 SER B CB  
2808 O OG  . SER B 90  ? 1.3404 1.5084 2.0370 0.3097  0.6019  0.7349  173 SER B OG  
2809 N N   . ARG B 91  ? 1.2918 1.4412 1.9933 0.3221  0.5961  0.6689  174 ARG B N   
2810 C CA  . ARG B 91  ? 1.2897 1.4414 2.0327 0.3258  0.5947  0.6568  174 ARG B CA  
2811 C C   . ARG B 91  ? 1.3519 1.4739 2.0032 0.3242  0.5807  0.6244  174 ARG B C   
2812 O O   . ARG B 91  ? 1.4790 1.6091 2.0982 0.3138  0.5360  0.6158  174 ARG B O   
2813 C CB  . ARG B 91  ? 1.2224 1.4130 2.0461 0.3150  0.5490  0.6704  174 ARG B CB  
2814 C CG  . ARG B 91  ? 1.2785 1.4994 2.2089 0.3159  0.5612  0.7020  174 ARG B CG  
2815 C CD  . ARG B 91  ? 1.2786 1.5261 2.2335 0.3026  0.5299  0.7221  174 ARG B CD  
2816 N NE  . ARG B 91  ? 1.2875 1.5642 2.3459 0.3015  0.5412  0.7539  174 ARG B NE  
2817 C CZ  . ARG B 91  ? 1.2156 1.5216 2.3624 0.2934  0.5151  0.7701  174 ARG B CZ  
2818 N NH1 . ARG B 91  ? 1.2681 1.5776 2.4125 0.2853  0.4778  0.7583  174 ARG B NH1 
2819 N NH2 . ARG B 91  ? 1.2008 1.5326 2.4385 0.2917  0.5249  0.7994  174 ARG B NH2 
2820 N N   . LYS B 92  ? 1.4377 1.5251 2.0475 0.3334  0.6180  0.6052  175 LYS B N   
2821 C CA  . LYS B 92  ? 1.5258 1.5806 2.0350 0.3296  0.6042  0.5736  175 LYS B CA  
2822 C C   . LYS B 92  ? 1.4801 1.5515 1.9929 0.3188  0.5493  0.5606  175 LYS B C   
2823 O O   . LYS B 92  ? 1.5490 1.6137 1.9936 0.3104  0.5178  0.5465  175 LYS B O   
2824 C CB  . LYS B 92  ? 1.6239 1.6385 2.1006 0.3394  0.6509  0.5521  175 LYS B CB  
2825 C CG  . LYS B 92  ? 1.7214 1.7125 2.1836 0.3490  0.7125  0.5593  175 LYS B CG  
2826 C CD  . LYS B 92  ? 1.8249 1.8123 2.2261 0.3431  0.7096  0.5724  175 LYS B CD  
2827 C CE  . LYS B 92  ? 1.9614 1.9169 2.3272 0.3499  0.7736  0.5759  175 LYS B CE  
2828 N NZ  . LYS B 92  ? 2.0597 2.0001 2.3394 0.3420  0.7675  0.5849  175 LYS B NZ  
2829 N N   . ARG B 93  ? 1.4166 1.5097 2.0114 0.3184  0.5383  0.5673  176 ARG B N   
2830 C CA  . ARG B 93  ? 1.3114 1.4235 1.9208 0.3060  0.4887  0.5603  176 ARG B CA  
2831 C C   . ARG B 93  ? 1.2032 1.3486 1.9175 0.3034  0.4772  0.5848  176 ARG B C   
2832 O O   . ARG B 93  ? 1.3173 1.4664 2.0952 0.3138  0.5098  0.6015  176 ARG B O   
2833 C CB  . ARG B 93  ? 1.3466 1.4316 1.9143 0.3057  0.4870  0.5313  176 ARG B CB  
2834 C CG  . ARG B 93  ? 1.4210 1.4857 2.0252 0.3187  0.5290  0.5285  176 ARG B CG  
2835 C CD  . ARG B 93  ? 1.5164 1.5464 2.0679 0.3183  0.5318  0.4971  176 ARG B CD  
2836 N NE  . ARG B 93  ? 1.5570 1.5788 2.1745 0.3272  0.5539  0.4982  176 ARG B NE  
2837 C CZ  . ARG B 93  ? 1.5967 1.6394 2.2858 0.3224  0.5275  0.5094  176 ARG B CZ  
2838 N NH1 . ARG B 93  ? 1.6352 1.7088 2.3374 0.3070  0.4784  0.5190  176 ARG B NH1 
2839 N NH2 . ARG B 93  ? 1.6335 1.6637 2.3817 0.3327  0.5514  0.5113  176 ARG B NH2 
2840 N N   . LEU B 94  ? 1.0654 1.2350 1.7990 0.2886  0.4314  0.5880  177 LEU B N   
2841 C CA  . LEU B 94  ? 1.0470 1.2470 1.8714 0.2817  0.4134  0.6124  177 LEU B CA  
2842 C C   . LEU B 94  ? 1.0880 1.2846 1.9434 0.2782  0.3999  0.6067  177 LEU B C   
2843 O O   . LEU B 94  ? 1.1682 1.3477 1.9710 0.2733  0.3861  0.5823  177 LEU B O   
2844 C CB  . LEU B 94  ? 1.0198 1.2459 1.8480 0.2648  0.3733  0.6216  177 LEU B CB  
2845 C CG  . LEU B 94  ? 1.0115 1.2420 1.8132 0.2659  0.3792  0.6294  177 LEU B CG  
2846 C CD1 . LEU B 94  ? 0.9774 1.2334 1.7997 0.2482  0.3396  0.6386  177 LEU B CD1 
2847 C CD2 . LEU B 94  ? 1.0139 1.2468 1.8586 0.2782  0.4183  0.6518  177 LEU B CD2 
2848 N N   . ARG B 95  ? 1.0817 1.2944 2.0262 0.2806  0.4039  0.6310  178 ARG B N   
2849 C CA  . ARG B 95  ? 1.1014 1.3132 2.0890 0.2764  0.3877  0.6335  178 ARG B CA  
2850 C C   . ARG B 95  ? 1.0370 1.2664 2.0154 0.2529  0.3359  0.6349  178 ARG B C   
2851 O O   . ARG B 95  ? 1.0211 1.2732 2.0106 0.2418  0.3165  0.6485  178 ARG B O   
2852 C CB  . ARG B 95  ? 1.1833 1.4110 2.2770 0.2853  0.4034  0.6642  178 ARG B CB  
2853 C CG  . ARG B 95  ? 1.2351 1.4994 2.3917 0.2713  0.3738  0.6953  178 ARG B CG  
2854 C CD  . ARG B 95  ? 1.3372 1.6202 2.5974 0.2824  0.3968  0.7266  178 ARG B CD  
2855 N NE  . ARG B 95  ? 1.3938 1.7077 2.7173 0.2630  0.3523  0.7550  178 ARG B NE  
2856 C CZ  . ARG B 95  ? 1.5331 1.8534 2.9061 0.2532  0.3209  0.7694  178 ARG B CZ  
2857 N NH1 . ARG B 95  ? 1.4895 1.7887 2.8689 0.2629  0.3302  0.7602  178 ARG B NH1 
2858 N NH2 . ARG B 95  ? 1.6260 1.9719 3.0414 0.2319  0.2782  0.7941  178 ARG B NH2 
2859 N N   . GLU B 96  ? 1.0078 1.2252 1.9671 0.2442  0.3156  0.6211  179 GLU B N   
2860 C CA  . GLU B 96  ? 0.9969 1.2250 1.9286 0.2204  0.2715  0.6155  179 GLU B CA  
2861 C C   . GLU B 96  ? 0.9655 1.2225 1.9512 0.2035  0.2418  0.6434  179 GLU B C   
2862 O O   . GLU B 96  ? 0.9814 1.2496 1.9369 0.1863  0.2161  0.6387  179 GLU B O   
2863 C CB  . GLU B 96  ? 1.0339 1.2447 1.9507 0.2126  0.2567  0.6019  179 GLU B CB  
2864 C CG  . GLU B 96  ? 1.0753 1.2566 1.9225 0.2219  0.2760  0.5685  179 GLU B CG  
2865 C CD  . GLU B 96  ? 1.1161 1.2837 1.9351 0.2075  0.2531  0.5515  179 GLU B CD  
2866 O OE1 . GLU B 96  ? 1.0738 1.2496 1.9310 0.1927  0.2274  0.5676  179 GLU B OE1 
2867 O OE2 . GLU B 96  ? 1.1265 1.2738 1.8831 0.2095  0.2600  0.5225  179 GLU B OE2 
2868 N N   . GLU B 97  ? 1.0072 1.2752 2.0739 0.2081  0.2458  0.6721  180 GLU B N   
2869 C CA  . GLU B 97  ? 1.0491 1.3440 2.1729 0.1909  0.2159  0.7018  180 GLU B CA  
2870 C C   . GLU B 97  ? 1.0415 1.3518 2.1477 0.1861  0.2150  0.7032  180 GLU B C   
2871 O O   . GLU B 97  ? 0.9648 1.2871 2.0599 0.1636  0.1822  0.7065  180 GLU B O   
2872 C CB  . GLU B 97  ? 1.0584 1.3640 2.2806 0.2018  0.2268  0.7334  180 GLU B CB  
2873 C CG  . GLU B 97  ? 1.2405 1.5309 2.4897 0.2038  0.2204  0.7364  180 GLU B CG  
2874 C CD  . GLU B 97  ? 1.3649 1.6263 2.5912 0.2282  0.2626  0.7132  180 GLU B CD  
2875 O OE1 . GLU B 97  ? 1.4034 1.6540 2.5781 0.2417  0.2950  0.6917  180 GLU B OE1 
2876 O OE2 . GLU B 97  ? 1.5128 1.7594 2.7688 0.2323  0.2615  0.7163  180 GLU B OE2 
2877 N N   . GLU B 98  ? 1.0778 1.3837 2.1764 0.2065  0.2529  0.6992  181 GLU B N   
2878 C CA  . GLU B 98  ? 1.0648 1.3822 2.1502 0.2054  0.2577  0.7029  181 GLU B CA  
2879 C C   . GLU B 98  ? 0.9839 1.2913 1.9837 0.1974  0.2444  0.6750  181 GLU B C   
2880 O O   . GLU B 98  ? 0.9701 1.2897 1.9610 0.1814  0.2210  0.6769  181 GLU B O   
2881 C CB  . GLU B 98  ? 1.1327 1.4447 2.2321 0.2292  0.3051  0.7083  181 GLU B CB  
2882 C CG  . GLU B 98  ? 1.1840 1.5021 2.2593 0.2291  0.3130  0.7110  181 GLU B CG  
2883 C CD  . GLU B 98  ? 1.2352 1.5513 2.3390 0.2484  0.3591  0.7242  181 GLU B CD  
2884 O OE1 . GLU B 98  ? 1.2304 1.5282 2.3299 0.2661  0.3947  0.7163  181 GLU B OE1 
2885 O OE2 . GLU B 98  ? 1.1714 1.5026 2.3014 0.2446  0.3610  0.7420  181 GLU B OE2 
2886 N N   . ALA B 99  ? 0.9229 1.2077 1.8639 0.2081  0.2592  0.6490  182 ALA B N   
2887 C CA  . ALA B 99  ? 0.8718 1.1479 1.7375 0.2012  0.2449  0.6219  182 ALA B CA  
2888 C C   . ALA B 99  ? 0.8206 1.1090 1.6851 0.1758  0.2049  0.6192  182 ALA B C   
2889 O O   . ALA B 99  ? 0.9083 1.2037 1.7480 0.1659  0.1905  0.6123  182 ALA B O   
2890 C CB  . ALA B 99  ? 0.9033 1.1543 1.7169 0.2115  0.2589  0.5962  182 ALA B CB  
2891 N N   . ALA B 100 ? 0.7824 1.0714 1.6743 0.1646  0.1881  0.6255  183 ALA B N   
2892 C CA  . ALA B 100 ? 0.7651 1.0616 1.6498 0.1375  0.1520  0.6234  183 ALA B CA  
2893 C C   . ALA B 100 ? 0.7471 1.0624 1.6633 0.1221  0.1347  0.6424  183 ALA B C   
2894 O O   . ALA B 100 ? 0.7461 1.0647 1.6331 0.1042  0.1158  0.6312  183 ALA B O   
2895 C CB  . ALA B 100 ? 0.7453 1.0357 1.6539 0.1280  0.1376  0.6313  183 ALA B CB  
2896 N N   . ARG B 101 ? 0.8561 1.1828 1.8344 0.1290  0.1431  0.6705  184 ARG B N   
2897 C CA  . ARG B 101 ? 0.8730 1.2174 1.8883 0.1140  0.1267  0.6911  184 ARG B CA  
2898 C C   . ARG B 101 ? 0.8374 1.1820 1.8126 0.1150  0.1329  0.6764  184 ARG B C   
2899 O O   . ARG B 101 ? 0.8013 1.1501 1.7632 0.0939  0.1104  0.6722  184 ARG B O   
2900 C CB  . ARG B 101 ? 0.8698 1.2276 1.9649 0.1268  0.1425  0.7233  184 ARG B CB  
2901 C CG  . ARG B 101 ? 0.8942 1.2714 2.0425 0.1067  0.1179  0.7500  184 ARG B CG  
2902 C CD  . ARG B 101 ? 0.9726 1.3643 2.1739 0.1202  0.1417  0.7710  184 ARG B CD  
2903 N NE  . ARG B 101 ? 1.0052 1.3930 2.2239 0.1510  0.1871  0.7730  184 ARG B NE  
2904 C CZ  . ARG B 101 ? 1.0620 1.4453 2.3140 0.1682  0.2074  0.7783  184 ARG B CZ  
2905 N NH1 . ARG B 101 ? 1.0423 1.4240 2.3155 0.1602  0.1856  0.7833  184 ARG B NH1 
2906 N NH2 . ARG B 101 ? 1.0535 1.4302 2.3142 0.1937  0.2524  0.7776  184 ARG B NH2 
2907 N N   . LEU B 102 ? 0.8385 1.1754 1.7919 0.1389  0.1634  0.6679  185 LEU B N   
2908 C CA  . LEU B 102 ? 0.8257 1.1610 1.7468 0.1441  0.1716  0.6590  185 LEU B CA  
2909 C C   . LEU B 102 ? 0.8490 1.1753 1.7075 0.1373  0.1583  0.6290  185 LEU B C   
2910 O O   . LEU B 102 ? 0.9138 1.2436 1.7609 0.1268  0.1463  0.6234  185 LEU B O   
2911 C CB  . LEU B 102 ? 0.8040 1.1312 1.7192 0.1703  0.2082  0.6630  185 LEU B CB  
2912 C CG  . LEU B 102 ? 0.8119 1.1497 1.7951 0.1787  0.2282  0.6928  185 LEU B CG  
2913 C CD1 . LEU B 102 ? 0.8368 1.1613 1.8012 0.2032  0.2691  0.6921  185 LEU B CD1 
2914 C CD2 . LEU B 102 ? 0.7918 1.1471 1.8188 0.1645  0.2144  0.7137  185 LEU B CD2 
2915 N N   . PHE B 103 ? 0.8254 1.1399 1.6487 0.1427  0.1610  0.6098  186 PHE B N   
2916 C CA  . PHE B 103 ? 0.8250 1.1330 1.5957 0.1367  0.1493  0.5814  186 PHE B CA  
2917 C C   . PHE B 103 ? 0.8077 1.1227 1.5797 0.1095  0.1218  0.5746  186 PHE B C   
2918 O O   . PHE B 103 ? 0.8926 1.2075 1.6361 0.1022  0.1132  0.5553  186 PHE B O   
2919 C CB  . PHE B 103 ? 0.8545 1.1484 1.5924 0.1455  0.1566  0.5635  186 PHE B CB  
2920 C CG  . PHE B 103 ? 0.8686 1.1581 1.5582 0.1397  0.1449  0.5346  186 PHE B CG  
2921 C CD1 . PHE B 103 ? 0.8797 1.1671 1.5391 0.1501  0.1492  0.5241  186 PHE B CD1 
2922 C CD2 . PHE B 103 ? 0.8727 1.1603 1.5503 0.1234  0.1291  0.5195  186 PHE B CD2 
2923 C CE1 . PHE B 103 ? 0.8842 1.1704 1.5089 0.1453  0.1370  0.4990  186 PHE B CE1 
2924 C CE2 . PHE B 103 ? 0.8918 1.1778 1.5323 0.1178  0.1201  0.4930  186 PHE B CE2 
2925 C CZ  . PHE B 103 ? 0.8548 1.1415 1.4723 0.1293  0.1235  0.4827  186 PHE B CZ  
2926 N N   . LYS B 104 ? 0.8058 1.1260 1.6113 0.0936  0.1081  0.5909  187 LYS B N   
2927 C CA  . LYS B 104 ? 0.8672 1.1900 1.6669 0.0640  0.0824  0.5857  187 LYS B CA  
2928 C C   . LYS B 104 ? 0.8458 1.1747 1.6523 0.0545  0.0771  0.5877  187 LYS B C   
2929 O O   . LYS B 104 ? 0.8335 1.1596 1.6153 0.0361  0.0652  0.5695  187 LYS B O   
2930 C CB  . LYS B 104 ? 0.8984 1.2234 1.7308 0.0468  0.0649  0.6069  187 LYS B CB  
2931 C CG  . LYS B 104 ? 0.9425 1.2631 1.7502 0.0137  0.0393  0.5971  187 LYS B CG  
2932 C CD  . LYS B 104 ? 0.9960 1.3131 1.8213 -0.0024 0.0202  0.6152  187 LYS B CD  
2933 C CE  . LYS B 104 ? 1.0730 1.3803 1.8572 -0.0360 -0.0013 0.6009  187 LYS B CE  
2934 N NZ  . LYS B 104 ? 1.1080 1.4123 1.9121 -0.0597 -0.0282 0.6269  187 LYS B NZ  
2935 N N   . GLN B 105 ? 0.8654 1.2011 1.7072 0.0667  0.0880  0.6091  188 GLN B N   
2936 C CA  . GLN B 105 ? 0.8340 1.1734 1.6864 0.0595  0.0849  0.6131  188 GLN B CA  
2937 C C   . GLN B 105 ? 0.8217 1.1550 1.6377 0.0709  0.0943  0.5905  188 GLN B C   
2938 O O   . GLN B 105 ? 0.8104 1.1416 1.6176 0.0572  0.0853  0.5784  188 GLN B O   
2939 C CB  . GLN B 105 ? 0.8101 1.1579 1.7102 0.0716  0.0976  0.6420  188 GLN B CB  
2940 C CG  . GLN B 105 ? 0.7900 1.1475 1.7408 0.0613  0.0869  0.6686  188 GLN B CG  
2941 C CD  . GLN B 105 ? 0.8237 1.1916 1.8267 0.0755  0.1043  0.6957  188 GLN B CD  
2942 O OE1 . GLN B 105 ? 0.9058 1.2771 1.9240 0.0689  0.1024  0.7034  188 GLN B OE1 
2943 N NE2 . GLN B 105 ? 0.8289 1.2004 1.8611 0.0946  0.1236  0.7097  188 GLN B NE2 
2944 N N   . ILE B 106 ? 0.7654 1.0945 1.5620 0.0955  0.1120  0.5856  189 ILE B N   
2945 C CA  . ILE B 106 ? 0.7540 1.0772 1.5151 0.1078  0.1175  0.5660  189 ILE B CA  
2946 C C   . ILE B 106 ? 0.7869 1.1088 1.5224 0.0916  0.1023  0.5382  189 ILE B C   
2947 O O   . ILE B 106 ? 0.8047 1.1259 1.5319 0.0901  0.0990  0.5246  189 ILE B O   
2948 C CB  . ILE B 106 ? 0.7555 1.0712 1.4921 0.1318  0.1352  0.5643  189 ILE B CB  
2949 C CG1 . ILE B 106 ? 0.8202 1.1345 1.5763 0.1488  0.1561  0.5891  189 ILE B CG1 
2950 C CG2 . ILE B 106 ? 0.7622 1.0720 1.4581 0.1401  0.1327  0.5417  189 ILE B CG2 
2951 C CD1 . ILE B 106 ? 0.8470 1.1493 1.5749 0.1709  0.1784  0.5886  189 ILE B CD1 
2952 N N   . VAL B 107 ? 0.7756 1.0967 1.5021 0.0794  0.0943  0.5303  190 VAL B N   
2953 C CA  . VAL B 107 ? 0.7889 1.1082 1.4903 0.0629  0.0836  0.5037  190 VAL B CA  
2954 C C   . VAL B 107 ? 0.7770 1.0966 1.4866 0.0360  0.0715  0.4998  190 VAL B C   
2955 O O   . VAL B 107 ? 0.7890 1.1072 1.4846 0.0269  0.0696  0.4770  190 VAL B O   
2956 C CB  . VAL B 107 ? 0.8443 1.1597 1.5306 0.0575  0.0801  0.4974  190 VAL B CB  
2957 C CG1 . VAL B 107 ? 0.8625 1.1761 1.5253 0.0360  0.0704  0.4717  190 VAL B CG1 
2958 C CG2 . VAL B 107 ? 0.8590 1.1697 1.5288 0.0826  0.0933  0.4938  190 VAL B CG2 
2959 N N   . SER B 108 ? 0.8019 1.1224 1.5354 0.0226  0.0637  0.5213  191 SER B N   
2960 C CA  . SER B 108 ? 0.8166 1.1335 1.5529 -0.0053 0.0514  0.5184  191 SER B CA  
2961 C C   . SER B 108 ? 0.8602 1.1757 1.6025 0.0006  0.0587  0.5097  191 SER B C   
2962 O O   . SER B 108 ? 0.9698 1.2784 1.7013 -0.0188 0.0547  0.4914  191 SER B O   
2963 C CB  . SER B 108 ? 0.8052 1.1244 1.5715 -0.0190 0.0391  0.5473  191 SER B CB  
2964 O OG  . SER B 108 ? 0.7896 1.1108 1.5618 -0.0188 0.0332  0.5610  191 SER B OG  
2965 N N   . ALA B 109 ? 0.8477 1.1673 1.6071 0.0267  0.0704  0.5235  192 ALA B N   
2966 C CA  . ALA B 109 ? 0.8542 1.1708 1.6216 0.0354  0.0768  0.5191  192 ALA B CA  
2967 C C   . ALA B 109 ? 0.8244 1.1389 1.5702 0.0391  0.0791  0.4894  192 ALA B C   
2968 O O   . ALA B 109 ? 0.8127 1.1216 1.5617 0.0273  0.0780  0.4733  192 ALA B O   
2969 C CB  . ALA B 109 ? 0.8671 1.1864 1.6495 0.0628  0.0897  0.5412  192 ALA B CB  
2970 N N   . VAL B 110 ? 0.7621 1.0803 1.4886 0.0544  0.0824  0.4819  193 VAL B N   
2971 C CA  . VAL B 110 ? 0.7503 1.0698 1.4619 0.0597  0.0829  0.4556  193 VAL B CA  
2972 C C   . VAL B 110 ? 0.7891 1.1069 1.4919 0.0331  0.0785  0.4307  193 VAL B C   
2973 O O   . VAL B 110 ? 0.7917 1.1094 1.4994 0.0303  0.0811  0.4092  193 VAL B O   
2974 C CB  . VAL B 110 ? 0.7194 1.0420 1.4098 0.0780  0.0851  0.4529  193 VAL B CB  
2975 C CG1 . VAL B 110 ? 0.7377 1.0644 1.4171 0.0782  0.0818  0.4249  193 VAL B CG1 
2976 C CG2 . VAL B 110 ? 0.7175 1.0377 1.4080 0.1038  0.0926  0.4734  193 VAL B CG2 
2977 N N   . ALA B 111 ? 0.7861 1.1015 1.4775 0.0132  0.0725  0.4344  194 ALA B N   
2978 C CA  . ALA B 111 ? 0.8284 1.1388 1.5025 -0.0152 0.0694  0.4125  194 ALA B CA  
2979 C C   . ALA B 111 ? 0.8655 1.1670 1.5475 -0.0339 0.0709  0.4032  194 ALA B C   
2980 O O   . ALA B 111 ? 0.8859 1.1841 1.5629 -0.0446 0.0779  0.3761  194 ALA B O   
2981 C CB  . ALA B 111 ? 0.8417 1.1481 1.5010 -0.0337 0.0596  0.4244  194 ALA B CB  
2982 N N   . HIS B 112 ? 0.8701 1.1677 1.5675 -0.0376 0.0657  0.4255  195 HIS B N   
2983 C CA  . HIS B 112 ? 0.8961 1.1819 1.6022 -0.0559 0.0659  0.4206  195 HIS B CA  
2984 C C   . HIS B 112 ? 0.8702 1.1540 1.5937 -0.0419 0.0781  0.4029  195 HIS B C   
2985 O O   . HIS B 112 ? 0.8557 1.1270 1.5777 -0.0607 0.0836  0.3822  195 HIS B O   
2986 C CB  . HIS B 112 ? 0.8832 1.1690 1.6114 -0.0556 0.0576  0.4524  195 HIS B CB  
2987 C CG  . HIS B 112 ? 0.8662 1.1386 1.6047 -0.0740 0.0562  0.4498  195 HIS B CG  
2988 N ND1 . HIS B 112 ? 0.8795 1.1371 1.5971 -0.1109 0.0468  0.4409  195 HIS B ND1 
2989 C CD2 . HIS B 112 ? 0.8949 1.1634 1.6599 -0.0619 0.0629  0.4546  195 HIS B CD2 
2990 C CE1 . HIS B 112 ? 0.9721 1.2169 1.7030 -0.1210 0.0482  0.4388  195 HIS B CE1 
2991 N NE2 . HIS B 112 ? 0.9364 1.1880 1.6987 -0.0910 0.0582  0.4472  195 HIS B NE2 
2992 N N   . CYS B 113 ? 0.8791 1.1731 1.6185 -0.0096 0.0821  0.4119  196 CYS B N   
2993 C CA  . CYS B 113 ? 0.8854 1.1793 1.6443 0.0072  0.0901  0.3979  196 CYS B CA  
2994 C C   . CYS B 113 ? 0.8580 1.1550 1.6098 0.0002  0.0959  0.3653  196 CYS B C   
2995 O O   . CYS B 113 ? 0.8719 1.1614 1.6383 -0.0083 0.1046  0.3439  196 CYS B O   
2996 C CB  . CYS B 113 ? 0.8896 1.1922 1.6576 0.0409  0.0896  0.4166  196 CYS B CB  
2997 S SG  . CYS B 113 ? 0.8985 1.1964 1.6837 0.0525  0.0897  0.4532  196 CYS B SG  
2998 N N   . HIS B 114 ? 0.8121 1.1194 1.5448 0.0036  0.0929  0.3611  197 HIS B N   
2999 C CA  . HIS B 114 ? 0.7906 1.1034 1.5197 -0.0031 0.0988  0.3312  197 HIS B CA  
3000 C C   . HIS B 114 ? 0.8021 1.1025 1.5190 -0.0371 0.1075  0.3082  197 HIS B C   
3001 O O   . HIS B 114 ? 0.8751 1.1760 1.6055 -0.0421 0.1196  0.2808  197 HIS B O   
3002 C CB  . HIS B 114 ? 0.8013 1.1241 1.5086 0.0018  0.0931  0.3326  197 HIS B CB  
3003 C CG  . HIS B 114 ? 0.7925 1.1250 1.5054 0.0332  0.0873  0.3457  197 HIS B CG  
3004 N ND1 . HIS B 114 ? 0.7715 1.1110 1.4663 0.0404  0.0828  0.3436  197 HIS B ND1 
3005 C CD2 . HIS B 114 ? 0.8279 1.1612 1.5573 0.0571  0.0851  0.3615  197 HIS B CD2 
3006 C CE1 . HIS B 114 ? 0.7819 1.1251 1.4783 0.0665  0.0780  0.3562  197 HIS B CE1 
3007 N NE2 . HIS B 114 ? 0.8315 1.1711 1.5477 0.0770  0.0791  0.3681  197 HIS B NE2 
3008 N N   . GLN B 115 ? 0.8290 1.1173 1.5218 -0.0611 0.1016  0.3193  198 GLN B N   
3009 C CA  . GLN B 115 ? 0.9009 1.1714 1.5715 -0.0978 0.1085  0.2989  198 GLN B CA  
3010 C C   . GLN B 115 ? 0.9169 1.1750 1.6102 -0.1010 0.1211  0.2830  198 GLN B C   
3011 O O   . GLN B 115 ? 1.0451 1.2902 1.7274 -0.1243 0.1358  0.2544  198 GLN B O   
3012 C CB  . GLN B 115 ? 0.9850 1.2428 1.6255 -0.1246 0.0942  0.3180  198 GLN B CB  
3013 C CG  . GLN B 115 ? 1.0787 1.3440 1.6996 -0.1252 0.0798  0.3382  198 GLN B CG  
3014 C CD  . GLN B 115 ? 1.1418 1.4127 1.7438 -0.1289 0.0858  0.3195  198 GLN B CD  
3015 O OE1 . GLN B 115 ? 1.1733 1.4593 1.7928 -0.1035 0.0918  0.3122  198 GLN B OE1 
3016 N NE2 . GLN B 115 ? 1.2394 1.4970 1.8037 -0.1622 0.0825  0.3133  198 GLN B NE2 
3017 N N   . SER B 116 ? 0.8825 1.1420 1.6060 -0.0790 0.1172  0.3015  199 SER B N   
3018 C CA  . SER B 116 ? 0.8964 1.1431 1.6486 -0.0774 0.1285  0.2894  199 SER B CA  
3019 C C   . SER B 116 ? 0.8970 1.1559 1.6908 -0.0466 0.1366  0.2800  199 SER B C   
3020 O O   . SER B 116 ? 0.9999 1.2503 1.8265 -0.0357 0.1419  0.2800  199 SER B O   
3021 C CB  . SER B 116 ? 0.9107 1.1489 1.6738 -0.0743 0.1187  0.3171  199 SER B CB  
3022 O OG  . SER B 116 ? 0.9612 1.1886 1.6932 -0.1041 0.1079  0.3273  199 SER B OG  
3023 N N   . ALA B 117 ? 0.8569 1.1345 1.6516 -0.0336 0.1358  0.2728  200 ALA B N   
3024 C CA  . ALA B 117 ? 0.8399 1.1312 1.6756 -0.0067 0.1392  0.2640  200 ALA B CA  
3025 C C   . ALA B 117 ? 0.8633 1.1575 1.7250 0.0239  0.1284  0.2911  200 ALA B C   
3026 O O   . ALA B 117 ? 0.9702 1.2641 1.8729 0.0398  0.1321  0.2857  200 ALA B O   
3027 C CB  . ALA B 117 ? 0.8639 1.1466 1.7285 -0.0180 0.1600  0.2298  200 ALA B CB  
3028 N N   . ILE B 118 ? 0.8701 1.1652 1.7096 0.0311  0.1162  0.3212  201 ILE B N   
3029 C CA  . ILE B 118 ? 0.8962 1.1944 1.7502 0.0599  0.1070  0.3489  201 ILE B CA  
3030 C C   . ILE B 118 ? 0.8698 1.1840 1.7006 0.0739  0.0973  0.3565  201 ILE B C   
3031 O O   . ILE B 118 ? 0.8516 1.1682 1.6512 0.0626  0.0954  0.3606  201 ILE B O   
3032 C CB  . ILE B 118 ? 0.9588 1.2447 1.8074 0.0565  0.1048  0.3764  201 ILE B CB  
3033 C CG1 . ILE B 118 ? 1.0377 1.3059 1.9166 0.0507  0.1121  0.3723  201 ILE B CG1 
3034 C CG2 . ILE B 118 ? 0.9356 1.2266 1.7804 0.0830  0.0969  0.4082  201 ILE B CG2 
3035 C CD1 . ILE B 118 ? 1.0931 1.3484 1.9737 0.0225  0.1243  0.3399  201 ILE B CD1 
3036 N N   . VAL B 119 ? 0.8951 1.2189 1.7421 0.0967  0.0904  0.3570  202 VAL B N   
3037 C CA  . VAL B 119 ? 0.8802 1.2147 1.7023 0.1120  0.0794  0.3669  202 VAL B CA  
3038 C C   . VAL B 119 ? 0.9309 1.2579 1.7436 0.1324  0.0735  0.3994  202 VAL B C   
3039 O O   . VAL B 119 ? 0.9319 1.2519 1.7705 0.1435  0.0721  0.4095  202 VAL B O   
3040 C CB  . VAL B 119 ? 0.8578 1.2061 1.7012 0.1228  0.0720  0.3497  202 VAL B CB  
3041 C CG1 . VAL B 119 ? 0.8416 1.1961 1.6576 0.1406  0.0572  0.3634  202 VAL B CG1 
3042 C CG2 . VAL B 119 ? 0.8938 1.2502 1.7423 0.1014  0.0812  0.3183  202 VAL B CG2 
3043 N N   . LEU B 120 ? 0.9138 1.2406 1.6904 0.1372  0.0717  0.4155  203 LEU B N   
