data_6DMY
# 
_entry.id   6DMY 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.329 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   6DMY         
WWPDB D_1000234941 
EMDB  EMD-7968     
# 
_pdbx_database_related.db_name        EMDB 
_pdbx_database_related.details        'Cryo-EM structure of human Ptch1 and ShhN complex' 
_pdbx_database_related.db_id          EMD-7968 
_pdbx_database_related.content_type   'associated EM volume' 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.entry_id                        6DMY 
_pdbx_database_status.recvd_initial_deposition_date   2018-06-05 
_pdbx_database_status.SG_entry                        N 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_nmr_data            ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
_audit_author.identifier_ORCID 
'Yan, N.'    1 ? 
'Gong, X.'   2 ? 
'Qian, H.W.' 3 ? 
# 
_citation.abstract                  ? 
_citation.abstract_id_CAS           ? 
_citation.book_id_ISBN              ? 
_citation.book_publisher            ? 
_citation.book_publisher_city       ? 
_citation.book_title                ? 
_citation.coordinate_linkage        ? 
_citation.country                   US 
_citation.database_id_Medline       ? 
_citation.details                   ? 
_citation.id                        primary 
_citation.journal_abbrev            Science 
_citation.journal_id_ASTM           SCIEAS 
_citation.journal_id_CSD            0038 
_citation.journal_id_ISSN           1095-9203 
_citation.journal_full              ? 
_citation.journal_issue             ? 
_citation.journal_volume            361 
_citation.language                  ? 
_citation.page_first                ? 
_citation.page_last                 ? 
_citation.title                     'Structural basis for the recognition of Sonic Hedgehog by human Patched1.' 
_citation.year                      2018 
_citation.database_id_CSD           ? 
_citation.pdbx_database_id_DOI      10.1126/science.aas8935 
_citation.pdbx_database_id_PubMed   29954986 
_citation.unpublished_flag          ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Gong, X.' 1 ? 
primary 'Qian, H.' 2 ? 
primary 'Cao, P.'  3 ? 
primary 'Zhao, X.' 4 ? 
primary 'Zhou, Q.' 5 ? 
primary 'Lei, J.'  6 ? 
primary 'Yan, N.'  7 ? 
# 
_cell.angle_alpha                  90.00 
_cell.angle_alpha_esd              ? 
_cell.angle_beta                   90.00 
_cell.angle_beta_esd               ? 
_cell.angle_gamma                  90.00 
_cell.angle_gamma_esd              ? 
_cell.entry_id                     6DMY 
_cell.details                      ? 
_cell.formula_units_Z              ? 
_cell.length_a                     1 
_cell.length_a_esd                 ? 
_cell.length_b                     1 
_cell.length_b_esd                 ? 
_cell.length_c                     1 
_cell.length_c_esd                 ? 
_cell.volume                       ? 
_cell.volume_esd                   ? 
_cell.Z_PDB                        1 
_cell.reciprocal_angle_alpha       ? 
_cell.reciprocal_angle_beta        ? 
_cell.reciprocal_angle_gamma       ? 
_cell.reciprocal_angle_alpha_esd   ? 
_cell.reciprocal_angle_beta_esd    ? 
_cell.reciprocal_angle_gamma_esd   ? 
_cell.reciprocal_length_a          ? 
_cell.reciprocal_length_b          ? 
_cell.reciprocal_length_c          ? 
_cell.reciprocal_length_a_esd      ? 
_cell.reciprocal_length_b_esd      ? 
_cell.reciprocal_length_c_esd      ? 
_cell.pdbx_unique_axis             ? 
# 
_symmetry.entry_id                         6DMY 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                1 
_symmetry.space_group_name_Hall            ? 
_symmetry.space_group_name_H-M             'P 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'Protein patched homolog 1'                                                               150189.578 1 ? ? ? ? 
2 polymer     man 'Sonic hedgehog protein'                                                                  19934.461  1 ? ? ? ? 
3 branched    man '2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose' 424.401    1 ? ? ? ? 
4 non-polymer man 2-acetamido-2-deoxy-beta-D-glucopyranose                                                  221.208    5 ? ? ? ? 
5 non-polymer syn 'CHOLESTEROL HEMISUCCINATE'                                                               486.726    2 ? ? ? ? 
6 non-polymer syn SERINE                                                                                    105.093    1 ? ? ? ? 
7 non-polymer syn 'ZINC ION'                                                                                65.409     1 ? ? ? ? 
8 non-polymer syn 'CALCIUM ION'                                                                             40.078     2 ? ? ? ? 
# 
loop_
_entity_name_com.entity_id 
_entity_name_com.name 
1 PTC1                                                                                         
2 'SHH,HHG-1,Shh unprocessed N-terminal signaling and C-terminal autoprocessing domains,ShhNC' 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)' no no 
;MADYKDDDDKSGPDEVDASGRMASAGNAAEPQDRGGGGSGCIGAPGRPAGGGRRRRTGGLRRAAAPDRDYLHRPSYCDAA
FALEQISKGKATGRKAPLWLRAKFQRLLFKLGCYIQKNCGKFLVVGLLIFGAFAVGLKAANLETNVEELWVEVGGRVSRE
LNYTRQKIGEEAMFNPQLMIQTPKEEGANVLTTEALLQHLDSALQASRVHVYMYNRQWKLEHLCYKSGELITETGYMDQI
IEYLYPCLIITPLDCFWEGAKLQSGTAYLLGKPPLRWTNFDPLEFLEELKKINYQVDSWEEMLNKAEVGHGYMDRPCLNP
ADPDCPATAPNKNSTKPLDMALVLNGGCHGLSRKYMHWQEELIVGGTVKNSTGKLVSAHALQTMFQLMTPKQMYEHFKGY
EYVSHINWNEDKAAAILEAWQRTYVEVVHQSVAQNSTQKVLSFTTTTLDDILKSFSDVSVIRVASGYLLMLAYACLTMLR
WDCSKSQGAVGLAGVLLVALSVAAGLGLCSLIGISFNAATTQVLPFLALGVGVDDVFLLAHAFSETGQNKRIPFEDRTGE
CLKRTGASVALTSISNVTAFFMAALIPIPALRAFSLQAAVVVVFNFAMVLLIFPAILSMDLYRREDRRLDIFCCFTSPCV
SRVIQVEPQAYTDTHDNTRYSPPPPYSSHSFAHETQITMQSTVQLRTEYDPHTHVYYTTAEPRSEISVQPVTVTQDTLSC
QSPESTSSTRDLLSQFSDSSLHCLEPPCTKWTLSSFAEKHYAPFLLKPKAKVVVIFLFLGLLGVSLYGTTRVRDGLDLTD
IVPRETREYDFIAAQFKYFSFYNMYIVTQKADYPNIQHLLYDLHRSFSNVKYVMLEENKQLPKMWLHYFRDWLQGLQDAF
DSDWETGKIMPNNYKNGSDDGVLAYKLLVQTGSRDKPIDISQLTKQRLVDADGIINPSAFYIYLTAWVSNDPVAYAASQA
NIRPHRPEWVHDKADYMPETRLRIPAAEPIEYAQFPFYLNGLRDTSDFVEAIEKVRTICSNYTSLGLSSYPNGYPFLFWE
QYIGLRHWLLLFISVVLACTFLVCAVFLLNPWTAGIIVMVLALMTVELFGMMGLIGIKLSAVPVVILIASVGIGVEFTVH
VALAFLTAIGDKNRRAVLALEHMFAPVLDGAVSTLLGVLMLAGSEFDFIVRYFFAVLAILTILGVLNGLVLLPVLLSFFG
PYPEVSPANGLNRLPTPSPEPPPSVVRFAMPPGHTHSGSDSSDSEYSSQTTVSGLSEELRHYEAQQGAGGPAHQVIVEAT
ENPVFAHSTVVHPESRHHPPSNPRQQPHLDSGSLPPGRQGQQPRRDLEGSDEVDAVEGSHHHHHHHHHH
;
;MADYKDDDDKSGPDEVDASGRMASAGNAAEPQDRGGGGSGCIGAPGRPAGGGRRRRTGGLRRAAAPDRDYLHRPSYCDAA
FALEQISKGKATGRKAPLWLRAKFQRLLFKLGCYIQKNCGKFLVVGLLIFGAFAVGLKAANLETNVEELWVEVGGRVSRE
LNYTRQKIGEEAMFNPQLMIQTPKEEGANVLTTEALLQHLDSALQASRVHVYMYNRQWKLEHLCYKSGELITETGYMDQI
IEYLYPCLIITPLDCFWEGAKLQSGTAYLLGKPPLRWTNFDPLEFLEELKKINYQVDSWEEMLNKAEVGHGYMDRPCLNP
ADPDCPATAPNKNSTKPLDMALVLNGGCHGLSRKYMHWQEELIVGGTVKNSTGKLVSAHALQTMFQLMTPKQMYEHFKGY
EYVSHINWNEDKAAAILEAWQRTYVEVVHQSVAQNSTQKVLSFTTTTLDDILKSFSDVSVIRVASGYLLMLAYACLTMLR
WDCSKSQGAVGLAGVLLVALSVAAGLGLCSLIGISFNAATTQVLPFLALGVGVDDVFLLAHAFSETGQNKRIPFEDRTGE
CLKRTGASVALTSISNVTAFFMAALIPIPALRAFSLQAAVVVVFNFAMVLLIFPAILSMDLYRREDRRLDIFCCFTSPCV
SRVIQVEPQAYTDTHDNTRYSPPPPYSSHSFAHETQITMQSTVQLRTEYDPHTHVYYTTAEPRSEISVQPVTVTQDTLSC
QSPESTSSTRDLLSQFSDSSLHCLEPPCTKWTLSSFAEKHYAPFLLKPKAKVVVIFLFLGLLGVSLYGTTRVRDGLDLTD
IVPRETREYDFIAAQFKYFSFYNMYIVTQKADYPNIQHLLYDLHRSFSNVKYVMLEENKQLPKMWLHYFRDWLQGLQDAF
DSDWETGKIMPNNYKNGSDDGVLAYKLLVQTGSRDKPIDISQLTKQRLVDADGIINPSAFYIYLTAWVSNDPVAYAASQA
NIRPHRPEWVHDKADYMPETRLRIPAAEPIEYAQFPFYLNGLRDTSDFVEAIEKVRTICSNYTSLGLSSYPNGYPFLFWE
QYIGLRHWLLLFISVVLACTFLVCAVFLLNPWTAGIIVMVLALMTVELFGMMGLIGIKLSAVPVVILIASVGIGVEFTVH
VALAFLTAIGDKNRRAVLALEHMFAPVLDGAVSTLLGVLMLAGSEFDFIVRYFFAVLAILTILGVLNGLVLLPVLLSFFG
PYPEVSPANGLNRLPTPSPEPPPSVVRFAMPPGHTHSGSDSSDSEYSSQTTVSGLSEELRHYEAQQGAGGPAHQVIVEAT
ENPVFAHSTVVHPESRHHPPSNPRQQPHLDSGSLPPGRQGQQPRRDLEGSDEVDAVEGSHHHHHHHHHH
;
A ? 
2 'polypeptide(L)' no no 
;AHMCGPGRGFGKRRHPKKLTPLAYKQFIPNVAEKTLGASGRYEGKISRNSERFKELTPNYNPDIIFKDEENTGADRLMTQ
RCKDKLNALAISVMNQWPGVKLRVTEGWDEDGHHSEESLHYEGRAVDITTSDRDRSKYGMLARLAVEAGFDWVYYESKAH
IHCSVKAENSVAAKSGG
;
;AHMCGPGRGFGKRRHPKKLTPLAYKQFIPNVAEKTLGASGRYEGKISRNSERFKELTPNYNPDIIFKDEENTGADRLMTQ
RCKDKLNALAISVMNQWPGVKLRVTEGWDEDGHHSEESLHYEGRAVDITTSDRDRSKYGMLARLAVEAGFDWVYYESKAH
IHCSVKAENSVAAKSGG
;
B ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1    MET n 
1 2    ALA n 
1 3    ASP n 
1 4    TYR n 
1 5    LYS n 
1 6    ASP n 
1 7    ASP n 
1 8    ASP n 
1 9    ASP n 
1 10   LYS n 
1 11   SER n 
1 12   GLY n 
1 13   PRO n 
1 14   ASP n 
1 15   GLU n 
1 16   VAL n 
1 17   ASP n 
1 18   ALA n 
1 19   SER n 
1 20   GLY n 
1 21   ARG n 
1 22   MET n 
1 23   ALA n 
1 24   SER n 
1 25   ALA n 
1 26   GLY n 
1 27   ASN n 
1 28   ALA n 
1 29   ALA n 
1 30   GLU n 
1 31   PRO n 
1 32   GLN n 
1 33   ASP n 
1 34   ARG n 
1 35   GLY n 
1 36   GLY n 
1 37   GLY n 
1 38   GLY n 
1 39   SER n 
1 40   GLY n 
1 41   CYS n 
1 42   ILE n 
1 43   GLY n 
1 44   ALA n 
1 45   PRO n 
1 46   GLY n 
1 47   ARG n 
1 48   PRO n 
1 49   ALA n 
1 50   GLY n 
1 51   GLY n 
1 52   GLY n 
1 53   ARG n 
1 54   ARG n 
1 55   ARG n 
1 56   ARG n 
1 57   THR n 
1 58   GLY n 
1 59   GLY n 
1 60   LEU n 
1 61   ARG n 
1 62   ARG n 
1 63   ALA n 
1 64   ALA n 
1 65   ALA n 
1 66   PRO n 
1 67   ASP n 
1 68   ARG n 
1 69   ASP n 
1 70   TYR n 
1 71   LEU n 
1 72   HIS n 
1 73   ARG n 
1 74   PRO n 
1 75   SER n 
1 76   TYR n 
1 77   CYS n 
1 78   ASP n 
1 79   ALA n 
1 80   ALA n 
1 81   PHE n 
1 82   ALA n 
1 83   LEU n 
1 84   GLU n 
1 85   GLN n 
1 86   ILE n 
1 87   SER n 
1 88   LYS n 
1 89   GLY n 
1 90   LYS n 
1 91   ALA n 
1 92   THR n 
1 93   GLY n 
1 94   ARG n 
1 95   LYS n 
1 96   ALA n 
1 97   PRO n 
1 98   LEU n 
1 99   TRP n 
1 100  LEU n 
1 101  ARG n 
1 102  ALA n 
1 103  LYS n 
1 104  PHE n 
1 105  GLN n 
1 106  ARG n 
1 107  LEU n 
1 108  LEU n 
1 109  PHE n 
1 110  LYS n 
1 111  LEU n 
1 112  GLY n 
1 113  CYS n 
1 114  TYR n 
1 115  ILE n 
1 116  GLN n 
1 117  LYS n 
1 118  ASN n 
1 119  CYS n 
1 120  GLY n 
1 121  LYS n 
1 122  PHE n 
1 123  LEU n 
1 124  VAL n 
1 125  VAL n 
1 126  GLY n 
1 127  LEU n 
1 128  LEU n 
1 129  ILE n 
1 130  PHE n 
1 131  GLY n 
1 132  ALA n 
1 133  PHE n 
1 134  ALA n 
1 135  VAL n 
1 136  GLY n 
1 137  LEU n 
1 138  LYS n 
1 139  ALA n 
1 140  ALA n 
1 141  ASN n 
1 142  LEU n 
1 143  GLU n 
1 144  THR n 
1 145  ASN n 
1 146  VAL n 
1 147  GLU n 
1 148  GLU n 
1 149  LEU n 
1 150  TRP n 
1 151  VAL n 
1 152  GLU n 
1 153  VAL n 
1 154  GLY n 
1 155  GLY n 
1 156  ARG n 
1 157  VAL n 
1 158  SER n 
1 159  ARG n 
1 160  GLU n 
1 161  LEU n 
1 162  ASN n 
1 163  TYR n 
1 164  THR n 
1 165  ARG n 
1 166  GLN n 
1 167  LYS n 
1 168  ILE n 
1 169  GLY n 
1 170  GLU n 
1 171  GLU n 
1 172  ALA n 
1 173  MET n 
1 174  PHE n 
1 175  ASN n 
1 176  PRO n 
1 177  GLN n 
1 178  LEU n 
1 179  MET n 
1 180  ILE n 
1 181  GLN n 
1 182  THR n 
1 183  PRO n 
1 184  LYS n 
1 185  GLU n 
1 186  GLU n 
1 187  GLY n 
1 188  ALA n 
1 189  ASN n 
1 190  VAL n 
1 191  LEU n 
1 192  THR n 
1 193  THR n 
1 194  GLU n 
1 195  ALA n 
1 196  LEU n 
1 197  LEU n 
1 198  GLN n 
1 199  HIS n 
1 200  LEU n 
1 201  ASP n 
1 202  SER n 
1 203  ALA n 
1 204  LEU n 
1 205  GLN n 
1 206  ALA n 
1 207  SER n 
1 208  ARG n 
1 209  VAL n 
1 210  HIS n 
1 211  VAL n 
1 212  TYR n 
1 213  MET n 
1 214  TYR n 
1 215  ASN n 
1 216  ARG n 
1 217  GLN n 
1 218  TRP n 
1 219  LYS n 
1 220  LEU n 
1 221  GLU n 
1 222  HIS n 
1 223  LEU n 
1 224  CYS n 
1 225  TYR n 
1 226  LYS n 
1 227  SER n 
1 228  GLY n 
1 229  GLU n 
1 230  LEU n 
1 231  ILE n 
1 232  THR n 
1 233  GLU n 
1 234  THR n 
1 235  GLY n 
1 236  TYR n 
1 237  MET n 
1 238  ASP n 
1 239  GLN n 
1 240  ILE n 
1 241  ILE n 
1 242  GLU n 
1 243  TYR n 
1 244  LEU n 
1 245  TYR n 
1 246  PRO n 
1 247  CYS n 
1 248  LEU n 
1 249  ILE n 
1 250  ILE n 
1 251  THR n 
1 252  PRO n 
1 253  LEU n 
1 254  ASP n 
1 255  CYS n 
1 256  PHE n 
1 257  TRP n 
1 258  GLU n 
1 259  GLY n 
1 260  ALA n 
1 261  LYS n 
1 262  LEU n 
1 263  GLN n 
1 264  SER n 
1 265  GLY n 
1 266  THR n 
1 267  ALA n 
1 268  TYR n 
1 269  LEU n 
1 270  LEU n 
1 271  GLY n 
1 272  LYS n 
1 273  PRO n 
1 274  PRO n 
1 275  LEU n 
1 276  ARG n 
1 277  TRP n 
1 278  THR n 
1 279  ASN n 
1 280  PHE n 
1 281  ASP n 
1 282  PRO n 
1 283  LEU n 
1 284  GLU n 
1 285  PHE n 
1 286  LEU n 
1 287  GLU n 
1 288  GLU n 
1 289  LEU n 
1 290  LYS n 
1 291  LYS n 
1 292  ILE n 
1 293  ASN n 
1 294  TYR n 
1 295  GLN n 
1 296  VAL n 
1 297  ASP n 
1 298  SER n 
1 299  TRP n 
1 300  GLU n 
1 301  GLU n 
1 302  MET n 
1 303  LEU n 
1 304  ASN n 
1 305  LYS n 
1 306  ALA n 
1 307  GLU n 
1 308  VAL n 
1 309  GLY n 
1 310  HIS n 
1 311  GLY n 
1 312  TYR n 
1 313  MET n 
1 314  ASP n 
1 315  ARG n 
1 316  PRO n 
1 317  CYS n 
1 318  LEU n 
1 319  ASN n 
1 320  PRO n 
1 321  ALA n 
1 322  ASP n 
1 323  PRO n 
1 324  ASP n 
1 325  CYS n 
1 326  PRO n 
1 327  ALA n 
1 328  THR n 
1 329  ALA n 
1 330  PRO n 
1 331  ASN n 
1 332  LYS n 
1 333  ASN n 
1 334  SER n 
1 335  THR n 
1 336  LYS n 
1 337  PRO n 
1 338  LEU n 
1 339  ASP n 
1 340  MET n 
1 341  ALA n 
1 342  LEU n 
1 343  VAL n 
1 344  LEU n 
1 345  ASN n 
1 346  GLY n 
1 347  GLY n 
1 348  CYS n 
1 349  HIS n 
1 350  GLY n 
1 351  LEU n 
1 352  SER n 
1 353  ARG n 
1 354  LYS n 
1 355  TYR n 
1 356  MET n 
1 357  HIS n 
1 358  TRP n 
1 359  GLN n 
1 360  GLU n 
1 361  GLU n 
1 362  LEU n 
1 363  ILE n 
1 364  VAL n 
1 365  GLY n 
1 366  GLY n 
1 367  THR n 
1 368  VAL n 
1 369  LYS n 
1 370  ASN n 
1 371  SER n 
1 372  THR n 
1 373  GLY n 
1 374  LYS n 
1 375  LEU n 
1 376  VAL n 
1 377  SER n 
1 378  ALA n 
1 379  HIS n 
1 380  ALA n 
1 381  LEU n 
1 382  GLN n 
1 383  THR n 
1 384  MET n 
1 385  PHE n 
1 386  GLN n 
1 387  LEU n 
1 388  MET n 
1 389  THR n 
1 390  PRO n 
1 391  LYS n 
1 392  GLN n 
1 393  MET n 
1 394  TYR n 
1 395  GLU n 
1 396  HIS n 
1 397  PHE n 
1 398  LYS n 
1 399  GLY n 
1 400  TYR n 
1 401  GLU n 
1 402  TYR n 
1 403  VAL n 
1 404  SER n 
1 405  HIS n 
1 406  ILE n 
1 407  ASN n 
1 408  TRP n 
1 409  ASN n 
1 410  GLU n 
1 411  ASP n 
1 412  LYS n 
1 413  ALA n 
1 414  ALA n 
1 415  ALA n 
1 416  ILE n 
1 417  LEU n 
1 418  GLU n 
1 419  ALA n 
1 420  TRP n 
1 421  GLN n 
1 422  ARG n 
1 423  THR n 
1 424  TYR n 
1 425  VAL n 
1 426  GLU n 
1 427  VAL n 
1 428  VAL n 
1 429  HIS n 
1 430  GLN n 
1 431  SER n 
1 432  VAL n 
1 433  ALA n 
1 434  GLN n 
1 435  ASN n 
1 436  SER n 
1 437  THR n 
1 438  GLN n 
1 439  LYS n 
1 440  VAL n 
1 441  LEU n 
1 442  SER n 
1 443  PHE n 
1 444  THR n 
1 445  THR n 
1 446  THR n 
1 447  THR n 
1 448  LEU n 
1 449  ASP n 
1 450  ASP n 
1 451  ILE n 
1 452  LEU n 
1 453  LYS n 
1 454  SER n 
1 455  PHE n 
1 456  SER n 
1 457  ASP n 
1 458  VAL n 
1 459  SER n 
1 460  VAL n 
1 461  ILE n 
1 462  ARG n 
1 463  VAL n 
1 464  ALA n 
1 465  SER n 
1 466  GLY n 
1 467  TYR n 
1 468  LEU n 
1 469  LEU n 
1 470  MET n 
1 471  LEU n 
1 472  ALA n 
1 473  TYR n 
1 474  ALA n 
1 475  CYS n 
1 476  LEU n 
1 477  THR n 
1 478  MET n 
1 479  LEU n 
1 480  ARG n 
1 481  TRP n 
1 482  ASP n 
1 483  CYS n 
1 484  SER n 
1 485  LYS n 
1 486  SER n 
1 487  GLN n 
1 488  GLY n 
1 489  ALA n 
1 490  VAL n 
1 491  GLY n 
1 492  LEU n 
1 493  ALA n 
1 494  GLY n 
1 495  VAL n 
1 496  LEU n 
1 497  LEU n 
1 498  VAL n 
1 499  ALA n 
1 500  LEU n 
1 501  SER n 
1 502  VAL n 
1 503  ALA n 
1 504  ALA n 
1 505  GLY n 
1 506  LEU n 
1 507  GLY n 
1 508  LEU n 
1 509  CYS n 
1 510  SER n 
1 511  LEU n 
1 512  ILE n 
1 513  GLY n 
1 514  ILE n 
1 515  SER n 
1 516  PHE n 
1 517  ASN n 
1 518  ALA n 
1 519  ALA n 
1 520  THR n 
1 521  THR n 
1 522  GLN n 
1 523  VAL n 
1 524  LEU n 
1 525  PRO n 
1 526  PHE n 
1 527  LEU n 
1 528  ALA n 
1 529  LEU n 
1 530  GLY n 
1 531  VAL n 
1 532  GLY n 
1 533  VAL n 
1 534  ASP n 
1 535  ASP n 
1 536  VAL n 
1 537  PHE n 
1 538  LEU n 
1 539  LEU n 
1 540  ALA n 
1 541  HIS n 
1 542  ALA n 
1 543  PHE n 
1 544  SER n 
1 545  GLU n 
1 546  THR n 
1 547  GLY n 
1 548  GLN n 
1 549  ASN n 
1 550  LYS n 
1 551  ARG n 
1 552  ILE n 
1 553  PRO n 
1 554  PHE n 
1 555  GLU n 
1 556  ASP n 
1 557  ARG n 
1 558  THR n 
1 559  GLY n 
1 560  GLU n 
1 561  CYS n 
1 562  LEU n 
1 563  LYS n 
1 564  ARG n 
1 565  THR n 
1 566  GLY n 
1 567  ALA n 
1 568  SER n 
1 569  VAL n 
1 570  ALA n 
1 571  LEU n 
1 572  THR n 
1 573  SER n 
1 574  ILE n 
1 575  SER n 
1 576  ASN n 
1 577  VAL n 
1 578  THR n 
1 579  ALA n 
1 580  PHE n 
1 581  PHE n 
1 582  MET n 
1 583  ALA n 
1 584  ALA n 
1 585  LEU n 
1 586  ILE n 
1 587  PRO n 
1 588  ILE n 
1 589  PRO n 
1 590  ALA n 
1 591  LEU n 
1 592  ARG n 
1 593  ALA n 
1 594  PHE n 
1 595  SER n 
1 596  LEU n 
1 597  GLN n 
1 598  ALA n 
1 599  ALA n 
1 600  VAL n 
1 601  VAL n 
1 602  VAL n 
1 603  VAL n 
1 604  PHE n 
1 605  ASN n 
1 606  PHE n 
1 607  ALA n 
1 608  MET n 
1 609  VAL n 
1 610  LEU n 
1 611  LEU n 
1 612  ILE n 
1 613  PHE n 
1 614  PRO n 
1 615  ALA n 
1 616  ILE n 
1 617  LEU n 
1 618  SER n 
1 619  MET n 
1 620  ASP n 
1 621  LEU n 
1 622  TYR n 
1 623  ARG n 
1 624  ARG n 
1 625  GLU n 
1 626  ASP n 
1 627  ARG n 
1 628  ARG n 
1 629  LEU n 
1 630  ASP n 
1 631  ILE n 
1 632  PHE n 
1 633  CYS n 
1 634  CYS n 
1 635  PHE n 
1 636  THR n 
1 637  SER n 
1 638  PRO n 
1 639  CYS n 
1 640  VAL n 
1 641  SER n 
1 642  ARG n 
1 643  VAL n 
1 644  ILE n 
1 645  GLN n 
1 646  VAL n 
1 647  GLU n 
1 648  PRO n 
1 649  GLN n 
1 650  ALA n 
1 651  TYR n 
1 652  THR n 
1 653  ASP n 
1 654  THR n 
1 655  HIS n 
1 656  ASP n 
1 657  ASN n 
1 658  THR n 
1 659  ARG n 
1 660  TYR n 
1 661  SER n 
1 662  PRO n 
1 663  PRO n 
1 664  PRO n 
1 665  PRO n 
1 666  TYR n 
1 667  SER n 
1 668  SER n 
1 669  HIS n 
1 670  SER n 
1 671  PHE n 
1 672  ALA n 
1 673  HIS n 
1 674  GLU n 
1 675  THR n 
1 676  GLN n 
1 677  ILE n 
1 678  THR n 
1 679  MET n 
1 680  GLN n 
1 681  SER n 
1 682  THR n 
1 683  VAL n 
1 684  GLN n 
1 685  LEU n 
1 686  ARG n 
1 687  THR n 
1 688  GLU n 
1 689  TYR n 
1 690  ASP n 
1 691  PRO n 
1 692  HIS n 
1 693  THR n 
1 694  HIS n 
1 695  VAL n 
1 696  TYR n 
1 697  TYR n 
1 698  THR n 
1 699  THR n 
1 700  ALA n 
1 701  GLU n 
1 702  PRO n 
1 703  ARG n 
1 704  SER n 
1 705  GLU n 
1 706  ILE n 
1 707  SER n 
1 708  VAL n 
1 709  GLN n 
1 710  PRO n 
1 711  VAL n 
1 712  THR n 
1 713  VAL n 
1 714  THR n 
1 715  GLN n 
1 716  ASP n 
1 717  THR n 
1 718  LEU n 
1 719  SER n 
1 720  CYS n 
1 721  GLN n 
1 722  SER n 
1 723  PRO n 
1 724  GLU n 
1 725  SER n 
1 726  THR n 
1 727  SER n 
1 728  SER n 
1 729  THR n 
1 730  ARG n 
1 731  ASP n 
1 732  LEU n 
1 733  LEU n 
1 734  SER n 
1 735  GLN n 
1 736  PHE n 
1 737  SER n 
1 738  ASP n 
1 739  SER n 
1 740  SER n 
1 741  LEU n 
1 742  HIS n 
1 743  CYS n 
1 744  LEU n 
1 745  GLU n 
1 746  PRO n 
1 747  PRO n 
1 748  CYS n 
1 749  THR n 
1 750  LYS n 
1 751  TRP n 
1 752  THR n 
1 753  LEU n 
1 754  SER n 
1 755  SER n 
1 756  PHE n 
1 757  ALA n 
1 758  GLU n 
1 759  LYS n 
1 760  HIS n 
1 761  TYR n 
1 762  ALA n 
1 763  PRO n 
1 764  PHE n 
1 765  LEU n 
1 766  LEU n 
1 767  LYS n 
1 768  PRO n 
1 769  LYS n 
1 770  ALA n 
1 771  LYS n 
1 772  VAL n 
1 773  VAL n 
1 774  VAL n 
1 775  ILE n 
1 776  PHE n 
1 777  LEU n 
1 778  PHE n 
1 779  LEU n 
1 780  GLY n 
1 781  LEU n 
1 782  LEU n 
1 783  GLY n 
1 784  VAL n 
1 785  SER n 
1 786  LEU n 
1 787  TYR n 
1 788  GLY n 
1 789  THR n 
1 790  THR n 
1 791  ARG n 
1 792  VAL n 
1 793  ARG n 
1 794  ASP n 
1 795  GLY n 
1 796  LEU n 
1 797  ASP n 
1 798  LEU n 
1 799  THR n 
1 800  ASP n 
1 801  ILE n 
1 802  VAL n 
1 803  PRO n 
1 804  ARG n 
1 805  GLU n 
1 806  THR n 
1 807  ARG n 
1 808  GLU n 
1 809  TYR n 
1 810  ASP n 
1 811  PHE n 
1 812  ILE n 
1 813  ALA n 
1 814  ALA n 
1 815  GLN n 
1 816  PHE n 
1 817  LYS n 
1 818  TYR n 
1 819  PHE n 
1 820  SER n 
1 821  PHE n 
1 822  TYR n 
1 823  ASN n 
1 824  MET n 
1 825  TYR n 
1 826  ILE n 
1 827  VAL n 
1 828  THR n 
1 829  GLN n 
1 830  LYS n 
1 831  ALA n 
1 832  ASP n 
1 833  TYR n 
1 834  PRO n 
1 835  ASN n 
1 836  ILE n 
1 837  GLN n 
1 838  HIS n 
1 839  LEU n 
1 840  LEU n 
1 841  TYR n 
1 842  ASP n 
1 843  LEU n 
1 844  HIS n 
1 845  ARG n 
1 846  SER n 
1 847  PHE n 
1 848  SER n 
1 849  ASN n 
1 850  VAL n 
1 851  LYS n 
1 852  TYR n 
1 853  VAL n 
1 854  MET n 
1 855  LEU n 
1 856  GLU n 
1 857  GLU n 
1 858  ASN n 
1 859  LYS n 
1 860  GLN n 
1 861  LEU n 
1 862  PRO n 
1 863  LYS n 
1 864  MET n 
1 865  TRP n 
1 866  LEU n 
1 867  HIS n 
1 868  TYR n 
1 869  PHE n 
1 870  ARG n 
1 871  ASP n 
1 872  TRP n 
1 873  LEU n 
1 874  GLN n 
1 875  GLY n 
1 876  LEU n 
1 877  GLN n 
1 878  ASP n 
1 879  ALA n 
1 880  PHE n 
1 881  ASP n 
1 882  SER n 
1 883  ASP n 
1 884  TRP n 
1 885  GLU n 
1 886  THR n 
1 887  GLY n 
1 888  LYS n 
1 889  ILE n 
1 890  MET n 
1 891  PRO n 
1 892  ASN n 
1 893  ASN n 
1 894  TYR n 
1 895  LYS n 
1 896  ASN n 
1 897  GLY n 
1 898  SER n 
1 899  ASP n 
1 900  ASP n 
1 901  GLY n 
1 902  VAL n 
1 903  LEU n 
1 904  ALA n 
1 905  TYR n 
1 906  LYS n 
1 907  LEU n 
1 908  LEU n 
1 909  VAL n 
1 910  GLN n 
1 911  THR n 
1 912  GLY n 
1 913  SER n 
1 914  ARG n 
1 915  ASP n 
1 916  LYS n 
1 917  PRO n 
1 918  ILE n 
1 919  ASP n 
1 920  ILE n 
1 921  SER n 
1 922  GLN n 
1 923  LEU n 
1 924  THR n 
1 925  LYS n 
1 926  GLN n 
1 927  ARG n 
1 928  LEU n 
1 929  VAL n 
1 930  ASP n 
1 931  ALA n 
1 932  ASP n 
1 933  GLY n 
1 934  ILE n 
1 935  ILE n 
1 936  ASN n 
1 937  PRO n 
1 938  SER n 
1 939  ALA n 
1 940  PHE n 
1 941  TYR n 
1 942  ILE n 
1 943  TYR n 
1 944  LEU n 
1 945  THR n 
1 946  ALA n 
1 947  TRP n 
1 948  VAL n 
1 949  SER n 
1 950  ASN n 
1 951  ASP n 
1 952  PRO n 
1 953  VAL n 
1 954  ALA n 
1 955  TYR n 
1 956  ALA n 
1 957  ALA n 
1 958  SER n 
1 959  GLN n 
1 960  ALA n 
1 961  ASN n 
1 962  ILE n 
1 963  ARG n 
1 964  PRO n 
1 965  HIS n 
1 966  ARG n 
1 967  PRO n 
1 968  GLU n 
1 969  TRP n 
1 970  VAL n 
1 971  HIS n 
1 972  ASP n 
1 973  LYS n 
1 974  ALA n 
1 975  ASP n 
1 976  TYR n 
1 977  MET n 
1 978  PRO n 
1 979  GLU n 
1 980  THR n 
1 981  ARG n 
1 982  LEU n 
1 983  ARG n 
1 984  ILE n 
1 985  PRO n 
1 986  ALA n 
1 987  ALA n 
1 988  GLU n 
1 989  PRO n 
1 990  ILE n 
1 991  GLU n 
1 992  TYR n 
1 993  ALA n 
1 994  GLN n 
1 995  PHE n 
1 996  PRO n 
1 997  PHE n 
1 998  TYR n 
1 999  LEU n 
1 1000 ASN n 
1 1001 GLY n 
1 1002 LEU n 
1 1003 ARG n 
1 1004 ASP n 
1 1005 THR n 
1 1006 SER n 
1 1007 ASP n 
1 1008 PHE n 
1 1009 VAL n 
1 1010 GLU n 
1 1011 ALA n 
1 1012 ILE n 
1 1013 GLU n 
1 1014 LYS n 
1 1015 VAL n 
1 1016 ARG n 
1 1017 THR n 
1 1018 ILE n 
1 1019 CYS n 
1 1020 SER n 
1 1021 ASN n 
1 1022 TYR n 
1 1023 THR n 
1 1024 SER n 
1 1025 LEU n 
1 1026 GLY n 
1 1027 LEU n 
1 1028 SER n 
1 1029 SER n 
1 1030 TYR n 
1 1031 PRO n 
1 1032 ASN n 
1 1033 GLY n 
1 1034 TYR n 
1 1035 PRO n 
1 1036 PHE n 
1 1037 LEU n 
1 1038 PHE n 
1 1039 TRP n 
1 1040 GLU n 
1 1041 GLN n 
1 1042 TYR n 
1 1043 ILE n 
1 1044 GLY n 
1 1045 LEU n 
1 1046 ARG n 
1 1047 HIS n 
1 1048 TRP n 
1 1049 LEU n 
1 1050 LEU n 
1 1051 LEU n 
1 1052 PHE n 
1 1053 ILE n 
1 1054 SER n 
1 1055 VAL n 
1 1056 VAL n 
1 1057 LEU n 
1 1058 ALA n 
1 1059 CYS n 
1 1060 THR n 
1 1061 PHE n 
1 1062 LEU n 
1 1063 VAL n 
1 1064 CYS n 
1 1065 ALA n 
1 1066 VAL n 
1 1067 PHE n 
1 1068 LEU n 
1 1069 LEU n 
1 1070 ASN n 
1 1071 PRO n 
1 1072 TRP n 
1 1073 THR n 
1 1074 ALA n 
1 1075 GLY n 
1 1076 ILE n 
1 1077 ILE n 
1 1078 VAL n 
1 1079 MET n 
1 1080 VAL n 
1 1081 LEU n 
1 1082 ALA n 
1 1083 LEU n 
1 1084 MET n 
1 1085 THR n 
1 1086 VAL n 
1 1087 GLU n 
1 1088 LEU n 
1 1089 PHE n 
1 1090 GLY n 
1 1091 MET n 
1 1092 MET n 
1 1093 GLY n 
1 1094 LEU n 
1 1095 ILE n 
1 1096 GLY n 
1 1097 ILE n 
1 1098 LYS n 
1 1099 LEU n 
1 1100 SER n 
1 1101 ALA n 
1 1102 VAL n 
1 1103 PRO n 
1 1104 VAL n 
1 1105 VAL n 
1 1106 ILE n 
1 1107 LEU n 
1 1108 ILE n 
1 1109 ALA n 
1 1110 SER n 
1 1111 VAL n 
1 1112 GLY n 
1 1113 ILE n 
1 1114 GLY n 
1 1115 VAL n 
1 1116 GLU n 
1 1117 PHE n 
1 1118 THR n 
1 1119 VAL n 
1 1120 HIS n 
1 1121 VAL n 
1 1122 ALA n 
1 1123 LEU n 
1 1124 ALA n 
1 1125 PHE n 
1 1126 LEU n 
1 1127 THR n 
1 1128 ALA n 
1 1129 ILE n 
1 1130 GLY n 
1 1131 ASP n 
1 1132 LYS n 
1 1133 ASN n 
1 1134 ARG n 
1 1135 ARG n 
1 1136 ALA n 
1 1137 VAL n 
1 1138 LEU n 
1 1139 ALA n 
1 1140 LEU n 
1 1141 GLU n 
1 1142 HIS n 
1 1143 MET n 
1 1144 PHE n 
1 1145 ALA n 
1 1146 PRO n 
1 1147 VAL n 
1 1148 LEU n 
1 1149 ASP n 
1 1150 GLY n 
1 1151 ALA n 
1 1152 VAL n 
1 1153 SER n 
1 1154 THR n 
1 1155 LEU n 
1 1156 LEU n 
1 1157 GLY n 
1 1158 VAL n 
1 1159 LEU n 
1 1160 MET n 
1 1161 LEU n 
1 1162 ALA n 
1 1163 GLY n 
1 1164 SER n 
1 1165 GLU n 
1 1166 PHE n 
1 1167 ASP n 
1 1168 PHE n 
1 1169 ILE n 
1 1170 VAL n 
1 1171 ARG n 
1 1172 TYR n 
1 1173 PHE n 
1 1174 PHE n 
1 1175 ALA n 
1 1176 VAL n 
1 1177 LEU n 
1 1178 ALA n 
1 1179 ILE n 
1 1180 LEU n 
1 1181 THR n 
1 1182 ILE n 
1 1183 LEU n 
1 1184 GLY n 
1 1185 VAL n 
1 1186 LEU n 
1 1187 ASN n 
1 1188 GLY n 
1 1189 LEU n 
1 1190 VAL n 
1 1191 LEU n 
1 1192 LEU n 
1 1193 PRO n 
1 1194 VAL n 
1 1195 LEU n 
1 1196 LEU n 
1 1197 SER n 
1 1198 PHE n 
1 1199 PHE n 
1 1200 GLY n 
1 1201 PRO n 
1 1202 TYR n 
1 1203 PRO n 
1 1204 GLU n 
1 1205 VAL n 
1 1206 SER n 
1 1207 PRO n 
1 1208 ALA n 
1 1209 ASN n 
1 1210 GLY n 
1 1211 LEU n 
1 1212 ASN n 
1 1213 ARG n 
1 1214 LEU n 
1 1215 PRO n 
1 1216 THR n 
1 1217 PRO n 
1 1218 SER n 
1 1219 PRO n 
1 1220 GLU n 
1 1221 PRO n 
1 1222 PRO n 
1 1223 PRO n 
1 1224 SER n 
1 1225 VAL n 
1 1226 VAL n 
1 1227 ARG n 
1 1228 PHE n 
1 1229 ALA n 
1 1230 MET n 
1 1231 PRO n 
1 1232 PRO n 
1 1233 GLY n 
1 1234 HIS n 
1 1235 THR n 
1 1236 HIS n 
1 1237 SER n 
1 1238 GLY n 
1 1239 SER n 
1 1240 ASP n 
1 1241 SER n 
1 1242 SER n 
1 1243 ASP n 
1 1244 SER n 
1 1245 GLU n 
1 1246 TYR n 
1 1247 SER n 
1 1248 SER n 
1 1249 GLN n 
1 1250 THR n 
1 1251 THR n 
1 1252 VAL n 
1 1253 SER n 
1 1254 GLY n 
1 1255 LEU n 
1 1256 SER n 
1 1257 GLU n 
1 1258 GLU n 
1 1259 LEU n 
1 1260 ARG n 
1 1261 HIS n 
1 1262 TYR n 
1 1263 GLU n 
1 1264 ALA n 
1 1265 GLN n 
1 1266 GLN n 
1 1267 GLY n 
1 1268 ALA n 
1 1269 GLY n 
1 1270 GLY n 
1 1271 PRO n 
1 1272 ALA n 
1 1273 HIS n 
1 1274 GLN n 
1 1275 VAL n 
1 1276 ILE n 
1 1277 VAL n 
1 1278 GLU n 
1 1279 ALA n 
1 1280 THR n 
1 1281 GLU n 
1 1282 ASN n 
1 1283 PRO n 
1 1284 VAL n 
1 1285 PHE n 
1 1286 ALA n 
1 1287 HIS n 
1 1288 SER n 
1 1289 THR n 
1 1290 VAL n 
1 1291 VAL n 
1 1292 HIS n 
1 1293 PRO n 
1 1294 GLU n 
1 1295 SER n 
1 1296 ARG n 
1 1297 HIS n 
1 1298 HIS n 
1 1299 PRO n 
1 1300 PRO n 
1 1301 SER n 
1 1302 ASN n 
1 1303 PRO n 
1 1304 ARG n 
1 1305 GLN n 
1 1306 GLN n 
1 1307 PRO n 
1 1308 HIS n 
1 1309 LEU n 
1 1310 ASP n 
1 1311 SER n 
1 1312 GLY n 
1 1313 SER n 
1 1314 LEU n 
1 1315 PRO n 
1 1316 PRO n 
1 1317 GLY n 
1 1318 ARG n 
1 1319 GLN n 
1 1320 GLY n 
1 1321 GLN n 
1 1322 GLN n 
1 1323 PRO n 
1 1324 ARG n 
1 1325 ARG n 
1 1326 ASP n 
1 1327 LEU n 
1 1328 GLU n 
1 1329 GLY n 
1 1330 SER n 
1 1331 ASP n 
1 1332 GLU n 
1 1333 VAL n 
1 1334 ASP n 
1 1335 ALA n 
1 1336 VAL n 
1 1337 GLU n 
1 1338 GLY n 
1 1339 SER n 
1 1340 HIS n 
1 1341 HIS n 
1 1342 HIS n 
1 1343 HIS n 
1 1344 HIS n 
1 1345 HIS n 
1 1346 HIS n 
1 1347 HIS n 
1 1348 HIS n 
1 1349 HIS n 
2 1    ALA n 
2 2    HIS n 
2 3    MET n 
2 4    CYS n 
2 5    GLY n 
2 6    PRO n 
2 7    GLY n 
2 8    ARG n 
2 9    GLY n 
2 10   PHE n 
2 11   GLY n 
2 12   LYS n 
2 13   ARG n 
2 14   ARG n 
2 15   HIS n 
2 16   PRO n 
2 17   LYS n 
2 18   LYS n 
2 19   LEU n 
2 20   THR n 
2 21   PRO n 
2 22   LEU n 
2 23   ALA n 
2 24   TYR n 
2 25   LYS n 
2 26   GLN n 
2 27   PHE n 
2 28   ILE n 
2 29   PRO n 
2 30   ASN n 
2 31   VAL n 
2 32   ALA n 
2 33   GLU n 
2 34   LYS n 
2 35   THR n 
2 36   LEU n 
2 37   GLY n 
2 38   ALA n 
2 39   SER n 
2 40   GLY n 
2 41   ARG n 
2 42   TYR n 
2 43   GLU n 
2 44   GLY n 
2 45   LYS n 
2 46   ILE n 
2 47   SER n 
2 48   ARG n 
2 49   ASN n 
2 50   SER n 
2 51   GLU n 
2 52   ARG n 
2 53   PHE n 
2 54   LYS n 
2 55   GLU n 
2 56   LEU n 
2 57   THR n 
2 58   PRO n 
2 59   ASN n 
2 60   TYR n 
2 61   ASN n 
2 62   PRO n 
2 63   ASP n 
2 64   ILE n 
2 65   ILE n 
2 66   PHE n 
2 67   LYS n 
2 68   ASP n 
2 69   GLU n 
2 70   GLU n 
2 71   ASN n 
2 72   THR n 
2 73   GLY n 
2 74   ALA n 
2 75   ASP n 
2 76   ARG n 
2 77   LEU n 
2 78   MET n 
2 79   THR n 
2 80   GLN n 
2 81   ARG n 
2 82   CYS n 
2 83   LYS n 
2 84   ASP n 
2 85   LYS n 
2 86   LEU n 
2 87   ASN n 
2 88   ALA n 
2 89   LEU n 
2 90   ALA n 
2 91   ILE n 
2 92   SER n 
2 93   VAL n 
2 94   MET n 
2 95   ASN n 
2 96   GLN n 
2 97   TRP n 
2 98   PRO n 
2 99   GLY n 
2 100  VAL n 
2 101  LYS n 
2 102  LEU n 
2 103  ARG n 
2 104  VAL n 
2 105  THR n 
2 106  GLU n 
2 107  GLY n 
2 108  TRP n 
2 109  ASP n 
2 110  GLU n 
2 111  ASP n 
2 112  GLY n 
2 113  HIS n 
2 114  HIS n 
2 115  SER n 
2 116  GLU n 
2 117  GLU n 
2 118  SER n 
2 119  LEU n 
2 120  HIS n 
2 121  TYR n 
2 122  GLU n 
2 123  GLY n 
2 124  ARG n 
2 125  ALA n 
2 126  VAL n 
2 127  ASP n 
2 128  ILE n 
2 129  THR n 
2 130  THR n 
2 131  SER n 
2 132  ASP n 
2 133  ARG n 
2 134  ASP n 
2 135  ARG n 
2 136  SER n 
2 137  LYS n 
2 138  TYR n 
2 139  GLY n 
2 140  MET n 
2 141  LEU n 
2 142  ALA n 
2 143  ARG n 
2 144  LEU n 
2 145  ALA n 
2 146  VAL n 
2 147  GLU n 
2 148  ALA n 
2 149  GLY n 
2 150  PHE n 
2 151  ASP n 
2 152  TRP n 
2 153  VAL n 
2 154  TYR n 
2 155  TYR n 
2 156  GLU n 
2 157  SER n 
2 158  LYS n 
2 159  ALA n 
2 160  HIS n 
2 161  ILE n 
2 162  HIS n 
2 163  CYS n 
2 164  SER n 
2 165  VAL n 
2 166  LYS n 
2 167  ALA n 
2 168  GLU n 
2 169  ASN n 
2 170  SER n 
2 171  VAL n 
2 172  ALA n 
2 173  ALA n 
2 174  LYS n 
2 175  SER n 
2 176  GLY n 
2 177  GLY n 
# 
loop_
_entity_src_gen.entity_id 
_entity_src_gen.pdbx_src_id 
_entity_src_gen.pdbx_alt_source_flag 
_entity_src_gen.pdbx_seq_type 
_entity_src_gen.pdbx_beg_seq_num 
_entity_src_gen.pdbx_end_seq_num 
_entity_src_gen.gene_src_common_name 
_entity_src_gen.gene_src_genus 
_entity_src_gen.pdbx_gene_src_gene 
_entity_src_gen.gene_src_species 
_entity_src_gen.gene_src_strain 
_entity_src_gen.gene_src_tissue 
_entity_src_gen.gene_src_tissue_fraction 
_entity_src_gen.gene_src_details 
_entity_src_gen.pdbx_gene_src_fragment 
_entity_src_gen.pdbx_gene_src_scientific_name 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 
_entity_src_gen.pdbx_gene_src_variant 
_entity_src_gen.pdbx_gene_src_cell_line 
_entity_src_gen.pdbx_gene_src_atcc 
_entity_src_gen.pdbx_gene_src_organ 
_entity_src_gen.pdbx_gene_src_organelle 
_entity_src_gen.pdbx_gene_src_cell 
_entity_src_gen.pdbx_gene_src_cellular_location 
_entity_src_gen.host_org_common_name 
_entity_src_gen.pdbx_host_org_scientific_name 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 
_entity_src_gen.host_org_genus 
_entity_src_gen.pdbx_host_org_gene 
_entity_src_gen.pdbx_host_org_organ 
_entity_src_gen.host_org_species 
_entity_src_gen.pdbx_host_org_tissue 
_entity_src_gen.pdbx_host_org_tissue_fraction 
_entity_src_gen.pdbx_host_org_strain 
_entity_src_gen.pdbx_host_org_variant 
_entity_src_gen.pdbx_host_org_cell_line 
_entity_src_gen.pdbx_host_org_atcc 
_entity_src_gen.pdbx_host_org_culture_collection 
_entity_src_gen.pdbx_host_org_cell 
_entity_src_gen.pdbx_host_org_organelle 
_entity_src_gen.pdbx_host_org_cellular_location 
_entity_src_gen.pdbx_host_org_vector_type 
_entity_src_gen.pdbx_host_org_vector 
_entity_src_gen.host_org_details 
_entity_src_gen.expression_system_id 
_entity_src_gen.plasmid_name 
_entity_src_gen.plasmid_details 
_entity_src_gen.pdbx_description 
1 1 sample 'Biological sequence' 1 1349 Human ? 'PTCH1, PTCH' ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? 'Homo sapiens' 9606 
? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
2 1 sample 'Biological sequence' 1 177  Human ? SHH           ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? 