3044 C CA  . LEU B 120 ? 0.9411 1.2586 1.7044 0.1527  0.0722  0.4461  203 LEU B CA  
3045 C C   . LEU B 120 ? 0.9560 1.2725 1.7128 0.1750  0.0608  0.4553  203 LEU B C   
3046 O O   . LEU B 120 ? 1.0166 1.3235 1.7831 0.1869  0.0593  0.4750  203 LEU B O   
3047 C CB  . LEU B 120 ? 0.9834 1.2993 1.7148 0.1500  0.0785  0.4595  203 LEU B CB  
3048 C CG  . LEU B 120 ? 0.9826 1.2972 1.7206 0.1298  0.0862  0.4630  203 LEU B CG  
3049 C CD1 . LEU B 120 ? 1.0021 1.3094 1.7699 0.1222  0.0895  0.4712  203 LEU B CD1 
3050 C CD2 . LEU B 120 ? 1.0212 1.3421 1.7552 0.1086  0.0842  0.4381  203 LEU B CD2 
3051 N N   . GLY B 121 ? 0.9667 1.2915 1.7054 0.1794  0.0511  0.4426  204 GLY B N   
3052 C CA  . GLY B 121 ? 1.0505 1.3742 1.7802 0.1977  0.0350  0.4505  204 GLY B CA  
3053 C C   . GLY B 121 ? 1.1019 1.4122 1.7811 0.2105  0.0341  0.4739  204 GLY B C   
3054 O O   . GLY B 121 ? 1.2009 1.5107 1.8525 0.2186  0.0201  0.4724  204 GLY B O   
3055 N N   . ASP B 122 ? 1.0590 1.3577 1.7264 0.2112  0.0496  0.4950  205 ASP B N   
3056 C CA  . ASP B 122 ? 1.1156 1.3986 1.7374 0.2230  0.0552  0.5183  205 ASP B CA  
3057 C C   . ASP B 122 ? 1.0601 1.3401 1.6696 0.2164  0.0767  0.5251  205 ASP B C   
3058 O O   . ASP B 122 ? 1.0384 1.3099 1.6513 0.2192  0.0906  0.5472  205 ASP B O   
3059 C CB  . ASP B 122 ? 1.2522 1.5222 1.8821 0.2340  0.0529  0.5439  205 ASP B CB  
3060 C CG  . ASP B 122 ? 1.3957 1.6459 1.9712 0.2455  0.0587  0.5685  205 ASP B CG  
3061 O OD1 . ASP B 122 ? 1.4818 1.7269 2.0126 0.2459  0.0658  0.5642  205 ASP B OD1 
3062 O OD2 . ASP B 122 ? 1.4773 1.7141 2.0530 0.2535  0.0574  0.5922  205 ASP B OD2 
3063 N N   . LEU B 123 ? 1.0460 1.3339 1.6470 0.2072  0.0790  0.5066  206 LEU B N   
3064 C CA  . LEU B 123 ? 0.9979 1.2835 1.5907 0.2020  0.0970  0.5130  206 LEU B CA  
3065 C C   . LEU B 123 ? 1.0542 1.3242 1.5992 0.2144  0.1084  0.5241  206 LEU B C   
3066 O O   . LEU B 123 ? 1.0623 1.3253 1.5695 0.2207  0.0988  0.5149  206 LEU B O   
3067 C CB  . LEU B 123 ? 0.9589 1.2556 1.5603 0.1868  0.0944  0.4910  206 LEU B CB  
3068 C CG  . LEU B 123 ? 0.9512 1.2586 1.5927 0.1687  0.0921  0.4829  206 LEU B CG  
3069 C CD1 . LEU B 123 ? 0.9107 1.2249 1.5479 0.1535  0.0895  0.4631  206 LEU B CD1 
3070 C CD2 . LEU B 123 ? 0.9683 1.2731 1.6323 0.1644  0.1036  0.5051  206 LEU B CD2 
3071 N N   . LYS B 124 ? 1.0357 1.2994 1.5842 0.2167  0.1297  0.5435  207 LYS B N   
3072 C CA  . LYS B 124 ? 1.0647 1.3113 1.5725 0.2274  0.1491  0.5547  207 LYS B CA  
3073 C C   . LYS B 124 ? 1.0545 1.3028 1.5921 0.2260  0.1732  0.5734  207 LYS B C   
3074 O O   . LYS B 124 ? 0.9449 1.2052 1.5292 0.2179  0.1714  0.5829  207 LYS B O   
3075 C CB  . LYS B 124 ? 1.1054 1.3347 1.5748 0.2394  0.1477  0.5689  207 LYS B CB  
3076 C CG  . LYS B 124 ? 1.1334 1.3636 1.6333 0.2409  0.1470  0.5900  207 LYS B CG  
3077 C CD  . LYS B 124 ? 1.2225 1.4326 1.6786 0.2519  0.1424  0.6057  207 LYS B CD  
3078 C CE  . LYS B 124 ? 1.1784 1.3887 1.6676 0.2534  0.1346  0.6239  207 LYS B CE  
3079 N NZ  . LYS B 124 ? 1.2648 1.4536 1.7068 0.2632  0.1261  0.6403  207 LYS B NZ  
3080 N N   . LEU B 125 ? 1.0764 1.3122 1.5893 0.2334  0.1961  0.5786  208 LEU B N   
3081 C CA  . LEU B 125 ? 1.1063 1.3463 1.6565 0.2330  0.2198  0.5961  208 LEU B CA  
3082 C C   . LEU B 125 ? 1.1504 1.3912 1.7268 0.2349  0.2298  0.6222  208 LEU B C   
3083 O O   . LEU B 125 ? 1.1055 1.3600 1.7353 0.2277  0.2349  0.6353  208 LEU B O   
3084 C CB  . LEU B 125 ? 1.1306 1.3540 1.6511 0.2425  0.2473  0.5956  208 LEU B CB  
3085 C CG  . LEU B 125 ? 1.0616 1.2847 1.5745 0.2389  0.2432  0.5738  208 LEU B CG  
3086 C CD1 . LEU B 125 ? 1.0833 1.2835 1.5597 0.2499  0.2731  0.5717  208 LEU B CD1 
3087 C CD2 . LEU B 125 ? 1.0096 1.2531 1.5846 0.2278  0.2374  0.5773  208 LEU B CD2 
3088 N N   . ARG B 126 ? 1.1825 1.4086 1.7228 0.2428  0.2287  0.6302  209 ARG B N   
3089 C CA  . ARG B 126 ? 1.2132 1.4365 1.7740 0.2446  0.2381  0.6560  209 ARG B CA  
3090 C C   . ARG B 126 ? 1.0962 1.3372 1.7148 0.2327  0.2198  0.6585  209 ARG B C   
3091 O O   . ARG B 126 ? 1.2084 1.4518 1.8623 0.2301  0.2303  0.6795  209 ARG B O   
3092 C CB  . ARG B 126 ? 1.3778 1.5796 1.8852 0.2537  0.2343  0.6643  209 ARG B CB  
3093 C CG  . ARG B 126 ? 1.5924 1.7761 2.0811 0.2607  0.2650  0.6911  209 ARG B CG  
3094 C CD  . ARG B 126 ? 1.7638 1.9357 2.2425 0.2629  0.2543  0.7102  209 ARG B CD  
3095 N NE  . ARG B 126 ? 1.8841 2.0727 2.4311 0.2552  0.2461  0.7197  209 ARG B NE  
3096 C CZ  . ARG B 126 ? 1.9136 2.1088 2.5059 0.2510  0.2681  0.7389  209 ARG B CZ  
3097 N NH1 . ARG B 126 ? 1.9260 2.1145 2.5083 0.2555  0.3025  0.7517  209 ARG B NH1 
3098 N NH2 . ARG B 126 ? 1.9106 2.1188 2.5608 0.2415  0.2564  0.7447  209 ARG B NH2 
3099 N N   . LYS B 127 ? 1.0087 1.2606 1.6364 0.2242  0.1945  0.6362  210 LYS B N   
3100 C CA  . LYS B 127 ? 1.0070 1.2710 1.6810 0.2111  0.1783  0.6337  210 LYS B CA  
3101 C C   . LYS B 127 ? 0.9520 1.2307 1.6723 0.1962  0.1809  0.6366  210 LYS B C   
3102 O O   . LYS B 127 ? 0.9211 1.2067 1.6753 0.1821  0.1683  0.6340  210 LYS B O   
3103 C CB  . LYS B 127 ? 1.0686 1.3373 1.7346 0.2065  0.1533  0.6069  210 LYS B CB  
3104 C CG  . LYS B 127 ? 1.1260 1.3828 1.7561 0.2197  0.1432  0.6053  210 LYS B CG  
3105 C CD  . LYS B 127 ? 1.1620 1.4130 1.8150 0.2218  0.1350  0.6173  210 LYS B CD  
3106 C CE  . LYS B 127 ? 1.1699 1.4280 1.8397 0.2185  0.1123  0.5951  210 LYS B CE  
3107 N NZ  . LYS B 127 ? 1.1748 1.4300 1.8867 0.2147  0.1079  0.6014  210 LYS B NZ  
3108 N N   . PHE B 128 ? 0.9347 1.2169 1.6569 0.1980  0.1956  0.6411  211 PHE B N   
3109 C CA  . PHE B 128 ? 0.8375 1.1341 1.6072 0.1840  0.1950  0.6480  211 PHE B CA  
3110 C C   . PHE B 128 ? 0.8489 1.1468 1.6485 0.1901  0.2193  0.6759  211 PHE B C   
3111 O O   . PHE B 128 ? 0.9243 1.2126 1.7007 0.2054  0.2431  0.6824  211 PHE B O   
3112 C CB  . PHE B 128 ? 0.8007 1.1024 1.5609 0.1794  0.1886  0.6307  211 PHE B CB  
3113 C CG  . PHE B 128 ? 0.7782 1.0826 1.5233 0.1674  0.1647  0.6050  211 PHE B CG  
3114 C CD1 . PHE B 128 ? 0.7714 1.0847 1.5454 0.1460  0.1480  0.6006  211 PHE B CD1 
3115 C CD2 . PHE B 128 ? 0.7862 1.0831 1.4887 0.1761  0.1591  0.5857  211 PHE B CD2 
3116 C CE1 . PHE B 128 ? 0.7473 1.0615 1.5072 0.1338  0.1308  0.5756  211 PHE B CE1 
3117 C CE2 . PHE B 128 ? 0.7764 1.0778 1.4729 0.1650  0.1398  0.5619  211 PHE B CE2 
3118 C CZ  . PHE B 128 ? 0.7636 1.0731 1.4883 0.1441  0.1280  0.5562  211 PHE B CZ  
3119 N N   . VAL B 129 ? 0.8167 1.1251 1.6675 0.1769  0.2145  0.6914  212 VAL B N   
3120 C CA  . VAL B 129 ? 0.8690 1.1812 1.7590 0.1810  0.2374  0.7203  212 VAL B CA  
3121 C C   . VAL B 129 ? 0.8511 1.1823 1.8041 0.1662  0.2312  0.7334  212 VAL B C   
3122 O O   . VAL B 129 ? 0.8187 1.1575 1.7872 0.1468  0.2044  0.7245  212 VAL B O   
3123 C CB  . VAL B 129 ? 0.8616 1.1660 1.7587 0.1808  0.2403  0.7351  212 VAL B CB  
3124 C CG1 . VAL B 129 ? 0.9157 1.2000 1.7532 0.1973  0.2480  0.7300  212 VAL B CG1 
3125 C CG2 . VAL B 129 ? 0.7980 1.1066 1.7196 0.1610  0.2131  0.7280  212 VAL B CG2 
3126 N N   . PHE B 130 ? 0.8684 1.2061 1.8578 0.1744  0.2564  0.7551  213 PHE B N   
3127 C CA  . PHE B 130 ? 0.8701 1.2280 1.9304 0.1618  0.2505  0.7732  213 PHE B CA  
3128 C C   . PHE B 130 ? 0.8646 1.2299 1.9669 0.1445  0.2371  0.7889  213 PHE B C   
3129 O O   . PHE B 130 ? 0.9062 1.2627 2.0021 0.1499  0.2507  0.7981  213 PHE B O   
3130 C CB  . PHE B 130 ? 0.8730 1.2366 1.9687 0.1771  0.2848  0.7922  213 PHE B CB  
3131 C CG  . PHE B 130 ? 0.9195 1.2751 1.9840 0.1915  0.2979  0.7770  213 PHE B CG  
3132 C CD1 . PHE B 130 ? 0.9043 1.2676 1.9806 0.1828  0.2756  0.7671  213 PHE B CD1 
3133 C CD2 . PHE B 130 ? 0.9910 1.3282 2.0111 0.2120  0.3326  0.7727  213 PHE B CD2 
3134 C CE1 . PHE B 130 ? 0.9392 1.2928 1.9889 0.1956  0.2880  0.7529  213 PHE B CE1 
3135 C CE2 . PHE B 130 ? 1.0339 1.3605 2.0238 0.2238  0.3453  0.7567  213 PHE B CE2 
3136 C CZ  . PHE B 130 ? 0.9906 1.3256 1.9977 0.2163  0.3233  0.7466  213 PHE B CZ  
3137 N N   . SER B 131 ? 0.8698 1.2483 2.0103 0.1221  0.2087  0.7915  214 SER B N   
3138 C CA  . SER B 131 ? 0.9011 1.2836 2.0759 0.1009  0.1907  0.8020  214 SER B CA  
3139 C C   . SER B 131 ? 0.9343 1.3356 2.1891 0.0950  0.1985  0.8349  214 SER B C   
3140 O O   . SER B 131 ? 0.9345 1.3367 2.2178 0.0802  0.1898  0.8461  214 SER B O   
3141 C CB  . SER B 131 ? 0.8933 1.2750 2.0547 0.0753  0.1533  0.7839  214 SER B CB  
3142 O OG  . SER B 131 ? 0.8897 1.2857 2.0813 0.0667  0.1399  0.7916  214 SER B OG  
3143 N N   . THR B 132 ? 1.0362 1.4520 2.3313 0.1061  0.2150  0.8500  215 THR B N   
3144 C CA  . THR B 132 ? 1.0646 1.5007 2.4449 0.1055  0.2304  0.8831  215 THR B CA  
3145 C C   . THR B 132 ? 1.1370 1.5750 2.5289 0.1331  0.2747  0.8916  215 THR B C   
3146 O O   . THR B 132 ? 1.0724 1.4967 2.4091 0.1496  0.2874  0.8721  215 THR B O   
3147 C CB  . THR B 132 ? 1.0416 1.5011 2.4945 0.0827  0.1981  0.9005  215 THR B CB  
3148 O OG1 . THR B 132 ? 0.8576 1.3101 2.2725 0.0607  0.1571  0.8813  215 THR B OG1 
3149 C CG2 . THR B 132 ? 1.1614 1.6364 2.6887 0.0663  0.1935  0.9286  215 THR B CG2 
3150 N N   . GLU B 133 ? 1.1594 1.6135 2.6246 0.1367  0.2991  0.9198  216 GLU B N   
3151 C CA  . GLU B 133 ? 1.2056 1.6614 2.6906 0.1610  0.3453  0.9280  216 GLU B CA  
3152 C C   . GLU B 133 ? 1.1595 1.6251 2.6707 0.1667  0.3393  0.9241  216 GLU B C   
3153 O O   . GLU B 133 ? 1.0811 1.5387 2.5819 0.1883  0.3754  0.9190  216 GLU B O   
3154 C CB  . GLU B 133 ? 1.3674 1.8388 2.9296 0.1629  0.3764  0.9587  216 GLU B CB  
3155 C CG  . GLU B 133 ? 1.4951 2.0002 3.1698 0.1469  0.3567  0.9860  216 GLU B CG  
3156 C CD  . GLU B 133 ? 1.6151 2.1283 3.3167 0.1194  0.3213  0.9975  216 GLU B CD  
3157 O OE1 . GLU B 133 ? 1.6391 2.1316 3.2726 0.1100  0.3037  0.9810  216 GLU B OE1 
3158 O OE2 . GLU B 133 ? 1.5840 2.1247 3.3820 0.1069  0.3114  1.0240  216 GLU B OE2 
3159 N N   . GLU B 134 ? 1.1708 1.6503 2.7115 0.1462  0.2936  0.9261  217 GLU B N   
3160 C CA  . GLU B 134 ? 1.1757 1.6572 2.7177 0.1481  0.2773  0.9174  217 GLU B CA  
3161 C C   . GLU B 134 ? 1.1257 1.5809 2.5787 0.1669  0.2961  0.8871  217 GLU B C   
3162 O O   . GLU B 134 ? 1.1110 1.5632 2.5740 0.1836  0.3176  0.8841  217 GLU B O   
3163 C CB  . GLU B 134 ? 1.2689 1.7558 2.8081 0.1190  0.2203  0.9142  217 GLU B CB  
3164 C CG  . GLU B 134 ? 1.3134 1.8279 2.9512 0.1018  0.1929  0.9448  217 GLU B CG  
3165 C CD  . GLU B 134 ? 1.3860 1.9180 3.0890 0.0897  0.1930  0.9701  217 GLU B CD  
3166 O OE1 . GLU B 134 ? 1.3603 1.8805 3.0200 0.0796  0.1891  0.9608  217 GLU B OE1 
3167 O OE2 . GLU B 134 ? 1.5439 2.1018 3.3468 0.0900  0.1967  1.0000  217 GLU B OE2 
3168 N N   . ARG B 135 ? 1.0284 1.4643 2.3984 0.1632  0.2868  0.8649  218 ARG B N   
3169 C CA  . ARG B 135 ? 0.9638 1.3751 2.2465 0.1783  0.2997  0.8361  218 ARG B CA  
3170 C C   . ARG B 135 ? 0.9556 1.3652 2.2259 0.1754  0.2787  0.8213  218 ARG B C   
3171 O O   . ARG B 135 ? 1.0183 1.4155 2.2633 0.1927  0.3006  0.8089  218 ARG B O   
3172 C CB  . ARG B 135 ? 0.9627 1.3610 2.2297 0.2033  0.3516  0.8382  218 ARG B CB  
3173 C CG  . ARG B 135 ? 0.9129 1.3061 2.1712 0.2051  0.3718  0.8504  218 ARG B CG  
3174 C CD  . ARG B 135 ? 0.9156 1.2961 2.1657 0.2268  0.4272  0.8573  218 ARG B CD  
3175 N NE  . ARG B 135 ? 0.9306 1.2808 2.0800 0.2371  0.4388  0.8365  218 ARG B NE  
3176 C CZ  . ARG B 135 ? 0.9653 1.2934 2.0562 0.2527  0.4627  0.8180  218 ARG B CZ  
3177 N NH1 . ARG B 135 ? 0.9595 1.2888 2.0806 0.2632  0.4863  0.8160  218 ARG B NH1 
3178 N NH2 . ARG B 135 ? 1.0495 1.3513 2.0485 0.2577  0.4634  0.8014  218 ARG B NH2 
3179 N N   . THR B 136 ? 0.9288 1.3494 2.2179 0.1513  0.2362  0.8239  219 THR B N   
3180 C CA  . THR B 136 ? 0.9231 1.3418 2.1989 0.1409  0.2075  0.8125  219 THR B CA  
3181 C C   . THR B 136 ? 0.9246 1.3323 2.1337 0.1220  0.1759  0.7882  219 THR B C   
3182 O O   . THR B 136 ? 1.1227 1.5239 2.3025 0.1139  0.1565  0.7734  219 THR B O   
3183 C CB  . THR B 136 ? 0.9283 1.3689 2.2865 0.1232  0.1803  0.8401  219 THR B CB  
3184 O OG1 . THR B 136 ? 0.8941 1.3446 2.2727 0.1007  0.1569  0.8519  219 THR B OG1 
3185 C CG2 . THR B 136 ? 0.9246 1.3799 2.3661 0.1419  0.2106  0.8657  219 THR B CG2 
3186 N N   . GLN B 137 ? 0.9098 1.3144 2.0984 0.1149  0.1729  0.7845  220 GLN B N   
3187 C CA  . GLN B 137 ? 0.8979 1.2942 2.0411 0.0937  0.1440  0.7649  220 GLN B CA  
3188 C C   . GLN B 137 ? 0.8975 1.2786 1.9847 0.1066  0.1603  0.7463  220 GLN B C   
3189 O O   . GLN B 137 ? 0.8803 1.2614 1.9823 0.1157  0.1789  0.7591  220 GLN B O   
3190 C CB  . GLN B 137 ? 0.9232 1.3306 2.1123 0.0681  0.1195  0.7831  220 GLN B CB  
3191 C CG  . GLN B 137 ? 0.9621 1.3584 2.1137 0.0487  0.1012  0.7660  220 GLN B CG  
3192 C CD  . GLN B 137 ? 1.0735 1.4621 2.1891 0.0232  0.0698  0.7469  220 GLN B CD  
3193 O OE1 . GLN B 137 ? 1.2735 1.6631 2.3808 0.0209  0.0603  0.7437  220 GLN B OE1 
3194 N NE2 . GLN B 137 ? 1.1318 1.5100 2.2236 0.0031  0.0551  0.7330  220 GLN B NE2 
3195 N N   . LEU B 138 ? 0.8877 1.2562 1.9142 0.1067  0.1523  0.7178  221 LEU B N   
3196 C CA  . LEU B 138 ? 0.8501 1.2050 1.8261 0.1190  0.1628  0.7003  221 LEU B CA  
3197 C C   . LEU B 138 ? 0.8791 1.2291 1.8389 0.1005  0.1415  0.6859  221 LEU B C   
3198 O O   . LEU B 138 ? 0.8152 1.1683 1.7834 0.0762  0.1176  0.6808  221 LEU B O   
3199 C CB  . LEU B 138 ? 0.8457 1.1902 1.7690 0.1324  0.1688  0.6772  221 LEU B CB  
3200 C CG  . LEU B 138 ? 0.8696 1.2111 1.7946 0.1540  0.1962  0.6854  221 LEU B CG  
3201 C CD1 . LEU B 138 ? 0.9024 1.2319 1.7737 0.1620  0.1964  0.6599  221 LEU B CD1 
3202 C CD2 . LEU B 138 ? 0.8891 1.2246 1.8132 0.1716  0.2247  0.6998  221 LEU B CD2 
3203 N N   . ARG B 139 ? 0.9193 1.2594 1.8552 0.1119  0.1512  0.6800  222 ARG B N   
3204 C CA  . ARG B 139 ? 0.9557 1.2882 1.8762 0.0997  0.1365  0.6636  222 ARG B CA  
3205 C C   . ARG B 139 ? 0.8756 1.1966 1.7560 0.1187  0.1454  0.6502  222 ARG B C   
3206 O O   . ARG B 139 ? 0.8268 1.1433 1.6989 0.1387  0.1646  0.6636  222 ARG B O   
3207 C CB  . ARG B 139 ? 1.1095 1.4433 2.0714 0.0892  0.1355  0.6835  222 ARG B CB  
3208 C CG  . ARG B 139 ? 1.3698 1.6953 2.3302 0.0678  0.1175  0.6687  222 ARG B CG  
3209 C CD  . ARG B 139 ? 1.6079 1.9362 2.6150 0.0491  0.1106  0.6891  222 ARG B CD  
3210 N NE  . ARG B 139 ? 1.8124 2.1355 2.8155 0.0179  0.0864  0.6731  222 ARG B NE  
3211 C CZ  . ARG B 139 ? 1.8575 2.1746 2.8840 -0.0055 0.0742  0.6778  222 ARG B CZ  
3212 N NH1 . ARG B 139 ? 1.7070 2.0154 2.7157 -0.0350 0.0536  0.6592  222 ARG B NH1 
3213 N NH2 . ARG B 139 ? 1.9130 2.2301 2.9767 -0.0019 0.0827  0.6998  222 ARG B NH2 
3214 N N   . LEU B 140 ? 0.8394 1.1551 1.6954 0.1115  0.1316  0.6244  223 LEU B N   
3215 C CA  . LEU B 140 ? 0.9032 1.2093 1.7316 0.1268  0.1341  0.6128  223 LEU B CA  
3216 C C   . LEU B 140 ? 0.9074 1.2056 1.7566 0.1314  0.1405  0.6310  223 LEU B C   
3217 O O   . LEU B 140 ? 0.8660 1.1622 1.7429 0.1151  0.1332  0.6324  223 LEU B O   
3218 C CB  . LEU B 140 ? 0.8759 1.1803 1.6898 0.1154  0.1190  0.5823  223 LEU B CB  
3219 C CG  . LEU B 140 ? 0.8748 1.1719 1.6715 0.1298  0.1172  0.5693  223 LEU B CG  
3220 C CD1 . LEU B 140 ? 0.8586 1.1538 1.6223 0.1524  0.1239  0.5735  223 LEU B CD1 
3221 C CD2 . LEU B 140 ? 0.8614 1.1604 1.6530 0.1163  0.1057  0.5379  223 LEU B CD2 
3222 N N   . GLU B 141 ? 0.9504 1.2414 1.7820 0.1524  0.1544  0.6448  224 GLU B N   
3223 C CA  . GLU B 141 ? 1.0191 1.3014 1.8682 0.1586  0.1651  0.6691  224 GLU B CA  
3224 C C   . GLU B 141 ? 0.9957 1.2682 1.8580 0.1528  0.1534  0.6621  224 GLU B C   
3225 O O   . GLU B 141 ? 1.0346 1.3021 1.9282 0.1454  0.1561  0.6773  224 GLU B O   
3226 C CB  . GLU B 141 ? 1.0991 1.3710 1.9107 0.1812  0.1807  0.6811  224 GLU B CB  
3227 C CG  . GLU B 141 ? 1.2115 1.4722 2.0328 0.1886  0.1964  0.7097  224 GLU B CG  
3228 C CD  . GLU B 141 ? 1.3936 1.6392 2.1641 0.2082  0.2101  0.7192  224 GLU B CD  
3229 O OE1 . GLU B 141 ? 1.4152 1.6557 2.1444 0.2161  0.1982  0.7017  224 GLU B OE1 
3230 O OE2 . GLU B 141 ? 1.5230 1.7607 2.2937 0.2141  0.2328  0.7446  224 GLU B OE2 
3231 N N   . SER B 142 ? 1.0056 1.2750 1.8468 0.1565  0.1413  0.6385  225 SER B N   
3232 C CA  . SER B 142 ? 1.0324 1.2902 1.8837 0.1591  0.1335  0.6328  225 SER B CA  
3233 C C   . SER B 142 ? 1.0178 1.2793 1.8609 0.1554  0.1199  0.6002  225 SER B C   
3234 O O   . SER B 142 ? 0.9855 1.2553 1.8012 0.1605  0.1168  0.5872  225 SER B O   
3235 C CB  . SER B 142 ? 1.1038 1.3494 1.9327 0.1813  0.1393  0.6528  225 SER B CB  
3236 O OG  . SER B 142 ? 1.1935 1.4266 2.0368 0.1860  0.1298  0.6510  225 SER B OG  
3237 N N   . LEU B 143 ? 1.0307 1.2848 1.8998 0.1465  0.1138  0.5866  226 LEU B N   
3238 C CA  . LEU B 143 ? 1.0653 1.3212 1.9350 0.1462  0.1048  0.5572  226 LEU B CA  
3239 C C   . LEU B 143 ? 1.0683 1.3144 1.9488 0.1651  0.0993  0.5615  226 LEU B C   
3240 O O   . LEU B 143 ? 0.9275 1.1763 1.8189 0.1666  0.0924  0.5386  226 LEU B O   
3241 C CB  . LEU B 143 ? 1.0851 1.3379 1.9768 0.1210  0.1042  0.5341  226 LEU B CB  
3242 C CG  . LEU B 143 ? 1.1000 1.3612 1.9800 0.0987  0.1041  0.5296  226 LEU B CG  
3243 C CD1 . LEU B 143 ? 1.0633 1.3150 1.9574 0.0707  0.1027  0.5093  226 LEU B CD1 
3244 C CD2 . LEU B 143 ? 1.1129 1.3880 1.9631 0.1012  0.1009  0.5154  226 LEU B CD2 
3245 N N   . GLU B 144 ? 1.2465 1.4811 2.1256 0.1790  0.1024  0.5916  227 GLU B N   
3246 C CA  . GLU B 144 ? 1.4084 1.6289 2.3043 0.1945  0.0952  0.6017  227 GLU B CA  
3247 C C   . GLU B 144 ? 1.4817 1.7091 2.3752 0.2063  0.0806  0.5834  227 GLU B C   
3248 O O   . GLU B 144 ? 1.6059 1.8262 2.5351 0.2115  0.0736  0.5766  227 GLU B O   
3249 C CB  . GLU B 144 ? 1.5876 1.7955 2.4621 0.2100  0.0988  0.6386  227 GLU B CB  
3250 C CG  . GLU B 144 ? 1.7051 1.9034 2.5897 0.2031  0.1141  0.6654  227 GLU B CG  
3251 C CD  . GLU B 144 ? 1.7143 1.9069 2.6445 0.1846  0.1175  0.6577  227 GLU B CD  
3252 O OE1 . GLU B 144 ? 1.8746 2.0522 2.8350 0.1869  0.1123  0.6555  227 GLU B OE1 
3253 O OE2 . GLU B 144 ? 1.4785 1.6799 2.4148 0.1676  0.1248  0.6554  227 GLU B OE2 
3254 N N   . ASP B 145 ? 1.4071 1.6478 2.2642 0.2107  0.0759  0.5759  228 ASP B N   
3255 C CA  . ASP B 145 ? 1.4013 1.6514 2.2602 0.2198  0.0601  0.5577  228 ASP B CA  
3256 C C   . ASP B 145 ? 1.2364 1.5047 2.0796 0.2092  0.0603  0.5295  228 ASP B C   
3257 O O   . ASP B 145 ? 1.1379 1.4131 1.9445 0.2152  0.0543  0.5288  228 ASP B O   
3258 C CB  . ASP B 145 ? 1.4877 1.7297 2.3186 0.2400  0.0460  0.5813  228 ASP B CB  
3259 C CG  . ASP B 145 ? 1.5029 1.7296 2.3689 0.2514  0.0364  0.5986  228 ASP B CG  
3260 O OD1 . ASP B 145 ? 1.4952 1.7265 2.4083 0.2533  0.0274  0.5811  228 ASP B OD1 
3261 O OD2 . ASP B 145 ? 1.5225 1.7315 2.3714 0.2583  0.0393  0.6300  228 ASP B OD2 
3262 N N   . THR B 146 ? 1.1124 1.3851 1.9823 0.1913  0.0682  0.5061  229 THR B N   
3263 C CA  . THR B 146 ? 0.9796 1.2668 1.8447 0.1777  0.0692  0.4764  229 THR B CA  
3264 C C   . THR B 146 ? 0.9429 1.2331 1.8523 0.1773  0.0664  0.4524  229 THR B C   
3265 O O   . THR B 146 ? 1.0885 1.3696 2.0295 0.1900  0.0617  0.4624  229 THR B O   
3266 C CB  . THR B 146 ? 0.9596 1.2459 1.8171 0.1544  0.0814  0.4704  229 THR B CB  
3267 O OG1 . THR B 146 ? 0.9263 1.1994 1.8146 0.1442  0.0882  0.4711  229 THR B OG1 
3268 C CG2 . THR B 146 ? 0.9491 1.2349 1.7740 0.1569  0.0852  0.4949  229 THR B CG2 
3269 N N   . HIS B 147 ? 0.8812 1.1829 1.7953 0.1629  0.0707  0.4218  230 HIS B N   
3270 C CA  . HIS B 147 ? 0.8701 1.1786 1.8279 0.1627  0.0714  0.3950  230 HIS B CA  
3271 C C   . HIS B 147 ? 0.8833 1.1880 1.8509 0.1364  0.0895  0.3657  230 HIS B C   
3272 O O   . HIS B 147 ? 0.9091 1.2206 1.8467 0.1191  0.0941  0.3520  230 HIS B O   
3273 C CB  . HIS B 147 ? 0.8580 1.1862 1.8097 0.1708  0.0590  0.3844  230 HIS B CB  
3274 C CG  . HIS B 147 ? 0.9064 1.2357 1.8405 0.1936  0.0390  0.4106  230 HIS B CG  
3275 N ND1 . HIS B 147 ? 0.9833 1.3112 1.9529 0.2124  0.0244  0.4219  230 HIS B ND1 
3276 C CD2 . HIS B 147 ? 0.9582 1.2869 1.8400 0.1994  0.0314  0.4281  230 HIS B CD2 
3277 C CE1 . HIS B 147 ? 1.0208 1.3464 1.9547 0.2270  0.0067  0.4460  230 HIS B CE1 
3278 N NE2 . HIS B 147 ? 0.9929 1.3183 1.8722 0.2194  0.0126  0.4485  230 HIS B NE2 