;Escherichia coli 'BL21-Gold(DE3)pLysS AG'
;
866768 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_db_isoform 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
1 UNP PTC1_HUMAN Q13635 ? 1 
;MASAGNAAEPQDRGGGGSGCIGAPGRPAGGGRRRRTGGLRRAAAPDRDYLHRPSYCDAAFALEQISKGKATGRKAPLWLR
AKFQRLLFKLGCYIQKNCGKFLVVGLLIFGAFAVGLKAANLETNVEELWVEVGGRVSRELNYTRQKIGEEAMFNPQLMIQ
TPKEEGANVLTTEALLQHLDSALQASRVHVYMYNRQWKLEHLCYKSGELITETGYMDQIIEYLYPCLIITPLDCFWEGAK
LQSGTAYLLGKPPLRWTNFDPLEFLEELKKINYQVDSWEEMLNKAEVGHGYMDRPCLNPADPDCPATAPNKNSTKPLDMA
LVLNGGCHGLSRKYMHWQEELIVGGTVKNSTGKLVSAHALQTMFQLMTPKQMYEHFKGYEYVSHINWNEDKAAAILEAWQ
RTYVEVVHQSVAQNSTQKVLSFTTTTLDDILKSFSDVSVIRVASGYLLMLAYACLTMLRWDCSKSQGAVGLAGVLLVALS
VAAGLGLCSLIGISFNAATTQVLPFLALGVGVDDVFLLAHAFSETGQNKRIPFEDRTGECLKRTGASVALTSISNVTAFF
MAALIPIPALRAFSLQAAVVVVFNFAMVLLIFPAILSMDLYRREDRRLDIFCCFTSPCVSRVIQVEPQAYTDTHDNTRYS
PPPPYSSHSFAHETQITMQSTVQLRTEYDPHTHVYYTTAEPRSEISVQPVTVTQDTLSCQSPESTSSTRDLLSQFSDSSL
HCLEPPCTKWTLSSFAEKHYAPFLLKPKAKVVVIFLFLGLLGVSLYGTTRVRDGLDLTDIVPRETREYDFIAAQFKYFSF
YNMYIVTQKADYPNIQHLLYDLHRSFSNVKYVMLEENKQLPKMWLHYFRDWLQGLQDAFDSDWETGKIMPNNYKNGSDDG
VLAYKLLVQTGSRDKPIDISQLTKQRLVDADGIINPSAFYIYLTAWVSNDPVAYAASQANIRPHRPEWVHDKADYMPETR
LRIPAAEPIEYAQFPFYLNGLRDTSDFVEAIEKVRTICSNYTSLGLSSYPNGYPFLFWEQYIGLRHWLLLFISVVLACTF
LVCAVFLLNPWTAGIIVMVLALMTVELFGMMGLIGIKLSAVPVVILIASVGIGVEFTVHVALAFLTAIGDKNRRAVLALE
HMFAPVLDGAVSTLLGVLMLAGSEFDFIVRYFFAVLAILTILGVLNGLVLLPVLLSFFGPYPEVSPANGLNRLPTPSPEP
PPSVVRFAMPPGHTHSGSDSSDSEYSSQTTVSGLSEELRHYEAQQGAGGPAHQVIVEATENPVFAHSTVVHPESRHHPPS
NPRQQPHLDSGSLPPGRQGQQPRRD
;
1  
2 UNP SHH_HUMAN  Q15465 ? 2 
;CGPGRGFGKRRHPKKLTPLAYKQFIPNVAEKTLGASGRYEGKISRNSERFKELTPNYNPDIIFKDEENTGADRLMTQRCK
DKLNALAISVMNQWPGVKLRVTEGWDEDGHHSEESLHYEGRAVDITTSDRDRSKYGMLARLAVEAGFDWVYYESKAHIHC
SVKAENSVAAKSGG
;
24 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 6DMY A 22 ? 1326 ? Q13635 1  ? 1305 ? 1  1305 
2 2 6DMY B 4  ? 177  ? Q15465 24 ? 197  ? 24 197  
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 6DMY MET A 1    ? UNP Q13635 ? ? 'initiating methionine' -20  1  
1 6DMY ALA A 2    ? UNP Q13635 ? ? 'expression tag'        -19  2  
1 6DMY ASP A 3    ? UNP Q13635 ? ? 'expression tag'        -18  3  
1 6DMY TYR A 4    ? UNP Q13635 ? ? 'expression tag'        -17  4  
1 6DMY LYS A 5    ? UNP Q13635 ? ? 'expression tag'        -16  5  
1 6DMY ASP A 6    ? UNP Q13635 ? ? 'expression tag'        -15  6  
1 6DMY ASP A 7    ? UNP Q13635 ? ? 'expression tag'        -14  7  
1 6DMY ASP A 8    ? UNP Q13635 ? ? 'expression tag'        -13  8  
1 6DMY ASP A 9    ? UNP Q13635 ? ? 'expression tag'        -12  9  
1 6DMY LYS A 10   ? UNP Q13635 ? ? 'expression tag'        -11  10 
1 6DMY SER A 11   ? UNP Q13635 ? ? 'expression tag'        -10  11 
1 6DMY GLY A 12   ? UNP Q13635 ? ? 'expression tag'        -9   12 
1 6DMY PRO A 13   ? UNP Q13635 ? ? 'expression tag'        -8   13 
1 6DMY ASP A 14   ? UNP Q13635 ? ? 'expression tag'        -7   14 
1 6DMY GLU A 15   ? UNP Q13635 ? ? 'expression tag'        -6   15 
1 6DMY VAL A 16   ? UNP Q13635 ? ? 'expression tag'        -5   16 
1 6DMY ASP A 17   ? UNP Q13635 ? ? 'expression tag'        -4   17 
1 6DMY ALA A 18   ? UNP Q13635 ? ? 'expression tag'        -3   18 
1 6DMY SER A 19   ? UNP Q13635 ? ? 'expression tag'        -2   19 
1 6DMY GLY A 20   ? UNP Q13635 ? ? 'expression tag'        -1   20 
1 6DMY ARG A 21   ? UNP Q13635 ? ? 'expression tag'        0    21 
1 6DMY LEU A 1327 ? UNP Q13635 ? ? 'expression tag'        1306 22 
1 6DMY GLU A 1328 ? UNP Q13635 ? ? 'expression tag'        1307 23 
1 6DMY GLY A 1329 ? UNP Q13635 ? ? 'expression tag'        1308 24 
1 6DMY SER A 1330 ? UNP Q13635 ? ? 'expression tag'        1309 25 
1 6DMY ASP A 1331 ? UNP Q13635 ? ? 'expression tag'        1310 26 
1 6DMY GLU A 1332 ? UNP Q13635 ? ? 'expression tag'        1311 27 
1 6DMY VAL A 1333 ? UNP Q13635 ? ? 'expression tag'        1312 28 
1 6DMY ASP A 1334 ? UNP Q13635 ? ? 'expression tag'        1313 29 
1 6DMY ALA A 1335 ? UNP Q13635 ? ? 'expression tag'        1314 30 
1 6DMY VAL A 1336 ? UNP Q13635 ? ? 'expression tag'        1315 31 
1 6DMY GLU A 1337 ? UNP Q13635 ? ? 'expression tag'        1316 32 
1 6DMY GLY A 1338 ? UNP Q13635 ? ? 'expression tag'        1317 33 
1 6DMY SER A 1339 ? UNP Q13635 ? ? 'expression tag'        1318 34 
1 6DMY HIS A 1340 ? UNP Q13635 ? ? 'expression tag'        1319 35 
1 6DMY HIS A 1341 ? UNP Q13635 ? ? 'expression tag'        1320 36 
1 6DMY HIS A 1342 ? UNP Q13635 ? ? 'expression tag'        1321 37 
1 6DMY HIS A 1343 ? UNP Q13635 ? ? 'expression tag'        1322 38 
1 6DMY HIS A 1344 ? UNP Q13635 ? ? 'expression tag'        1323 39 
1 6DMY HIS A 1345 ? UNP Q13635 ? ? 'expression tag'        1324 40 
1 6DMY HIS A 1346 ? UNP Q13635 ? ? 'expression tag'        1325 41 
1 6DMY HIS A 1347 ? UNP Q13635 ? ? 'expression tag'        1326 42 
1 6DMY HIS A 1348 ? UNP Q13635 ? ? 'expression tag'        1327 43 
1 6DMY HIS A 1349 ? UNP Q13635 ? ? 'expression tag'        1328 44 
2 6DMY ALA B 1    ? UNP Q15465 ? ? 'expression tag'        21   45 
2 6DMY HIS B 2    ? UNP Q15465 ? ? 'expression tag'        22   46 
2 6DMY MET B 3    ? UNP Q15465 ? ? 'expression tag'        23   47 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking'          y ALANINE                                  ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking'          y ARGININE                                 ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking'          y ASPARAGINE                               ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking'          y 'ASPARTIC ACID'                          ? 'C4 H7 N O4'     133.103 
CA  non-polymer                  . 'CALCIUM ION'                            ? 'Ca 2'           40.078  
CYS 'L-peptide linking'          y CYSTEINE                                 ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking'          y GLUTAMINE                                ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking'          y 'GLUTAMIC ACID'                          ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'            y GLYCINE                                  ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking'          y HISTIDINE                                ? 'C6 H10 N3 O2 1' 156.162 
ILE 'L-peptide linking'          y ISOLEUCINE                               ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking'          y LEUCINE                                  ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking'          y LYSINE                                   ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking'          y METHIONINE                               ? 'C5 H11 N O2 S'  149.211 
NAG 'D-saccharide, beta linking' . 2-acetamido-2-deoxy-beta-D-glucopyranose ? 'C8 H15 N O6'    221.208 
PHE 'L-peptide linking'          y PHENYLALANINE                            ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking'          y PROLINE                                  ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking'          y SERINE                                   ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking'          y THREONINE                                ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking'          y TRYPTOPHAN                               ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking'          y TYROSINE                                 ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking'          y VALINE                                   ? 'C5 H11 N O2'    117.146 
Y01 non-polymer                  . 'CHOLESTEROL HEMISUCCINATE'              ? 'C31 H50 O4'     486.726 
ZN  non-polymer                  . 'ZINC ION'                               ? 'Zn 2'           65.409  
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.entry_id                   6DMY 
_exptl.crystals_number            ? 
_exptl.details                    ? 
_exptl.method                     'ELECTRON MICROSCOPY' 
_exptl.method_details             ? 
# 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.B_iso_max                                ? 
_refine.B_iso_mean                               ? 
_refine.B_iso_min                                ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.details                                  ? 
_refine.diff_density_max                         ? 
_refine.diff_density_max_esd                     ? 
_refine.diff_density_min                         ? 
_refine.diff_density_min_esd                     ? 
_refine.diff_density_rms                         ? 
_refine.diff_density_rms_esd                     ? 
_refine.entry_id                                 6DMY 
_refine.pdbx_refine_id                           'ELECTRON MICROSCOPY' 
_refine.ls_abs_structure_details                 ? 
_refine.ls_abs_structure_Flack                   ? 
_refine.ls_abs_structure_Flack_esd               ? 
_refine.ls_abs_structure_Rogers                  ? 
_refine.ls_abs_structure_Rogers_esd              ? 
_refine.ls_d_res_high                            . 
_refine.ls_d_res_low                             ? 
_refine.ls_extinction_coef                       ? 
_refine.ls_extinction_coef_esd                   ? 
_refine.ls_extinction_expression                 ? 
_refine.ls_extinction_method                     ? 
_refine.ls_goodness_of_fit_all                   ? 
_refine.ls_goodness_of_fit_all_esd               ? 
_refine.ls_goodness_of_fit_obs                   ? 
_refine.ls_goodness_of_fit_obs_esd               ? 
_refine.ls_hydrogen_treatment                    ? 
_refine.ls_matrix_type                           ? 
_refine.ls_number_constraints                    ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_reflns_all                     ? 
_refine.ls_number_reflns_obs                     ? 
_refine.ls_number_reflns_R_free                  ? 
_refine.ls_number_reflns_R_work                  ? 
_refine.ls_number_restraints                     ? 
_refine.ls_percent_reflns_obs                    ? 
_refine.ls_percent_reflns_R_free                 ? 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_obs                          ? 
_refine.ls_R_factor_R_free                       ? 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_R_factor_R_work                       ? 
_refine.ls_R_Fsqd_factor_obs                     ? 
_refine.ls_R_I_factor_obs                        ? 
_refine.ls_redundancy_reflns_all                 ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.ls_restrained_S_all                      ? 
_refine.ls_restrained_S_obs                      ? 
_refine.ls_shift_over_esd_max                    ? 
_refine.ls_shift_over_esd_mean                   ? 
_refine.ls_structure_factor_coef                 ? 
_refine.ls_weighting_details                     ? 
_refine.ls_weighting_scheme                      ? 
_refine.ls_wR_factor_all                         ? 
_refine.ls_wR_factor_obs                         ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.occupancy_max                            ? 
_refine.occupancy_min                            ? 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.ls_R_factor_gt                           ? 
_refine.ls_goodness_of_fit_gt                    ? 
_refine.ls_goodness_of_fit_ref                   ? 
_refine.ls_shift_over_su_max                     ? 
_refine.ls_shift_over_su_max_lt                  ? 
_refine.ls_shift_over_su_mean                    ? 
_refine.ls_shift_over_su_mean_lt                 ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          ? 
_refine.pdbx_ls_sigma_Fsqd                       ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_ls_cross_valid_method               ? 
_refine.pdbx_method_to_determine_struct          ? 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_R_Free_selection_details            ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_real_space_R                        ? 
_refine.pdbx_density_correlation                 ? 
_refine.pdbx_pd_number_of_powder_patterns        ? 
_refine.pdbx_pd_number_of_points                 ? 
_refine.pdbx_pd_meas_number_of_points            ? 
_refine.pdbx_pd_proc_ls_prof_R_factor            ? 
_refine.pdbx_pd_proc_ls_prof_wR_factor           ? 
_refine.pdbx_pd_Marquardt_correlation_coeff      ? 
_refine.pdbx_pd_Fsqrd_R_factor                   ? 
_refine.pdbx_pd_ls_matrix_band_width             ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_diffrn_id                           ? 
_refine.overall_SU_B                             ? 
_refine.overall_SU_ML                            ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_average_fsc_overall                 ? 
_refine.pdbx_average_fsc_work                    ? 
_refine.pdbx_average_fsc_free                    ? 
# 
loop_
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.criterion 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.number 
_refine_ls_restr.rejects 
_refine_ls_restr.type 
_refine_ls_restr.weight 
_refine_ls_restr.pdbx_restraint_function 
'ELECTRON MICROSCOPY' ? 0.009  ? 9418  ? f_bond_d           ? ? 
'ELECTRON MICROSCOPY' ? 1.366  ? 12821 ? f_angle_d          ? ? 
'ELECTRON MICROSCOPY' ? 11.668 ? 5564  ? f_dihedral_angle_d ? ? 
'ELECTRON MICROSCOPY' ? 0.071  ? 1467  ? f_chiral_restr     ? ? 
'ELECTRON MICROSCOPY' ? 0.009  ? 1607  ? f_plane_restr      ? ? 
# 
_struct.entry_id                     6DMY 
_struct.title                        'Cryo-EM structure of human Ptch1 and ShhN complex' 
_struct.pdbx_descriptor              'Protein patched homolog 1, Sonic hedgehog protein' 
_struct.pdbx_model_details           ? 
_struct.pdbx_formula_weight          ? 
_struct.pdbx_formula_weight_method   ? 
_struct.pdbx_model_type_details      ? 
_struct.pdbx_CASP_flag               N 
# 
_struct_keywords.entry_id        6DMY 
_struct_keywords.text            'Receptor, RND family, PROTEIN BINDING' 
_struct_keywords.pdbx_keywords   'PROTEIN BINDING' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
D N N 4 ? 
E N N 4 ? 
F N N 4 ? 
G N N 4 ? 
H N N 4 ? 
I N N 5 ? 
J N N 5 ? 
K N N 6 ? 
L N N 7 ? 
M N N 8 ? 
N N N 8 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  AA1 LYS A 95   ? LYS A 117  ? LYS A 74   LYS A 96   1 ? 23 
HELX_P HELX_P2  AA2 ASN A 118  ? GLY A 136  ? ASN A 97   GLY A 115  1 ? 19 
HELX_P HELX_P3  AA3 VAL A 157  ? ARG A 165  ? VAL A 136  ARG A 144  1 ? 9  
HELX_P HELX_P4  AA4 THR A 192  ? ALA A 206  ? THR A 171  ALA A 185  1 ? 15 
HELX_P HELX_P5  AA5 LYS A 219  ? CYS A 224  ? LYS A 198  CYS A 203  1 ? 6  
HELX_P HELX_P6  AA6 GLY A 235  ? LEU A 244  ? GLY A 214  LEU A 223  1 ? 10 
HELX_P HELX_P7  AA7 THR A 251  ? CYS A 255  ? THR A 230  CYS A 234  5 ? 5  
HELX_P HELX_P8  AA8 ASP A 281  ? GLU A 288  ? ASP A 260  GLU A 267  1 ? 8  
HELX_P HELX_P9  AA9 VAL A 296  ? ALA A 306  ? VAL A 275  ALA A 285  1 ? 11 
HELX_P HELX_P10 AB1 GLU A 360  ? VAL A 364  ? GLU A 339  VAL A 343  1 ? 5  
HELX_P HELX_P11 AB2 THR A 389  ? PHE A 397  ? THR A 368  PHE A 376  1 ? 9  
HELX_P HELX_P12 AB3 ASN A 409  ? SER A 431  ? ASN A 388  SER A 410  1 ? 23 
HELX_P HELX_P13 AB4 THR A 446  ? SER A 456  ? THR A 425  SER A 435  1 ? 11 
HELX_P HELX_P14 AB5 SER A 459  ? MET A 478  ? SER A 438  MET A 457  1 ? 20 
HELX_P HELX_P15 AB6 GLN A 487  ? SER A 510  ? GLN A 466  SER A 489  1 ? 24 
HELX_P HELX_P16 AB7 ALA A 519  ? THR A 546  ? ALA A 498  THR A 525  1 ? 28 
HELX_P HELX_P17 AB8 ASP A 556  ? ARG A 564  ? ASP A 535  ARG A 543  1 ? 9  
HELX_P HELX_P18 AB9 THR A 565  ? LEU A 585  ? THR A 544  LEU A 564  1 ? 21 
HELX_P HELX_P19 AC1 ILE A 588  ? ASP A 626  ? ILE A 567  ASP A 605  1 ? 39 
HELX_P HELX_P20 AC2 TRP A 751  ? PHE A 756  ? TRP A 730  PHE A 735  1 ? 6  
HELX_P HELX_P21 AC3 TYR A 761  ? LEU A 766  ? TYR A 740  LEU A 745  1 ? 6  
HELX_P HELX_P22 AC4 LYS A 771  ? THR A 790  ? LYS A 750  THR A 769  1 ? 20 
HELX_P HELX_P23 AC5 THR A 806  ? PHE A 816  ? THR A 785  PHE A 795  1 ? 11 
HELX_P HELX_P24 AC6 GLN A 837  ? PHE A 847  ? GLN A 816  PHE A 826  1 ? 11 
HELX_P HELX_P25 AC7 SER A 848  ? LYS A 851  ? SER A 827  LYS A 830  5 ? 4  
HELX_P HELX_P26 AC8 MET A 864  ? TRP A 884  ? MET A 843  TRP A 863  1 ? 21 
HELX_P HELX_P27 AC9 VAL A 902  ? GLN A 910  ? VAL A 881  GLN A 889  1 ? 9  
HELX_P HELX_P28 AD1 ASP A 919  ? LYS A 925  ? ASP A 898  LYS A 904  5 ? 7  
HELX_P HELX_P29 AD2 TYR A 941  ? ASP A 951  ? TYR A 920  ASP A 930  1 ? 11 
HELX_P HELX_P30 AD3 ASP A 951  ? SER A 958  ? ASP A 930  SER A 937  1 ? 8  
HELX_P HELX_P31 AD4 ASP A 1004 ? THR A 1023 ? ASP A 983  THR A 1002 1 ? 20 
HELX_P HELX_P32 AD5 TYR A 1034 ? TRP A 1039 ? TYR A 1013 TRP A 1018 1 ? 6  
HELX_P HELX_P33 AD6 HIS A 1047 ? PHE A 1067 ? HIS A 1026 PHE A 1046 1 ? 21 
HELX_P HELX_P34 AD7 ASN A 1070 ? GLY A 1096 ? ASN A 1049 GLY A 1075 1 ? 27 
HELX_P HELX_P35 AD8 VAL A 1102 ? ALA A 1128 ? VAL A 1081 ALA A 1107 1 ? 27 
HELX_P HELX_P36 AD9 ASN A 1133 ? MET A 1143 ? ASN A 1112 MET A 1122 1 ? 11 
HELX_P HELX_P37 AE1 MET A 1143 ? ALA A 1162 ? MET A 1122 ALA A 1141 1 ? 20 
HELX_P HELX_P38 AE2 PHE A 1166 ? PHE A 1173 ? PHE A 1145 PHE A 1152 1 ? 8  
HELX_P HELX_P39 AE3 PHE A 1173 ? PHE A 1199 ? PHE A 1152 PHE A 1178 1 ? 27 
HELX_P HELX_P40 AE4 SER B 50   ? LYS B 54   ? SER B 70   LYS B 74   5 ? 5  
HELX_P HELX_P41 AE5 THR B 79   ? ASN B 95   ? THR B 99   ASN B 115  1 ? 17 
HELX_P HELX_P42 AE6 SER B 118  ? GLU B 122  ? SER B 138  GLU B 142  5 ? 5  
HELX_P HELX_P43 AE7 LYS B 137  ? GLU B 147  ? LYS B 157  GLU B 167  1 ? 11 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
_struct_conn.pdbx_role 
disulf1 disulf ?    ? A CYS 224  SG  ? ? ? 1_555 A CYS 247 SG ? ? A CYS 203  A CYS 226  1_555 ? ? ? ? ? ? ? 2.028 ? ? 
disulf2 disulf ?    ? A CYS 255  SG  ? ? ? 1_555 A CYS 348 SG ? ? A CYS 234  A CYS 327  1_555 ? ? ? ? ? ? ? 2.035 ? ? 
disulf3 disulf ?    ? A CYS 317  SG  ? ? ? 1_555 A CYS 325 SG ? ? A CYS 296  A CYS 304  1_555 ? ? ? ? ? ? ? 2.033 ? ? 
covale1 covale one  ? A ASN 162  ND2 ? ? ? 1_555 H NAG .   C1 ? ? A ASN 141  A NAG 1807 1_555 ? ? ? ? ? ? ? 1.436 ? 
N-Glycosylation 
covale2 covale one  ? A ASN 333  ND2 ? ? ? 1_555 D NAG .   C1 ? ? A ASN 312  A NAG 1801 1_555 ? ? ? ? ? ? ? 1.428 ? 
N-Glycosylation 
covale3 covale one  ? A ASN 370  ND2 ? ? ? 1_555 E NAG .   C1 ? ? A ASN 349  A NAG 1802 1_555 ? ? ? ? ? ? ? 1.443 ? 
N-Glycosylation 
covale4 covale one  ? A ASN 435  ND2 ? ? ? 1_555 F NAG .   C1 ? ? A ASN 414  A NAG 1803 1_555 ? ? ? ? ? ? ? 1.447 ? 
N-Glycosylation 
covale5 covale one  ? A ASN 896  ND2 ? ? ? 1_555 G NAG .   C1 ? ? A ASN 875  A NAG 1804 1_555 ? ? ? ? ? ? ? 1.436 ? 
N-Glycosylation 
covale6 covale one  ? A ASN 1021 ND2 ? ? ? 1_555 C NAG .   C1 ? ? A ASN 1000 C NAG 1    1_555 ? ? ? ? ? ? ? 1.441 ? 
N-Glycosylation 
covale7 covale both ? C NAG .    O4  ? ? ? 1_555 C NAG .   C1 ? ? C NAG 1    C NAG 2    1_555 ? ? ? ? ? ? ? 1.427 ? ? 
metalc1 metalc ?    ? B GLU 69   OE1 ? ? ? 1_555 N CA  .   CA ? ? B GLU 89   B CA  204  1_555 ? ? ? ? ? ? ? 2.537 ? ? 
metalc2 metalc ?    ? B GLU 69   OE2 ? ? ? 1_555 N CA  .   CA ? ? B GLU 89   B CA  204  1_555 ? ? ? ? ? ? ? 2.429 ? ? 
metalc3 metalc ?    ? B GLU 70   OE2 ? ? ? 1_555 M CA  .   CA ? ? B GLU 90   B CA  203  1_555 ? ? ? ? ? ? ? 2.736 ? ? 
metalc4 metalc ?    ? B ASP 75   OD1 ? ? ? 1_555 N CA  .   CA ? ? B ASP 95   B CA  204  1_555 ? ? ? ? ? ? ? 2.501 ? ? 
metalc5 metalc ?    ? B ASP 75   OD2 ? ? ? 1_555 N CA  .   CA ? ? B ASP 95   B CA  204  1_555 ? ? ? ? ? ? ? 2.536 ? ? 
metalc6 metalc ?    ? B THR 105  O   ? ? ? 1_555 N CA  .   CA ? ? B THR 125  B CA  204  1_555 ? ? ? ? ? ? ? 2.497 ? ? 
metalc7 metalc ?    ? B HIS 120  NE2 ? ? ? 1_555 L ZN  .   ZN ? ? B HIS 140  B ZN  202  1_555 ? ? ? ? ? ? ? 2.181 ? ? 
metalc8 metalc ?    ? B ASP 127  OD1 ? ? ? 1_555 L ZN  .   ZN ? ? B ASP 147  B ZN  202  1_555 ? ? ? ? ? ? ? 2.272 ? ? 
metalc9 metalc ?    ? B ASP 127  OD2 ? ? ? 1_555 L ZN  .   ZN ? ? B ASP 147  B ZN  202  1_555 ? ? ? ? ? ? ? 2.084 ? ? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
disulf ? ? 
covale ? ? 
metalc ? ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 GLU 857 A . ? GLU 836 A ASN 858 A ? ASN 837 A 1 -8.58 
2 ARG 963 A . ? ARG 942 A PRO 964 A ? PRO 943 A 1 10.08 
3 ILE 28  B . ? ILE 48  B PRO 29  B ? PRO 49  B 1 2.74  
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA1 ? 4 ? 
AA2 ? 2 ? 
AA3 ? 3 ? 
AA4 ? 6 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA1 1 2 ? anti-parallel 
AA1 2 3 ? anti-parallel 
AA1 3 4 ? anti-parallel 
AA2 1 2 ? anti-parallel 
AA3 1 2 ? anti-parallel 
AA3 2 3 ? anti-parallel 
AA4 1 2 ? anti-parallel 
AA4 2 3 ? anti-parallel 
AA4 3 4 ? anti-parallel 
AA4 4 5 ? anti-parallel 
AA4 5 6 ? parallel      
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA1 1 ILE A 249  ? ILE A 250  ? ILE A 228  ILE A 229  
AA1 2 LEU A 381  ? PHE A 385  ? LEU A 360  PHE A 364  
AA1 3 GLN A 177  ? THR A 182  ? GLN A 156  THR A 161  
AA1 4 LYS A 439  ? PHE A 443  ? LYS A 418  PHE A 422  
AA2 1 GLY A 347  ? HIS A 349  ? GLY A 326  HIS A 328  
AA2 2 HIS A 357  ? GLN A 359  ? HIS A 336  GLN A 338  
AA3 1 ALA A 993  ? LEU A 999  ? ALA A 972  LEU A 978  
AA3 2 TYR A 822  ? GLN A 829  ? TYR A 801  GLN A 808  
AA3 3 SER A 1028 ? GLY A 1033 ? SER A 1007 GLY A 1012 
AA4 1 PHE B 27   ? ILE B 28   ? PHE B 47   ILE B 48   
AA4 2 TRP B 152  ? TYR B 154  ? TRP B 172  TYR B 174  
AA4 3 ILE B 161  ? SER B 164  ? ILE B 181  SER B 184  
AA4 4 ALA B 125  ? THR B 129  ? ALA B 145  THR B 149  
AA4 5 ARG B 103  ? GLU B 106  ? ARG B 123  GLU B 126  
AA4 6 ILE B 65   ? PHE B 66   ? ILE B 85   PHE B 86   
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA1 1 2 N ILE A 250 ? N ILE A 229 O MET A 384  ? O MET A 363  
AA1 2 3 O PHE A 385 ? O PHE A 364 N GLN A 177  ? N GLN A 156  
AA1 3 4 N THR A 182 ? N THR A 161 O LYS A 439  ? O LYS A 418  
AA2 1 2 N CYS A 348 ? N CYS A 327 O TRP A 358  ? O TRP A 337  
AA3 1 2 O PHE A 997 ? O PHE A 976 N MET A 824  ? N MET A 803  
AA3 2 3 N VAL A 827 ? N VAL A 806 O TYR A 1030 ? O TYR A 1009 
AA4 1 2 N ILE B 28  ? N ILE B 48  O VAL B 153  ? O VAL B 173  
AA4 2 3 O TYR B 154 ? O TYR B 174 N HIS B 162  ? N HIS B 182  
AA4 3 4 O ILE B 161 ? O ILE B 181 N ILE B 128  ? N ILE B 148  
AA4 4 5 O THR B 129 ? O THR B 149 N ARG B 103  ? N ARG B 123  
AA4 5 6 O VAL B 104 ? O VAL B 124 N ILE B 65   ? N ILE B 85   
# 
_atom_sites.entry_id                    6DMY 
_atom_sites.fract_transf_matrix[1][1]   1.000000 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   1.000000 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   1.000000 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
CA 
N  
O  
S  
ZN 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N  N   . ARG A 1 94   ? 102.599 135.127 147.003 1.00 60.61  ? 73   ARG A N   1 
ATOM   2    C  CA  . ARG A 1 94   ? 103.098 135.065 148.370 1.00 60.61  ? 73   ARG A CA  1 
ATOM   3    C  C   . ARG A 1 94   ? 102.783 133.716 148.979 1.00 60.61  ? 73   ARG A C   1 
ATOM   4    O  O   . ARG A 1 94   ? 103.563 133.176 149.756 1.00 60.61  ? 73   ARG A O   1 
ATOM   5    C  CB  . ARG A 1 94   ? 102.496 136.186 149.219 1.00 30.00  ? 73   ARG A CB  1 
ATOM   6    N  N   . LYS A 1 95   ? 101.640 133.166 148.590 1.00 68.30  ? 74   LYS A N   1 
ATOM   7    C  CA  . LYS A 1 95   ? 101.121 131.946 149.184 1.00 68.30  ? 74   LYS A CA  1 
ATOM   8    C  C   . LYS A 1 95   ? 100.699 130.897 148.176 1.00 68.30  ? 74   LYS A C   1 
ATOM   9    O  O   . LYS A 1 95   ? 100.615 129.721 148.541 1.00 68.30  ? 74   LYS A O   1 
ATOM   10   C  CB  . LYS A 1 95   ? 99.930  132.274 150.092 1.00 68.30  ? 74   LYS A CB  1 
ATOM   11   C  CG  . LYS A 1 95   ? 98.780  132.951 149.372 1.00 68.30  ? 74   LYS A CG  1 
ATOM   12   C  CD  . LYS A 1 95   ? 97.666  133.276 150.340 1.00 68.30  ? 74   LYS A CD  1 
ATOM   13   C  CE  . LYS A 1 95   ? 98.068  134.403 151.266 1.00 68.30  ? 74   LYS A CE  1 
ATOM   14   N  NZ  . LYS A 1 95   ? 98.225  135.683 150.537 1.00 68.30  ? 74   LYS A NZ  1 
ATOM   15   N  N   . ALA A 1 96   ? 100.428 131.270 146.943 1.00 70.47  ? 75   ALA A N   1 
ATOM   16   C  CA  . ALA A 1 96   ? 100.147 130.323 145.872 1.00 70.47  ? 75   ALA A CA  1 
ATOM   17   C  C   . ALA A 1 96   ? 101.369 129.655 145.227 1.00 70.47  ? 75   ALA A C   1 
ATOM   18   O  O   . ALA A 1 96   ? 101.260 128.460 144.928 1.00 70.47  ? 75   ALA A O   1 
ATOM   19   C  CB  . ALA A 1 96   ? 99.290  130.996 144.794 1.00 70.47  ? 75   ALA A CB  1 
ATOM   20   N  N   . PRO A 1 97   ? 102.513 130.331 144.949 1.00 65.46  ? 76   PRO A N   1 
ATOM   21   C  CA  . PRO A 1 97   ? 103.638 129.593 144.333 1.00 65.46  ? 76   PRO A CA  1 
ATOM   22   C  C   . PRO A 1 97   ? 104.207 128.473 145.186 1.00 65.46  ? 76   PRO A C   1 
ATOM   23   O  O   . PRO A 1 97   ? 104.633 127.446 144.641 1.00 65.46  ? 76   PRO A O   1 
ATOM   24   C  CB  . PRO A 1 97   ? 104.688 130.686 144.095 1.00 65.46  ? 76   PRO A CB  1 
ATOM   25   C  CG  . PRO A 1 97   ? 103.933 131.893 143.963 1.00 65.46  ? 76   PRO A CG  1 
ATOM   26   C  CD  . PRO A 1 97   ? 102.817 131.779 144.925 1.00 65.46  ? 76   PRO A CD  1 
ATOM   27   N  N   . LEU A 1 98   ? 104.200 128.621 146.507 1.00 63.77  ? 77   LEU A N   1 
ATOM   28   C  CA  . LEU A 1 98   ? 104.674 127.531 147.345 1.00 63.77  ? 77   LEU A CA  1 
ATOM   29   C  C   . LEU A 1 98   ? 103.680 126.381 147.381 1.00 63.77  ? 77   LEU A C   1 
ATOM   30   O  O   . LEU A 1 98   ? 104.086 125.214 147.455 1.00 63.77  ? 77   LEU A O   1 
ATOM   31   C  CB  . LEU A 1 98   ? 104.959 128.054 148.740 1.00 63.77  ? 77   LEU A CB  1 
ATOM   32   C  CG  . LEU A 1 98   ? 106.121 129.035 148.715 1.00 63.77  ? 77   LEU A CG  1 
ATOM   33   C  CD1 . LEU A 1 98   ? 106.249 129.703 150.053 1.00 63.77  ? 77   LEU A CD1 1 
ATOM   34   C  CD2 . LEU A 1 98   ? 107.408 128.324 148.361 1.00 63.77  ? 77   LEU A CD2 1 
ATOM   35   N  N   . TRP A 1 99   ? 102.382 126.684 147.299 1.00 74.33  ? 78   TRP A N   1 
ATOM   36   C  CA  . TRP A 1 99   ? 101.387 125.622 147.210 1.00 74.33  ? 78   TRP A CA  1 
ATOM   37   C  C   . TRP A 1 99   ? 101.475 124.895 145.880 1.00 74.33  ? 78   TRP A C   1 
ATOM   38   O  O   . TRP A 1 99   ? 101.268 123.678 145.815 1.00 74.33  ? 78   TRP A O   1 
ATOM   39   C  CB  . TRP A 1 99   ? 99.986  126.186 147.405 1.00 74.33  ? 78   TRP A CB  1 
ATOM   40   C  CG  . TRP A 1 99   ? 98.949  125.128 147.343 1.00 74.33  ? 78   TRP A CG  1 
ATOM   41   C  CD1 . TRP A 1 99   ? 98.857  124.038 148.150 1.00 74.33  ? 78   TRP A CD1 1 
ATOM   42   C  CD2 . TRP A 1 99   ? 97.842  125.055 146.442 1.00 74.33  ? 78   TRP A CD2 1 
ATOM   43   N  NE1 . TRP A 1 99   ? 97.768  123.282 147.804 1.00 74.33  ? 78   TRP A NE1 1 
ATOM   44   C  CE2 . TRP A 1 99   ? 97.125  123.887 146.757 1.00 74.33  ? 78   TRP A CE2 1 
ATOM   45   C  CE3 . TRP A 1 99   ? 97.387  125.861 145.397 1.00 74.33  ? 78   TRP A CE3 1 
ATOM   46   C  CZ2 . TRP A 1 99   ? 95.980  123.504 146.068 1.00 74.33  ? 78   TRP A CZ2 1 
ATOM   47   C  CZ3 . TRP A 1 99   ? 96.250  125.477 144.712 1.00 74.33  ? 78   TRP A CZ3 1 
ATOM   48   C  CH2 . TRP A 1 99   ? 95.559  124.311 145.051 1.00 74.33  ? 78   TRP A CH2 1 
ATOM   49   N  N   . LEU A 1 100  ? 101.802 125.615 144.811 1.00 66.17  ? 79   LEU A N   1 
ATOM   50   C  CA  . LEU A 1 100  ? 101.863 124.970 143.509 1.00 66.17  ? 79   LEU A CA  1 
ATOM   51   C  C   . LEU A 1 100  ? 103.127 124.139 143.350 1.00 66.17  ? 79   LEU A C   1 
ATOM   52   O  O   . LEU A 1 100  ? 103.066 123.035 142.798 1.00 66.17  ? 79   LEU A O   1 
ATOM   53   C  CB  . LEU A 1 100  ? 101.731 126.010 142.406 1.00 66.17  ? 79   LEU A CB  1 
ATOM   54   C  CG  . LEU A 1 100  ? 100.301 126.539 142.451 1.00 66.17  ? 79   LEU A CG  1 
ATOM   55   C  CD1 . LEU A 1 100  ? 100.106 127.645 141.467 1.00 66.17  ? 79   LEU A CD1 1 
ATOM   56   C  CD2 . LEU A 1 100  ? 99.282  125.431 142.212 1.00 66.17  ? 79   LEU A CD2 1 
ATOM   57   N  N   . ARG A 1 101  ? 104.268 124.623 143.853 1.00 68.29  ? 80   ARG A N   1 
ATOM   58   C  CA  . ARG A 1 101  ? 105.454 123.774 143.888 1.00 68.29  ? 80   ARG A CA  1 
ATOM   59   C  C   . ARG A 1 101  ? 105.256 122.579 144.806 1.00 68.29  ? 80   ARG A C   1 
ATOM   60   O  O   . ARG A 1 101  ? 105.816 121.505 144.548 1.00 68.29  ? 80   ARG A O   1 
ATOM   61   C  CB  . ARG A 1 101  ? 106.676 124.571 144.322 1.00 68.29  ? 80   ARG A CB  1 
ATOM   62   C  CG  . ARG A 1 101  ? 107.182 125.534 143.291 1.00 68.29  ? 80   ARG A CG  1 
ATOM   63   C  CD  . ARG A 1 101  ? 108.343 126.342 143.834 1.00 68.29  ? 80   ARG A CD  1 
ATOM   64   N  NE  . ARG A 1 101  ? 109.509 125.527 144.157 1.00 68.29  ? 80   ARG A NE  1 
ATOM   65   C  CZ  . ARG A 1 101  ? 109.993 125.362 145.385 1.00 68.29  ? 80   ARG A CZ  1 
ATOM   66   N  NH1 . ARG A 1 101  ? 109.424 125.960 146.417 1.00 68.29  ? 80   ARG A NH1 1 
ATOM   67   N  NH2 . ARG A 1 101  ? 111.058 124.604 145.581 1.00 68.29  ? 80   ARG A NH2 1 
ATOM   68   N  N   . ALA A 1 102  ? 104.451 122.743 145.861 1.00 76.34  ? 81   ALA A N   1 
ATOM   69   C  CA  . ALA A 1 102  ? 104.057 121.599 146.673 1.00 76.34  ? 81   ALA A CA  1 
ATOM   70   C  C   . ALA A 1 102  ? 103.247 120.607 145.857 1.00 76.34  ? 81   ALA A C   1 
ATOM   71   O  O   . ALA A 1 102  ? 103.405 119.392 146.014 1.00 76.34  ? 81   ALA A O   1 
ATOM   72   C  CB  . ALA A 1 102  ? 103.260 122.062 147.887 1.00 76.34  ? 81   ALA A CB  1 
ATOM   73   N  N   . LYS A 1 103  ? 102.403 121.102 144.953 1.00 73.24  ? 82   LYS A N   1 
ATOM   74   C  CA  . LYS A 1 103  ? 101.588 120.191 144.158 1.00 73.24  ? 82   LYS A CA  1 
ATOM   75   C  C   . LYS A 1 103  ? 102.410 119.497 143.078 1.00 73.24  ? 82   LYS A C   1 
ATOM   76   O  O   . LYS A 1 103  ? 102.099 118.361 142.708 1.00 73.24  ? 82   LYS A O   1 
ATOM   77   C  CB  . LYS A 1 103  ? 100.403 120.943 143.556 1.00 73.24  ? 82   LYS A CB  1 
ATOM   78   C  CG  . LYS A 1 103  ? 99.371  120.059 142.898 1.00 73.24  ? 82   LYS A CG  1 
ATOM   79   C  CD  . LYS A 1 103  ? 98.802  119.054 143.886 1.00 73.24  ? 82   LYS A CD  1 
ATOM   80   C  CE  . LYS A 1 103  ? 97.987  119.726 144.980 1.00 73.24  ? 82   LYS A CE  1 
ATOM   81   N  NZ  . LYS A 1 103  ? 96.721  120.308 144.463 1.00 73.24  ? 82   LYS A NZ  1 
ATOM   82   N  N   . PHE A 1 104  ? 103.470 120.140 142.575 1.00 77.87  ? 83   PHE A N   1 
ATOM   83   C  CA  . PHE A 1 104  ? 104.376 119.431 141.671 1.00 77.87  ? 83   PHE A CA  1 
ATOM   84   C  C   . PHE A 1 104  ? 105.187 118.378 142.417 1.00 77.87  ? 83   PHE A C   1 
ATOM   85   O  O   . PHE A 1 104  ? 105.395 117.272 141.906 1.00 77.87  ? 83   PHE A O   1 
ATOM   86   C  CB  . PHE A 1 104  ? 105.325 120.398 140.954 1.00 77.87  ? 83   PHE A CB  1 
ATOM   87   C  CG  . PHE A 1 104  ? 104.687 121.184 139.842 1.00 77.87  ? 83   PHE A CG  1 
ATOM   88   C  CD1 . PHE A 1 104  ? 104.419 120.589 138.625 1.00 77.87  ? 83   PHE A CD1 1 
ATOM   89   C  CD2 . PHE A 1 104  ? 104.401 122.528 139.997 1.00 77.87  ? 83   PHE A CD2 1 
ATOM   90   C  CE1 . PHE A 1 104  ? 103.837 121.316 137.592 1.00 77.87  ? 83   PHE A CE1 1 
ATOM   91   C  CE2 . PHE A 1 104  ? 103.822 123.260 138.972 1.00 77.87  ? 83   PHE A CE2 1 
ATOM   92   C  CZ  . PHE A 1 104  ? 103.542 122.655 137.770 1.00 77.87  ? 83   PHE A CZ  1 
ATOM   93   N  N   . GLN A 1 105  ? 105.649 118.699 143.625 1.00 79.14  ? 84   GLN A N   1 
ATOM   94   C  CA  . GLN A 1 105  ? 106.533 117.783 144.335 1.00 79.14  ? 84   GLN A CA  1 
ATOM   95   C  C   . GLN A 1 105  ? 105.791 116.576 144.903 1.00 79.14  ? 84   GLN A C   1 
ATOM   96   O  O   . GLN A 1 105  ? 106.327 115.457 144.891 1.00 79.14  ? 84   GLN A O   1 
ATOM   97   C  CB  . GLN A 1 105  ? 107.262 118.526 145.450 1.00 79.14  ? 84   GLN A CB  1 
ATOM   98   C  CG  . GLN A 1 105  ? 108.352 119.450 144.966 1.00 79.14  ? 84   GLN A CG  1 
ATOM   99   C  CD  . GLN A 1 105  ? 109.044 120.165 146.098 1.00 79.14  ? 84   GLN A CD  1 
ATOM   100  O  OE1 . GLN A 1 105  ? 108.627 120.074 147.247 1.00 79.14  ? 84   GLN A OE1 1 
ATOM   101  N  NE2 . GLN A 1 105  ? 110.126 120.859 145.786 1.00 79.14  ? 84   GLN A NE2 1 
ATOM   102  N  N   . ARG A 1 106  ? 104.558 116.775 145.376 1.00 89.36  ? 85   ARG A N   1 
ATOM   103  C  CA  . ARG A 1 106  ? 103.895 115.758 146.185 1.00 89.36  ? 85   ARG A CA  1 
ATOM   104  C  C   . ARG A 1 106  ? 103.472 114.531 145.387 1.00 89.36  ? 85   ARG A C   1 
ATOM   105  O  O   . ARG A 1 106  ? 103.243 113.477 145.987 1.00 89.36  ? 85   ARG A O   1 
ATOM   106  C  CB  . ARG A 1 106  ? 102.675 116.354 146.886 1.00 89.36  ? 85   ARG A CB  1 
ATOM   107  C  CG  . ARG A 1 106  ? 101.539 116.721 145.968 1.00 89.36  ? 85   ARG A CG  1 
ATOM   108  C  CD  . ARG A 1 106  ? 100.409 117.352 146.742 1.00 89.36  ? 85   ARG A CD  1 
ATOM   109  N  NE  . ARG A 1 106  ? 99.771  116.408 147.651 1.00 89.36  ? 85   ARG A NE  1 
ATOM   110  C  CZ  . ARG A 1 106  ? 98.942  116.759 148.627 1.00 89.36  ? 85   ARG A CZ  1 
ATOM   111  N  NH1 . ARG A 1 106  ? 98.399  115.838 149.406 1.00 89.36  ? 85   ARG A NH1 1 
ATOM   112  N  NH2 . ARG A 1 106  ? 98.650  118.034 148.821 1.00 89.36  ? 85   ARG A NH2 1 
ATOM   113  N  N   . LEU A 1 107  ? 103.371 114.632 144.060 1.00 74.26  ? 86   LEU A N   1 
ATOM   114  C  CA  . LEU A 1 107  ? 103.024 113.493 143.215 1.00 74.26  ? 86   LEU A CA  1 
ATOM   115  C  C   . LEU A 1 107  ? 104.248 112.830 142.611 1.00 74.26  ? 86   LEU A C   1 
ATOM   116  O  O   . LEU A 1 107  ? 104.310 111.598 142.508 1.00 74.26  ? 86   LEU A O   1 
ATOM   117  C  CB  . LEU A 1 107  ? 102.075 113.937 142.096 1.00 74.26  ? 86   LEU A CB  1 
ATOM   118  C  CG  . LEU A 1 107  ? 100.678 114.426 142.499 1.00 74.26  ? 86   LEU A CG  1 
ATOM   119  C  CD1 . LEU A 1 107  ? 99.910  114.991 141.300 1.00 74.26  ? 86   LEU A CD1 1 
ATOM   120  C  CD2 . LEU A 1 107  ? 99.880  113.319 143.182 1.00 74.26  ? 86   LEU A CD2 1 
ATOM   121  N  N   . LEU A 1 108  ? 105.232 113.640 142.235 1.00 72.89  ? 87   LEU A N   1 
ATOM   122  C  CA  . LEU A 1 108  ? 106.482 113.130 141.694 1.00 72.89  ? 87   LEU A CA  1 
ATOM   123  C  C   . LEU A 1 108  ? 107.263 112.356 142.746 1.00 72.89  ? 87   LEU A C   1 
ATOM   124  O  O   . LEU A 1 108  ? 108.032 111.449 142.404 1.00 72.89  ? 87   LEU A O   1 
ATOM   125  C  CB  . LEU A 1 108  ? 107.272 114.312 141.132 1.00 72.89  ? 87   LEU A CB  1 
ATOM   126  C  CG  . LEU A 1 108  ? 108.506 114.216 140.246 1.00 72.89  ? 87   LEU A CG  1 
ATOM   127  C  CD1 . LEU A 1 108  ? 109.724 114.102 141.067 1.00 72.89  ? 87   LEU A CD1 1 
ATOM   128  C  CD2 . LEU A 1 108  ? 108.376 113.019 139.340 1.00 72.89  ? 87   LEU A CD2 1 
ATOM   129  N  N   . PHE A 1 109  ? 107.065 112.690 144.023 1.00 75.89  ? 88   PHE A N   1 
ATOM   130  C  CA  . PHE A 1 109  ? 107.586 111.858 145.104 1.00 75.89  ? 88   PHE A CA  1 
ATOM   131  C  C   . PHE A 1 109  ? 106.944 110.473 145.122 1.00 75.89  ? 88   PHE A C   1 
ATOM   132  O  O   . PHE A 1 109  ? 107.635 109.468 145.343 1.00 75.89  ? 88   PHE A O   1 
ATOM   133  C  CB  . PHE A 1 109  ? 107.372 112.561 146.438 1.00 75.89  ? 88   PHE A CB  1 
ATOM   134  C  CG  . PHE A 1 109  ? 107.598 111.679 147.606 1.00 75.89  ? 88   PHE A CG  1 
ATOM   135  C  CD1 . PHE A 1 109  ? 108.870 111.257 147.931 1.00 75.89  ? 88   PHE A CD1 1 
ATOM   136  C  CD2 . PHE A 1 109  ? 106.534 111.276 148.386 1.00 75.89  ? 88   PHE A CD2 1 
ATOM   137  C  CE1 . PHE A 1 109  ? 109.074 110.434 149.006 1.00 75.89  ? 88   PHE A CE1 1 
ATOM   138  C  CE2 . PHE A 1 109  ? 106.731 110.455 149.458 1.00 75.89  ? 88   PHE A CE2 1 
ATOM   139  C  CZ  . PHE A 1 109  ? 107.999 110.033 149.765 1.00 75.89  ? 88   PHE A CZ  1 
ATOM   140  N  N   . LYS A 1 110  ? 105.620 110.403 144.927 1.00 87.04  ? 89   LYS A N   1 
ATOM   141  C  CA  . LYS A 1 110  ? 104.927 109.117 144.875 1.00 87.04  ? 89   LYS A CA  1 
ATOM   142  C  C   . LYS A 1 110  ? 105.411 108.283 143.701 1.00 87.04  ? 89   LYS A C   1 
ATOM   143  O  O   . LYS A 1 110  ? 105.582 107.060 143.820 1.00 87.04  ? 89   LYS A O   1 
ATOM   144  C  CB  . LYS A 1 110  ? 103.418 109.328 144.774 1.00 87.04  ? 89   LYS A CB  1 
ATOM   145  C  CG  . LYS A 1 110  ? 102.626 108.037 144.789 1.00 87.04  ? 89   LYS A CG  1 
ATOM   146  C  CD  . LYS A 1 110  ? 101.151 108.250 144.523 1.00 87.04  ? 89   LYS A CD  1 
ATOM   147  C  CE  . LYS A 1 110  ? 100.434 108.807 145.726 1.00 87.04  ? 89   LYS A CE  1 
ATOM   148  N  NZ  . LYS A 1 110  ? 98.966  108.796 145.501 1.00 87.04  ? 89   LYS A NZ  1 
ATOM   149  N  N   . LEU A 1 111  ? 105.649 108.941 142.561 1.00 87.93  ? 90   LEU A N   1 
ATOM   150  C  CA  . LEU A 1 111  ? 106.287 108.280 141.427 1.00 87.93  ? 90   LEU A CA  1 
ATOM   151  C  C   . LEU A 1 111  ? 107.672 107.772 141.798 1.00 87.93  ? 90   LEU A C   1 
ATOM   152  O  O   . LEU A 1 111  ? 108.068 106.684 141.374 1.00 87.93  ? 90   LEU A O   1 
ATOM   153  C  CB  . LEU A 1 111  ? 106.362 109.240 140.240 1.00 87.93  ? 90   LEU A CB  1 
ATOM   154  C  CG  . LEU A 1 111  ? 106.933 108.703 138.932 1.00 87.93  ? 90   LEU A CG  1 
ATOM   155  C  CD1 . LEU A 1 111  ? 106.082 107.561 138.439 1.00 87.93  ? 90   LEU A CD1 1 
ATOM   156  C  CD2 . LEU A 1 111  ? 106.985 109.798 137.889 1.00 87.93  ? 90   LEU A CD2 1 
ATOM   157  N  N   . GLY A 1 112  ? 108.395 108.516 142.637 1.00 90.88  ? 91   GLY A N   1 
ATOM   158  C  CA  . GLY A 1 112  ? 109.656 108.015 143.156 1.00 90.88  ? 91   GLY A CA  1 
ATOM   159  C  C   . GLY A 1 112  ? 109.506 106.798 144.048 1.00 90.88  ? 91   GLY A C   1 
ATOM   160  O  O   . GLY A 1 112  ? 110.398 105.944 144.092 1.00 90.88  ? 91   GLY A O   1 
ATOM   161  N  N   . CYS A 1 113  ? 108.377 106.688 144.754 1.00 97.55  ? 92   CYS A N   1 
ATOM   162  C  CA  . CYS A 1 113  ? 108.134 105.509 145.582 1.00 97.55  ? 92   CYS A CA  1 
ATOM   163  C  C   . CYS A 1 113  ? 107.846 104.280 144.728 1.00 97.55  ? 92   CYS A C   1 
ATOM   164  O  O   . CYS A 1 113  ? 108.424 103.205 144.944 1.00 97.55  ? 92   CYS A O   1 
ATOM   165  C  CB  . CYS A 1 113  ? 106.975 105.771 146.543 1.00 97.55  ? 92   CYS A CB  1 
ATOM   166  S  SG  . CYS A 1 113  ? 107.292 107.041 147.788 1.00 97.55  ? 92   CYS A SG  1 
ATOM   167  N  N   . TYR A 1 114  ? 106.947 104.418 143.751 1.00 90.26  ? 93   TYR A N   1 
ATOM   168  C  CA  . TYR A 1 114  ? 106.573 103.271 142.931 1.00 90.26  ? 93   TYR A CA  1 
ATOM   169  C  C   . TYR A 1 114  ? 107.699 102.855 141.993 1.00 90.26  ? 93   TYR A C   1 
ATOM   170  O  O   . TYR A 1 114  ? 107.782 101.683 141.617 1.00 90.26  ? 93   TYR A O   1 
ATOM   171  C  CB  . TYR A 1 114  ? 105.296 103.589 142.158 1.00 90.26  ? 93   TYR A CB  1 
ATOM   172  C  CG  . TYR A 1 114  ? 104.742 102.441 141.350 1.00 90.26  ? 93   TYR A CG  1 
ATOM   173  C  CD1 . TYR A 1 114  ? 104.273 101.295 141.976 1.00 90.26  ? 93   TYR A CD1 1 
ATOM   174  C  CD2 . TYR A 1 114  ? 104.616 102.530 139.970 1.00 90.26  ? 93   TYR A CD2 1 
ATOM   175  C  CE1 . TYR A 1 114  ? 103.739 100.249 141.249 1.00 90.26  ? 93   TYR A CE1 1 
ATOM   176  C  CE2 . TYR A 1 114  ? 104.082 101.487 139.235 1.00 90.26  ? 93   TYR A CE2 1 
ATOM   177  C  CZ  . TYR A 1 114  ? 103.646 100.351 139.883 1.00 90.26  ? 93   TYR A CZ  1 
ATOM   178  O  OH  . TYR A 1 114  ? 103.113 99.311  139.162 1.00 90.26  ? 93   TYR A OH  1 
ATOM   179  N  N   . ILE A 1 115  ? 108.576 103.791 141.615 1.00 85.36  ? 94   ILE A N   1 
ATOM   180  C  CA  . ILE A 1 115  ? 109.809 103.408 140.933 1.00 85.36  ? 94   ILE A CA  1 
ATOM   181  C  C   . ILE A 1 115  ? 110.776 102.739 141.910 1.00 85.36  ? 94   ILE A C   1 
ATOM   182  O  O   . ILE A 1 115  ? 111.489 101.797 141.537 1.00 85.36  ? 94   ILE A O   1 
ATOM   183  C  CB  . ILE A 1 115  ? 110.428 104.636 140.224 1.00 85.36  ? 94   ILE A CB  1 
ATOM   184  C  CG1 . ILE A 1 115  ? 109.538 105.090 139.067 1.00 85.36  ? 94   ILE A CG1 1 
ATOM   185  C  CG2 . ILE A 1 115  ? 111.829 104.374 139.691 1.00 85.36  ? 94   ILE A CG2 1 
ATOM   186  C  CD1 . ILE A 1 115  ? 109.318 104.053 138.020 1.00 85.36  ? 94   ILE A CD1 1 
ATOM   187  N  N   . GLN A 1 116  ? 110.783 103.175 143.177 1.00 80.81  ? 95   GLN A N   1 
ATOM   188  C  CA  . GLN A 1 116  ? 111.686 102.589 144.168 1.00 80.81  ? 95   GLN A CA  1 
ATOM   189  C  C   . GLN A 1 116  ? 111.360 101.125 144.441 1.00 80.81  ? 95   GLN A C   1 
ATOM   190  O  O   . GLN A 1 116  ? 112.269 100.293 144.549 1.00 80.81  ? 95   GLN A O   1 
ATOM   191  C  CB  . GLN A 1 116  ? 111.643 103.402 145.464 1.00 80.81  ? 95   GLN A CB  1 
ATOM   192  C  CG  . GLN A 1 116  ? 112.443 102.816 146.617 1.00 80.81  ? 95   GLN A CG  1 
ATOM   193  C  CD  . GLN A 1 116  ? 113.925 102.693 146.330 1.00 80.81  ? 95   GLN A CD  1 
ATOM   194  O  OE1 . GLN A 1 116  ? 114.418 101.612 146.020 1.00 80.81  ? 95   GLN A OE1 1 
ATOM   195  N  NE2 . GLN A 1 116  ? 114.650 103.791 146.469 1.00 80.81  ? 95   GLN A NE2 1 
ATOM   196  N  N   . LYS A 1 117  ? 110.075 100.776 144.504 1.00 85.47  ? 96   LYS A N   1 
ATOM   197  C  CA  . LYS A 1 117  ? 109.702 99.388  144.768 1.00 85.47  ? 96   LYS A CA  1 
ATOM   198  C  C   . LYS A 1 117  ? 109.885 98.449  143.581 1.00 85.47  ? 96   LYS A C   1 
ATOM   199  O  O   . LYS A 1 117  ? 109.735 97.235  143.749 1.00 85.47  ? 96   LYS A O   1 
ATOM   200  C  CB  . LYS A 1 117  ? 108.250 99.303  145.241 1.00 85.47  ? 96   LYS A CB  1 
ATOM   201  C  CG  . LYS A 1 117  ? 108.042 99.741  146.663 1.00 85.47  ? 96   LYS A CG  1 
ATOM   202  C  CD  . LYS A 1 117  ? 108.816 98.820  147.591 1.00 85.47  ? 96   LYS A CD  1 
ATOM   203  C  CE  . LYS A 1 117  ? 108.233 97.420  147.597 1.00 85.47  ? 96   LYS A CE  1 
ATOM   204  N  NZ  . LYS A 1 117  ? 108.956 96.527  148.536 1.00 85.47  ? 96   LYS A NZ  1 
ATOM   205  N  N   . ASN A 1 118  ? 110.199 98.956  142.400 1.00 88.83  ? 97   ASN A N   1 
ATOM   206  C  CA  . ASN A 1 118  ? 110.229 98.144  141.192 1.00 88.83  ? 97   ASN A CA  1 
ATOM   207  C  C   . ASN A 1 118  ? 111.560 98.306  140.488 1.00 88.83  ? 97   ASN A C   1 
ATOM   208  O  O   . ASN A 1 118  ? 111.631 98.631  139.300 1.00 88.83  ? 97   ASN A O   1 
ATOM   209  C  CB  . ASN A 1 118  ? 109.059 98.499  140.298 1.00 88.83  ? 97   ASN A CB  1 
ATOM   210  C  CG  . ASN A 1 118  ? 107.742 98.174  140.950 1.00 88.83  ? 97   ASN A CG  1 
ATOM   211  O  OD1 . ASN A 1 118  ? 107.609 97.150  141.618 1.00 88.83  ? 97   ASN A OD1 1 
ATOM   212  N  ND2 . ASN A 1 118  ? 106.762 99.048  140.778 1.00 88.83  ? 97   ASN A ND2 1 
ATOM   213  N  N   . CYS A 1 119  ? 112.630 98.088  141.262 1.00 85.46  ? 98   CYS A N   1 
ATOM   214  C  CA  . CYS A 1 119  ? 113.995 98.424  140.866 1.00 85.46  ? 98   CYS A CA  1 
ATOM   215  C  C   . CYS A 1 119  ? 114.438 97.678  139.611 1.00 85.46  ? 98   CYS A C   1 
ATOM   216  O  O   . CYS A 1 119  ? 114.732 98.291  138.582 1.00 85.46  ? 98   CYS A O   1 
ATOM   217  C  CB  . CYS A 1 119  ? 114.937 98.131  142.032 1.00 85.46  ? 98   CYS A CB  1 
ATOM   218  S  SG  . CYS A 1 119  ? 114.906 96.413  142.607 1.00 85.46  ? 98   CYS A SG  1 
ATOM   219  N  N   . GLY A 1 120  ? 114.494 96.350  139.672 1.00 94.87  ? 99   GLY A N   1 
ATOM   220  C  CA  . GLY A 1 120  ? 114.899 95.613  138.492 1.00 94.87  ? 99   GLY A CA  1 
ATOM   221  C  C   . GLY A 1 120  ? 113.827 95.498  137.437 1.00 94.87  ? 99   GLY A C   1 
ATOM   222  O  O   . GLY A 1 120  ? 114.151 95.349  136.252 1.00 94.87  ? 99   GLY A O   1 
ATOM   223  N  N   . LYS A 1 121  ? 112.561 95.601  137.844 1.00 89.26  ? 100  LYS A N   1 
ATOM   224  C  CA  . LYS A 1 121  ? 111.450 95.274  136.958 1.00 89.26  ? 100  LYS A CA  1 
ATOM   225  C  C   . LYS A 1 121  ? 111.324 96.292  135.830 1.00 89.26  ? 100  LYS A C   1 
ATOM   226  O  O   . LYS A 1 121  ? 111.181 95.920  134.661 1.00 89.26  ? 100  LYS A O   1 
ATOM   227  C  CB  . LYS A 1 121  ? 110.149 95.190  137.760 1.00 89.26  ? 100  LYS A CB  1 
ATOM   228  C  CG  . LYS A 1 121  ? 110.012 93.949  138.646 1.00 89.26  ? 100  LYS A CG  1 
ATOM   229  C  CD  . LYS A 1 121  ? 110.517 94.191  140.066 1.00 89.26  ? 100  LYS A CD  1 
ATOM   230  C  CE  . LYS A 1 121  ? 110.197 93.034  140.997 1.00 89.26  ? 100  LYS A CE  1 
ATOM   231  N  NZ  . LYS A 1 121  ? 110.964 91.805  140.656 1.00 89.26  ? 100  LYS A NZ  1 
ATOM   232  N  N   . PHE A 1 122  ? 111.416 97.581  136.153 1.00 94.26  ? 101  PHE A N   1 
ATOM   233  C  CA  . PHE A 1 122  ? 111.317 98.606  135.123 1.00 94.26  ? 101  PHE A CA  1 
ATOM   234  C  C   . PHE A 1 122  ? 112.622 98.812  134.375 1.00 94.26  ? 101  PHE A C   1 
ATOM   235  O  O   . PHE A 1 122  ? 112.610 99.420  133.299 1.00 94.26  ? 101  PHE A O   1 
ATOM   236  C  CB  . PHE A 1 122  ? 110.809 99.907  135.740 1.00 94.26  ? 101  PHE A CB  1 
ATOM   237  C  CG  . PHE A 1 122  ? 109.340 99.874  136.055 1.00 94.26  ? 101  PHE A CG  1 
ATOM   238  C  CD1 . PHE A 1 122  ? 108.493 99.012  135.366 1.00 94.26  ? 101  PHE A CD1 1 
ATOM   239  C  CD2 . PHE A 1 122  ? 108.810 100.645 137.066 1.00 94.26  ? 101  PHE A CD2 1 
ATOM   240  C  CE1 . PHE A 1 122  ? 107.132 98.957  135.652 1.00 94.26  ? 101  PHE A CE1 1 
ATOM   241  C  CE2 . PHE A 1 122  ? 107.450 100.591 137.363 1.00 94.26  ? 101  PHE A CE2 1 
ATOM   242  C  CZ  . PHE A 1 122  ? 106.614 99.743  136.653 1.00 94.26  ? 101  PHE A CZ  1 
ATOM   243  N  N   . LEU A 1 123  ? 113.736 98.309  134.903 1.00 94.15  ? 102  LEU A N   1 
ATOM   244  C  CA  . LEU A 1 123  ? 114.932 98.165  134.082 1.00 94.15  ? 102  LEU A CA  1 
ATOM   245  C  C   . LEU A 1 123  ? 114.696 97.148  132.978 1.00 94.15  ? 102  LEU A C   1 
ATOM   246  O  O   . LEU A 1 123  ? 115.057 97.381  131.817 1.00 94.15  ? 102  LEU A O   1 
ATOM   247  C  CB  . LEU A 1 123  ? 116.124 97.757  134.950 1.00 94.15  ? 102  LEU A CB  1 
ATOM   248  C  CG  . LEU A 1 123  ? 117.560 97.748  134.403 1.00 94.15  ? 102  LEU A CG  1 
ATOM   249  C  CD1 . LEU A 1 123  ? 117.983 96.475  133.663 1.00 94.15  ? 102  LEU A CD1 1 
ATOM   250  C  CD2 . LEU A 1 123  ? 117.743 98.948  133.503 1.00 94.15  ? 102  LEU A CD2 1 
ATOM   251  N  N   . VAL A 1 124  ? 114.102 96.002  133.335 1.00 100.74 ? 103  VAL A N   1 
ATOM   252  C  CA  . VAL A 1 124  ? 113.840 94.946  132.358 1.00 100.74 ? 103  VAL A CA  1 
ATOM   253  C  C   . VAL A 1 124  ? 112.819 95.410  131.328 1.00 100.74 ? 103  VAL A C   1 
ATOM   254  O  O   . VAL A 1 124  ? 113.023 95.247  130.116 1.00 100.74 ? 103  VAL A O   1 
ATOM   255  C  CB  . VAL A 1 124  ? 113.381 93.660  133.070 1.00 100.74 ? 103  VAL A CB  1 
ATOM   256  C  CG1 . VAL A 1 124  ? 112.903 92.630  132.068 1.00 100.74 ? 103  VAL A CG1 1 
ATOM   257  C  CG2 . VAL A 1 124  ? 114.518 93.078  133.891 1.00 100.74 ? 103  VAL A CG2 1 
ATOM   258  N  N   . VAL A 1 125  ? 111.728 96.023  131.797 1.00 94.01  ? 104  VAL A N   1 
ATOM   259  C  CA  . VAL A 1 125  ? 110.685 96.520  130.902 1.00 94.01  ? 104  VAL A CA  1 
ATOM   260  C  C   . VAL A 1 125  ? 111.234 97.607  129.987 1.00 94.01  ? 104  VAL A C   1 
ATOM   261  O  O   . VAL A 1 125  ? 111.126 97.513  128.758 1.00 94.01  ? 104  VAL A O   1 
ATOM   262  C  CB  . VAL A 1 125  ? 109.480 97.024  131.715 1.00 94.01  ? 104  VAL A CB  1 
ATOM   263  C  CG1 . VAL A 1 125  ? 108.491 97.739  130.817 1.00 94.01  ? 104  VAL A CG1 1 
ATOM   264  C  CG2 . VAL A 1 125  ? 108.795 95.866  132.414 1.00 94.01  ? 104  VAL A CG2 1 
ATOM   265  N  N   . GLY A 1 126  ? 111.895 98.611  130.567 1.00 85.24  ? 105  GLY A N   1 
ATOM   266  C  CA  . GLY A 1 126  ? 112.320 99.761  129.781 1.00 85.24  ? 105  GLY A CA  1 
ATOM   267  C  C   . GLY A 1 126  ? 113.433 99.449  128.799 1.00 85.24  ? 105  GLY A C   1 
ATOM   268  O  O   . GLY A 1 126  ? 113.389 99.883  127.641 1.00 85.24  ? 105  GLY A O   1 
ATOM   269  N  N   . LEU A 1 127  ? 114.436 98.685  129.238 1.00 96.40  ? 106  LEU A N   1 
ATOM   270  C  CA  . LEU A 1 127  ? 115.519 98.301  128.343 1.00 96.40  ? 106  LEU A CA  1 
ATOM   271  C  C   . LEU A 1 127  ? 115.010 97.369  127.249 1.00 96.40  ? 106  LEU A C   1 
ATOM   272  O  O   . LEU A 1 127  ? 115.311 97.564  126.061 1.00 96.40  ? 106  LEU A O   1 
ATOM   273  C  CB  . LEU A 1 127  ? 116.636 97.651  129.163 1.00 96.40  ? 106  LEU A CB  1 
ATOM   274  C  CG  . LEU A 1 127  ? 118.060 97.389  128.653 1.00 96.40  ? 106  LEU A CG  1 
ATOM   275  C  CD1 . LEU A 1 127  ? 118.207 96.121  127.813 1.00 96.40  ? 106  LEU A CD1 1 
ATOM   276  C  CD2 . LEU A 1 127  ? 118.541 98.595  127.881 1.00 96.40  ? 106  LEU A CD2 1 
ATOM   277  N  N   . LEU A 1 128  ? 114.191 96.383  127.629 1.00 92.20  ? 107  LEU A N   1 
ATOM   278  C  CA  . LEU A 1 128  ? 113.693 95.404  126.674 1.00 92.20  ? 107  LEU A CA  1 
ATOM   279  C  C   . LEU A 1 128  ? 112.710 95.995  125.675 1.00 92.20  ? 107  LEU A C   1 
ATOM   280  O  O   . LEU A 1 128  ? 112.534 95.413  124.602 1.00 92.20  ? 107  LEU A O   1 
ATOM   281  C  CB  . LEU A 1 128  ? 113.048 94.229  127.409 1.00 92.20  ? 107  LEU A CB  1 
ATOM   282  C  CG  . LEU A 1 128  ? 113.879 92.987  127.753 1.00 92.20  ? 107  LEU A CG  1 
ATOM   283  C  CD1 . LEU A 1 128  ? 114.259 92.271  126.475 1.00 92.20  ? 107  LEU A CD1 1 
ATOM   284  C  CD2 . LEU A 1 128  ? 115.129 93.285  128.570 1.00 92.20  ? 107  LEU A CD2 1 
ATOM   285  N  N   . ILE A 1 129  ? 112.071 97.128  125.979 1.00 84.77  ? 108  ILE A N   1 
ATOM   286  C  CA  . ILE A 1 129  ? 111.250 97.770  124.953 1.00 84.77  ? 108  ILE A CA  1 
ATOM   287  C  C   . ILE A 1 129  ? 112.005 98.844  124.180 1.00 84.77  ? 108  ILE A C   1 
ATOM   288  O  O   . ILE A 1 129  ? 111.606 99.178  123.055 1.00 84.77  ? 108  ILE A O   1 
ATOM   289  C  CB  . ILE A 1 129  ? 109.953 98.395  125.503 1.00 84.77  ? 108  ILE A CB  1 
ATOM   290  C  CG1 . ILE A 1 129  ? 110.239 99.562  126.433 1.00 84.77  ? 108  ILE A CG1 1 
ATOM   291  C  CG2 . ILE A 1 129  ? 109.092 97.351  126.181 1.00 84.77  ? 108  ILE A CG2 1 
ATOM   292  C  CD1 . ILE A 1 129  ? 109.005 100.314 126.791 1.00 84.77  ? 108  ILE A CD1 1 
ATOM   293  N  N   . PHE A 1 130  ? 113.086 99.388  124.730 1.00 83.89  ? 109  PHE A N   1 
ATOM   294  C  CA  . PHE A 1 130  ? 113.837 100.371 123.968 1.00 83.89  ? 109  PHE A CA  1 
ATOM   295  C  C   . PHE A 1 130  ? 114.857 99.754  123.034 1.00 83.89  ? 109  PHE A C   1 
ATOM   296  O  O   . PHE A 1 130  ? 115.315 100.439 122.116 1.00 83.89  ? 109  PHE A O   1 
ATOM   297  C  CB  . PHE A 1 130  ? 114.518 101.370 124.902 1.00 83.89  ? 109  PHE A CB  1 
ATOM   298  C  CG  . PHE A 1 130  ? 113.581 102.385 125.475 1.00 83.89  ? 109  PHE A CG  1 
ATOM   299  C  CD1 . PHE A 1 130  ? 112.334 102.583 124.907 1.00 83.89  ? 109  PHE A CD1 1 
ATOM   300  C  CD2 . PHE A 1 130  ? 113.936 103.135 126.576 1.00 83.89  ? 109  PHE A CD2 1 
ATOM   301  C  CE1 . PHE A 1 130  ? 111.464 103.512 125.426 1.00 83.89  ? 109  PHE A CE1 1 
ATOM   302  C  CE2 . PHE A 1 130  ? 113.060 104.057 127.098 1.00 83.89  ? 109  PHE A CE2 1 
ATOM   303  C  CZ  . PHE A 1 130  ? 111.830 104.254 126.520 1.00 83.89  ? 109  PHE A CZ  1 
ATOM   304  N  N   . GLY A 1 131  ? 115.219 98.484  123.222 1.00 86.88  ? 110  GLY A N   1 
ATOM   305  C  CA  . GLY A 1 131  ? 116.011 97.815  122.203 1.00 86.88  ? 110  GLY A CA  1 
ATOM   306  C  C   . GLY A 1 131  ? 115.249 97.593  120.908 1.00 86.88  ? 110  GLY A C   1 
ATOM   307  O  O   . GLY A 1 131  ? 115.847 97.599  119.822 1.00 86.88  ? 110  GLY A O   1 
ATOM   308  N  N   . ALA A 1 132  ? 113.923 97.436  121.004 1.00 81.04  ? 111  ALA A N   1 
ATOM   309  C  CA  . ALA A 1 132  ? 113.107 97.045  119.857 1.00 81.04  ? 111  ALA A CA  1 
ATOM   310  C  C   . ALA A 1 132  ? 113.036 98.150  118.815 1.00 81.04  ? 111  ALA A C   1 
ATOM   311  O  O   . ALA A 1 132  ? 113.025 97.873  117.608 1.00 81.04  ? 111  ALA A O   1 
ATOM   312  C  CB  . ALA A 1 132  ? 111.705 96.663  120.324 1.00 81.04  ? 111  ALA A CB  1 
ATOM   313  N  N   . PHE A 1 133  ? 112.987 99.407  119.260 1.00 76.62  ? 112  PHE A N   1 
ATOM   314  C  CA  . PHE A 1 133  ? 113.068 100.516 118.318 1.00 76.62  ? 112  PHE A CA  1 
ATOM   315  C  C   . PHE A 1 133  ? 114.444 100.596 117.683 1.00 76.62  ? 112  PHE A C   1 
ATOM   316  O  O   . PHE A 1 133  ? 114.562 100.974 116.514 1.00 76.62  ? 112  PHE A O   1 
ATOM   317  C  CB  . PHE A 1 133  ? 112.756 101.837 119.017 1.00 76.62  ? 112  PHE A CB  1 
ATOM   318  C  CG  . PHE A 1 133  ? 111.317 102.009 119.411 1.00 76.62  ? 112  PHE A CG  1 
ATOM   319  C  CD1 . PHE A 1 133  ? 110.321 101.203 118.894 1.00 76.62  ? 112  PHE A CD1 1 
ATOM   320  C  CD2 . PHE A 1 133  ? 110.966 103.003 120.300 1.00 76.62  ? 112  PHE A CD2 1 
ATOM   321  C  CE1 . PHE A 1 133  ? 109.010 101.384 119.267 1.00 76.62  ? 112  PHE A CE1 1 
ATOM   322  C  CE2 . PHE A 1 133  ? 109.659 103.187 120.671 1.00 76.62  ? 112  PHE A CE2 1 
ATOM   323  C  CZ  . PHE A 1 133  ? 108.681 102.379 120.157 1.00 76.62  ? 112  PHE A CZ  1 
ATOM   324  N  N   . ALA A 1 134  ? 115.485 100.233 118.434 1.00 76.53  ? 113  ALA A N   1 
ATOM   325  C  CA  . ALA A 1 134  ? 116.849 100.366 117.944 1.00 76.53  ? 113  ALA A CA  1 
ATOM   326  C  C   . ALA A 1 134  ? 117.176 99.324  116.886 1.00 76.53  ? 113  ALA A C   1 
ATOM   327  O  O   . ALA A 1 134  ? 117.993 99.586  115.998 1.00 76.53  ? 113  ALA A O   1 
ATOM   328  C  CB  . ALA A 1 134  ? 117.837 100.268 119.102 1.00 76.53  ? 113  ALA A CB  1 
ATOM   329  N  N   . VAL A 1 135  ? 116.572 98.139  116.966 1.00 86.22  ? 114  VAL A N   1 
ATOM   330  C  CA  . VAL A 1 135  ? 116.745 97.202  115.859 1.00 86.22  ? 114  VAL A CA  1 
ATOM   331  C  C   . VAL A 1 135  ? 115.730 97.497  114.757 1.00 86.22  ? 114  VAL A C   1 
ATOM   332  O  O   . VAL A 1 135  ? 116.037 97.355  113.567 1.00 86.22  ? 114  VAL A O   1 
ATOM   333  C  CB  . VAL A 1 135  ? 116.663 95.753  116.374 1.00 86.22  ? 114  VAL A CB  1 
ATOM   334  C  CG1 . VAL A 1 135  ? 116.774 94.737  115.244 1.00 86.22  ? 114  VAL A CG1 1 
ATOM   335  C  CG2 . VAL A 1 135  ? 117.765 95.506  117.393 1.00 86.22  ? 114  VAL A CG2 1 
ATOM   336  N  N   . GLY A 1 136  ? 114.549 97.991  115.117 1.00 87.16  ? 115  GLY A N   1 
ATOM   337  C  CA  . GLY A 1 136  ? 113.511 98.249  114.135 1.00 87.16  ? 115  GLY A CA  1 
ATOM   338  C  C   . GLY A 1 136  ? 113.718 99.465  113.249 1.00 87.16  ? 115  GLY A C   1 
ATOM   339  O  O   . GLY A 1 136  ? 112.919 100.406 113.278 1.00 87.16  ? 115  GLY A O   1 
ATOM   340  N  N   . LEU A 1 137  ? 114.772 99.448  112.442 1.00 66.77  ? 116  LEU A N   1 
ATOM   341  C  CA  . LEU A 1 137  ? 115.066 100.502 111.478 1.00 66.77  ? 116  LEU A CA  1 
ATOM   342  C  C   . LEU A 1 137  ? 115.228 99.911  110.082 1.00 66.77  ? 116  LEU A C   1 
ATOM   343  O  O   . LEU A 1 137  ? 116.161 100.221 109.343 1.00 66.77  ? 116  LEU A O   1 
ATOM   344  C  CB  . LEU A 1 137  ? 116.281 101.318 111.932 1.00 66.77  ? 116  LEU A CB  1 
ATOM   345  C  CG  . LEU A 1 137  ? 117.585 100.707 112.473 1.00 66.77  ? 116  LEU A CG  1 
ATOM   346  C  CD1 . LEU A 1 137  ? 118.597 100.288 111.419 1.00 66.77  ? 116  LEU A CD1 1 
ATOM   347  C  CD2 . LEU A 1 137  ? 118.234 101.695 113.439 1.00 66.77  ? 116  LEU A CD2 1 
ATOM   348  N  N   . LYS A 1 138  ? 114.280 99.054  109.689 1.00 63.20  ? 117  LYS A N   1 
ATOM   349  C  CA  . LYS A 1 138  ? 114.359 98.438  108.370 1.00 63.20  ? 117  LYS A CA  1 
ATOM   350  C  C   . LYS A 1 138  ? 114.030 99.433  107.266 1.00 63.20  ? 117  LYS A C   1 
ATOM   351  O  O   . LYS A 1 138  ? 114.499 99.278  106.136 1.00 63.20  ? 117  LYS A O   1 
ATOM   352  C  CB  . LYS A 1 138  ? 113.445 97.209  108.299 1.00 63.20  ? 117  LYS A CB  1 
ATOM   353  C  CG  . LYS A 1 138  ? 111.957 97.489  108.354 1.00 63.20  ? 117  LYS A CG  1 
ATOM   354  C  CD  . LYS A 1 138  ? 111.144 96.209  108.392 1.00 63.20  ? 117  LYS A CD  1 
ATOM   355  C  CE  . LYS A 1 138  ? 111.203 95.583  109.769 1.00 63.20  ? 117  LYS A CE  1 
ATOM   356  N  NZ  . LYS A 1 138  ? 110.288 94.418  109.892 1.00 63.20  ? 117  LYS A NZ  1 
ATOM   357  N  N   . ALA A 1 139  ? 113.239 100.456 107.564 1.00 82.19  ? 118  ALA A N   1 
ATOM   358  C  CA  . ALA A 1 139  ? 112.970 101.530 106.608 1.00 82.19  ? 118  ALA A CA  1 
ATOM   359  C  C   . ALA A 1 139  ? 113.898 102.718 106.830 1.00 82.19  ? 118  ALA A C   1 
ATOM   360  O  O   . ALA A 1 139  ? 113.455 103.863 106.923 1.00 82.19  ? 118  ALA A O   1 
ATOM   361  C  CB  . ALA A 1 139  ? 111.510 101.955 106.699 1.00 82.19  ? 118  ALA A CB  1 
ATOM   362  N  N   . ALA A 1 140  ? 115.203 102.470 106.901 1.00 86.06  ? 119  ALA A N   1 
ATOM   363  C  CA  . ALA A 1 140  ? 116.183 103.524 107.141 1.00 86.06  ? 119  ALA A CA  1 
ATOM   364  C  C   . ALA A 1 140  ? 117.182 103.525 105.995 1.00 86.06  ? 119  ALA A C   1 
ATOM   365  O  O   . ALA A 1 140  ? 117.992 102.601 105.866 1.00 86.06  ? 119  ALA A O   1 
ATOM   366  C  CB  . ALA A 1 140  ? 116.882 103.335 108.483 1.00 86.06  ? 119  ALA A CB  1 
ATOM   367  N  N   . ASN A 1 141  ? 117.128 104.569 105.177 1.00 87.38  ? 120  ASN A N   1 
ATOM   368  C  CA  . ASN A 1 141  ? 117.998 104.726 104.024 1.00 87.38  ? 120  ASN A CA  1 
ATOM   369  C  C   . ASN A 1 141  ? 118.445 106.179 103.984 1.00 87.38  ? 120  ASN A C   1 
ATOM   370  O  O   . ASN A 1 141  ? 118.293 106.918 104.960 1.00 87.38  ? 120  ASN A O   1 
ATOM   371  C  CB  . ASN A 1 141  ? 117.287 104.268 102.742 1.00 87.38  ? 120  ASN A CB  1 
ATOM   372  C  CG  . ASN A 1 141  ? 115.931 104.939 102.533 1.00 87.38  ? 120  ASN A CG  1 
ATOM   373  O  OD1 . ASN A 1 141  ? 115.518 105.811 103.295 1.00 87.38  ? 120  ASN A OD1 1 
ATOM   374  N  ND2 . ASN A 1 141  ? 115.229 104.516 101.489 1.00 87.38  ? 120  ASN A ND2 1 
ATOM   375  N  N   . LEU A 1 142  ? 119.011 106.596 102.863 1.00 91.36  ? 121  LEU A N   1 
ATOM   376  C  CA  . LEU A 1 142  ? 119.367 107.988 102.660 1.00 91.36  ? 121  LEU A CA  1 
ATOM   377  C  C   . LEU A 1 142  ? 118.462 108.554 101.581 1.00 91.36  ? 121  LEU A C   1 
ATOM   378  O  O   . LEU A 1 142  ? 118.264 107.914 100.544 1.00 91.36  ? 121  LEU A O   1 
ATOM   379  C  CB  . LEU A 1 142  ? 120.831 108.145 102.253 1.00 91.36  ? 121  LEU A CB  1 
ATOM   380  C  CG  . LEU A 1 142  ? 121.933 108.066 103.316 1.00 91.36  ? 121  LEU A CG  1 
ATOM   381  C  CD1 . LEU A 1 142  ? 121.634 108.994 104.473 1.00 91.36  ? 121  LEU A CD1 1 
ATOM   382  C  CD2 . LEU A 1 142  ? 122.222 106.659 103.793 1.00 91.36  ? 121  LEU A CD2 1 
ATOM   383  N  N   . GLU A 1 143  ? 117.887 109.734 101.839 1.00 97.69  ? 122  GLU A N   1 
ATOM   384  C  CA  . GLU A 1 143  ? 117.138 110.428 100.797 1.00 97.69  ? 122  GLU A CA  1 
ATOM   385  C  C   . GLU A 1 143  ? 118.065 110.838 99.665  1.00 97.69  ? 122  GLU A C   1 
ATOM   386  O  O   . GLU A 1 143  ? 117.759 110.621 98.486  1.00 97.69  ? 122  GLU A O   1 
ATOM   387  C  CB  . GLU A 1 143  ? 116.421 111.646 101.374 1.00 97.69  ? 122  GLU A CB  1 
ATOM   388  C  CG  . GLU A 1 143  ? 115.278 111.323 102.320 1.00 97.69  ? 122  GLU A CG  1 
ATOM   389  C  CD  . GLU A 1 143  ? 114.561 112.575 102.805 1.00 97.69  ? 122  GLU A CD  1 
ATOM   390  O  OE1 . GLU A 1 143  ? 115.020 113.688 102.473 1.00 97.69  ? 122  GLU A OE1 1 
ATOM   391  O  OE2 . GLU A 1 143  ? 113.542 112.448 103.520 1.00 97.69  ? 122  GLU A OE2 1 
ATOM   392  N  N   . THR A 1 144  ? 119.171 111.473 100.038 1.00 88.49  ? 123  THR A N   1 
ATOM   393  C  CA  . THR A 1 144  ? 120.295 111.737 99.139  1.00 88.49  ? 123  THR A CA  1 
ATOM   394  C  C   . THR A 1 144  ? 120.053 112.358 97.773  1.00 88.49  ? 123  THR A C   1 
ATOM   395  O  O   . THR A 1 144  ? 120.688 111.958 96.802  1.00 88.49  ? 123  THR A O   1 
ATOM   396  C  CB  . THR A 1 144  ? 121.128 110.460 98.929  1.00 88.49  ? 123  THR A CB  1 
ATOM   397  O  OG1 . THR A 1 144  ? 122.251 110.754 98.090  1.00 88.49  ? 123  THR A OG1 1 
ATOM   398  C  CG2 . THR A 1 144  ? 120.281 109.383 98.278  1.00 88.49  ? 123  THR A CG2 1 
ATOM   399  N  N   . ASN A 1 145  ? 119.111 113.272 97.646  1.00 90.85  ? 124  ASN A N   1 
ATOM   400  C  CA  . ASN A 1 145  ? 118.925 113.886 96.346  1.00 90.85  ? 124  ASN A CA  1 
ATOM   401  C  C   . ASN A 1 145  ? 119.179 115.364 96.522  1.00 90.85  ? 124  ASN A C   1 
ATOM   402  O  O   . ASN A 1 145  ? 118.525 116.018 97.330  1.00 90.85  ? 124  ASN A O   1 
ATOM   403  C  CB  . ASN A 1 145  ? 117.523 113.620 95.811  1.00 90.85  ? 124  ASN A CB  1 
ATOM   404  C  CG  . ASN A 1 145  ? 117.117 112.166 95.950  1.00 90.85  ? 124  ASN A CG  1 
ATOM   405  O  OD1 . ASN A 1 145  ? 116.825 111.495 94.961  1.00 90.85  ? 124  ASN A OD1 1 
ATOM   406  N  ND2 . ASN A 1 145  ? 117.101 111.670 97.181  1.00 90.85  ? 124  ASN A ND2 1 
ATOM   407  N  N   . VAL A 1 146  ? 120.241 115.841 95.884  1.00 89.71  ? 125  VAL A N   1 
ATOM   408  C  CA  . VAL A 1 146  ? 120.628 117.239 95.976  1.00 89.71  ? 125  VAL A CA  1 
ATOM   409  C  C   . VAL A 1 146  ? 119.568 118.138 95.373  1.00 89.71  ? 125  VAL A C   1 
ATOM   410  O  O   . VAL A 1 146  ? 119.261 119.193 95.912  1.00 89.71  ? 125  VAL A O   1 
ATOM   411  C  CB  . VAL A 1 146  ? 121.976 117.498 95.286  1.00 89.71  ? 125  VAL A CB  1 
ATOM   412  C  CG1 . VAL A 1 146  ? 122.237 116.445 94.221  1.00 89.71  ? 125  VAL A CG1 1 
ATOM   413  C  CG2 . VAL A 1 146  ? 122.004 118.900 94.697  1.00 89.71  ? 125  VAL A CG2 1 
ATOM   414  N  N   . GLU A 1 147  ? 119.013 117.718 94.244  1.00 95.62  ? 126  GLU A N   1 
ATOM   415  C  CA  . GLU A 1 147  ? 117.974 118.498 93.595  1.00 95.62  ? 126  GLU A CA  1 
ATOM   416  C  C   . GLU A 1 147  ? 116.764 118.567 94.512  1.00 95.62  ? 126  GLU A C   1 
ATOM   417  O  O   . GLU A 1 147  ? 116.164 119.623 94.677  1.00 95.62  ? 126  GLU A O   1 
ATOM   418  C  CB  . GLU A 1 147  ? 117.603 117.890 92.242  1.00 95.62  ? 126  GLU A CB  1 
ATOM   419  C  CG  . GLU A 1 147  ? 118.046 118.724 91.049  1.00 95.62  ? 126  GLU A CG  1 
ATOM   420  C  CD  . GLU A 1 147  ? 119.472 118.434 90.625  1.00 95.62  ? 126  GLU A CD  1 
ATOM   421  O  OE1 . GLU A 1 147  ? 119.716 117.353 90.049  1.00 95.62  ? 126  GLU A OE1 1 
ATOM   422  O  OE2 . GLU A 1 147  ? 120.350 119.288 90.865  1.00 95.62  ? 126  GLU A OE2 1 
ATOM   423  N  N   . GLU A 1 148  ? 116.410 117.442 95.117  1.00 98.94  ? 127  GLU A N   1 
ATOM   424  C  CA  . GLU A 1 148  ? 115.300 117.439 96.049  1.00 98.94  ? 127  GLU A CA  1 
ATOM   425  C  C   . GLU A 1 148  ? 115.880 117.149 97.419  1.00 98.94  ? 127  GLU A C   1 
ATOM   426  O  O   . GLU A 1 148  ? 116.311 116.021 97.672  1.00 98.94  ? 127  GLU A O   1 
ATOM   427  C  CB  . GLU A 1 148  ? 114.278 116.372 95.670  1.00 98.94  ? 127  GLU A CB  1 
ATOM   428  C  CG  . GLU A 1 148  ? 113.378 115.948 96.817  1.00 98.94  ? 127  GLU A CG  1 
ATOM   429  C  CD  . GLU A 1 148  ? 113.925 114.754 97.569  1.00 98.94  ? 127  GLU A CD  1 
ATOM   430  O  OE1 . GLU A 1 148  ? 113.470 114.506 98.703  1.00 98.94  ? 127  GLU A OE1 1 
ATOM   431  O  OE2 . GLU A 1 148  ? 114.810 114.061 97.028  1.00 98.94  ? 127  GLU A OE2 1 
ATOM   432  N  N   . LEU A 1 149  ? 115.698 118.133 98.291  1.00 82.95  ? 128  LEU A N   1 
ATOM   433  C  CA  . LEU A 1 149  ? 116.189 118.178 99.654  1.00 82.95  ? 128  LEU A CA  1 
ATOM   434  C  C   . LEU A 1 149  ? 116.481 119.650 99.926  1.00 82.95  ? 128  LEU A C   1 
ATOM   435  O  O   . LEU A 1 149  ? 116.238 120.147 101.022 1.00 82.95  ? 128  LEU A O   1 
ATOM   436  C  CB  . LEU A 1 149  ? 117.482 117.380 99.777  1.00 82.95  ? 128  LEU A CB  1 
ATOM   437  C  CG  . LEU A 1 149  ? 117.484 116.200 100.743 1.00 82.95  ? 128  LEU A CG  1 
ATOM   438  C  CD1 . LEU A 1 149  ? 116.359 115.243 100.391 1.00 82.95  ? 128  LEU A CD1 1 
ATOM   439  C  CD2 . LEU A 1 149  ? 118.830 115.496 100.700 1.00 82.95  ? 128  LEU A CD2 1 
ATOM   440  N  N   . TRP A 1 150  ? 116.991 120.342 98.910  1.00 85.23  ? 129  TRP A N   1 
ATOM   441  C  CA  . TRP A 1 150  ? 117.302 121.764 98.986  1.00 85.23  ? 129  TRP A CA  1 
ATOM   442  C  C   . TRP A 1 150  ? 116.281 122.622 98.234  1.00 85.23  ? 129  TRP A C   1 
ATOM   443  O  O   . TRP A 1 150  ? 116.455 123.830 98.114  1.00 85.23  ? 129  TRP A O   1 
ATOM   444  C  CB  . TRP A 1 150  ? 118.696 122.013 98.418  1.00 85.23  ? 129  TRP A CB  1 
ATOM   445  C  CG  . TRP A 1 150  ? 119.423 123.157 99.036  1.00 85.23  ? 129  TRP A CG  1 
ATOM   446  C  CD1 . TRP A 1 150  ? 119.968 124.221 98.386  1.00 85.23  ? 129  TRP A CD1 1 
ATOM   447  C  CD2 . TRP A 1 150  ? 119.706 123.348 100.424 1.00 85.23  ? 129  TRP A CD2 1 
ATOM   448  N  NE1 . TRP A 1 150  ? 120.568 125.067 99.282  1.00 85.23  ? 129  TRP A NE1 1 
ATOM   449  C  CE2 . TRP A 1 150  ? 120.420 124.554 100.542 1.00 85.23  ? 129  TRP A CE2 1 
ATOM   450  C  CE3 . TRP A 1 150  ? 119.421 122.619 101.580 1.00 85.23  ? 129  TRP A CE3 1 
ATOM   451  C  CZ2 . TRP A 1 150  ? 120.853 125.049 101.767 1.00 85.23  ? 129  TRP A CZ2 1 
ATOM   452  C  CZ3 . TRP A 1 150  ? 119.852 123.112 102.797 1.00 85.23  ? 129  TRP A CZ3 1 
ATOM   453  C  CH2 . TRP A 1 150  ? 120.560 124.315 102.880 1.00 85.23  ? 129  TRP A CH2 1 
ATOM   454  N  N   . VAL A 1 151  ? 115.225 121.994 97.725  1.00 100.97 ? 130  VAL A N   1 
ATOM   455  C  CA  . VAL A 1 151  ? 114.195 122.685 96.968  1.00 100.97 ? 130  VAL A CA  1 
ATOM   456  C  C   . VAL A 1 151  ? 113.287 123.601 97.778  1.00 100.97 ? 130  VAL A C   1 
ATOM   457  O  O   . VAL A 1 151  ? 112.997 124.708 97.333  1.00 100.97 ? 130  VAL A O   1 
ATOM   458  C  CB  . VAL A 1 151  ? 113.290 121.703 96.194  1.00 100.97 ? 130  VAL A CB  1 
ATOM   459  C  CG1 . VAL A 1 151  ? 113.505 121.844 94.696  1.00 100.97 ? 130  VAL A CG1 1 
ATOM   460  C  CG2 . VAL A 1 151  ? 113.525 120.274 96.649  1.00 100.97 ? 130  VAL A CG2 1 
ATOM   461  N  N   . GLU A 1 152  ? 112.844 123.200 98.961  1.00 87.95  ? 131  GLU A N   1 
ATOM   462  C  CA  . GLU A 1 152  ? 111.939 124.134 99.655  1.00 87.95  ? 131  GLU A CA  1 
ATOM   463  C  C   . GLU A 1 152  ? 110.516 123.871 99.161  1.00 87.95  ? 131  GLU A C   1 
ATOM   464  O  O   . GLU A 1 152  ? 109.810 124.768 98.705  1.00 87.95  ? 131  GLU A O   1 
ATOM   465  C  CB  . GLU A 1 152  ? 112.354 125.608 99.512  1.00 87.95  ? 131  GLU A CB  1 
ATOM   466  C  CG  . GLU A 1 152  ? 111.312 126.586 100.028 1.00 87.95  ? 131  GLU A CG  1 
ATOM   467  C  CD  . GLU A 1 152  ? 111.724 128.031 99.852  1.00 87.95  ? 131  GLU A CD  1 
ATOM   468  O  OE1 . GLU A 1 152  ? 112.893 128.277 99.489  1.00 87.95  ? 131  GLU A OE1 1 
ATOM   469  O  OE2 . GLU A 1 152  ? 110.878 128.921 100.079 1.00 87.95  ? 131  GLU A OE2 1 
ATOM   470  N  N   . VAL A 1 153  ? 110.136 122.601 99.243  1.00 82.17  ? 132  VAL A N   1 
ATOM   471  C  CA  . VAL A 1 153  ? 108.872 122.088 98.751  1.00 82.17  ? 132  VAL A CA  1 
ATOM   472  C  C   . VAL A 1 153  ? 107.577 122.569 99.380  1.00 82.17  ? 132  VAL A C   1 
ATOM   473  O  O   . VAL A 1 153  ? 107.496 122.879 100.567 1.00 82.17  ? 132  VAL A O   1 
ATOM   474  C  CB  . VAL A 1 153  ? 108.867 120.549 98.810  1.00 82.17  ? 132  VAL A CB  1 
ATOM   475  C  CG1 . VAL A 1 153  ? 109.591 120.075 100.059 1.00 82.17  ? 132  VAL A CG1 1 
ATOM   476  C  CG2 . VAL A 1 153  ? 107.443 120.009 98.764  1.00 82.17  ? 132  VAL A CG2 1 
ATOM   477  N  N   . GLY A 1 154  ? 106.575 122.627 98.513  1.00 98.33  ? 133  GLY A N   1 
ATOM   478  C  CA  . GLY A 1 154  ? 105.207 122.979 98.832  1.00 98.33  ? 133  GLY A CA  1 
ATOM   479  C  C   . GLY A 1 154  ? 104.594 124.044 97.949  1.00 98.33  ? 133  GLY A C   1 
ATOM   480  O  O   . GLY A 1 154  ? 103.456 123.898 97.495  1.00 98.33  ? 133  GLY A O   1 
ATOM   481  N  N   . GLY A 1 155  ? 105.339 125.104 97.668  1.00 84.36  ? 134  GLY A N   1 
ATOM   482  C  CA  . GLY A 1 155  ? 104.742 126.232 96.988  1.00 84.36  ? 134  GLY A CA  1 
ATOM   483  C  C   . GLY A 1 155  ? 105.695 127.055 96.152  1.00 84.36  ? 134  GLY A C   1 
ATOM   484  O  O   . GLY A 1 155  ? 106.847 127.270 96.541  1.00 84.36  ? 134  GLY A O   1 
ATOM   485  N  N   . ARG A 1 156  ? 105.226 127.432 94.955  1.00 67.42  ? 135  ARG A N   1 
ATOM   486  C  CA  . ARG A 1 156  ? 105.786 128.411 94.020  1.00 67.42  ? 135  ARG A CA  1 
ATOM   487  C  C   . ARG A 1 156  ? 107.039 127.881 93.325  1.00 67.42  ? 135  ARG A C   1 
ATOM   488  O  O   . ARG A 1 156  ? 107.533 128.492 92.376  1.00 67.42  ? 135  ARG A O   1 
ATOM   489  C  CB  . ARG A 1 156  ? 106.051 129.748 94.730  1.00 67.42  ? 135  ARG A CB  1 
ATOM   490  C  CG  . ARG A 1 156  ? 106.183 130.971 93.828  1.00 67.42  ? 135  ARG A CG  1 
ATOM   491  C  CD  . ARG A 1 156  ? 106.403 132.208 94.648  1.00 67.42  ? 135  ARG A CD  1 
ATOM   492  N  NE  . ARG A 1 156  ? 107.715 132.193 95.276  1.00 67.42  ? 135  ARG A NE  1 
ATOM   493  C  CZ  . ARG A 1 156  ? 108.062 132.987 96.281  1.00 67.42  ? 135  ARG A CZ  1 
ATOM   494  N  NH1 . ARG A 1 156  ? 107.182 133.841 96.783  1.00 67.42  ? 135  ARG A NH1 1 
ATOM   495  N  NH2 . ARG A 1 156  ? 109.280 132.916 96.799  1.00 67.42  ? 135  ARG A NH2 1 
ATOM   496  N  N   . VAL A 1 157  ? 107.548 126.731 93.752  1.00 57.67  ? 136  VAL A N   1 
ATOM   497  C  CA  . VAL A 1 157  ? 108.618 126.053 93.034  1.00 57.67  ? 136  VAL A CA  1 
ATOM   498  C  C   . VAL A 1 157  ? 108.189 124.621 92.759  1.00 57.67  ? 136  VAL A C   1 
ATOM   499  O  O   . VAL A 1 157  ? 108.303 124.134 91.628  1.00 57.67  ? 136  VAL A O   1 
ATOM   500  C  CB  . VAL A 1 157  ? 109.940 126.092 93.819  1.00 57.67  ? 136  VAL A CB  1 
ATOM   501  C  CG1 . VAL A 1 157  ? 110.981 125.239 93.136  1.00 57.67  ? 136  VAL A CG1 1 
ATOM   502  C  CG2 . VAL A 1 157  ? 110.448 127.499 93.924  1.00 57.67  ? 136  VAL A CG2 1 
ATOM   503  N  N   . SER A 1 158  ? 107.665 123.953 93.789  1.00 61.52  ? 137  SER A N   1 
ATOM   504  C  CA  . SER A 1 158  ? 107.502 122.504 93.738  1.00 61.52  ? 137  SER A CA  1 
ATOM   505  C  C   . SER A 1 158  ? 106.404 122.084 92.771  1.00 61.52  ? 137  SER A C   1 
ATOM   506  O  O   . SER A 1 158  ? 106.503 121.027 92.138  1.00 61.52  ? 137  SER A O   1 
ATOM   507  C  CB  . SER A 1 158  ? 107.217 121.963 95.133  1.00 61.52  ? 137  SER A CB  1 
ATOM   508  O  OG  . SER A 1 158  ? 107.024 120.562 95.093  1.00 61.52  ? 137  SER A OG  1 
ATOM   509  N  N   . ARG A 1 159  ? 105.408 122.946 92.614  1.00 67.75  ? 138  ARG A N   1 
ATOM   510  C  CA  . ARG A 1 159  ? 104.329 122.687 91.682  1.00 67.75  ? 138  ARG A CA  1 
ATOM   511  C  C   . ARG A 1 159  ? 104.900 122.846 90.282  1.00 67.75  ? 138  ARG A C   1 
ATOM   512  O  O   . ARG A 1 159  ? 104.692 122.004 89.410  1.00 67.75  ? 138  ARG A O   1 
ATOM   513  C  CB  . ARG A 1 159  ? 103.194 123.680 91.888  1.00 67.75  ? 138  ARG A CB  1 
ATOM   514  C  CG  . ARG A 1 159  ? 103.133 124.761 90.826  1.00 67.75  ? 138  ARG A CG  1 
ATOM   515  C  CD  . ARG A 1 159  ? 102.595 126.057 91.404  1.00 67.75  ? 138  ARG A CD  1 
ATOM   516  N  NE  . ARG A 1 159  ? 101.155 125.995 91.624  1.00 67.75  ? 138  ARG A NE  1 
ATOM   517  C  CZ  . ARG A 1 159  ? 100.583 125.385 92.655  1.00 67.75  ? 138  ARG A CZ  1 