3279 N N   . ILE B 148 ? 0.9508 1.2418 1.9577 0.1322  0.1000  0.3556  231 ILE B N   
3280 C CA  . ILE B 148 ? 1.0241 1.3053 2.0324 0.1042  0.1190  0.3267  231 ILE B CA  
3281 C C   . ILE B 148 ? 1.0710 1.3645 2.1080 0.1000  0.1287  0.2919  231 ILE B C   
3282 O O   . ILE B 148 ? 1.1640 1.4609 2.2538 0.1156  0.1294  0.2842  231 ILE B O   
3283 C CB  . ILE B 148 ? 1.0534 1.3086 2.0719 0.0917  0.1292  0.3302  231 ILE B CB  
3284 C CG1 . ILE B 148 ? 1.1139 1.3551 2.1522 0.0685  0.1510  0.2917  231 ILE B CG1 
3285 C CG2 . ILE B 148 ? 1.0146 1.2595 2.0591 0.1143  0.1206  0.3599  231 ILE B CG2 
3286 C CD1 . ILE B 148 ? 1.1623 1.4011 2.1525 0.0355  0.1591  0.2733  231 ILE B CD1 
3287 N N   . MET B 149 ? 1.1238 1.4246 2.1275 0.0789  0.1354  0.2732  232 MET B N   
3288 C CA  . MET B 149 ? 1.1108 1.4251 2.1343 0.0712  0.1467  0.2409  232 MET B CA  
3289 C C   . MET B 149 ? 1.1889 1.4853 2.2191 0.0440  0.1734  0.2086  232 MET B C   
3290 O O   . MET B 149 ? 1.1942 1.4676 2.2048 0.0280  0.1800  0.2112  232 MET B O   
3291 C CB  . MET B 149 ? 1.0960 1.4263 2.0760 0.0631  0.1391  0.2401  232 MET B CB  
3292 C CG  . MET B 149 ? 1.1482 1.5011 2.1407 0.0875  0.1200  0.2507  232 MET B CG  
3293 S SD  . MET B 149 ? 1.2457 1.5986 2.2731 0.1223  0.1002  0.2806  232 MET B SD  
3294 C CE  . MET B 149 ? 1.2916 1.6651 2.2948 0.1393  0.0749  0.2948  232 MET B CE  
3295 N N   . LYS B 150 ? 1.3078 1.6146 2.3661 0.0380  0.1893  0.1778  233 LYS B N   
3296 C CA  . LYS B 150 ? 1.3875 1.6771 2.4572 0.0131  0.2206  0.1412  233 LYS B CA  
3297 C C   . LYS B 150 ? 1.4146 1.7104 2.4405 -0.0140 0.2309  0.1210  233 LYS B C   
3298 O O   . LYS B 150 ? 1.4052 1.7240 2.4538 -0.0085 0.2334  0.1082  233 LYS B O   
3299 C CB  . LYS B 150 ? 1.4105 1.7051 2.5622 0.0302  0.2359  0.1212  233 LYS B CB  
3300 C CG  . LYS B 150 ? 1.4323 1.7435 2.6341 0.0690  0.2098  0.1500  233 LYS B CG  
3301 C CD  . LYS B 150 ? 1.4657 1.8105 2.6806 0.0845  0.1914  0.1555  233 LYS B CD  
3302 C CE  . LYS B 150 ? 1.4664 1.8204 2.6744 0.1126  0.1563  0.1958  233 LYS B CE  
3303 N NZ  . LYS B 150 ? 1.4049 1.7818 2.5802 0.1159  0.1368  0.2045  233 LYS B NZ  
3304 N N   . GLY B 151 ? 1.4450 1.7200 2.4077 -0.0436 0.2337  0.1218  234 GLY B N   
3305 C CA  . GLY B 151 ? 1.4384 1.7105 2.3497 -0.0754 0.2438  0.1047  234 GLY B CA  
3306 C C   . GLY B 151 ? 1.3844 1.6786 2.2677 -0.0684 0.2220  0.1241  234 GLY B C   
3307 O O   . GLY B 151 ? 1.2635 1.5580 2.1176 -0.0611 0.1991  0.1549  234 GLY B O   
3308 N N   . GLU B 152 ? 1.4130 1.7251 2.3098 -0.0705 0.2311  0.1050  235 GLU B N   
3309 C CA  . GLU B 152 ? 1.4003 1.7312 2.2719 -0.0671 0.2139  0.1173  235 GLU B CA  
3310 C C   . GLU B 152 ? 1.3500 1.7085 2.2672 -0.0308 0.1949  0.1308  235 GLU B C   
3311 O O   . GLU B 152 ? 1.2794 1.6507 2.1745 -0.0235 0.1768  0.1452  235 GLU B O   
3312 C CB  . GLU B 152 ? 1.4605 1.7921 2.3127 -0.0959 0.2342  0.0893  235 GLU B CB  
3313 C CG  . GLU B 152 ? 1.5364 1.8741 2.4433 -0.0990 0.2644  0.0537  235 GLU B CG  
3314 C CD  . GLU B 152 ? 1.6197 1.9671 2.5191 -0.1202 0.2822  0.0297  235 GLU B CD  
3315 O OE1 . GLU B 152 ? 1.5830 1.9441 2.4591 -0.1191 0.2648  0.0423  235 GLU B OE1 
3316 O OE2 . GLU B 152 ? 1.7266 2.0665 2.6451 -0.1385 0.3162  -0.0028 235 GLU B OE2 
3317 N N   . ASP B 153 ? 1.3423 1.7076 2.3212 -0.0091 0.1976  0.1268  236 ASP B N   
3318 C CA  . ASP B 153 ? 1.3096 1.6986 2.3311 0.0238  0.1758  0.1416  236 ASP B CA  
3319 C C   . ASP B 153 ? 1.2400 1.6260 2.2286 0.0430  0.1480  0.1791  236 ASP B C   
3320 O O   . ASP B 153 ? 1.3218 1.6885 2.2822 0.0387  0.1475  0.1948  236 ASP B O   
3321 C CB  . ASP B 153 ? 1.3410 1.7341 2.4383 0.0413  0.1840  0.1317  236 ASP B CB  
3322 C CG  . ASP B 153 ? 1.4098 1.8266 2.5518 0.0731  0.1577  0.1485  236 ASP B CG  
3323 O OD1 . ASP B 153 ? 1.4037 1.8441 2.5683 0.0750  0.1525  0.1378  236 ASP B OD1 
3324 O OD2 . ASP B 153 ? 1.6017 2.0121 2.7531 0.0947  0.1404  0.1741  236 ASP B OD2 
3325 N N   . ASP B 154 ? 1.1423 1.5465 2.1324 0.0620  0.1261  0.1926  237 ASP B N   
3326 C CA  . ASP B 154 ? 1.0450 1.4453 2.0035 0.0813  0.1028  0.2263  237 ASP B CA  
3327 C C   . ASP B 154 ? 0.9976 1.4150 1.9785 0.1073  0.0787  0.2385  237 ASP B C   
3328 O O   . ASP B 154 ? 0.9461 1.3601 1.8903 0.1202  0.0608  0.2627  237 ASP B O   
3329 C CB  . ASP B 154 ? 1.0234 1.4165 1.9178 0.0668  0.1005  0.2353  237 ASP B CB  
3330 C CG  . ASP B 154 ? 1.0015 1.4098 1.8802 0.0668  0.0903  0.2292  237 ASP B CG  
3331 O OD1 . ASP B 154 ? 0.9276 1.3518 1.8387 0.0619  0.0947  0.2063  237 ASP B OD1 
3332 O OD2 . ASP B 154 ? 0.9650 1.3685 1.8006 0.0710  0.0791  0.2470  237 ASP B OD2 
3333 N N   . ALA B 155 ? 1.0248 1.4593 2.0661 0.1144  0.0780  0.2224  238 ALA B N   
3334 C CA  . ALA B 155 ? 1.0352 1.4875 2.1000 0.1354  0.0511  0.2328  238 ALA B CA  
3335 C C   . ALA B 155 ? 1.0157 1.4583 2.0951 0.1588  0.0352  0.2603  238 ALA B C   
3336 O O   . ALA B 155 ? 0.9642 1.3970 2.0790 0.1612  0.0477  0.2590  238 ALA B O   
3337 C CB  . ALA B 155 ? 1.0131 1.4895 2.1469 0.1338  0.0552  0.2073  238 ALA B CB  
3338 N N   . LEU B 156 ? 1.0104 1.4520 2.0573 0.1744  0.0089  0.2852  239 LEU B N   
3339 C CA  . LEU B 156 ? 1.0363 1.4674 2.0927 0.1957  -0.0079 0.3135  239 LEU B CA  
3340 C C   . LEU B 156 ? 1.1018 1.5404 2.1420 0.2108  -0.0415 0.3310  239 LEU B C   
3341 O O   . LEU B 156 ? 1.0455 1.4918 2.0506 0.2038  -0.0491 0.3235  239 LEU B O   
3342 C CB  . LEU B 156 ? 0.9921 1.3985 2.0015 0.1939  0.0034  0.3332  239 LEU B CB  
3343 C CG  . LEU B 156 ? 1.0332 1.4300 1.9671 0.1889  0.0027  0.3461  239 LEU B CG  
3344 C CD1 . LEU B 156 ? 1.1117 1.4974 2.0109 0.2077  -0.0177 0.3776  239 LEU B CD1 
3345 C CD2 . LEU B 156 ? 1.0572 1.4382 1.9665 0.1750  0.0251  0.3486  239 LEU B CD2 
3346 N N   . SER B 157 ? 1.1922 1.6274 2.2607 0.2301  -0.0625 0.3533  240 SER B N   
3347 C CA  . SER B 157 ? 1.1937 1.6335 2.2484 0.2436  -0.0996 0.3724  240 SER B CA  
3348 C C   . SER B 157 ? 1.2214 1.6369 2.2296 0.2581  -0.1163 0.4098  240 SER B C   
3349 O O   . SER B 157 ? 1.2001 1.6144 2.1853 0.2669  -0.1479 0.4271  240 SER B O   
3350 C CB  . SER B 157 ? 1.1766 1.6407 2.3180 0.2520  -0.1184 0.3640  240 SER B CB  
3351 O OG  . SER B 157 ? 1.1570 1.6263 2.3710 0.2504  -0.0933 0.3463  240 SER B OG  
3352 N N   . ASP B 158 ? 1.2556 1.6507 2.2478 0.2586  -0.0956 0.4222  241 ASP B N   
3353 C CA  . ASP B 158 ? 1.3556 1.7257 2.2990 0.2693  -0.1043 0.4571  241 ASP B CA  
3354 C C   . ASP B 158 ? 1.3279 1.6865 2.1834 0.2628  -0.1001 0.4627  241 ASP B C   
3355 O O   . ASP B 158 ? 1.3256 1.6779 2.1542 0.2524  -0.0736 0.4560  241 ASP B O   
3356 C CB  . ASP B 158 ? 1.4063 1.7590 2.3654 0.2700  -0.0813 0.4675  241 ASP B CB  
3357 C CG  . ASP B 158 ? 1.5008 1.8552 2.5420 0.2800  -0.0856 0.4689  241 ASP B CG  
3358 O OD1 . ASP B 158 ? 1.4914 1.8593 2.5827 0.2905  -0.1098 0.4692  241 ASP B OD1 
3359 O OD2 . ASP B 158 ? 1.5911 1.9317 2.6495 0.2769  -0.0641 0.4704  241 ASP B OD2 
3360 N N   . LYS B 159 ? 1.3133 1.6667 2.1254 0.2691  -0.1269 0.4768  242 LYS B N   
3361 C CA  . LYS B 159 ? 1.3087 1.6498 2.0378 0.2634  -0.1252 0.4785  242 LYS B CA  
3362 C C   . LYS B 159 ? 1.3468 1.6579 2.0153 0.2708  -0.1202 0.5106  242 LYS B C   
3363 O O   . LYS B 159 ? 1.4582 1.7550 2.0902 0.2784  -0.1446 0.5321  242 LYS B O   
3364 C CB  . LYS B 159 ? 1.2854 1.6371 2.0048 0.2632  -0.1581 0.4715  242 LYS B CB  
3365 C CG  . LYS B 159 ? 1.2047 1.5854 1.9749 0.2524  -0.1552 0.4374  242 LYS B CG  
3366 C CD  . LYS B 159 ? 1.1917 1.5851 1.9574 0.2498  -0.1875 0.4288  242 LYS B CD  
3367 C CE  . LYS B 159 ? 1.1867 1.6069 1.9974 0.2364  -0.1760 0.3942  242 LYS B CE  
3368 N NZ  . LYS B 159 ? 1.2523 1.6921 2.0849 0.2331  -0.2079 0.3835  242 LYS B NZ  
3369 N N   . HIS B 160 ? 1.3062 1.6078 1.9649 0.2669  -0.0887 0.5141  243 HIS B N   
3370 C CA  . HIS B 160 ? 1.3633 1.6387 1.9732 0.2722  -0.0762 0.5430  243 HIS B CA  
3371 C C   . HIS B 160 ? 1.3500 1.6202 1.9256 0.2632  -0.0442 0.5363  243 HIS B C   
3372 O O   . HIS B 160 ? 1.2768 1.5616 1.8876 0.2535  -0.0279 0.5170  243 HIS B O   
3373 C CB  . HIS B 160 ? 1.4289 1.6992 2.0880 0.2787  -0.0721 0.5604  243 HIS B CB  
3374 C CG  . HIS B 160 ? 1.5968 1.8405 2.2138 0.2840  -0.0607 0.5928  243 HIS B CG  
3375 N ND1 . HIS B 160 ? 1.6437 1.8809 2.2605 0.2788  -0.0298 0.5985  243 HIS B ND1 
3376 C CD2 . HIS B 160 ? 1.7083 1.9297 2.2825 0.2928  -0.0760 0.6224  243 HIS B CD2 
3377 C CE1 . HIS B 160 ? 1.7017 1.9153 2.2811 0.2848  -0.0239 0.6292  243 HIS B CE1 
3378 N NE2 . HIS B 160 ? 1.7490 1.9509 2.2981 0.2929  -0.0508 0.6442  243 HIS B NE2 
3379 N N   . GLY B 161 ? 1.3894 1.6377 1.8966 0.2657  -0.0353 0.5524  244 GLY B N   
3380 C CA  . GLY B 161 ? 1.2999 1.5421 1.7762 0.2594  -0.0049 0.5484  244 GLY B CA  
3381 C C   . GLY B 161 ? 1.3147 1.5316 1.7109 0.2625  0.0024  0.5598  244 GLY B C   
3382 O O   . GLY B 161 ? 1.4005 1.6035 1.7549 0.2671  -0.0190 0.5688  244 GLY B O   
3383 N N   . CYS B 162 ? 1.2697 1.4797 1.6452 0.2592  0.0326  0.5589  245 CYS B N   
3384 C CA  . CYS B 162 ? 1.3142 1.4981 1.6155 0.2613  0.0483  0.5655  245 CYS B CA  
3385 C C   . CYS B 162 ? 1.2773 1.4607 1.5437 0.2558  0.0374  0.5395  245 CYS B C   
3386 O O   . CYS B 162 ? 1.2145 1.4162 1.5144 0.2489  0.0407  0.5180  245 CYS B O   
3387 C CB  . CYS B 162 ? 1.3275 1.5069 1.6352 0.2607  0.0869  0.5741  245 CYS B CB  
3388 S SG  . CYS B 162 ? 1.4445 1.5953 1.6768 0.2621  0.1168  0.5727  245 CYS B SG  
3389 N N   . PRO B 163 ? 1.3138 1.4741 1.5103 0.2570  0.0240  0.5416  246 PRO B N   
3390 C CA  . PRO B 163 ? 1.3362 1.4954 1.5012 0.2503  0.0057  0.5169  246 PRO B CA  
3391 C C   . PRO B 163 ? 1.3580 1.5192 1.5217 0.2441  0.0282  0.4939  246 PRO B C   
3392 O O   . PRO B 163 ? 1.4266 1.6045 1.6126 0.2369  0.0125  0.4709  246 PRO B O   
3393 C CB  . PRO B 163 ? 1.4021 1.5261 1.4777 0.2512  -0.0017 0.5283  246 PRO B CB  
3394 C CG  . PRO B 163 ? 1.4508 1.5686 1.5315 0.2585  -0.0090 0.5590  246 PRO B CG  
3395 C CD  . PRO B 163 ? 1.3937 1.5260 1.5348 0.2626  0.0210  0.5683  246 PRO B CD  
3396 N N   . ALA B 164 ? 1.3692 1.5146 1.5138 0.2466  0.0651  0.5005  247 ALA B N   
3397 C CA  . ALA B 164 ? 1.3376 1.4837 1.4875 0.2417  0.0861  0.4808  247 ALA B CA  
3398 C C   . ALA B 164 ? 1.2524 1.4313 1.4762 0.2351  0.0797  0.4676  247 ALA B C   
3399 O O   . ALA B 164 ? 1.2934 1.4758 1.5206 0.2280  0.0807  0.4471  247 ALA B O   
3400 C CB  . ALA B 164 ? 1.3619 1.4896 1.4967 0.2471  0.1277  0.4931  247 ALA B CB  
3401 N N   . TYR B 165 ? 1.1729 1.3728 1.4521 0.2358  0.0727  0.4786  248 TYR B N   
3402 C CA  . TYR B 165 ? 1.0791 1.3063 1.4215 0.2269  0.0685  0.4658  248 TYR B CA  
3403 C C   . TYR B 165 ? 1.0751 1.3227 1.4459 0.2209  0.0382  0.4483  248 TYR B C   
3404 O O   . TYR B 165 ? 1.0226 1.2907 1.4410 0.2116  0.0368  0.4356  248 TYR B O   
3405 C CB  . TYR B 165 ? 1.0372 1.2738 1.4255 0.2282  0.0822  0.4844  248 TYR B CB  
3406 C CG  . TYR B 165 ? 1.0817 1.3041 1.4579 0.2327  0.1132  0.5009  248 TYR B CG  
3407 C CD1 . TYR B 165 ? 1.1093 1.3372 1.5085 0.2265  0.1296  0.4956  248 TYR B CD1 
3408 C CD2 . TYR B 165 ? 1.1516 1.3546 1.4953 0.2427  0.1265  0.5227  248 TYR B CD2 
3409 C CE1 . TYR B 165 ? 1.0921 1.3097 1.4916 0.2316  0.1584  0.5115  248 TYR B CE1 
3410 C CE2 . TYR B 165 ? 1.1718 1.3634 1.5110 0.2469  0.1588  0.5372  248 TYR B CE2 
3411 C CZ  . TYR B 165 ? 1.1189 1.3192 1.4903 0.2420  0.1747  0.5313  248 TYR B CZ  
3412 O OH  . TYR B 165 ? 1.0944 1.2865 1.4736 0.2468  0.2066  0.5463  248 TYR B OH  
3413 N N   . VAL B 166 ? 1.1324 1.3745 1.4752 0.2248  0.0142  0.4472  249 VAL B N   
3414 C CA  . VAL B 166 ? 1.1105 1.3749 1.4923 0.2206  -0.0142 0.4332  249 VAL B CA  
3415 C C   . VAL B 166 ? 1.0602 1.3332 1.4410 0.2091  -0.0207 0.4057  249 VAL B C   
3416 O O   . VAL B 166 ? 1.0906 1.3453 1.4187 0.2074  -0.0195 0.3988  249 VAL B O   
3417 C CB  . VAL B 166 ? 1.1967 1.4545 1.5584 0.2286  -0.0428 0.4456  249 VAL B CB  
3418 C CG1 . VAL B 166 ? 1.1545 1.4384 1.5676 0.2250  -0.0722 0.4308  249 VAL B CG1 
3419 C CG2 . VAL B 166 ? 1.1990 1.4480 1.5674 0.2391  -0.0370 0.4743  249 VAL B CG2 
3420 N N   . SER B 167 ? 0.9904 1.2893 1.4286 0.2003  -0.0267 0.3896  250 SER B N   
3421 C CA  . SER B 167 ? 0.9768 1.2865 1.4231 0.1871  -0.0316 0.3635  250 SER B CA  
3422 C C   . SER B 167 ? 0.9885 1.3048 1.4293 0.1862  -0.0626 0.3528  250 SER B C   
3423 O O   . SER B 167 ? 1.0480 1.3681 1.4990 0.1950  -0.0829 0.3648  250 SER B O   
3424 C CB  . SER B 167 ? 0.9316 1.2642 1.4378 0.1760  -0.0227 0.3511  250 SER B CB  
3425 O OG  . SER B 167 ? 0.9308 1.2828 1.4875 0.1786  -0.0370 0.3494  250 SER B OG  
3426 N N   . PRO B 168 ? 1.0141 1.3313 1.4413 0.1750  -0.0683 0.3315  251 PRO B N   
3427 C CA  . PRO B 168 ? 1.0336 1.3567 1.4548 0.1721  -0.1005 0.3215  251 PRO B CA  
3428 C C   . PRO B 168 ? 1.0178 1.3729 1.5111 0.1722  -0.1202 0.3176  251 PRO B C   
3429 O O   . PRO B 168 ? 1.0761 1.4352 1.5732 0.1785  -0.1497 0.3258  251 PRO B O   
3430 C CB  . PRO B 168 ? 1.0295 1.3503 1.4368 0.1572  -0.0966 0.2975  251 PRO B CB  
3431 C CG  . PRO B 168 ? 1.0455 1.3507 1.4345 0.1556  -0.0634 0.2996  251 PRO B CG  
3432 C CD  . PRO B 168 ? 1.0035 1.3185 1.4288 0.1626  -0.0483 0.3158  251 PRO B CD  
3433 N N   . GLU B 169 ? 0.9939 1.3697 1.5441 0.1652  -0.1033 0.3063  252 GLU B N   
3434 C CA  . GLU B 169 ? 1.0075 1.4133 1.6331 0.1643  -0.1146 0.2983  252 GLU B CA  
3435 C C   . GLU B 169 ? 1.0394 1.4475 1.6903 0.1806  -0.1278 0.3198  252 GLU B C   
3436 O O   . GLU B 169 ? 1.1236 1.5527 1.8294 0.1840  -0.1486 0.3173  252 GLU B O   
3437 C CB  . GLU B 169 ? 0.9774 1.3986 1.6487 0.1514  -0.0882 0.2812  252 GLU B CB  
3438 C CG  . GLU B 169 ? 0.9619 1.3781 1.6482 0.1552  -0.0652 0.2926  252 GLU B CG  
3439 C CD  . GLU B 169 ? 0.9406 1.3367 1.5824 0.1495  -0.0413 0.2984  252 GLU B CD  
3440 O OE1 . GLU B 169 ? 0.9320 1.3104 1.5202 0.1505  -0.0423 0.3022  252 GLU B OE1 
3441 O OE2 . GLU B 169 ? 0.8875 1.2846 1.5500 0.1438  -0.0219 0.2995  252 GLU B OE2 
3442 N N   . ILE B 170 ? 1.0747 1.4611 1.6899 0.1907  -0.1160 0.3419  253 ILE B N   
3443 C CA  . ILE B 170 ? 1.0870 1.4698 1.7169 0.2061  -0.1298 0.3660  253 ILE B CA  
3444 C C   . ILE B 170 ? 1.1451 1.5200 1.7419 0.2124  -0.1662 0.3780  253 ILE B C   
3445 O O   . ILE B 170 ? 1.1815 1.5650 1.8149 0.2217  -0.1907 0.3912  253 ILE B O   
3446 C CB  . ILE B 170 ? 1.0999 1.4605 1.6984 0.2131  -0.1058 0.3871  253 ILE B CB  
3447 C CG1 . ILE B 170 ? 1.0776 1.4496 1.7254 0.2067  -0.0791 0.3780  253 ILE B CG1 
3448 C CG2 . ILE B 170 ? 1.1192 1.4674 1.7111 0.2283  -0.1215 0.4159  253 ILE B CG2 
3449 C CD1 . ILE B 170 ? 1.0327 1.3862 1.6510 0.2074  -0.0526 0.3927  253 ILE B CD1 
3450 N N   . LEU B 171 ? 1.1931 1.5502 1.7214 0.2061  -0.1707 0.3729  254 LEU B N   
3451 C CA  . LEU B 171 ? 1.2706 1.6138 1.7505 0.2078  -0.2051 0.3828  254 LEU B CA  
3452 C C   . LEU B 171 ? 1.2724 1.6397 1.7905 0.1996  -0.2384 0.3661  254 LEU B C   
3453 O O   . LEU B 171 ? 1.3852 1.7505 1.8940 0.2029  -0.2758 0.3791  254 LEU B O   
3454 C CB  . LEU B 171 ? 1.3400 1.6482 1.7240 0.2034  -0.1922 0.3827  254 LEU B CB  
3455 C CG  . LEU B 171 ? 1.3576 1.6412 1.7020 0.2108  -0.1570 0.3992  254 LEU B CG  
3456 C CD1 . LEU B 171 ? 1.4087 1.6604 1.6708 0.2055  -0.1386 0.3929  254 LEU B CD1 
3457 C CD2 . LEU B 171 ? 1.3782 1.6495 1.7113 0.2234  -0.1682 0.4302  254 LEU B CD2 
3458 N N   . ASN B 172 ? 1.2504 1.6404 1.8128 0.1881  -0.2268 0.3392  255 ASN B N   
3459 C CA  . ASN B 172 ? 1.2930 1.7069 1.8934 0.1784  -0.2575 0.3224  255 ASN B CA  
3460 C C   . ASN B 172 ? 1.2566 1.7114 1.9659 0.1776  -0.2583 0.3099  255 ASN B C   
3461 O O   . ASN B 172 ? 1.2686 1.7464 2.0209 0.1713  -0.2845 0.2991  255 ASN B O   
3462 C CB  . ASN B 172 ? 1.3369 1.7388 1.8856 0.1622  -0.2545 0.3010  255 ASN B CB  
3463 C CG  . ASN B 172 ? 1.3825 1.7740 1.9123 0.1559  -0.2111 0.2881  255 ASN B CG  
3464 O OD1 . ASN B 172 ? 1.3478 1.7554 1.9290 0.1564  -0.1868 0.2843  255 ASN B OD1 
3465 N ND2 . ASN B 172 ? 1.4767 1.8397 1.9339 0.1488  -0.2018 0.2810  255 ASN B ND2 
3466 N N   . THR B 173 ? 1.2500 1.7123 2.0033 0.1835  -0.2293 0.3111  256 THR B N   
3467 C CA  . THR B 173 ? 1.1863 1.6815 2.0404 0.1844  -0.2232 0.2998  256 THR B CA  
3468 C C   . THR B 173 ? 1.1569 1.6562 2.0535 0.2025  -0.2454 0.3239  256 THR B C   
3469 O O   . THR B 173 ? 1.1604 1.6343 2.0089 0.2134  -0.2474 0.3487  256 THR B O   
3470 C CB  . THR B 173 ? 1.1674 1.6616 2.0348 0.1775  -0.1770 0.2863  256 THR B CB  
3471 O OG1 . THR B 173 ? 1.1825 1.7011 2.1007 0.1618  -0.1628 0.2575  256 THR B OG1 
3472 C CG2 . THR B 173 ? 1.1485 1.6406 2.0552 0.1906  -0.1629 0.3005  256 THR B CG2 
3473 N N   . THR B 174 ? 1.1383 1.6691 2.1278 0.2055  -0.2613 0.3175  257 THR B N   
3474 C CA  . THR B 174 ? 1.1549 1.6925 2.2090 0.2227  -0.2708 0.3357  257 THR B CA  
3475 C C   . THR B 174 ? 1.1095 1.6567 2.2215 0.2205  -0.2276 0.3173  257 THR B C   
3476 O O   . THR B 174 ? 1.0171 1.5740 2.1353 0.2046  -0.1996 0.2899  257 THR B O   
3477 C CB  . THR B 174 ? 1.1989 1.7657 2.3342 0.2288  -0.3124 0.3403  257 THR B CB  
3478 O OG1 . THR B 174 ? 1.1989 1.7986 2.3988 0.2157  -0.3036 0.3095  257 THR B OG1 
3479 C CG2 . THR B 174 ? 1.2684 1.8217 2.3414 0.2298  -0.3612 0.3623  257 THR B CG2 
3480 N N   . GLY B 175 ? 1.1511 1.6932 2.3035 0.2351  -0.2231 0.3327  258 GLY B N   
3481 C CA  . GLY B 175 ? 1.1086 1.6563 2.3187 0.2332  -0.1843 0.3156  258 GLY B CA  
3482 C C   . GLY B 175 ? 1.1051 1.6284 2.2477 0.2229  -0.1478 0.3106  258 GLY B C   
3483 O O   . GLY B 175 ? 1.1351 1.6325 2.2010 0.2267  -0.1515 0.3318  258 GLY B O   
3484 N N   . THR B 176 ? 1.0759 1.6074 2.2488 0.2088  -0.1122 0.2829  259 THR B N   
3485 C CA  . THR B 176 ? 1.0000 1.5101 2.1239 0.1977  -0.0784 0.2783  259 THR B CA  
3486 C C   . THR B 176 ? 0.9638 1.4652 2.0102 0.1831  -0.0735 0.2730  259 THR B C   
3487 O O   . THR B 176 ? 0.9447 1.4574 1.9795 0.1784  -0.0905 0.2660  259 THR B O   
3488 C CB  . THR B 176 ? 0.9780 1.4957 2.1575 0.1851  -0.0426 0.2506  259 THR B CB  
3489 O OG1 . THR B 176 ? 0.9821 1.5252 2.2020 0.1724  -0.0374 0.2233  259 THR B OG1 
3490 C CG2 . THR B 176 ? 0.9909 1.5092 2.2429 0.2003  -0.0409 0.2563  259 THR B CG2 
3491 N N   . TYR B 177 ? 0.9385 1.4188 1.9354 0.1759  -0.0509 0.2773  260 TYR B N   
3492 C CA  . TYR B 177 ? 0.8806 1.3510 1.8135 0.1611  -0.0402 0.2714  260 TYR B CA  
3493 C C   . TYR B 177 ? 0.8764 1.3334 1.7966 0.1483  -0.0099 0.2668  260 TYR B C   
3494 O O   . TYR B 177 ? 0.9181 1.3671 1.8602 0.1542  -0.0012 0.2752  260 TYR B O   
3495 C CB  . TYR B 177 ? 0.8900 1.3420 1.7532 0.1712  -0.0577 0.2950  260 TYR B CB  
3496 C CG  . TYR B 177 ? 0.9160 1.3481 1.7579 0.1863  -0.0587 0.3235  260 TYR B CG  
3497 C CD1 . TYR B 177 ? 0.9848 1.4171 1.8480 0.2040  -0.0821 0.3423  260 TYR B CD1 
3498 C CD2 . TYR B 177 ? 0.9293 1.3423 1.7311 0.1823  -0.0379 0.3338  260 TYR B CD2 
3499 C CE1 . TYR B 177 ? 1.0088 1.4212 1.8511 0.2165  -0.0822 0.3695  260 TYR B CE1 
3500 C CE2 . TYR B 177 ? 0.9696 1.3652 1.7547 0.1951  -0.0374 0.3604  260 TYR B CE2 
3501 C CZ  . TYR B 177 ? 1.0320 1.4266 1.8356 0.2118  -0.0585 0.3777  260 TYR B CZ  
3502 O OH  . TYR B 177 ? 1.1199 1.4956 1.9062 0.2232  -0.0572 0.4050  260 TYR B OH  
3503 N N   . SER B 178 ? 0.8535 1.3063 1.7372 0.1299  0.0039  0.2550  261 SER B N   
3504 C CA  . SER B 178 ? 0.8241 1.2621 1.6859 0.1153  0.0274  0.2543  261 SER B CA  
3505 C C   . SER B 178 ? 0.8411 1.2590 1.6595 0.1266  0.0243  0.2829  261 SER B C   
3506 O O   . SER B 178 ? 0.8190 1.2287 1.5911 0.1316  0.0160  0.2949  261 SER B O   
3507 C CB  . SER B 178 ? 0.8343 1.2715 1.6672 0.0931  0.0387  0.2384  261 SER B CB  
3508 O OG  . SER B 178 ? 0.9220 1.3422 1.7257 0.0798  0.0547  0.2446  261 SER B OG  
3509 N N   . GLY B 179 ? 0.8247 1.2338 1.6605 0.1299  0.0332  0.2926  262 GLY B N   
3510 C CA  . GLY B 179 ? 0.8427 1.2343 1.6480 0.1397  0.0331  0.3202  262 GLY B CA  
3511 C C   . GLY B 179 ? 0.8369 1.2168 1.6020 0.1255  0.0456  0.3257  262 GLY B C   
3512 O O   . GLY B 179 ? 0.8878 1.2560 1.6214 0.1346  0.0445  0.3484  262 GLY B O   
3513 N N   . LYS B 180 ? 0.8071 1.1892 1.5749 0.1028  0.0579  0.3063  263 LYS B N   
3514 C CA  . LYS B 180 ? 0.7993 1.1712 1.5320 0.0873  0.0655  0.3122  263 LYS B CA  