ATOM   518  N  NH1 . ARG A 1 159  ? 99.264  125.377 92.775  1.00 67.75  ? 138  ARG A NH1 1 
ATOM   519  N  NH2 . ARG A 1 159  ? 101.330 124.781 93.566  1.00 67.75  ? 138  ARG A NH2 1 
ATOM   520  N  N   . GLU A 1 160  ? 105.633 123.932 90.075  1.00 58.63  ? 139  GLU A N   1 
ATOM   521  C  CA  . GLU A 1 160  ? 106.247 124.194 88.781  1.00 58.63  ? 139  GLU A CA  1 
ATOM   522  C  C   . GLU A 1 160  ? 107.176 123.054 88.400  1.00 58.63  ? 139  GLU A C   1 
ATOM   523  O  O   . GLU A 1 160  ? 107.223 122.644 87.232  1.00 58.63  ? 139  GLU A O   1 
ATOM   524  C  CB  . GLU A 1 160  ? 106.995 125.520 88.831  1.00 58.63  ? 139  GLU A CB  1 
ATOM   525  C  CG  . GLU A 1 160  ? 106.079 126.700 89.082  1.00 58.63  ? 139  GLU A CG  1 
ATOM   526  C  CD  . GLU A 1 160  ? 106.825 128.003 89.300  1.00 58.63  ? 139  GLU A CD  1 
ATOM   527  O  OE1 . GLU A 1 160  ? 108.069 127.969 89.378  1.00 58.63  ? 139  GLU A OE1 1 
ATOM   528  O  OE2 . GLU A 1 160  ? 106.169 129.061 89.404  1.00 58.63  ? 139  GLU A OE2 1 
ATOM   529  N  N   . LEU A 1 161  ? 107.895 122.510 89.385  1.00 51.20  ? 140  LEU A N   1 
ATOM   530  C  CA  . LEU A 1 161  ? 108.645 121.280 89.176  1.00 51.20  ? 140  LEU A CA  1 
ATOM   531  C  C   . LEU A 1 161  ? 107.734 120.129 88.799  1.00 51.20  ? 140  LEU A C   1 
ATOM   532  O  O   . LEU A 1 161  ? 108.123 119.281 87.993  1.00 51.20  ? 140  LEU A O   1 
ATOM   533  C  CB  . LEU A 1 161  ? 109.452 120.919 90.419  1.00 51.20  ? 140  LEU A CB  1 
ATOM   534  C  CG  . LEU A 1 161  ? 110.929 121.287 90.437  1.00 51.20  ? 140  LEU A CG  1 
ATOM   535  C  CD1 . LEU A 1 161  ? 111.640 120.415 89.441  1.00 51.20  ? 140  LEU A CD1 1 
ATOM   536  C  CD2 . LEU A 1 161  ? 111.139 122.735 90.083  1.00 51.20  ? 140  LEU A CD2 1 
ATOM   537  N  N   . ASN A 1 162  ? 106.517 120.086 89.339  1.00 42.37  ? 141  ASN A N   1 
ATOM   538  C  CA  . ASN A 1 162  ? 105.600 119.064 88.860  1.00 42.37  ? 141  ASN A CA  1 
ATOM   539  C  C   . ASN A 1 162  ? 105.120 119.354 87.447  1.00 42.37  ? 141  ASN A C   1 
ATOM   540  O  O   . ASN A 1 162  ? 104.685 118.432 86.755  1.00 42.37  ? 141  ASN A O   1 
ATOM   541  C  CB  . ASN A 1 162  ? 104.380 118.929 89.763  1.00 42.37  ? 141  ASN A CB  1 
ATOM   542  C  CG  . ASN A 1 162  ? 103.725 117.577 89.633  1.00 42.37  ? 141  ASN A CG  1 
ATOM   543  O  OD1 . ASN A 1 162  ? 104.294 116.669 89.036  1.00 42.37  ? 141  ASN A OD1 1 
ATOM   544  N  ND2 . ASN A 1 162  ? 102.518 117.436 90.155  1.00 42.37  ? 141  ASN A ND2 1 
ATOM   545  N  N   . TYR A 1 163  ? 105.194 120.605 86.992  1.00 50.73  ? 142  TYR A N   1 
ATOM   546  C  CA  . TYR A 1 163  ? 104.716 120.871 85.644  1.00 50.73  ? 142  TYR A CA  1 
ATOM   547  C  C   . TYR A 1 163  ? 105.774 120.488 84.619  1.00 50.73  ? 142  TYR A C   1 
ATOM   548  O  O   . TYR A 1 163  ? 105.484 119.757 83.662  1.00 50.73  ? 142  TYR A O   1 
ATOM   549  C  CB  . TYR A 1 163  ? 104.329 122.337 85.497  1.00 50.73  ? 142  TYR A CB  1 
ATOM   550  C  CG  . TYR A 1 163  ? 103.334 122.578 84.392  1.00 50.73  ? 142  TYR A CG  1 
ATOM   551  C  CD1 . TYR A 1 163  ? 101.995 122.327 84.598  1.00 50.73  ? 142  TYR A CD1 1 
ATOM   552  C  CD2 . TYR A 1 163  ? 103.730 123.024 83.154  1.00 50.73  ? 142  TYR A CD2 1 
ATOM   553  C  CE1 . TYR A 1 163  ? 101.083 122.533 83.605  1.00 50.73  ? 142  TYR A CE1 1 
ATOM   554  C  CE2 . TYR A 1 163  ? 102.829 123.244 82.164  1.00 50.73  ? 142  TYR A CE2 1 
ATOM   555  C  CZ  . TYR A 1 163  ? 101.509 122.990 82.392  1.00 50.73  ? 142  TYR A CZ  1 
ATOM   556  O  OH  . TYR A 1 163  ? 100.610 123.203 81.387  1.00 50.73  ? 142  TYR A OH  1 
ATOM   557  N  N   . THR A 1 164  ? 107.017 120.936 84.829  1.00 55.60  ? 143  THR A N   1 
ATOM   558  C  CA  . THR A 1 164  ? 108.080 120.597 83.887  1.00 55.60  ? 143  THR A CA  1 
ATOM   559  C  C   . THR A 1 164  ? 108.449 119.126 83.976  1.00 55.60  ? 143  THR A C   1 
ATOM   560  O  O   . THR A 1 164  ? 108.716 118.492 82.952  1.00 55.60  ? 143  THR A O   1 
ATOM   561  C  CB  . THR A 1 164  ? 109.325 121.438 84.125  1.00 55.60  ? 143  THR A CB  1 
ATOM   562  O  OG1 . THR A 1 164  ? 109.897 121.086 85.387  1.00 55.60  ? 143  THR A OG1 1 
ATOM   563  C  CG2 . THR A 1 164  ? 108.992 122.898 84.132  1.00 55.60  ? 143  THR A CG2 1 
ATOM   564  N  N   . ARG A 1 165  ? 108.471 118.561 85.185  1.00 71.68  ? 144  ARG A N   1 
ATOM   565  C  CA  . ARG A 1 165  ? 108.656 117.119 85.299  1.00 71.68  ? 144  ARG A CA  1 
ATOM   566  C  C   . ARG A 1 165  ? 107.436 116.350 84.831  1.00 71.68  ? 144  ARG A C   1 
ATOM   567  O  O   . ARG A 1 165  ? 107.549 115.160 84.531  1.00 71.68  ? 144  ARG A O   1 
ATOM   568  C  CB  . ARG A 1 165  ? 108.979 116.710 86.735  1.00 71.68  ? 144  ARG A CB  1 
ATOM   569  C  CG  . ARG A 1 165  ? 110.355 117.117 87.217  1.00 71.68  ? 144  ARG A CG  1 
ATOM   570  C  CD  . ARG A 1 165  ? 110.569 116.652 88.636  1.00 71.68  ? 144  ARG A CD  1 
ATOM   571  N  NE  . ARG A 1 165  ? 110.646 115.202 88.693  1.00 71.68  ? 144  ARG A NE  1 
ATOM   572  C  CZ  . ARG A 1 165  ? 111.773 114.518 88.537  1.00 71.68  ? 144  ARG A CZ  1 
ATOM   573  N  NH1 . ARG A 1 165  ? 112.912 115.159 88.326  1.00 71.68  ? 144  ARG A NH1 1 
ATOM   574  N  NH2 . ARG A 1 165  ? 111.767 113.196 88.596  1.00 71.68  ? 144  ARG A NH2 1 
ATOM   575  N  N   . GLN A 1 166  ? 106.274 116.995 84.761  1.00 50.95  ? 145  GLN A N   1 
ATOM   576  C  CA  . GLN A 1 166  ? 105.087 116.297 84.299  1.00 50.95  ? 145  GLN A CA  1 
ATOM   577  C  C   . GLN A 1 166  ? 105.096 116.145 82.788  1.00 50.95  ? 145  GLN A C   1 
ATOM   578  O  O   . GLN A 1 166  ? 104.986 115.031 82.267  1.00 50.95  ? 145  GLN A O   1 
ATOM   579  C  CB  . GLN A 1 166  ? 103.826 117.031 84.748  1.00 50.95  ? 145  GLN A CB  1 
ATOM   580  C  CG  . GLN A 1 166  ? 102.561 116.266 84.438  1.00 50.95  ? 145  GLN A CG  1 
ATOM   581  C  CD  . GLN A 1 166  ? 101.325 116.967 84.933  1.00 50.95  ? 145  GLN A CD  1 
ATOM   582  O  OE1 . GLN A 1 166  ? 101.393 118.077 85.450  1.00 50.95  ? 145  GLN A OE1 1 
ATOM   583  N  NE2 . GLN A 1 166  ? 100.182 116.316 84.788  1.00 50.95  ? 145  GLN A NE2 1 
ATOM   584  N  N   . LYS A 1 167  ? 105.234 117.251 82.061  1.00 50.20  ? 146  LYS A N   1 
ATOM   585  C  CA  . LYS A 1 167  ? 105.029 117.209 80.618  1.00 50.20  ? 146  LYS A CA  1 
ATOM   586  C  C   . LYS A 1 167  ? 106.276 116.839 79.824  1.00 50.20  ? 146  LYS A C   1 
ATOM   587  O  O   . LYS A 1 167  ? 106.283 117.004 78.602  1.00 50.20  ? 146  LYS A O   1 
ATOM   588  C  CB  . LYS A 1 167  ? 104.469 118.538 80.125  1.00 50.20  ? 146  LYS A CB  1 
ATOM   589  C  CG  . LYS A 1 167  ? 103.021 118.706 80.481  1.00 50.20  ? 146  LYS A CG  1 
ATOM   590  C  CD  . LYS A 1 167  ? 102.461 119.994 79.949  1.00 50.20  ? 146  LYS A CD  1 
ATOM   591  C  CE  . LYS A 1 167  ? 100.960 120.032 80.140  1.00 50.20  ? 146  LYS A CE  1 
ATOM   592  N  NZ  . LYS A 1 167  ? 100.582 120.004 81.576  1.00 50.20  ? 146  LYS A NZ  1 
ATOM   593  N  N   . ILE A 1 168  ? 107.324 116.342 80.474  1.00 56.90  ? 147  ILE A N   1 
ATOM   594  C  CA  . ILE A 1 168  ? 108.493 115.829 79.768  1.00 56.90  ? 147  ILE A CA  1 
ATOM   595  C  C   . ILE A 1 168  ? 108.794 114.415 80.246  1.00 56.90  ? 147  ILE A C   1 
ATOM   596  O  O   . ILE A 1 168  ? 108.923 113.487 79.441  1.00 56.90  ? 147  ILE A O   1 
ATOM   597  C  CB  . ILE A 1 168  ? 109.710 116.753 79.940  1.00 56.90  ? 147  ILE A CB  1 
ATOM   598  C  CG1 . ILE A 1 168  ? 109.576 117.989 79.057  1.00 56.90  ? 147  ILE A CG1 1 
ATOM   599  C  CG2 . ILE A 1 168  ? 110.988 116.028 79.622  1.00 56.90  ? 147  ILE A CG2 1 
ATOM   600  C  CD1 . ILE A 1 168  ? 108.940 119.152 79.721  1.00 56.90  ? 147  ILE A CD1 1 
ATOM   601  N  N   . GLY A 1 169  ? 108.882 114.241 81.558  1.00 79.68  ? 148  GLY A N   1 
ATOM   602  C  CA  . GLY A 1 169  ? 109.237 112.972 82.161  1.00 79.68  ? 148  GLY A CA  1 
ATOM   603  C  C   . GLY A 1 169  ? 110.312 113.193 83.198  1.00 79.68  ? 148  GLY A C   1 
ATOM   604  O  O   . GLY A 1 169  ? 110.294 112.594 84.275  1.00 79.68  ? 148  GLY A O   1 
ATOM   605  N  N   . GLU A 1 170  ? 111.242 114.083 82.881  1.00 98.77  ? 149  GLU A N   1 
ATOM   606  C  CA  . GLU A 1 170  ? 112.214 114.608 83.833  1.00 98.77  ? 149  GLU A CA  1 
ATOM   607  C  C   . GLU A 1 170  ? 112.363 116.085 83.509  1.00 98.77  ? 149  GLU A C   1 
ATOM   608  O  O   . GLU A 1 170  ? 111.528 116.678 82.819  1.00 98.77  ? 149  GLU A O   1 
ATOM   609  C  CB  . GLU A 1 170  ? 113.566 113.878 83.776  1.00 98.77  ? 149  GLU A CB  1 
ATOM   610  C  CG  . GLU A 1 170  ? 113.582 112.443 84.278  1.00 98.77  ? 149  GLU A CG  1 
ATOM   611  C  CD  . GLU A 1 170  ? 113.207 111.454 83.197  1.00 98.77  ? 149  GLU A CD  1 
ATOM   612  O  OE1 . GLU A 1 170  ? 112.971 111.894 82.053  1.00 98.77  ? 149  GLU A OE1 1 
ATOM   613  O  OE2 . GLU A 1 170  ? 113.158 110.239 83.487  1.00 98.77  ? 149  GLU A OE2 1 
ATOM   614  N  N   . GLU A 1 171  ? 113.421 116.696 84.011  1.00 93.05  ? 150  GLU A N   1 
ATOM   615  C  CA  . GLU A 1 171  ? 113.716 118.080 83.694  1.00 93.05  ? 150  GLU A CA  1 
ATOM   616  C  C   . GLU A 1 171  ? 115.038 118.174 82.943  1.00 93.05  ? 150  GLU A C   1 
ATOM   617  O  O   . GLU A 1 171  ? 115.787 117.198 82.827  1.00 93.05  ? 150  GLU A O   1 
ATOM   618  C  CB  . GLU A 1 171  ? 113.747 118.939 84.964  1.00 93.05  ? 150  GLU A CB  1 
ATOM   619  C  CG  . GLU A 1 171  ? 114.895 118.633 85.911  1.00 93.05  ? 150  GLU A CG  1 
ATOM   620  C  CD  . GLU A 1 171  ? 114.580 117.533 86.913  1.00 93.05  ? 150  GLU A CD  1 
ATOM   621  O  OE1 . GLU A 1 171  ? 113.624 116.762 86.694  1.00 93.05  ? 150  GLU A OE1 1 
ATOM   622  O  OE2 . GLU A 1 171  ? 115.292 117.445 87.933  1.00 93.05  ? 150  GLU A OE2 1 
ATOM   623  N  N   . ALA A 1 172  ? 115.245 119.356 82.352  1.00 85.01  ? 151  ALA A N   1 
ATOM   624  C  CA  . ALA A 1 172  ? 116.497 119.880 81.803  1.00 85.01  ? 151  ALA A CA  1 
ATOM   625  C  C   . ALA A 1 172  ? 116.965 119.220 80.508  1.00 85.01  ? 151  ALA A C   1 
ATOM   626  O  O   . ALA A 1 172  ? 117.966 119.659 79.933  1.00 85.01  ? 151  ALA A O   1 
ATOM   627  C  CB  . ALA A 1 172  ? 117.615 119.814 82.852  1.00 85.01  ? 151  ALA A CB  1 
ATOM   628  N  N   . MET A 1 173  ? 116.310 118.137 80.078  1.00 76.58  ? 152  MET A N   1 
ATOM   629  C  CA  . MET A 1 173  ? 116.402 117.541 78.738  1.00 76.58  ? 152  MET A CA  1 
ATOM   630  C  C   . MET A 1 173  ? 117.759 116.949 78.351  1.00 76.58  ? 152  MET A C   1 
ATOM   631  O  O   . MET A 1 173  ? 117.861 116.275 77.320  1.00 76.58  ? 152  MET A O   1 
ATOM   632  C  CB  . MET A 1 173  ? 115.998 118.556 77.663  1.00 76.58  ? 152  MET A CB  1 
ATOM   633  C  CG  . MET A 1 173  ? 114.536 118.895 77.674  1.00 76.58  ? 152  MET A CG  1 
ATOM   634  S  SD  . MET A 1 173  ? 113.542 117.411 77.453  1.00 76.58  ? 152  MET A SD  1 
ATOM   635  C  CE  . MET A 1 173  ? 113.945 116.941 75.777  1.00 76.58  ? 152  MET A CE  1 
ATOM   636  N  N   . PHE A 1 174  ? 118.777 117.145 79.175  1.00 54.88  ? 153  PHE A N   1 
ATOM   637  C  CA  . PHE A 1 174  ? 120.144 116.710 78.918  1.00 54.88  ? 153  PHE A CA  1 
ATOM   638  C  C   . PHE A 1 174  ? 120.912 116.867 80.216  1.00 54.88  ? 153  PHE A C   1 
ATOM   639  O  O   . PHE A 1 174  ? 120.367 117.300 81.234  1.00 54.88  ? 153  PHE A O   1 
ATOM   640  C  CB  . PHE A 1 174  ? 120.807 117.483 77.772  1.00 54.88  ? 153  PHE A CB  1 
ATOM   641  C  CG  . PHE A 1 174  ? 120.678 118.974 77.872  1.00 54.88  ? 153  PHE A CG  1 
ATOM   642  C  CD1 . PHE A 1 174  ? 119.663 119.627 77.197  1.00 54.88  ? 153  PHE A CD1 1 
ATOM   643  C  CD2 . PHE A 1 174  ? 121.560 119.723 78.627  1.00 54.88  ? 153  PHE A CD2 1 
ATOM   644  C  CE1 . PHE A 1 174  ? 119.532 120.992 77.268  1.00 54.88  ? 153  PHE A CE1 1 
ATOM   645  C  CE2 . PHE A 1 174  ? 121.435 121.092 78.704  1.00 54.88  ? 153  PHE A CE2 1 
ATOM   646  C  CZ  . PHE A 1 174  ? 120.420 121.724 78.022  1.00 54.88  ? 153  PHE A CZ  1 
ATOM   647  N  N   . ASN A 1 175  ? 122.175 116.521 80.168  1.00 34.26  ? 154  ASN A N   1 
ATOM   648  C  CA  . ASN A 1 175  ? 123.070 116.745 81.287  1.00 34.26  ? 154  ASN A CA  1 
ATOM   649  C  C   . ASN A 1 175  ? 124.488 116.917 80.768  1.00 34.26  ? 154  ASN A C   1 
ATOM   650  O  O   . ASN A 1 175  ? 125.092 115.967 80.267  1.00 34.26  ? 154  ASN A O   1 
ATOM   651  C  CB  . ASN A 1 175  ? 122.956 115.605 82.300  1.00 34.26  ? 154  ASN A CB  1 
ATOM   652  C  CG  . ASN A 1 175  ? 122.901 114.251 81.646  1.00 34.26  ? 154  ASN A CG  1 
ATOM   653  O  OD1 . ASN A 1 175  ? 122.970 114.141 80.428  1.00 34.26  ? 154  ASN A OD1 1 
ATOM   654  N  ND2 . ASN A 1 175  ? 122.764 113.207 82.450  1.00 34.26  ? 154  ASN A ND2 1 
ATOM   655  N  N   . PRO A 1 176  ? 125.039 118.119 80.850  1.00 20.00  ? 155  PRO A N   1 
ATOM   656  C  CA  . PRO A 1 176  ? 126.344 118.368 80.248  1.00 20.00  ? 155  PRO A CA  1 
ATOM   657  C  C   . PRO A 1 176  ? 127.467 117.743 81.048  1.00 20.00  ? 155  PRO A C   1 
ATOM   658  O  O   . PRO A 1 176  ? 127.448 117.728 82.278  1.00 20.00  ? 155  PRO A O   1 
ATOM   659  C  CB  . PRO A 1 176  ? 126.440 119.892 80.256  1.00 20.00  ? 155  PRO A CB  1 
ATOM   660  C  CG  . PRO A 1 176  ? 125.605 120.298 81.382  1.00 20.00  ? 155  PRO A CG  1 
ATOM   661  C  CD  . PRO A 1 176  ? 124.478 119.331 81.456  1.00 20.00  ? 155  PRO A CD  1 
ATOM   662  N  N   . GLN A 1 177  ? 128.450 117.230 80.330  1.00 29.32  ? 156  GLN A N   1 
ATOM   663  C  CA  . GLN A 1 177  ? 129.635 116.582 80.879  1.00 29.32  ? 156  GLN A CA  1 
ATOM   664  C  C   . GLN A 1 177  ? 130.807 117.489 80.544  1.00 29.32  ? 156  GLN A C   1 
ATOM   665  O  O   . GLN A 1 177  ? 131.488 117.291 79.541  1.00 29.32  ? 156  GLN A O   1 
ATOM   666  C  CB  . GLN A 1 177  ? 129.815 115.200 80.287  1.00 29.32  ? 156  GLN A CB  1 
ATOM   667  C  CG  . GLN A 1 177  ? 129.085 114.091 80.991  1.00 29.32  ? 156  GLN A CG  1 
ATOM   668  C  CD  . GLN A 1 177  ? 127.613 114.325 81.080  1.00 29.32  ? 156  GLN A CD  1 
ATOM   669  O  OE1 . GLN A 1 177  ? 127.047 114.333 82.162  1.00 29.32  ? 156  GLN A OE1 1 
ATOM   670  N  NE2 . GLN A 1 177  ? 126.987 114.578 79.955  1.00 29.32  ? 156  GLN A NE2 1 
ATOM   671  N  N   . LEU A 1 178  ? 131.061 118.467 81.398  1.00 23.28  ? 157  LEU A N   1 
ATOM   672  C  CA  . LEU A 1 178  ? 131.800 119.643 80.982  1.00 23.28  ? 157  LEU A CA  1 
ATOM   673  C  C   . LEU A 1 178  ? 133.152 119.741 81.670  1.00 23.28  ? 157  LEU A C   1 
ATOM   674  O  O   . LEU A 1 178  ? 133.350 119.202 82.757  1.00 23.28  ? 157  LEU A O   1 
ATOM   675  C  CB  . LEU A 1 178  ? 130.955 120.885 81.244  1.00 23.28  ? 157  LEU A CB  1 
ATOM   676  C  CG  . LEU A 1 178  ? 130.441 121.155 82.654  1.00 23.28  ? 157  LEU A CG  1 
ATOM   677  C  CD1 . LEU A 1 178  ? 131.303 122.148 83.353  1.00 23.28  ? 157  LEU A CD1 1 
ATOM   678  C  CD2 . LEU A 1 178  ? 129.025 121.662 82.611  1.00 23.28  ? 157  LEU A CD2 1 
ATOM   679  N  N   . MET A 1 179  ? 134.077 120.468 81.035  1.00 37.77  ? 158  MET A N   1 
ATOM   680  C  CA  . MET A 1 179  ? 135.430 120.634 81.549  1.00 37.77  ? 158  MET A CA  1 
ATOM   681  C  C   . MET A 1 179  ? 135.844 122.098 81.553  1.00 37.77  ? 158  MET A C   1 
ATOM   682  O  O   . MET A 1 179  ? 135.262 122.933 80.866  1.00 37.77  ? 158  MET A O   1 
ATOM   683  C  CB  . MET A 1 179  ? 136.472 119.862 80.738  1.00 37.77  ? 158  MET A CB  1 
ATOM   684  C  CG  . MET A 1 179  ? 136.780 120.444 79.389  1.00 37.77  ? 158  MET A CG  1 
ATOM   685  S  SD  . MET A 1 179  ? 138.165 119.616 78.607  1.00 37.77  ? 158  MET A SD  1 
ATOM   686  C  CE  . MET A 1 179  ? 137.432 118.033 78.266  1.00 37.77  ? 158  MET A CE  1 
ATOM   687  N  N   . ILE A 1 180  ? 136.884 122.392 82.331  1.00 44.52  ? 159  ILE A N   1 
ATOM   688  C  CA  . ILE A 1 180  ? 137.509 123.710 82.409  1.00 44.52  ? 159  ILE A CA  1 
ATOM   689  C  C   . ILE A 1 180  ? 139.018 123.523 82.413  1.00 44.52  ? 159  ILE A C   1 
ATOM   690  O  O   . ILE A 1 180  ? 139.537 122.665 83.130  1.00 44.52  ? 159  ILE A O   1 
ATOM   691  C  CB  . ILE A 1 180  ? 137.039 124.512 83.648  1.00 44.52  ? 159  ILE A CB  1 
ATOM   692  C  CG1 . ILE A 1 180  ? 135.805 125.347 83.330  1.00 44.52  ? 159  ILE A CG1 1 
ATOM   693  C  CG2 . ILE A 1 180  ? 138.094 125.456 84.181  1.00 44.52  ? 159  ILE A CG2 1 
ATOM   694  C  CD1 . ILE A 1 180  ? 134.505 124.712 83.549  1.00 44.52  ? 159  ILE A CD1 1 
ATOM   695  N  N   . GLN A 1 181  ? 139.712 124.295 81.585  1.00 49.77  ? 160  GLN A N   1 
ATOM   696  C  CA  . GLN A 1 181  ? 141.162 124.385 81.624  1.00 49.77  ? 160  GLN A CA  1 
ATOM   697  C  C   . GLN A 1 181  ? 141.581 125.632 82.394  1.00 49.77  ? 160  GLN A C   1 
ATOM   698  O  O   . GLN A 1 181  ? 140.994 126.704 82.229  1.00 49.77  ? 160  GLN A O   1 
ATOM   699  C  CB  . GLN A 1 181  ? 141.727 124.423 80.213  1.00 49.77  ? 160  GLN A CB  1 
ATOM   700  C  CG  . GLN A 1 181  ? 143.207 124.395 80.139  1.00 49.77  ? 160  GLN A CG  1 
ATOM   701  C  CD  . GLN A 1 181  ? 143.667 124.475 78.722  1.00 49.77  ? 160  GLN A CD  1 
ATOM   702  O  OE1 . GLN A 1 181  ? 142.861 124.598 77.808  1.00 49.77  ? 160  GLN A OE1 1 
ATOM   703  N  NE2 . GLN A 1 181  ? 144.967 124.410 78.519  1.00 49.77  ? 160  GLN A NE2 1 
ATOM   704  N  N   . THR A 1 182  ? 142.597 125.487 83.245  1.00 80.76  ? 161  THR A N   1 
ATOM   705  C  CA  . THR A 1 182  ? 143.097 126.505 84.159  1.00 80.76  ? 161  THR A CA  1 
ATOM   706  C  C   . THR A 1 182  ? 144.587 126.757 83.914  1.00 80.76  ? 161  THR A C   1 
ATOM   707  O  O   . THR A 1 182  ? 145.304 125.849 83.488  1.00 80.76  ? 161  THR A O   1 
ATOM   708  C  CB  . THR A 1 182  ? 142.874 126.065 85.613  1.00 80.76  ? 161  THR A CB  1 
ATOM   709  O  OG1 . THR A 1 182  ? 143.552 124.826 85.836  1.00 80.76  ? 161  THR A OG1 1 
ATOM   710  C  CG2 . THR A 1 182  ? 141.397 125.905 85.908  1.00 80.76  ? 161  THR A CG2 1 
ATOM   711  N  N   . PRO A 1 183  ? 145.088 127.972 84.178  1.00 77.86  ? 162  PRO A N   1 
ATOM   712  C  CA  . PRO A 1 183  ? 146.441 128.321 83.732  1.00 77.86  ? 162  PRO A CA  1 
ATOM   713  C  C   . PRO A 1 183  ? 147.561 127.720 84.554  1.00 77.86  ? 162  PRO A C   1 
ATOM   714  O  O   . PRO A 1 183  ? 148.617 127.393 84.008  1.00 77.86  ? 162  PRO A O   1 
ATOM   715  C  CB  . PRO A 1 183  ? 146.475 129.838 83.904  1.00 77.86  ? 162  PRO A CB  1 
ATOM   716  C  CG  . PRO A 1 183  ? 145.127 130.251 84.085  1.00 77.86  ? 162  PRO A CG  1 
ATOM   717  C  CD  . PRO A 1 183  ? 144.417 129.153 84.736  1.00 77.86  ? 162  PRO A CD  1 
ATOM   718  N  N   . LYS A 1 184  ? 147.335 127.626 85.869  1.00 91.19  ? 163  LYS A N   1 
ATOM   719  C  CA  . LYS A 1 184  ? 148.372 127.402 86.888  1.00 91.19  ? 163  LYS A CA  1 
ATOM   720  C  C   . LYS A 1 184  ? 149.467 128.475 86.789  1.00 91.19  ? 163  LYS A C   1 
ATOM   721  O  O   . LYS A 1 184  ? 150.664 128.189 86.732  1.00 91.19  ? 163  LYS A O   1 
ATOM   722  C  CB  . LYS A 1 184  ? 148.925 125.969 86.815  1.00 91.19  ? 163  LYS A CB  1 
ATOM   723  C  CG  . LYS A 1 184  ? 149.721 125.447 88.008  1.00 91.19  ? 163  LYS A CG  1 
ATOM   724  C  CD  . LYS A 1 184  ? 149.988 123.964 87.844  1.00 91.19  ? 163  LYS A CD  1 
ATOM   725  C  CE  . LYS A 1 184  ? 151.018 123.703 86.769  1.00 91.19  ? 163  LYS A CE  1 
ATOM   726  N  NZ  . LYS A 1 184  ? 151.322 122.258 86.636  1.00 91.19  ? 163  LYS A NZ  1 
ATOM   727  N  N   . GLU A 1 185  ? 149.038 129.730 86.683  1.00 97.57  ? 164  GLU A N   1 
ATOM   728  C  CA  . GLU A 1 185  ? 149.861 130.891 87.014  1.00 97.57  ? 164  GLU A CA  1 
ATOM   729  C  C   . GLU A 1 185  ? 149.114 131.949 87.817  1.00 97.57  ? 164  GLU A C   1 
ATOM   730  O  O   . GLU A 1 185  ? 149.749 132.593 88.660  1.00 97.57  ? 164  GLU A O   1 
ATOM   731  C  CB  . GLU A 1 185  ? 150.450 131.528 85.734  1.00 97.57  ? 164  GLU A CB  1 
ATOM   732  C  CG  . GLU A 1 185  ? 151.392 132.728 85.971  1.00 97.57  ? 164  GLU A CG  1 
ATOM   733  C  CD  . GLU A 1 185  ? 152.029 133.300 84.716  1.00 97.57  ? 164  GLU A CD  1 
ATOM   734  O  OE1 . GLU A 1 185  ? 151.840 132.735 83.626  1.00 97.57  ? 164  GLU A OE1 1 
ATOM   735  O  OE2 . GLU A 1 185  ? 152.714 134.337 84.823  1.00 97.57  ? 164  GLU A OE2 1 
ATOM   736  N  N   . GLU A 1 186  ? 147.779 132.046 87.673  1.00 115.64 ? 165  GLU A N   1 
ATOM   737  C  CA  . GLU A 1 186  ? 146.774 133.044 88.060  1.00 115.64 ? 165  GLU A CA  1 
ATOM   738  C  C   . GLU A 1 186  ? 146.755 134.241 87.082  1.00 115.64 ? 165  GLU A C   1 
ATOM   739  O  O   . GLU A 1 186  ? 145.823 135.040 87.131  1.00 115.64 ? 165  GLU A O   1 
ATOM   740  C  CB  . GLU A 1 186  ? 146.931 133.548 89.518  1.00 115.64 ? 165  GLU A CB  1 
ATOM   741  C  CG  . GLU A 1 186  ? 145.779 134.310 90.173  1.00 115.64 ? 165  GLU A CG  1 
ATOM   742  C  CD  . GLU A 1 186  ? 144.566 133.441 90.432  1.00 115.64 ? 165  GLU A CD  1 
ATOM   743  O  OE1 . GLU A 1 186  ? 144.738 132.221 90.632  1.00 115.64 ? 165  GLU A OE1 1 
ATOM   744  O  OE2 . GLU A 1 186  ? 143.438 133.979 90.429  1.00 115.64 ? 165  GLU A OE2 1 
ATOM   745  N  N   . GLY A 1 187  ? 147.689 134.344 86.144  1.00 89.47  ? 166  GLY A N   1 
ATOM   746  C  CA  . GLY A 1 187  ? 147.618 135.424 85.175  1.00 89.47  ? 166  GLY A CA  1 
ATOM   747  C  C   . GLY A 1 187  ? 148.111 135.076 83.785  1.00 89.47  ? 166  GLY A C   1 
ATOM   748  O  O   . GLY A 1 187  ? 148.560 135.959 83.052  1.00 89.47  ? 166  GLY A O   1 
ATOM   749  N  N   . ALA A 1 188  ? 148.037 133.803 83.401  1.00 81.59  ? 167  ALA A N   1 
ATOM   750  C  CA  . ALA A 1 188  ? 148.818 133.331 82.263  1.00 81.59  ? 167  ALA A CA  1 
ATOM   751  C  C   . ALA A 1 188  ? 148.235 133.681 80.905  1.00 81.59  ? 167  ALA A C   1 
ATOM   752  O  O   . ALA A 1 188  ? 148.886 133.355 79.904  1.00 81.59  ? 167  ALA A O   1 
ATOM   753  C  CB  . ALA A 1 188  ? 149.006 131.817 82.315  1.00 81.59  ? 167  ALA A CB  1 
ATOM   754  N  N   . ASN A 1 189  ? 147.055 134.309 80.848  1.00 61.62  ? 168  ASN A N   1 
ATOM   755  C  CA  . ASN A 1 189  ? 146.396 134.710 79.600  1.00 61.62  ? 168  ASN A CA  1 
ATOM   756  C  C   . ASN A 1 189  ? 146.187 133.496 78.687  1.00 61.62  ? 168  ASN A C   1 
ATOM   757  O  O   . ASN A 1 189  ? 146.876 133.321 77.683  1.00 61.62  ? 168  ASN A O   1 
ATOM   758  C  CB  . ASN A 1 189  ? 147.165 135.827 78.876  1.00 61.62  ? 168  ASN A CB  1 
ATOM   759  C  CG  . ASN A 1 189  ? 146.379 136.443 77.718  1.00 61.62  ? 168  ASN A CG  1 
ATOM   760  O  OD1 . ASN A 1 189  ? 145.226 136.103 77.476  1.00 61.62  ? 168  ASN A OD1 1 
ATOM   761  N  ND2 . ASN A 1 189  ? 147.008 137.362 77.006  1.00 61.62  ? 168  ASN A ND2 1 
ATOM   762  N  N   . VAL A 1 190  ? 145.247 132.638 79.081  1.00 53.80  ? 169  VAL A N   1 
ATOM   763  C  CA  . VAL A 1 190  ? 145.089 131.378 78.366  1.00 53.80  ? 169  VAL A CA  1 
ATOM   764  C  C   . VAL A 1 190  ? 144.365 131.667 77.060  1.00 53.80  ? 169  VAL A C   1 
ATOM   765  O  O   . VAL A 1 190  ? 143.141 131.552 76.953  1.00 53.80  ? 169  VAL A O   1 
ATOM   766  C  CB  . VAL A 1 190  ? 144.324 130.352 79.216  1.00 53.80  ? 169  VAL A CB  1 
ATOM   767  C  CG1 . VAL A 1 190  ? 144.251 129.005 78.529  1.00 53.80  ? 169  VAL A CG1 1 
ATOM   768  C  CG2 . VAL A 1 190  ? 145.002 130.202 80.507  1.00 53.80  ? 169  VAL A CG2 1 
ATOM   769  N  N   . LEU A 1 191  ? 145.145 132.090 76.073  1.00 55.31  ? 170  LEU A N   1 
ATOM   770  C  CA  . LEU A 1 191  ? 144.809 132.093 74.662  1.00 55.31  ? 170  LEU A CA  1 
ATOM   771  C  C   . LEU A 1 191  ? 146.046 131.711 73.879  1.00 55.31  ? 170  LEU A C   1 
ATOM   772  O  O   . LEU A 1 191  ? 146.277 132.216 72.780  1.00 55.31  ? 170  LEU A O   1 
ATOM   773  C  CB  . LEU A 1 191  ? 144.279 133.446 74.177  1.00 55.31  ? 170  LEU A CB  1 
ATOM   774  C  CG  . LEU A 1 191  ? 142.854 133.895 74.513  1.00 55.31  ? 170  LEU A CG  1 
ATOM   775  C  CD1 . LEU A 1 191  ? 142.789 134.570 75.846  1.00 55.31  ? 170  LEU A CD1 1 
ATOM   776  C  CD2 . LEU A 1 191  ? 142.302 134.804 73.451  1.00 55.31  ? 170  LEU A CD2 1 
ATOM   777  N  N   . THR A 1 192  ? 146.884 130.879 74.469  1.00 72.35  ? 171  THR A N   1 
ATOM   778  C  CA  . THR A 1 192  ? 148.101 130.426 73.833  1.00 72.35  ? 171  THR A CA  1 
ATOM   779  C  C   . THR A 1 192  ? 147.828 129.143 73.068  1.00 72.35  ? 171  THR A C   1 
ATOM   780  O  O   . THR A 1 192  ? 146.987 128.325 73.459  1.00 72.35  ? 171  THR A O   1 
ATOM   781  C  CB  . THR A 1 192  ? 149.195 130.199 74.875  1.00 72.35  ? 171  THR A CB  1 
ATOM   782  O  OG1 . THR A 1 192  ? 148.764 129.199 75.802  1.00 72.35  ? 171  THR A OG1 1 
ATOM   783  C  CG2 . THR A 1 192  ? 149.466 131.480 75.639  1.00 72.35  ? 171  THR A CG2 1 
ATOM   784  N  N   . THR A 1 193  ? 148.554 128.973 71.964  1.00 77.39  ? 172  THR A N   1 
ATOM   785  C  CA  . THR A 1 193  ? 148.351 127.803 71.126  1.00 77.39  ? 172  THR A CA  1 
ATOM   786  C  C   . THR A 1 193  ? 148.819 126.522 71.789  1.00 77.39  ? 172  THR A C   1 
ATOM   787  O  O   . THR A 1 193  ? 148.353 125.443 71.413  1.00 77.39  ? 172  THR A O   1 
ATOM   788  C  CB  . THR A 1 193  ? 149.064 127.988 69.800  1.00 77.39  ? 172  THR A CB  1 
ATOM   789  O  OG1 . THR A 1 193  ? 150.464 128.159 70.042  1.00 77.39  ? 172  THR A OG1 1 
ATOM   790  C  CG2 . THR A 1 193  ? 148.530 129.211 69.107  1.00 77.39  ? 172  THR A CG2 1 
ATOM   791  N  N   . GLU A 1 194  ? 149.725 126.609 72.762  1.00 63.51  ? 173  GLU A N   1 
ATOM   792  C  CA  . GLU A 1 194  ? 150.036 125.434 73.566  1.00 63.51  ? 173  GLU A CA  1 
ATOM   793  C  C   . GLU A 1 194  ? 148.852 125.017 74.432  1.00 63.51  ? 173  GLU A C   1 
ATOM   794  O  O   . GLU A 1 194  ? 148.612 123.818 74.630  1.00 63.51  ? 173  GLU A O   1 
ATOM   795  C  CB  . GLU A 1 194  ? 151.277 125.700 74.420  1.00 63.51  ? 173  GLU A CB  1 
ATOM   796  C  CG  . GLU A 1 194  ? 151.176 126.909 75.343  1.00 63.51  ? 173  GLU A CG  1 
ATOM   797  C  CD  . GLU A 1 194  ? 152.374 127.072 76.247  1.00 63.51  ? 173  GLU A CD  1 
ATOM   798  O  OE1 . GLU A 1 194  ? 153.323 126.274 76.133  1.00 63.51  ? 173  GLU A OE1 1 
ATOM   799  O  OE2 . GLU A 1 194  ? 152.355 127.990 77.088  1.00 63.51  ? 173  GLU A OE2 1 
ATOM   800  N  N   . ALA A 1 195  ? 148.080 125.985 74.914  1.00 61.68  ? 174  ALA A N   1 
ATOM   801  C  CA  . ALA A 1 195  ? 146.946 125.667 75.761  1.00 61.68  ? 174  ALA A CA  1 
ATOM   802  C  C   . ALA A 1 195  ? 145.787 125.156 74.934  1.00 61.68  ? 174  ALA A C   1 
ATOM   803  O  O   . ALA A 1 195  ? 145.085 124.231 75.350  1.00 61.68  ? 174  ALA A O   1 
ATOM   804  C  CB  . ALA A 1 195  ? 146.526 126.893 76.558  1.00 61.68  ? 174  ALA A CB  1 
ATOM   805  N  N   . LEU A 1 196  ? 145.582 125.737 73.756  1.00 235.71 ? 175  LEU A N   1 
ATOM   806  C  CA  . LEU A 1 196  ? 144.570 125.195 72.870  1.00 237.78 ? 175  LEU A CA  1 
ATOM   807  C  C   . LEU A 1 196  ? 144.987 123.854 72.287  1.00 238.48 ? 175  LEU A C   1 
ATOM   808  O  O   . LEU A 1 196  ? 144.124 123.078 71.878  1.00 238.07 ? 175  LEU A O   1 
ATOM   809  C  CB  . LEU A 1 196  ? 144.253 126.176 71.747  1.00 99.29  ? 175  LEU A CB  1 
ATOM   810  C  CG  . LEU A 1 196  ? 143.179 127.229 72.016  1.00 99.29  ? 175  LEU A CG  1 
ATOM   811  C  CD1 . LEU A 1 196  ? 141.907 126.544 72.440  1.00 99.29  ? 175  LEU A CD1 1 
ATOM   812  C  CD2 . LEU A 1 196  ? 143.604 128.278 73.002  1.00 99.29  ? 175  LEU A CD2 1 
ATOM   813  N  N   . LEU A 1 197  ? 146.284 123.557 72.247  1.00 180.61 ? 176  LEU A N   1 
ATOM   814  C  CA  . LEU A 1 197  ? 146.708 122.239 71.800  1.00 181.97 ? 176  LEU A CA  1 
ATOM   815  C  C   . LEU A 1 197  ? 146.484 121.206 72.899  1.00 182.12 ? 176  LEU A C   1 
ATOM   816  O  O   . LEU A 1 197  ? 146.136 120.053 72.612  1.00 183.15 ? 176  LEU A O   1 
ATOM   817  C  CB  . LEU A 1 197  ? 148.174 122.294 71.376  1.00 98.33  ? 176  LEU A CB  1 
ATOM   818  C  CG  . LEU A 1 197  ? 148.805 121.269 70.430  1.00 98.33  ? 176  LEU A CG  1 
ATOM   819  C  CD1 . LEU A 1 197  ? 149.140 119.929 71.075  1.00 98.33  ? 176  LEU A CD1 1 
ATOM   820  C  CD2 . LEU A 1 197  ? 147.909 121.086 69.226  1.00 98.33  ? 176  LEU A CD2 1 
ATOM   821  N  N   . GLN A 1 198  ? 146.668 121.597 74.164  1.00 157.53 ? 177  GLN A N   1 
ATOM   822  C  CA  . GLN A 1 198  ? 146.335 120.681 75.252  1.00 158.00 ? 177  GLN A CA  1 
ATOM   823  C  C   . GLN A 1 198  ? 144.829 120.496 75.377  1.00 153.99 ? 177  GLN A C   1 
ATOM   824  O  O   . GLN A 1 198  ? 144.360 119.402 75.709  1.00 151.89 ? 177  GLN A O   1 
ATOM   825  C  CB  . GLN A 1 198  ? 146.920 121.185 76.570  1.00 112.49 ? 177  GLN A CB  1 
ATOM   826  C  CG  . GLN A 1 198  ? 146.804 120.210 77.728  1.00 112.49 ? 177  GLN A CG  1 
ATOM   827  C  CD  . GLN A 1 198  ? 147.597 118.932 77.501  1.00 112.49 ? 177  GLN A CD  1 
ATOM   828  O  OE1 . GLN A 1 198  ? 148.667 118.949 76.899  1.00 112.49 ? 177  GLN A OE1 1 
ATOM   829  N  NE2 . GLN A 1 198  ? 147.090 117.824 78.019  1.00 112.49 ? 177  GLN A NE2 1 
ATOM   830  N  N   . HIS A 1 199  ? 144.058 121.543 75.086  1.00 168.47 ? 178  HIS A N   1 
ATOM   831  C  CA  . HIS A 1 199  ? 142.610 121.421 75.113  1.00 167.26 ? 178  HIS A CA  1 
ATOM   832  C  C   . HIS A 1 199  ? 142.131 120.616 73.922  1.00 163.67 ? 178  HIS A C   1 
ATOM   833  O  O   . HIS A 1 199  ? 141.092 119.950 73.991  1.00 160.88 ? 178  HIS A O   1 
ATOM   834  C  CB  . HIS A 1 199  ? 141.988 122.810 75.111  1.00 88.90  ? 178  HIS A CB  1 
ATOM   835  C  CG  . HIS A 1 199  ? 140.584 122.847 75.616  1.00 88.90  ? 178  HIS A CG  1 
ATOM   836  N  ND1 . HIS A 1 199  ? 140.282 122.772 76.957  1.00 88.90  ? 178  HIS A ND1 1 
ATOM   837  C  CD2 . HIS A 1 199  ? 139.402 122.951 74.969  1.00 88.90  ? 178  HIS A CD2 1 
ATOM   838  C  CE1 . HIS A 1 199  ? 138.973 122.830 77.115  1.00 88.90  ? 178  HIS A CE1 1 
ATOM   839  N  NE2 . HIS A 1 199  ? 138.417 122.937 75.924  1.00 88.90  ? 178  HIS A NE2 1 
ATOM   840  N  N   . LEU A 1 200  ? 142.898 120.656 72.835  1.00 140.75 ? 179  LEU A N   1 
ATOM   841  C  CA  . LEU A 1 200  ? 142.644 119.809 71.681  1.00 140.60 ? 179  LEU A CA  1 
ATOM   842  C  C   . LEU A 1 200  ? 142.840 118.348 72.023  1.00 141.90 ? 179  LEU A C   1 
ATOM   843  O  O   . LEU A 1 200  ? 141.983 117.519 71.710  1.00 142.38 ? 179  LEU A O   1 
ATOM   844  C  CB  . LEU A 1 200  ? 143.591 120.193 70.555  1.00 92.35  ? 179  LEU A CB  1 
ATOM   845  C  CG  . LEU A 1 200  ? 143.511 119.725 69.111  1.00 92.35  ? 179  LEU A CG  1 
ATOM   846  C  CD1 . LEU A 1 200  ? 144.275 120.768 68.353  1.00 92.35  ? 179  LEU A CD1 1 
ATOM   847  C  CD2 . LEU A 1 200  ? 144.138 118.365 68.852  1.00 92.35  ? 179  LEU A CD2 1 
ATOM   848  N  N   . ASP A 1 201  ? 143.988 118.002 72.614  1.00 115.70 ? 180  ASP A N   1 
ATOM   849  C  CA  . ASP A 1 201  ? 144.271 116.592 72.856  1.00 115.79 ? 180  ASP A CA  1 
ATOM   850  C  C   . ASP A 1 201  ? 143.430 116.030 73.992  1.00 115.27 ? 180  ASP A C   1 
ATOM   851  O  O   . ASP A 1 201  ? 143.038 114.857 73.951  1.00 114.31 ? 180  ASP A O   1 
ATOM   852  C  CB  . ASP A 1 201  ? 145.744 116.380 73.158  1.00 104.72 ? 180  ASP A CB  1 
ATOM   853  C  CG  . ASP A 1 201  ? 146.085 114.926 73.293  1.00 104.72 ? 180  ASP A CG  1 
ATOM   854  O  OD1 . ASP A 1 201  ? 146.174 114.249 72.254  1.00 104.72 ? 180  ASP A OD1 1 
ATOM   855  O  OD2 . ASP A 1 201  ? 146.232 114.455 74.436  1.00 104.72 ? 180  ASP A OD2 1 
ATOM   856  N  N   . SER A 1 202  ? 143.149 116.847 75.010  1.00 120.81 ? 181  SER A N   1 
ATOM   857  C  CA  . SER A 1 202  ? 142.200 116.454 76.043  1.00 121.47 ? 181  SER A CA  1 
ATOM   858  C  C   . SER A 1 202  ? 140.800 116.300 75.476  1.00 120.22 ? 181  SER A C   1 
ATOM   859  O  O   . SER A 1 202  ? 140.045 115.419 75.908  1.00 121.07 ? 181  SER A O   1 
ATOM   860  C  CB  . SER A 1 202  ? 142.202 117.483 77.164  1.00 107.70 ? 181  SER A CB  1 
ATOM   861  O  OG  . SER A 1 202  ? 143.476 117.546 77.761  1.00 107.70 ? 181  SER A OG  1 
ATOM   862  N  N   . ALA A 1 203  ? 140.448 117.124 74.493  1.00 100.63 ? 182  ALA A N   1 
ATOM   863  C  CA  . ALA A 1 203  ? 139.147 116.991 73.864  1.00 98.86  ? 182  ALA A CA  1 
ATOM   864  C  C   . ALA A 1 203  ? 139.075 115.765 72.964  1.00 99.01  ? 182  ALA A C   1 
ATOM   865  O  O   . ALA A 1 203  ? 138.015 115.144 72.871  1.00 98.12  ? 182  ALA A O   1 
ATOM   866  C  CB  . ALA A 1 203  ? 138.819 118.255 73.084  1.00 106.86 ? 182  ALA A CB  1 
ATOM   867  N  N   . LEU A 1 204  ? 140.174 115.390 72.302  1.00 138.81 ? 183  LEU A N   1 
ATOM   868  C  CA  . LEU A 1 204  ? 140.151 114.187 71.476  1.00 138.98 ? 183  LEU A CA  1 
ATOM   869  C  C   . LEU A 1 204  ? 140.116 112.928 72.324  1.00 140.44 ? 183  LEU A C   1 
ATOM   870  O  O   . LEU A 1 204  ? 139.273 112.051 72.104  1.00 142.84 ? 183  LEU A O   1 
ATOM   871  C  CB  . LEU A 1 204  ? 141.345 114.127 70.529  1.00 103.05 ? 183  LEU A CB  1 
ATOM   872  C  CG  . LEU A 1 204  ? 141.269 114.853 69.201  1.00 103.05 ? 183  LEU A CG  1 
ATOM   873  C  CD1 . LEU A 1 204  ? 142.575 114.698 68.448  1.00 103.05 ? 183  LEU A CD1 1 
ATOM   874  C  CD2 . LEU A 1 204  ? 140.158 114.224 68.425  1.00 103.05 ? 183  LEU A CD2 1 
ATOM   875  N  N   . GLN A 1 205  ? 141.033 112.812 73.287  1.00 130.32 ? 184  GLN A N   1 
ATOM   876  C  CA  . GLN A 1 205  ? 141.086 111.607 74.108  1.00 131.56 ? 184  GLN A CA  1 
ATOM   877  C  C   . GLN A 1 205  ? 139.858 111.489 74.990  1.00 130.68 ? 184  GLN A C   1 
ATOM   878  O  O   . GLN A 1 205  ? 139.414 110.378 75.290  1.00 130.92 ? 184  GLN A O   1 
ATOM   879  C  CB  . GLN A 1 205  ? 142.344 111.616 74.956  1.00 101.17 ? 184  GLN A CB  1 
ATOM   880  C  CG  . GLN A 1 205  ? 143.598 111.620 74.130  1.00 101.17 ? 184  GLN A CG  1 
ATOM   881  C  CD  . GLN A 1 205  ? 144.825 111.748 74.980  1.00 101.17 ? 184  GLN A CD  1 
ATOM   882  O  OE1 . GLN A 1 205  ? 144.737 111.823 76.201  1.00 101.17 ? 184  GLN A OE1 1 
ATOM   883  N  NE2 . GLN A 1 205  ? 145.984 111.813 74.340  1.00 101.17 ? 184  GLN A NE2 1 
ATOM   884  N  N   . ALA A 1 206  ? 139.266 112.625 75.356  1.00 101.37 ? 185  ALA A N   1 
ATOM   885  C  CA  . ALA A 1 206  ? 137.990 112.635 76.049  1.00 100.82 ? 185  ALA A CA  1 
ATOM   886  C  C   . ALA A 1 206  ? 136.837 112.188 75.165  1.00 99.21  ? 185  ALA A C   1 
ATOM   887  O  O   . ALA A 1 206  ? 135.764 111.881 75.688  1.00 97.04  ? 185  ALA A O   1 
ATOM   888  C  CB  . ALA A 1 206  ? 137.714 114.039 76.572  1.00 96.53  ? 185  ALA A CB  1 
ATOM   889  N  N   . SER A 1 207  ? 137.024 112.157 73.845  1.00 58.30  ? 186  SER A N   1 
ATOM   890  C  CA  . SER A 1 207  ? 135.947 111.863 72.917  1.00 58.27  ? 186  SER A CA  1 
ATOM   891  C  C   . SER A 1 207  ? 136.057 110.507 72.242  1.00 59.51  ? 186  SER A C   1 
ATOM   892  O  O   . SER A 1 207  ? 135.066 110.041 71.678  1.00 59.20  ? 186  SER A O   1 
ATOM   893  C  CB  . SER A 1 207  ? 135.873 112.937 71.830  1.00 94.64  ? 186  SER A CB  1 
ATOM   894  O  OG  . SER A 1 207  ? 134.850 112.637 70.909  1.00 94.64  ? 186  SER A OG  1 
ATOM   895  N  N   . ARG A 1 208  ? 137.215 109.866 72.282  1.00 120.66 ? 187  ARG A N   1 
ATOM   896  C  CA  . ARG A 1 208  ? 137.382 108.561 71.665  1.00 121.03 ? 187  ARG A CA  1 
ATOM   897  C  C   . ARG A 1 208  ? 137.048 107.413 72.604  1.00 121.15 ? 187  ARG A C   1 
ATOM   898  O  O   . ARG A 1 208  ? 137.304 106.258 72.253  1.00 121.77 ? 187  ARG A O   1 
ATOM   899  C  CB  . ARG A 1 208  ? 138.818 108.388 71.164  1.00 98.70  ? 187  ARG A CB  1 
ATOM   900  C  CG  . ARG A 1 208  ? 139.271 109.414 70.154  1.00 98.70  ? 187  ARG A CG  1 
ATOM   901  C  CD  . ARG A 1 208  ? 138.529 109.261 68.856  1.00 98.70  ? 187  ARG A CD  1 
ATOM   902  N  NE  . ARG A 1 208  ? 138.955 110.246 67.873  1.00 98.70  ? 187  ARG A NE  1 
ATOM   903  C  CZ  . ARG A 1 208  ? 138.382 110.401 66.687  1.00 98.70  ? 187  ARG A CZ  1 
ATOM   904  N  NH1 . ARG A 1 208  ? 137.361 109.634 66.343  1.00 98.70  ? 187  ARG A NH1 1 
ATOM   905  N  NH2 . ARG A 1 208  ? 138.828 111.320 65.847  1.00 98.70  ? 187  ARG A NH2 1 
ATOM   906  N  N   . VAL A 1 209  ? 136.498 107.691 73.783  1.00 55.28  ? 188  VAL A N   1 
ATOM   907  C  CA  . VAL A 1 209  ? 136.390 106.675 74.824  1.00 55.28  ? 188  VAL A CA  1 
ATOM   908  C  C   . VAL A 1 209  ? 135.257 105.720 74.495  1.00 55.28  ? 188  VAL A C   1 
ATOM   909  O  O   . VAL A 1 209  ? 134.151 106.133 74.134  1.00 55.28  ? 188  VAL A O   1 
ATOM   910  C  CB  . VAL A 1 209  ? 136.215 107.319 76.207  1.00 55.28  ? 188  VAL A CB  1 
ATOM   911  C  CG1 . VAL A 1 209  ? 137.492 107.957 76.619  1.00 55.28  ? 188  VAL A CG1 1 
ATOM   912  C  CG2 . VAL A 1 209  ? 135.199 108.392 76.167  1.00 55.28  ? 188  VAL A CG2 1 
ATOM   913  N  N   . HIS A 1 210  ? 135.548 104.434 74.581  1.00 52.80  ? 189  HIS A N   1 
ATOM   914  C  CA  . HIS A 1 210  ? 134.619 103.393 74.203  1.00 52.58  ? 189  HIS A CA  1 
ATOM   915  C  C   . HIS A 1 210  ? 134.444 102.432 75.361  1.00 53.81  ? 189  HIS A C   1 
ATOM   916  O  O   . HIS A 1 210  ? 135.386 102.150 76.101  1.00 53.87  ? 189  HIS A O   1 
ATOM   917  C  CB  . HIS A 1 210  ? 135.116 102.640 72.985  1.00 107.72 ? 189  HIS A CB  1 
ATOM   918  C  CG  . HIS A 1 210  ? 136.429 101.959 73.193  1.00 107.72 ? 189  HIS A CG  1 
ATOM   919  N  ND1 . HIS A 1 210  ? 136.537 100.710 73.765  1.00 107.72 ? 189  HIS A ND1 1 
ATOM   920  C  CD2 . HIS A 1 210  ? 137.690 102.348 72.896  1.00 107.72 ? 189  HIS A CD2 1 
ATOM   921  C  CE1 . HIS A 1 210  ? 137.809 100.362 73.819  1.00 107.72 ? 189  HIS A CE1 1 
ATOM   922  N  NE2 . HIS A 1 210  ? 138.529 101.338 73.296  1.00 107.72 ? 189  HIS A NE2 1 
ATOM   923  N  N   . VAL A 1 211  ? 133.229 101.926 75.514  1.00 124.04 ? 190  VAL A N   1 
ATOM   924  C  CA  . VAL A 1 211  ? 132.889 100.995 76.578  1.00 126.83 ? 190  VAL A CA  1 
ATOM   925  C  C   . VAL A 1 211  ? 132.386 99.712  75.932  1.00 128.29 ? 190  VAL A C   1 
ATOM   926  O  O   . VAL A 1 211  ? 131.576 99.765  75.000  1.00 129.64 ? 190  VAL A O   1 
ATOM   927  C  CB  . VAL A 1 211  ? 131.825 101.592 77.516  1.00 120.67 ? 190  VAL A CB  1 
ATOM   928  C  CG1 . VAL A 1 211  ? 131.509 100.641 78.629  1.00 120.67 ? 190  VAL A CG1 1 
ATOM   929  C  CG2 . VAL A 1 211  ? 132.280 102.920 78.072  1.00 120.67 ? 190  VAL A CG2 1 
ATOM   930  N  N   . TYR A 1 212  ? 132.906 98.570  76.377  1.00 74.52  ? 191  TYR A N   1 
ATOM   931  C  CA  . TYR A 1 212  ? 132.270 97.286  76.091  1.00 74.52  ? 191  TYR A CA  1 
ATOM   932  C  C   . TYR A 1 212  ? 131.429 96.867  77.289  1.00 74.52  ? 191  TYR A C   1 
ATOM   933  O  O   . TYR A 1 212  ? 131.778 95.944  78.020  1.00 74.52  ? 191  TYR A O   1 
ATOM   934  C  CB  . TYR A 1 212  ? 133.303 96.203  75.788  1.00 74.52  ? 191  TYR A CB  1 
ATOM   935  C  CG  . TYR A 1 212  ? 134.021 96.248  74.462  1.00 74.52  ? 191  TYR A CG  1 
ATOM   936  C  CD1 . TYR A 1 212  ? 133.704 97.183  73.491  1.00 74.52  ? 191  TYR A CD1 1 
ATOM   937  C  CD2 . TYR A 1 212  ? 134.982 95.292  74.162  1.00 74.52  ? 191  TYR A CD2 1 
ATOM   938  C  CE1 . TYR A 1 212  ? 134.368 97.193  72.276  1.00 74.52  ? 191  TYR A CE1 1 
ATOM   939  C  CE2 . TYR A 1 212  ? 135.639 95.292  72.956  1.00 74.52  ? 191  TYR A CE2 1 
ATOM   940  C  CZ  . TYR A 1 212  ? 135.327 96.244  72.019  1.00 74.52  ? 191  TYR A CZ  1 
ATOM   941  O  OH  . TYR A 1 212  ? 135.980 96.248  70.813  1.00 74.52  ? 191  TYR A OH  1 
ATOM   942  N  N   . MET A 1 213  ? 130.314 97.565  77.506  1.00 81.20  ? 192  MET A N   1 
ATOM   943  C  CA  . MET A 1 213  ? 129.547 97.238  78.701  1.00 81.20  ? 192  MET A CA  1 
ATOM   944  C  C   . MET A 1 213  ? 128.740 95.963  78.510  1.00 81.20  ? 192  MET A C   1 
ATOM   945  O  O   . MET A 1 213  ? 128.978 94.960  79.189  1.00 81.20  ? 192  MET A O   1 
ATOM   946  C  CB  . MET A 1 213  ? 128.625 98.374  79.118  1.00 81.20  ? 192  MET A CB  1 
ATOM   947  C  CG  . MET A 1 213  ? 127.947 97.966  80.391  1.00 81.20  ? 192  MET A CG  1 
ATOM   948  S  SD  . MET A 1 213  ? 126.917 99.123  81.265  1.00 81.20  ? 192  MET A SD  1 
ATOM   949  C  CE  . MET A 1 213  ? 126.311 97.981  82.493  1.00 81.20  ? 192  MET A CE  1 
ATOM   950  N  N   . TYR A 1 214  ? 127.801 95.975  77.586  1.00 62.88  ? 193  TYR A N   1 
ATOM   951  C  CA  . TYR A 1 214  ? 127.126 94.744  77.208  1.00 62.88  ? 193  TYR A CA  1 
ATOM   952  C  C   . TYR A 1 214  ? 127.915 94.148  76.046  1.00 62.88  ? 193  TYR A C   1 
ATOM   953  O  O   . TYR A 1 214  ? 129.050 94.560  75.798  1.00 62.88  ? 193  TYR A O   1 
ATOM   954  C  CB  . TYR A 1 214  ? 125.651 95.021  76.915  1.00 62.88  ? 193  TYR A CB  1 
ATOM   955  C  CG  . TYR A 1 214  ? 124.867 95.362  78.164  1.00 62.88  ? 193  TYR A CG  1 
ATOM   956  C  CD1 . TYR A 1 214  ? 125.330 94.992  79.421  1.00 62.88  ? 193  TYR A CD1 1 
ATOM   957  C  CD2 . TYR A 1 214  ? 123.695 96.089  78.095  1.00 62.88  ? 193  TYR A CD2 1 
ATOM   958  C  CE1 . TYR A 1 214  ? 124.633 95.311  80.565  1.00 62.88  ? 193  TYR A CE1 1 
ATOM   959  C  CE2 . TYR A 1 214  ? 122.988 96.409  79.236  1.00 62.88  ? 193  TYR A CE2 1 
ATOM   960  C  CZ  . TYR A 1 214  ? 123.468 96.021  80.466  1.00 62.88  ? 193  TYR A CZ  1 
ATOM   961  O  OH  . TYR A 1 214  ? 122.777 96.333  81.609  1.00 62.88  ? 193  TYR A OH  1 
ATOM   962  N  N   . ASN A 1 215  ? 127.343 93.184  75.324  1.00 68.04  ? 194  ASN A N   1 
ATOM   963  C  CA  . ASN A 1 215  ? 128.087 92.527  74.251  1.00 68.04  ? 194  ASN A CA  1 
ATOM   964  C  C   . ASN A 1 215  ? 128.412 93.446  73.075  1.00 68.04  ? 194  ASN A C   1 
ATOM   965  O  O   . ASN A 1 215  ? 129.259 93.085  72.252  1.00 68.04  ? 194  ASN A O   1 
ATOM   966  C  CB  . ASN A 1 215  ? 127.306 91.318  73.752  1.00 68.04  ? 194  ASN A CB  1 
ATOM   967  C  CG  . ASN A 1 215  ? 127.285 90.190  74.755  1.00 68.04  ? 194  ASN A CG  1 
ATOM   968  O  OD1 . ASN A 1 215  ? 128.300 89.867  75.368  1.00 68.04  ? 194  ASN A OD1 1 
ATOM   969  N  ND2 . ASN A 1 215  ? 126.121 89.585  74.933  1.00 68.04  ? 194  ASN A ND2 1 
ATOM   970  N  N   . ARG A 1 216  ? 127.787 94.621  72.997  1.00 72.95  ? 195  ARG A N   1 
ATOM   971  C  CA  . ARG A 1 216  ? 127.993 95.575  71.921  1.00 72.95  ? 195  ARG A CA  1 
ATOM   972  C  C   . ARG A 1 216  ? 128.548 96.881  72.463  1.00 72.95  ? 195  ARG A C   1 
ATOM   973  O  O   . ARG A 1 216  ? 128.269 97.275  73.592  1.00 72.95  ? 195  ARG A O   1 
ATOM   974  C  CB  . ARG A 1 216  ? 126.684 95.794  71.167  1.00 72.95  ? 195  ARG A CB  1 
ATOM   975  C  CG  . ARG A 1 216  ? 126.401 94.606  70.277  1.00 72.95  ? 195  ARG A CG  1 
ATOM   976  C  CD  . ARG A 1 216  ? 125.013 94.551  69.693  1.00 72.95  ? 195  ARG A CD  1 
ATOM   977  N  NE  . ARG A 1 216  ? 124.916 93.465  68.720  1.00 72.95  ? 195  ARG A NE  1 
ATOM   978  C  CZ  . ARG A 1 216  ? 124.702 92.189  69.024  1.00 72.95  ? 195  ARG A CZ  1 
ATOM   979  N  NH1 . ARG A 1 216  ? 124.576 91.801  70.285  1.00 72.95  ? 195  ARG A NH1 1 
ATOM   980  N  NH2 . ARG A 1 216  ? 124.636 91.288  68.062  1.00 72.95  ? 195  ARG A NH2 1 
ATOM   981  N  N   . GLN A 1 217  ? 129.342 97.539  71.632  1.00 117.47 ? 196  GLN A N   1 
ATOM   982  C  CA  . GLN A 1 217  ? 130.172 98.662  72.040  1.00 118.11 ? 196  GLN A CA  1 
ATOM   983  C  C   . GLN A 1 217  ? 129.394 99.966  72.013  1.00 119.85 ? 196  GLN A C   1 
ATOM   984  O  O   . GLN A 1 217  ? 128.688 100.246 71.040  1.00 119.71 ? 196  GLN A O   1 
ATOM   985  C  CB  . GLN A 1 217  ? 131.364 98.757  71.098  1.00 111.68 ? 196  GLN A CB  1 
ATOM   986  C  CG  . GLN A 1 217  ? 132.256 99.945  71.284  1.00 111.68 ? 196  GLN A CG  1 
ATOM   987  C  CD  . GLN A 1 217  ? 133.409 99.899  70.312  1.00 111.68 ? 196  GLN A CD  1 
ATOM   988  O  OE1 . GLN A 1 217  ? 133.565 98.924  69.582  1.00 111.68 ? 196  GLN A OE1 1 
ATOM   989  N  NE2 . GLN A 1 217  ? 134.194 100.966 70.257  1.00 111.68 ? 196  GLN A NE2 1 
ATOM   990  N  N   . TRP A 1 218  ? 129.536 100.772 73.064  1.00 204.61 ? 197  TRP A N   1 
ATOM   991  C  CA  . TRP A 1 218  ? 128.957 102.110 73.104  1.00 208.35 ? 197  TRP A CA  1 
ATOM   992  C  C   . TRP A 1 218  ? 130.044 103.172 73.116  1.00 210.27 ? 197  TRP A C   1 
ATOM   993  O  O   . TRP A 1 218  ? 130.940 103.138 73.962  1.00 208.37 ? 197  TRP A O   1 
ATOM   994  C  CB  . TRP A 1 218  ? 128.038 102.293 74.310  1.00 100.76 ? 197  TRP A CB  1 
ATOM   995  C  CG  . TRP A 1 218  ? 126.685 101.760 74.066  1.00 100.76 ? 197  TRP A CG  1 
ATOM   996  C  CD1 . TRP A 1 218  ? 125.681 102.381 73.399  1.00 100.76 ? 197  TRP A CD1 1 
ATOM   997  C  CD2 . TRP A 1 218  ? 126.166 100.511 74.493  1.00 100.76 ? 197  TRP A CD2 1 
ATOM   998  N  NE1 . TRP A 1 218  ? 124.567 101.590 73.364  1.00 100.76 ? 197  TRP A NE1 1 
ATOM   999  C  CE2 . TRP A 1 218  ? 124.836 100.436 74.042  1.00 100.76 ? 197  TRP A CE2 1 
ATOM   1000 C  CE3 . TRP A 1 218  ? 126.690 99.450  75.223  1.00 100.76 ? 197  TRP A CE3 1 
ATOM   1001 C  CZ2 . TRP A 1 218  ? 124.034 99.342  74.281  1.00 100.76 ? 197  TRP A CZ2 1 
ATOM   1002 C  CZ3 . TRP A 1 218  ? 125.891 98.364  75.458  1.00 100.76 ? 197  TRP A CZ3 1 
ATOM   1003 C  CH2 . TRP A 1 218  ? 124.578 98.317  74.991  1.00 100.76 ? 197  TRP A CH2 1 
ATOM   1004 N  N   . LYS A 1 219  ? 129.947 104.117 72.188  1.00 234.92 ? 198  LYS A N   1 
ATOM   1005 C  CA  . LYS A 1 219  ? 130.882 105.223 72.043  1.00 241.70 ? 198  LYS A CA  1 
ATOM   1006 C  C   . LYS A 1 219  ? 130.137 106.531 72.279  1.00 248.50 ? 198  LYS A C   1 
ATOM   1007 O  O   . LYS A 1 219  ? 128.993 106.541 72.727  1.00 248.96 ? 198  LYS A O   1 
ATOM   1008 C  CB  . LYS A 1 219  ? 131.537 105.212 70.667  1.00 94.02  ? 198  LYS A CB  1 
ATOM   1009 C  CG  . LYS A 1 219  ? 132.323 103.970 70.360  1.00 94.02  ? 198  LYS A CG  1 
ATOM   1010 C  CD  . LYS A 1 219  ? 133.046 104.130 69.045  1.00 94.02  ? 198  LYS A CD  1 
ATOM   1011 C  CE  . LYS A 1 219  ? 132.082 104.152 67.879  1.00 94.02  ? 198  LYS A CE  1 
ATOM   1012 N  NZ  . LYS A 1 219  ? 131.434 102.834 67.669  1.00 94.02  ? 198  LYS A NZ  1 
ATOM   1013 N  N   . LEU A 1 220  ? 130.801 107.647 71.983  1.00 237.59 ? 199  LEU A N   1 
ATOM   1014 C  CA  . LEU A 1 220  ? 130.161 108.944 72.153  1.00 242.98 ? 199  LEU A CA  1 
ATOM   1015 C  C   . LEU A 1 220  ? 129.089 109.190 71.109  1.00 245.13 ? 199  LEU A C   1 
ATOM   1016 O  O   . LEU A 1 220  ? 128.169 109.970 71.361  1.00 245.50 ? 199  LEU A O   1 
ATOM   1017 C  CB  . LEU A 1 220  ? 131.221 110.049 72.132  1.00 88.21  ? 199  LEU A CB  1 
ATOM   1018 C  CG  . LEU A 1 220  ? 130.961 111.510 72.526  1.00 88.21  ? 199  LEU A CG  1 
ATOM   1019 C  CD1 . LEU A 1 220  ? 130.486 112.365 71.383  1.00 88.21  ? 199  LEU A CD1 1 
ATOM   1020 C  CD2 . LEU A 1 220  ? 129.964 111.577 73.647  1.00 88.21  ? 199  LEU A CD2 1 
ATOM   1021 N  N   . GLU A 1 221  ? 129.166 108.531 69.955  1.00 43.55  ? 200  GLU A N   1 
ATOM   1022 C  CA  . GLU A 1 221  ? 128.140 108.715 68.944  1.00 43.55  ? 200  GLU A CA  1 
ATOM   1023 C  C   . GLU A 1 221  ? 126.826 108.062 69.337  1.00 43.55  ? 200  GLU A C   1 
ATOM   1024 O  O   . GLU A 1 221  ? 125.784 108.424 68.788  1.00 43.55  ? 200  GLU A O   1 
ATOM   1025 C  CB  . GLU A 1 221  ? 128.601 108.153 67.603  1.00 43.55  ? 200  GLU A CB  1 
ATOM   1026 C  CG  . GLU A 1 221  ? 128.768 106.650 67.610  1.00 43.55  ? 200  GLU A CG  1 
ATOM   1027 C  CD  . GLU A 1 221  ? 129.131 106.076 66.264  1.00 43.55  ? 200  GLU A CD  1 
ATOM   1028 O  OE1 . GLU A 1 221  ? 129.278 106.844 65.295  1.00 43.55  ? 200  GLU A OE1 1 
ATOM   1029 O  OE2 . GLU A 1 221  ? 129.259 104.841 66.174  1.00 43.55  ? 200  GLU A OE2 1 
ATOM   1030 N  N   . HIS A 1 222  ? 126.848 107.104 70.260  1.00 42.98  ? 201  HIS A N   1 
ATOM   1031 C  CA  . HIS A 1 222  ? 125.630 106.452 70.707  1.00 42.98  ? 201  HIS A CA  1 
ATOM   1032 C  C   . HIS A 1 222  ? 124.966 107.190 71.842  1.00 42.98  ? 201  HIS A C   1 
ATOM   1033 O  O   . HIS A 1 222  ? 123.805 106.915 72.141  1.00 42.98  ? 201  HIS A O   1 
ATOM   1034 C  CB  . HIS A 1 222  ? 125.918 105.038 71.188  1.00 42.98  ? 201  HIS A CB  1 
ATOM   1035 C  CG  . HIS A 1 222  ? 126.405 104.113 70.124  1.00 42.98  ? 201  HIS A CG  1 
ATOM   1036 N  ND1 . HIS A 1 222  ? 127.738 103.971 69.814  1.00 42.98  ? 201  HIS A ND1 1 
ATOM   1037 C  CD2 . HIS A 1 222  ? 125.738 103.256 69.321  1.00 42.98  ? 201  HIS A CD2 1 
ATOM   1038 C  CE1 . HIS A 1 222  ? 127.868 103.078 68.851  1.00 42.98  ? 201  HIS A CE1 1 
ATOM   1039 N  NE2 . HIS A 1 222  ? 126.670 102.626 68.536  1.00 42.98  ? 201  HIS A NE2 1 
ATOM   1040 N  N   . LEU A 1 223  ? 125.678 108.109 72.483  1.00 40.81  ? 202  LEU A N   1 
ATOM   1041 C  CA  . LEU A 1 223  ? 125.200 108.725 73.703  1.00 40.81  ? 202  LEU A CA  1 
ATOM   1042 C  C   . LEU A 1 223  ? 124.877 110.201 73.561  1.00 40.81  ? 202  LEU A C   1 
ATOM   1043 O  O   . LEU A 1 223  ? 124.176 110.737 74.418  1.00 40.81  ? 202  LEU A O   1 
ATOM   1044 C  CB  . LEU A 1 223  ? 126.237 108.574 74.821  1.00 40.81  ? 202  LEU A CB  1 
ATOM   1045 C  CG  . LEU A 1 223  ? 126.679 107.166 75.171  1.00 40.81  ? 202  LEU A CG  1 
ATOM   1046 C  CD1 . LEU A 1 223  ? 127.669 107.211 76.303  1.00 40.81  ? 202  LEU A CD1 1 
ATOM   1047 C  CD2 . LEU A 1 223  ? 125.506 106.325 75.518  1.00 40.81  ? 202  LEU A CD2 1 
ATOM   1048 N  N   . CYS A 1 224  ? 125.359 110.868 72.521  1.00 47.25  ? 203  CYS A N   1 
ATOM   1049 C  CA  . CYS A 1 224  ? 125.269 112.315 72.538  1.00 47.25  ? 203  CYS A CA  1 
ATOM   1050 C  C   . CYS A 1 224  ? 123.901 112.773 72.061  1.00 47.25  ? 203  CYS A C   1 
ATOM   1051 O  O   . CYS A 1 224  ? 123.073 111.981 71.611  1.00 47.25  ? 203  CYS A O   1 
ATOM   1052 C  CB  . CYS A 1 224  ? 126.365 112.940 71.696  1.00 47.25  ? 203  CYS A CB  1 
ATOM   1053 S  SG  . CYS A 1 224  ? 126.220 112.714 69.937  1.00 47.25  ? 203  CYS A SG  1 
ATOM   1054 N  N   . TYR A 1 225  ? 123.672 114.077 72.170  1.00 34.92  ? 204  TYR A N   1 
ATOM   1055 C  CA  . TYR A 1 225  ? 122.335 114.658 72.098  1.00 34.92  ? 204  TYR A CA  1 
ATOM   1056 C  C   . TYR A 1 225  ? 122.103 115.265 70.726  1.00 34.92  ? 204  TYR A C   1 
ATOM   1057 O  O   . TYR A 1 225  ? 122.517 116.391 70.453  1.00 34.92  ? 204  TYR A O   1 
ATOM   1058 C  CB  . TYR A 1 225  ? 122.151 115.682 73.205  1.00 34.92  ? 204  TYR A CB  1 
ATOM   1059 C  CG  . TYR A 1 225  ? 120.871 116.458 73.143  1.00 34.92  ? 204  TYR A CG  1 
ATOM   1060 C  CD1 . TYR A 1 225  ? 119.647 115.829 73.258  1.00 34.92  ? 204  TYR A CD1 1 
ATOM   1061 C  CD2 . TYR A 1 225  ? 120.891 117.834 73.055  1.00 34.92  ? 204  TYR A CD2 1 
ATOM   1062 C  CE1 . TYR A 1 225  ? 118.475 116.550 73.223  1.00 34.92  ? 204  TYR A CE1 1 
ATOM   1063 C  CE2 . TYR A 1 225  ? 119.732 118.562 73.027  1.00 34.92  ? 204  TYR A CE2 1 
ATOM   1064 C  CZ  . TYR A 1 225  ? 118.529 117.917 73.110  1.00 34.92  ? 204  TYR A CZ  1 
ATOM   1065 O  OH  . TYR A 1 225  ? 117.375 118.657 73.078  1.00 34.92  ? 204  TYR A OH  1 
ATOM   1066 N  N   . LYS A 1 226  ? 121.449 114.505 69.860  1.00 43.89  ? 205  LYS A N   1 
ATOM   1067 C  CA  . LYS A 1 226  ? 120.972 115.042 68.599  1.00 43.89  ? 205  LYS A CA  1 
ATOM   1068 C  C   . LYS A 1 226  ? 119.783 115.936 68.901  1.00 43.89  ? 205  LYS A C   1 
ATOM   1069 O  O   . LYS A 1 226  ? 118.824 115.486 69.533  1.00 43.89  ? 205  LYS A O   1 
ATOM   1070 C  CB  . LYS A 1 226  ? 120.578 113.904 67.668  1.00 43.89  ? 205  LYS A CB  1 
ATOM   1071 C  CG  . LYS A 1 226  ? 121.639 112.831 67.554  1.00 43.89  ? 205  LYS A CG  1 
ATOM   1072 C  CD  . LYS A 1 226  ? 122.928 113.389 67.007  1.00 43.89  ? 205  LYS A CD  1 
ATOM   1073 C  CE  . LYS A 1 226  ? 123.923 112.298 66.755  1.00 43.89  ? 205  LYS A CE  1 
ATOM   1074 N  NZ  . LYS A 1 226  ? 124.331 111.711 68.051  1.00 43.89  ? 205  LYS A NZ  1 
ATOM   1075 N  N   . SER A 1 227  ? 119.861 117.203 68.487  1.00 51.31  ? 206  SER A N   1 
ATOM   1076 C  CA  . SER A 1 227  ? 118.908 118.233 68.893  1.00 51.31  ? 206  SER A CA  1 
ATOM   1077 C  C   . SER A 1 227  ? 117.492 117.936 68.422  1.00 51.31  ? 206  SER A C   1 
ATOM   1078 O  O   . SER A 1 227  ? 116.606 117.663 69.234  1.00 51.31  ? 206  SER A O   1 
ATOM   1079 C  CB  . SER A 1 227  ? 119.352 119.593 68.361  1.00 51.31  ? 206  SER A CB  1 
ATOM   1080 O  OG  . SER A 1 227  ? 120.644 119.931 68.831  1.00 51.31  ? 206  SER A OG  1 
ATOM   1081 N  N   . GLY A 1 228  ? 117.276 117.963 67.117  1.00 49.12  ? 207  GLY A N   1 
ATOM   1082 C  CA  . GLY A 1 228  ? 116.036 117.487 66.548  1.00 49.12  ? 207  GLY A CA  1 
ATOM   1083 C  C   . GLY A 1 228  ? 116.324 116.849 65.211  1.00 49.12  ? 207  GLY A C   1 
ATOM   1084 O  O   . GLY A 1 228  ? 116.848 117.507 64.311  1.00 49.12  ? 207  GLY A O   1 
ATOM   1085 N  N   . GLU A 1 229  ? 115.987 115.578 65.060  1.00 66.32  ? 208  GLU A N   1 
ATOM   1086 C  CA  . GLU A 1 229  ? 116.396 114.828 63.886  1.00 66.32  ? 208  GLU A CA  1 
ATOM   1087 C  C   . GLU A 1 229  ? 115.487 115.119 62.702  1.00 66.32  ? 208  GLU A C   1 
ATOM   1088 O  O   . GLU A 1 229  ? 114.288 115.356 62.854  1.00 66.32  ? 208  GLU A O   1 
ATOM   1089 C  CB  . GLU A 1 229  ? 116.419 113.338 64.220  1.00 66.32  ? 208  GLU A CB  1 
ATOM   1090 C  CG  . GLU A 1 229  ? 115.148 112.830 64.877  1.00 66.32  ? 208  GLU A CG  1 
ATOM   1091 C  CD  . GLU A 1 229  ? 114.166 112.237 63.899  1.00 66.32  ? 208  GLU A CD  1 
ATOM   1092 O  OE1 . GLU A 1 229  ? 114.603 111.829 62.809  1.00 66.32  ? 208  GLU A OE1 1 
ATOM   1093 O  OE2 . GLU A 1 229  ? 112.962 112.178 64.225  1.00 66.32  ? 208  GLU A OE2 1 
ATOM   1094 N  N   . LEU A 1 230  ? 116.075 115.122 61.510  1.00 58.40  ? 209  LEU A N   1 
ATOM   1095 C  CA  . LEU A 1 230  ? 115.335 115.392 60.288  1.00 58.40  ? 209  LEU A CA  1 
ATOM   1096 C  C   . LEU A 1 230  ? 115.395 114.166 59.392  1.00 58.40  ? 209  LEU A C   1 
ATOM   1097 O  O   . LEU A 1 230  ? 116.457 113.557 59.237  1.00 58.40  ? 209  LEU A O   1 
ATOM   1098 C  CB  . LEU A 1 230  ? 115.882 116.636 59.575  1.00 58.40  ? 209  LEU A CB  1 
ATOM   1099 C  CG  . LEU A 1 230  ? 117.248 116.732 58.900  1.00 58.40  ? 209  LEU A CG  1 
ATOM   1100 C  CD1 . LEU A 1 230  ? 117.128 116.445 57.420  1.00 58.40  ? 209  LEU A CD1 1 
ATOM   1101 C  CD2 . LEU A 1 230  ? 117.859 118.090 59.115  1.00 58.40  ? 209  LEU A CD2 1 
ATOM   1102 N  N   . ILE A 1 231  ? 114.259 113.798 58.812  1.00 68.34  ? 210  ILE A N   1 
ATOM   1103 C  CA  . ILE A 1 231  ? 114.160 112.603 57.989  1.00 68.34  ? 210  ILE A CA  1 
ATOM   1104 C  C   . ILE A 1 231  ? 113.763 112.996 56.578  1.00 68.34  ? 210  ILE A C   1 
ATOM   1105 O  O   . ILE A 1 231  ? 112.989 113.938 56.378  1.00 68.34  ? 210  ILE A O   1 
ATOM   1106 C  CB  . ILE A 1 231  ? 113.173 111.573 58.586  1.00 68.34  ? 210  ILE A CB  1 
ATOM   1107 C  CG1 . ILE A 1 231  ? 111.825 112.204 58.947  1.00 68.34  ? 210  ILE A CG1 1 
ATOM   1108 C  CG2 . ILE A 1 231  ? 113.787 110.890 59.788  1.00 68.34  ? 210  ILE A CG2 1 
ATOM   1109 C  CD1 . ILE A 1 231  ? 110.732 112.047 57.904  1.00 68.34  ? 210  ILE A CD1 1 
ATOM   1110 N  N   . THR A 1 232  ? 114.316 112.285 55.599  1.00 79.57  ? 211  THR A N   1 
ATOM   1111 C  CA  . THR A 1 232  ? 113.929 112.423 54.205  1.00 79.57  ? 211  THR A CA  1 
ATOM   1112 C  C   . THR A 1 232  ? 113.773 111.045 53.591  1.00 79.57  ? 211  THR A C   1 
ATOM   1113 O  O   . THR A 1 232  ? 114.233 110.041 54.134  1.00 79.57  ? 211  THR A O   1 
ATOM   1114 C  CB  . THR A 1 232  ? 114.944 113.220 53.383  1.00 79.57  ? 211  THR A CB  1 
ATOM   1115 O  OG1 . THR A 1 232  ? 116.237 112.628 53.515  1.00 79.57  ? 211  THR A OG1 1 
ATOM   1116 C  CG2 . THR A 1 232  ? 114.990 114.665 53.820  1.00 79.57  ? 211  THR A CG2 1 
ATOM   1117 N  N   . GLU A 1 233  ? 113.104 111.011 52.449  1.00 98.07  ? 212  GLU A N   1 
ATOM   1118 C  CA  . GLU A 1 233  ? 112.935 109.797 51.673  1.00 98.07  ? 212  GLU A CA  1 
ATOM   1119 C  C   . GLU A 1 233  ? 113.839 109.768 50.461  1.00 98.07  ? 212  GLU A C   1 
ATOM   1120 O  O   . GLU A 1 233  ? 113.685 108.894 49.606  1.00 98.07  ? 212  GLU A O   1 
ATOM   1121 C  CB  . GLU A 1 233  ? 111.491 109.672 51.229  1.00 98.07  ? 212  GLU A CB  1 
ATOM   1122 C  CG  . GLU A 1 233  ? 111.100 110.811 50.318  1.00 98.07  ? 212  GLU A CG  1 
ATOM   1123 C  CD  . GLU A 1 233  ? 109.648 110.777 49.930  1.00 98.07  ? 212  GLU A CD  1 
ATOM   1124 O  OE1 . GLU A 1 233  ? 108.941 109.847 50.368  1.00 98.07  ? 212  GLU A OE1 1 
ATOM   1125 O  OE2 . GLU A 1 233  ? 109.204 111.682 49.195  1.00 98.07  ? 212  GLU A OE2 1 
ATOM   1126 N  N   . THR A 1 234  ? 114.787 110.694 50.370  1.00 88.17  ? 213  THR A N   1 
ATOM   1127 C  CA  . THR A 1 234  ? 115.623 110.845 49.188  1.00 88.17  ? 213  THR A CA  1 
ATOM   1128 C  C   . THR A 1 234  ? 116.733 109.808 49.089  1.00 88.17  ? 213  THR A C   1 
ATOM   1129 O  O   . THR A 1 234  ? 117.582 109.925 48.203  1.00 88.17  ? 213  THR A O   1 
ATOM   1130 C  CB  . THR A 1 234  ? 116.226 112.244 49.158  1.00 88.17  ? 213  THR A CB  1 
ATOM   1131 O  OG1 . THR A 1 234  ? 117.047 112.421 50.314  1.00 88.17  ? 213  THR A OG1 1 
ATOM   1132 C  CG2 . THR A 1 234  ? 115.126 113.284 49.170  1.00 88.17  ? 213  THR A CG2 1 
ATOM   1133 N  N   . GLY A 1 235  ? 116.775 108.818 49.972  1.00 97.18  ? 214  GLY A N   1 
ATOM   1134 C  CA  . GLY A 1 235  ? 117.578 107.651 49.697  1.00 97.18  ? 214  GLY A CA  1 
ATOM   1135 C  C   . GLY A 1 235  ? 119.025 107.793 50.102  1.00 97.18  ? 214  GLY A C   1 
ATOM   1136 O  O   . GLY A 1 235  ? 119.389 107.531 51.253  1.00 97.18  ? 214  GLY A O   1 
ATOM   1137 N  N   . TYR A 1 236  ? 119.854 108.168 49.122  1.00 91.42  ? 215  TYR A N   1 
ATOM   1138 C  CA  . TYR A 1 236  ? 121.296 108.305 49.314  1.00 91.42  ? 215  TYR A CA  1 
ATOM   1139 C  C   . TYR A 1 236  ? 121.623 109.356 50.369  1.00 91.42  ? 215  TYR A C   1 
ATOM   1140 O  O   . TYR A 1 236  ? 122.326 109.079 51.348  1.00 91.42  ? 215  TYR A O   1 
ATOM   1141 C  CB  . TYR A 1 236  ? 121.956 108.635 47.963  1.00 91.42  ? 215  TYR A CB  1 
ATOM   1142 C  CG  . TYR A 1 236  ? 121.438 109.885 47.240  1.00 91.42  ? 215  TYR A CG  1 
ATOM   1143 C  CD1 . TYR A 1 236  ? 120.295 109.835 46.449  1.00 91.42  ? 215  TYR A CD1 1 
ATOM   1144 C  CD2 . TYR A 1 236  ? 122.122 111.095 47.314  1.00 91.42  ? 215  TYR A CD2 1 
ATOM   1145 C  CE1 . TYR A 1 236  ? 119.825 110.959 45.803  1.00 91.42  ? 215  TYR A CE1 1 
ATOM   1146 C  CE2 . TYR A 1 236  ? 121.654 112.219 46.668  1.00 91.42  ? 215  TYR A CE2 1 
ATOM   1147 C  CZ  . TYR A 1 236  ? 120.513 112.141 45.911  1.00 91.42  ? 215  TYR A CZ  1 
ATOM   1148 O  OH  . TYR A 1 236  ? 120.055 113.257 45.261  1.00 91.42  ? 215  TYR A OH  1 
ATOM   1149 N  N   . MET A 1 237  ? 121.040 110.537 50.229  1.00 85.23  ? 216  MET A N   1 
ATOM   1150 C  CA  . MET A 1 237  ? 121.443 111.707 50.987  1.00 85.23  ? 216  MET A CA  1 
ATOM   1151 C  C   . MET A 1 237  ? 120.925 111.656 52.410  1.00 85.23  ? 216  MET A C   1 
ATOM   1152 O  O   . MET A 1 237  ? 121.594 112.160 53.323  1.00 85.23  ? 216  MET A O   1 
ATOM   1153 C  CB  . MET A 1 237  ? 120.967 112.938 50.225  1.00 85.23  ? 216  MET A CB  1 
ATOM   1154 C  CG  . MET A 1 237  ? 120.999 114.245 50.921  1.00 85.23  ? 216  MET A CG  1 
ATOM   1155 S  SD  . MET A 1 237  ? 120.601 115.450 49.657  1.00 85.23  ? 216  MET A SD  1 
ATOM   1156 C  CE  . MET A 1 237  ? 119.064 114.759 49.055  1.00 85.23  ? 216  MET A CE  1 
ATOM   1157 N  N   . ASP A 1 238  ? 119.785 110.991 52.612  1.00 82.05  ? 217  ASP A N   1 
ATOM   1158 C  CA  . ASP A 1 238  ? 119.323 110.679 53.959  1.00 82.05  ? 217  ASP A CA  1 
ATOM   1159 C  C   . ASP A 1 238  ? 120.356 109.877 54.731  1.00 82.05  ? 217  ASP A C   1 
ATOM   1160 O  O   . ASP A 1 238  ? 120.520 110.092 55.940  1.00 82.05  ? 217  ASP A O   1 
ATOM   1161 C  CB  . ASP A 1 238  ? 118.010 109.910 53.909  1.00 82.05  ? 217  ASP A CB  1 
ATOM   1162 C  CG  . ASP A 1 238  ? 117.466 109.603 55.293  1.00 82.05  ? 217  ASP A CG  1 
ATOM   1163 O  OD1 . ASP A 1 238  ? 117.016 110.546 55.974  1.00 82.05  ? 217  ASP A OD1 1 
ATOM   1164 O  OD2 . ASP A 1 238  ? 117.481 108.418 55.692  1.00 82.05  ? 217  ASP A OD2 1 
ATOM   1165 N  N   . GLN A 1 239  ? 121.079 108.981 54.038  1.00 82.80  ? 218  GLN A N   1 
ATOM   1166 C  CA  . GLN A 1 239  ? 122.174 108.226 54.645  1.00 82.80  ? 218  GLN A CA  1 
ATOM   1167 C  C   . GLN A 1 239  ? 123.192 109.151 55.291  1.00 82.80  ? 218  GLN A C   1 
ATOM   1168 O  O   . GLN A 1 239  ? 123.609 108.921 56.431  1.00 82.80  ? 218  GLN A O   1 
ATOM   1169 C  CB  . GLN A 1 239  ? 122.860 107.358 53.593  1.00 82.80  ? 218  GLN A CB  1 
ATOM   1170 C  CG  . GLN A 1 239  ? 122.014 106.231 53.029  1.00 82.80  ? 218  GLN A CG  1 
ATOM   1171 C  CD  . GLN A 1 239  ? 121.675 105.172 54.060  1.00 82.80  ? 218  GLN A CD  1 
ATOM   1172 O  OE1 . GLN A 1 239  ? 120.527 105.041 54.474  1.00 82.80  ? 218  GLN A OE1 1 
ATOM   1173 N  NE2 . GLN A 1 239  ? 122.677 104.408 54.477  1.00 82.80  ? 218  GLN A NE2 1 
ATOM   1174 N  N   . ILE A 1 240  ? 123.514 110.256 54.609  1.00 63.06  ? 219  ILE A N   1 
ATOM   1175 C  CA  . ILE A 1 240  ? 124.435 111.250 55.152  1.00 63.06  ? 219  ILE A CA  1 
ATOM   1176 C  C   . ILE A 1 240  ? 123.854 111.885 56.406  1.00 63.06  ? 219  ILE A C   1 
ATOM   1177 O  O   . ILE A 1 240  ? 124.513 111.947 57.453  1.00 63.06  ? 219  ILE A O   1 
ATOM   1178 C  CB  . ILE A 1 240  ? 124.765 112.294 54.073  1.00 63.06  ? 219  ILE A CB  1 
ATOM   1179 C  CG1 . ILE A 1 240  ? 125.686 111.678 53.027  1.00 63.06  ? 219  ILE A CG1 1 
ATOM   1180 C  CG2 . ILE A 1 240  ? 125.362 113.526 54.666  1.00 63.06  ? 219  ILE A CG2 1 
ATOM   1181 C  CD1 . ILE A 1 240  ? 125.862 112.530 51.817  1.00 63.06  ? 219  ILE A CD1 1 
ATOM   1182 N  N   . ILE A 1 241  ? 122.574 112.261 56.349  1.00 61.15  ? 220  ILE A N   1 
ATOM   1183 C  CA  . ILE A 1 241  ? 121.894 112.821 57.512  1.00 61.15  ? 220  ILE A CA  1 
ATOM   1184 C  C   . ILE A 1 241  ? 121.746 111.764 58.598  1.00 61.15  ? 220  ILE A C   1 
ATOM   1185 O  O   . ILE A 1 241  ? 121.714 112.077 59.793  1.00 61.15  ? 220  ILE A O   1 
ATOM   1186 C  CB  . ILE A 1 241  ? 120.541 113.405 57.062  1.00 61.15  ? 220  ILE A CB  1 
ATOM   1187 C  CG1 . ILE A 1 241  ? 120.771 114.481 56.010  1.00 61.15  ? 220  ILE A CG1 1 
ATOM   1188 C  CG2 . ILE A 1 241  ? 119.779 114.017 58.202  1.00 61.15  ? 220  ILE A CG2 1 
ATOM   1189 C  CD1 . ILE A 1 241  ? 121.600 115.625 56.510  1.00 61.15  ? 220  ILE A CD1 1 
ATOM   1190 N  N   . GLU A 1 242  ? 121.753 110.494 58.206  1.00 70.53  ? 221  GLU A N   1 
ATOM   1191 C  CA  . GLU A 1 242  ? 121.642 109.432 59.184  1.00 70.53  ? 221  GLU A CA  1 
ATOM   1192 C  C   . GLU A 1 242  ? 122.936 109.252 59.958  1.00 70.53  ? 221  GLU A C   1 
ATOM   1193 O  O   . GLU A 1 242  ? 122.915 108.694 61.057  1.00 70.53  ? 221  GLU A O   1 
ATOM   1194 C  CB  . GLU A 1 242  ? 121.232 108.155 58.454  1.00 70.53  ? 221  GLU A CB  1 
ATOM   1195 C  CG  . GLU A 1 242  ? 120.751 107.009 59.294  1.00 70.53  ? 221  GLU A CG  1 
ATOM   1196 C  CD  . GLU A 1 242  ? 120.166 105.915 58.430  1.00 70.53  ? 221  GLU A CD  1 
ATOM   1197 O  OE1 . GLU A 1 242  ? 120.135 106.085 57.196  1.00 70.53  ? 221  GLU A OE1 1 
ATOM   1198 O  OE2 . GLU A 1 242  ? 119.737 104.890 58.974  1.00 70.53  ? 221  GLU A OE2 1 
ATOM   1199 N  N   . TYR A 1 243  ? 124.049 109.761 59.443  1.00 70.38  ? 222  TYR A N   1 
ATOM   1200 C  CA  . TYR A 1 243  ? 125.328 109.420 60.042  1.00 70.38  ? 222  TYR A CA  1 
ATOM   1201 C  C   . TYR A 1 243  ? 126.114 110.609 60.555  1.00 70.38  ? 222  TYR A C   1 
ATOM   1202 O  O   . TYR A 1 243  ? 126.754 110.491 61.598  1.00 70.38  ? 222  TYR A O   1 
ATOM   1203 C  CB  . TYR A 1 243  ? 126.168 108.624 59.038  1.00 70.38  ? 222  TYR A CB  1 
ATOM   1204 C  CG  . TYR A 1 243  ? 125.674 107.209 58.870  1.00 70.38  ? 222  TYR A CG  1 
ATOM   1205 C  CD1 . TYR A 1 243  ? 125.039 106.545 59.916  1.00 70.38  ? 222  TYR A CD1 1 
ATOM   1206 C  CD2 . TYR A 1 243  ? 125.765 106.566 57.648  1.00 70.38  ? 222  TYR A CD2 1 
ATOM   1207 C  CE1 . TYR A 1 243  ? 124.565 105.256 59.765  1.00 70.38  ? 222  TYR A CE1 1 
ATOM   1208 C  CE2 . TYR A 1 243  ? 125.290 105.278 57.481  1.00 70.38  ? 222  TYR A CE2 1 
ATOM   1209 C  CZ  . TYR A 1 243  ? 124.691 104.628 58.543  1.00 70.38  ? 222  TYR A CZ  1 
ATOM   1210 O  OH  . TYR A 1 243  ? 124.217 103.348 58.380  1.00 70.38  ? 222  TYR A OH  1 
ATOM   1211 N  N   . LEU A 1 244  ? 126.088 111.759 59.886  1.00 50.13  ? 223  LEU A N   1 
ATOM   1212 C  CA  . LEU A 1 244  ? 126.985 112.822 60.333  1.00 50.13  ? 223  LEU A CA  1 
ATOM   1213 C  C   . LEU A 1 244  ? 126.405 113.584 61.519  1.00 50.13  ? 223  LEU A C   1 
ATOM   1214 O  O   . LEU A 1 244  ? 126.844 113.381 62.654  1.00 50.13  ? 223  LEU A O   1 
ATOM   1215 C  CB  . LEU A 1 244  ? 127.284 113.766 59.173  1.00 50.13  ? 223  LEU A CB  1 
ATOM   1216 C  CG  . LEU A 1 244  ? 128.048 113.085 58.050  1.00 50.13  ? 223  LEU A CG  1 
ATOM   1217 C  CD1 . LEU A 1 244  ? 128.260 114.062 56.921  1.00 50.13  ? 223  LEU A CD1 1 
ATOM   1218 C  CD2 . LEU A 1 244  ? 129.364 112.572 58.572  1.00 50.13  ? 223  LEU A CD2 1 
ATOM   1219 N  N   . TYR A 1 245  ? 125.380 114.433 61.267  1.00 38.42  ? 224  TYR A N   1 
ATOM   1220 C  CA  . TYR A 1 245  ? 124.445 115.098 62.183  1.00 38.42  ? 224  TYR A CA  1 
ATOM   1221 C  C   . TYR A 1 245  ? 125.094 115.591 63.477  1.00 38.42  ? 224  TYR A C   1 
ATOM   1222 O  O   . TYR A 1 245  ? 125.067 114.876 64.481  1.00 38.42  ? 224  TYR A O   1 
ATOM   1223 C  CB  . TYR A 1 245  ? 123.245 114.224 62.521  1.00 38.42  ? 224  TYR A CB  1 
ATOM   1224 C  CG  . TYR A 1 245  ? 122.103 115.104 62.971  1.00 38.42  ? 224  TYR A CG  1 
ATOM   1225 C  CD1 . TYR A 1 245  ? 121.313 115.737 62.042  1.00 38.42  ? 224  TYR A CD1 1 
ATOM   1226 C  CD2 . TYR A 1 245  ? 121.874 115.373 64.307  1.00 38.42  ? 224  TYR A CD2 1 
ATOM   1227 C  CE1 . TYR A 1 245  ? 120.300 116.563 62.429  1.00 38.42  ? 224  TYR A CE1 1 
ATOM   1228 C  CE2 . TYR A 1 245  ? 120.865 116.210 64.702  1.00 38.42  ? 224  TYR A CE2 1 
ATOM   1229 C  CZ  . TYR A 1 245  ? 120.088 116.797 63.760  1.00 38.42  ? 224  TYR A CZ  1 
ATOM   1230 O  OH  . TYR A 1 245  ? 119.086 117.632 64.147  1.00 38.42  ? 224  TYR A OH  1 
ATOM   1231 N  N   . PRO A 1 246  ? 125.635 116.781 63.504  1.00 43.16  ? 225  PRO A N   1 
ATOM   1232 C  CA  . PRO A 1 246  ? 126.905 117.051 64.185  1.00 43.16  ? 225  PRO A CA  1 
ATOM   1233 C  C   . PRO A 1 246  ? 127.077 116.821 65.679  1.00 43.16  ? 225  PRO A C   1 
ATOM   1234 O  O   . PRO A 1 246  ? 128.171 117.163 66.140  1.00 43.16  ? 225  PRO A O   1 
ATOM   1235 C  CB  . PRO A 1 246  ? 127.088 118.542 63.918  1.00 43.16  ? 225  PRO A CB  1 
ATOM   1236 C  CG  . PRO A 1 246  ? 125.713 119.049 63.942  1.00 43.16  ? 225  PRO A CG  1 
ATOM   1237 C  CD  . PRO A 1 246  ? 124.874 118.012 63.285  1.00 43.16  ? 225  PRO A CD  1 
ATOM   1238 N  N   . CYS A 1 247  ? 126.100 116.295 66.433  1.00 42.23  ? 226  CYS A N   1 
ATOM   1239 C  CA  . CYS A 1 247  ? 126.328 115.779 67.796  1.00 42.23  ? 226  CYS A CA  1 
ATOM   1240 C  C   . CYS A 1 247  ? 126.826 116.875 68.752  1.00 42.23  ? 226  CYS A C   1 
ATOM   1241 O  O   . CYS A 1 247  ? 128.017 116.981 69.041  1.00 42.23  ? 226  CYS A O   1 
ATOM   1242 C  CB  . CYS A 1 247  ? 127.281 114.573 67.740  1.00 42.23  ? 226  CYS A CB  1 
ATOM   1243 S  SG  . CYS A 1 247  ? 127.794 113.815 69.288  1.00 42.23  ? 226  CYS A SG  1 
ATOM   1244 N  N   . LEU A 1 248  ? 125.873 117.730 69.148  1.00 29.87  ? 227  LEU A N   1 
ATOM   1245 C  CA  . LEU A 1 248  ? 126.010 119.011 69.854  1.00 29.87  ? 227  LEU A CA  1 
ATOM   1246 C  C   . LEU A 1 248  ? 127.093 119.069 70.925  1.00 29.87  ? 227  LEU A C   1 
ATOM   1247 O  O   . LEU A 1 248  ? 127.087 118.282 71.873  1.00 29.87  ? 227  LEU A O   1 
ATOM   1248 C  CB  . LEU A 1 248  ? 124.669 119.345 70.501  1.00 29.87  ? 227  LEU A CB  1 
ATOM   1249 C  CG  . LEU A 1 248  ? 124.612 120.584 71.386  1.00 29.87  ? 227  LEU A CG  1 
ATOM   1250 C  CD1 . LEU A 1 248  ? 124.901 121.804 70.578  1.00 29.87  ? 227  LEU A CD1 1 
ATOM   1251 C  CD2 . LEU A 1 248  ? 123.252 120.702 72.033  1.00 29.87  ? 227  LEU A CD2 1 
ATOM   1252 N  N   . ILE A 1 249  ? 128.004 120.036 70.780  1.00 19.73  ? 228  ILE A N   1 
ATOM   1253 C  CA  . ILE A 1 249  ? 129.152 120.271 71.659  1.00 19.73  ? 228  ILE A CA  1 
ATOM   1254 C  C   . ILE A 1 249  ? 129.439 121.765 71.656  1.00 19.73  ? 228  ILE A C   1 
ATOM   1255 O  O   . ILE A 1 249  ? 129.597 122.357 70.586  1.00 19.73  ? 228  ILE A O   1 
ATOM   1256 C  CB  . ILE A 1 249  ? 130.414 119.513 71.189  1.00 19.73  ? 228  ILE A CB  1 
ATOM   1257 C  CG1 . ILE A 1 249  ? 130.318 118.008 71.387  1.00 19.73  ? 228  ILE A CG1 1 
ATOM   1258 C  CG2 . ILE A 1 249  ? 131.639 120.007 71.894  1.00 19.73  ? 228  ILE A CG2 1 
ATOM   1259 C  CD1 . ILE A 1 249  ? 131.434 117.262 70.733  1.00 19.73  ? 228  ILE A CD1 1 
ATOM   1260 N  N   . ILE A 1 250  ? 129.524 122.388 72.829  1.00 32.58  ? 229  ILE A N   1 
ATOM   1261 C  CA  . ILE A 1 250  ? 129.960 123.779 72.935  1.00 32.58  ? 229  ILE A CA  1 
ATOM   1262 C  C   . ILE A 1 250  ? 131.428 123.791 73.324  1.00 32.58  ? 229  ILE A C   1 
ATOM   1263 O  O   . ILE A 1 250  ? 131.798 123.202 74.345  1.00 32.58  ? 229  ILE A O   1 
ATOM   1264 C  CB  . ILE A 1 250  ? 129.133 124.555 73.970  1.00 32.58  ? 229  ILE A CB  1 
ATOM   1265 C  CG1 . ILE A 1 250  ? 127.657 124.569 73.594  1.00 32.58  ? 229  ILE A CG1 1 
ATOM   1266 C  CG2 . ILE A 1 250  ? 129.651 125.959 74.080  1.00 32.58  ? 229  ILE A CG2 1 
ATOM   1267 C  CD1 . ILE A 1 250  ? 126.761 125.079 74.685  1.00 32.58  ? 229  ILE A CD1 1 
ATOM   1268 N  N   . THR A 1 251  ? 132.264 124.478 72.544  1.00 28.72  ? 230  THR A N   1 
ATOM   1269 C  CA  . THR A 1 251  ? 133.699 124.420 72.782  1.00 28.72  ? 230  THR A CA  1 
ATOM   1270 C  C   . THR A 1 251  ? 134.350 125.640 72.138  1.00 28.72  ? 230  THR A C   1 
ATOM   1271 O  O   . THR A 1 251  ? 133.753 126.238 71.239  1.00 28.72  ? 230  THR A O   1 
ATOM   1272 C  CB  . THR A 1 251  ? 134.276 123.098 72.231  1.00 28.72  ? 230  THR A CB  1 
ATOM   1273 O  OG1 . THR A 1 251  ? 135.592 122.869 72.739  1.00 28.72  ? 230  THR A OG1 1 
ATOM   1274 C  CG2 . THR A 1 251  ? 134.325 123.090 70.740  1.00 28.72  ? 230  THR A CG2 1 
ATOM   1275 N  N   . PRO A 1 252  ? 135.520 126.082 72.622  1.00 23.87  ? 231  PRO A N   1 
ATOM   1276 C  CA  . PRO A 1 252  ? 136.217 127.186 71.944  1.00 23.87  ? 231  PRO A CA  1 
ATOM   1277 C  C   . PRO A 1 252  ? 136.740 126.840 70.580  1.00 23.87  ? 231  PRO A C   1 
ATOM   1278 O  O   . PRO A 1 252  ? 136.708 127.691 69.685  1.00 23.87  ? 231  PRO A O   1 
ATOM   1279 C  CB  . PRO A 1 252  ? 137.371 127.512 72.898  1.00 23.87  ? 231  PRO A CB  1 