3515 C C   . LYS B 180 ? 0.7982 1.1701 1.4965 0.0909  0.0584  0.3148  263 LYS B C   
3516 O O   . LYS B 180 ? 0.8317 1.1928 1.5015 0.0940  0.0599  0.3329  263 LYS B O   
3517 C CB  . LYS B 180 ? 0.7982 1.1693 1.5364 0.0593  0.0784  0.2914  263 LYS B CB  
3518 C CG  . LYS B 180 ? 0.8227 1.1865 1.5846 0.0512  0.0885  0.2886  263 LYS B CG  
3519 C CD  . LYS B 180 ? 0.8128 1.1725 1.5726 0.0210  0.1027  0.2644  263 LYS B CD  
3520 C CE  . LYS B 180 ? 0.8662 1.2133 1.6427 0.0108  0.1136  0.2603  263 LYS B CE  
3521 N NZ  . LYS B 180 ? 0.9228 1.2561 1.6722 -0.0232 0.1243  0.2477  263 LYS B NZ  
3522 N N   . ALA B 181 ? 0.7592 1.1426 1.4637 0.0900  0.0518  0.2963  264 ALA B N   
3523 C CA  . ALA B 181 ? 0.7936 1.1746 1.4654 0.0928  0.0444  0.2961  264 ALA B CA  
3524 C C   . ALA B 181 ? 0.8046 1.1760 1.4511 0.1154  0.0355  0.3173  264 ALA B C   
3525 O O   . ALA B 181 ? 0.8305 1.1899 1.4413 0.1180  0.0372  0.3255  264 ALA B O   
3526 C CB  . ALA B 181 ? 0.7933 1.1895 1.4817 0.0873  0.0369  0.2725  264 ALA B CB  
3527 N N   . ALA B 182 ? 0.8494 1.2240 1.5141 0.1310  0.0273  0.3262  265 ALA B N   
3528 C CA  . ALA B 182 ? 0.8860 1.2485 1.5216 0.1507  0.0195  0.3478  265 ALA B CA  
3529 C C   . ALA B 182 ? 0.8811 1.2283 1.4963 0.1534  0.0343  0.3694  265 ALA B C   
3530 O O   . ALA B 182 ? 0.9059 1.2393 1.4831 0.1626  0.0370  0.3822  265 ALA B O   
3531 C CB  . ALA B 182 ? 0.9251 1.2931 1.5878 0.1649  0.0061  0.3551  265 ALA B CB  
3532 N N   . ASP B 183 ? 0.8807 1.2297 1.5229 0.1446  0.0446  0.3728  266 ASP B N   
3533 C CA  . ASP B 183 ? 0.9046 1.2429 1.5388 0.1430  0.0576  0.3928  266 ASP B CA  
3534 C C   . ASP B 183 ? 0.8784 1.2105 1.4865 0.1357  0.0644  0.3932  266 ASP B C   
3535 O O   . ASP B 183 ? 0.8776 1.1992 1.4695 0.1439  0.0731  0.4121  266 ASP B O   
3536 C CB  . ASP B 183 ? 0.8979 1.2390 1.5648 0.1284  0.0643  0.3913  266 ASP B CB  
3537 C CG  . ASP B 183 ? 0.9854 1.3246 1.6781 0.1392  0.0629  0.4022  266 ASP B CG  
3538 O OD1 . ASP B 183 ? 1.0732 1.4086 1.7582 0.1584  0.0561  0.4152  266 ASP B OD1 
3539 O OD2 . ASP B 183 ? 1.0154 1.3542 1.7344 0.1269  0.0684  0.3979  266 ASP B OD2 
3540 N N   . VAL B 184 ? 0.8797 1.2177 1.4874 0.1202  0.0620  0.3727  267 VAL B N   
3541 C CA  . VAL B 184 ? 0.8750 1.2057 1.4615 0.1123  0.0667  0.3725  267 VAL B CA  
3542 C C   . VAL B 184 ? 0.9153 1.2351 1.4680 0.1280  0.0665  0.3758  267 VAL B C   
3543 O O   . VAL B 184 ? 0.9421 1.2498 1.4795 0.1312  0.0764  0.3874  267 VAL B O   
3544 C CB  . VAL B 184 ? 0.8437 1.1811 1.4357 0.0902  0.0642  0.3502  267 VAL B CB  
3545 C CG1 . VAL B 184 ? 0.8765 1.2044 1.4450 0.0845  0.0661  0.3490  267 VAL B CG1 
3546 C CG2 . VAL B 184 ? 0.8247 1.1646 1.4370 0.0709  0.0687  0.3505  267 VAL B CG2 
3547 N N   . TRP B 185 ? 0.9163 1.2389 1.4585 0.1370  0.0553  0.3656  268 TRP B N   
3548 C CA  . TRP B 185 ? 0.9397 1.2476 1.4413 0.1504  0.0538  0.3682  268 TRP B CA  
3549 C C   . TRP B 185 ? 0.9416 1.2349 1.4267 0.1653  0.0672  0.3931  268 TRP B C   
3550 O O   . TRP B 185 ? 0.9707 1.2473 1.4268 0.1713  0.0791  0.3985  268 TRP B O   
3551 C CB  . TRP B 185 ? 0.9209 1.2349 1.4158 0.1561  0.0344  0.3566  268 TRP B CB  
3552 C CG  . TRP B 185 ? 0.9445 1.2398 1.3903 0.1681  0.0305  0.3608  268 TRP B CG  
3553 C CD1 . TRP B 185 ? 1.0039 1.2845 1.4224 0.1830  0.0339  0.3804  268 TRP B CD1 
3554 C CD2 . TRP B 185 ? 0.9541 1.2400 1.3668 0.1643  0.0230  0.3444  268 TRP B CD2 
3555 N NE1 . TRP B 185 ? 1.0762 1.3371 1.4416 0.1879  0.0298  0.3765  268 TRP B NE1 
3556 C CE2 . TRP B 185 ? 1.0324 1.2960 1.3941 0.1766  0.0224  0.3539  268 TRP B CE2 
3557 C CE3 . TRP B 185 ? 0.9013 1.1933 1.3203 0.1501  0.0172  0.3223  268 TRP B CE3 
3558 C CZ2 . TRP B 185 ? 1.0288 1.2749 1.3441 0.1747  0.0154  0.3404  268 TRP B CZ2 
3559 C CZ3 . TRP B 185 ? 0.9271 1.2036 1.3054 0.1492  0.0099  0.3102  268 TRP B CZ3 
3560 C CH2 . TRP B 185 ? 0.9919 1.2451 1.3182 0.1612  0.0087  0.3185  268 TRP B CH2 
3561 N N   . SER B 186 ? 0.9491 1.2476 1.4553 0.1709  0.0674  0.4076  269 SER B N   
3562 C CA  . SER B 186 ? 0.9743 1.2605 1.4705 0.1833  0.0817  0.4324  269 SER B CA  
3563 C C   . SER B 186 ? 0.9587 1.2405 1.4649 0.1789  0.1002  0.4432  269 SER B C   
3564 O O   . SER B 186 ? 0.9574 1.2249 1.4445 0.1896  0.1166  0.4575  269 SER B O   
3565 C CB  . SER B 186 ? 0.9769 1.2699 1.5016 0.1871  0.0780  0.4457  269 SER B CB  
3566 O OG  . SER B 186 ? 1.0248 1.3181 1.5396 0.1956  0.0612  0.4427  269 SER B OG  
3567 N N   . LEU B 187 ? 0.9001 1.1933 1.4365 0.1625  0.0975  0.4367  270 LEU B N   
3568 C CA  . LEU B 187 ? 0.8640 1.1547 1.4150 0.1559  0.1090  0.4476  270 LEU B CA  
3569 C C   . LEU B 187 ? 0.8738 1.1512 1.3992 0.1597  0.1166  0.4413  270 LEU B C   
3570 O O   . LEU B 187 ? 0.9430 1.2126 1.4761 0.1642  0.1316  0.4559  270 LEU B O   
3571 C CB  . LEU B 187 ? 0.8226 1.1248 1.4014 0.1339  0.1001  0.4406  270 LEU B CB  
3572 C CG  . LEU B 187 ? 0.7929 1.1043 1.4006 0.1253  0.0959  0.4469  270 LEU B CG  
3573 C CD1 . LEU B 187 ? 0.7492 1.0667 1.3697 0.1001  0.0877  0.4345  270 LEU B CD1 
3574 C CD2 . LEU B 187 ? 0.8140 1.1227 1.4407 0.1320  0.1065  0.4744  270 LEU B CD2 
3575 N N   . GLY B 188 ? 0.8570 1.1318 1.3570 0.1573  0.1067  0.4195  271 GLY B N   
3576 C CA  . GLY B 188 ? 0.9227 1.1807 1.3933 0.1611  0.1137  0.4107  271 GLY B CA  
3577 C C   . GLY B 188 ? 0.9673 1.2060 1.4046 0.1796  0.1295  0.4201  271 GLY B C   
3578 O O   . GLY B 188 ? 1.0036 1.2259 1.4320 0.1858  0.1482  0.4249  271 GLY B O   
3579 N N   . VAL B 189 ? 0.9793 1.2182 1.3985 0.1881  0.1233  0.4235  272 VAL B N   
3580 C CA  . VAL B 189 ? 1.0540 1.2720 1.4340 0.2034  0.1389  0.4343  272 VAL B CA  
3581 C C   . VAL B 189 ? 1.0448 1.2594 1.4492 0.2103  0.1649  0.4577  272 VAL B C   
3582 O O   . VAL B 189 ? 1.0958 1.2901 1.4761 0.2198  0.1880  0.4621  272 VAL B O   
3583 C CB  . VAL B 189 ? 1.0224 1.2415 1.3825 0.2097  0.1243  0.4391  272 VAL B CB  
3584 C CG1 . VAL B 189 ? 1.0996 1.2941 1.4142 0.2230  0.1427  0.4536  272 VAL B CG1 
3585 C CG2 . VAL B 189 ? 1.0253 1.2480 1.3652 0.2039  0.0982  0.4172  272 VAL B CG2 
3586 N N   . MET B 190 ? 1.0160 1.2500 1.4695 0.2045  0.1614  0.4713  273 MET B N   
3587 C CA  . MET B 190 ? 1.0279 1.2642 1.5169 0.2081  0.1813  0.4948  273 MET B CA  
3588 C C   . MET B 190 ? 1.0771 1.3079 1.5833 0.2067  0.1952  0.4950  273 MET B C   
3589 O O   . MET B 190 ? 1.1290 1.3479 1.6379 0.2178  0.2211  0.5074  273 MET B O   
3590 C CB  . MET B 190 ? 1.0122 1.2697 1.5490 0.1974  0.1689  0.5057  273 MET B CB  
3591 C CG  . MET B 190 ? 1.0815 1.3409 1.6152 0.2035  0.1655  0.5164  273 MET B CG  
3592 S SD  . MET B 190 ? 1.1544 1.4329 1.7257 0.1900  0.1435  0.5145  273 MET B SD  
3593 C CE  . MET B 190 ? 1.0444 1.3301 1.6650 0.1848  0.1557  0.5408  273 MET B CE  
3594 N N   . LEU B 191 ? 1.1189 1.3569 1.6378 0.1931  0.1794  0.4816  274 LEU B N   
3595 C CA  . LEU B 191 ? 1.1049 1.3375 1.6459 0.1904  0.1883  0.4841  274 LEU B CA  
3596 C C   . LEU B 191 ? 1.1323 1.3391 1.6378 0.2036  0.2097  0.4748  274 LEU B C   
3597 O O   . LEU B 191 ? 1.2463 1.4442 1.7742 0.2125  0.2331  0.4874  274 LEU B O   
3598 C CB  . LEU B 191 ? 1.1038 1.3450 1.6552 0.1713  0.1661  0.4708  274 LEU B CB  
3599 C CG  . LEU B 191 ? 1.1091 1.3430 1.6826 0.1663  0.1701  0.4742  274 LEU B CG  
3600 C CD1 . LEU B 191 ? 1.1071 1.3490 1.7337 0.1678  0.1784  0.5026  274 LEU B CD1 
3601 C CD2 . LEU B 191 ? 1.1345 1.3748 1.7072 0.1450  0.1471  0.4601  274 LEU B CD2 
3602 N N   . TYR B 192 ? 1.0814 1.2756 1.5343 0.2043  0.2021  0.4528  275 TYR B N   
3603 C CA  . TYR B 192 ? 1.0950 1.2597 1.5013 0.2151  0.2219  0.4411  275 TYR B CA  
3604 C C   . TYR B 192 ? 1.1613 1.3135 1.5640 0.2307  0.2537  0.4590  275 TYR B C   
3605 O O   . TYR B 192 ? 1.2395 1.3744 1.6496 0.2393  0.2819  0.4619  275 TYR B O   
3606 C CB  . TYR B 192 ? 1.0872 1.2427 1.4345 0.2127  0.2046  0.4196  275 TYR B CB  
3607 C CG  . TYR B 192 ? 1.1276 1.2487 1.4170 0.2192  0.2208  0.4036  275 TYR B CG  
3608 C CD1 . TYR B 192 ? 1.1831 1.2819 1.4310 0.2313  0.2440  0.4104  275 TYR B CD1 
3609 C CD2 . TYR B 192 ? 1.1586 1.2664 1.4308 0.2114  0.2139  0.3808  275 TYR B CD2 
3610 C CE1 . TYR B 192 ? 1.2613 1.3240 1.4486 0.2350  0.2608  0.3937  275 TYR B CE1 
3611 C CE2 . TYR B 192 ? 1.2081 1.2805 1.4240 0.2157  0.2293  0.3640  275 TYR B CE2 
3612 C CZ  . TYR B 192 ? 1.2768 1.3261 1.4483 0.2271  0.2527  0.3699  275 TYR B CZ  
3613 O OH  . TYR B 192 ? 1.3934 1.4032 1.5017 0.2295  0.2703  0.3520  275 TYR B OH  
3614 N N   . THR B 193 ? 1.1435 1.3049 1.5411 0.2339  0.2504  0.4721  276 THR B N   
3615 C CA  . THR B 193 ? 1.1713 1.3168 1.5466 0.2470  0.2788  0.4861  276 THR B CA  
3616 C C   . THR B 193 ? 1.1269 1.2812 1.5649 0.2531  0.3056  0.5101  276 THR B C   
3617 O O   . THR B 193 ? 1.1253 1.2608 1.5546 0.2646  0.3412  0.5168  276 THR B O   
3618 C CB  . THR B 193 ? 1.2013 1.3497 1.5420 0.2471  0.2617  0.4904  276 THR B CB  
3619 O OG1 . THR B 193 ? 1.3302 1.4485 1.6045 0.2556  0.2804  0.4887  276 THR B OG1 
3620 C CG2 . THR B 193 ? 1.1797 1.3501 1.5688 0.2469  0.2597  0.5146  276 THR B CG2 
3621 N N   . LEU B 194 ? 1.0653 1.2467 1.5669 0.2441  0.2890  0.5218  277 LEU B N   
3622 C CA  . LEU B 194 ? 1.0736 1.2657 1.6432 0.2472  0.3074  0.5439  277 LEU B CA  
3623 C C   . LEU B 194 ? 1.0985 1.2742 1.6812 0.2537  0.3287  0.5376  277 LEU B C   
3624 O O   . LEU B 194 ? 1.1419 1.3114 1.7550 0.2653  0.3615  0.5514  277 LEU B O   
3625 C CB  . LEU B 194 ? 0.9983 1.2192 1.6256 0.2320  0.2789  0.5554  277 LEU B CB  
3626 C CG  . LEU B 194 ? 0.9320 1.1709 1.5657 0.2237  0.2589  0.5638  277 LEU B CG  
3627 C CD1 . LEU B 194 ? 0.8961 1.1565 1.5743 0.2050  0.2309  0.5683  277 LEU B CD1 
3628 C CD2 . LEU B 194 ? 0.9481 1.1890 1.6028 0.2332  0.2817  0.5874  277 LEU B CD2 
3629 N N   . LEU B 195 ? 1.0840 1.2524 1.6484 0.2462  0.3115  0.5171  278 LEU B N   
3630 C CA  . LEU B 195 ? 1.1021 1.2537 1.6844 0.2511  0.3283  0.5110  278 LEU B CA  
3631 C C   . LEU B 195 ? 1.1543 1.2699 1.6816 0.2640  0.3612  0.4934  278 LEU B C   
3632 O O   . LEU B 195 ? 1.2567 1.3564 1.8107 0.2746  0.3922  0.4959  278 LEU B O   
3633 C CB  . LEU B 195 ? 1.0651 1.2191 1.6461 0.2365  0.2984  0.4960  278 LEU B CB  
3634 C CG  . LEU B 195 ? 1.0152 1.1985 1.6472 0.2202  0.2677  0.5113  278 LEU B CG  
3635 C CD1 . LEU B 195 ? 1.0078 1.1897 1.6191 0.2039  0.2402  0.4922  278 LEU B CD1 
3636 C CD2 . LEU B 195 ? 1.0399 1.2319 1.7472 0.2236  0.2778  0.5376  278 LEU B CD2 
3637 N N   . VAL B 196 ? 1.1349 1.2364 1.5870 0.2621  0.3533  0.4753  279 VAL B N   
3638 C CA  . VAL B 196 ? 1.2082 1.2714 1.5915 0.2699  0.3791  0.4556  279 VAL B CA  
3639 C C   . VAL B 196 ? 1.2751 1.3256 1.6362 0.2816  0.4137  0.4682  279 VAL B C   
3640 O O   . VAL B 196 ? 1.4181 1.4386 1.7583 0.2912  0.4526  0.4615  279 VAL B O   
3641 C CB  . VAL B 196 ? 1.2333 1.2863 1.5436 0.2599  0.3497  0.4308  279 VAL B CB  
3642 C CG1 . VAL B 196 ? 1.3186 1.3282 1.5493 0.2648  0.3736  0.4100  279 VAL B CG1 
3643 C CG2 . VAL B 196 ? 1.1916 1.2555 1.5236 0.2472  0.3200  0.4173  279 VAL B CG2 
3644 N N   . GLY B 197 ? 1.2701 1.3407 1.6340 0.2799  0.4014  0.4857  280 GLY B N   
3645 C CA  . GLY B 197 ? 1.2928 1.3494 1.6247 0.2883  0.4305  0.4982  280 GLY B CA  
3646 C C   . GLY B 197 ? 1.3522 1.3871 1.5900 0.2847  0.4180  0.4864  280 GLY B C   
3647 O O   . GLY B 197 ? 1.3963 1.4167 1.5983 0.2894  0.4391  0.4978  280 GLY B O   
3648 N N   . ARG B 198 ? 1.3856 1.4175 1.5840 0.2755  0.3836  0.4649  281 ARG B N   
3649 C CA  . ARG B 198 ? 1.4343 1.4512 1.5530 0.2703  0.3615  0.4560  281 ARG B CA  
3650 C C   . ARG B 198 ? 1.4091 1.4558 1.5496 0.2603  0.3129  0.4512  281 ARG B C   
3651 O O   . ARG B 198 ? 1.4498 1.5181 1.6456 0.2553  0.2999  0.4463  281 ARG B O   
3652 C CB  . ARG B 198 ? 1.5458 1.5217 1.5857 0.2678  0.3708  0.4288  281 ARG B CB  
3653 C CG  . ARG B 198 ? 1.6968 1.6343 1.6992 0.2764  0.4235  0.4277  281 ARG B CG  
3654 C CD  . ARG B 198 ? 1.8194 1.7122 1.7385 0.2713  0.4316  0.3971  281 ARG B CD  
3655 N NE  . ARG B 198 ? 1.7991 1.6915 1.7533 0.2693  0.4293  0.3770  281 ARG B NE  
3656 C CZ  . ARG B 198 ? 1.7758 1.6817 1.7348 0.2588  0.3884  0.3615  281 ARG B CZ  
3657 N NH1 . ARG B 198 ? 1.7591 1.6834 1.6962 0.2497  0.3442  0.3620  281 ARG B NH1 
3658 N NH2 . ARG B 198 ? 1.7964 1.6974 1.7876 0.2574  0.3928  0.3458  281 ARG B NH2 
3659 N N   . TYR B 199 ? 1.4432 1.4903 1.5417 0.2567  0.2860  0.4526  282 TYR B N   
3660 C CA  . TYR B 199 ? 1.3866 1.4600 1.5044 0.2474  0.2412  0.4439  282 TYR B CA  
3661 C C   . TYR B 199 ? 1.3673 1.4293 1.4560 0.2391  0.2262  0.4149  282 TYR B C   
3662 O O   . TYR B 199 ? 1.3855 1.4132 1.4129 0.2396  0.2413  0.4013  282 TYR B O   
3663 C CB  . TYR B 199 ? 1.4222 1.4965 1.5049 0.2468  0.2154  0.4527  282 TYR B CB  
3664 C CG  . TYR B 199 ? 1.3885 1.4742 1.4990 0.2531  0.2230  0.4812  282 TYR B CG  
3665 C CD1 . TYR B 199 ? 1.3047 1.4214 1.4943 0.2527  0.2231  0.4937  282 TYR B CD1 
3666 C CD2 . TYR B 199 ? 1.4429 1.5066 1.4977 0.2574  0.2278  0.4962  282 TYR B CD2 
3667 C CE1 . TYR B 199 ? 1.2716 1.3975 1.4879 0.2571  0.2292  0.5191  282 TYR B CE1 
3668 C CE2 . TYR B 199 ? 1.4112 1.4837 1.4924 0.2624  0.2346  0.5233  282 TYR B CE2 
3669 C CZ  . TYR B 199 ? 1.3276 1.4316 1.4915 0.2625  0.2356  0.5339  282 TYR B CZ  
3670 O OH  . TYR B 199 ? 1.3047 1.4153 1.4945 0.2661  0.2423  0.5599  282 TYR B OH  
3671 N N   . PRO B 200 ? 1.3247 1.4136 1.4549 0.2298  0.1974  0.4045  283 PRO B N   
3672 C CA  . PRO B 200 ? 1.3439 1.4233 1.4487 0.2202  0.1812  0.3774  283 PRO B CA  
3673 C C   . PRO B 200 ? 1.3653 1.4276 1.4012 0.2164  0.1583  0.3665  283 PRO B C   
3674 O O   . PRO B 200 ? 1.3938 1.4326 1.3847 0.2101  0.1553  0.3450  283 PRO B O   
3675 C CB  . PRO B 200 ? 1.3091 1.4244 1.4764 0.2103  0.1560  0.3731  283 PRO B CB  
3676 C CG  . PRO B 200 ? 1.2890 1.4294 1.4926 0.2137  0.1476  0.3939  283 PRO B CG  
3677 C CD  . PRO B 200 ? 1.2868 1.4131 1.4841 0.2259  0.1792  0.4154  283 PRO B CD  
3678 N N   . PHE B 201 ? 1.3561 1.4288 1.3853 0.2192  0.1403  0.3819  284 PHE B N   
3679 C CA  . PHE B 201 ? 1.4262 1.4806 1.3884 0.2162  0.1171  0.3783  284 PHE B CA  
3680 C C   . PHE B 201 ? 1.5007 1.5400 1.4310 0.2254  0.1319  0.4034  284 PHE B C   
3681 O O   . PHE B 201 ? 1.4695 1.5316 1.4493 0.2315  0.1332  0.4241  284 PHE B O   
3682 C CB  . PHE B 201 ? 1.3917 1.4767 1.3860 0.2096  0.0730  0.3746  284 PHE B CB  
3683 C CG  . PHE B 201 ? 1.3653 1.4734 1.4088 0.2000  0.0611  0.3542  284 PHE B CG  
3684 C CD1 . PHE B 201 ? 1.4191 1.5150 1.4311 0.1892  0.0463  0.3297  284 PHE B CD1 
3685 C CD2 . PHE B 201 ? 1.3361 1.4762 1.4549 0.1995  0.0650  0.3595  284 PHE B CD2 
3686 C CE1 . PHE B 201 ? 1.4156 1.5324 1.4741 0.1790  0.0369  0.3121  284 PHE B CE1 
3687 C CE2 . PHE B 201 ? 1.2776 1.4365 1.4369 0.1885  0.0560  0.3416  284 PHE B CE2 
3688 C CZ  . PHE B 201 ? 1.3263 1.4743 1.4570 0.1786  0.0426  0.3184  284 PHE B CZ  
3689 N N   . HIS B 202 ? 1.6541 1.6528 1.4989 0.2248  0.1434  0.4009  285 HIS B N   
3690 C CA  . HIS B 202 ? 1.7823 1.7597 1.5840 0.2315  0.1622  0.4244  285 HIS B CA  
3691 C C   . HIS B 202 ? 1.8592 1.7991 1.5594 0.2242  0.1451  0.4222  285 HIS B C   
3692 O O   . HIS B 202 ? 1.9013 1.8141 1.5437 0.2153  0.1425  0.3988  285 HIS B O   
3693 C CB  . HIS B 202 ? 1.8910 1.8490 1.6924 0.2393  0.2169  0.4288  285 HIS B CB  
3694 C CG  . HIS B 202 ? 2.0678 2.0018 1.8227 0.2447  0.2414  0.4521  285 HIS B CG  
3695 N ND1 . HIS B 202 ? 2.2178 2.1038 1.8837 0.2427  0.2718  0.4464  285 HIS B ND1 
3696 C CD2 . HIS B 202 ? 2.1111 2.0595 1.8903 0.2501  0.2384  0.4809  285 HIS B CD2 
3697 C CE1 . HIS B 202 ? 2.2516 2.1247 1.8898 0.2465  0.2886  0.4718  285 HIS B CE1 
3698 N NE2 . HIS B 202 ? 2.2034 2.1141 1.9110 0.2513  0.2679  0.4937  285 HIS B NE2 
3699 N N   . ASP B 203 ? 1.8903 1.8265 1.5677 0.2269  0.1336  0.4479  286 ASP B N   
3700 C CA  . ASP B 203 ? 2.0168 1.9109 1.5888 0.2199  0.1244  0.4540  286 ASP B CA  
3701 C C   . ASP B 203 ? 2.0609 1.9535 1.6288 0.2264  0.1272  0.4893  286 ASP B C   
3702 O O   . ASP B 203 ? 2.0497 1.9788 1.7009 0.2347  0.1212  0.5056  286 ASP B O   
3703 C CB  . ASP B 203 ? 2.0409 1.9373 1.5847 0.2082  0.0687  0.4422  286 ASP B CB  
3704 C CG  . ASP B 203 ? 2.1817 2.0269 1.6029 0.1962  0.0597  0.4408  286 ASP B CG  
3705 O OD1 . ASP B 203 ? 2.2158 2.0489 1.5968 0.1953  0.0412  0.4668  286 ASP B OD1 
3706 O OD2 . ASP B 203 ? 2.2507 2.0653 1.6132 0.1865  0.0708  0.4140  286 ASP B OD2 
3707 N N   . SER B 204 ? 2.1548 2.0028 1.6243 0.2213  0.1380  0.5009  287 SER B N   
3708 C CA  . SER B 204 ? 2.1815 2.0231 1.6381 0.2255  0.1385  0.5367  287 SER B CA  
3709 C C   . SER B 204 ? 2.1770 2.0397 1.6550 0.2240  0.0779  0.5534  287 SER B C   
3710 O O   . SER B 204 ? 2.1379 2.0240 1.6759 0.2325  0.0709  0.5783  287 SER B O   
3711 C CB  . SER B 204 ? 2.3063 2.0902 1.6442 0.2181  0.1692  0.5447  287 SER B CB  
3712 O OG  . SER B 204 ? 2.3928 2.1402 1.6400 0.2045  0.1610  0.5186  287 SER B OG  
3713 N N   . ASP B 205 ? 2.2428 2.0963 1.6747 0.2129  0.0346  0.5394  288 ASP B N   
3714 C CA  . ASP B 205 ? 2.2843 2.1612 1.7467 0.2113  -0.0266 0.5516  288 ASP B CA  
3715 C C   . ASP B 205 ? 2.1273 2.0603 1.7138 0.2192  -0.0402 0.5384  288 ASP B C   
3716 O O   . ASP B 205 ? 2.0845 2.0292 1.6960 0.2169  -0.0265 0.5096  288 ASP B O   
3717 C CB  . ASP B 205 ? 2.4324 2.2818 1.8082 0.1949  -0.0664 0.5377  288 ASP B CB  
3718 C CG  . ASP B 205 ? 2.4725 2.3443 1.8778 0.1923  -0.1338 0.5517  288 ASP B CG  
3719 O OD1 . ASP B 205 ? 2.4614 2.3641 1.9449 0.2036  -0.1499 0.5745  288 ASP B OD1 
3720 O OD2 . ASP B 205 ? 2.5299 2.3875 1.8820 0.1781  -0.1716 0.5386  288 ASP B OD2 
3721 N N   . PRO B 206 ? 2.0501 2.0150 1.7132 0.2278  -0.0641 0.5593  289 PRO B N   
3722 C CA  . PRO B 206 ? 1.9519 1.9668 1.7265 0.2328  -0.0770 0.5447  289 PRO B CA  
3723 C C   . PRO B 206 ? 1.9281 1.9618 1.7198 0.2243  -0.1202 0.5219  289 PRO B C   
3724 O O   . PRO B 206 ? 1.8960 1.9573 1.7460 0.2230  -0.1134 0.4972  289 PRO B O   
3725 C CB  . PRO B 206 ? 1.9217 1.9567 1.7606 0.2430  -0.0907 0.5734  289 PRO B CB  
3726 C CG  . PRO B 206 ? 2.0104 2.0083 1.7695 0.2414  -0.1042 0.6032  289 PRO B CG  
3727 C CD  . PRO B 206 ? 2.0787 2.0338 1.7365 0.2342  -0.0678 0.5964  289 PRO B CD  
3728 N N   . SER B 207 ? 1.9699 1.9889 1.7123 0.2173  -0.1645 0.5307  290 SER B N   
3729 C CA  . SER B 207 ? 1.9566 1.9941 1.7175 0.2078  -0.2073 0.5096  290 SER B CA  
3730 C C   . SER B 207 ? 1.9810 2.0010 1.6909 0.1959  -0.1904 0.4764  290 SER B C   
3731 O O   . SER B 207 ? 1.9517 1.9983 1.7110 0.1906  -0.2043 0.4520  290 SER B O   
3732 C CB  . SER B 207 ? 2.0235 2.0504 1.7486 0.2022  -0.2636 0.5295  290 SER B CB  
3733 O OG  . SER B 207 ? 2.1905 2.1775 1.8352 0.2029  -0.2574 0.5592  290 SER B OG  
3734 N N   . ALA B 208 ? 2.0426 2.0173 1.6581 0.1918  -0.1572 0.4750  291 ALA B N   
3735 C CA  . ALA B 208 ? 2.0563 2.0104 1.6285 0.1827  -0.1315 0.4432  291 ALA B CA  
3736 C C   . ALA B 208 ? 2.0184 2.0029 1.6749 0.1902  -0.0958 0.4259  291 ALA B C   
3737 O O   . ALA B 208 ? 2.0539 2.0446 1.7235 0.1827  -0.0949 0.3977  291 ALA B O   
3738 C CB  . ALA B 208 ? 2.1351 2.0331 1.5953 0.1786  -0.0958 0.4464  291 ALA B CB  
3739 N N   . LEU B 209 ? 1.9798 1.9813 1.6908 0.2035  -0.0681 0.4442  292 LEU B N   
3740 C CA  . LEU B 209 ? 1.8398 1.8698 1.6312 0.2098  -0.0371 0.4338  292 LEU B CA  
3741 C C   . LEU B 209 ? 1.7704 1.8451 1.6478 0.2069  -0.0675 0.4206  292 LEU B C   
3742 O O   . LEU B 209 ? 1.7500 1.8394 1.6652 0.2030  -0.0547 0.3991  292 LEU B O   
3743 C CB  . LEU B 209 ? 1.8035 1.8400 1.6300 0.2223  -0.0068 0.4595  292 LEU B CB  
3744 C CG  . LEU B 209 ? 1.7369 1.7864 1.6169 0.2279  0.0360  0.4546  292 LEU B CG  
3745 C CD1 . LEU B 209 ? 1.7484 1.7921 1.6366 0.2378  0.0660  0.4824  292 LEU B CD1 
3746 C CD2 . LEU B 209 ? 1.6422 1.7352 1.6156 0.2267  0.0233  0.4433  292 LEU B CD2 
3747 N N   . PHE B 210 ? 1.7715 1.8663 1.6802 0.2084  -0.1071 0.4336  293 PHE B N   
3748 C CA  . PHE B 210 ? 1.6918 1.8288 1.6845 0.2053  -0.1350 0.4203  293 PHE B CA  
3749 C C   . PHE B 210 ? 1.7147 1.8517 1.6893 0.1913  -0.1566 0.3924  293 PHE B C   