ATOM   1280 C  CG  . PRO A 1 252  ? 137.517 126.345 73.728  1.00 23.87  ? 231  PRO A CG  1 
ATOM   1281 C  CD  . PRO A 1 252  ? 136.151 125.800 73.913  1.00 23.87  ? 231  PRO A CD  1 
ATOM   1282 N  N   . LEU A 1 253  ? 137.211 125.617 70.376  1.00 27.12  ? 232  LEU A N   1 
ATOM   1283 C  CA  . LEU A 1 253  ? 137.864 125.246 69.130  1.00 27.12  ? 232  LEU A CA  1 
ATOM   1284 C  C   . LEU A 1 253  ? 136.879 124.810 68.048  1.00 27.12  ? 232  LEU A C   1 
ATOM   1285 O  O   . LEU A 1 253  ? 137.244 124.044 67.152  1.00 27.12  ? 232  LEU A O   1 
ATOM   1286 C  CB  . LEU A 1 253  ? 138.944 124.192 69.394  1.00 27.12  ? 232  LEU A CB  1 
ATOM   1287 C  CG  . LEU A 1 253  ? 138.755 122.795 69.968  1.00 27.12  ? 232  LEU A CG  1 
ATOM   1288 C  CD1 . LEU A 1 253  ? 139.955 121.974 69.607  1.00 27.12  ? 232  LEU A CD1 1 
ATOM   1289 C  CD2 . LEU A 1 253  ? 138.664 122.837 71.465  1.00 27.12  ? 232  LEU A CD2 1 
ATOM   1290 N  N   . ASP A 1 254  ? 135.630 125.279 68.121  1.00 51.94  ? 233  ASP A N   1 
ATOM   1291 C  CA  . ASP A 1 254  ? 134.773 125.376 66.949  1.00 51.94  ? 233  ASP A CA  1 
ATOM   1292 C  C   . ASP A 1 254  ? 135.100 126.589 66.098  1.00 51.94  ? 233  ASP A C   1 
ATOM   1293 O  O   . ASP A 1 254  ? 134.598 126.698 64.977  1.00 51.94  ? 233  ASP A O   1 
ATOM   1294 C  CB  . ASP A 1 254  ? 133.305 125.441 67.350  1.00 51.94  ? 233  ASP A CB  1 
ATOM   1295 C  CG  . ASP A 1 254  ? 132.763 124.111 67.786  1.00 51.94  ? 233  ASP A CG  1 
ATOM   1296 O  OD1 . ASP A 1 254  ? 133.281 123.075 67.325  1.00 51.94  ? 233  ASP A OD1 1 
ATOM   1297 O  OD2 . ASP A 1 254  ? 131.810 124.096 68.589  1.00 51.94  ? 233  ASP A OD2 1 
ATOM   1298 N  N   . CYS A 1 255  ? 135.906 127.512 66.610  1.00 65.39  ? 234  CYS A N   1 
ATOM   1299 C  CA  . CYS A 1 255  ? 136.451 128.577 65.784  1.00 65.39  ? 234  CYS A CA  1 
ATOM   1300 C  C   . CYS A 1 255  ? 137.756 128.188 65.108  1.00 65.39  ? 234  CYS A C   1 
ATOM   1301 O  O   . CYS A 1 255  ? 138.520 129.074 64.723  1.00 65.39  ? 234  CYS A O   1 
ATOM   1302 C  CB  . CYS A 1 255  ? 136.649 129.851 66.612  1.00 65.39  ? 234  CYS A CB  1 
ATOM   1303 S  SG  . CYS A 1 255  ? 135.124 130.773 66.952  1.00 65.39  ? 234  CYS A SG  1 
ATOM   1304 N  N   . PHE A 1 256  ? 138.035 126.897 64.974  1.00 58.57  ? 235  PHE A N   1 
ATOM   1305 C  CA  . PHE A 1 256  ? 139.181 126.385 64.243  1.00 58.57  ? 235  PHE A CA  1 
ATOM   1306 C  C   . PHE A 1 256  ? 138.769 125.161 63.446  1.00 58.57  ? 235  PHE A C   1 
ATOM   1307 O  O   . PHE A 1 256  ? 137.639 124.691 63.538  1.00 58.57  ? 235  PHE A O   1 
ATOM   1308 C  CB  . PHE A 1 256  ? 140.306 125.984 65.181  1.00 58.57  ? 235  PHE A CB  1 
ATOM   1309 C  CG  . PHE A 1 256  ? 140.898 127.110 65.933  1.00 58.57  ? 235  PHE A CG  1 
ATOM   1310 C  CD1 . PHE A 1 256  ? 141.891 127.883 65.375  1.00 58.57  ? 235  PHE A CD1 1 
ATOM   1311 C  CD2 . PHE A 1 256  ? 140.472 127.387 67.210  1.00 58.57  ? 235  PHE A CD2 1 
ATOM   1312 C  CE1 . PHE A 1 256  ? 142.446 128.912 66.082  1.00 58.57  ? 235  PHE A CE1 1 
ATOM   1313 C  CE2 . PHE A 1 256  ? 141.013 128.415 67.915  1.00 58.57  ? 235  PHE A CE2 1 
ATOM   1314 C  CZ  . PHE A 1 256  ? 142.002 129.182 67.354  1.00 58.57  ? 235  PHE A CZ  1 
ATOM   1315 N  N   . TRP A 1 257  ? 139.712 124.612 62.688  1.00 46.48  ? 236  TRP A N   1 
ATOM   1316 C  CA  . TRP A 1 257  ? 139.478 123.328 62.036  1.00 46.48  ? 236  TRP A CA  1 
ATOM   1317 C  C   . TRP A 1 257  ? 139.909 122.195 62.971  1.00 46.48  ? 236  TRP A C   1 
ATOM   1318 O  O   . TRP A 1 257  ? 140.874 121.484 62.743  1.00 46.48  ? 236  TRP A O   1 
ATOM   1319 C  CB  . TRP A 1 257  ? 140.200 123.256 60.693  1.00 46.48  ? 236  TRP A CB  1 
ATOM   1320 C  CG  . TRP A 1 257  ? 139.934 121.984 59.956  1.00 46.48  ? 236  TRP A CG  1 
ATOM   1321 C  CD1 . TRP A 1 257  ? 138.772 121.606 59.396  1.00 46.48  ? 236  TRP A CD1 1 
ATOM   1322 C  CD2 . TRP A 1 257  ? 140.841 120.894 59.779  1.00 46.48  ? 236  TRP A CD2 1 
ATOM   1323 N  NE1 . TRP A 1 257  ? 138.895 120.362 58.848  1.00 46.48  ? 236  TRP A NE1 1 
ATOM   1324 C  CE2 . TRP A 1 257  ? 140.160 119.901 59.083  1.00 46.48  ? 236  TRP A CE2 1 
ATOM   1325 C  CE3 . TRP A 1 257  ? 142.172 120.671 60.137  1.00 46.48  ? 236  TRP A CE3 1 
ATOM   1326 C  CZ2 . TRP A 1 257  ? 140.761 118.708 58.730  1.00 46.48  ? 236  TRP A CZ2 1 
ATOM   1327 C  CZ3 . TRP A 1 257  ? 142.751 119.488 59.813  1.00 46.48  ? 236  TRP A CZ3 1 
ATOM   1328 C  CH2 . TRP A 1 257  ? 142.055 118.520 59.112  1.00 46.48  ? 236  TRP A CH2 1 
ATOM   1329 N  N   . GLU A 1 258  ? 139.227 122.074 64.096  1.00 55.66  ? 237  GLU A N   1 
ATOM   1330 C  CA  . GLU A 1 258  ? 139.378 120.872 64.901  1.00 55.66  ? 237  GLU A CA  1 
ATOM   1331 C  C   . GLU A 1 258  ? 138.090 120.338 65.473  1.00 55.66  ? 237  GLU A C   1 
ATOM   1332 O  O   . GLU A 1 258  ? 138.087 119.194 65.939  1.00 55.66  ? 237  GLU A O   1 
ATOM   1333 C  CB  . GLU A 1 258  ? 140.360 121.073 66.061  1.00 55.66  ? 237  GLU A CB  1 
ATOM   1334 C  CG  . GLU A 1 258  ? 141.806 120.846 65.735  1.00 55.66  ? 237  GLU A CG  1 
ATOM   1335 C  CD  . GLU A 1 258  ? 142.500 122.068 65.214  1.00 55.66  ? 237  GLU A CD  1 
ATOM   1336 O  OE1 . GLU A 1 258  ? 141.844 123.114 65.118  1.00 55.66  ? 237  GLU A OE1 1 
ATOM   1337 O  OE2 . GLU A 1 258  ? 143.700 121.980 64.902  1.00 55.66  ? 237  GLU A OE2 1 
ATOM   1338 N  N   . GLY A 1 259  ? 137.008 121.114 65.462  1.00 61.16  ? 238  GLY A N   1 
ATOM   1339 C  CA  . GLY A 1 259  ? 135.742 120.590 65.933  1.00 61.16  ? 238  GLY A CA  1 
ATOM   1340 C  C   . GLY A 1 259  ? 135.260 119.456 65.056  1.00 61.16  ? 238  GLY A C   1 
ATOM   1341 O  O   . GLY A 1 259  ? 134.575 118.543 65.523  1.00 61.16  ? 238  GLY A O   1 
ATOM   1342 N  N   . ALA A 1 260  ? 135.652 119.488 63.783  1.00 64.68  ? 239  ALA A N   1 
ATOM   1343 C  CA  . ALA A 1 260  ? 135.442 118.367 62.883  1.00 64.68  ? 239  ALA A CA  1 
ATOM   1344 C  C   . ALA A 1 260  ? 136.134 117.108 63.387  1.00 64.68  ? 239  ALA A C   1 
ATOM   1345 O  O   . ALA A 1 260  ? 135.524 116.031 63.416  1.00 64.68  ? 239  ALA A O   1 
ATOM   1346 C  CB  . ALA A 1 260  ? 135.936 118.749 61.496  1.00 64.68  ? 239  ALA A CB  1 
ATOM   1347 N  N   . LYS A 1 261  ? 137.372 117.234 63.886  1.00 51.85  ? 240  LYS A N   1 
ATOM   1348 C  CA  . LYS A 1 261  ? 138.048 116.080 64.483  1.00 51.85  ? 240  LYS A CA  1 
ATOM   1349 C  C   . LYS A 1 261  ? 137.383 115.645 65.776  1.00 51.85  ? 240  LYS A C   1 
ATOM   1350 O  O   . LYS A 1 261  ? 137.628 114.541 66.270  1.00 51.85  ? 240  LYS A O   1 
ATOM   1351 C  CB  . LYS A 1 261  ? 139.522 116.373 64.745  1.00 51.85  ? 240  LYS A CB  1 
ATOM   1352 C  CG  . LYS A 1 261  ? 140.376 116.236 63.529  1.00 51.85  ? 240  LYS A CG  1 
ATOM   1353 C  CD  . LYS A 1 261  ? 141.846 116.232 63.863  1.00 51.85  ? 240  LYS A CD  1 
ATOM   1354 C  CE  . LYS A 1 261  ? 142.350 117.620 64.116  1.00 51.85  ? 240  LYS A CE  1 
ATOM   1355 N  NZ  . LYS A 1 261  ? 143.828 117.643 64.254  1.00 51.85  ? 240  LYS A NZ  1 
ATOM   1356 N  N   . LEU A 1 262  ? 136.526 116.492 66.328  1.00 53.41  ? 241  LEU A N   1 
ATOM   1357 C  CA  . LEU A 1 262  ? 135.832 116.155 67.553  1.00 53.41  ? 241  LEU A CA  1 
ATOM   1358 C  C   . LEU A 1 262  ? 134.534 115.415 67.248  1.00 53.41  ? 241  LEU A C   1 
ATOM   1359 O  O   . LEU A 1 262  ? 133.764 115.094 68.158  1.00 53.41  ? 241  LEU A O   1 
ATOM   1360 C  CB  . LEU A 1 262  ? 135.601 117.453 68.319  1.00 53.41  ? 241  LEU A CB  1 
ATOM   1361 C  CG  . LEU A 1 262  ? 135.314 117.537 69.796  1.00 53.41  ? 241  LEU A CG  1 
ATOM   1362 C  CD1 . LEU A 1 262  ? 136.466 116.910 70.500  1.00 53.41  ? 241  LEU A CD1 1 
ATOM   1363 C  CD2 . LEU A 1 262  ? 135.250 118.996 70.154  1.00 53.41  ? 241  LEU A CD2 1 
ATOM   1364 N  N   . GLN A 1 263  ? 134.284 115.111 65.966  1.00 47.02  ? 242  GLN A N   1 
ATOM   1365 C  CA  . GLN A 1 263  ? 132.974 114.600 65.572  1.00 47.02  ? 242  GLN A CA  1 
ATOM   1366 C  C   . GLN A 1 263  ? 132.918 113.080 65.545  1.00 47.02  ? 242  GLN A C   1 
ATOM   1367 O  O   . GLN A 1 263  ? 132.104 112.480 66.256  1.00 47.02  ? 242  GLN A O   1 
ATOM   1368 C  CB  . GLN A 1 263  ? 132.582 115.144 64.208  1.00 47.02  ? 242  GLN A CB  1 
ATOM   1369 C  CG  . GLN A 1 263  ? 132.295 116.604 64.222  1.00 47.02  ? 242  GLN A CG  1 
ATOM   1370 C  CD  . GLN A 1 263  ? 131.258 116.935 65.249  1.00 47.02  ? 242  GLN A CD  1 
ATOM   1371 O  OE1 . GLN A 1 263  ? 131.501 117.697 66.179  1.00 47.02  ? 242  GLN A OE1 1 
ATOM   1372 N  NE2 . GLN A 1 263  ? 130.112 116.305 65.130  1.00 47.02  ? 242  GLN A NE2 1 
ATOM   1373 N  N   . SER A 1 264  ? 133.757 112.449 64.714  1.00 82.87  ? 243  SER A N   1 
ATOM   1374 C  CA  . SER A 1 264  ? 133.720 111.011 64.390  1.00 82.87  ? 243  SER A CA  1 
ATOM   1375 C  C   . SER A 1 264  ? 132.359 110.594 63.820  1.00 82.87  ? 243  SER A C   1 
ATOM   1376 O  O   . SER A 1 264  ? 131.620 109.799 64.404  1.00 82.87  ? 243  SER A O   1 
ATOM   1377 C  CB  . SER A 1 264  ? 134.098 110.129 65.588  1.00 82.87  ? 243  SER A CB  1 
ATOM   1378 O  OG  . SER A 1 264  ? 133.079 110.132 66.575  1.00 82.87  ? 243  SER A OG  1 
ATOM   1379 N  N   . GLY A 1 265  ? 132.041 111.151 62.652  1.00 79.07  ? 244  GLY A N   1 
ATOM   1380 C  CA  . GLY A 1 265  ? 130.840 110.780 61.931  1.00 79.07  ? 244  GLY A CA  1 
ATOM   1381 C  C   . GLY A 1 265  ? 130.977 109.476 61.174  1.00 79.07  ? 244  GLY A C   1 
ATOM   1382 O  O   . GLY A 1 265  ? 130.280 108.509 61.495  1.00 79.07  ? 244  GLY A O   1 
ATOM   1383 N  N   . THR A 1 266  ? 131.889 109.435 60.193  1.00 77.24  ? 245  THR A N   1 
ATOM   1384 C  CA  . THR A 1 266  ? 132.220 108.260 59.369  1.00 77.24  ? 245  THR A CA  1 
ATOM   1385 C  C   . THR A 1 266  ? 130.984 107.724 58.637  1.00 77.24  ? 245  THR A C   1 
ATOM   1386 O  O   . THR A 1 266  ? 130.427 106.686 58.981  1.00 77.24  ? 245  THR A O   1 
ATOM   1387 C  CB  . THR A 1 266  ? 132.905 107.136 60.164  1.00 77.24  ? 245  THR A CB  1 
ATOM   1388 O  OG1 . THR A 1 266  ? 132.041 106.649 61.198  1.00 77.24  ? 245  THR A OG1 1 
ATOM   1389 C  CG2 . THR A 1 266  ? 134.208 107.603 60.766  1.00 77.24  ? 245  THR A CG2 1 
ATOM   1390 N  N   . ALA A 1 267  ? 130.548 108.501 57.645  1.00 88.34  ? 246  ALA A N   1 
ATOM   1391 C  CA  . ALA A 1 267  ? 129.328 108.179 56.908  1.00 88.34  ? 246  ALA A CA  1 
ATOM   1392 C  C   . ALA A 1 267  ? 129.423 106.868 56.133  1.00 88.34  ? 246  ALA A C   1 
ATOM   1393 O  O   . ALA A 1 267  ? 128.391 106.233 55.895  1.00 88.34  ? 246  ALA A O   1 
ATOM   1394 C  CB  . ALA A 1 267  ? 128.979 109.316 55.952  1.00 88.34  ? 246  ALA A CB  1 
ATOM   1395 N  N   . TYR A 1 268  ? 130.636 106.461 55.726  1.00 100.92 ? 247  TYR A N   1 
ATOM   1396 C  CA  . TYR A 1 268  ? 130.905 105.167 55.062  1.00 100.92 ? 247  TYR A CA  1 
ATOM   1397 C  C   . TYR A 1 268  ? 130.116 104.983 53.767  1.00 100.92 ? 247  TYR A C   1 
ATOM   1398 O  O   . TYR A 1 268  ? 129.529 103.928 53.525  1.00 100.92 ? 247  TYR A O   1 
ATOM   1399 C  CB  . TYR A 1 268  ? 130.671 103.980 56.001  1.00 100.92 ? 247  TYR A CB  1 
ATOM   1400 C  CG  . TYR A 1 268  ? 131.826 103.690 56.928  1.00 100.92 ? 247  TYR A CG  1 
ATOM   1401 C  CD1 . TYR A 1 268  ? 133.094 104.163 56.648  1.00 100.92 ? 247  TYR A CD1 1 
ATOM   1402 C  CD2 . TYR A 1 268  ? 131.646 102.940 58.076  1.00 100.92 ? 247  TYR A CD2 1 
ATOM   1403 C  CE1 . TYR A 1 268  ? 134.148 103.901 57.481  1.00 100.92 ? 247  TYR A CE1 1 
ATOM   1404 C  CE2 . TYR A 1 268  ? 132.695 102.675 58.919  1.00 100.92 ? 247  TYR A CE2 1 
ATOM   1405 C  CZ  . TYR A 1 268  ? 133.945 103.154 58.615  1.00 100.92 ? 247  TYR A CZ  1 
ATOM   1406 O  OH  . TYR A 1 268  ? 135.000 102.890 59.454  1.00 100.92 ? 247  TYR A OH  1 
ATOM   1407 N  N   . LEU A 1 269  ? 130.095 106.020 52.940  1.00 98.85  ? 248  LEU A N   1 
ATOM   1408 C  CA  . LEU A 1 269  ? 129.575 105.890 51.590  1.00 98.85  ? 248  LEU A CA  1 
ATOM   1409 C  C   . LEU A 1 269  ? 130.530 105.013 50.789  1.00 98.85  ? 248  LEU A C   1 
ATOM   1410 O  O   . LEU A 1 269  ? 131.735 104.997 51.046  1.00 98.85  ? 248  LEU A O   1 
ATOM   1411 C  CB  . LEU A 1 269  ? 129.414 107.280 50.974  1.00 98.85  ? 248  LEU A CB  1 
ATOM   1412 C  CG  . LEU A 1 269  ? 128.637 107.520 49.684  1.00 98.85  ? 248  LEU A CG  1 
ATOM   1413 C  CD1 . LEU A 1 269  ? 127.918 108.840 49.795  1.00 98.85  ? 248  LEU A CD1 1 
ATOM   1414 C  CD2 . LEU A 1 269  ? 129.563 107.565 48.495  1.00 98.85  ? 248  LEU A CD2 1 
ATOM   1415 N  N   . LEU A 1 270  ? 129.991 104.244 49.841  1.00 112.48 ? 249  LEU A N   1 
ATOM   1416 C  CA  . LEU A 1 270  ? 130.793 103.204 49.202  1.00 112.48 ? 249  LEU A CA  1 
ATOM   1417 C  C   . LEU A 1 270  ? 131.718 103.717 48.102  1.00 112.48 ? 249  LEU A C   1 
ATOM   1418 O  O   . LEU A 1 270  ? 132.537 102.942 47.597  1.00 112.48 ? 249  LEU A O   1 
ATOM   1419 C  CB  . LEU A 1 270  ? 129.884 102.110 48.652  1.00 112.48 ? 249  LEU A CB  1 
ATOM   1420 C  CG  . LEU A 1 270  ? 129.226 101.273 49.749  1.00 112.48 ? 249  LEU A CG  1 
ATOM   1421 C  CD1 . LEU A 1 270  ? 128.296 100.230 49.153  1.00 112.48 ? 249  LEU A CD1 1 
ATOM   1422 C  CD2 . LEU A 1 270  ? 130.284 100.614 50.620  1.00 112.48 ? 249  LEU A CD2 1 
ATOM   1423 N  N   . GLY A 1 271  ? 131.618 104.986 47.725  1.00 113.02 ? 250  GLY A N   1 
ATOM   1424 C  CA  . GLY A 1 271  ? 132.576 105.577 46.813  1.00 113.02 ? 250  GLY A CA  1 
ATOM   1425 C  C   . GLY A 1 271  ? 133.678 106.314 47.545  1.00 113.02 ? 250  GLY A C   1 
ATOM   1426 O  O   . GLY A 1 271  ? 134.863 106.081 47.291  1.00 113.02 ? 250  GLY A O   1 
ATOM   1427 N  N   . LYS A 1 272  ? 133.303 107.209 48.455  1.00 108.73 ? 251  LYS A N   1 
ATOM   1428 C  CA  . LYS A 1 272  ? 134.274 107.905 49.289  1.00 108.73 ? 251  LYS A CA  1 
ATOM   1429 C  C   . LYS A 1 272  ? 134.185 107.345 50.697  1.00 108.73 ? 251  LYS A C   1 
ATOM   1430 O  O   . LYS A 1 272  ? 133.165 107.558 51.373  1.00 108.73 ? 251  LYS A O   1 
ATOM   1431 C  CB  . LYS A 1 272  ? 134.024 109.413 49.296  1.00 108.73 ? 251  LYS A CB  1 
ATOM   1432 C  CG  . LYS A 1 272  ? 135.058 110.201 50.087  1.00 108.73 ? 251  LYS A CG  1 
ATOM   1433 C  CD  . LYS A 1 272  ? 136.446 110.003 49.500  1.00 108.73 ? 251  LYS A CD  1 
ATOM   1434 C  CE  . LYS A 1 272  ? 136.567 110.633 48.125  1.00 108.73 ? 251  LYS A CE  1 
ATOM   1435 N  NZ  . LYS A 1 272  ? 137.930 110.442 47.573  1.00 108.73 ? 251  LYS A NZ  1 
ATOM   1436 N  N   . PRO A 1 273  ? 135.201 106.628 51.173  1.00 101.77 ? 252  PRO A N   1 
ATOM   1437 C  CA  . PRO A 1 273  ? 135.047 105.800 52.385  1.00 101.77 ? 252  PRO A CA  1 
ATOM   1438 C  C   . PRO A 1 273  ? 134.877 106.591 53.680  1.00 101.77 ? 252  PRO A C   1 
ATOM   1439 O  O   . PRO A 1 273  ? 133.952 106.263 54.434  1.00 101.77 ? 252  PRO A O   1 
ATOM   1440 C  CB  . PRO A 1 273  ? 136.319 104.938 52.386  1.00 101.77 ? 252  PRO A CB  1 
ATOM   1441 C  CG  . PRO A 1 273  ? 136.740 104.910 50.961  1.00 101.77 ? 252  PRO A CG  1 
ATOM   1442 C  CD  . PRO A 1 273  ? 136.401 106.251 50.406  1.00 101.77 ? 252  PRO A CD  1 
ATOM   1443 N  N   . PRO A 1 274  ? 135.749 107.622 54.045  1.00 90.40  ? 253  PRO A N   1 
ATOM   1444 C  CA  . PRO A 1 274  ? 135.509 108.274 55.345  1.00 90.40  ? 253  PRO A CA  1 
ATOM   1445 C  C   . PRO A 1 274  ? 134.234 109.106 55.390  1.00 90.40  ? 253  PRO A C   1 
ATOM   1446 O  O   . PRO A 1 274  ? 133.307 108.775 56.138  1.00 90.40  ? 253  PRO A O   1 
ATOM   1447 C  CB  . PRO A 1 274  ? 136.741 109.169 55.529  1.00 90.40  ? 253  PRO A CB  1 
ATOM   1448 C  CG  . PRO A 1 274  ? 137.732 108.679 54.574  1.00 90.40  ? 253  PRO A CG  1 
ATOM   1449 C  CD  . PRO A 1 274  ? 136.923 108.256 53.409  1.00 90.40  ? 253  PRO A CD  1 
ATOM   1450 N  N   . LEU A 1 275  ? 134.173 110.124 54.524  1.00 71.93  ? 254  LEU A N   1 
ATOM   1451 C  CA  . LEU A 1 275  ? 133.104 111.129 54.447  1.00 71.93  ? 254  LEU A CA  1 
ATOM   1452 C  C   . LEU A 1 275  ? 132.834 111.739 55.826  1.00 71.93  ? 254  LEU A C   1 
ATOM   1453 O  O   . LEU A 1 275  ? 131.776 111.561 56.424  1.00 71.93  ? 254  LEU A O   1 
ATOM   1454 C  CB  . LEU A 1 275  ? 131.839 110.526 53.830  1.00 71.93  ? 254  LEU A CB  1 
ATOM   1455 C  CG  . LEU A 1 275  ? 130.858 111.402 53.040  1.00 71.93  ? 254  LEU A CG  1 
ATOM   1456 C  CD1 . LEU A 1 275  ? 129.994 112.341 53.860  1.00 71.93  ? 254  LEU A CD1 1 
ATOM   1457 C  CD2 . LEU A 1 275  ? 131.590 112.167 51.957  1.00 71.93  ? 254  LEU A CD2 1 
ATOM   1458 N  N   . ARG A 1 276  ? 133.838 112.434 56.346  1.00 57.81  ? 255  ARG A N   1 
ATOM   1459 C  CA  . ARG A 1 276  ? 133.801 112.998 57.685  1.00 57.81  ? 255  ARG A CA  1 
ATOM   1460 C  C   . ARG A 1 276  ? 133.673 114.511 57.617  1.00 57.81  ? 255  ARG A C   1 
ATOM   1461 O  O   . ARG A 1 276  ? 133.767 115.120 56.549  1.00 57.81  ? 255  ARG A O   1 
ATOM   1462 C  CB  . ARG A 1 276  ? 135.062 112.621 58.461  1.00 57.81  ? 255  ARG A CB  1 
ATOM   1463 C  CG  . ARG A 1 276  ? 135.172 111.164 58.811  1.00 57.81  ? 255  ARG A CG  1 
ATOM   1464 C  CD  . ARG A 1 276  ? 136.556 110.873 59.339  1.00 57.81  ? 255  ARG A CD  1 
ATOM   1465 N  NE  . ARG A 1 276  ? 136.857 111.705 60.496  1.00 57.81  ? 255  ARG A NE  1 
ATOM   1466 C  CZ  . ARG A 1 276  ? 136.591 111.365 61.751  1.00 57.81  ? 255  ARG A CZ  1 
ATOM   1467 N  NH1 . ARG A 1 276  ? 136.030 110.197 62.016  1.00 57.81  ? 255  ARG A NH1 1 
ATOM   1468 N  NH2 . ARG A 1 276  ? 136.896 112.187 62.744  1.00 57.81  ? 255  ARG A NH2 1 
ATOM   1469 N  N   . TRP A 1 277  ? 133.487 115.127 58.784  1.00 42.72  ? 256  TRP A N   1 
ATOM   1470 C  CA  . TRP A 1 277  ? 133.411 116.581 58.827  1.00 42.72  ? 256  TRP A CA  1 
ATOM   1471 C  C   . TRP A 1 277  ? 134.756 117.245 58.608  1.00 42.72  ? 256  TRP A C   1 
ATOM   1472 O  O   . TRP A 1 277  ? 134.800 118.448 58.341  1.00 42.72  ? 256  TRP A O   1 
ATOM   1473 C  CB  . TRP A 1 277  ? 132.836 117.070 60.146  1.00 42.72  ? 256  TRP A CB  1 
ATOM   1474 C  CG  . TRP A 1 277  ? 131.400 116.863 60.251  1.00 42.72  ? 256  TRP A CG  1 
ATOM   1475 C  CD1 . TRP A 1 277  ? 130.767 115.909 60.965  1.00 42.72  ? 256  TRP A CD1 1 
ATOM   1476 C  CD2 . TRP A 1 277  ? 130.390 117.611 59.589  1.00 42.72  ? 256  TRP A CD2 1 
ATOM   1477 N  NE1 . TRP A 1 277  ? 129.413 116.021 60.807  1.00 42.72  ? 256  TRP A NE1 1 
ATOM   1478 C  CE2 . TRP A 1 277  ? 129.160 117.060 59.956  1.00 42.72  ? 256  TRP A CE2 1 
ATOM   1479 C  CE3 . TRP A 1 277  ? 130.409 118.695 58.718  1.00 42.72  ? 256  TRP A CE3 1 
ATOM   1480 C  CZ2 . TRP A 1 277  ? 127.960 117.558 59.491  1.00 42.72  ? 256  TRP A CZ2 1 
ATOM   1481 C  CZ3 . TRP A 1 277  ? 129.222 119.190 58.261  1.00 42.72  ? 256  TRP A CZ3 1 
ATOM   1482 C  CH2 . TRP A 1 277  ? 128.012 118.620 58.640  1.00 42.72  ? 256  TRP A CH2 1 
ATOM   1483 N  N   . THR A 1 278  ? 135.851 116.507 58.738  1.00 51.28  ? 257  THR A N   1 
ATOM   1484 C  CA  . THR A 1 278  ? 137.148 117.006 58.314  1.00 51.28  ? 257  THR A CA  1 
ATOM   1485 C  C   . THR A 1 278  ? 137.300 117.009 56.802  1.00 51.28  ? 257  THR A C   1 
ATOM   1486 O  O   . THR A 1 278  ? 138.310 117.505 56.296  1.00 51.28  ? 257  THR A O   1 
ATOM   1487 C  CB  . THR A 1 278  ? 138.258 116.147 58.905  1.00 51.28  ? 257  THR A CB  1 
ATOM   1488 O  OG1 . THR A 1 278  ? 138.177 114.831 58.352  1.00 51.28  ? 257  THR A OG1 1 
ATOM   1489 C  CG2 . THR A 1 278  ? 138.110 116.042 60.385  1.00 51.28  ? 257  THR A CG2 1 
ATOM   1490 N  N   . ASN A 1 279  ? 136.336 116.452 56.075  1.00 68.34  ? 258  ASN A N   1 
ATOM   1491 C  CA  . ASN A 1 279  ? 136.539 116.088 54.686  1.00 68.34  ? 258  ASN A CA  1 
ATOM   1492 C  C   . ASN A 1 279  ? 135.560 116.754 53.733  1.00 68.34  ? 258  ASN A C   1 
ATOM   1493 O  O   . ASN A 1 279  ? 135.989 117.320 52.723  1.00 68.34  ? 258  ASN A O   1 
ATOM   1494 C  CB  . ASN A 1 279  ? 136.433 114.561 54.563  1.00 68.34  ? 258  ASN A CB  1 
ATOM   1495 C  CG  . ASN A 1 279  ? 136.997 114.031 53.270  1.00 68.34  ? 258  ASN A CG  1 
ATOM   1496 O  OD1 . ASN A 1 279  ? 137.529 114.776 52.452  1.00 68.34  ? 258  ASN A OD1 1 
ATOM   1497 N  ND2 . ASN A 1 279  ? 136.881 112.726 53.076  1.00 68.34  ? 258  ASN A ND2 1 
ATOM   1498 N  N   . PHE A 1 280  ? 134.258 116.706 54.008  1.00 69.63  ? 259  PHE A N   1 
ATOM   1499 C  CA  . PHE A 1 280  ? 133.364 116.564 52.868  1.00 69.63  ? 259  PHE A CA  1 
ATOM   1500 C  C   . PHE A 1 280  ? 132.770 117.871 52.359  1.00 69.63  ? 259  PHE A C   1 
ATOM   1501 O  O   . PHE A 1 280  ? 132.395 117.910 51.181  1.00 69.63  ? 259  PHE A O   1 
ATOM   1502 C  CB  . PHE A 1 280  ? 132.253 115.560 53.184  1.00 69.63  ? 259  PHE A CB  1 
ATOM   1503 C  CG  . PHE A 1 280  ? 131.027 116.151 53.763  1.00 69.63  ? 259  PHE A CG  1 
ATOM   1504 C  CD1 . PHE A 1 280  ? 130.988 116.578 55.064  1.00 69.63  ? 259  PHE A CD1 1 
ATOM   1505 C  CD2 . PHE A 1 280  ? 129.867 116.172 53.020  1.00 69.63  ? 259  PHE A CD2 1 
ATOM   1506 C  CE1 . PHE A 1 280  ? 129.835 117.086 55.588  1.00 69.63  ? 259  PHE A CE1 1 
ATOM   1507 C  CE2 . PHE A 1 280  ? 128.708 116.678 53.533  1.00 69.63  ? 259  PHE A CE2 1 
ATOM   1508 C  CZ  . PHE A 1 280  ? 128.688 117.133 54.823  1.00 69.63  ? 259  PHE A CZ  1 
ATOM   1509 N  N   . ASP A 1 281  ? 132.674 118.931 53.200  1.00 74.80  ? 260  ASP A N   1 
ATOM   1510 C  CA  . ASP A 1 281  ? 132.469 120.316 52.756  1.00 74.80  ? 260  ASP A CA  1 
ATOM   1511 C  C   . ASP A 1 281  ? 131.187 120.515 51.951  1.00 74.80  ? 260  ASP A C   1 
ATOM   1512 O  O   . ASP A 1 281  ? 131.254 120.528 50.717  1.00 74.80  ? 260  ASP A O   1 
ATOM   1513 C  CB  . ASP A 1 281  ? 133.654 120.795 51.919  1.00 74.80  ? 260  ASP A CB  1 
ATOM   1514 C  CG  . ASP A 1 281  ? 133.701 122.302 51.779  1.00 74.80  ? 260  ASP A CG  1 
ATOM   1515 O  OD1 . ASP A 1 281  ? 132.890 122.990 52.428  1.00 74.80  ? 260  ASP A OD1 1 
ATOM   1516 O  OD2 . ASP A 1 281  ? 134.551 122.798 51.012  1.00 74.80  ? 260  ASP A OD2 1 
ATOM   1517 N  N   . PRO A 1 282  ? 130.025 120.638 52.598  1.00 70.81  ? 261  PRO A N   1 
ATOM   1518 C  CA  . PRO A 1 282  ? 128.746 120.391 51.910  1.00 70.81  ? 261  PRO A CA  1 
ATOM   1519 C  C   . PRO A 1 282  ? 128.406 121.306 50.738  1.00 70.81  ? 261  PRO A C   1 
ATOM   1520 O  O   . PRO A 1 282  ? 127.627 120.877 49.884  1.00 70.81  ? 261  PRO A O   1 
ATOM   1521 C  CB  . PRO A 1 282  ? 127.717 120.554 53.033  1.00 70.81  ? 261  PRO A CB  1 
ATOM   1522 C  CG  . PRO A 1 282  ? 128.349 121.472 53.981  1.00 70.81  ? 261  PRO A CG  1 
ATOM   1523 C  CD  . PRO A 1 282  ? 129.818 121.169 53.953  1.00 70.81  ? 261  PRO A CD  1 
ATOM   1524 N  N   . LEU A 1 283  ? 128.949 122.526 50.639  1.00 70.41  ? 262  LEU A N   1 
ATOM   1525 C  CA  . LEU A 1 283  ? 128.566 123.366 49.500  1.00 70.41  ? 262  LEU A CA  1 
ATOM   1526 C  C   . LEU A 1 283  ? 129.180 122.882 48.196  1.00 70.41  ? 262  LEU A C   1 
ATOM   1527 O  O   . LEU A 1 283  ? 128.496 122.839 47.167  1.00 70.41  ? 262  LEU A O   1 
ATOM   1528 C  CB  . LEU A 1 283  ? 128.917 124.831 49.721  1.00 70.41  ? 262  LEU A CB  1 
ATOM   1529 C  CG  . LEU A 1 283  ? 127.902 125.623 50.531  1.00 70.41  ? 262  LEU A CG  1 
ATOM   1530 C  CD1 . LEU A 1 283  ? 128.301 127.078 50.562  1.00 70.41  ? 262  LEU A CD1 1 
ATOM   1531 C  CD2 . LEU A 1 283  ? 126.515 125.461 49.943  1.00 70.41  ? 262  LEU A CD2 1 
ATOM   1532 N  N   . GLU A 1 284  ? 130.454 122.506 48.209  1.00 77.36  ? 263  GLU A N   1 
ATOM   1533 C  CA  . GLU A 1 284  ? 131.027 121.945 46.999  1.00 77.36  ? 263  GLU A CA  1 
ATOM   1534 C  C   . GLU A 1 284  ? 130.537 120.524 46.773  1.00 77.36  ? 263  GLU A C   1 
ATOM   1535 O  O   . GLU A 1 284  ? 130.601 120.027 45.646  1.00 77.36  ? 263  GLU A O   1 
ATOM   1536 C  CB  . GLU A 1 284  ? 132.553 122.013 47.074  1.00 77.36  ? 263  GLU A CB  1 
ATOM   1537 C  CG  . GLU A 1 284  ? 133.297 121.778 45.764  1.00 77.36  ? 263  GLU A CG  1 
ATOM   1538 C  CD  . GLU A 1 284  ? 133.072 122.888 44.742  1.00 77.36  ? 263  GLU A CD  1 
ATOM   1539 O  OE1 . GLU A 1 284  ? 132.778 124.033 45.144  1.00 77.36  ? 263  GLU A OE1 1 
ATOM   1540 O  OE2 . GLU A 1 284  ? 133.206 122.621 43.529  1.00 77.36  ? 263  GLU A OE2 1 
ATOM   1541 N  N   . PHE A 1 285  ? 130.019 119.871 47.815  1.00 71.21  ? 264  PHE A N   1 
ATOM   1542 C  CA  . PHE A 1 285  ? 129.308 118.613 47.620  1.00 71.21  ? 264  PHE A CA  1 
ATOM   1543 C  C   . PHE A 1 285  ? 128.015 118.838 46.847  1.00 71.21  ? 264  PHE A C   1 
ATOM   1544 O  O   . PHE A 1 285  ? 127.684 118.065 45.943  1.00 71.21  ? 264  PHE A O   1 
ATOM   1545 C  CB  . PHE A 1 285  ? 129.020 117.971 48.973  1.00 71.21  ? 264  PHE A CB  1 
ATOM   1546 C  CG  . PHE A 1 285  ? 128.426 116.593 48.889  1.00 71.21  ? 264  PHE A CG  1 
ATOM   1547 C  CD1 . PHE A 1 285  ? 129.233 115.487 48.678  1.00 71.21  ? 264  PHE A CD1 1 
ATOM   1548 C  CD2 . PHE A 1 285  ? 127.063 116.401 49.034  1.00 71.21  ? 264  PHE A CD2 1 
ATOM   1549 C  CE1 . PHE A 1 285  ? 128.692 114.216 48.614  1.00 71.21  ? 264  PHE A CE1 1 
ATOM   1550 C  CE2 . PHE A 1 285  ? 126.514 115.137 48.966  1.00 71.21  ? 264  PHE A CE2 1 
ATOM   1551 C  CZ  . PHE A 1 285  ? 127.330 114.044 48.755  1.00 71.21  ? 264  PHE A CZ  1 
ATOM   1552 N  N   . LEU A 1 286  ? 127.279 119.897 47.180  1.00 82.57  ? 265  LEU A N   1 
ATOM   1553 C  CA  . LEU A 1 286  ? 126.039 120.190 46.469  1.00 82.57  ? 265  LEU A CA  1 
ATOM   1554 C  C   . LEU A 1 286  ? 126.304 120.674 45.050  1.00 82.57  ? 265  LEU A C   1 
ATOM   1555 O  O   . LEU A 1 286  ? 125.548 120.342 44.133  1.00 82.57  ? 265  LEU A O   1 
ATOM   1556 C  CB  . LEU A 1 286  ? 125.215 121.223 47.232  1.00 82.57  ? 265  LEU A CB  1 
ATOM   1557 C  CG  . LEU A 1 286  ? 124.115 120.726 48.174  1.00 82.57  ? 265  LEU A CG  1 
ATOM   1558 C  CD1 . LEU A 1 286  ? 123.049 120.030 47.368  1.00 82.57  ? 265  LEU A CD1 1 
ATOM   1559 C  CD2 . LEU A 1 286  ? 124.614 119.798 49.248  1.00 82.57  ? 265  LEU A CD2 1 
ATOM   1560 N  N   . GLU A 1 287  ? 127.365 121.455 44.844  1.00 92.56  ? 266  GLU A N   1 
ATOM   1561 C  CA  . GLU A 1 287  ? 127.644 121.948 43.498  1.00 92.56  ? 266  GLU A CA  1 
ATOM   1562 C  C   . GLU A 1 287  ? 128.219 120.841 42.623  1.00 92.56  ? 266  GLU A C   1 
ATOM   1563 O  O   . GLU A 1 287  ? 127.756 120.619 41.497  1.00 92.56  ? 266  GLU A O   1 
ATOM   1564 C  CB  . GLU A 1 287  ? 128.593 123.140 43.566  1.00 92.56  ? 266  GLU A CB  1 
ATOM   1565 C  CG  . GLU A 1 287  ? 128.815 123.844 42.240  1.00 92.56  ? 266  GLU A CG  1 
ATOM   1566 C  CD  . GLU A 1 287  ? 127.598 124.624 41.767  1.00 92.56  ? 266  GLU A CD  1 
ATOM   1567 O  OE1 . GLU A 1 287  ? 126.788 125.051 42.617  1.00 92.56  ? 266  GLU A OE1 1 
ATOM   1568 O  OE2 . GLU A 1 287  ? 127.455 124.823 40.541  1.00 92.56  ? 266  GLU A OE2 1 
ATOM   1569 N  N   . GLU A 1 288  ? 129.197 120.097 43.145  1.00 99.35  ? 267  GLU A N   1 
ATOM   1570 C  CA  . GLU A 1 288  ? 129.762 118.943 42.453  1.00 99.35  ? 267  GLU A CA  1 
ATOM   1571 C  C   . GLU A 1 288  ? 128.851 117.723 42.476  1.00 99.35  ? 267  GLU A C   1 
ATOM   1572 O  O   . GLU A 1 288  ? 129.279 116.649 42.044  1.00 99.35  ? 267  GLU A O   1 
ATOM   1573 C  CB  . GLU A 1 288  ? 131.115 118.559 43.051  1.00 99.35  ? 267  GLU A CB  1 
ATOM   1574 C  CG  . GLU A 1 288  ? 132.222 119.565 42.808  1.00 99.35  ? 267  GLU A CG  1 
ATOM   1575 C  CD  . GLU A 1 288  ? 133.565 119.133 43.389  1.00 99.35  ? 267  GLU A CD  1 
ATOM   1576 O  OE1 . GLU A 1 288  ? 133.625 118.067 44.036  1.00 99.35  ? 267  GLU A OE1 1 
ATOM   1577 O  OE2 . GLU A 1 288  ? 134.560 119.869 43.211  1.00 99.35  ? 267  GLU A OE2 1 
ATOM   1578 N  N   . LEU A 1 289  ? 127.638 117.840 43.010  1.00 92.05  ? 268  LEU A N   1 
ATOM   1579 C  CA  . LEU A 1 289  ? 126.564 116.919 42.693  1.00 92.05  ? 268  LEU A CA  1 
ATOM   1580 C  C   . LEU A 1 289  ? 125.475 117.573 41.862  1.00 92.05  ? 268  LEU A C   1 
ATOM   1581 O  O   . LEU A 1 289  ? 124.543 116.884 41.437  1.00 92.05  ? 268  LEU A O   1 
ATOM   1582 C  CB  . LEU A 1 289  ? 125.963 116.326 43.972  1.00 92.05  ? 268  LEU A CB  1 
ATOM   1583 C  CG  . LEU A 1 289  ? 126.591 115.011 44.464  1.00 92.05  ? 268  LEU A CG  1 
ATOM   1584 C  CD1 . LEU A 1 289  ? 126.365 113.928 43.450  1.00 92.05  ? 268  LEU A CD1 1 
ATOM   1585 C  CD2 . LEU A 1 289  ? 128.088 115.071 44.791  1.00 92.05  ? 268  LEU A CD2 1 
ATOM   1586 N  N   . LYS A 1 290  ? 125.568 118.876 41.627  1.00 106.01 ? 269  LYS A N   1 
ATOM   1587 C  CA  . LYS A 1 290  ? 124.740 119.555 40.645  1.00 106.01 ? 269  LYS A CA  1 
ATOM   1588 C  C   . LYS A 1 290  ? 125.372 119.500 39.261  1.00 106.01 ? 269  LYS A C   1 
ATOM   1589 O  O   . LYS A 1 290  ? 124.688 119.758 38.262  1.00 106.01 ? 269  LYS A O   1 
ATOM   1590 C  CB  . LYS A 1 290  ? 124.508 121.007 41.082  1.00 106.01 ? 269  LYS A CB  1 
ATOM   1591 C  CG  . LYS A 1 290  ? 123.388 121.753 40.379  1.00 106.01 ? 269  LYS A CG  1 
ATOM   1592 C  CD  . LYS A 1 290  ? 123.364 123.190 40.819  1.00 106.01 ? 269  LYS A CD  1 
ATOM   1593 C  CE  . LYS A 1 290  ? 122.891 123.303 42.247  1.00 106.01 ? 269  LYS A CE  1 
ATOM   1594 N  NZ  . LYS A 1 290  ? 122.786 124.726 42.652  1.00 106.01 ? 269  LYS A NZ  1 
ATOM   1595 N  N   . LYS A 1 291  ? 126.661 119.154 39.186  1.00 116.25 ? 270  LYS A N   1 
ATOM   1596 C  CA  . LYS A 1 291  ? 127.280 118.822 37.906  1.00 116.25 ? 270  LYS A CA  1 
ATOM   1597 C  C   . LYS A 1 291  ? 126.607 117.609 37.272  1.00 116.25 ? 270  LYS A C   1 
ATOM   1598 O  O   . LYS A 1 291  ? 126.371 117.580 36.059  1.00 116.25 ? 270  LYS A O   1 
ATOM   1599 C  CB  . LYS A 1 291  ? 128.778 118.583 38.115  1.00 116.25 ? 270  LYS A CB  1 
ATOM   1600 C  CG  . LYS A 1 291  ? 129.589 118.207 36.881  1.00 116.25 ? 270  LYS A CG  1 
ATOM   1601 C  CD  . LYS A 1 291  ? 129.890 116.714 36.823  1.00 116.25 ? 270  LYS A CD  1 
ATOM   1602 C  CE  . LYS A 1 291  ? 130.859 116.309 37.918  1.00 116.25 ? 270  LYS A CE  1 
ATOM   1603 N  NZ  . LYS A 1 291  ? 131.149 114.850 37.884  1.00 116.25 ? 270  LYS A NZ  1 
ATOM   1604 N  N   . ILE A 1 292  ? 126.280 116.607 38.081  1.00 102.55 ? 271  ILE A N   1 
ATOM   1605 C  CA  . ILE A 1 292  ? 125.500 115.454 37.650  1.00 102.55 ? 271  ILE A CA  1 
ATOM   1606 C  C   . ILE A 1 292  ? 124.049 115.934 37.690  1.00 102.55 ? 271  ILE A C   1 
ATOM   1607 O  O   . ILE A 1 292  ? 123.759 116.989 38.262  1.00 102.55 ? 271  ILE A O   1 
ATOM   1608 C  CB  . ILE A 1 292  ? 125.781 114.224 38.546  1.00 102.55 ? 271  ILE A CB  1 
ATOM   1609 C  CG1 . ILE A 1 292  ? 127.287 113.974 38.686  1.00 102.55 ? 271  ILE A CG1 1 
ATOM   1610 C  CG2 . ILE A 1 292  ? 125.276 112.917 37.938  1.00 102.55 ? 271  ILE A CG2 1 
ATOM   1611 C  CD1 . ILE A 1 292  ? 127.920 114.464 39.974  1.00 102.55 ? 271  ILE A CD1 1 
ATOM   1612 N  N   . ASN A 1 293  ? 123.115 115.171 37.120  1.00 116.33 ? 272  ASN A N   1 
ATOM   1613 C  CA  . ASN A 1 293  ? 121.783 115.646 36.760  1.00 116.33 ? 272  ASN A CA  1 
ATOM   1614 C  C   . ASN A 1 293  ? 120.824 115.796 37.947  1.00 116.33 ? 272  ASN A C   1 
ATOM   1615 O  O   . ASN A 1 293  ? 119.608 115.772 37.729  1.00 116.33 ? 272  ASN A O   1 
ATOM   1616 C  CB  . ASN A 1 293  ? 121.155 114.706 35.727  1.00 116.33 ? 272  ASN A CB  1 
ATOM   1617 C  CG  . ASN A 1 293  ? 121.910 114.689 34.415  1.00 116.33 ? 272  ASN A CG  1 
ATOM   1618 O  OD1 . ASN A 1 293  ? 122.461 113.660 34.015  1.00 116.33 ? 272  ASN A OD1 1 
ATOM   1619 N  ND2 . ASN A 1 293  ? 121.941 115.831 33.733  1.00 116.33 ? 272  ASN A ND2 1 
ATOM   1620 N  N   . TYR A 1 294  ? 121.311 115.933 39.175  1.00 117.83 ? 273  TYR A N   1 
ATOM   1621 C  CA  . TYR A 1 294  ? 120.431 115.924 40.335  1.00 117.83 ? 273  TYR A CA  1 
ATOM   1622 C  C   . TYR A 1 294  ? 119.844 117.319 40.536  1.00 117.83 ? 273  TYR A C   1 
ATOM   1623 O  O   . TYR A 1 294  ? 120.492 118.330 40.257  1.00 117.83 ? 273  TYR A O   1 
ATOM   1624 C  CB  . TYR A 1 294  ? 121.189 115.464 41.582  1.00 117.83 ? 273  TYR A CB  1 
ATOM   1625 C  CG  . TYR A 1 294  ? 121.791 114.061 41.497  1.00 117.83 ? 273  TYR A CG  1 
ATOM   1626 C  CD1 . TYR A 1 294  ? 121.360 113.135 40.547  1.00 117.83 ? 273  TYR A CD1 1 
ATOM   1627 C  CD2 . TYR A 1 294  ? 122.811 113.671 42.359  1.00 117.83 ? 273  TYR A CD2 1 
ATOM   1628 C  CE1 . TYR A 1 294  ? 121.924 111.887 40.457  1.00 117.83 ? 273  TYR A CE1 1 
ATOM   1629 C  CE2 . TYR A 1 294  ? 123.369 112.408 42.280  1.00 117.83 ? 273  TYR A CE2 1 
ATOM   1630 C  CZ  . TYR A 1 294  ? 122.921 111.529 41.330  1.00 117.83 ? 273  TYR A CZ  1 
ATOM   1631 O  OH  . TYR A 1 294  ? 123.473 110.276 41.241  1.00 117.83 ? 273  TYR A OH  1 
ATOM   1632 N  N   . GLN A 1 295  ? 118.691 117.409 41.193  1.00 105.11 ? 274  GLN A N   1 
ATOM   1633 C  CA  . GLN A 1 295  ? 118.084 118.724 41.410  1.00 105.11 ? 274  GLN A CA  1 
ATOM   1634 C  C   . GLN A 1 295  ? 117.762 119.009 42.877  1.00 105.11 ? 274  GLN A C   1 
ATOM   1635 O  O   . GLN A 1 295  ? 116.601 119.018 43.278  1.00 105.11 ? 274  GLN A O   1 
ATOM   1636 C  CB  . GLN A 1 295  ? 116.808 118.849 40.577  1.00 105.11 ? 274  GLN A CB  1 
ATOM   1637 C  CG  . GLN A 1 295  ? 116.073 120.164 40.761  1.00 105.11 ? 274  GLN A CG  1 
ATOM   1638 C  CD  . GLN A 1 295  ? 116.978 121.360 40.562  1.00 105.11 ? 274  GLN A CD  1 
ATOM   1639 O  OE1 . GLN A 1 295  ? 116.836 122.108 39.596  1.00 105.11 ? 274  GLN A OE1 1 
ATOM   1640 N  NE2 . GLN A 1 295  ? 117.921 121.543 41.476  1.00 105.11 ? 274  GLN A NE2 1 
ATOM   1641 N  N   . VAL A 1 296  ? 118.834 119.135 43.654  1.00 89.75  ? 275  VAL A N   1 
ATOM   1642 C  CA  . VAL A 1 296  ? 118.765 119.415 45.073  1.00 89.75  ? 275  VAL A CA  1 
ATOM   1643 C  C   . VAL A 1 296  ? 118.735 120.911 45.320  1.00 89.75  ? 275  VAL A C   1 
ATOM   1644 O  O   . VAL A 1 296  ? 119.614 121.454 45.981  1.00 89.75  ? 275  VAL A O   1 
ATOM   1645 C  CB  . VAL A 1 296  ? 120.003 118.850 45.783  1.00 89.75  ? 275  VAL A CB  1 
ATOM   1646 C  CG1 . VAL A 1 296  ? 119.881 117.343 45.938  1.00 89.75  ? 275  VAL A CG1 1 
ATOM   1647 C  CG2 . VAL A 1 296  ? 121.256 119.202 44.998  1.00 89.75  ? 275  VAL A CG2 1 
ATOM   1648 N  N   . ASP A 1 297  ? 117.730 121.581 44.777  1.00 90.53  ? 276  ASP A N   1 
ATOM   1649 C  CA  . ASP A 1 297  ? 117.594 123.013 44.977  1.00 90.53  ? 276  ASP A CA  1 
ATOM   1650 C  C   . ASP A 1 297  ? 117.308 123.342 46.434  1.00 90.53  ? 276  ASP A C   1 
ATOM   1651 O  O   . ASP A 1 297  ? 117.830 124.311 46.976  1.00 90.53  ? 276  ASP A O   1 
ATOM   1652 C  CB  . ASP A 1 297  ? 116.497 123.584 44.083  1.00 90.53  ? 276  ASP A CB  1 
ATOM   1653 C  CG  . ASP A 1 297  ? 116.511 125.094 44.049  1.00 90.53  ? 276  ASP A CG  1 
ATOM   1654 O  OD1 . ASP A 1 297  ? 116.655 125.701 45.129  1.00 90.53  ? 276  ASP A OD1 1 
ATOM   1655 O  OD2 . ASP A 1 297  ? 116.383 125.671 42.948  1.00 90.53  ? 276  ASP A OD2 1 
ATOM   1656 N  N   . SER A 1 298  ? 116.472 122.522 47.061  1.00 74.52  ? 277  SER A N   1 
ATOM   1657 C  CA  . SER A 1 298  ? 116.067 122.741 48.445  1.00 74.52  ? 277  SER A CA  1 
ATOM   1658 C  C   . SER A 1 298  ? 117.191 122.686 49.469  1.00 74.52  ? 277  SER A C   1 
ATOM   1659 O  O   . SER A 1 298  ? 117.249 123.513 50.376  1.00 74.52  ? 277  SER A O   1 
ATOM   1660 C  CB  . SER A 1 298  ? 114.986 121.740 48.840  1.00 74.52  ? 277  SER A CB  1 
ATOM   1661 O  OG  . SER A 1 298  ? 114.814 121.726 50.244  1.00 74.52  ? 277  SER A OG  1 