3750 O O   . PHE B 210 ? 1.6548 1.8204 1.6909 0.1861  -0.1575 0.3724  293 PHE B O   
3751 C CB  . PHE B 210 ? 1.6783 1.8347 1.7124 0.2114  -0.1721 0.4414  293 PHE B CB  
3752 C CG  . PHE B 210 ? 1.6652 1.8261 1.7337 0.2243  -0.1535 0.4671  293 PHE B CG  
3753 C CD1 . PHE B 210 ? 1.6396 1.8151 1.7584 0.2286  -0.1162 0.4635  293 PHE B CD1 
3754 C CD2 . PHE B 210 ? 1.7355 1.8858 1.7884 0.2308  -0.1764 0.4962  293 PHE B CD2 
3755 C CE1 . PHE B 210 ? 1.6391 1.8180 1.7904 0.2386  -0.1012 0.4866  293 PHE B CE1 
3756 C CE2 . PHE B 210 ? 1.7569 1.9096 1.8429 0.2418  -0.1598 0.5200  293 PHE B CE2 
3757 C CZ  . PHE B 210 ? 1.7107 1.8781 1.8467 0.2454  -0.1219 0.5142  293 PHE B CZ  
3758 N N   . SER B 211 ? 1.8737 1.9765 1.7613 0.1832  -0.1737 0.3908  294 SER B N   
3759 C CA  . SER B 211 ? 1.9308 2.0276 1.7922 0.1679  -0.1933 0.3637  294 SER B CA  
3760 C C   . SER B 211 ? 1.8492 1.9354 1.7048 0.1636  -0.1538 0.3385  294 SER B C   
3761 O O   . SER B 211 ? 1.7697 1.8669 1.6455 0.1523  -0.1659 0.3145  294 SER B O   
3762 C CB  . SER B 211 ? 2.0952 2.1527 1.8558 0.1577  -0.2223 0.3681  294 SER B CB  
3763 O OG  . SER B 211 ? 2.2728 2.2817 1.9401 0.1580  -0.1863 0.3705  294 SER B OG  
3764 N N   . LYS B 212 ? 1.8124 1.8787 1.6472 0.1723  -0.1078 0.3449  295 LYS B N   
3765 C CA  . LYS B 212 ? 1.7619 1.8211 1.6054 0.1700  -0.0715 0.3245  295 LYS B CA  
3766 C C   . LYS B 212 ? 1.6085 1.7092 1.5509 0.1740  -0.0591 0.3230  295 LYS B C   
3767 O O   . LYS B 212 ? 1.5513 1.6556 1.5156 0.1675  -0.0460 0.3037  295 LYS B O   
3768 C CB  . LYS B 212 ? 1.8800 1.8929 1.6498 0.1740  -0.0284 0.3251  295 LYS B CB  
3769 C CG  . LYS B 212 ? 1.9425 1.9455 1.7030 0.1877  0.0022  0.3517  295 LYS B CG  
3770 C CD  . LYS B 212 ? 2.0237 1.9832 1.7232 0.1900  0.0496  0.3451  295 LYS B CD  
3771 C CE  . LYS B 212 ? 1.9968 1.9589 1.7363 0.1900  0.0787  0.3254  295 LYS B CE  
3772 N NZ  . LYS B 212 ? 2.0576 1.9787 1.7497 0.1948  0.1275  0.3208  295 LYS B NZ  
3773 N N   . ILE B 213 ? 1.5426 1.6721 1.5418 0.1828  -0.0649 0.3426  296 ILE B N   
3774 C CA  . ILE B 213 ? 1.4567 1.6256 1.5464 0.1828  -0.0599 0.3392  296 ILE B CA  
3775 C C   . ILE B 213 ? 1.4715 1.6678 1.6034 0.1711  -0.0918 0.3195  296 ILE B C   
3776 O O   . ILE B 213 ? 1.4000 1.6141 1.5763 0.1631  -0.0833 0.3032  296 ILE B O   
3777 C CB  . ILE B 213 ? 1.3909 1.5798 1.5283 0.1939  -0.0578 0.3634  296 ILE B CB  
3778 C CG1 . ILE B 213 ? 1.4378 1.6050 1.5489 0.2040  -0.0221 0.3825  296 ILE B CG1 
3779 C CG2 . ILE B 213 ? 1.2780 1.5043 1.5012 0.1904  -0.0566 0.3561  296 ILE B CG2 
3780 C CD1 . ILE B 213 ? 1.4581 1.6337 1.5933 0.2145  -0.0238 0.4094  296 ILE B CD1 
3781 N N   . ARG B 214 ? 1.5412 1.7409 1.6608 0.1693  -0.1292 0.3226  297 ARG B N   
3782 C CA  . ARG B 214 ? 1.5345 1.7595 1.6936 0.1578  -0.1616 0.3047  297 ARG B CA  
3783 C C   . ARG B 214 ? 1.5481 1.7592 1.6795 0.1436  -0.1560 0.2785  297 ARG B C   
3784 O O   . ARG B 214 ? 1.5045 1.7402 1.6885 0.1337  -0.1597 0.2610  297 ARG B O   
3785 C CB  . ARG B 214 ? 1.6135 1.8379 1.7529 0.1575  -0.2058 0.3148  297 ARG B CB  
3786 C CG  . ARG B 214 ? 1.5977 1.8550 1.8100 0.1670  -0.2243 0.3318  297 ARG B CG  
3787 C CD  . ARG B 214 ? 1.7357 1.9804 1.9114 0.1712  -0.2618 0.3533  297 ARG B CD  
3788 N NE  . ARG B 214 ? 1.7846 2.0567 2.0325 0.1829  -0.2762 0.3725  297 ARG B NE  
3789 C CZ  . ARG B 214 ? 1.8933 2.1605 2.1312 0.1891  -0.3104 0.3967  297 ARG B CZ  
3790 N NH1 . ARG B 214 ? 2.0128 2.2483 2.1650 0.1827  -0.3367 0.4052  297 ARG B NH1 
3791 N NH2 . ARG B 214 ? 1.9176 2.2097 2.2313 0.2008  -0.3192 0.4128  297 ARG B NH2 
3792 N N   . ARG B 215 ? 1.6362 1.8053 1.6840 0.1420  -0.1451 0.2754  298 ARG B N   
3793 C CA  . ARG B 215 ? 1.6745 1.8237 1.6921 0.1292  -0.1364 0.2502  298 ARG B CA  
3794 C C   . ARG B 215 ? 1.6106 1.7657 1.6672 0.1300  -0.0991 0.2435  298 ARG B C   
3795 O O   . ARG B 215 ? 1.6125 1.7712 1.6870 0.1177  -0.0985 0.2232  298 ARG B O   
3796 C CB  . ARG B 215 ? 1.8225 1.9204 1.7383 0.1274  -0.1294 0.2473  298 ARG B CB  
3797 C CG  . ARG B 215 ? 1.8958 1.9712 1.7768 0.1112  -0.1329 0.2188  298 ARG B CG  
3798 C CD  . ARG B 215 ? 2.0424 2.0690 1.8187 0.1045  -0.1419 0.2135  298 ARG B CD  
3799 N NE  . ARG B 215 ? 2.1529 2.1410 1.8783 0.0930  -0.1251 0.1870  298 ARG B NE  
3800 C CZ  . ARG B 215 ? 2.1541 2.1087 1.8490 0.0994  -0.0790 0.1816  298 ARG B CZ  
3801 N NH1 . ARG B 215 ? 2.1224 2.0795 1.8349 0.1168  -0.0439 0.2014  298 ARG B NH1 
3802 N NH2 . ARG B 215 ? 2.1803 2.0986 1.8321 0.0880  -0.0676 0.1558  298 ARG B NH2 
3803 N N   . GLY B 216 ? 1.5554 1.7087 1.6221 0.1432  -0.0696 0.2617  299 GLY B N   
3804 C CA  . GLY B 216 ? 1.4737 1.6359 1.5839 0.1439  -0.0390 0.2608  299 GLY B CA  
3805 C C   . GLY B 216 ? 1.5208 1.6494 1.5942 0.1422  -0.0102 0.2506  299 GLY B C   
3806 O O   . GLY B 216 ? 1.4416 1.5756 1.5512 0.1417  0.0118  0.2513  299 GLY B O   
3807 N N   . GLN B 217 ? 1.6632 1.7548 1.6646 0.1403  -0.0109 0.2409  300 GLN B N   
3808 C CA  . GLN B 217 ? 1.7217 1.7757 1.6864 0.1411  0.0215  0.2312  300 GLN B CA  
3809 C C   . GLN B 217 ? 1.6272 1.6677 1.5880 0.1572  0.0591  0.2511  300 GLN B C   
3810 O O   . GLN B 217 ? 1.6496 1.6776 1.5719 0.1661  0.0637  0.2657  300 GLN B O   
3811 C CB  . GLN B 217 ? 1.8939 1.9079 1.7789 0.1325  0.0127  0.2118  300 GLN B CB  
3812 C CG  . GLN B 217 ? 1.9502 1.9775 1.8450 0.1145  -0.0244 0.1909  300 GLN B CG  
3813 C CD  . GLN B 217 ? 1.9393 2.0007 1.9124 0.1062  -0.0276 0.1833  300 GLN B CD  
3814 O OE1 . GLN B 217 ? 1.9995 2.0531 1.9940 0.1067  -0.0006 0.1804  300 GLN B OE1 
3815 N NE2 . GLN B 217 ? 1.9200 2.0185 1.9366 0.0978  -0.0606 0.1809  300 GLN B NE2 
3816 N N   . PHE B 218 ? 1.5449 1.5882 1.5479 0.1598  0.0849  0.2530  301 PHE B N   
3817 C CA  . PHE B 218 ? 1.5195 1.5516 1.5301 0.1741  0.1216  0.2713  301 PHE B CA  
3818 C C   . PHE B 218 ? 1.5392 1.5565 1.5731 0.1735  0.1469  0.2636  301 PHE B C   
3819 O O   . PHE B 218 ? 1.5910 1.6216 1.6598 0.1622  0.1341  0.2529  301 PHE B O   
3820 C CB  . PHE B 218 ? 1.4406 1.5089 1.5076 0.1810  0.1190  0.2961  301 PHE B CB  
3821 C CG  . PHE B 218 ? 1.3449 1.4432 1.4834 0.1744  0.1157  0.2985  301 PHE B CG  
3822 C CD1 . PHE B 218 ? 1.2994 1.4265 1.4687 0.1620  0.0866  0.2892  301 PHE B CD1 
3823 C CD2 . PHE B 218 ? 1.3510 1.4482 1.5264 0.1795  0.1418  0.3109  301 PHE B CD2 
3824 C CE1 . PHE B 218 ? 1.2636 1.4143 1.4898 0.1531  0.0853  0.2906  301 PHE B CE1 
3825 C CE2 . PHE B 218 ? 1.3481 1.4697 1.5816 0.1705  0.1357  0.3146  301 PHE B CE2 
3826 C CZ  . PHE B 218 ? 1.2898 1.4366 1.5441 0.1565  0.1082  0.3038  301 PHE B CZ  
3827 N N   . CYS B 219 ? 1.6077 1.5969 1.6250 0.1854  0.1838  0.2701  302 CYS B N   
3828 C CA  . CYS B 219 ? 1.6369 1.6061 1.6762 0.1874  0.2107  0.2639  302 CYS B CA  
3829 C C   . CYS B 219 ? 1.5190 1.5041 1.6217 0.1994  0.2352  0.2897  302 CYS B C   
3830 O O   . CYS B 219 ? 1.5030 1.4881 1.6008 0.2111  0.2534  0.3070  302 CYS B O   
3831 C CB  . CYS B 219 ? 1.7411 1.6592 1.7118 0.1910  0.2371  0.2462  302 CYS B CB  
3832 S SG  . CYS B 219 ? 1.9207 1.8125 1.9291 0.2028  0.2846  0.2484  302 CYS B SG  
3833 N N   . ILE B 220 ? 1.3935 1.3911 1.5547 0.1950  0.2345  0.2935  303 ILE B N   
3834 C CA  . ILE B 220 ? 1.3309 1.3419 1.5557 0.2043  0.2542  0.3185  303 ILE B CA  
3835 C C   . ILE B 220 ? 1.3918 1.3673 1.6200 0.2143  0.2902  0.3143  303 ILE B C   
3836 O O   . ILE B 220 ? 1.4664 1.4273 1.7041 0.2077  0.2880  0.3014  303 ILE B O   
3837 C CB  . ILE B 220 ? 1.2398 1.2833 1.5261 0.1921  0.2307  0.3286  303 ILE B CB  
3838 C CG1 . ILE B 220 ? 1.2122 1.2890 1.4981 0.1822  0.1993  0.3298  303 ILE B CG1 
3839 C CG2 . ILE B 220 ? 1.1983 1.2546 1.5490 0.2000  0.2469  0.3565  303 ILE B CG2 
3840 C CD1 . ILE B 220 ? 1.1590 1.2637 1.4921 0.1664  0.1771  0.3344  303 ILE B CD1 
3841 N N   . PRO B 221 ? 1.4691 1.4301 1.6945 0.2304  0.3255  0.3255  304 PRO B N   
3842 C CA  . PRO B 221 ? 1.5062 1.4303 1.7353 0.2410  0.3645  0.3182  304 PRO B CA  
3843 C C   . PRO B 221 ? 1.5184 1.4495 1.8258 0.2418  0.3671  0.3296  304 PRO B C   
3844 O O   . PRO B 221 ? 1.4144 1.3813 1.7786 0.2355  0.3434  0.3498  304 PRO B O   
3845 C CB  . PRO B 221 ? 1.5094 1.4272 1.7359 0.2569  0.4011  0.3336  304 PRO B CB  
3846 C CG  . PRO B 221 ? 1.4591 1.4201 1.7188 0.2554  0.3794  0.3588  304 PRO B CG  
3847 C CD  . PRO B 221 ? 1.4531 1.4316 1.6828 0.2394  0.3343  0.3472  304 PRO B CD  
3848 N N   . GLU B 222 ? 1.6446 1.5387 1.9530 0.2488  0.3961  0.3168  305 GLU B N   
3849 C CA  . GLU B 222 ? 1.6891 1.5822 2.0646 0.2480  0.3946  0.3245  305 GLU B CA  
3850 C C   . GLU B 222 ? 1.5782 1.5009 2.0440 0.2569  0.4001  0.3601  305 GLU B C   
3851 O O   . GLU B 222 ? 1.5473 1.4836 2.0689 0.2496  0.3799  0.3739  305 GLU B O   
3852 C CB  . GLU B 222 ? 1.8388 1.6810 2.1975 0.2551  0.4276  0.3019  305 GLU B CB  
3853 C CG  . GLU B 222 ? 1.9349 1.7514 2.2372 0.2391  0.4078  0.2705  305 GLU B CG  
3854 C CD  . GLU B 222 ? 2.0036 1.8393 2.2436 0.2231  0.3709  0.2586  305 GLU B CD  
3855 O OE1 . GLU B 222 ? 2.0075 1.8448 2.1984 0.2270  0.3763  0.2568  305 GLU B OE1 
3856 O OE2 . GLU B 222 ? 2.0394 1.8894 2.2834 0.2062  0.3362  0.2527  305 GLU B OE2 
3857 N N   . HIS B 223 ? 1.4854 1.4185 1.9644 0.2703  0.4242  0.3762  306 HIS B N   
3858 C CA  . HIS B 223 ? 1.4275 1.3888 1.9973 0.2786  0.4303  0.4108  306 HIS B CA  
3859 C C   . HIS B 223 ? 1.3448 1.3501 1.9519 0.2636  0.3862  0.4329  306 HIS B C   
3860 O O   . HIS B 223 ? 1.3278 1.3541 2.0124 0.2652  0.3815  0.4608  306 HIS B O   
3861 C CB  . HIS B 223 ? 1.4537 1.4150 2.0331 0.2957  0.4700  0.4228  306 HIS B CB  
3862 C CG  . HIS B 223 ? 1.4547 1.4418 2.0025 0.2911  0.4557  0.4318  306 HIS B CG  
3863 N ND1 . HIS B 223 ? 1.5507 1.5183 2.0176 0.2937  0.4716  0.4158  306 HIS B ND1 
3864 C CD2 . HIS B 223 ? 1.4275 1.4556 2.0129 0.2835  0.4268  0.4556  306 HIS B CD2 
3865 C CE1 . HIS B 223 ? 1.5356 1.5319 1.9956 0.2892  0.4525  0.4305  306 HIS B CE1 
3866 N NE2 . HIS B 223 ? 1.4741 1.5069 2.0053 0.2830  0.4264  0.4533  306 HIS B NE2 
3867 N N   . ILE B 224 ? 1.3365 1.3543 1.8901 0.2486  0.3548  0.4203  307 ILE B N   
3868 C CA  . ILE B 224 ? 1.2519 1.3074 1.8304 0.2323  0.3157  0.4359  307 ILE B CA  
3869 C C   . ILE B 224 ? 1.2027 1.2590 1.8159 0.2185  0.2926  0.4396  307 ILE B C   
3870 O O   . ILE B 224 ? 1.2597 1.2903 1.8461 0.2147  0.2930  0.4189  307 ILE B O   
3871 C CB  . ILE B 224 ? 1.2411 1.3064 1.7553 0.2206  0.2914  0.4176  307 ILE B CB  
3872 C CG1 . ILE B 224 ? 1.2848 1.3464 1.7562 0.2324  0.3098  0.4152  307 ILE B CG1 
3873 C CG2 . ILE B 224 ? 1.1971 1.2974 1.7376 0.2031  0.2557  0.4302  307 ILE B CG2 
3874 C CD1 . ILE B 224 ? 1.2743 1.3568 1.7906 0.2417  0.3230  0.4437  307 ILE B CD1 
3875 N N   . SER B 225 ? 1.1303 1.2144 1.7983 0.2088  0.2708  0.4659  308 SER B N   
3876 C CA  . SER B 225 ? 1.1062 1.1900 1.8068 0.1934  0.2471  0.4748  308 SER B CA  
3877 C C   . SER B 225 ? 1.0732 1.1567 1.7238 0.1721  0.2199  0.4530  308 SER B C   
3878 O O   . SER B 225 ? 1.0661 1.1598 1.6699 0.1677  0.2128  0.4364  308 SER B O   
3879 C CB  . SER B 225 ? 1.0993 1.2122 1.8617 0.1847  0.2269  0.5091  308 SER B CB  
3880 O OG  . SER B 225 ? 1.0560 1.1954 1.7967 0.1733  0.2086  0.5099  308 SER B OG  
3881 N N   . PRO B 226 ? 1.0889 1.1611 1.7528 0.1584  0.2046  0.4543  309 PRO B N   
3882 C CA  . PRO B 226 ? 1.0943 1.1681 1.7149 0.1361  0.1806  0.4342  309 PRO B CA  
3883 C C   . PRO B 226 ? 1.0615 1.1682 1.6741 0.1185  0.1561  0.4394  309 PRO B C   
3884 O O   . PRO B 226 ? 1.1290 1.2429 1.6987 0.1111  0.1488  0.4170  309 PRO B O   
3885 C CB  . PRO B 226 ? 1.0747 1.1310 1.7216 0.1241  0.1696  0.4432  309 PRO B CB  
3886 C CG  . PRO B 226 ? 1.0836 1.1183 1.7733 0.1461  0.1952  0.4553  309 PRO B CG  
3887 C CD  . PRO B 226 ? 1.0854 1.1407 1.8034 0.1626  0.2094  0.4726  309 PRO B CD  
3888 N N   . LYS B 227 ? 1.0096 1.1350 1.6648 0.1121  0.1441  0.4680  310 LYS B N   
3889 C CA  . LYS B 227 ? 0.9777 1.1298 1.6253 0.0935  0.1226  0.4722  310 LYS B CA  
3890 C C   . LYS B 227 ? 0.9928 1.1616 1.6208 0.1049  0.1313  0.4635  310 LYS B C   
3891 O O   . LYS B 227 ? 0.9612 1.1449 1.5639 0.0918  0.1183  0.4509  310 LYS B O   
3892 C CB  . LYS B 227 ? 0.9451 1.1096 1.6403 0.0824  0.1064  0.5055  310 LYS B CB  
3893 C CG  . LYS B 227 ? 0.9771 1.1276 1.6871 0.0644  0.0889  0.5179  310 LYS B CG  
3894 C CD  . LYS B 227 ? 1.0281 1.1875 1.7938 0.0594  0.0743  0.5558  310 LYS B CD  
3895 C CE  . LYS B 227 ? 1.0529 1.1936 1.8403 0.0459  0.0574  0.5736  310 LYS B CE  
3896 N NZ  . LYS B 227 ? 1.0398 1.1777 1.7837 0.0124  0.0332  0.5660  310 LYS B NZ  
3897 N N   . ALA B 228 ? 1.0046 1.1701 1.6470 0.1285  0.1543  0.4715  311 ALA B N   
3898 C CA  . ALA B 228 ? 1.0279 1.2040 1.6481 0.1406  0.1646  0.4650  311 ALA B CA  
3899 C C   . ALA B 228 ? 1.0588 1.2233 1.6211 0.1440  0.1679  0.4340  311 ALA B C   
3900 O O   . ALA B 228 ? 1.0422 1.2195 1.5802 0.1442  0.1623  0.4255  311 ALA B O   
3901 C CB  . ALA B 228 ? 1.0243 1.1966 1.6724 0.1633  0.1914  0.4821  311 ALA B CB  
3902 N N   . ARG B 229 ? 1.0714 1.2111 1.6145 0.1461  0.1754  0.4182  312 ARG B N   
3903 C CA  . ARG B 229 ? 1.1039 1.2304 1.5922 0.1472  0.1758  0.3888  312 ARG B CA  
3904 C C   . ARG B 229 ? 1.1013 1.2456 1.5730 0.1271  0.1498  0.3738  312 ARG B C   
3905 O O   . ARG B 229 ? 1.1534 1.3046 1.5937 0.1284  0.1437  0.3584  312 ARG B O   
3906 C CB  . ARG B 229 ? 1.1405 1.2341 1.6158 0.1506  0.1884  0.3750  312 ARG B CB  
3907 C CG  . ARG B 229 ? 1.1528 1.2270 1.5693 0.1514  0.1897  0.3444  312 ARG B CG  
3908 C CD  . ARG B 229 ? 1.1838 1.2224 1.5925 0.1528  0.2030  0.3315  312 ARG B CD  
3909 N NE  . ARG B 229 ? 1.1968 1.2175 1.6353 0.1712  0.2324  0.3471  312 ARG B NE  
3910 C CZ  . ARG B 229 ? 1.2738 1.2731 1.6871 0.1891  0.2613  0.3412  312 ARG B CZ  
3911 N NH1 . ARG B 229 ? 1.3252 1.3144 1.6748 0.1905  0.2621  0.3204  312 ARG B NH1 
3912 N NH2 . ARG B 229 ? 1.3228 1.3095 1.7756 0.2051  0.2900  0.3568  312 ARG B NH2 
3913 N N   . CYS B 230 ? 1.0768 1.2282 1.5711 0.1079  0.1347  0.3792  313 CYS B N   
3914 C CA  . CYS B 230 ? 1.1572 1.3228 1.6374 0.0872  0.1151  0.3631  313 CYS B CA  
3915 C C   . CYS B 230 ? 1.0856 1.2788 1.5836 0.0777  0.1040  0.3739  313 CYS B C   
3916 O O   . CYS B 230 ? 1.1695 1.3758 1.6629 0.0587  0.0907  0.3624  313 CYS B O   
3917 C CB  . CYS B 230 ? 1.2561 1.4077 1.7394 0.0691  0.1078  0.3584  313 CYS B CB  
3918 S SG  . CYS B 230 ? 1.4085 1.5617 1.9334 0.0557  0.0999  0.3898  313 CYS B SG  
3919 N N   . LEU B 231 ? 1.0599 1.2605 1.5800 0.0897  0.1112  0.3954  314 LEU B N   
3920 C CA  . LEU B 231 ? 1.0171 1.2404 1.5471 0.0864  0.1044  0.4019  314 LEU B CA  
3921 C C   . LEU B 231 ? 1.0240 1.2515 1.5300 0.1016  0.1089  0.3893  314 LEU B C   
3922 O O   . LEU B 231 ? 1.0355 1.2793 1.5391 0.0951  0.0990  0.3806  314 LEU B O   
3923 C CB  . LEU B 231 ? 0.9723 1.2018 1.5385 0.0920  0.1092  0.4314  314 LEU B CB  
3924 C CG  . LEU B 231 ? 0.9162 1.1655 1.4953 0.0891  0.1038  0.4401  314 LEU B CG  
3925 C CD1 . LEU B 231 ? 0.8644 1.1253 1.4373 0.0645  0.0871  0.4278  314 LEU B CD1 
3926 C CD2 . LEU B 231 ? 0.9230 1.1767 1.5426 0.0916  0.1066  0.4704  314 LEU B CD2 
3927 N N   . ILE B 232 ? 1.0283 1.2395 1.5180 0.1216  0.1248  0.3902  315 ILE B N   
3928 C CA  . ILE B 232 ? 0.9967 1.2057 1.4543 0.1357  0.1281  0.3804  315 ILE B CA  
3929 C C   . ILE B 232 ? 1.0237 1.2363 1.4560 0.1258  0.1117  0.3544  315 ILE B C   
3930 O O   . ILE B 232 ? 1.0472 1.2751 1.4757 0.1259  0.1007  0.3488  315 ILE B O   
3931 C CB  . ILE B 232 ? 1.0419 1.2257 1.4761 0.1548  0.1504  0.3827  315 ILE B CB  
3932 C CG1 . ILE B 232 ? 1.0542 1.2404 1.5194 0.1671  0.1687  0.4096  315 ILE B CG1 
3933 C CG2 . ILE B 232 ? 1.0776 1.2529 1.4632 0.1639  0.1488  0.3683  315 ILE B CG2 
3934 C CD1 . ILE B 232 ? 1.1026 1.2630 1.5593 0.1837  0.1972  0.4138  315 ILE B CD1 
3935 N N   . ARG B 233 ? 1.0622 1.2615 1.4834 0.1168  0.1096  0.3397  316 ARG B N   
3936 C CA  . ARG B 233 ? 1.0238 1.2270 1.4258 0.1059  0.0941  0.3147  316 ARG B CA  
3937 C C   . ARG B 233 ? 0.9874 1.2166 1.4148 0.0873  0.0794  0.3089  316 ARG B C   
3938 O O   . ARG B 233 ? 1.0527 1.2938 1.4749 0.0824  0.0671  0.2917  316 ARG B O   
3939 C CB  . ARG B 233 ? 1.0511 1.2299 1.4332 0.1009  0.0972  0.2999  316 ARG B CB  
3940 C CG  . ARG B 233 ? 1.1593 1.3117 1.5005 0.1173  0.1084  0.2930  316 ARG B CG  
3941 C CD  . ARG B 233 ? 1.2694 1.4014 1.5785 0.1094  0.1024  0.2677  316 ARG B CD  
3942 N NE  . ARG B 233 ? 1.4225 1.5182 1.6988 0.1226  0.1228  0.2650  316 ARG B NE  
3943 C CZ  . ARG B 233 ? 1.5051 1.5851 1.7387 0.1361  0.1304  0.2621  316 ARG B CZ  
3944 N NH1 . ARG B 233 ? 1.5183 1.6160 1.7375 0.1391  0.1157  0.2639  316 ARG B NH1 
3945 N NH2 . ARG B 233 ? 1.5711 1.6147 1.7746 0.1461  0.1539  0.2576  316 ARG B NH2 
3946 N N   . SER B 234 ? 0.9444 1.1819 1.3994 0.0766  0.0809  0.3233  317 SER B N   
3947 C CA  . SER B 234 ? 0.8983 1.1578 1.3732 0.0595  0.0717  0.3184  317 SER B CA  
3948 C C   . SER B 234 ? 0.8772 1.1541 1.3609 0.0696  0.0685  0.3195  317 SER B C   
3949 O O   . SER B 234 ? 0.8877 1.1813 1.3854 0.0586  0.0618  0.3074  317 SER B O   
3950 C CB  . SER B 234 ? 0.9368 1.1969 1.4316 0.0449  0.0729  0.3360  317 SER B CB  
3951 O OG  . SER B 234 ? 1.0995 1.3431 1.5910 0.0347  0.0736  0.3394  317 SER B OG  
3952 N N   . LEU B 235 ? 0.8510 1.1229 1.3300 0.0895  0.0753  0.3353  318 LEU B N   
3953 C CA  . LEU B 235 ? 0.8367 1.1220 1.3259 0.0989  0.0723  0.3407  318 LEU B CA  
3954 C C   . LEU B 235 ? 0.8577 1.1420 1.3244 0.1123  0.0645  0.3300  318 LEU B C   
3955 O O   . LEU B 235 ? 0.8154 1.1148 1.2952 0.1136  0.0544  0.3246  318 LEU B O   
3956 C CB  . LEU B 235 ? 0.8350 1.1158 1.3340 0.1106  0.0837  0.3666  318 LEU B CB  
3957 C CG  . LEU B 235 ? 0.7975 1.0782 1.3203 0.0982  0.0880  0.3822  318 LEU B CG  
3958 C CD1 . LEU B 235 ? 0.8196 1.0990 1.3585 0.1109  0.0983  0.4080  318 LEU B CD1 
3959 C CD2 . LEU B 235 ? 0.7842 1.0782 1.3246 0.0755  0.0787  0.3747  318 LEU B CD2 
3960 N N   . LEU B 236 ? 0.8988 1.1636 1.3319 0.1214  0.0686  0.3273  319 LEU B N   
3961 C CA  . LEU B 236 ? 0.9307 1.1897 1.3329 0.1313  0.0585  0.3181  319 LEU B CA  
3962 C C   . LEU B 236 ? 0.9523 1.2164 1.3505 0.1184  0.0429  0.2933  319 LEU B C   
3963 O O   . LEU B 236 ? 0.9867 1.2344 1.3495 0.1212  0.0381  0.2830  319 LEU B O   
3964 C CB  . LEU B 236 ? 0.9838 1.2147 1.3444 0.1462  0.0730  0.3265  319 LEU B CB  
3965 C CG  . LEU B 236 ? 1.0153 1.2416 1.3828 0.1594  0.0913  0.3518  319 LEU B CG  
3966 C CD1 . LEU B 236 ? 1.0817 1.2786 1.4068 0.1732  0.1104  0.3571  319 LEU B CD1 
3967 C CD2 . LEU B 236 ? 1.0513 1.2934 1.4322 0.1653  0.0819  0.3626  319 LEU B CD2 
3968 N N   . ARG B 237 ? 0.9345 1.2202 1.3683 0.1030  0.0360  0.2831  320 ARG B N   
3969 C CA  . ARG B 237 ? 0.9798 1.2755 1.4201 0.0898  0.0222  0.2601  320 ARG B CA  
3970 C C   . ARG B 237 ? 0.9956 1.3071 1.4450 0.0974  0.0037  0.2553  320 ARG B C   
3971 O O   . ARG B 237 ? 0.9932 1.3155 1.4615 0.1065  0.0028  0.2673  320 ARG B O   
3972 C CB  . ARG B 237 ? 0.9815 1.2937 1.4572 0.0691  0.0258  0.2510  320 ARG B CB  
3973 C CG  . ARG B 237 ? 0.9648 1.2624 1.4348 0.0578  0.0394  0.2577  320 ARG B CG  
3974 C CD  . ARG B 237 ? 1.0158 1.3013 1.4727 0.0438  0.0384  0.2433  320 ARG B CD  
3975 N NE  . ARG B 237 ? 1.0439 1.3245 1.5104 0.0274  0.0477  0.2511  320 ARG B NE  
3976 C CZ  . ARG B 237 ? 1.1193 1.3786 1.5728 0.0214  0.0532  0.2563  320 ARG B CZ  
3977 N NH1 . ARG B 237 ? 1.1892 1.4276 1.6188 0.0306  0.0541  0.2515  320 ARG B NH1 
3978 N NH2 . ARG B 237 ? 1.0818 1.3386 1.5456 0.0052  0.0575  0.2668  320 ARG B NH2 
3979 N N   . ARG B 238 ? 1.0692 1.3826 1.5102 0.0921  -0.0127 0.2382  321 ARG B N   
3980 C CA  . ARG B 238 ? 1.0924 1.4192 1.5408 0.0993  -0.0362 0.2354  321 ARG B CA  
3981 C C   . ARG B 238 ? 1.0255 1.3851 1.5366 0.0933  -0.0406 0.2293  321 ARG B C   
3982 O O   . ARG B 238 ? 0.9573 1.3295 1.4912 0.1044  -0.0498 0.2384  321 ARG B O   
3983 C CB  . ARG B 238 ? 1.2133 1.5330 1.6372 0.0925  -0.0554 0.2184  321 ARG B CB  
3984 C CG  . ARG B 238 ? 1.3896 1.6756 1.7600 0.0885  -0.0455 0.2120  321 ARG B CG  
3985 C CD  . ARG B 238 ? 1.4597 1.7289 1.7863 0.0874  -0.0670 0.2008  321 ARG B CD  