ATOM   1662 N  N   . TRP A 1 299  ? 118.088 121.721 49.319  1.00 27.28  ? 278  TRP A N   1 
ATOM   1663 C  CA  . TRP A 1 299  ? 119.189 121.564 50.246  1.00 26.93  ? 278  TRP A CA  1 
ATOM   1664 C  C   . TRP A 1 299  ? 120.118 122.755 50.165  1.00 27.44  ? 278  TRP A C   1 
ATOM   1665 O  O   . TRP A 1 299  ? 120.647 123.206 51.181  1.00 28.17  ? 278  TRP A O   1 
ATOM   1666 C  CB  . TRP A 1 299  ? 119.915 120.270 49.931  1.00 103.10 ? 278  TRP A CB  1 
ATOM   1667 C  CG  . TRP A 1 299  ? 119.021 119.129 50.150  1.00 103.10 ? 278  TRP A CG  1 
ATOM   1668 C  CD1 . TRP A 1 299  ? 118.198 118.551 49.239  1.00 103.10 ? 278  TRP A CD1 1 
ATOM   1669 C  CD2 . TRP A 1 299  ? 118.837 118.420 51.369  1.00 103.10 ? 278  TRP A CD2 1 
ATOM   1670 N  NE1 . TRP A 1 299  ? 117.504 117.531 49.817  1.00 103.10 ? 278  TRP A NE1 1 
ATOM   1671 C  CE2 . TRP A 1 299  ? 117.888 117.420 51.125  1.00 103.10 ? 278  TRP A CE2 1 
ATOM   1672 C  CE3 . TRP A 1 299  ? 119.383 118.533 52.645  1.00 103.10 ? 278  TRP A CE3 1 
ATOM   1673 C  CZ2 . TRP A 1 299  ? 117.478 116.535 52.104  1.00 103.10 ? 278  TRP A CZ2 1 
ATOM   1674 C  CZ3 . TRP A 1 299  ? 118.978 117.654 53.616  1.00 103.10 ? 278  TRP A CZ3 1 
ATOM   1675 C  CH2 . TRP A 1 299  ? 118.031 116.667 53.344  1.00 103.10 ? 278  TRP A CH2 1 
ATOM   1676 N  N   . GLU A 1 300  ? 120.314 123.281 48.960  1.00 28.01  ? 279  GLU A N   1 
ATOM   1677 C  CA  . GLU A 1 300  ? 121.063 124.518 48.803  1.00 29.19  ? 279  GLU A CA  1 
ATOM   1678 C  C   . GLU A 1 300  ? 120.310 125.686 49.420  1.00 30.59  ? 279  GLU A C   1 
ATOM   1679 O  O   . GLU A 1 300  ? 120.923 126.582 50.019  1.00 31.16  ? 279  GLU A O   1 
ATOM   1680 C  CB  . GLU A 1 300  ? 121.329 124.763 47.324  1.00 118.49 ? 279  GLU A CB  1 
ATOM   1681 C  CG  . GLU A 1 300  ? 122.139 125.991 47.021  1.00 118.49 ? 279  GLU A CG  1 
ATOM   1682 C  CD  . GLU A 1 300  ? 122.323 126.180 45.534  1.00 118.49 ? 279  GLU A CD  1 
ATOM   1683 O  OE1 . GLU A 1 300  ? 121.812 125.337 44.770  1.00 118.49 ? 279  GLU A OE1 1 
ATOM   1684 O  OE2 . GLU A 1 300  ? 122.964 127.170 45.125  1.00 118.49 ? 279  GLU A OE2 1 
ATOM   1685 N  N   . GLU A 1 301  ? 118.977 125.678 49.297  1.00 31.73  ? 280  GLU A N   1 
ATOM   1686 C  CA  . GLU A 1 301  ? 118.162 126.648 50.019  1.00 32.76  ? 280  GLU A CA  1 
ATOM   1687 C  C   . GLU A 1 301  ? 118.323 126.506 51.528  1.00 33.37  ? 280  GLU A C   1 
ATOM   1688 O  O   . GLU A 1 301  ? 118.322 127.509 52.252  1.00 32.74  ? 280  GLU A O   1 
ATOM   1689 C  CB  . GLU A 1 301  ? 116.697 126.484 49.624  1.00 111.43 ? 280  GLU A CB  1 
ATOM   1690 C  CG  . GLU A 1 301  ? 115.779 127.523 50.225  1.00 111.43 ? 280  GLU A CG  1 
ATOM   1691 C  CD  . GLU A 1 301  ? 114.338 127.343 49.810  1.00 111.43 ? 280  GLU A CD  1 
ATOM   1692 O  OE1 . GLU A 1 301  ? 114.049 126.388 49.063  1.00 111.43 ? 280  GLU A OE1 1 
ATOM   1693 O  OE2 . GLU A 1 301  ? 113.490 128.156 50.236  1.00 111.43 ? 280  GLU A OE2 1 
ATOM   1694 N  N   . MET A 1 302  ? 118.506 125.278 52.017  1.00 85.99  ? 281  MET A N   1 
ATOM   1695 C  CA  . MET A 1 302  ? 118.637 125.065 53.454  1.00 89.46  ? 281  MET A CA  1 
ATOM   1696 C  C   . MET A 1 302  ? 120.008 125.494 53.960  1.00 92.87  ? 281  MET A C   1 
ATOM   1697 O  O   . MET A 1 302  ? 120.110 126.106 55.028  1.00 92.62  ? 281  MET A O   1 
ATOM   1698 C  CB  . MET A 1 302  ? 118.380 123.597 53.796  1.00 111.92 ? 281  MET A CB  1 
ATOM   1699 C  CG  . MET A 1 302  ? 118.312 123.321 55.284  1.00 111.92 ? 281  MET A CG  1 
ATOM   1700 S  SD  . MET A 1 302  ? 117.980 121.601 55.683  1.00 111.92 ? 281  MET A SD  1 
ATOM   1701 C  CE  . MET A 1 302  ? 119.576 120.882 55.383  1.00 111.92 ? 281  MET A CE  1 
ATOM   1702 N  N   . LEU A 1 303  ? 121.067 125.190 53.207  1.00 91.84  ? 282  LEU A N   1 
ATOM   1703 C  CA  . LEU A 1 303  ? 122.405 125.564 53.644  1.00 97.16  ? 282  LEU A CA  1 
ATOM   1704 C  C   . LEU A 1 303  ? 122.629 127.059 53.507  1.00 95.56  ? 282  LEU A C   1 
ATOM   1705 O  O   . LEU A 1 303  ? 123.435 127.630 54.246  1.00 91.64  ? 282  LEU A O   1 
ATOM   1706 C  CB  . LEU A 1 303  ? 123.472 124.812 52.855  1.00 106.79 ? 282  LEU A CB  1 
ATOM   1707 C  CG  . LEU A 1 303  ? 123.458 123.283 52.846  1.00 106.79 ? 282  LEU A CG  1 
ATOM   1708 C  CD1 . LEU A 1 303  ? 124.683 122.731 52.128  1.00 106.79 ? 282  LEU A CD1 1 
ATOM   1709 C  CD2 . LEU A 1 303  ? 123.288 122.676 54.208  1.00 106.79 ? 282  LEU A CD2 1 
ATOM   1710 N  N   . ASN A 1 304  ? 121.936 127.711 52.579  1.00 87.10  ? 283  ASN A N   1 
ATOM   1711 C  CA  . ASN A 1 304  ? 121.980 129.166 52.577  1.00 92.93  ? 283  ASN A CA  1 
ATOM   1712 C  C   . ASN A 1 304  ? 121.102 129.756 53.674  1.00 96.44  ? 283  ASN A C   1 
ATOM   1713 O  O   . ASN A 1 304  ? 121.420 130.821 54.210  1.00 96.86  ? 283  ASN A O   1 
ATOM   1714 C  CB  . ASN A 1 304  ? 121.558 129.702 51.211  1.00 113.92 ? 283  ASN A CB  1 
ATOM   1715 C  CG  . ASN A 1 304  ? 122.588 129.434 50.142  1.00 113.92 ? 283  ASN A CG  1 
ATOM   1716 O  OD1 . ASN A 1 304  ? 123.785 129.610 50.361  1.00 113.92 ? 283  ASN A OD1 1 
ATOM   1717 N  ND2 . ASN A 1 304  ? 122.132 128.993 48.979  1.00 113.92 ? 283  ASN A ND2 1 
ATOM   1718 N  N   . LYS A 1 305  ? 120.005 129.078 54.021  1.00 73.52  ? 284  LYS A N   1 
ATOM   1719 C  CA  . LYS A 1 305  ? 119.093 129.589 55.039  1.00 73.52  ? 284  LYS A CA  1 
ATOM   1720 C  C   . LYS A 1 305  ? 119.703 129.464 56.427  1.00 73.52  ? 284  LYS A C   1 
ATOM   1721 O  O   . LYS A 1 305  ? 119.977 130.467 57.093  1.00 73.52  ? 284  LYS A O   1 
ATOM   1722 C  CB  . LYS A 1 305  ? 117.767 128.830 54.965  1.00 73.52  ? 284  LYS A CB  1 
ATOM   1723 C  CG  . LYS A 1 305  ? 116.735 129.254 55.993  1.00 73.52  ? 284  LYS A CG  1 
ATOM   1724 C  CD  . LYS A 1 305  ? 116.270 130.680 55.769  1.00 73.52  ? 284  LYS A CD  1 
ATOM   1725 C  CE  . LYS A 1 305  ? 115.433 130.798 54.511  1.00 73.52  ? 284  LYS A CE  1 
ATOM   1726 N  NZ  . LYS A 1 305  ? 114.962 132.194 54.317  1.00 73.52  ? 284  LYS A NZ  1 
ATOM   1727 N  N   . ALA A 1 306  ? 119.925 128.231 56.872  1.00 142.34 ? 285  ALA A N   1 
ATOM   1728 C  CA  . ALA A 1 306  ? 120.712 127.948 58.067  1.00 143.97 ? 285  ALA A CA  1 
ATOM   1729 C  C   . ALA A 1 306  ? 122.166 128.060 57.656  1.00 145.60 ? 285  ALA A C   1 
ATOM   1730 O  O   . ALA A 1 306  ? 122.739 127.119 57.108  1.00 145.52 ? 285  ALA A O   1 
ATOM   1731 C  CB  . ALA A 1 306  ? 120.397 126.565 58.619  1.00 124.48 ? 285  ALA A CB  1 
ATOM   1732 N  N   . GLU A 1 307  ? 122.769 129.211 57.927  1.00 63.37  ? 286  GLU A N   1 
ATOM   1733 C  CA  . GLU A 1 307  ? 123.975 129.644 57.230  1.00 63.37  ? 286  GLU A CA  1 
ATOM   1734 C  C   . GLU A 1 307  ? 125.179 128.838 57.706  1.00 63.37  ? 286  GLU A C   1 
ATOM   1735 O  O   . GLU A 1 307  ? 125.999 129.289 58.506  1.00 63.37  ? 286  GLU A O   1 
ATOM   1736 C  CB  . GLU A 1 307  ? 124.174 131.135 57.446  1.00 63.37  ? 286  GLU A CB  1 
ATOM   1737 C  CG  . GLU A 1 307  ? 125.229 131.766 56.578  1.00 63.37  ? 286  GLU A CG  1 
ATOM   1738 C  CD  . GLU A 1 307  ? 125.303 133.252 56.785  1.00 63.37  ? 286  GLU A CD  1 
ATOM   1739 O  OE1 . GLU A 1 307  ? 124.523 133.771 57.610  1.00 63.37  ? 286  GLU A OE1 1 
ATOM   1740 O  OE2 . GLU A 1 307  ? 126.141 133.901 56.127  1.00 63.37  ? 286  GLU A OE2 1 
ATOM   1741 N  N   . VAL A 1 308  ? 125.271 127.599 57.222  1.00 169.61 ? 287  VAL A N   1 
ATOM   1742 C  CA  . VAL A 1 308  ? 126.519 126.862 57.366  1.00 165.91 ? 287  VAL A CA  1 
ATOM   1743 C  C   . VAL A 1 308  ? 127.591 127.479 56.481  1.00 164.13 ? 287  VAL A C   1 
ATOM   1744 O  O   . VAL A 1 308  ? 128.598 127.987 56.982  1.00 162.56 ? 287  VAL A O   1 
ATOM   1745 C  CB  . VAL A 1 308  ? 126.322 125.362 57.094  1.00 116.14 ? 287  VAL A CB  1 
ATOM   1746 C  CG1 . VAL A 1 308  ? 125.776 124.706 58.314  1.00 116.14 ? 287  VAL A CG1 1 
ATOM   1747 C  CG2 . VAL A 1 308  ? 125.309 125.148 56.032  1.00 116.14 ? 287  VAL A CG2 1 
ATOM   1748 N  N   . GLY A 1 309  ? 127.369 127.496 55.166  1.00 135.48 ? 288  GLY A N   1 
ATOM   1749 C  CA  . GLY A 1 309  ? 128.203 128.266 54.272  1.00 134.20 ? 288  GLY A CA  1 
ATOM   1750 C  C   . GLY A 1 309  ? 129.633 127.790 54.161  1.00 130.94 ? 288  GLY A C   1 
ATOM   1751 O  O   . GLY A 1 309  ? 130.499 128.428 54.771  1.00 130.67 ? 288  GLY A O   1 
ATOM   1752 N  N   . HIS A 1 310  ? 129.870 126.656 53.480  1.00 85.24  ? 289  HIS A N   1 
ATOM   1753 C  CA  . HIS A 1 310  ? 131.197 126.147 53.129  1.00 83.21  ? 289  HIS A CA  1 
ATOM   1754 C  C   . HIS A 1 310  ? 131.933 125.774 54.418  1.00 80.15  ? 289  HIS A C   1 
ATOM   1755 O  O   . HIS A 1 310  ? 132.934 126.401 54.777  1.00 78.47  ? 289  HIS A O   1 
ATOM   1756 C  CB  . HIS A 1 310  ? 131.943 127.211 52.298  1.00 116.23 ? 289  HIS A CB  1 
ATOM   1757 C  CG  . HIS A 1 310  ? 132.897 126.673 51.282  1.00 116.23 ? 289  HIS A CG  1 
ATOM   1758 N  ND1 . HIS A 1 310  ? 133.880 127.452 50.712  1.00 116.23 ? 289  HIS A ND1 1 
ATOM   1759 C  CD2 . HIS A 1 310  ? 132.962 125.475 50.663  1.00 116.23 ? 289  HIS A CD2 1 
ATOM   1760 C  CE1 . HIS A 1 310  ? 134.544 126.737 49.823  1.00 116.23 ? 289  HIS A CE1 1 
ATOM   1761 N  NE2 . HIS A 1 310  ? 134.010 125.531 49.778  1.00 116.23 ? 289  HIS A NE2 1 
ATOM   1762 N  N   . GLY A 1 311  ? 131.417 124.760 55.122  1.00 47.67  ? 290  GLY A N   1 
ATOM   1763 C  CA  . GLY A 1 311  ? 131.470 124.651 56.574  1.00 45.59  ? 290  GLY A CA  1 
ATOM   1764 C  C   . GLY A 1 311  ? 132.758 124.684 57.375  1.00 43.25  ? 290  GLY A C   1 
ATOM   1765 O  O   . GLY A 1 311  ? 133.029 125.699 58.016  1.00 42.92  ? 290  GLY A O   1 
ATOM   1766 N  N   . TYR A 1 312  ? 133.565 123.624 57.370  1.00 33.33  ? 291  TYR A N   1 
ATOM   1767 C  CA  . TYR A 1 312  ? 134.795 123.622 58.159  1.00 31.68  ? 291  TYR A CA  1 
ATOM   1768 C  C   . TYR A 1 312  ? 136.061 123.843 57.345  1.00 30.51  ? 291  TYR A C   1 
ATOM   1769 O  O   . TYR A 1 312  ? 137.131 123.980 57.938  1.00 29.45  ? 291  TYR A O   1 
ATOM   1770 C  CB  . TYR A 1 312  ? 134.973 122.313 58.942  1.00 97.92  ? 291  TYR A CB  1 
ATOM   1771 C  CG  . TYR A 1 312  ? 134.351 122.251 60.319  1.00 97.92  ? 291  TYR A CG  1 
ATOM   1772 C  CD1 . TYR A 1 312  ? 134.927 122.924 61.387  1.00 97.92  ? 291  TYR A CD1 1 
ATOM   1773 C  CD2 . TYR A 1 312  ? 133.251 121.458 60.576  1.00 97.92  ? 291  TYR A CD2 1 
ATOM   1774 C  CE1 . TYR A 1 312  ? 134.387 122.854 62.652  1.00 97.92  ? 291  TYR A CE1 1 
ATOM   1775 C  CE2 . TYR A 1 312  ? 132.711 121.379 61.841  1.00 97.92  ? 291  TYR A CE2 1 
ATOM   1776 C  CZ  . TYR A 1 312  ? 133.282 122.078 62.870  1.00 97.92  ? 291  TYR A CZ  1 
ATOM   1777 O  OH  . TYR A 1 312  ? 132.731 121.998 64.121  1.00 97.92  ? 291  TYR A OH  1 
ATOM   1778 N  N   . MET A 1 313  ? 135.985 123.882 56.023  1.00 63.22  ? 292  MET A N   1 
ATOM   1779 C  CA  . MET A 1 313  ? 137.196 124.095 55.249  1.00 63.22  ? 292  MET A CA  1 
ATOM   1780 C  C   . MET A 1 313  ? 137.647 125.548 55.232  1.00 63.22  ? 292  MET A C   1 
ATOM   1781 O  O   . MET A 1 313  ? 138.709 125.836 54.676  1.00 63.22  ? 292  MET A O   1 
ATOM   1782 C  CB  . MET A 1 313  ? 136.987 123.636 53.820  1.00 63.22  ? 292  MET A CB  1 
ATOM   1783 C  CG  . MET A 1 313  ? 136.611 122.188 53.689  1.00 63.22  ? 292  MET A CG  1 
ATOM   1784 S  SD  . MET A 1 313  ? 137.776 120.991 54.352  1.00 63.22  ? 292  MET A SD  1 
ATOM   1785 C  CE  . MET A 1 313  ? 136.869 120.433 55.784  1.00 63.22  ? 292  MET A CE  1 
ATOM   1786 N  N   . ASP A 1 314  ? 136.868 126.467 55.801  1.00 68.10  ? 293  ASP A N   1 
ATOM   1787 C  CA  . ASP A 1 314  ? 137.217 127.878 55.852  1.00 68.10  ? 293  ASP A CA  1 
ATOM   1788 C  C   . ASP A 1 314  ? 137.804 128.297 57.184  1.00 68.10  ? 293  ASP A C   1 
ATOM   1789 O  O   . ASP A 1 314  ? 138.214 129.451 57.326  1.00 68.10  ? 293  ASP A O   1 
ATOM   1790 C  CB  . ASP A 1 314  ? 135.984 128.732 55.568  1.00 68.10  ? 293  ASP A CB  1 
ATOM   1791 C  CG  . ASP A 1 314  ? 135.516 128.607 54.151  1.00 68.10  ? 293  ASP A CG  1 
ATOM   1792 O  OD1 . ASP A 1 314  ? 136.358 128.320 53.281  1.00 68.10  ? 293  ASP A OD1 1 
ATOM   1793 O  OD2 . ASP A 1 314  ? 134.313 128.809 53.903  1.00 68.10  ? 293  ASP A OD2 1 
ATOM   1794 N  N   . ARG A 1 315  ? 137.844 127.423 58.141  1.00 62.07  ? 294  ARG A N   1 
ATOM   1795 C  CA  . ARG A 1 315  ? 138.330 127.811 59.448  1.00 62.07  ? 294  ARG A CA  1 
ATOM   1796 C  C   . ARG A 1 315  ? 139.853 127.704 59.512  1.00 62.07  ? 294  ARG A C   1 
ATOM   1797 O  O   . ARG A 1 315  ? 140.456 126.972 58.725  1.00 62.07  ? 294  ARG A O   1 
ATOM   1798 C  CB  . ARG A 1 315  ? 137.678 126.942 60.512  1.00 62.07  ? 294  ARG A CB  1 
ATOM   1799 C  CG  . ARG A 1 315  ? 136.223 127.301 60.709  1.00 62.07  ? 294  ARG A CG  1 
ATOM   1800 C  CD  . ARG A 1 315  ? 135.551 126.444 61.746  1.00 62.07  ? 294  ARG A CD  1 
ATOM   1801 N  NE  . ARG A 1 315  ? 134.231 126.957 62.072  1.00 62.07  ? 294  ARG A NE  1 
ATOM   1802 C  CZ  . ARG A 1 315  ? 133.129 126.628 61.418  1.00 62.07  ? 294  ARG A CZ  1 
ATOM   1803 N  NH1 . ARG A 1 315  ? 133.195 125.787 60.401  1.00 62.07  ? 294  ARG A NH1 1 
ATOM   1804 N  NH2 . ARG A 1 315  ? 131.964 127.138 61.775  1.00 62.07  ? 294  ARG A NH2 1 
ATOM   1805 N  N   . PRO A 1 316  ? 140.497 128.471 60.398  1.00 59.36  ? 295  PRO A N   1 
ATOM   1806 C  CA  . PRO A 1 316  ? 141.946 128.338 60.576  1.00 59.36  ? 295  PRO A CA  1 
ATOM   1807 C  C   . PRO A 1 316  ? 142.329 126.956 61.083  1.00 59.36  ? 295  PRO A C   1 
ATOM   1808 O  O   . PRO A 1 316  ? 141.573 126.311 61.810  1.00 59.36  ? 295  PRO A O   1 
ATOM   1809 C  CB  . PRO A 1 316  ? 142.273 129.426 61.598  1.00 59.36  ? 295  PRO A CB  1 
ATOM   1810 C  CG  . PRO A 1 316  ? 141.217 130.434 61.401  1.00 59.36  ? 295  PRO A CG  1 
ATOM   1811 C  CD  . PRO A 1 316  ? 139.982 129.673 61.077  1.00 59.36  ? 295  PRO A CD  1 
ATOM   1812 N  N   . CYS A 1 317  ? 143.516 126.503 60.676  1.00 62.37  ? 296  CYS A N   1 
ATOM   1813 C  CA  . CYS A 1 317  ? 143.871 125.092 60.795  1.00 62.37  ? 296  CYS A CA  1 
ATOM   1814 C  C   . CYS A 1 317  ? 144.354 124.723 62.194  1.00 62.37  ? 296  CYS A C   1 
ATOM   1815 O  O   . CYS A 1 317  ? 144.275 123.549 62.572  1.00 62.37  ? 296  CYS A O   1 
ATOM   1816 C  CB  . CYS A 1 317  ? 144.935 124.745 59.748  1.00 62.37  ? 296  CYS A CB  1 
ATOM   1817 S  SG  . CYS A 1 317  ? 145.396 123.008 59.610  1.00 62.37  ? 296  CYS A SG  1 
ATOM   1818 N  N   . LEU A 1 318  ? 144.937 125.684 62.927  1.00 69.85  ? 297  LEU A N   1 
ATOM   1819 C  CA  . LEU A 1 318  ? 145.441 125.608 64.309  1.00 69.85  ? 297  LEU A CA  1 
ATOM   1820 C  C   . LEU A 1 318  ? 146.667 124.696 64.450  1.00 69.85  ? 297  LEU A C   1 
ATOM   1821 O  O   . LEU A 1 318  ? 147.344 124.706 65.485  1.00 69.85  ? 297  LEU A O   1 
ATOM   1822 C  CB  . LEU A 1 318  ? 144.316 125.208 65.285  1.00 69.85  ? 297  LEU A CB  1 
ATOM   1823 C  CG  . LEU A 1 318  ? 144.503 125.161 66.809  1.00 69.85  ? 297  LEU A CG  1 
ATOM   1824 C  CD1 . LEU A 1 318  ? 145.022 126.488 67.255  1.00 69.85  ? 297  LEU A CD1 1 
ATOM   1825 C  CD2 . LEU A 1 318  ? 143.224 124.837 67.534  1.00 69.85  ? 297  LEU A CD2 1 
ATOM   1826 N  N   . ASN A 1 319  ? 147.023 123.980 63.398  1.00 70.20  ? 298  ASN A N   1 
ATOM   1827 C  CA  . ASN A 1 319  ? 148.347 123.403 63.270  1.00 70.20  ? 298  ASN A CA  1 
ATOM   1828 C  C   . ASN A 1 319  ? 148.633 123.262 61.787  1.00 70.20  ? 298  ASN A C   1 
ATOM   1829 O  O   . ASN A 1 319  ? 148.231 122.265 61.179  1.00 70.20  ? 298  ASN A O   1 
ATOM   1830 C  CB  . ASN A 1 319  ? 148.457 122.052 63.966  1.00 70.20  ? 298  ASN A CB  1 
ATOM   1831 C  CG  . ASN A 1 319  ? 149.896 121.612 64.144  1.00 70.20  ? 298  ASN A CG  1 
ATOM   1832 O  OD1 . ASN A 1 319  ? 150.828 122.317 63.760  1.00 70.20  ? 298  ASN A OD1 1 
ATOM   1833 N  ND2 . ASN A 1 319  ? 150.085 120.445 64.738  1.00 70.20  ? 298  ASN A ND2 1 
ATOM   1834 N  N   . PRO A 1 320  ? 149.282 124.245 61.165  1.00 72.75  ? 299  PRO A N   1 
ATOM   1835 C  CA  . PRO A 1 320  ? 149.731 124.071 59.782  1.00 72.75  ? 299  PRO A CA  1 
ATOM   1836 C  C   . PRO A 1 320  ? 150.790 122.981 59.676  1.00 72.75  ? 299  PRO A C   1 
ATOM   1837 O  O   . PRO A 1 320  ? 151.454 122.627 60.654  1.00 72.75  ? 299  PRO A O   1 
ATOM   1838 C  CB  . PRO A 1 320  ? 150.293 125.449 59.419  1.00 72.75  ? 299  PRO A CB  1 
ATOM   1839 C  CG  . PRO A 1 320  ? 149.584 126.386 60.328  1.00 72.75  ? 299  PRO A CG  1 
ATOM   1840 C  CD  . PRO A 1 320  ? 149.437 125.637 61.614  1.00 72.75  ? 299  PRO A CD  1 
ATOM   1841 N  N   . ALA A 1 321  ? 150.925 122.457 58.451  1.00 64.10  ? 300  ALA A N   1 
ATOM   1842 C  CA  . ALA A 1 321  ? 151.646 121.215 58.147  1.00 64.10  ? 300  ALA A CA  1 
ATOM   1843 C  C   . ALA A 1 321  ? 151.135 120.054 58.996  1.00 64.10  ? 300  ALA A C   1 
ATOM   1844 O  O   . ALA A 1 321  ? 151.905 119.248 59.518  1.00 64.10  ? 300  ALA A O   1 
ATOM   1845 C  CB  . ALA A 1 321  ? 153.163 121.373 58.278  1.00 64.10  ? 300  ALA A CB  1 
ATOM   1846 N  N   . ASP A 1 322  ? 149.828 119.989 59.149  1.00 83.27  ? 301  ASP A N   1 
ATOM   1847 C  CA  . ASP A 1 322  ? 149.109 118.774 59.506  1.00 83.27  ? 301  ASP A CA  1 
ATOM   1848 C  C   . ASP A 1 322  ? 148.845 117.994 58.224  1.00 83.27  ? 301  ASP A C   1 
ATOM   1849 O  O   . ASP A 1 322  ? 148.258 118.548 57.289  1.00 83.27  ? 301  ASP A O   1 
ATOM   1850 C  CB  . ASP A 1 322  ? 147.789 119.124 60.188  1.00 83.27  ? 301  ASP A CB  1 
ATOM   1851 C  CG  . ASP A 1 322  ? 147.142 117.949 60.917  1.00 83.27  ? 301  ASP A CG  1 
ATOM   1852 O  OD1 . ASP A 1 322  ? 147.713 116.852 60.956  1.00 83.27  ? 301  ASP A OD1 1 
ATOM   1853 O  OD2 . ASP A 1 322  ? 146.034 118.127 61.464  1.00 83.27  ? 301  ASP A OD2 1 
ATOM   1854 N  N   . PRO A 1 323  ? 149.257 116.721 58.117  1.00 87.34  ? 302  PRO A N   1 
ATOM   1855 C  CA  . PRO A 1 323  ? 149.026 115.961 56.873  1.00 87.34  ? 302  PRO A CA  1 
ATOM   1856 C  C   . PRO A 1 323  ? 147.569 115.648 56.555  1.00 87.34  ? 302  PRO A C   1 
ATOM   1857 O  O   . PRO A 1 323  ? 147.318 114.922 55.587  1.00 87.34  ? 302  PRO A O   1 
ATOM   1858 C  CB  . PRO A 1 323  ? 149.817 114.666 57.103  1.00 87.34  ? 302  PRO A CB  1 
ATOM   1859 C  CG  . PRO A 1 323  ? 149.967 114.560 58.571  1.00 87.34  ? 302  PRO A CG  1 
ATOM   1860 C  CD  . PRO A 1 323  ? 150.115 115.971 59.049  1.00 87.34  ? 302  PRO A CD  1 
ATOM   1861 N  N   . ASP A 1 324  ? 146.608 116.142 57.335  1.00 85.68  ? 303  ASP A N   1 
ATOM   1862 C  CA  . ASP A 1 324  ? 145.198 116.093 56.986  1.00 85.68  ? 303  ASP A CA  1 
ATOM   1863 C  C   . ASP A 1 324  ? 144.607 117.485 56.802  1.00 85.68  ? 303  ASP A C   1 
ATOM   1864 O  O   . ASP A 1 324  ? 143.423 117.593 56.463  1.00 85.68  ? 303  ASP A O   1 
ATOM   1865 C  CB  . ASP A 1 324  ? 144.424 115.336 58.063  1.00 85.68  ? 303  ASP A CB  1 
ATOM   1866 C  CG  . ASP A 1 324  ? 144.953 113.939 58.272  1.00 85.68  ? 303  ASP A CG  1 
ATOM   1867 O  OD1 . ASP A 1 324  ? 145.514 113.368 57.318  1.00 85.68  ? 303  ASP A OD1 1 
ATOM   1868 O  OD2 . ASP A 1 324  ? 144.816 113.414 59.393  1.00 85.68  ? 303  ASP A OD2 1 
ATOM   1869 N  N   . CYS A 1 325  ? 145.407 118.542 56.999  1.00 79.84  ? 304  CYS A N   1 
ATOM   1870 C  CA  . CYS A 1 325  ? 144.900 119.912 57.001  1.00 79.84  ? 304  CYS A CA  1 
ATOM   1871 C  C   . CYS A 1 325  ? 144.408 120.309 55.612  1.00 79.84  ? 304  CYS A C   1 
ATOM   1872 O  O   . CYS A 1 325  ? 145.012 119.922 54.608  1.00 79.84  ? 304  CYS A O   1 
ATOM   1873 C  CB  . CYS A 1 325  ? 145.988 120.885 57.466  1.00 79.84  ? 304  CYS A CB  1 
ATOM   1874 S  SG  . CYS A 1 325  ? 145.529 122.658 57.612  1.00 79.84  ? 304  CYS A SG  1 
ATOM   1875 N  N   . PRO A 1 326  ? 143.302 121.050 55.525  1.00 74.59  ? 305  PRO A N   1 
ATOM   1876 C  CA  . PRO A 1 326  ? 142.759 121.422 54.215  1.00 74.59  ? 305  PRO A CA  1 
ATOM   1877 C  C   . PRO A 1 326  ? 143.634 122.423 53.486  1.00 74.59  ? 305  PRO A C   1 
ATOM   1878 O  O   . PRO A 1 326  ? 144.123 123.391 54.069  1.00 74.59  ? 305  PRO A O   1 
ATOM   1879 C  CB  . PRO A 1 326  ? 141.403 122.042 54.563  1.00 74.59  ? 305  PRO A CB  1 
ATOM   1880 C  CG  . PRO A 1 326  ? 141.062 121.477 55.879  1.00 74.59  ? 305  PRO A CG  1 
ATOM   1881 C  CD  . PRO A 1 326  ? 142.345 121.334 56.604  1.00 74.59  ? 305  PRO A CD  1 
ATOM   1882 N  N   . ALA A 1 327  ? 143.812 122.191 52.189  1.00 81.69  ? 306  ALA A N   1 
ATOM   1883 C  CA  . ALA A 1 327  ? 144.477 123.175 51.354  1.00 81.69  ? 306  ALA A CA  1 
ATOM   1884 C  C   . ALA A 1 327  ? 143.557 124.315 50.955  1.00 81.69  ? 306  ALA A C   1 
ATOM   1885 O  O   . ALA A 1 327  ? 144.012 125.249 50.290  1.00 81.69  ? 306  ALA A O   1 
ATOM   1886 C  CB  . ALA A 1 327  ? 145.053 122.513 50.103  1.00 81.69  ? 306  ALA A CB  1 
ATOM   1887 N  N   . THR A 1 328  ? 142.281 124.260 51.325  1.00 88.77  ? 307  THR A N   1 
ATOM   1888 C  CA  . THR A 1 328  ? 141.397 125.408 51.214  1.00 88.77  ? 307  THR A CA  1 
ATOM   1889 C  C   . THR A 1 328  ? 141.234 126.141 52.535  1.00 88.77  ? 307  THR A C   1 
ATOM   1890 O  O   . THR A 1 328  ? 140.450 127.094 52.606  1.00 88.77  ? 307  THR A O   1 
ATOM   1891 C  CB  . THR A 1 328  ? 140.024 124.987 50.692  1.00 88.77  ? 307  THR A CB  1 
ATOM   1892 O  OG1 . THR A 1 328  ? 139.442 124.041 51.594  1.00 88.77  ? 307  THR A OG1 1 
ATOM   1893 C  CG2 . THR A 1 328  ? 140.148 124.367 49.316  1.00 88.77  ? 307  THR A CG2 1 
ATOM   1894 N  N   . ALA A 1 329  ? 141.938 125.710 53.581  1.00 90.48  ? 308  ALA A N   1 
ATOM   1895 C  CA  . ALA A 1 329  ? 141.998 126.477 54.813  1.00 90.48  ? 308  ALA A CA  1 
ATOM   1896 C  C   . ALA A 1 329  ? 142.766 127.773 54.570  1.00 90.48  ? 308  ALA A C   1 
ATOM   1897 O  O   . ALA A 1 329  ? 143.700 127.805 53.768  1.00 90.48  ? 308  ALA A O   1 
ATOM   1898 C  CB  . ALA A 1 329  ? 142.672 125.669 55.918  1.00 90.48  ? 308  ALA A CB  1 
ATOM   1899 N  N   . PRO A 1 330  ? 142.378 128.866 55.226  1.00 74.71  ? 309  PRO A N   1 
ATOM   1900 C  CA  . PRO A 1 330  ? 143.078 130.131 54.982  1.00 74.71  ? 309  PRO A CA  1 
ATOM   1901 C  C   . PRO A 1 330  ? 144.447 130.178 55.609  1.00 74.71  ? 309  PRO A C   1 
ATOM   1902 O  O   . PRO A 1 330  ? 145.294 130.952 55.155  1.00 74.71  ? 309  PRO A O   1 
ATOM   1903 C  CB  . PRO A 1 330  ? 142.145 131.172 55.608  1.00 74.71  ? 309  PRO A CB  1 
ATOM   1904 C  CG  . PRO A 1 330  ? 141.457 130.437 56.677  1.00 74.71  ? 309  PRO A CG  1 
ATOM   1905 C  CD  . PRO A 1 330  ? 141.274 129.034 56.182  1.00 74.71  ? 309  PRO A CD  1 
ATOM   1906 N  N   . ASN A 1 331  ? 144.698 129.359 56.614  1.00 72.99  ? 310  ASN A N   1 
ATOM   1907 C  CA  . ASN A 1 331  ? 145.902 129.457 57.415  1.00 72.99  ? 310  ASN A CA  1 
ATOM   1908 C  C   . ASN A 1 331  ? 147.013 128.544 56.911  1.00 72.99  ? 310  ASN A C   1 
ATOM   1909 O  O   . ASN A 1 331  ? 148.019 128.371 57.607  1.00 72.99  ? 310  ASN A O   1 
ATOM   1910 C  CB  . ASN A 1 331  ? 145.564 129.122 58.868  1.00 72.99  ? 310  ASN A CB  1 
ATOM   1911 C  CG  . ASN A 1 331  ? 146.423 129.864 59.857  1.00 72.99  ? 310  ASN A CG  1 
ATOM   1912 O  OD1 . ASN A 1 331  ? 146.139 129.869 61.051  1.00 72.99  ? 310  ASN A OD1 1 
ATOM   1913 N  ND2 . ASN A 1 331  ? 147.454 130.529 59.366  1.00 72.99  ? 310  ASN A ND2 1 
ATOM   1914 N  N   . LYS A 1 332  ? 146.853 127.949 55.731  1.00 80.41  ? 311  LYS A N   1 
ATOM   1915 C  CA  . LYS A 1 332  ? 147.860 127.027 55.227  1.00 80.41  ? 311  LYS A CA  1 
ATOM   1916 C  C   . LYS A 1 332  ? 149.085 127.802 54.759  1.00 80.41  ? 311  LYS A C   1 
ATOM   1917 O  O   . LYS A 1 332  ? 148.961 128.786 54.020  1.00 80.41  ? 311  LYS A O   1 
ATOM   1918 C  CB  . LYS A 1 332  ? 147.276 126.144 54.112  1.00 80.41  ? 311  LYS A CB  1 
ATOM   1919 C  CG  . LYS A 1 332  ? 146.734 126.837 52.854  1.00 80.41  ? 311  LYS A CG  1 
ATOM   1920 C  CD  . LYS A 1 332  ? 147.754 126.857 51.722  1.00 80.41  ? 311  LYS A CD  1 
ATOM   1921 C  CE  . LYS A 1 332  ? 147.221 127.543 50.483  1.00 80.41  ? 311  LYS A CE  1 
ATOM   1922 N  NZ  . LYS A 1 332  ? 148.278 127.633 49.436  1.00 80.41  ? 311  LYS A NZ  1 
ATOM   1923 N  N   . ASN A 1 333  ? 150.258 127.377 55.239  1.00 109.88 ? 312  ASN A N   1 
ATOM   1924 C  CA  . ASN A 1 333  ? 151.560 127.980 54.933  1.00 109.88 ? 312  ASN A CA  1 
ATOM   1925 C  C   . ASN A 1 333  ? 151.576 129.487 55.193  1.00 109.88 ? 312  ASN A C   1 
ATOM   1926 O  O   . ASN A 1 333  ? 151.747 130.297 54.282  1.00 109.88 ? 312  ASN A O   1 
ATOM   1927 C  CB  . ASN A 1 333  ? 151.985 127.698 53.493  1.00 109.88 ? 312  ASN A CB  1 
ATOM   1928 C  CG  . ASN A 1 333  ? 152.569 126.314 53.302  1.00 109.88 ? 312  ASN A CG  1 
ATOM   1929 O  OD1 . ASN A 1 333  ? 153.198 125.751 54.194  1.00 109.88 ? 312  ASN A OD1 1 
ATOM   1930 N  ND2 . ASN A 1 333  ? 152.394 125.781 52.105  1.00 109.88 ? 312  ASN A ND2 1 
ATOM   1931 N  N   . SER A 1 334  ? 151.369 129.862 56.446  1.00 85.21  ? 313  SER A N   1 
ATOM   1932 C  CA  . SER A 1 334  ? 151.275 131.265 56.807  1.00 85.21  ? 313  SER A CA  1 
ATOM   1933 C  C   . SER A 1 334  ? 152.283 131.586 57.894  1.00 85.21  ? 313  SER A C   1 
ATOM   1934 O  O   . SER A 1 334  ? 152.317 130.923 58.933  1.00 85.21  ? 313  SER A O   1 
ATOM   1935 C  CB  . SER A 1 334  ? 149.865 131.622 57.261  1.00 85.21  ? 313  SER A CB  1 
ATOM   1936 O  OG  . SER A 1 334  ? 148.951 131.496 56.190  1.00 85.21  ? 313  SER A OG  1 
ATOM   1937 N  N   . THR A 1 335  ? 153.097 132.606 57.646  1.00 111.99 ? 314  THR A N   1 
ATOM   1938 C  CA  . THR A 1 335  ? 154.085 133.080 58.603  1.00 111.99 ? 314  THR A CA  1 
ATOM   1939 C  C   . THR A 1 335  ? 153.653 134.367 59.293  1.00 111.99 ? 314  THR A C   1 
ATOM   1940 O  O   . THR A 1 335  ? 153.865 134.516 60.503  1.00 111.99 ? 314  THR A O   1 
ATOM   1941 C  CB  . THR A 1 335  ? 155.425 133.290 57.888  1.00 111.99 ? 314  THR A CB  1 
ATOM   1942 O  OG1 . THR A 1 335  ? 155.805 132.073 57.235  1.00 111.99 ? 314  THR A OG1 1 
ATOM   1943 C  CG2 . THR A 1 335  ? 156.522 133.667 58.869  1.00 111.99 ? 314  THR A CG2 1 
ATOM   1944 N  N   . LYS A 1 336  ? 153.013 135.276 58.556  1.00 120.37 ? 315  LYS A N   1 
ATOM   1945 C  CA  . LYS A 1 336  ? 152.681 136.589 59.106  1.00 120.37 ? 315  LYS A CA  1 
ATOM   1946 C  C   . LYS A 1 336  ? 151.650 136.604 60.242  1.00 120.37 ? 315  LYS A C   1 
ATOM   1947 O  O   . LYS A 1 336  ? 151.747 137.521 61.076  1.00 120.37 ? 315  LYS A O   1 
ATOM   1948 C  CB  . LYS A 1 336  ? 152.274 137.550 57.964  1.00 120.37 ? 315  LYS A CB  1 
ATOM   1949 C  CG  . LYS A 1 336  ? 151.102 137.137 57.091  1.00 120.37 ? 315  LYS A CG  1 
ATOM   1950 C  CD  . LYS A 1 336  ? 150.779 138.111 55.991  1.00 120.37 ? 315  LYS A CD  1 
ATOM   1951 C  CE  . LYS A 1 336  ? 149.584 137.613 55.198  1.00 120.37 ? 315  LYS A CE  1 
ATOM   1952 N  NZ  . LYS A 1 336  ? 149.216 138.533 54.091  1.00 120.37 ? 315  LYS A NZ  1 
ATOM   1953 N  N   . PRO A 1 337  ? 150.670 135.666 60.379  1.00 109.52 ? 316  PRO A N   1 
ATOM   1954 C  CA  . PRO A 1 337  ? 149.955 135.654 61.653  1.00 109.52 ? 316  PRO A CA  1 
ATOM   1955 C  C   . PRO A 1 337  ? 150.550 134.619 62.571  1.00 109.52 ? 316  PRO A C   1 
ATOM   1956 O  O   . PRO A 1 337  ? 151.456 133.880 62.174  1.00 109.52 ? 316  PRO A O   1 
ATOM   1957 C  CB  . PRO A 1 337  ? 148.536 135.258 61.251  1.00 109.52 ? 316  PRO A CB  1 
ATOM   1958 C  CG  . PRO A 1 337  ? 148.773 134.287 60.204  1.00 109.52 ? 316  PRO A CG  1 
ATOM   1959 C  CD  . PRO A 1 337  ? 149.966 134.773 59.433  1.00 109.52 ? 316  PRO A CD  1 
ATOM   1960 N  N   . LEU A 1 338  ? 150.079 134.556 63.806  1.00 114.64 ? 317  LEU A N   1 
ATOM   1961 C  CA  . LEU A 1 338  ? 149.911 133.203 64.284  1.00 114.64 ? 317  LEU A CA  1 
ATOM   1962 C  C   . LEU A 1 338  ? 148.417 132.916 64.284  1.00 114.64 ? 317  LEU A C   1 
ATOM   1963 O  O   . LEU A 1 338  ? 147.904 132.366 63.309  1.00 114.64 ? 317  LEU A O   1 
ATOM   1964 C  CB  . LEU A 1 338  ? 150.511 133.019 65.680  1.00 30.00  ? 317  LEU A CB  1 
ATOM   1965 C  CG  . LEU A 1 338  ? 152.035 133.131 65.782  1.00 30.00  ? 317  LEU A CG  1 
ATOM   1966 C  CD1 . LEU A 1 338  ? 152.479 133.076 67.236  1.00 30.00  ? 317  LEU A CD1 1 
ATOM   1967 C  CD2 . LEU A 1 338  ? 152.711 132.040 64.968  1.00 30.00  ? 317  LEU A CD2 1 
ATOM   1968 N  N   . ASP A 1 339  ? 147.704 133.477 65.265  1.00 113.15 ? 318  ASP A N   1 
ATOM   1969 C  CA  . ASP A 1 339  ? 146.347 133.078 65.640  1.00 113.15 ? 318  ASP A CA  1 
ATOM   1970 C  C   . ASP A 1 339  ? 145.794 133.998 66.736  1.00 113.15 ? 318  ASP A C   1 
ATOM   1971 O  O   . ASP A 1 339  ? 146.306 135.103 66.948  1.00 113.15 ? 318  ASP A O   1 
ATOM   1972 C  CB  . ASP A 1 339  ? 146.325 131.622 66.110  1.00 30.00  ? 318  ASP A CB  1 
ATOM   1973 C  CG  . ASP A 1 339  ? 146.536 130.641 64.974  1.00 30.00  ? 318  ASP A CG  1 
ATOM   1974 O  OD1 . ASP A 1 339  ? 146.415 131.052 63.801  1.00 30.00  ? 318  ASP A OD1 1 
ATOM   1975 O  OD2 . ASP A 1 339  ? 146.824 129.439 65.158  1.00 30.00  ? 318  ASP A OD2 1 
ATOM   1976 N  N   . MET A 1 340  ? 144.725 133.542 67.410  1.00 88.68  ? 319  MET A N   1 
ATOM   1977 C  CA  . MET A 1 340  ? 144.455 133.889 68.809  1.00 88.68  ? 319  MET A CA  1 
ATOM   1978 C  C   . MET A 1 340  ? 144.086 135.330 69.138  1.00 88.68  ? 319  MET A C   1 
ATOM   1979 O  O   . MET A 1 340  ? 144.971 136.183 69.264  1.00 88.68  ? 319  MET A O   1 
ATOM   1980 C  CB  . MET A 1 340  ? 145.622 133.461 69.680  1.00 88.68  ? 319  MET A CB  1 
ATOM   1981 C  CG  . MET A 1 340  ? 145.792 131.976 69.635  1.00 88.68  ? 319  MET A CG  1 
ATOM   1982 S  SD  . MET A 1 340  ? 144.313 131.085 70.093  1.00 88.68  ? 319  MET A SD  1 
ATOM   1983 C  CE  . MET A 1 340  ? 144.841 129.464 69.591  1.00 88.68  ? 319  MET A CE  1 
ATOM   1984 N  N   . ALA A 1 341  ? 142.769 135.591 69.117  1.00 75.22  ? 320  ALA A N   1 
ATOM   1985 C  CA  . ALA A 1 341  ? 142.020 136.775 69.553  1.00 75.22  ? 320  ALA A CA  1 
ATOM   1986 C  C   . ALA A 1 341  ? 141.962 137.801 68.444  1.00 75.22  ? 320  ALA A C   1 
ATOM   1987 O  O   . ALA A 1 341  ? 141.476 138.918 68.634  1.00 75.22  ? 320  ALA A O   1 
ATOM   1988 C  CB  . ALA A 1 341  ? 142.568 137.411 70.840  1.00 75.22  ? 320  ALA A CB  1 
ATOM   1989 N  N   . LEU A 1 342  ? 142.446 137.414 67.278  1.00 86.45  ? 321  LEU A N   1 
ATOM   1990 C  CA  . LEU A 1 342  ? 141.776 137.772 66.048  1.00 86.45  ? 321  LEU A CA  1 
ATOM   1991 C  C   . LEU A 1 342  ? 141.056 136.573 65.459  1.00 86.45  ? 321  LEU A C   1 
ATOM   1992 O  O   . LEU A 1 342  ? 140.411 136.706 64.414  1.00 86.45  ? 321  LEU A O   1 
ATOM   1993 C  CB  . LEU A 1 342  ? 142.755 138.359 65.025  1.00 86.45  ? 321  LEU A CB  1 
ATOM   1994 C  CG  . LEU A 1 342  ? 142.963 139.877 65.055  1.00 86.45  ? 321  LEU A CG  1 
ATOM   1995 C  CD1 . LEU A 1 342  ? 141.640 140.574 64.813  1.00 86.45  ? 321  LEU A CD1 1 
ATOM   1996 C  CD2 . LEU A 1 342  ? 143.615 140.391 66.330  1.00 86.45  ? 321  LEU A CD2 1 
ATOM   1997 N  N   . VAL A 1 343  ? 141.151 135.411 66.109  1.00 90.51  ? 322  VAL A N   1 
ATOM   1998 C  CA  . VAL A 1 343  ? 140.432 134.216 65.688  1.00 90.51  ? 322  VAL A CA  1 
ATOM   1999 C  C   . VAL A 1 343  ? 139.198 134.043 66.556  1.00 90.51  ? 322  VAL A C   1 
ATOM   2000 O  O   . VAL A 1 343  ? 138.067 134.099 66.064  1.00 90.51  ? 322  VAL A O   1 
ATOM   2001 C  CB  . VAL A 1 343  ? 141.307 132.953 65.764  1.00 90.51  ? 322  VAL A CB  1 
ATOM   2002 C  CG1 . VAL A 1 343  ? 140.467 131.766 65.396  1.00 90.51  ? 322  VAL A CG1 1 
ATOM   2003 C  CG2 . VAL A 1 343  ? 142.500 133.057 64.836  1.00 90.51  ? 322  VAL A CG2 1 
ATOM   2004 N  N   . LEU A 1 344  ? 139.406 133.815 67.856  1.00 60.03  ? 323  LEU A N   1 
ATOM   2005 C  CA  . LEU A 1 344  ? 138.295 133.642 68.786  1.00 60.03  ? 323  LEU A CA  1 
ATOM   2006 C  C   . LEU A 1 344  ? 138.090 134.957 69.528  1.00 60.03  ? 323  LEU A C   1 
ATOM   2007 O  O   . LEU A 1 344  ? 138.512 135.156 70.660  1.00 60.03  ? 323  LEU A O   1 
ATOM   2008 C  CB  . LEU A 1 344  ? 138.514 132.427 69.699  1.00 60.03  ? 323  LEU A CB  1 
ATOM   2009 C  CG  . LEU A 1 344  ? 139.703 132.034 70.576  1.00 60.03  ? 323  LEU A CG  1 
ATOM   2010 C  CD1 . LEU A 1 344  ? 139.613 132.476 72.008  1.00 60.03  ? 323  LEU A CD1 1 
ATOM   2011 C  CD2 . LEU A 1 344  ? 139.807 130.547 70.554  1.00 60.03  ? 323  LEU A CD2 1 
ATOM   2012 N  N   . ASN A 1 345  ? 137.438 135.874 68.840  1.00 75.57  ? 324  ASN A N   1 
ATOM   2013 C  CA  . ASN A 1 345  ? 136.961 137.106 69.439  1.00 75.57  ? 324  ASN A CA  1 
ATOM   2014 C  C   . ASN A 1 345  ? 135.529 136.853 69.912  1.00 75.57  ? 324  ASN A C   1 
ATOM   2015 O  O   . ASN A 1 345  ? 135.127 135.698 70.069  1.00 75.57  ? 324  ASN A O   1 
ATOM   2016 C  CB  . ASN A 1 345  ? 137.119 138.259 68.454  1.00 75.57  ? 324  ASN A CB  1 
ATOM   2017 C  CG  . ASN A 1 345  ? 137.422 139.565 69.150  1.00 75.57  ? 324  ASN A CG  1 
ATOM   2018 O  OD1 . ASN A 1 345  ? 137.895 140.512 68.526  1.00 75.57  ? 324  ASN A OD1 1 
ATOM   2019 N  ND2 . ASN A 1 345  ? 137.179 139.618 70.454  1.00 75.57  ? 324  ASN A ND2 1 
ATOM   2020 N  N   . GLY A 1 346  ? 134.745 137.912 70.136  1.00 81.21  ? 325  GLY A N   1 
ATOM   2021 C  CA  . GLY A 1 346  ? 133.501 137.905 70.897  1.00 81.21  ? 325  GLY A CA  1 
ATOM   2022 C  C   . GLY A 1 346  ? 132.413 136.874 70.639  1.00 81.21  ? 325  GLY A C   1 
ATOM   2023 O  O   . GLY A 1 346  ? 131.422 136.843 71.374  1.00 81.21  ? 325  GLY A O   1 
ATOM   2024 N  N   . GLY A 1 347  ? 132.559 136.046 69.614  1.00 67.62  ? 326  GLY A N   1 
ATOM   2025 C  CA  . GLY A 1 347  ? 131.677 134.909 69.428  1.00 67.62  ? 326  GLY A CA  1 
ATOM   2026 C  C   . GLY A 1 347  ? 132.419 133.721 68.853  1.00 67.62  ? 326  GLY A C   1 
ATOM   2027 O  O   . GLY A 1 347  ? 133.472 133.860 68.229  1.00 67.62  ? 326  GLY A O   1 
ATOM   2028 N  N   . CYS A 1 348  ? 131.860 132.536 69.088  1.00 74.84  ? 327  CYS A N   1 
ATOM   2029 C  CA  . CYS A 1 348  ? 132.307 131.310 68.433  1.00 74.84  ? 327  CYS A CA  1 
ATOM   2030 C  C   . CYS A 1 348  ? 131.110 130.443 68.103  1.00 74.84  ? 327  CYS A C   1 
ATOM   2031 O  O   . CYS A 1 348  ? 130.399 129.993 69.002  1.00 74.84  ? 327  CYS A O   1 
ATOM   2032 C  CB  . CYS A 1 348  ? 133.308 130.528 69.284  1.00 74.84  ? 327  CYS A CB  1 
ATOM   2033 S  SG  . CYS A 1 348  ? 135.009 130.988 68.972  1.00 74.84  ? 327  CYS A SG  1 
ATOM   2034 N  N   . HIS A 1 349  ? 130.923 130.182 66.817  1.00 51.59  ? 328  HIS A N   1 
ATOM   2035 C  CA  . HIS A 1 349  ? 129.775 129.477 66.278  1.00 51.59  ? 328  HIS A CA  1 
ATOM   2036 C  C   . HIS A 1 349  ? 130.125 128.036 65.941  1.00 51.59  ? 328  HIS A C   1 
ATOM   2037 O  O   . HIS A 1 349  ? 131.282 127.629 65.994  1.00 51.59  ? 328  HIS A O   1 
ATOM   2038 C  CB  . HIS A 1 349  ? 129.267 130.202 65.039  1.00 51.59  ? 328  HIS A CB  1 
ATOM   2039 C  CG  . HIS A 1 349  ? 130.346 130.524 64.061  1.00 51.59  ? 328  HIS A CG  1 
ATOM   2040 N  ND1 . HIS A 1 349  ? 131.108 131.667 64.152  1.00 51.59  ? 328  HIS A ND1 1 
ATOM   2041 C  CD2 . HIS A 1 349  ? 130.818 129.840 62.995  1.00 51.59  ? 328  HIS A CD2 1 
ATOM   2042 C  CE1 . HIS A 1 349  ? 131.991 131.683 63.171  1.00 51.59  ? 328  HIS A CE1 1 