3986 N NE  . ARG B 238 ? 1.5327 1.8156 1.8627 0.0947  -0.0946 0.2062  321 ARG B NE  
3987 C CZ  . ARG B 238 ? 1.6070 1.8819 1.9142 0.1109  -0.0963 0.2261  321 ARG B CZ  
3988 N NH1 . ARG B 238 ? 1.6478 1.9032 1.9298 0.1218  -0.0700 0.2415  321 ARG B NH1 
3989 N NH2 . ARG B 238 ? 1.6226 1.9099 1.9365 0.1159  -0.1253 0.2323  321 ARG B NH2 
3990 N N   . GLU B 239 ? 1.0481 1.4192 1.5866 0.0748  -0.0318 0.2137  322 GLU B N   
3991 C CA  . GLU B 239 ? 1.0377 1.4363 1.6336 0.0658  -0.0283 0.2041  322 GLU B CA  
3992 C C   . GLU B 239 ? 0.9748 1.3707 1.5791 0.0672  -0.0089 0.2172  322 GLU B C   
3993 O O   . GLU B 239 ? 0.9947 1.3742 1.5746 0.0603  0.0058  0.2237  322 GLU B O   
3994 C CB  . GLU B 239 ? 1.0398 1.4465 1.6521 0.0429  -0.0227 0.1827  322 GLU B CB  
3995 C CG  . GLU B 239 ? 1.0862 1.5157 1.7505 0.0286  -0.0092 0.1704  322 GLU B CG  
3996 C CD  . GLU B 239 ? 1.1227 1.5801 1.8425 0.0370  -0.0220 0.1639  322 GLU B CD  
3997 O OE1 . GLU B 239 ? 1.1703 1.6381 1.9010 0.0386  -0.0430 0.1562  322 GLU B OE1 
3998 O OE2 . GLU B 239 ? 1.0815 1.5495 1.8358 0.0415  -0.0124 0.1668  322 GLU B OE2 
3999 N N   . PRO B 240 ? 0.9395 1.3504 1.5804 0.0756  -0.0102 0.2218  323 PRO B N   
4000 C CA  . PRO B 240 ? 0.8961 1.3012 1.5415 0.0764  0.0065  0.2348  323 PRO B CA  
4001 C C   . PRO B 240 ? 0.8394 1.2450 1.4940 0.0537  0.0254  0.2245  323 PRO B C   
4002 O O   . PRO B 240 ? 0.8414 1.2331 1.4774 0.0498  0.0368  0.2375  323 PRO B O   
4003 C CB  . PRO B 240 ? 0.9024 1.3233 1.5912 0.0884  -0.0002 0.2372  323 PRO B CB  
4004 C CG  . PRO B 240 ? 0.9081 1.3348 1.5955 0.1017  -0.0251 0.2383  323 PRO B CG  
4005 C CD  . PRO B 240 ? 0.9107 1.3400 1.5868 0.0876  -0.0298 0.2202  323 PRO B CD  
4006 N N   . SER B 241 ? 0.8551 1.2759 1.5373 0.0374  0.0283  0.2022  324 SER B N   
4007 C CA  . SER B 241 ? 0.8767 1.2961 1.5627 0.0121  0.0473  0.1907  324 SER B CA  
4008 C C   . SER B 241 ? 0.8698 1.2687 1.5117 -0.0009 0.0514  0.1969  324 SER B C   
4009 O O   . SER B 241 ? 0.9168 1.3072 1.5490 -0.0206 0.0646  0.1968  324 SER B O   
4010 C CB  . SER B 241 ? 0.8880 1.3286 1.6161 -0.0021 0.0524  0.1648  324 SER B CB  
4011 O OG  . SER B 241 ? 1.0081 1.4575 1.7399 0.0017  0.0361  0.1570  324 SER B OG  
4012 N N   . GLU B 242 ? 0.8535 1.2424 1.4685 0.0087  0.0400  0.2021  325 GLU B N   
4013 C CA  . GLU B 242 ? 0.8707 1.2379 1.4492 0.0001  0.0438  0.2098  325 GLU B CA  
4014 C C   . GLU B 242 ? 0.8678 1.2181 1.4259 0.0089  0.0488  0.2346  325 GLU B C   
4015 O O   . GLU B 242 ? 0.9112 1.2464 1.4520 -0.0026 0.0544  0.2433  325 GLU B O   
4016 C CB  . GLU B 242 ? 0.9628 1.3214 1.5201 0.0076  0.0322  0.2049  325 GLU B CB  
4017 C CG  . GLU B 242 ? 1.0837 1.4562 1.6600 -0.0073 0.0271  0.1812  325 GLU B CG  
4018 C CD  . GLU B 242 ? 1.2360 1.5984 1.7899 -0.0010 0.0128  0.1751  325 GLU B CD  
4019 O OE1 . GLU B 242 ? 1.3050 1.6441 1.8216 0.0118  0.0118  0.1877  325 GLU B OE1 
4020 O OE2 . GLU B 242 ? 1.2572 1.6347 1.8325 -0.0099 0.0037  0.1567  325 GLU B OE2 
4021 N N   . ARG B 243 ? 0.8697 1.2231 1.4336 0.0287  0.0463  0.2475  326 ARG B N   
4022 C CA  . ARG B 243 ? 0.8126 1.1527 1.3640 0.0378  0.0519  0.2718  326 ARG B CA  
4023 C C   . ARG B 243 ? 0.8140 1.1525 1.3737 0.0185  0.0602  0.2777  326 ARG B C   
4024 O O   . ARG B 243 ? 0.8867 1.2356 1.4637 0.0028  0.0640  0.2632  326 ARG B O   
4025 C CB  . ARG B 243 ? 0.8098 1.1548 1.3695 0.0598  0.0485  0.2834  326 ARG B CB  
4026 C CG  . ARG B 243 ? 0.8084 1.1501 1.3500 0.0785  0.0382  0.2825  326 ARG B CG  
4027 C CD  . ARG B 243 ? 0.8112 1.1576 1.3610 0.0973  0.0331  0.2946  326 ARG B CD  
4028 N NE  . ARG B 243 ? 0.8557 1.2037 1.3933 0.1083  0.0173  0.2878  326 ARG B NE  
4029 C CZ  . ARG B 243 ? 0.9254 1.2828 1.4780 0.1205  0.0047  0.2916  326 ARG B CZ  
4030 N NH1 . ARG B 243 ? 0.9482 1.3134 1.5308 0.1250  0.0087  0.3013  326 ARG B NH1 
4031 N NH2 . ARG B 243 ? 0.9595 1.3169 1.4970 0.1274  -0.0137 0.2863  326 ARG B NH2 
4032 N N   . LEU B 244 ? 0.8117 1.1368 1.3606 0.0195  0.0631  0.2991  327 LEU B N   
4033 C CA  . LEU B 244 ? 0.8364 1.1586 1.3907 0.0009  0.0664  0.3083  327 LEU B CA  
4034 C C   . LEU B 244 ? 0.8390 1.1700 1.4134 0.0055  0.0687  0.3116  327 LEU B C   
4035 O O   . LEU B 244 ? 0.9044 1.2413 1.4888 0.0269  0.0676  0.3153  327 LEU B O   
4036 C CB  . LEU B 244 ? 0.9238 1.2315 1.4697 0.0021  0.0656  0.3333  327 LEU B CB  
4037 C CG  . LEU B 244 ? 0.9428 1.2369 1.4728 -0.0028 0.0640  0.3343  327 LEU B CG  
4038 C CD1 . LEU B 244 ? 0.9455 1.2273 1.4796 0.0073  0.0649  0.3614  327 LEU B CD1 
4039 C CD2 . LEU B 244 ? 0.9461 1.2361 1.4668 -0.0337 0.0618  0.3243  327 LEU B CD2 
4040 N N   . THR B 245 ? 0.8225 1.1518 1.3998 -0.0174 0.0719  0.3083  328 THR B N   
4041 C CA  . THR B 245 ? 0.8226 1.1538 1.4153 -0.0197 0.0750  0.3122  328 THR B CA  
4042 C C   . THR B 245 ? 0.8369 1.1603 1.4297 -0.0130 0.0710  0.3413  328 THR B C   
4043 O O   . THR B 245 ? 1.0001 1.3152 1.5811 -0.0180 0.0667  0.3553  328 THR B O   
4044 C CB  . THR B 245 ? 0.8368 1.1626 1.4202 -0.0536 0.0806  0.2965  328 THR B CB  
4045 O OG1 . THR B 245 ? 0.8735 1.2099 1.4704 -0.0575 0.0894  0.2683  328 THR B OG1 
4046 C CG2 . THR B 245 ? 0.8740 1.1920 1.4589 -0.0674 0.0817  0.3043  328 THR B CG2 
4047 N N   . ALA B 246 ? 0.8170 1.1426 1.4273 -0.0030 0.0725  0.3511  329 ALA B N   
4048 C CA  . ALA B 246 ? 0.8456 1.1659 1.4625 0.0018  0.0696  0.3793  329 ALA B CA  
4049 C C   . ALA B 246 ? 0.8978 1.2089 1.5065 -0.0271 0.0630  0.3883  329 ALA B C   
4050 O O   . ALA B 246 ? 0.9043 1.2116 1.5178 -0.0256 0.0571  0.4125  329 ALA B O   
4051 C CB  . ALA B 246 ? 0.8535 1.1768 1.4917 0.0155  0.0728  0.3875  329 ALA B CB  
4052 N N   . PRO B 247 ? 0.8844 1.1909 1.4820 -0.0541 0.0638  0.3700  330 PRO B N   
4053 C CA  . PRO B 247 ? 0.9516 1.2460 1.5300 -0.0853 0.0548  0.3776  330 PRO B CA  
4054 C C   . PRO B 247 ? 1.0322 1.3214 1.5958 -0.0903 0.0471  0.3878  330 PRO B C   
4055 O O   . PRO B 247 ? 1.1439 1.4254 1.7065 -0.1027 0.0343  0.4112  330 PRO B O   
4056 C CB  . PRO B 247 ? 0.9678 1.2564 1.5285 -0.1114 0.0631  0.3484  330 PRO B CB  
4057 C CG  . PRO B 247 ? 0.9771 1.2739 1.5629 -0.0942 0.0739  0.3354  330 PRO B CG  
4058 C CD  . PRO B 247 ? 0.9204 1.2293 1.5290 -0.0571 0.0723  0.3508  330 PRO B CD  
4059 N N   . GLU B 248 ? 0.9677 1.2605 1.5233 -0.0814 0.0532  0.3716  331 GLU B N   
4060 C CA  . GLU B 248 ? 0.9658 1.2506 1.5076 -0.0872 0.0471  0.3790  331 GLU B CA  
4061 C C   . GLU B 248 ? 1.0049 1.2906 1.5640 -0.0592 0.0455  0.4007  331 GLU B C   
4062 O O   . GLU B 248 ? 1.0919 1.3683 1.6495 -0.0642 0.0382  0.4167  331 GLU B O   
4063 C CB  . GLU B 248 ? 0.9572 1.2415 1.4803 -0.0981 0.0538  0.3519  331 GLU B CB  
4064 C CG  . GLU B 248 ? 0.9687 1.2657 1.5022 -0.0744 0.0624  0.3325  331 GLU B CG  
4065 C CD  . GLU B 248 ? 1.0397 1.3414 1.5654 -0.0914 0.0708  0.3017  331 GLU B CD  
4066 O OE1 . GLU B 248 ? 1.0811 1.3739 1.5880 -0.1222 0.0734  0.2941  331 GLU B OE1 
4067 O OE2 . GLU B 248 ? 1.0536 1.3679 1.5924 -0.0751 0.0749  0.2849  331 GLU B OE2 
4068 N N   . ILE B 249 ? 0.9529 1.2476 1.5286 -0.0307 0.0531  0.4029  332 ILE B N   
4069 C CA  . ILE B 249 ? 0.9057 1.1986 1.4966 -0.0063 0.0560  0.4245  332 ILE B CA  
4070 C C   . ILE B 249 ? 0.8763 1.1654 1.4866 -0.0164 0.0469  0.4534  332 ILE B C   
4071 O O   . ILE B 249 ? 0.9389 1.2217 1.5600 -0.0103 0.0454  0.4700  332 ILE B O   
4072 C CB  . ILE B 249 ? 0.9133 1.2138 1.5160 0.0210  0.0657  0.4274  332 ILE B CB  
4073 C CG1 . ILE B 249 ? 0.8928 1.1968 1.4792 0.0339  0.0706  0.4036  332 ILE B CG1 
4074 C CG2 . ILE B 249 ? 0.9637 1.2599 1.5815 0.0425  0.0730  0.4509  332 ILE B CG2 
4075 C CD1 . ILE B 249 ? 0.9330 1.2433 1.5268 0.0555  0.0761  0.4061  332 ILE B CD1 
4076 N N   . LEU B 250 ? 0.8462 1.1385 1.4635 -0.0321 0.0402  0.4590  333 LEU B N   
4077 C CA  . LEU B 250 ? 0.8557 1.1464 1.4944 -0.0449 0.0272  0.4875  333 LEU B CA  
4078 C C   . LEU B 250 ? 0.9016 1.1815 1.5335 -0.0667 0.0113  0.5003  333 LEU B C   
4079 O O   . LEU B 250 ? 0.9009 1.1808 1.5604 -0.0704 -0.0010 0.5293  333 LEU B O   
4080 C CB  . LEU B 250 ? 0.8201 1.1117 1.4573 -0.0653 0.0207  0.4852  333 LEU B CB  
4081 C CG  . LEU B 250 ? 0.7688 1.0693 1.4263 -0.0467 0.0310  0.4858  333 LEU B CG  
4082 C CD1 . LEU B 250 ? 0.7436 1.0395 1.3947 -0.0724 0.0241  0.4792  333 LEU B CD1 
4083 C CD2 . LEU B 250 ? 0.7257 1.0332 1.4212 -0.0245 0.0342  0.5153  333 LEU B CD2 
4084 N N   . LEU B 251 ? 0.8936 1.1649 1.4924 -0.0818 0.0109  0.4802  334 LEU B N   
4085 C CA  . LEU B 251 ? 0.8612 1.1189 1.4466 -0.1037 -0.0035 0.4904  334 LEU B CA  
4086 C C   . LEU B 251 ? 0.8218 1.0735 1.4093 -0.0863 0.0035  0.4884  334 LEU B C   
4087 O O   . LEU B 251 ? 0.9342 1.1729 1.5020 -0.1050 -0.0045 0.4874  334 LEU B O   
4088 C CB  . LEU B 251 ? 0.9002 1.1484 1.4419 -0.1385 -0.0070 0.4687  334 LEU B CB  
4089 C CG  . LEU B 251 ? 0.9144 1.1640 1.4430 -0.1572 -0.0067 0.4574  334 LEU B CG  
4090 C CD1 . LEU B 251 ? 0.9058 1.1443 1.3902 -0.1885 -0.0017 0.4301  334 LEU B CD1 
4091 C CD2 . LEU B 251 ? 0.9149 1.1608 1.4567 -0.1730 -0.0272 0.4867  334 LEU B CD2 
4092 N N   . HIS B 252 ? 0.7863 1.0441 1.3936 -0.0530 0.0187  0.4876  335 HIS B N   
4093 C CA  . HIS B 252 ? 0.8531 1.1015 1.4564 -0.0377 0.0275  0.4805  335 HIS B CA  
4094 C C   . HIS B 252 ? 0.8852 1.1259 1.5240 -0.0265 0.0244  0.5100  335 HIS B C   
4095 O O   . HIS B 252 ? 0.8739 1.1228 1.5469 -0.0095 0.0294  0.5286  335 HIS B O   
4096 C CB  . HIS B 252 ? 0.8765 1.1313 1.4707 -0.0113 0.0460  0.4582  335 HIS B CB  
4097 C CG  . HIS B 252 ? 0.8781 1.1207 1.4630 0.0037  0.0555  0.4479  335 HIS B CG  
4098 N ND1 . HIS B 252 ? 0.8701 1.1024 1.4772 0.0219  0.0630  0.4650  335 HIS B ND1 
4099 C CD2 . HIS B 252 ? 0.8797 1.1182 1.4378 0.0039  0.0600  0.4212  335 HIS B CD2 
4100 C CE1 . HIS B 252 ? 0.8807 1.0997 1.4702 0.0317  0.0720  0.4485  335 HIS B CE1 
4101 N NE2 . HIS B 252 ? 0.9215 1.1447 1.4807 0.0206  0.0688  0.4223  335 HIS B NE2 
4102 N N   . PRO B 253 ? 0.9196 1.1441 1.5544 -0.0360 0.0172  0.5146  336 PRO B N   
4103 C CA  . PRO B 253 ? 0.9372 1.1521 1.6107 -0.0288 0.0118  0.5433  336 PRO B CA  
4104 C C   . PRO B 253 ? 0.9606 1.1820 1.6800 0.0029  0.0279  0.5592  336 PRO B C   
4105 O O   . PRO B 253 ? 1.0575 1.2818 1.8228 0.0036  0.0185  0.5898  336 PRO B O   
4106 C CB  . PRO B 253 ? 0.9939 1.1892 1.6485 -0.0285 0.0167  0.5293  336 PRO B CB  
4107 C CG  . PRO B 253 ? 0.9949 1.1892 1.6026 -0.0572 0.0082  0.5077  336 PRO B CG  
4108 C CD  . PRO B 253 ? 0.9606 1.1743 1.5560 -0.0541 0.0155  0.4912  336 PRO B CD  
4109 N N   . TRP B 254 ? 0.9395 1.1619 1.6476 0.0281  0.0520  0.5396  337 TRP B N   
4110 C CA  . TRP B 254 ? 0.9022 1.1280 1.6462 0.0578  0.0731  0.5519  337 TRP B CA  
4111 C C   . TRP B 254 ? 0.8913 1.1330 1.6852 0.0568  0.0653  0.5833  337 TRP B C   
4112 O O   . TRP B 254 ? 0.8724 1.1130 1.7174 0.0705  0.0722  0.6064  337 TRP B O   
4113 C CB  . TRP B 254 ? 0.8584 1.0871 1.5710 0.0770  0.0942  0.5280  337 TRP B CB  
4114 C CG  . TRP B 254 ? 0.8738 1.1013 1.6132 0.1052  0.1195  0.5386  337 TRP B CG  
4115 C CD1 . TRP B 254 ? 0.9119 1.1242 1.6772 0.1223  0.1373  0.5463  337 TRP B CD1 
4116 C CD2 . TRP B 254 ? 0.8975 1.1374 1.6404 0.1191  0.1330  0.5423  337 TRP B CD2 
4117 N NE1 . TRP B 254 ? 0.9719 1.1867 1.7560 0.1454  0.1634  0.5539  337 TRP B NE1 
4118 C CE2 . TRP B 254 ? 0.9331 1.1646 1.7016 0.1434  0.1604  0.5524  337 TRP B CE2 
4119 C CE3 . TRP B 254 ? 0.8558 1.1110 1.5834 0.1130  0.1260  0.5381  337 TRP B CE3 
4120 C CZ2 . TRP B 254 ? 0.9334 1.1716 1.7090 0.1603  0.1809  0.5594  337 TRP B CZ2 
4121 C CZ3 . TRP B 254 ? 0.8565 1.1181 1.5937 0.1304  0.1436  0.5462  337 TRP B CZ3 
4122 C CH2 . TRP B 254 ? 0.8912 1.1444 1.6500 0.1532  0.1708  0.5572  337 TRP B CH2 
4123 N N   . PHE B 255 ? 0.9196 1.1756 1.7022 0.0397  0.0512  0.5836  338 PHE B N   
4124 C CA  . PHE B 255 ? 0.9398 1.2119 1.7663 0.0380  0.0441  0.6103  338 PHE B CA  
4125 C C   . PHE B 255 ? 0.9606 1.2326 1.8364 0.0258  0.0227  0.6439  338 PHE B C   
4126 O O   . PHE B 255 ? 1.0653 1.3466 2.0005 0.0404  0.0288  0.6693  338 PHE B O   
4127 C CB  . PHE B 255 ? 0.8967 1.1792 1.6961 0.0184  0.0320  0.6007  338 PHE B CB  
4128 C CG  . PHE B 255 ? 0.8661 1.1523 1.6348 0.0344  0.0520  0.5755  338 PHE B CG  
4129 C CD1 . PHE B 255 ? 0.8616 1.1562 1.6533 0.0574  0.0708  0.5839  338 PHE B CD1 
4130 C CD2 . PHE B 255 ? 0.8346 1.1158 1.5540 0.0260  0.0515  0.5452  338 PHE B CD2 
4131 C CE1 . PHE B 255 ? 0.8034 1.0993 1.5653 0.0712  0.0858  0.5641  338 PHE B CE1 
4132 C CE2 . PHE B 255 ? 0.8043 1.0895 1.5012 0.0411  0.0660  0.5249  338 PHE B CE2 
4133 C CZ  . PHE B 255 ? 0.8194 1.1109 1.5354 0.0633  0.0816  0.5353  338 PHE B CZ  
4134 N N   . GLU B 256 ? 0.9258 1.1872 1.7785 -0.0015 -0.0023 0.6450  339 GLU B N   
4135 C CA  . GLU B 256 ? 0.8992 1.1568 1.7935 -0.0156 -0.0281 0.6785  339 GLU B CA  
4136 C C   . GLU B 256 ? 0.8746 1.1222 1.8134 0.0090  -0.0136 0.6900  339 GLU B C   
4137 O O   . GLU B 256 ? 0.9369 1.1905 1.9426 0.0148  -0.0220 0.7227  339 GLU B O   
4138 C CB  . GLU B 256 ? 0.8964 1.1407 1.7442 -0.0534 -0.0577 0.6764  339 GLU B CB  
4139 C CG  . GLU B 256 ? 0.9453 1.1706 1.7438 -0.0560 -0.0486 0.6496  339 GLU B CG  
4140 C CD  . GLU B 256 ? 0.9426 1.1599 1.6765 -0.0910 -0.0631 0.6310  339 GLU B CD  
4141 O OE1 . GLU B 256 ? 1.0265 1.2538 1.7336 -0.0992 -0.0593 0.6139  339 GLU B OE1 
4142 O OE2 . GLU B 256 ? 0.9324 1.1318 1.6428 -0.1110 -0.0767 0.6333  339 GLU B OE2 
4143 N N   . SER B 257 ? 0.8326 1.0654 1.7389 0.0247  0.0098  0.6627  340 SER B N   
4144 C CA  . SER B 257 ? 0.8234 1.0420 1.7654 0.0498  0.0299  0.6670  340 SER B CA  
4145 C C   . SER B 257 ? 0.8796 1.1088 1.8834 0.0803  0.0564  0.6816  340 SER B C   
4146 O O   . SER B 257 ? 0.9941 1.2128 2.0461 0.0977  0.0692  0.6940  340 SER B O   
4147 C CB  . SER B 257 ? 0.8290 1.0285 1.7165 0.0595  0.0512  0.6306  340 SER B CB  
4148 O OG  . SER B 257 ? 0.7786 0.9796 1.6586 0.0874  0.0850  0.6125  340 SER B OG  
4149 N N   . VAL B 258 ? 0.9527 1.2003 1.9549 0.0874  0.0679  0.6787  341 VAL B N   
4150 C CA  . VAL B 258 ? 0.9343 1.1928 1.9940 0.1146  0.0963  0.6932  341 VAL B CA  
4151 C C   . VAL B 258 ? 0.9170 1.2012 2.0311 0.1086  0.0839  0.7226  341 VAL B C   
4152 O O   . VAL B 258 ? 0.8880 1.1816 2.0522 0.1300  0.1092  0.7347  341 VAL B O   
4153 C CB  . VAL B 258 ? 0.9231 1.1742 1.9408 0.1380  0.1344  0.6644  341 VAL B CB  
4154 C CG1 . VAL B 258 ? 0.9478 1.1719 1.9232 0.1451  0.1472  0.6384  341 VAL B CG1 
4155 C CG2 . VAL B 258 ? 0.9391 1.2007 1.9023 0.1277  0.1281  0.6471  341 VAL B CG2 
4156 N N   . LEU B 259 ? 0.9613 1.2550 2.0657 0.0784  0.0462  0.7337  342 LEU B N   
4157 C CA  . LEU B 259 ? 0.9852 1.3013 2.1453 0.0662  0.0252  0.7653  342 LEU B CA  
4158 C C   . LEU B 259 ? 1.0498 1.3769 2.3123 0.0768  0.0216  0.8048  342 LEU B C   
4159 O O   . LEU B 259 ? 1.0413 1.3897 2.3684 0.0836  0.0260  0.8278  342 LEU B O   
4160 C CB  . LEU B 259 ? 1.0390 1.3533 2.1585 0.0273  -0.0174 0.7674  342 LEU B CB  
4161 C CG  . LEU B 259 ? 1.0832 1.4159 2.2264 0.0063  -0.0422 0.7878  342 LEU B CG  
4162 C CD1 . LEU B 259 ? 1.0783 1.4142 2.1677 0.0044  -0.0286 0.7606  342 LEU B CD1 
4163 C CD2 . LEU B 259 ? 1.1877 1.5137 2.3180 -0.0318 -0.0892 0.8051  342 LEU B CD2 
4164 N N   . ILE B 272 ? 1.5725 1.8753 2.0803 -0.2698 0.1292  0.1139  497 ILE B N   
4165 C CA  . ILE B 272 ? 1.5825 1.8586 2.0641 -0.2855 0.1239  0.1227  497 ILE B CA  
4166 C C   . ILE B 272 ? 1.6732 1.9416 2.1576 -0.2586 0.1039  0.1291  497 ILE B C   
4167 O O   . ILE B 272 ? 1.7795 2.0685 2.2908 -0.2346 0.0953  0.1181  497 ILE B O   
4168 C CB  . ILE B 272 ? 1.4807 1.7614 1.9735 -0.3168 0.1402  0.1023  497 ILE B CB  
4169 C CG1 . ILE B 272 ? 1.4803 1.7260 1.9264 -0.3498 0.1461  0.1182  497 ILE B CG1 
4170 C CG2 . ILE B 272 ? 1.4213 1.7139 1.9452 -0.3068 0.1301  0.0872  497 ILE B CG2 
4171 C CD1 . ILE B 272 ? 1.5081 1.7492 1.9567 -0.3812 0.1599  0.1043  497 ILE B CD1 
4172 N N   . CYS B 273 ? 1.7172 1.9532 2.1723 -0.2650 0.0969  0.1467  498 CYS B N   
4173 C CA  . CYS B 273 ? 1.6096 1.8287 2.0605 -0.2433 0.0822  0.1534  498 CYS B CA  
4174 C C   . CYS B 273 ? 1.5420 1.7499 1.9950 -0.2623 0.0831  0.1401  498 CYS B C   
4175 O O   . CYS B 273 ? 1.5058 1.7181 1.9616 -0.2921 0.0956  0.1306  498 CYS B O   
4176 C CB  . CYS B 273 ? 1.5765 1.7661 2.0013 -0.2367 0.0755  0.1837  498 CYS B CB  
4177 S SG  . CYS B 273 ? 1.5907 1.7592 2.0129 -0.2036 0.0633  0.1923  498 CYS B SG  
4178 N N   . GLU B 274 ? 1.5051 1.6982 1.9567 -0.2463 0.0719  0.1375  499 GLU B N   
4179 C CA  . GLU B 274 ? 1.5292 1.7053 1.9804 -0.2644 0.0712  0.1267  499 GLU B CA  
4180 C C   . GLU B 274 ? 1.5134 1.6488 1.9383 -0.2787 0.0718  0.1481  499 GLU B C   
4181 O O   . GLU B 274 ? 1.5567 1.6766 1.9802 -0.3011 0.0745  0.1415  499 GLU B O   
4182 C CB  . GLU B 274 ? 1.5847 1.7597 2.0437 -0.2450 0.0585  0.1105  499 GLU B CB  
4183 C CG  . GLU B 274 ? 1.6588 1.8039 2.0956 -0.2180 0.0501  0.1224  499 GLU B CG  
4184 C CD  . GLU B 274 ? 1.7166 1.8747 2.1507 -0.1881 0.0473  0.1328  499 GLU B CD  
4185 O OE1 . GLU B 274 ? 1.7526 1.9351 2.1983 -0.1743 0.0401  0.1181  499 GLU B OE1 
4186 O OE2 . GLU B 274 ? 1.7523 1.8970 2.1751 -0.1787 0.0508  0.1565  499 GLU B OE2 
4187 N N   . HIS B 275 ? 1.4203 1.5386 1.8287 -0.2656 0.0681  0.1745  500 HIS B N   
4188 C CA  . HIS B 275 ? 1.3462 1.4260 1.7357 -0.2762 0.0650  0.2002  500 HIS B CA  
4189 C C   . HIS B 275 ? 1.2719 1.3510 1.6476 -0.2833 0.0643  0.2262  500 HIS B C   
4190 O O   . HIS B 275 ? 1.1395 1.2360 1.5212 -0.2621 0.0622  0.2318  500 HIS B O   
4191 C CB  . HIS B 275 ? 1.3590 1.4116 1.7491 -0.2487 0.0577  0.2082  500 HIS B CB  
4192 C CG  . HIS B 275 ? 1.4306 1.4657 1.8231 -0.2526 0.0571  0.1886  500 HIS B CG  
4193 N ND1 . HIS B 275 ? 1.4534 1.4669 1.8411 -0.2819 0.0592  0.1884  500 HIS B ND1 
4194 C CD2 . HIS B 275 ? 1.4367 1.4712 1.8330 -0.2332 0.0539  0.1679  500 HIS B CD2 
4195 C CE1 . HIS B 275 ? 1.4767 1.4775 1.8690 -0.2797 0.0574  0.1680  500 HIS B CE1 
4196 N NE2 . HIS B 275 ? 1.4887 1.5015 1.8842 -0.2510 0.0535  0.1547  500 HIS B NE2 
4197 N N   . GLU B 276 ? 1.2196 1.2768 1.5750 -0.3147 0.0648  0.2426  501 GLU B N   
4198 C CA  . GLU B 276 ? 1.1809 1.2294 1.5162 -0.3266 0.0591  0.2714  501 GLU B CA  
4199 C C   . GLU B 276 ? 1.2026 1.2151 1.5354 -0.3206 0.0444  0.3044  501 GLU B C   
4200 O O   . GLU B 276 ? 1.3108 1.2962 1.6237 -0.3476 0.0385  0.3246  501 GLU B O   
4201 C CB  . GLU B 276 ? 1.1615 1.2085 1.4696 -0.3686 0.0685  0.2693  501 GLU B CB  
4202 C CG  . GLU B 276 ? 1.1096 1.1925 1.4264 -0.3745 0.0857  0.2391  501 GLU B CG  
4203 C CD  . GLU B 276 ? 1.1215 1.2026 1.4067 -0.4127 0.0982  0.2397  501 GLU B CD  
4204 O OE1 . GLU B 276 ? 1.1285 1.1814 1.3826 -0.4459 0.0992  0.2524  501 GLU B OE1 
4205 O OE2 . GLU B 276 ? 1.0706 1.1771 1.3607 -0.4100 0.1083  0.2263  501 GLU B OE2 
4206 N N   . THR B 277 ? 1.1943 1.2062 1.5490 -0.2848 0.0393  0.3102  502 THR B N   
4207 C CA  . THR B 277 ? 1.2255 1.2052 1.5911 -0.2723 0.0289  0.3375  502 THR B CA  
4208 C C   . THR B 277 ? 1.2008 1.1789 1.5675 -0.2718 0.0156  0.3727  502 THR B C   
4209 O O   . THR B 277 ? 1.1397 1.1438 1.5115 -0.2585 0.0163  0.3720  502 THR B O   
4210 C CB  . THR B 277 ? 1.2502 1.2276 1.6384 -0.2353 0.0344  0.3231  502 THR B CB  
4211 O OG1 . THR B 277 ? 1.3403 1.2796 1.7399 -0.2296 0.0306  0.3390  502 THR B OG1 
4212 C CG2 . THR B 277 ? 1.2602 1.2595 1.6635 -0.2036 0.0352  0.3280  502 THR B CG2 
4213 N N   . SER B 278 ? 1.2353 1.1825 1.5988 -0.2876 0.0017  0.4044  503 SER B N   
4214 C CA  . SER B 278 ? 1.2024 1.1453 1.5700 -0.2904 -0.0164 0.4421  503 SER B CA  
4215 C C   . SER B 278 ? 1.1468 1.0830 1.5591 -0.2535 -0.0216 0.4618  503 SER B C   
4216 O O   . SER B 278 ? 1.1374 1.0526 1.5709 -0.2367 -0.0161 0.4590  503 SER B O   
4217 C CB  . SER B 278 ? 1.2459 1.1585 1.5878 -0.3280 -0.0325 0.4702  503 SER B CB  
4218 O OG  . SER B 278 ? 1.2757 1.1973 1.5724 -0.3641 -0.0278 0.4584  503 SER B OG  
4219 N N   . ILE B 279 ? 1.1285 1.0819 1.5562 -0.2419 -0.0301 0.4806  504 ILE B N   
4220 C CA  . ILE B 279 ? 1.1134 1.0657 1.5888 -0.2063 -0.0312 0.4986  504 ILE B CA  
4221 C C   . ILE B 279 ? 1.1342 1.0897 1.6290 -0.2109 -0.0534 0.5387  504 ILE B C   
4222 O O   . ILE B 279 ? 1.1292 1.0898 1.5929 -0.2417 -0.0684 0.5499  504 ILE B O   
4223 C CB  . ILE B 279 ? 1.0508 1.0297 1.5378 -0.1734 -0.0113 0.4711  504 ILE B CB  
4224 C CG1 . ILE B 279 ? 0.9898 1.0017 1.4611 -0.1796 -0.0127 0.4657  504 ILE B CG1 
4225 C CG2 . ILE B 279 ? 1.0390 1.0139 1.5096 -0.1679 0.0064  0.4331  504 ILE B CG2 
4226 C CD1 . ILE B 279 ? 0.9567 0.9924 1.4431 -0.1466 0.0031  0.4470  504 ILE B CD1 
4227 N N   . ASP B 280 ? 1.1526 1.1045 1.7001 -0.1806 -0.0543 0.5592  505 ASP B N   
4228 C CA  . ASP B 280 ? 1.1700 1.1288 1.7518 -0.1787 -0.0754 0.5983  505 ASP B CA  
4229 C C   . ASP B 280 ? 1.0990 1.0928 1.6787 -0.1688 -0.0693 0.5882  505 ASP B C   
4230 O O   . ASP B 280 ? 1.0836 1.0919 1.6911 -0.1355 -0.0500 0.5756  505 ASP B O   
4231 C CB  . ASP B 280 ? 1.2184 1.1621 1.8673 -0.1473 -0.0735 0.6213  505 ASP B CB  
4232 C CG  . ASP B 280 ? 1.2552 1.2069 1.9518 -0.1457 -0.0980 0.6656  505 ASP B CG  
4233 O OD1 . ASP B 280 ? 1.2861 1.2415 1.9584 -0.1775 -0.1259 0.6874  505 ASP B OD1 
4234 O OD2 . ASP B 280 ? 1.2545 1.2075 2.0145 -0.1132 -0.0889 0.6786  505 ASP B OD2 
4235 N N   . ILE B 281 ? 1.1025 1.1066 1.6466 -0.1995 -0.0852 0.5942  506 ILE B N   
4236 C CA  . ILE B 281 ? 1.0410 1.0757 1.5786 -0.1957 -0.0812 0.5845  506 ILE B CA  
4237 C C   . ILE B 281 ? 1.0490 1.0956 1.6431 -0.1744 -0.0917 0.6158  506 ILE B C   
4238 O O   . ILE B 281 ? 1.0231 1.0932 1.6347 -0.1515 -0.0775 0.6050  506 ILE B O   
4239 C CB  . ILE B 281 ? 1.0277 1.0633 1.5111 -0.2383 -0.0961 0.5847  506 ILE B CB  
4240 C CG1 . ILE B 281 ? 1.0446 1.0675 1.4748 -0.2643 -0.0847 0.5564  506 ILE B CG1 
4241 C CG2 . ILE B 281 ? 0.9657 1.0291 1.4419 -0.2355 -0.0903 0.5718  506 ILE B CG2 
4242 C CD1 . ILE B 281 ? 1.0055 1.0436 1.4320 -0.2440 -0.0551 0.5134  506 ILE B CD1 
4243 N N   . SER B 282 ? 1.0968 1.1276 1.7219 -0.1829 -0.1173 0.6559  507 SER B N   
4244 C CA  . SER B 282 ? 1.0962 1.1386 1.7886 -0.1620 -0.1281 0.6889  507 SER B CA  
4245 C C   . SER B 282 ? 1.0774 1.1355 1.8131 -0.1180 -0.0967 0.6729  507 SER B C   
4246 O O   . SER B 282 ? 1.1656 1.2460 1.9364 -0.1034 -0.0959 0.6841  507 SER B O   
4247 C CB  . SER B 282 ? 1.1521 1.1711 1.8888 -0.1644 -0.1510 0.7285  507 SER B CB  
4248 O OG  . SER B 282 ? 1.3336 1.3343 2.0264 -0.2070 -0.1824 0.7475  507 SER B OG  
4249 N N   . ALA B 283 ? 1.0706 1.1150 1.8016 -0.0987 -0.0712 0.6472  508 ALA B N   
4250 C CA  . ALA B 283 ? 1.0574 1.1096 1.8176 -0.0591 -0.0389 0.6289  508 ALA B CA  
4251 C C   . ALA B 283 ? 1.0735 1.1535 1.8103 -0.0491 -0.0225 0.6041  508 ALA B C   
4252 O O   . ALA B 283 ? 1.1099 1.1977 1.8720 -0.0180 0.0012  0.5961  508 ALA B O   
4253 C CB  . ALA B 283 ? 1.0742 1.1020 1.8168 -0.0484 -0.0180 0.6018  508 ALA B CB  
4254 N N   . TYR B 284 ? 1.0714 1.1633 1.7585 -0.0751 -0.0325 0.5905  509 TYR B N   
4255 C CA  . TYR B 284 ? 1.0015 1.1174 1.6664 -0.0673 -0.0183 0.5663  509 TYR B CA  
4256 C C   . TYR B 284 ? 1.0201 1.1568 1.6960 -0.0785 -0.0342 0.5858  509 TYR B C   
4257 O O   . TYR B 284 ? 1.0643 1.2194 1.7215 -0.0767 -0.0259 0.5685  509 TYR B O   
4258 C CB  . TYR B 284 ? 1.0060 1.1205 1.6130 -0.0864 -0.0138 0.5325  509 TYR B CB  
4259 C CG  . TYR B 284 ? 1.0542 1.1513 1.6492 -0.0746 0.0027  0.5088  509 TYR B CG  
4260 C CD1 . TYR B 284 ? 1.0941 1.1655 1.6830 -0.0901 -0.0054 0.5145  509 TYR B CD1 
4261 C CD2 . TYR B 284 ? 1.0812 1.1857 1.6680 -0.0500 0.0250  0.4809  509 TYR B CD2 
4262 C CE1 . TYR B 284 ? 1.1091 1.1628 1.6864 -0.0811 0.0093  0.4912  509 TYR B CE1 
4263 C CE2 . TYR B 284 ? 1.0756 1.1625 1.6472 -0.0419 0.0379  0.4578  509 TYR B CE2 
4264 C CZ  . TYR B 284 ? 1.0751 1.1369 1.6433 -0.0574 0.0305  0.4622  509 TYR B CZ  
4265 O OH  . TYR B 284 ? 1.0870 1.1295 1.6410 -0.0506 0.0430  0.4386  509 TYR B OH  
4266 N N   . ILE B 285 ? 1.0512 1.1843 1.7612 -0.0894 -0.0580 0.6228  510 ILE B N   
4267 C CA  . ILE B 285 ? 1.0981 1.2418 1.7992 -0.1163 -0.0828 0.6405  510 ILE B CA  
4268 C C   . ILE B 285 ? 1.0922 1.2428 1.8615 -0.1074 -0.1001 0.6823  510 ILE B C   
4269 O O   . ILE B 285 ? 1.0826 1.2211 1.8968 -0.0950 -0.1037 0.7038  510 ILE B O   
4270 C CB  . ILE B 285 ? 1.2475 1.3717 1.8925 -0.1580 -0.1033 0.6390  510 ILE B CB  
4271 C CG1 . ILE B 285 ? 1.3187 1.4462 1.9030 -0.1701 -0.0857 0.5973  510 ILE B CG1 
4272 C CG2 . ILE B 285 ? 1.2881 1.4102 1.9252 -0.1918 -0.1376 0.6688  510 ILE B CG2 
4273 C CD1 . ILE B 285 ? 1.3135 1.4623 1.8829 -0.1737 -0.0805 0.5829  510 ILE B CD1 
4274 N N   . ASP B 286 ? 1.1165 1.2873 1.8996 -0.1113 -0.1085 0.6927  511 ASP B N   
4275 C CA  . ASP B 286 ? 1.1741 1.3547 2.0209 -0.1110 -0.1313 0.7342  511 ASP B CA  
4276 C C   . ASP B 286 ? 1.1202 1.3090 1.9376 -0.1442 -0.1568 0.7413  511 ASP B C   
4277 O O   . ASP B 286 ? 1.1090 1.3181 1.9533 -0.1362 -0.1543 0.7463  511 ASP B O   
4278 C CB  . ASP B 286 ? 1.2570 1.4572 2.1714 -0.0717 -0.1067 0.7404  511 ASP B CB  
4279 C CG  . ASP B 286 ? 1.3741 1.5627 2.3263 -0.0390 -0.0813 0.7380  511 ASP B CG  
4280 O OD1 . ASP B 286 ? 1.3256 1.5037 2.2356 -0.0270 -0.0550 0.7034  511 ASP B OD1 
4281 O OD2 . ASP B 286 ? 1.4656 1.6557 2.4927 -0.0255 -0.0873 0.7703  511 ASP B OD2 
4282 N N   . PRO B 287 ? 1.1119 1.2824 1.8719 -0.1834 -0.1811 0.7420  512 PRO B N   
4283 C CA  . PRO B 287 ? 1.1354 1.3088 1.8554 -0.2174 -0.2011 0.7422  512 PRO B CA  
4284 C C   . PRO B 287 ? 1.1134 1.3034 1.8916 -0.2181 -0.2252 0.7776  512 PRO B C   
4285 O O   . PRO B 287 ? 1.0821 1.2832 1.8457 -0.2291 -0.2270 0.7698  512 PRO B O   
4286 C CB  . PRO B 287 ? 1.1791 1.3246 1.8383 -0.2604 -0.2275 0.7489  512 PRO B CB  
4287 C CG  . PRO B 287 ? 1.1680 1.2977 1.8335 -0.2468 -0.2175 0.7474  512 PRO B CG  
4288 C CD  . PRO B 287 ? 1.1194 1.2642 1.8654 -0.2010 -0.1997 0.7573  512 PRO B CD  
4289 N N   . ALA B 288 ? 1.1243 1.3158 1.9719 -0.2063 -0.2428 0.8156  513 ALA B N   
4290 C CA  . ALA B 288 ? 1.1120 1.3234 2.0362 -0.2004 -0.2633 0.8524  513 ALA B CA  
4291 C C   . ALA B 288 ? 1.1123 1.3493 2.0619 -0.1763 -0.2355 0.8364  513 ALA B C   
4292 O O   . ALA B 288 ? 1.1554 1.4036 2.1075 -0.1937 -0.2526 0.8453  513 ALA B O   
4293 C CB  . ALA B 288 ? 1.1274 1.3402 2.1364 -0.1740 -0.2659 0.8838  513 ALA B CB  
4294 N N   . ALA B 289 ? 1.0926 1.3359 2.0564 -0.1380 -0.1931 0.8124  514 ALA B N   
4295 C CA  . ALA B 289 ? 1.0475 1.3123 2.0333 -0.1120 -0.1630 0.7975  514 ALA B CA  
4296 C C   . ALA B 289 ? 1.0988 1.3633 2.0128 -0.1265 -0.1528 0.7624  514 ALA B C   
4297 O O   . ALA B 289 ? 1.0989 1.3797 2.0276 -0.1180 -0.1417 0.7580  514 ALA B O   
4298 C CB  . ALA B 289 ? 1.0101 1.2769 2.0267 -0.0689 -0.1221 0.7841  514 ALA B CB  
4299 N N   . PHE B 290 ? 1.1747 1.4202 2.0160 -0.1471 -0.1541 0.7375  515 PHE B N   
4300 C CA  . PHE B 290 ? 1.1849 1.4274 1.9587 -0.1623 -0.1428 0.7015  515 PHE B CA  
4301 C C   . PHE B 290 ? 1.2580 1.5015 2.0132 -0.1958 -0.1671 0.7091  515 PHE B C   
4302 O O   . PHE B 290 ? 1.2523 1.5041 1.9940 -0.1931 -0.1524 0.6891  515 PHE B O   
4303 C CB  . PHE B 290 ? 1.1598 1.3810 1.8705 -0.1798 -0.1408 0.6788  515 PHE B CB  
4304 C CG  . PHE B 290 ? 1.1059 1.3227 1.7514 -0.1971 -0.1277 0.6411  515 PHE B CG  
4305 C CD1 . PHE B 290 ? 1.0235 1.2509 1.6628 -0.1711 -0.0956 0.6095  515 PHE B CD1 
4306 C CD2 . PHE B 290 ? 1.1312 1.3307 1.7201 -0.2405 -0.1470 0.6371  515 PHE B CD2 
4307 C CE1 . PHE B 290 ? 1.0327 1.2571 1.6218 -0.1858 -0.0835 0.5756  515 PHE B CE1 
4308 C CE2 . PHE B 290 ? 1.1188 1.3134 1.6526 -0.2560 -0.1303 0.6003  515 PHE B CE2 
4309 C CZ  . PHE B 290 ? 1.0410 1.2494 1.5799 -0.2275 -0.0986 0.5698  515 PHE B CZ  
4310 N N   . ASN B 291 ? 1.2913 1.5238 2.0456 -0.2274 -0.2052 0.7386  516 ASN B N   
4311 C CA  . ASN B 291 ? 1.3329 1.5588 2.0590 -0.2680 -0.2360 0.7486  516 ASN B CA  
4312 C C   . ASN B 291 ? 1.2834 1.4874 1.9174 -0.3008 -0.2308 0.7141  516 ASN B C   
4313 O O   . ASN B 291 ? 1.2292 1.4103 1.8144 -0.3340 -0.2515 0.7194  516 ASN B O   
4314 C CB  . ASN B 291 ? 1.3946 1.6414 2.1648 -0.2584 -0.2341 0.7557  516 ASN B CB  
4315 C CG  . ASN B 291 ? 1.4104 1.6788 2.2763 -0.2344 -0.2441 0.7954  516 ASN B CG  
4316 O OD1 . ASN B 291 ? 1.4256 1.7105 2.3342 -0.2328 -0.2500 0.8095  516 ASN B OD1 
4317 N ND2 . ASN B 291 ? 1.4393 1.7073 2.3428 -0.2161 -0.2443 0.8131  516 ASN B ND2 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   SER 1   84  ?   ?   ?   A . n 
A 1 2   ALA 2   85  ?   ?   ?   A . n 
A 1 3   PRO 3   86  ?   ?   ?   A . n 
A 1 4   GLY 4   87  ?   ?   ?   A . n 
A 1 5   PRO 5   88  88  PRO PRO A . n 
A 1 6   SER 6   89  89  SER SER A . n 
A 1 7   ARG 7   90  90  ARG ARG A . n 
A 1 8   ILE 8   91  91  ILE ILE A . n 
A 1 9   ALA 9   92  92  ALA ALA A . n 
A 1 10  ASP 10  93  93  ASP ASP A . n 
A 1 11  TYR 11  94  94  TYR TYR A . n 
A 1 12  LEU 12  95  95  LEU LEU A . n 
A 1 13  LEU 13  96  96  LEU LEU A . n 
A 1 14  LEU 14  97  97  LEU LEU A . n 
A 1 15  PRO 15  98  98  PRO PRO A . n 
A 1 16  LEU 16  99  99  LEU LEU A . n 
A 1 17  ALA 17  100 100 ALA ALA A . n 
A 1 18  GLU 18  101 101 GLU GLU A . n 
A 1 19  ARG 19  102 102 ARG ARG A . n 
A 1 20  GLU 20  103 103 GLU GLU A . n 
A 1 21  HIS 21  104 104 HIS HIS A . n 
A 1 22  VAL 22  105 105 VAL VAL A . n 
A 1 23  SER 23  106 106 SER SER A . n 
A 1 24  ARG 24  107 107 ARG ARG A . n 
A 1 25  ALA 25  108 108 ALA ALA A . n 
A 1 26  LEU 26  109 109 LEU LEU A . n 
A 1 27  CYS 27  110 110 CYS CYS A . n 
A 1 28  ILE 28  111 111 ILE ILE A . n 
A 1 29  HIS 29  112 112 HIS HIS A . n 
A 1 30  THR 30  113 113 THR THR A . n 
A 1 31  GLY 31  114 114 GLY GLY A . n 
A 1 32  ARG 32  115 115 ARG ARG A . n 
A 1 33  GLU 33  116 116 GLU GLU A . n 
A 1 34  LEU 34  117 117 LEU LEU A . n 
A 1 35  ARG 35  118 118 ARG ARG A . n 
A 1 36  CYS 36  119 119 CYS CYS A . n 
A 1 37  LYS 37  120 120 LYS LYS A . n 
A 1 38  VAL 38  121 121 VAL VAL A . n 
A 1 39  PHE 39  122 122 PHE PHE A . n 
A 1 40  PRO 40  123 123 PRO PRO A . n 
A 1 41  ILE 41  124 124 ILE ILE A . n 
A 1 42  LYS 42  125 125 LYS LYS A . n 
A 1 43  HIS 43  126 126 HIS HIS A . n 
A 1 44  TYR 44  127 127 TYR TYR A . n 
A 1 45  GLN 45  128 128 GLN GLN A . n 
A 1 46  ASP 46  129 129 ASP ASP A . n 
A 1 47  LYS 47  130 130 LYS LYS A . n 
A 1 48  ILE 48  131 131 ILE ILE A . n 
A 1 49  ARG 49  132 132 ARG ARG A . n 
A 1 50  PRO 50  133 133 PRO PRO A . n 
A 1 51  TYR 51  134 134 TYR TYR A . n 
A 1 52  ILE 52  135 135 ILE ILE A . n 
A 1 53  GLN 53  136 136 GLN GLN A . n 
A 1 54  LEU 54  137 137 LEU LEU A . n 
A 1 55  PRO 55  138 138 PRO PRO A . n 
A 1 56  SER 56  139 139 SER SER A . n 
A 1 57  HIS 57  140 140 HIS HIS A . n 
A 1 58  SER 58  141 141 SER SER A . n 
A 1 59  ASN 59  142 142 ASN ASN A . n 
A 1 60  ILE 60  143 143 ILE ILE A . n 
A 1 61  THR 61  144 144 THR THR A . n 
A 1 62  GLY 62  145 145 GLY GLY A . n 
A 1 63  ILE 63  146 146 ILE ILE A . n 
A 1 64  VAL 64  147 147 VAL VAL A . n 
A 1 65  GLU 65  148 148 GLU GLU A . n 
A 1 66  VAL 66  149 149 VAL VAL A . n 
A 1 67  ILE 67  150 150 ILE ILE A . n 
A 1 68  LEU 68  151 151 LEU LEU A . n 
A 1 69  GLY 69  152 152 GLY GLY A . n 
A 1 70  GLU 70  153 153 GLU GLU A . n 
A 1 71  THR 71  154 154 THR THR A . n 
A 1 72  LYS 72  155 155 LYS LYS A . n 
A 1 73  ALA 73  156 156 ALA ALA A . n 
A 1 74  TYR 74  157 157 TYR TYR A . n 
A 1 75  VAL 75  158 158 VAL VAL A . n 
A 1 76  PHE 76  159 159 PHE PHE A . n 
A 1 77  PHE 77  160 160 PHE PHE A . n 
A 1 78  GLU 78  161 161 GLU GLU A . n 
A 1 79  LYS 79  162 162 LYS LYS A . n 
A 1 80  ASP 80  163 163 ASP ASP A . n 
A 1 81  PHE 81  164 164 PHE PHE A . n 
A 1 82  GLY 82  165 165 GLY GLY A . n 
A 1 83  ASP 83  166 166 ASP ASP A . n 
A 1 84  MET 84  167 167 MET MET A . n 
A 1 85  HIS 85  168 168 HIS HIS A . n 
A 1 86  SER 86  169 169 SER SER A . n 
A 1 87  TYR 87  170 170 TYR TYR A . n 
A 1 88  VAL 88  171 171 VAL VAL A . n 
A 1 89  ARG 89  172 172 ARG ARG A . n 
A 1 90  SER 90  173 173 SER SER A . n 
A 1 91  ARG 91  174 174 ARG ARG A . n 
A 1 92  LYS 92  175 175 LYS LYS A . n 
A 1 93  ARG 93  176 176 ARG ARG A . n 
A 1 94  LEU 94  177 177 LEU LEU A . n 
A 1 95  ARG 95  178 178 ARG ARG A . n 
A 1 96  GLU 96  179 179 GLU GLU A . n 
A 1 97  GLU 97  180 180 GLU GLU A . n 
A 1 98  GLU 98  181 181 GLU GLU A . n 
A 1 99  ALA 99  182 182 ALA ALA A . n 
A 1 100 ALA 100 183 183 ALA ALA A . n 
A 1 101 ARG 101 184 184 ARG ARG A . n 
A 1 102 LEU 102 185 185 LEU LEU A . n 
A 1 103 PHE 103 186 186 PHE PHE A . n 
A 1 104 LYS 104 187 187 LYS LYS A . n 
A 1 105 GLN 105 188 188 GLN GLN A . n 
A 1 106 ILE 106 189 189 ILE ILE A . n 
A 1 107 VAL 107 190 190 VAL VAL A . n 
A 1 108 SER 108 191 191 SER SER A . n 
A 1 109 ALA 109 192 192 ALA ALA A . n 
A 1 110 VAL 110 193 193 VAL VAL A . n 
A 1 111 ALA 111 194 194 ALA ALA A . n 
A 1 112 HIS 112 195 195 HIS HIS A . n 
A 1 113 CYS 113 196 196 CYS CYS A . n 
A 1 114 HIS 114 197 197 HIS HIS A . n 
A 1 115 GLN 115 198 198 GLN GLN A . n 
A 1 116 SER 116 199 199 SER SER A . n 
A 1 117 ALA 117 200 200 ALA ALA A . n 
A 1 118 ILE 118 201 201 ILE ILE A . n 
A 1 119 VAL 119 202 202 VAL VAL A . n 
A 1 120 LEU 120 203 203 LEU LEU A . n 
A 1 121 GLY 121 204 204 GLY GLY A . n 
A 1 122 ASP 122 205 205 ASP ASP A . n 
A 1 123 LEU 123 206 206 LEU LEU A . n 
A 1 124 LYS 124 207 207 LYS LYS A . n 
A 1 125 LEU 125 208 208 LEU LEU A . n 
A 1 126 ARG 126 209 209 ARG ARG A . n 
A 1 127 LYS 127 210 210 LYS LYS A . n 
A 1 128 PHE 128 211 211 PHE PHE A . n 
A 1 129 VAL 129 212 212 VAL VAL A . n 
A 1 130 PHE 130 213 213 PHE PHE A . n 
A 1 131 SER 131 214 214 SER SER A . n 
A 1 132 THR 132 215 215 THR THR A . n 
A 1 133 GLU 133 216 216 GLU GLU A . n 
A 1 134 GLU 134 217 217 GLU GLU A . n 
A 1 135 ARG 135 218 218 ARG ARG A . n 
A 1 136 THR 136 219 219 THR THR A . n 
A 1 137 GLN 137 220 220 GLN GLN A . n 
A 1 138 LEU 138 221 221 LEU LEU A . n 
A 1 139 ARG 139 222 222 ARG ARG A . n 
A 1 140 LEU 140 223 223 LEU LEU A . n 
A 1 141 GLU 141 224 224 GLU GLU A . n 
A 1 142 SER 142 225 225 SER SER A . n 
A 1 143 LEU 143 226 226 LEU LEU A . n 
A 1 144 GLU 144 227 227 GLU GLU A . n 
A 1 145 ASP 145 228 228 ASP ASP A . n 
A 1 146 THR 146 229 229 THR THR A . n 
A 1 147 HIS 147 230 230 HIS HIS A . n 
A 1 148 ILE 148 231 231 ILE ILE A . n 
A 1 149 MET 149 232 232 MET MET A . n 
A 1 150 LYS 150 233 233 LYS LYS A . n 
A 1 151 GLY 151 234 234 GLY GLY A . n 
A 1 152 GLU 152 235 235 GLU GLU A . n 
A 1 153 ASP 153 236 236 ASP ASP A . n 
A 1 154 ASP 154 237 237 ASP ASP A . n 
A 1 155 ALA 155 238 238 ALA ALA A . n 
A 1 156 LEU 156 239 239 LEU LEU A . n 
A 1 157 SER 157 240 240 SER SER A . n 
A 1 158 ASP 158 241 241 ASP ASP A . n 
A 1 159 LYS 159 242 242 LYS LYS A . n 
A 1 160 HIS 160 243 243 HIS HIS A . n 
A 1 161 GLY 161 244 244 GLY GLY A . n 
A 1 162 CYS 162 245 245 CYS CYS A . n 
A 1 163 PRO 163 246 246 PRO PRO A . n 
A 1 164 ALA 164 247 247 ALA ALA A . n 
A 1 165 TYR 165 248 248 TYR TYR A . n 
A 1 166 VAL 166 249 249 VAL VAL A . n 
A 1 167 SER 167 250 250 SER SER A . n 
A 1 168 PRO 168 251 251 PRO PRO A . n 
A 1 169 GLU 169 252 252 GLU GLU A . n 
A 1 170 ILE 170 253 253 ILE ILE A . n 
A 1 171 LEU 171 254 254 LEU LEU A . n 
A 1 172 ASN 172 255 255 ASN ASN A . n 
A 1 173 THR 173 256 256 THR THR A . n 
A 1 174 THR 174 257 257 THR THR A . n 
A 1 175 GLY 175 258 258 GLY GLY A . n 
A 1 176 THR 176 259 259 THR THR A . n 
A 1 177 TYR 177 260 260 TYR TYR A . n 
A 1 178 SER 178 261 261 SER SER A . n 
A 1 179 GLY 179 262 262 GLY GLY A . n 
A 1 180 LYS 180 263 263 LYS LYS A . n 
A 1 181 ALA 181 264 264 ALA ALA A . n 
A 1 182 ALA 182 265 265 ALA ALA A . n 
A 1 183 ASP 183 266 266 ASP ASP A . n 
A 1 184 VAL 184 267 267 VAL VAL A . n 
A 1 185 TRP 185 268 268 TRP TRP A . n 
A 1 186 SER 186 269 269 SER SER A . n 
A 1 187 LEU 187 270 270 LEU LEU A . n 
A 1 188 GLY 188 271 271 GLY GLY A . n 
A 1 189 VAL 189 272 272 VAL VAL A . n 
A 1 190 MET 190 273 273 MET MET A . n 
A 1 191 LEU 191 274 274 LEU LEU A . n 
A 1 192 TYR 192 275 275 TYR TYR A . n 
A 1 193 THR 193 276 276 THR THR A . n 
A 1 194 LEU 194 277 277 LEU LEU A . n 
A 1 195 LEU 195 278 278 LEU LEU A . n 
A 1 196 VAL 196 279 279 VAL VAL A . n 
A 1 197 GLY 197 280 280 GLY GLY A . n 
A 1 198 ARG 198 281 281 ARG ARG A . n 
A 1 199 TYR 199 282 282 TYR TYR A . n 
A 1 200 PRO 200 283 283 PRO PRO A . n 
A 1 201 PHE 201 284 284 PHE PHE A . n 
A 1 202 HIS 202 285 285 HIS HIS A . n 
A 1 203 ASP 203 286 286 ASP ASP A . n 
A 1 204 SER 204 287 287 SER SER A . n 
A 1 205 ASP 205 288 288 ASP ASP A . n 
A 1 206 PRO 206 289 289 PRO PRO A . n 
A 1 207 SER 207 290 290 SER SER A . n 
A 1 208 ALA 208 291 291 ALA ALA A . n 
A 1 209 LEU 209 292 292 LEU LEU A . n 
A 1 210 PHE 210 293 293 PHE PHE A . n 
A 1 211 SER 211 294 294 SER SER A . n 
A 1 212 LYS 212 295 295 LYS LYS A . n 
A 1 213 ILE 213 296 296 ILE ILE A . n 
A 1 214 ARG 214 297 297 ARG ARG A . n 
A 1 215 ARG 215 298 298 ARG ARG A . n 
A 1 216 GLY 216 299 299 GLY GLY A . n 
A 1 217 GLN 217 300 300 GLN GLN A . n 
A 1 218 PHE 218 301 301 PHE PHE A . n 
A 1 219 CYS 219 302 302 CYS CYS A . n 
A 1 220 ILE 220 303 303 ILE ILE A . n 
A 1 221 PRO 221 304 304 PRO PRO A . n 
A 1 222 GLU 222 305 305 GLU GLU A . n 
A 1 223 HIS 223 306 306 HIS HIS A . n 
A 1 224 ILE 224 307 307 ILE ILE A . n 
A 1 225 SER 225 308 308 SER SER A . n 
A 1 226 PRO 226 309 309 PRO PRO A . n 
A 1 227 LYS 227 310 310 LYS LYS A . n 
A 1 228 ALA 228 311 311 ALA ALA A . n 
A 1 229 ARG 229 312 312 ARG ARG A . n 
A 1 230 CYS 230 313 313 CYS CYS A . n 
A 1 231 LEU 231 314 314 LEU LEU A . n 
A 1 232 ILE 232 315 315 ILE ILE A . n 
A 1 233 ARG 233 316 316 ARG ARG A . n 
A 1 234 SER 234 317 317 SER SER A . n 
A 1 235 LEU 235 318 318 LEU LEU A . n 
A 1 236 LEU 236 319 319 LEU LEU A . n 
A 1 237 ARG 237 320 320 ARG ARG A . n 
A 1 238 ARG 238 321 321 ARG ARG A . n 
A 1 239 GLU 239 322 322 GLU GLU A . n 
A 1 240 PRO 240 323 323 PRO PRO A . n 
A 1 241 SER 241 324 324 SER SER A . n 
A 1 242 GLU 242 325 325 GLU GLU A . n 
A 1 243 ARG 243 326 326 ARG ARG A . n 
A 1 244 LEU 244 327 327 LEU LEU A . n 
A 1 245 THR 245 328 328 THR THR A . n 
A 1 246 ALA 246 329 329 ALA ALA A . n 
A 1 247 PRO 247 330 330 PRO PRO A . n 
A 1 248 GLU 248 331 331 GLU GLU A . n 
A 1 249 ILE 249 332 332 ILE ILE A . n 
A 1 250 LEU 250 333 333 LEU LEU A . n 
A 1 251 LEU 251 334 334 LEU LEU A . n 
A 1 252 HIS 252 335 335 HIS HIS A . n 
A 1 253 PRO 253 336 336 PRO PRO A . n 
A 1 254 TRP 254 337 337 TRP TRP A . n 
A 1 255 PHE 255 338 338 PHE PHE A . n 
A 1 256 GLU 256 339 339 GLU GLU A . n 
A 1 257 SER 257 340 340 SER SER A . n 
A 1 258 VAL 258 341 341 VAL VAL A . n 
A 1 259 LEU 259 484 ?   ?   ?   A . n 
A 1 260 GLU 260 485 ?   ?   ?   A . n 
A 1 261 GLY 261 486 ?   ?   ?   A . n 
A 1 262 SER 262 487 ?   ?   ?   A . n 
A 1 263 GLY 263 488 ?   ?   ?   A . n 
A 1 264 SER 264 489 ?   ?   ?   A . n 
A 1 265 SER 265 490 ?   ?   ?   A . n 
A 1 266 GLY 266 491 ?   ?   ?   A . n 
A 1 267 GLY 267 492 ?   ?   ?   A . n 
A 1 268 PRO 268 493 ?   ?   ?   A . n 
A 1 269 GLY 269 494 ?   ?   ?   A . n 
A 1 270 GLY 270 495 ?   ?   ?   A . n 
A 1 271 GLY 271 496 ?   ?   ?   A . n 
A 1 272 ILE 272 497 ?   ?   ?   A . n 
A 1 273 CYS 273 498 ?   ?   ?   A . n 
A 1 274 GLU 274 499 499 GLU GLU A . n 
A 1 275 HIS 275 500 500 HIS HIS A . n 
A 1 276 GLU 276 501 501 GLU GLU A . n 
A 1 277 THR 277 502 502 THR THR A . n 
A 1 278 SER 278 503 503 SER SER A . n 
A 1 279 ILE 279 504 504 ILE ILE A . n 
A 1 280 ASP 280 505 505 ASP ASP A . n 
A 1 281 ILE 281 506 506 ILE ILE A . n 
A 1 282 SER 282 507 507 SER SER A . n 
A 1 283 ALA 283 508 508 ALA ALA A . n 
A 1 284 TYR 284 509 509 TYR TYR A . n 
A 1 285 ILE 285 510 ?   ?   ?   A . n 
A 1 286 ASP 286 511 ?   ?   ?   A . n 
A 1 287 PRO 287 512 ?   ?   ?   A . n 
A 1 288 ALA 288 513 ?   ?   ?   A . n 
A 1 289 ALA 289 514 ?   ?   ?   A . n 
A 1 290 PHE 290 515 ?   ?   ?   A . n 
A 1 291 ASN 291 516 ?   ?   ?   A . n 
A 1 292 ASP 292 517 ?   ?   ?   A . n 
B 1 1   SER 1   84  ?   ?   ?   B . n 
B 1 2   ALA 2   85  ?   ?   ?   B . n 
B 1 3   PRO 3   86  ?   ?   ?   B . n 
B 1 4   GLY 4   87  ?   ?   ?   B . n 
B 1 5   PRO 5   88  ?   ?   ?   B . n 
B 1 6   SER 6   89  89  SER SER B . n 
B 1 7   ARG 7   90  90  ARG ARG B . n 
B 1 8   ILE 8   91  91  ILE ILE B . n 
B 1 9   ALA 9   92  92  ALA ALA B . n 
B 1 10  ASP 10  93  93  ASP ASP B . n 
B 1 11  TYR 11  94  94  TYR TYR B . n 
B 1 12  LEU 12  95  95  LEU LEU B . n 
B 1 13  LEU 13  96  96  LEU LEU B . n 
B 1 14  LEU 14  97  97  LEU LEU B . n 
B 1 15  PRO 15  98  98  PRO PRO B . n 
B 1 16  LEU 16  99  99  LEU LEU B . n 
B 1 17  ALA 17  100 100 ALA ALA B . n 
B 1 18  GLU 18  101 ?   ?   ?   B . n 
B 1 19  ARG 19  102 ?   ?   ?   B . n 
B 1 20  GLU 20  103 103 GLU GLU B . n 
B 1 21  HIS 21  104 104 HIS HIS B . n 
B 1 22  VAL 22  105 105 VAL VAL B . n 
B 1 23  SER 23  106 106 SER SER B . n 
B 1 24  ARG 24  107 107 ARG ARG B . n 
B 1 25  ALA 25  108 108 ALA ALA B . n 
B 1 26  LEU 26  109 109 LEU LEU B . n 
B 1 27  CYS 27  110 110 CYS CYS B . n 
B 1 28  ILE 28  111 ?   ?   ?   B . n 
B 1 29  HIS 29  112 ?   ?   ?   B . n 
B 1 30  THR 30  113 113 THR THR B . n 
B 1 31  GLY 31  114 114 GLY GLY B . n 
B 1 32  ARG 32  115 115 ARG ARG B . n 
B 1 33  GLU 33  116 116 GLU GLU B . n 
B 1 34  LEU 34  117 117 LEU LEU B . n 
B 1 35  ARG 35  118 118 ARG ARG B . n 
B 1 36  CYS 36  119 119 CYS CYS B . n 
B 1 37  LYS 37  120 120 LYS LYS B . n 
B 1 38  VAL 38  121 121 VAL VAL B . n 
B 1 39  PHE 39  122 122 PHE PHE B . n 
B 1 40  PRO 40  123 123 PRO PRO B . n 
B 1 41  ILE 41  124 124 ILE ILE B . n 
B 1 42  LYS 42  125 125 LYS LYS B . n 
B 1 43  HIS 43  126 126 HIS HIS B . n 
B 1 44  TYR 44  127 127 TYR TYR B . n 
B 1 45  GLN 45  128 128 GLN GLN B . n 
B 1 46  ASP 46  129 129 ASP ASP B . n 
B 1 47  LYS 47  130 130 LYS LYS B . n 
B 1 48  ILE 48  131 131 ILE ILE B . n 
B 1 49  ARG 49  132 132 ARG ARG B . n 
B 1 50  PRO 50  133 133 PRO PRO B . n 
B 1 51  TYR 51  134 134 TYR TYR B . n 
B 1 52  ILE 52  135 135 ILE ILE B . n 
B 1 53  GLN 53  136 136 GLN GLN B . n 
B 1 54  LEU 54  137 137 LEU LEU B . n 
B 1 55  PRO 55  138 138 PRO PRO B . n 
B 1 56  SER 56  139 139 SER SER B . n 
B 1 57  HIS 57  140 140 HIS HIS B . n 
B 1 58  SER 58  141 141 SER SER B . n 
B 1 59  ASN 59  142 142 ASN ASN B . n 
B 1 60  ILE 60  143 143 ILE ILE B . n 
B 1 61  THR 61  144 144 THR THR B . n 
B 1 62  GLY 62  145 145 GLY GLY B . n 
B 1 63  ILE 63  146 146 ILE ILE B . n 
B 1 64  VAL 64  147 147 VAL VAL B . n 
B 1 65  GLU 65  148 148 GLU GLU B . n 
B 1 66  VAL 66  149 149 VAL VAL B . n 
B 1 67  ILE 67  150 150 ILE ILE B . n 
B 1 68  LEU 68  151 151 LEU LEU B . n 
B 1 69  GLY 69  152 152 GLY GLY B . n 
B 1 70  GLU 70  153 153 GLU GLU B . n 
B 1 71  THR 71  154 154 THR THR B . n 
B 1 72  LYS 72  155 155 LYS LYS B . n 
B 1 73  ALA 73  156 156 ALA ALA B . n 
B 1 74  TYR 74  157 157 TYR TYR B . n 
B 1 75  VAL 75  158 158 VAL VAL B . n 
B 1 76  PHE 76  159 159 PHE PHE B . n 
B 1 77  PHE 77  160 160 PHE PHE B . n 
B 1 78  GLU 78  161 161 GLU GLU B . n 
B 1 79  LYS 79  162 162 LYS LYS B . n 
B 1 80  ASP 80  163 163 ASP ASP B . n 
B 1 81  PHE 81  164 164 PHE PHE B . n 
B 1 82  GLY 82  165 165 GLY GLY B . n 
B 1 83  ASP 83  166 166 ASP ASP B . n 
B 1 84  MET 84  167 167 MET MET B . n 
B 1 85  HIS 85  168 168 HIS HIS B . n 
B 1 86  SER 86  169 169 SER SER B . n 
B 1 87  TYR 87  170 170 TYR TYR B . n 
B 1 88  VAL 88  171 171 VAL VAL B . n 
B 1 89  ARG 89  172 172 ARG ARG B . n 
B 1 90  SER 90  173 173 SER SER B . n 
B 1 91  ARG 91  174 174 ARG ARG B . n 
B 1 92  LYS 92  175 175 LYS LYS B . n 
B 1 93  ARG 93  176 176 ARG ARG B . n 
B 1 94  LEU 94  177 177 LEU LEU B . n 
B 1 95  ARG 95  178 178 ARG ARG B . n 
B 1 96  GLU 96  179 179 GLU GLU B . n 
B 1 97  GLU 97  180 180 GLU GLU B . n 
B 1 98  GLU 98  181 181 GLU GLU B . n 
B 1 99  ALA 99  182 182 ALA ALA B . n 
B 1 100 ALA 100 183 183 ALA ALA B . n 
B 1 101 ARG 101 184 184 ARG ARG B . n 
B 1 102 LEU 102 185 185 LEU LEU B . n 
B 1 103 PHE 103 186 186 PHE PHE B . n 
B 1 104 LYS 104 187 187 LYS LYS B . n 
B 1 105 GLN 105 188 188 GLN GLN B . n 
B 1 106 ILE 106 189 189 ILE ILE B . n 
B 1 107 VAL 107 190 190 VAL VAL B . n 
B 1 108 SER 108 191 191 SER SER B . n 
B 1 109 ALA 109 192 192 ALA ALA B . n 
B 1 110 VAL 110 193 193 VAL VAL B . n 
B 1 111 ALA 111 194 194 ALA ALA B . n 
B 1 112 HIS 112 195 195 HIS HIS B . n 
B 1 113 CYS 113 196 196 CYS CYS B . n 
B 1 114 HIS 114 197 197 HIS HIS B . n 
B 1 115 GLN 115 198 198 GLN GLN B . n 
B 1 116 SER 116 199 199 SER SER B . n 
B 1 117 ALA 117 200 200 ALA ALA B . n 
B 1 118 ILE 118 201 201 ILE ILE B . n 
B 1 119 VAL 119 202 202 VAL VAL B . n 
B 1 120 LEU 120 203 203 LEU LEU B . n 
B 1 121 GLY 121 204 204 GLY GLY B . n 
B 1 122 ASP 122 205 205 ASP ASP B . n 
B 1 123 LEU 123 206 206 LEU LEU B . n 
B 1 124 LYS 124 207 207 LYS LYS B . n 
B 1 125 LEU 125 208 208 LEU LEU B . n 
B 1 126 ARG 126 209 209 ARG ARG B . n 
B 1 127 LYS 127 210 210 LYS LYS B . n 
B 1 128 PHE 128 211 211 PHE PHE B . n 
B 1 129 VAL 129 212 212 VAL VAL B . n 
B 1 130 PHE 130 213 213 PHE PHE B . n 
B 1 131 SER 131 214 214 SER SER B . n 
B 1 132 THR 132 215 215 THR THR B . n 
B 1 133 GLU 133 216 216 GLU GLU B . n 
B 1 134 GLU 134 217 217 GLU GLU B . n 
B 1 135 ARG 135 218 218 ARG ARG B . n 
B 1 136 THR 136 219 219 THR THR B . n 
B 1 137 GLN 137 220 220 GLN GLN B . n 
B 1 138 LEU 138 221 221 LEU LEU B . n 
B 1 139 ARG 139 222 222 ARG ARG B . n 
B 1 140 LEU 140 223 223 LEU LEU B . n 
B 1 141 GLU 141 224 224 GLU GLU B . n 
B 1 142 SER 142 225 225 SER SER B . n 
B 1 143 LEU 143 226 226 LEU LEU B . n 
B 1 144 GLU 144 227 227 GLU GLU B . n 
B 1 145 ASP 145 228 228 ASP ASP B . n 
B 1 146 THR 146 229 229 THR THR B . n 
B 1 147 HIS 147 230 230 HIS HIS B . n 
B 1 148 ILE 148 231 231 ILE ILE B . n 
B 1 149 MET 149 232 232 MET MET B . n 
B 1 150 LYS 150 233 233 LYS LYS B . n 
B 1 151 GLY 151 234 234 GLY GLY B . n 
B 1 152 GLU 152 235 235 GLU GLU B . n 
B 1 153 ASP 153 236 236 ASP ASP B . n 
B 1 154 ASP 154 237 237 ASP ASP B . n 
B 1 155 ALA 155 238 238 ALA ALA B . n 
B 1 156 LEU 156 239 239 LEU LEU B . n 
B 1 157 SER 157 240 240 SER SER B . n 
B 1 158 ASP 158 241 241 ASP ASP B . n 
B 1 159 LYS 159 242 242 LYS LYS B . n 
B 1 160 HIS 160 243 243 HIS HIS B . n 
B 1 161 GLY 161 244 244 GLY GLY B . n 
B 1 162 CYS 162 245 245 CYS CYS B . n 
B 1 163 PRO 163 246 246 PRO PRO B . n 
B 1 164 ALA 164 247 247 ALA ALA B . n 
B 1 165 TYR 165 248 248 TYR TYR B . n 
B 1 166 VAL 166 249 249 VAL VAL B . n 
B 1 167 SER 167 250 250 SER SER B . n 
B 1 168 PRO 168 251 251 PRO PRO B . n 
B 1 169 GLU 169 252 252 GLU GLU B . n 
B 1 170 ILE 170 253 253 ILE ILE B . n 
B 1 171 LEU 171 254 254 LEU LEU B . n 
B 1 172 ASN 172 255 255 ASN ASN B . n 
B 1 173 THR 173 256 256 THR THR B . n 
B 1 174 THR 174 257 257 THR THR B . n 
B 1 175 GLY 175 258 258 GLY GLY B . n 
B 1 176 THR 176 259 259 THR THR B . n 
B 1 177 TYR 177 260 260 TYR TYR B . n 
B 1 178 SER 178 261 261 SER SER B . n 
B 1 179 GLY 179 262 262 GLY GLY B . n 
B 1 180 LYS 180 263 263 LYS LYS B . n 
B 1 181 ALA 181 264 264 ALA ALA B . n 
B 1 182 ALA 182 265 265 ALA ALA B . n 
B 1 183 ASP 183 266 266 ASP ASP B . n 
B 1 184 VAL 184 267 267 VAL VAL B . n 
B 1 185 TRP 185 268 268 TRP TRP B . n 
B 1 186 SER 186 269 269 SER SER B . n 
B 1 187 LEU 187 270 270 LEU LEU B . n 
B 1 188 GLY 188 271 271 GLY GLY B . n 
B 1 189 VAL 189 272 272 VAL VAL B . n 
B 1 190 MET 190 273 273 MET MET B . n 
B 1 191 LEU 191 274 274 LEU LEU B . n 
B 1 192 TYR 192 275 275 TYR TYR B . n 
B 1 193 THR 193 276 276 THR THR B . n 
B 1 194 LEU 194 277 277 LEU LEU B . n 
B 1 195 LEU 195 278 278 LEU LEU B . n 
B 1 196 VAL 196 279 279 VAL VAL B . n 
B 1 197 GLY 197 280 280 GLY GLY B . n 
B 1 198 ARG 198 281 281 ARG ARG B . n 
B 1 199 TYR 199 282 282 TYR TYR B . n 
B 1 200 PRO 200 283 283 PRO PRO B . n 
B 1 201 PHE 201 284 284 PHE PHE B . n 
B 1 202 HIS 202 285 285 HIS HIS B . n 
B 1 203 ASP 203 286 286 ASP ASP B . n 
B 1 204 SER 204 287 287 SER SER B . n 
B 1 205 ASP 205 288 288 ASP ASP B . n 
B 1 206 PRO 206 289 289 PRO PRO B . n 
B 1 207 SER 207 290 290 SER SER B . n 
B 1 208 ALA 208 291 291 ALA ALA B . n 
B 1 209 LEU 209 292 292 LEU LEU B . n 
B 1 210 PHE 210 293 293 PHE PHE B . n 
B 1 211 SER 211 294 294 SER SER B . n 
B 1 212 LYS 212 295 295 LYS LYS B . n 
B 1 213 ILE 213 296 296 ILE ILE B . n 
B 1 214 ARG 214 297 297 ARG ARG B . n 
B 1 215 ARG 215 298 298 ARG ARG B . n 
B 1 216 GLY 216 299 299 GLY GLY B . n 
B 1 217 GLN 217 300 300 GLN GLN B . n 
B 1 218 PHE 218 301 301 PHE PHE B . n 
B 1 219 CYS 219 302 302 CYS CYS B . n 
B 1 220 ILE 220 303 303 ILE ILE B . n 
B 1 221 PRO 221 304 304 PRO PRO B . n 
B 1 222 GLU 222 305 305 GLU GLU B . n 
B 1 223 HIS 223 306 306 HIS HIS B . n 
B 1 224 ILE 224 307 307 ILE ILE B . n 
B 1 225 SER 225 308 308 SER SER B . n 
B 1 226 PRO 226 309 309 PRO PRO B . n 
B 1 227 LYS 227 310 310 LYS LYS B . n 
B 1 228 ALA 228 311 311 ALA ALA B . n 
B 1 229 ARG 229 312 312 ARG ARG B . n 
B 1 230 CYS 230 313 313 CYS CYS B . n 
B 1 231 LEU 231 314 314 LEU LEU B . n 
B 1 232 ILE 232 315 315 ILE ILE B . n 
B 1 233 ARG 233 316 316 ARG ARG B . n 
B 1 234 SER 234 317 317 SER SER B . n 
B 1 235 LEU 235 318 318 LEU LEU B . n 
B 1 236 LEU 236 319 319 LEU LEU B . n 
B 1 237 ARG 237 320 320 ARG ARG B . n 
B 1 238 ARG 238 321 321 ARG ARG B . n 
B 1 239 GLU 239 322 322 GLU GLU B . n 
B 1 240 PRO 240 323 323 PRO PRO B . n 
B 1 241 SER 241 324 324 SER SER B . n 
B 1 242 GLU 242 325 325 GLU GLU B . n 
B 1 243 ARG 243 326 326 ARG ARG B . n 
B 1 244 LEU 244 327 327 LEU LEU B . n 
B 1 245 THR 245 328 328 THR THR B . n 
B 1 246 ALA 246 329 329 ALA ALA B . n 
B 1 247 PRO 247 330 330 PRO PRO B . n 
B 1 248 GLU 248 331 331 GLU GLU B . n 
B 1 249 ILE 249 332 332 ILE ILE B . n 
B 1 250 LEU 250 333 333 LEU LEU B . n 
B 1 251 LEU 251 334 334 LEU LEU B . n 
B 1 252 HIS 252 335 335 HIS HIS B . n 
B 1 253 PRO 253 336 336 PRO PRO B . n 
B 1 254 TRP 254 337 337 TRP TRP B . n 
B 1 255 PHE 255 338 338 PHE PHE B . n 
B 1 256 GLU 256 339 339 GLU GLU B . n 
B 1 257 SER 257 340 340 SER SER B . n 
B 1 258 VAL 258 341 341 VAL VAL B . n 
B 1 259 LEU 259 342 342 LEU LEU B . n 
B 1 260 GLU 260 485 ?   ?   ?   B . n 
B 1 261 GLY 261 486 ?   ?   ?   B . n 
B 1 262 SER 262 487 ?   ?   ?   B . n 
B 1 263 GLY 263 488 ?   ?   ?   B . n 
B 1 264 SER 264 489 ?   ?   ?   B . n 
B 1 265 SER 265 490 ?   ?   ?   B . n 
B 1 266 GLY 266 491 ?   ?   ?   B . n 
B 1 267 GLY 267 492 ?   ?   ?   B . n 
B 1 268 PRO 268 493 ?   ?   ?   B . n 
B 1 269 GLY 269 494 ?   ?   ?   B . n 
B 1 270 GLY 270 495 ?   ?   ?   B . n 
B 1 271 GLY 271 496 ?   ?   ?   B . n 
B 1 272 ILE 272 497 497 ILE ILE B . n 
B 1 273 CYS 273 498 498 CYS CYS B . n 
B 1 274 GLU 274 499 499 GLU GLU B . n 
B 1 275 HIS 275 500 500 HIS HIS B . n 
B 1 276 GLU 276 501 501 GLU GLU B . n 
B 1 277 THR 277 502 502 THR THR B . n 
B 1 278 SER 278 503 503 SER SER B . n 
B 1 279 ILE 279 504 504 ILE ILE B . n 
B 1 280 ASP 280 505 505 ASP ASP B . n 
B 1 281 ILE 281 506 506 ILE ILE B . n 
B 1 282 SER 282 507 507 SER SER B . n 
B 1 283 ALA 283 508 508 ALA ALA B . n 
B 1 284 TYR 284 509 509 TYR TYR B . n 
B 1 285 ILE 285 510 510 ILE ILE B . n 
B 1 286 ASP 286 511 511 ASP ASP B . n 
B 1 287 PRO 287 512 512 PRO PRO B . n 
B 1 288 ALA 288 513 513 ALA ALA B . n 
B 1 289 ALA 289 514 514 ALA ALA B . n 
B 1 290 PHE 290 515 515 PHE PHE B . n 
B 1 291 ASN 291 516 516 ASN ASN B . n 
B 1 292 ASP 292 517 ?   ?   ?   B . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
C 2 HOH 1  601 51 HOH HOH A . 
C 2 HOH 2  602 45 HOH HOH A . 
C 2 HOH 3  603 38 HOH HOH A . 
C 2 HOH 4  604 1  HOH HOH A . 
C 2 HOH 5  605 18 HOH HOH A . 
C 2 HOH 6  606 52 HOH HOH A . 
C 2 HOH 7  607 27 HOH HOH A . 
C 2 HOH 8  608 33 HOH HOH A . 
C 2 HOH 9  609 48 HOH HOH A . 
C 2 HOH 10 610 63 HOH HOH A . 
C 2 HOH 11 611 41 HOH HOH A . 
C 2 HOH 12 612 59 HOH HOH A . 
C 2 HOH 13 613 34 HOH HOH A . 
C 2 HOH 14 614 64 HOH HOH A . 
C 2 HOH 15 615 39 HOH HOH A . 
C 2 HOH 16 616 56 HOH HOH A . 
C 2 HOH 17 617 29 HOH HOH A . 
C 2 HOH 18 618 4  HOH HOH A . 
C 2 HOH 19 619 46 HOH HOH A . 
C 2 HOH 20 620 25 HOH HOH A . 
D 2 HOH 1  601 42 HOH HOH B . 
D 2 HOH 2  602 35 HOH HOH B . 
D 2 HOH 3  603 62 HOH HOH B . 
D 2 HOH 4  604 14 HOH HOH B . 
D 2 HOH 5  605 58 HOH HOH B . 
D 2 HOH 6  606 44 HOH HOH B . 
D 2 HOH 7  607 53 HOH HOH B . 
D 2 HOH 8  608 13 HOH HOH B . 
D 2 HOH 9  609 55 HOH HOH B . 
D 2 HOH 10 610 30 HOH HOH B . 
D 2 HOH 11 611 57 HOH HOH B . 
D 2 HOH 12 612 8  HOH HOH B . 
D 2 HOH 13 613 37 HOH HOH B . 
D 2 HOH 14 614 26 HOH HOH B . 
D 2 HOH 15 615 7  HOH HOH B . 
D 2 HOH 16 616 61 HOH HOH B . 
D 2 HOH 17 617 50 HOH HOH B . 
D 2 HOH 18 618 49 HOH HOH B . 
D 2 HOH 19 619 40 HOH HOH B . 
D 2 HOH 20 620 28 HOH HOH B . 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA 
_pdbx_struct_assembly.oligomeric_details   dimeric 
_pdbx_struct_assembly.oligomeric_count     2 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 3950  ? 
1 MORE         -18   ? 
1 'SSA (A^2)'  25150 ? 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2018-10-10 
2 'Structure model' 1 1 2020-01-01 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
_pdbx_audit_revision_details.details             ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Author supporting evidence' 
2 2 'Structure model' 'Structure summary'          
# 
loop_
_pdbx_audit_revision_category.ordinal 
_pdbx_audit_revision_category.revision_ordinal 
_pdbx_audit_revision_category.data_content_type 
_pdbx_audit_revision_category.category 
1 2 'Structure model' entity             
2 2 'Structure model' pdbx_audit_support 
# 
loop_
_pdbx_audit_revision_item.ordinal 
_pdbx_audit_revision_item.revision_ordinal 
_pdbx_audit_revision_item.data_content_type 
_pdbx_audit_revision_item.item 
1 2 'Structure model' '_entity.formula_weight'                   
2 2 'Structure model' '_pdbx_audit_support.funding_organization' 
# 
loop_
_pdbx_refine_tls.pdbx_refine_id 
_pdbx_refine_tls.id 
_pdbx_refine_tls.details 
_pdbx_refine_tls.method 
_pdbx_refine_tls.origin_x 
_pdbx_refine_tls.origin_y 
_pdbx_refine_tls.origin_z 
_pdbx_refine_tls.T[1][1] 
_pdbx_refine_tls.T[2][2] 
_pdbx_refine_tls.T[3][3] 
_pdbx_refine_tls.T[1][2] 
_pdbx_refine_tls.T[1][3] 
_pdbx_refine_tls.T[2][3] 
_pdbx_refine_tls.L[1][1] 
_pdbx_refine_tls.L[2][2] 
_pdbx_refine_tls.L[3][3] 
_pdbx_refine_tls.L[1][2] 
_pdbx_refine_tls.L[1][3] 
_pdbx_refine_tls.L[2][3] 
_pdbx_refine_tls.S[1][1] 
_pdbx_refine_tls.S[1][2] 
_pdbx_refine_tls.S[1][3] 
_pdbx_refine_tls.S[2][1] 
_pdbx_refine_tls.S[2][2] 
_pdbx_refine_tls.S[2][3] 
_pdbx_refine_tls.S[3][1] 
_pdbx_refine_tls.S[3][2] 
_pdbx_refine_tls.S[3][3] 
'X-RAY DIFFRACTION' 1 ? refined 7.8041  30.9651 184.7332 0.1725 0.2556 0.3323 -0.0752 -0.0457 0.2063 1.8370 4.2619 1.7331 -0.5991 
0.1312  -1.3428 0.1204 0.0460 0.0607 0.4067  -0.2872 0.1490  0.0847  0.0189  0.1669 
'X-RAY DIFFRACTION' 2 ? refined 23.0676 61.2422 159.3720 0.1389 0.4412 0.8130 0.1628  0.1274  0.5374 2.6676 4.8588 1.5133 1.5610  
-0.2405 -0.4649 0.2434 0.3407 0.3886 -0.5356 -0.5982 -0.4171 -0.0029 -0.0080 0.3549 
# 
loop_
_pdbx_refine_tls_group.pdbx_refine_id 
_pdbx_refine_tls_group.id 
_pdbx_refine_tls_group.refine_tls_id 
_pdbx_refine_tls_group.beg_auth_asym_id 
_pdbx_refine_tls_group.beg_auth_seq_id 
_pdbx_refine_tls_group.beg_label_asym_id 
_pdbx_refine_tls_group.beg_label_seq_id 
_pdbx_refine_tls_group.end_auth_asym_id 
_pdbx_refine_tls_group.end_auth_seq_id 
_pdbx_refine_tls_group.end_label_asym_id 
_pdbx_refine_tls_group.end_label_seq_id 
_pdbx_refine_tls_group.selection 
_pdbx_refine_tls_group.selection_details 
'X-RAY DIFFRACTION' 1 1 A 88 ? ? A 509 ? ? ? ? 
'X-RAY DIFFRACTION' 2 2 B 89 ? ? B 516 ? ? ? ? 
# 
loop_
_software.citation_id 
_software.classification 
_software.compiler_name 
_software.compiler_version 
_software.contact_author 
_software.contact_author_email 
_software.date 
_software.description 
_software.dependencies 
_software.hardware 
_software.language 
_software.location 
_software.mods 
_software.name 
_software.os 
_software.os_version 
_software.type 
_software.version 
_software.pdbx_ordinal 
? refinement       ? ? ? ? ? ? ? ? ? ? ? REFMAC  ? ? ? 5.8.0135 1 
? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? XDS     ? ? ? .        2 
? 'data scaling'   ? ? ? ? ? ? ? ? ? ? ? Aimless ? ? ? .        3 
? phasing          ? ? ? ? ? ? ? ? ? ? ? PHASER  ? ? ? .        4 
# 
loop_
_pdbx_validate_rmsd_angle.id 
_pdbx_validate_rmsd_angle.PDB_model_num 
_pdbx_validate_rmsd_angle.auth_atom_id_1 
_pdbx_validate_rmsd_angle.auth_asym_id_1 
_pdbx_validate_rmsd_angle.auth_comp_id_1 
_pdbx_validate_rmsd_angle.auth_seq_id_1 
_pdbx_validate_rmsd_angle.PDB_ins_code_1 
_pdbx_validate_rmsd_angle.label_alt_id_1 
_pdbx_validate_rmsd_angle.auth_atom_id_2 
_pdbx_validate_rmsd_angle.auth_asym_id_2 
_pdbx_validate_rmsd_angle.auth_comp_id_2 
_pdbx_validate_rmsd_angle.auth_seq_id_2 
_pdbx_validate_rmsd_angle.PDB_ins_code_2 
_pdbx_validate_rmsd_angle.label_alt_id_2 
_pdbx_validate_rmsd_angle.auth_atom_id_3 
_pdbx_validate_rmsd_angle.auth_asym_id_3 
_pdbx_validate_rmsd_angle.auth_comp_id_3 
_pdbx_validate_rmsd_angle.auth_seq_id_3 
_pdbx_validate_rmsd_angle.PDB_ins_code_3 
_pdbx_validate_rmsd_angle.label_alt_id_3 
_pdbx_validate_rmsd_angle.angle_value 
_pdbx_validate_rmsd_angle.angle_target_value 
_pdbx_validate_rmsd_angle.angle_deviation 
_pdbx_validate_rmsd_angle.angle_standard_deviation 
_pdbx_validate_rmsd_angle.linker_flag 
1 1 NE A ARG 209 ? ? CZ A ARG 209 ? ? NH1 A ARG 209 ? ? 123.59 120.30 3.29 0.50 N 
2 1 NE B ARG 218 ? ? CZ B ARG 218 ? ? NH1 B ARG 218 ? ? 124.10 120.30 3.80 0.50 N 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1 ILE A 91  ? ? -114.71 -73.58  
2  1 ALA A 92  ? ? -163.39 96.24   
3  1 ALA A 100 ? ? -26.43  -62.98  
4  1 GLU A 103 ? ? -61.55  -74.83  
5  1 HIS A 112 ? ? -75.80  -76.87  
6  1 THR A 113 ? ? -68.37  -178.63 
7  1 ASP A 237 ? ? -148.70 16.72   
8  1 LEU A 319 ? ? -89.06  46.14   
9  1 GLU A 501 ? ? -101.75 68.88   
10 1 ALA A 508 ? ? -53.56  -2.19   
11 1 ILE B 91  ? ? -114.39 -73.15  
12 1 ALA B 92  ? ? -163.46 96.51   
13 1 ASP B 237 ? ? -149.41 16.87   
14 1 LEU B 319 ? ? -89.49  46.50   
15 1 GLU B 501 ? ? -103.70 69.56   
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A SER 84  ? A SER 1   
2  1 Y 1 A ALA 85  ? A ALA 2   
3  1 Y 1 A PRO 86  ? A PRO 3   
4  1 Y 1 A GLY 87  ? A GLY 4   
5  1 Y 1 A LEU 484 ? A LEU 259 
6  1 Y 1 A GLU 485 ? A GLU 260 
7  1 Y 1 A GLY 486 ? A GLY 261 
8  1 Y 1 A SER 487 ? A SER 262 
9  1 Y 1 A GLY 488 ? A GLY 263 
10 1 Y 1 A SER 489 ? A SER 264 
11 1 Y 1 A SER 490 ? A SER 265 
12 1 Y 1 A GLY 491 ? A GLY 266 
13 1 Y 1 A GLY 492 ? A GLY 267 
14 1 Y 1 A PRO 493 ? A PRO 268 
15 1 Y 1 A GLY 494 ? A GLY 269 
16 1 Y 1 A GLY 495 ? A GLY 270 
17 1 Y 1 A GLY 496 ? A GLY 271 
18 1 Y 1 A ILE 497 ? A ILE 272 
19 1 Y 1 A CYS 498 ? A CYS 273 
20 1 Y 1 A ILE 510 ? A ILE 285 
21 1 Y 1 A ASP 511 ? A ASP 286 
22 1 Y 1 A PRO 512 ? A PRO 287 
23 1 Y 1 A ALA 513 ? A ALA 288 
24 1 Y 1 A ALA 514 ? A ALA 289 
25 1 Y 1 A PHE 515 ? A PHE 290 
26 1 Y 1 A ASN 516 ? A ASN 291 
27 1 Y 1 A ASP 517 ? A ASP 292 
28 1 Y 1 B SER 84  ? B SER 1   
29 1 Y 1 B ALA 85  ? B ALA 2   
30 1 Y 1 B PRO 86  ? B PRO 3   
31 1 Y 1 B GLY 87  ? B GLY 4   
32 1 Y 1 B PRO 88  ? B PRO 5   
33 1 Y 1 B GLU 101 ? B GLU 18  
34 1 Y 1 B ARG 102 ? B ARG 19  
35 1 Y 1 B ILE 111 ? B ILE 28  
36 1 Y 1 B HIS 112 ? B HIS 29  
37 1 Y 1 B GLU 485 ? B GLU 260 
38 1 Y 1 B GLY 486 ? B GLY 261 
39 1 Y 1 B SER 487 ? B SER 262 
40 1 Y 1 B GLY 488 ? B GLY 263 
41 1 Y 1 B SER 489 ? B SER 264 
42 1 Y 1 B SER 490 ? B SER 265 
43 1 Y 1 B GLY 491 ? B GLY 266 
44 1 Y 1 B GLY 492 ? B GLY 267 
45 1 Y 1 B PRO 493 ? B PRO 268 
46 1 Y 1 B GLY 494 ? B GLY 269 
47 1 Y 1 B GLY 495 ? B GLY 270 
48 1 Y 1 B GLY 496 ? B GLY 271 
49 1 Y 1 B ASP 517 ? B ASP 292 
# 
loop_
_pdbx_audit_support.funding_organization 
_pdbx_audit_support.country 
_pdbx_audit_support.grant_number 
_pdbx_audit_support.ordinal 
'Health Research Council (HRC)' 'New Zealand' ?                                 1 
'Royal Society of New Zealand'  'New Zealand' 'Rutherford Discovery Fellowship' 2 
# 
_pdbx_entity_nonpoly.entity_id   2 
_pdbx_entity_nonpoly.name        water 
_pdbx_entity_nonpoly.comp_id     HOH 
# 
_pdbx_struct_assembly_auth_evidence.id                     1 
_pdbx_struct_assembly_auth_evidence.assembly_id            1 
_pdbx_struct_assembly_auth_evidence.experimental_support   'gel filtration' 
_pdbx_struct_assembly_auth_evidence.details                ? 
#