ATOM   2043 N  NE2 . HIS A 1 349  ? 131.834 130.586 62.453  1.00 51.59  ? 328  HIS A NE2 1 
ATOM   2044 N  N   . GLY A 1 350  ? 129.103 127.261 65.591  1.00 47.44  ? 329  GLY A N   1 
ATOM   2045 C  CA  . GLY A 1 350  ? 129.298 125.856 65.292  1.00 47.44  ? 329  GLY A CA  1 
ATOM   2046 C  C   . GLY A 1 350  ? 129.370 125.563 63.812  1.00 47.44  ? 329  GLY A C   1 
ATOM   2047 O  O   . GLY A 1 350  ? 130.273 126.041 63.126  1.00 47.44  ? 329  GLY A O   1 
ATOM   2048 N  N   . LEU A 1 351  ? 128.444 124.752 63.304  1.00 40.31  ? 330  LEU A N   1 
ATOM   2049 C  CA  . LEU A 1 351  ? 128.285 124.661 61.860  1.00 40.31  ? 330  LEU A CA  1 
ATOM   2050 C  C   . LEU A 1 351  ? 127.496 125.847 61.340  1.00 40.31  ? 330  LEU A C   1 
ATOM   2051 O  O   . LEU A 1 351  ? 128.010 126.663 60.573  1.00 40.31  ? 330  LEU A O   1 
ATOM   2052 C  CB  . LEU A 1 351  ? 127.557 123.382 61.463  1.00 40.31  ? 330  LEU A CB  1 
ATOM   2053 C  CG  . LEU A 1 351  ? 128.102 121.984 61.632  1.00 40.31  ? 330  LEU A CG  1 
ATOM   2054 C  CD1 . LEU A 1 351  ? 127.027 121.068 61.145  1.00 40.31  ? 330  LEU A CD1 1 
ATOM   2055 C  CD2 . LEU A 1 351  ? 129.320 121.828 60.797  1.00 40.31  ? 330  LEU A CD2 1 
ATOM   2056 N  N   . SER A 1 352  ? 126.240 125.955 61.760  1.00 31.43  ? 331  SER A N   1 
ATOM   2057 C  CA  . SER A 1 352  ? 125.355 126.997 61.263  1.00 31.67  ? 331  SER A CA  1 
ATOM   2058 C  C   . SER A 1 352  ? 125.661 128.296 61.985  1.00 32.72  ? 331  SER A C   1 
ATOM   2059 O  O   . SER A 1 352  ? 125.486 128.394 63.202  1.00 34.02  ? 331  SER A O   1 
ATOM   2060 C  CB  . SER A 1 352  ? 123.900 126.599 61.464  1.00 99.86  ? 331  SER A CB  1 
ATOM   2061 O  OG  . SER A 1 352  ? 123.596 126.528 62.838  1.00 99.86  ? 331  SER A OG  1 
ATOM   2062 N  N   . ARG A 1 353  ? 126.097 129.298 61.236  1.00 45.55  ? 332  ARG A N   1 
ATOM   2063 C  CA  . ARG A 1 353  ? 126.638 130.491 61.850  1.00 47.42  ? 332  ARG A CA  1 
ATOM   2064 C  C   . ARG A 1 353  ? 125.580 131.425 62.412  1.00 47.71  ? 332  ARG A C   1 
ATOM   2065 O  O   . ARG A 1 353  ? 125.946 132.390 63.086  1.00 49.74  ? 332  ARG A O   1 
ATOM   2066 C  CB  . ARG A 1 353  ? 127.489 131.254 60.843  1.00 98.28  ? 332  ARG A CB  1 
ATOM   2067 C  CG  . ARG A 1 353  ? 128.681 130.479 60.345  1.00 98.28  ? 332  ARG A CG  1 
ATOM   2068 C  CD  . ARG A 1 353  ? 129.565 131.354 59.481  1.00 98.28  ? 332  ARG A CD  1 
ATOM   2069 N  NE  . ARG A 1 353  ? 130.729 130.625 58.988  1.00 98.28  ? 332  ARG A NE  1 
ATOM   2070 C  CZ  . ARG A 1 353  ? 130.791 130.035 57.801  1.00 98.28  ? 332  ARG A CZ  1 
ATOM   2071 N  NH1 . ARG A 1 353  ? 131.889 129.388 57.440  1.00 98.28  ? 332  ARG A NH1 1 
ATOM   2072 N  NH2 . ARG A 1 353  ? 129.760 130.101 56.971  1.00 98.28  ? 332  ARG A NH2 1 
ATOM   2073 N  N   . LYS A 1 354  ? 124.290 131.197 62.160  1.00 46.63  ? 333  LYS A N   1 
ATOM   2074 C  CA  . LYS A 1 354  ? 123.288 132.041 62.793  1.00 46.25  ? 333  LYS A CA  1 
ATOM   2075 C  C   . LYS A 1 354  ? 122.428 131.312 63.805  1.00 46.11  ? 333  LYS A C   1 
ATOM   2076 O  O   . LYS A 1 354  ? 121.844 131.967 64.670  1.00 47.20  ? 333  LYS A O   1 
ATOM   2077 C  CB  . LYS A 1 354  ? 122.374 132.702 61.753  1.00 94.23  ? 333  LYS A CB  1 
ATOM   2078 C  CG  . LYS A 1 354  ? 121.343 131.822 61.113  1.00 94.23  ? 333  LYS A CG  1 
ATOM   2079 C  CD  . LYS A 1 354  ? 120.573 132.612 60.075  1.00 94.23  ? 333  LYS A CD  1 
ATOM   2080 C  CE  . LYS A 1 354  ? 119.726 133.696 60.710  1.00 94.23  ? 333  LYS A CE  1 
ATOM   2081 N  NZ  . LYS A 1 354  ? 118.611 133.145 61.507  1.00 94.23  ? 333  LYS A NZ  1 
ATOM   2082 N  N   . TYR A 1 355  ? 122.355 129.991 63.742  1.00 50.63  ? 334  TYR A N   1 
ATOM   2083 C  CA  . TYR A 1 355  ? 121.620 129.209 64.723  1.00 50.45  ? 334  TYR A CA  1 
ATOM   2084 C  C   . TYR A 1 355  ? 122.504 128.703 65.851  1.00 49.38  ? 334  TYR A C   1 
ATOM   2085 O  O   . TYR A 1 355  ? 122.116 128.780 67.018  1.00 49.61  ? 334  TYR A O   1 
ATOM   2086 C  CB  . TYR A 1 355  ? 120.941 128.032 64.030  1.00 89.91  ? 334  TYR A CB  1 
ATOM   2087 C  CG  . TYR A 1 355  ? 119.799 128.438 63.134  1.00 89.91  ? 334  TYR A CG  1 
ATOM   2088 C  CD1 . TYR A 1 355  ? 119.112 129.615 63.345  1.00 89.91  ? 334  TYR A CD1 1 
ATOM   2089 C  CD2 . TYR A 1 355  ? 119.434 127.655 62.057  1.00 89.91  ? 334  TYR A CD2 1 
ATOM   2090 C  CE1 . TYR A 1 355  ? 118.077 129.986 62.525  1.00 89.91  ? 334  TYR A CE1 1 
ATOM   2091 C  CE2 . TYR A 1 355  ? 118.402 128.022 61.231  1.00 89.91  ? 334  TYR A CE2 1 
ATOM   2092 C  CZ  . TYR A 1 355  ? 117.732 129.188 61.469  1.00 89.91  ? 334  TYR A CZ  1 
ATOM   2093 O  OH  . TYR A 1 355  ? 116.702 129.557 60.644  1.00 89.91  ? 334  TYR A OH  1 
ATOM   2094 N  N   . MET A 1 356  ? 123.701 128.219 65.534  1.00 55.27  ? 335  MET A N   1 
ATOM   2095 C  CA  . MET A 1 356  ? 124.625 127.674 66.524  1.00 55.27  ? 335  MET A CA  1 
ATOM   2096 C  C   . MET A 1 356  ? 125.662 128.693 66.955  1.00 55.27  ? 335  MET A C   1 
ATOM   2097 O  O   . MET A 1 356  ? 126.816 128.335 67.175  1.00 55.27  ? 335  MET A O   1 
ATOM   2098 C  CB  . MET A 1 356  ? 125.316 126.426 65.989  1.00 55.27  ? 335  MET A CB  1 
ATOM   2099 C  CG  . MET A 1 356  ? 124.404 125.237 65.796  1.00 55.27  ? 335  MET A CG  1 
ATOM   2100 S  SD  . MET A 1 356  ? 125.223 123.811 65.058  1.00 55.27  ? 335  MET A SD  1 
ATOM   2101 C  CE  . MET A 1 356  ? 126.211 123.221 66.423  1.00 55.27  ? 335  MET A CE  1 
ATOM   2102 N  N   . HIS A 1 357  ? 125.298 129.963 67.069  1.00 26.05  ? 336  HIS A N   1 
ATOM   2103 C  CA  . HIS A 1 357  ? 126.246 131.000 67.463  1.00 25.35  ? 336  HIS A CA  1 
ATOM   2104 C  C   . HIS A 1 357  ? 126.470 130.938 68.962  1.00 25.19  ? 336  HIS A C   1 
ATOM   2105 O  O   . HIS A 1 357  ? 125.643 131.406 69.742  1.00 26.64  ? 336  HIS A O   1 
ATOM   2106 C  CB  . HIS A 1 357  ? 125.737 132.375 67.072  1.00 87.81  ? 336  HIS A CB  1 
ATOM   2107 C  CG  . HIS A 1 357  ? 126.622 133.482 67.536  1.00 87.81  ? 336  HIS A CG  1 
ATOM   2108 N  ND1 . HIS A 1 357  ? 127.807 133.798 66.908  1.00 87.81  ? 336  HIS A ND1 1 
ATOM   2109 C  CD2 . HIS A 1 357  ? 126.514 134.327 68.586  1.00 87.81  ? 336  HIS A CD2 1 
ATOM   2110 C  CE1 . HIS A 1 357  ? 128.382 134.804 67.544  1.00 87.81  ? 336  HIS A CE1 1 
ATOM   2111 N  NE2 . HIS A 1 357  ? 127.617 135.143 68.566  1.00 87.81  ? 336  HIS A NE2 1 
ATOM   2112 N  N   . TRP A 1 358  ? 127.596 130.374 69.376  1.00 24.98  ? 337  TRP A N   1 
ATOM   2113 C  CA  . TRP A 1 358  ? 127.946 130.352 70.785  1.00 25.31  ? 337  TRP A CA  1 
ATOM   2114 C  C   . TRP A 1 358  ? 128.598 131.676 71.149  1.00 24.85  ? 337  TRP A C   1 
ATOM   2115 O  O   . TRP A 1 358  ? 129.204 132.342 70.305  1.00 24.76  ? 337  TRP A O   1 
ATOM   2116 C  CB  . TRP A 1 358  ? 128.891 129.198 71.122  1.00 97.56  ? 337  TRP A CB  1 
ATOM   2117 C  CG  . TRP A 1 358  ? 128.472 127.864 70.576  1.00 97.56  ? 337  TRP A CG  1 
ATOM   2118 C  CD1 . TRP A 1 358  ? 129.161 127.103 69.681  1.00 97.56  ? 337  TRP A CD1 1 
ATOM   2119 C  CD2 . TRP A 1 358  ? 127.228 127.184 70.790  1.00 97.56  ? 337  TRP A CD2 1 
ATOM   2120 N  NE1 . TRP A 1 358  ? 128.467 125.964 69.385  1.00 97.56  ? 337  TRP A NE1 1 
ATOM   2121 C  CE2 . TRP A 1 358  ? 127.269 125.997 70.039  1.00 97.56  ? 337  TRP A CE2 1 
ATOM   2122 C  CE3 . TRP A 1 358  ? 126.099 127.447 71.566  1.00 97.56  ? 337  TRP A CE3 1 
ATOM   2123 C  CZ2 . TRP A 1 358  ? 126.231 125.091 70.032  1.00 97.56  ? 337  TRP A CZ2 1 
ATOM   2124 C  CZ3 . TRP A 1 358  ? 125.064 126.546 71.558  1.00 97.56  ? 337  TRP A CZ3 1 
ATOM   2125 C  CH2 . TRP A 1 358  ? 125.135 125.381 70.800  1.00 97.56  ? 337  TRP A CH2 1 
ATOM   2126 N  N   . GLN A 1 359  ? 128.472 132.050 72.412  1.00 25.04  ? 338  GLN A N   1 
ATOM   2127 C  CA  . GLN A 1 359  ? 128.810 133.385 72.879  1.00 25.14  ? 338  GLN A CA  1 
ATOM   2128 C  C   . GLN A 1 359  ? 130.091 133.346 73.695  1.00 25.29  ? 338  GLN A C   1 
ATOM   2129 O  O   . GLN A 1 359  ? 130.583 132.282 74.066  1.00 24.68  ? 338  GLN A O   1 
ATOM   2130 C  CB  . GLN A 1 359  ? 127.650 133.944 73.696  1.00 95.04  ? 338  GLN A CB  1 
ATOM   2131 C  CG  . GLN A 1 359  ? 126.418 134.079 72.851  1.00 95.04  ? 338  GLN A CG  1 
ATOM   2132 C  CD  . GLN A 1 359  ? 125.194 134.356 73.663  1.00 95.04  ? 338  GLN A CD  1 
ATOM   2133 O  OE1 . GLN A 1 359  ? 125.263 134.434 74.871  1.00 95.04  ? 338  GLN A OE1 1 
ATOM   2134 N  NE2 . GLN A 1 359  ? 124.052 134.463 73.004  1.00 95.04  ? 338  GLN A NE2 1 
ATOM   2135 N  N   . GLU A 1 360  ? 130.646 134.523 73.970  1.00 45.63  ? 339  GLU A N   1 
ATOM   2136 C  CA  . GLU A 1 360  ? 131.932 134.549 74.646  1.00 45.69  ? 339  GLU A CA  1 
ATOM   2137 C  C   . GLU A 1 360  ? 131.811 134.307 76.141  1.00 46.03  ? 339  GLU A C   1 
ATOM   2138 O  O   . GLU A 1 360  ? 132.774 133.840 76.752  1.00 46.25  ? 339  GLU A O   1 
ATOM   2139 C  CB  . GLU A 1 360  ? 132.649 135.869 74.363  1.00 94.14  ? 339  GLU A CB  1 
ATOM   2140 C  CG  . GLU A 1 360  ? 131.961 137.117 74.859  1.00 94.14  ? 339  GLU A CG  1 
ATOM   2141 C  CD  . GLU A 1 360  ? 132.447 137.539 76.225  1.00 94.14  ? 339  GLU A CD  1 
ATOM   2142 O  OE1 . GLU A 1 360  ? 133.538 137.092 76.631  1.00 94.14  ? 339  GLU A OE1 1 
ATOM   2143 O  OE2 . GLU A 1 360  ? 131.744 138.323 76.889  1.00 94.14  ? 339  GLU A OE2 1 
ATOM   2144 N  N   . GLU A 1 361  ? 130.657 134.596 76.743  1.00 32.96  ? 340  GLU A N   1 
ATOM   2145 C  CA  . GLU A 1 361  ? 130.462 134.247 78.144  1.00 32.80  ? 340  GLU A CA  1 
ATOM   2146 C  C   . GLU A 1 361  ? 130.403 132.741 78.358  1.00 33.81  ? 340  GLU A C   1 
ATOM   2147 O  O   . GLU A 1 361  ? 130.862 132.252 79.395  1.00 34.58  ? 340  GLU A O   1 
ATOM   2148 C  CB  . GLU A 1 361  ? 129.193 134.897 78.696  1.00 88.48  ? 340  GLU A CB  1 
ATOM   2149 C  CG  . GLU A 1 361  ? 129.299 136.380 79.081  1.00 88.48  ? 340  GLU A CG  1 
ATOM   2150 C  CD  . GLU A 1 361  ? 129.002 137.349 77.953  1.00 88.48  ? 340  GLU A CD  1 
ATOM   2151 O  OE1 . GLU A 1 361  ? 128.670 136.901 76.843  1.00 88.48  ? 340  GLU A OE1 1 
ATOM   2152 O  OE2 . GLU A 1 361  ? 129.097 138.572 78.183  1.00 88.48  ? 340  GLU A OE2 1 
ATOM   2153 N  N   . LEU A 1 362  ? 129.853 131.995 77.393  1.00 46.37  ? 341  LEU A N   1 
ATOM   2154 C  CA  . LEU A 1 362  ? 129.706 130.545 77.530  1.00 45.55  ? 341  LEU A CA  1 
ATOM   2155 C  C   . LEU A 1 362  ? 131.038 129.821 77.582  1.00 46.02  ? 341  LEU A C   1 
ATOM   2156 O  O   . LEU A 1 362  ? 131.136 128.742 78.172  1.00 45.29  ? 341  LEU A O   1 
ATOM   2157 C  CB  . LEU A 1 362  ? 128.911 129.977 76.361  1.00 82.77  ? 341  LEU A CB  1 
ATOM   2158 C  CG  . LEU A 1 362  ? 127.415 130.161 76.293  1.00 82.77  ? 341  LEU A CG  1 
ATOM   2159 C  CD1 . LEU A 1 362  ? 126.954 129.702 74.945  1.00 82.77  ? 341  LEU A CD1 1 
ATOM   2160 C  CD2 . LEU A 1 362  ? 126.814 129.288 77.352  1.00 82.77  ? 341  LEU A CD2 1 
ATOM   2161 N  N   . ILE A 1 363  ? 132.063 130.388 76.976  1.00 28.48  ? 342  ILE A N   1 
ATOM   2162 C  CA  . ILE A 1 363  ? 133.220 129.635 76.525  1.00 28.48  ? 342  ILE A CA  1 
ATOM   2163 C  C   . ILE A 1 363  ? 134.488 130.077 77.235  1.00 28.48  ? 342  ILE A C   1 
ATOM   2164 O  O   . ILE A 1 363  ? 135.202 129.259 77.824  1.00 28.48  ? 342  ILE A O   1 
ATOM   2165 C  CB  . ILE A 1 363  ? 133.385 129.750 75.003  1.00 28.48  ? 342  ILE A CB  1 
ATOM   2166 C  CG1 . ILE A 1 363  ? 132.233 129.057 74.290  1.00 28.48  ? 342  ILE A CG1 1 
ATOM   2167 C  CG2 . ILE A 1 363  ? 134.669 129.185 74.590  1.00 28.48  ? 342  ILE A CG2 1 
ATOM   2168 C  CD1 . ILE A 1 363  ? 132.221 129.302 72.803  1.00 28.48  ? 342  ILE A CD1 1 
ATOM   2169 N  N   . VAL A 1 364  ? 134.790 131.363 77.191  1.00 24.17  ? 343  VAL A N   1 
ATOM   2170 C  CA  . VAL A 1 364  ? 136.047 131.863 77.713  1.00 24.17  ? 343  VAL A CA  1 
ATOM   2171 C  C   . VAL A 1 364  ? 135.766 132.606 79.014  1.00 24.17  ? 343  VAL A C   1 
ATOM   2172 O  O   . VAL A 1 364  ? 134.649 133.074 79.253  1.00 24.17  ? 343  VAL A O   1 
ATOM   2173 C  CB  . VAL A 1 364  ? 136.747 132.728 76.647  1.00 24.17  ? 343  VAL A CB  1 
ATOM   2174 C  CG1 . VAL A 1 364  ? 136.132 134.089 76.534  1.00 24.17  ? 343  VAL A CG1 1 
ATOM   2175 C  CG2 . VAL A 1 364  ? 138.220 132.775 76.873  1.00 24.17  ? 343  VAL A CG2 1 
ATOM   2176 N  N   . GLY A 1 365  ? 136.773 132.670 79.883  1.00 37.73  ? 344  GLY A N   1 
ATOM   2177 C  CA  . GLY A 1 365  ? 136.561 133.040 81.272  1.00 37.73  ? 344  GLY A CA  1 
ATOM   2178 C  C   . GLY A 1 365  ? 136.532 134.526 81.571  1.00 37.73  ? 344  GLY A C   1 
ATOM   2179 O  O   . GLY A 1 365  ? 135.738 135.266 80.988  1.00 37.73  ? 344  GLY A O   1 
ATOM   2180 N  N   . GLY A 1 366  ? 137.369 134.972 82.504  1.00 42.17  ? 345  GLY A N   1 
ATOM   2181 C  CA  . GLY A 1 366  ? 137.425 136.378 82.859  1.00 42.17  ? 345  GLY A CA  1 
ATOM   2182 C  C   . GLY A 1 366  ? 138.228 137.208 81.881  1.00 42.17  ? 345  GLY A C   1 
ATOM   2183 O  O   . GLY A 1 366  ? 139.450 137.075 81.803  1.00 42.17  ? 345  GLY A O   1 
ATOM   2184 N  N   . THR A 1 367  ? 137.561 138.095 81.160  1.00 52.36  ? 346  THR A N   1 
ATOM   2185 C  CA  . THR A 1 367  ? 138.118 138.755 79.992  1.00 52.36  ? 346  THR A CA  1 
ATOM   2186 C  C   . THR A 1 367  ? 138.414 140.228 80.271  1.00 52.36  ? 346  THR A C   1 
ATOM   2187 O  O   . THR A 1 367  ? 138.154 140.748 81.359  1.00 52.36  ? 346  THR A O   1 
ATOM   2188 C  CB  . THR A 1 367  ? 137.154 138.608 78.821  1.00 52.36  ? 346  THR A CB  1 
ATOM   2189 O  OG1 . THR A 1 367  ? 135.909 139.226 79.159  1.00 52.36  ? 346  THR A OG1 1 
ATOM   2190 C  CG2 . THR A 1 367  ? 136.902 137.156 78.549  1.00 52.36  ? 346  THR A CG2 1 
ATOM   2191 N  N   . VAL A 1 368  ? 138.946 140.910 79.255  1.00 63.97  ? 347  VAL A N   1 
ATOM   2192 C  CA  . VAL A 1 368  ? 139.343 142.310 79.377  1.00 63.97  ? 347  VAL A CA  1 
ATOM   2193 C  C   . VAL A 1 368  ? 139.342 142.910 77.974  1.00 63.97  ? 347  VAL A C   1 
ATOM   2194 O  O   . VAL A 1 368  ? 139.452 142.193 76.981  1.00 63.97  ? 347  VAL A O   1 
ATOM   2195 C  CB  . VAL A 1 368  ? 140.723 142.410 80.080  1.00 63.97  ? 347  VAL A CB  1 
ATOM   2196 C  CG1 . VAL A 1 368  ? 141.825 141.892 79.194  1.00 63.97  ? 347  VAL A CG1 1 
ATOM   2197 C  CG2 . VAL A 1 368  ? 141.011 143.819 80.588  1.00 63.97  ? 347  VAL A CG2 1 
ATOM   2198 N  N   . LYS A 1 369  ? 139.174 144.236 77.884  1.00 74.54  ? 348  LYS A N   1 
ATOM   2199 C  CA  . LYS A 1 369  ? 138.878 144.904 76.620  1.00 74.54  ? 348  LYS A CA  1 
ATOM   2200 C  C   . LYS A 1 369  ? 139.827 146.070 76.357  1.00 74.54  ? 348  LYS A C   1 
ATOM   2201 O  O   . LYS A 1 369  ? 140.146 146.835 77.270  1.00 74.54  ? 348  LYS A O   1 
ATOM   2202 C  CB  . LYS A 1 369  ? 137.441 145.435 76.613  1.00 74.54  ? 348  LYS A CB  1 
ATOM   2203 C  CG  . LYS A 1 369  ? 136.362 144.400 76.885  1.00 74.54  ? 348  LYS A CG  1 
ATOM   2204 C  CD  . LYS A 1 369  ? 136.250 143.372 75.777  1.00 74.54  ? 348  LYS A CD  1 
ATOM   2205 C  CE  . LYS A 1 369  ? 134.979 142.549 75.933  1.00 74.54  ? 348  LYS A CE  1 
ATOM   2206 N  NZ  . LYS A 1 369  ? 135.018 141.658 77.120  1.00 74.54  ? 348  LYS A NZ  1 
ATOM   2207 N  N   . ASN A 1 370  ? 140.270 146.208 75.100  1.00 97.96  ? 349  ASN A N   1 
ATOM   2208 C  CA  . ASN A 1 370  ? 141.007 147.403 74.681  1.00 97.96  ? 349  ASN A CA  1 
ATOM   2209 C  C   . ASN A 1 370  ? 140.053 148.529 74.304  1.00 97.96  ? 349  ASN A C   1 
ATOM   2210 O  O   . ASN A 1 370  ? 139.928 149.528 75.018  1.00 97.96  ? 349  ASN A O   1 
ATOM   2211 C  CB  . ASN A 1 370  ? 141.888 147.080 73.470  1.00 97.96  ? 349  ASN A CB  1 
ATOM   2212 C  CG  . ASN A 1 370  ? 142.839 148.215 73.100  1.00 97.96  ? 349  ASN A CG  1 
ATOM   2213 O  OD1 . ASN A 1 370  ? 142.985 149.187 73.845  1.00 97.96  ? 349  ASN A OD1 1 
ATOM   2214 N  ND2 . ASN A 1 370  ? 143.480 148.111 71.931  1.00 97.96  ? 349  ASN A ND2 1 
ATOM   2215 N  N   . SER A 1 371  ? 139.368 148.362 73.181  1.00 110.63 ? 350  SER A N   1 
ATOM   2216 C  CA  . SER A 1 371  ? 138.301 149.244 72.734  1.00 110.63 ? 350  SER A CA  1 
ATOM   2217 C  C   . SER A 1 371  ? 137.040 148.414 72.834  1.00 110.63 ? 350  SER A C   1 
ATOM   2218 O  O   . SER A 1 371  ? 136.894 147.440 72.090  1.00 110.63 ? 350  SER A O   1 
ATOM   2219 C  CB  . SER A 1 371  ? 138.530 149.754 71.310  1.00 30.00  ? 350  SER A CB  1 
ATOM   2220 O  OG  . SER A 1 371  ? 138.574 148.681 70.385  1.00 30.00  ? 350  SER A OG  1 
ATOM   2221 N  N   . THR A 1 372  ? 136.108 148.848 73.689  1.00 136.57 ? 351  THR A N   1 
ATOM   2222 C  CA  . THR A 1 372  ? 135.293 148.001 74.566  1.00 136.57 ? 351  THR A CA  1 
ATOM   2223 C  C   . THR A 1 372  ? 134.709 146.722 73.960  1.00 136.57 ? 351  THR A C   1 
ATOM   2224 O  O   . THR A 1 372  ? 134.376 145.791 74.696  1.00 136.57 ? 351  THR A O   1 
ATOM   2225 C  CB  . THR A 1 372  ? 134.164 148.841 75.177  1.00 136.57 ? 351  THR A CB  1 
ATOM   2226 O  OG1 . THR A 1 372  ? 133.449 148.058 76.143  1.00 136.57 ? 351  THR A OG1 1 
ATOM   2227 C  CG2 . THR A 1 372  ? 133.202 149.345 74.112  1.00 136.57 ? 351  THR A CG2 1 
ATOM   2228 N  N   . GLY A 1 373  ? 134.568 146.655 72.639  1.00 120.36 ? 352  GLY A N   1 
ATOM   2229 C  CA  . GLY A 1 373  ? 134.307 145.387 72.000  1.00 120.36 ? 352  GLY A CA  1 
ATOM   2230 C  C   . GLY A 1 373  ? 135.535 144.498 71.944  1.00 120.36 ? 352  GLY A C   1 
ATOM   2231 O  O   . GLY A 1 373  ? 135.440 143.300 72.215  1.00 120.36 ? 352  GLY A O   1 
ATOM   2232 N  N   . LYS A 1 374  ? 136.691 145.071 71.612  1.00 97.87  ? 353  LYS A N   1 
ATOM   2233 C  CA  . LYS A 1 374  ? 137.874 144.287 71.261  1.00 97.87  ? 353  LYS A CA  1 
ATOM   2234 C  C   . LYS A 1 374  ? 138.510 143.696 72.509  1.00 97.87  ? 353  LYS A C   1 
ATOM   2235 O  O   . LYS A 1 374  ? 139.083 144.417 73.329  1.00 97.87  ? 353  LYS A O   1 
ATOM   2236 C  CB  . LYS A 1 374  ? 138.879 145.146 70.501  1.00 97.87  ? 353  LYS A CB  1 
ATOM   2237 C  CG  . LYS A 1 374  ? 138.370 145.770 69.201  1.00 97.87  ? 353  LYS A CG  1 
ATOM   2238 C  CD  . LYS A 1 374  ? 138.152 144.760 68.084  1.00 97.87  ? 353  LYS A CD  1 
ATOM   2239 C  CE  . LYS A 1 374  ? 136.680 144.458 67.857  1.00 97.87  ? 353  LYS A CE  1 
ATOM   2240 N  NZ  . LYS A 1 374  ? 136.491 143.537 66.710  1.00 97.87  ? 353  LYS A NZ  1 
ATOM   2241 N  N   . LEU A 1 375  ? 138.430 142.378 72.630  1.00 80.64  ? 354  LEU A N   1 
ATOM   2242 C  CA  . LEU A 1 375  ? 139.011 141.659 73.747  1.00 80.64  ? 354  LEU A CA  1 
ATOM   2243 C  C   . LEU A 1 375  ? 140.535 141.641 73.622  1.00 80.64  ? 354  LEU A C   1 
ATOM   2244 O  O   . LEU A 1 375  ? 141.095 141.819 72.539  1.00 80.64  ? 354  LEU A O   1 
ATOM   2245 C  CB  . LEU A 1 375  ? 138.422 140.251 73.785  1.00 80.64  ? 354  LEU A CB  1 
ATOM   2246 C  CG  . LEU A 1 375  ? 138.582 139.287 74.949  1.00 80.64  ? 354  LEU A CG  1 
ATOM   2247 C  CD1 . LEU A 1 375  ? 137.341 138.445 75.036  1.00 80.64  ? 354  LEU A CD1 1 
ATOM   2248 C  CD2 . LEU A 1 375  ? 139.771 138.386 74.728  1.00 80.64  ? 354  LEU A CD2 1 
ATOM   2249 N  N   . VAL A 1 376  ? 141.212 141.460 74.759  1.00 73.78  ? 355  VAL A N   1 
ATOM   2250 C  CA  . VAL A 1 376  ? 142.672 141.427 74.800  1.00 73.78  ? 355  VAL A CA  1 
ATOM   2251 C  C   . VAL A 1 376  ? 143.158 140.125 75.408  1.00 73.78  ? 355  VAL A C   1 
ATOM   2252 O  O   . VAL A 1 376  ? 143.932 139.386 74.796  1.00 73.78  ? 355  VAL A O   1 
ATOM   2253 C  CB  . VAL A 1 376  ? 143.245 142.605 75.604  1.00 73.78  ? 355  VAL A CB  1 
ATOM   2254 C  CG1 . VAL A 1 376  ? 144.752 142.473 75.729  1.00 73.78  ? 355  VAL A CG1 1 
ATOM   2255 C  CG2 . VAL A 1 376  ? 142.892 143.905 74.955  1.00 73.78  ? 355  VAL A CG2 1 
ATOM   2256 N  N   . SER A 1 377  ? 142.727 139.855 76.631  1.00 75.06  ? 356  SER A N   1 
ATOM   2257 C  CA  . SER A 1 377  ? 143.219 138.740 77.415  1.00 75.06  ? 356  SER A CA  1 
ATOM   2258 C  C   . SER A 1 377  ? 142.064 138.085 78.145  1.00 75.06  ? 356  SER A C   1 
ATOM   2259 O  O   . SER A 1 377  ? 141.053 138.727 78.435  1.00 75.06  ? 356  SER A O   1 
ATOM   2260 C  CB  . SER A 1 377  ? 144.266 139.192 78.432  1.00 75.06  ? 356  SER A CB  1 
ATOM   2261 O  OG  . SER A 1 377  ? 144.516 138.174 79.382  1.00 75.06  ? 356  SER A OG  1 
ATOM   2262 N  N   . ALA A 1 378  ? 142.231 136.805 78.455  1.00 49.92  ? 357  ALA A N   1 
ATOM   2263 C  CA  . ALA A 1 378  ? 141.239 136.084 79.230  1.00 49.92  ? 357  ALA A CA  1 
ATOM   2264 C  C   . ALA A 1 378  ? 141.955 135.062 80.093  1.00 49.92  ? 357  ALA A C   1 
ATOM   2265 O  O   . ALA A 1 378  ? 143.183 135.044 80.168  1.00 49.92  ? 357  ALA A O   1 
ATOM   2266 C  CB  . ALA A 1 378  ? 140.199 135.445 78.328  1.00 49.92  ? 357  ALA A CB  1 
ATOM   2267 N  N   . HIS A 1 379  ? 141.184 134.222 80.769  1.00 63.87  ? 358  HIS A N   1 
ATOM   2268 C  CA  . HIS A 1 379  ? 141.788 133.489 81.867  1.00 63.00  ? 358  HIS A CA  1 
ATOM   2269 C  C   . HIS A 1 379  ? 141.436 132.002 81.894  1.00 63.66  ? 358  HIS A C   1 
ATOM   2270 O  O   . HIS A 1 379  ? 142.224 131.191 82.386  1.00 65.65  ? 358  HIS A O   1 
ATOM   2271 C  CB  . HIS A 1 379  ? 141.388 134.182 83.168  1.00 98.33  ? 358  HIS A CB  1 
ATOM   2272 C  CG  . HIS A 1 379  ? 142.264 133.847 84.329  1.00 98.33  ? 358  HIS A CG  1 
ATOM   2273 N  ND1 . HIS A 1 379  ? 141.980 134.245 85.616  1.00 98.33  ? 358  HIS A ND1 1 
ATOM   2274 C  CD2 . HIS A 1 379  ? 143.433 133.175 84.394  1.00 98.33  ? 358  HIS A CD2 1 
ATOM   2275 C  CE1 . HIS A 1 379  ? 142.927 133.808 86.426  1.00 98.33  ? 358  HIS A CE1 1 
ATOM   2276 N  NE2 . HIS A 1 379  ? 143.819 133.150 85.710  1.00 98.33  ? 358  HIS A NE2 1 
ATOM   2277 N  N   . ALA A 1 380  ? 140.278 131.615 81.359  1.00 78.05  ? 359  ALA A N   1 
ATOM   2278 C  CA  . ALA A 1 380  ? 139.876 130.215 81.419  1.00 79.10  ? 359  ALA A CA  1 
ATOM   2279 C  C   . ALA A 1 380  ? 139.043 129.865 80.198  1.00 76.20  ? 359  ALA A C   1 
ATOM   2280 O  O   . ALA A 1 380  ? 138.570 130.743 79.479  1.00 75.27  ? 359  ALA A O   1 
ATOM   2281 C  CB  . ALA A 1 380  ? 139.090 129.910 82.693  1.00 103.37 ? 359  ALA A CB  1 
ATOM   2282 N  N   . LEU A 1 381  ? 138.879 128.564 79.968  1.00 85.25  ? 360  LEU A N   1 
ATOM   2283 C  CA  . LEU A 1 381  ? 138.166 128.018 78.821  1.00 84.06  ? 360  LEU A CA  1 
ATOM   2284 C  C   . LEU A 1 381  ? 137.211 126.935 79.291  1.00 83.41  ? 360  LEU A C   1 
ATOM   2285 O  O   . LEU A 1 381  ? 137.290 126.477 80.430  1.00 107.51 ? 360  LEU A O   1 
ATOM   2286 C  CB  . LEU A 1 381  ? 139.134 127.436 77.795  1.00 91.30  ? 360  LEU A CB  1 
ATOM   2287 C  CG  . LEU A 1 381  ? 139.772 128.306 76.717  1.00 91.30  ? 360  LEU A CG  1 
ATOM   2288 C  CD1 . LEU A 1 381  ? 140.769 129.289 77.241  1.00 91.30  ? 360  LEU A CD1 1 
ATOM   2289 C  CD2 . LEU A 1 381  ? 140.450 127.376 75.754  1.00 91.30  ? 360  LEU A CD2 1 
ATOM   2290 N  N   . GLN A 1 382  ? 136.324 126.486 78.398  1.00 47.83  ? 361  GLN A N   1 
ATOM   2291 C  CA  . GLN A 1 382  ? 135.313 125.514 78.800  1.00 47.16  ? 361  GLN A CA  1 
ATOM   2292 C  C   . GLN A 1 382  ? 134.732 124.796 77.594  1.00 47.34  ? 361  GLN A C   1 
ATOM   2293 O  O   . GLN A 1 382  ? 134.345 125.441 76.622  1.00 47.12  ? 361  GLN A O   1 
ATOM   2294 C  CB  . GLN A 1 382  ? 134.184 126.194 79.574  1.00 83.37  ? 361  GLN A CB  1 
ATOM   2295 C  CG  . GLN A 1 382  ? 133.132 125.249 80.086  1.00 83.37  ? 361  GLN A CG  1 
ATOM   2296 C  CD  . GLN A 1 382  ? 132.161 125.927 81.001  1.00 83.37  ? 361  GLN A CD  1 
ATOM   2297 O  OE1 . GLN A 1 382  ? 132.255 127.128 81.234  1.00 83.37  ? 361  GLN A OE1 1 
ATOM   2298 N  NE2 . GLN A 1 382  ? 131.225 125.162 81.542  1.00 83.37  ? 361  GLN A NE2 1 
ATOM   2299 N  N   . THR A 1 383  ? 134.642 123.472 77.682  1.00 116.93 ? 362  THR A N   1 
ATOM   2300 C  CA  . THR A 1 383  ? 133.996 122.613 76.697  1.00 116.94 ? 362  THR A CA  1 
ATOM   2301 C  C   . THR A 1 383  ? 132.834 121.901 77.379  1.00 117.10 ? 362  THR A C   1 
ATOM   2302 O  O   . THR A 1 383  ? 132.931 121.551 78.553  1.00 117.16 ? 362  THR A O   1 
ATOM   2303 C  CB  . THR A 1 383  ? 135.006 121.599 76.137  1.00 80.71  ? 362  THR A CB  1 
ATOM   2304 O  OG1 . THR A 1 383  ? 136.104 122.301 75.548  1.00 80.71  ? 362  THR A OG1 1 
ATOM   2305 C  CG2 . THR A 1 383  ? 134.406 120.683 75.091  1.00 80.71  ? 362  THR A CG2 1 
ATOM   2306 N  N   . MET A 1 384  ? 131.722 121.713 76.677  1.00 172.17 ? 363  MET A N   1 
ATOM   2307 C  CA  . MET A 1 384  ? 130.542 121.078 77.258  1.00 173.59 ? 363  MET A CA  1 
ATOM   2308 C  C   . MET A 1 384  ? 130.065 119.946 76.358  1.00 174.87 ? 363  MET A C   1 
ATOM   2309 O  O   . MET A 1 384  ? 129.317 120.184 75.410  1.00 174.70 ? 363  MET A O   1 
ATOM   2310 C  CB  . MET A 1 384  ? 129.427 122.089 77.453  1.00 73.64  ? 363  MET A CB  1 
ATOM   2311 C  CG  . MET A 1 384  ? 129.709 123.161 78.470  1.00 73.64  ? 363  MET A CG  1 
ATOM   2312 S  SD  . MET A 1 384  ? 128.405 124.405 78.497  1.00 73.64  ? 363  MET A SD  1 
ATOM   2313 C  CE  . MET A 1 384  ? 127.065 123.479 79.224  1.00 73.64  ? 363  MET A CE  1 
ATOM   2314 N  N   . PHE A 1 385  ? 130.461 118.719 76.670  1.00 229.67 ? 364  PHE A N   1 
ATOM   2315 C  CA  . PHE A 1 385  ? 129.906 117.552 75.995  1.00 231.15 ? 364  PHE A CA  1 
ATOM   2316 C  C   . PHE A 1 385  ? 128.487 117.323 76.481  1.00 231.66 ? 364  PHE A C   1 
ATOM   2317 O  O   . PHE A 1 385  ? 128.280 116.914 77.625  1.00 231.73 ? 364  PHE A O   1 
ATOM   2318 C  CB  . PHE A 1 385  ? 130.755 116.318 76.264  1.00 73.95  ? 364  PHE A CB  1 
ATOM   2319 C  CG  . PHE A 1 385  ? 132.058 116.305 75.541  1.00 73.95  ? 364  PHE A CG  1 
ATOM   2320 C  CD1 . PHE A 1 385  ? 132.286 117.137 74.468  1.00 73.95  ? 364  PHE A CD1 1 
ATOM   2321 C  CD2 . PHE A 1 385  ? 133.060 115.452 75.936  1.00 73.95  ? 364  PHE A CD2 1 
ATOM   2322 C  CE1 . PHE A 1 385  ? 133.491 117.115 73.806  1.00 73.95  ? 364  PHE A CE1 1 
ATOM   2323 C  CE2 . PHE A 1 385  ? 134.264 115.427 75.274  1.00 73.95  ? 364  PHE A CE2 1 
ATOM   2324 C  CZ  . PHE A 1 385  ? 134.477 116.258 74.209  1.00 73.95  ? 364  PHE A CZ  1 
ATOM   2325 N  N   . GLN A 1 386  ? 127.505 117.587 75.634  1.00 18.28  ? 365  GLN A N   1 
ATOM   2326 C  CA  . GLN A 1 386  ? 126.134 117.269 75.982  1.00 18.28  ? 365  GLN A CA  1 
ATOM   2327 C  C   . GLN A 1 386  ? 125.934 115.772 75.856  1.00 18.28  ? 365  GLN A C   1 
ATOM   2328 O  O   . GLN A 1 386  ? 126.558 115.123 75.017  1.00 18.28  ? 365  GLN A O   1 
ATOM   2329 C  CB  . GLN A 1 386  ? 125.170 117.979 75.046  1.00 18.28  ? 365  GLN A CB  1 
ATOM   2330 C  CG  . GLN A 1 386  ? 125.390 119.459 74.948  1.00 18.28  ? 365  GLN A CG  1 
ATOM   2331 C  CD  . GLN A 1 386  ? 125.040 120.183 76.200  1.00 18.28  ? 365  GLN A CD  1 
ATOM   2332 O  OE1 . GLN A 1 386  ? 125.911 120.603 76.954  1.00 18.28  ? 365  GLN A OE1 1 
ATOM   2333 N  NE2 . GLN A 1 386  ? 123.755 120.379 76.413  1.00 18.28  ? 365  GLN A NE2 1 
ATOM   2334 N  N   . LEU A 1 387  ? 125.056 115.220 76.687  1.00 29.81  ? 366  LEU A N   1 
ATOM   2335 C  CA  . LEU A 1 387  ? 124.657 113.827 76.553  1.00 29.81  ? 366  LEU A CA  1 
ATOM   2336 C  C   . LEU A 1 387  ? 123.171 113.685 76.809  1.00 29.81  ? 366  LEU A C   1 
ATOM   2337 O  O   . LEU A 1 387  ? 122.542 114.535 77.438  1.00 29.81  ? 366  LEU A O   1 
ATOM   2338 C  CB  . LEU A 1 387  ? 125.391 112.893 77.509  1.00 29.81  ? 366  LEU A CB  1 
ATOM   2339 C  CG  . LEU A 1 387  ? 126.856 112.595 77.275  1.00 29.81  ? 366  LEU A CG  1 
ATOM   2340 C  CD1 . LEU A 1 387  ? 127.322 111.652 78.344  1.00 29.81  ? 366  LEU A CD1 1 
ATOM   2341 C  CD2 . LEU A 1 387  ? 127.029 111.982 75.933  1.00 29.81  ? 366  LEU A CD2 1 
ATOM   2342 N  N   . MET A 1 388  ? 122.626 112.577 76.328  1.00 33.19  ? 367  MET A N   1 
ATOM   2343 C  CA  . MET A 1 388  ? 121.244 112.230 76.588  1.00 33.19  ? 367  MET A CA  1 
ATOM   2344 C  C   . MET A 1 388  ? 121.105 111.697 78.003  1.00 33.19  ? 367  MET A C   1 
ATOM   2345 O  O   . MET A 1 388  ? 121.960 110.953 78.485  1.00 33.19  ? 367  MET A O   1 
ATOM   2346 C  CB  . MET A 1 388  ? 120.769 111.171 75.602  1.00 33.19  ? 367  MET A CB  1 
ATOM   2347 C  CG  . MET A 1 388  ? 120.792 111.603 74.165  1.00 33.19  ? 367  MET A CG  1 
ATOM   2348 S  SD  . MET A 1 388  ? 120.129 110.361 73.054  1.00 33.19  ? 367  MET A SD  1 
ATOM   2349 C  CE  . MET A 1 388  ? 121.460 109.182 73.069  1.00 33.19  ? 367  MET A CE  1 
ATOM   2350 N  N   . THR A 1 389  ? 120.030 112.092 78.672  1.00 46.91  ? 368  THR A N   1 
ATOM   2351 C  CA  . THR A 1 389  ? 119.670 111.500 79.943  1.00 46.91  ? 368  THR A CA  1 
ATOM   2352 C  C   . THR A 1 389  ? 119.164 110.075 79.711  1.00 46.91  ? 368  THR A C   1 
ATOM   2353 O  O   . THR A 1 389  ? 118.792 109.735 78.587  1.00 46.91  ? 368  THR A O   1 
ATOM   2354 C  CB  . THR A 1 389  ? 118.612 112.368 80.614  1.00 46.91  ? 368  THR A CB  1 
ATOM   2355 O  OG1 . THR A 1 389  ? 117.496 112.513 79.735  1.00 46.91  ? 368  THR A OG1 1 
ATOM   2356 C  CG2 . THR A 1 389  ? 119.184 113.718 80.928  1.00 46.91  ? 368  THR A CG2 1 
ATOM   2357 N  N   . PRO A 1 390  ? 119.176 109.211 80.742  1.00 49.65  ? 369  PRO A N   1 
ATOM   2358 C  CA  . PRO A 1 390  ? 118.772 107.811 80.526  1.00 49.65  ? 369  PRO A CA  1 
ATOM   2359 C  C   . PRO A 1 390  ? 117.350 107.615 80.045  1.00 49.65  ? 369  PRO A C   1 
ATOM   2360 O  O   . PRO A 1 390  ? 117.077 106.600 79.395  1.00 49.65  ? 369  PRO A O   1 
ATOM   2361 C  CB  . PRO A 1 390  ? 118.975 107.176 81.902  1.00 49.65  ? 369  PRO A CB  1 
ATOM   2362 C  CG  . PRO A 1 390  ? 120.028 107.950 82.489  1.00 49.65  ? 369  PRO A CG  1 
ATOM   2363 C  CD  . PRO A 1 390  ? 119.833 109.349 82.054  1.00 49.65  ? 369  PRO A CD  1 
ATOM   2364 N  N   . LYS A 1 391  ? 116.437 108.544 80.310  1.00 61.02  ? 370  LYS A N   1 
ATOM   2365 C  CA  . LYS A 1 391  ? 115.130 108.442 79.679  1.00 61.02  ? 370  LYS A CA  1 
ATOM   2366 C  C   . LYS A 1 391  ? 115.213 108.782 78.198  1.00 61.02  ? 370  LYS A C   1 
ATOM   2367 O  O   . LYS A 1 391  ? 114.552 108.142 77.374  1.00 61.02  ? 370  LYS A O   1 
ATOM   2368 C  CB  . LYS A 1 391  ? 114.128 109.341 80.391  1.00 61.02  ? 370  LYS A CB  1 
ATOM   2369 C  CG  . LYS A 1 391  ? 112.728 109.298 79.808  1.00 61.02  ? 370  LYS A CG  1 
ATOM   2370 C  CD  . LYS A 1 391  ? 112.122 107.913 79.893  1.00 61.02  ? 370  LYS A CD  1 
ATOM   2371 C  CE  . LYS A 1 391  ? 111.833 107.521 81.328  1.00 61.02  ? 370  LYS A CE  1 
ATOM   2372 N  NZ  . LYS A 1 391  ? 110.723 108.314 81.914  1.00 61.02  ? 370  LYS A NZ  1 
ATOM   2373 N  N   . GLN A 1 392  ? 116.038 109.770 77.837  1.00 55.57  ? 371  GLN A N   1 
ATOM   2374 C  CA  . GLN A 1 392  ? 116.234 110.094 76.428  1.00 55.57  ? 371  GLN A CA  1 
ATOM   2375 C  C   . GLN A 1 392  ? 116.912 108.953 75.686  1.00 55.57  ? 371  GLN A C   1 
ATOM   2376 O  O   . GLN A 1 392  ? 116.585 108.682 74.527  1.00 55.57  ? 371  GLN A O   1 
ATOM   2377 C  CB  . GLN A 1 392  ? 117.055 111.371 76.289  1.00 55.57  ? 371  GLN A CB  1 
ATOM   2378 C  CG  . GLN A 1 392  ? 116.340 112.649 76.659  1.00 55.57  ? 371  GLN A CG  1 
ATOM   2379 C  CD  . GLN A 1 392  ? 115.243 113.010 75.686  1.00 55.57  ? 371  GLN A CD  1 
ATOM   2380 O  OE1 . GLN A 1 392  ? 114.059 112.949 76.014  1.00 55.57  ? 371  GLN A OE1 1 
ATOM   2381 N  NE2 . GLN A 1 392  ? 115.633 113.397 74.481  1.00 55.57  ? 371  GLN A NE2 1 
ATOM   2382 N  N   . MET A 1 393  ? 117.842 108.260 76.341  1.00 53.15  ? 372  MET A N   1 
ATOM   2383 C  CA  . MET A 1 393  ? 118.507 107.140 75.692  1.00 53.15  ? 372  MET A CA  1 
ATOM   2384 C  C   . MET A 1 393  ? 117.607 105.915 75.618  1.00 53.15  ? 372  MET A C   1 
ATOM   2385 O  O   . MET A 1 393  ? 117.670 105.167 74.640  1.00 53.15  ? 372  MET A O   1 
ATOM   2386 C  CB  . MET A 1 393  ? 119.803 106.803 76.422  1.00 53.15  ? 372  MET A CB  1 
ATOM   2387 C  CG  . MET A 1 393  ? 120.625 105.761 75.724  1.00 53.15  ? 372  MET A CG  1 
ATOM   2388 S  SD  . MET A 1 393  ? 122.144 105.338 76.563  1.00 53.15  ? 372  MET A SD  1 
ATOM   2389 C  CE  . MET A 1 393  ? 122.660 103.963 75.543  1.00 53.15  ? 372  MET A CE  1 
ATOM   2390 N  N   . TYR A 1 394  ? 116.764 105.702 76.631  1.00 47.82  ? 373  TYR A N   1 
ATOM   2391 C  CA  . TYR A 1 394  ? 115.770 104.638 76.550  1.00 47.82  ? 373  TYR A CA  1 
ATOM   2392 C  C   . TYR A 1 394  ? 114.786 104.891 75.423  1.00 47.82  ? 373  TYR A C   1 
ATOM   2393 O  O   . TYR A 1 394  ? 114.408 103.963 74.702  1.00 47.82  ? 373  TYR A O   1 
ATOM   2394 C  CB  . TYR A 1 394  ? 115.011 104.501 77.866  1.00 47.82  ? 373  TYR A CB  1 
ATOM   2395 C  CG  . TYR A 1 394  ? 113.902 103.482 77.781  1.00 47.82  ? 373  TYR A CG  1 
ATOM   2396 C  CD1 . TYR A 1 394  ? 114.190 102.136 77.728  1.00 47.82  ? 373  TYR A CD1 1 
ATOM   2397 C  CD2 . TYR A 1 394  ? 112.569 103.867 77.750  1.00 47.82  ? 373  TYR A CD2 1 
ATOM   2398 C  CE1 . TYR A 1 394  ? 113.198 101.197 77.633  1.00 47.82  ? 373  TYR A CE1 1 
ATOM   2399 C  CE2 . TYR A 1 394  ? 111.565 102.931 77.659  1.00 47.82  ? 373  TYR A CE2 1 
ATOM   2400 C  CZ  . TYR A 1 394  ? 111.891 101.596 77.603  1.00 47.82  ? 373  TYR A CZ  1 
ATOM   2401 O  OH  . TYR A 1 394  ? 110.910 100.642 77.514  1.00 47.82  ? 373  TYR A OH  1 
ATOM   2402 N  N   . GLU A 1 395  ? 114.360 106.139 75.256  1.00 60.33  ? 374  GLU A N   1 
ATOM   2403 C  CA  . GLU A 1 395  ? 113.446 106.456 74.171  1.00 60.33  ? 374  GLU A CA  1 
ATOM   2404 C  C   . GLU A 1 395  ? 114.145 106.514 72.821  1.00 60.33  ? 374  GLU A C   1 
ATOM   2405 O  O   . GLU A 1 395  ? 113.471 106.462 71.788  1.00 60.33  ? 374  GLU A O   1 
ATOM   2406 C  CB  . GLU A 1 395  ? 112.735 107.781 74.439  1.00 60.33  ? 374  GLU A CB  1 
ATOM   2407 C  CG  . GLU A 1 395  ? 111.833 107.783 75.657  1.00 60.33  ? 374  GLU A CG  1 
ATOM   2408 C  CD  . GLU A 1 395  ? 110.647 106.854 75.533  1.00 60.33  ? 374  GLU A CD  1 
ATOM   2409 O  OE1 . GLU A 1 395  ? 110.156 106.648 74.406  1.00 60.33  ? 374  GLU A OE1 1 
ATOM   2410 O  OE2 . GLU A 1 395  ? 110.189 106.337 76.573  1.00 60.33  ? 374  GLU A OE2 1 
ATOM   2411 N  N   . HIS A 1 396  ? 115.470 106.625 72.798  1.00 33.37  ? 375  HIS A N   1 
ATOM   2412 C  CA  . HIS A 1 396  ? 116.177 106.607 71.527  1.00 33.37  ? 375  HIS A CA  1 
ATOM   2413 C  C   . HIS A 1 396  ? 116.241 105.194 70.969  1.00 33.37  ? 375  HIS A C   1 
ATOM   2414 O  O   . HIS A 1 396  ? 115.679 104.909 69.910  1.00 33.37  ? 375  HIS A O   1 
ATOM   2415 C  CB  . HIS A 1 396  ? 117.574 107.195 71.704  1.00 33.37  ? 375  HIS A CB  1 
ATOM   2416 C  CG  . HIS A 1 396  ? 118.359 107.295 70.434  1.00 33.37  ? 375  HIS A CG  1 
ATOM   2417 N  ND1 . HIS A 1 396  ? 118.006 108.144 69.409  1.00 33.37  ? 375  HIS A ND1 1 
ATOM   2418 C  CD2 . HIS A 1 396  ? 119.509 106.698 70.047  1.00 33.37  ? 375  HIS A CD2 1 
ATOM   2419 C  CE1 . HIS A 1 396  ? 118.885 108.039 68.431  1.00 33.37  ? 375  HIS A CE1 1 
ATOM   2420 N  NE2 . HIS A 1 396  ? 119.809 107.169 68.794  1.00 33.37  ? 375  HIS A NE2 1 
ATOM   2421 N  N   . PHE A 1 397  ? 116.892 104.287 71.688  1.00 31.00  ? 376  PHE A N   1 
ATOM   2422 C  CA  . PHE A 1 397  ? 117.017 102.905 71.244  1.00 31.00  ? 376  PHE A CA  1 
ATOM   2423 C  C   . PHE A 1 397  ? 115.728 102.166 71.555  1.00 31.00  ? 376  PHE A C   1 
ATOM   2424 O  O   . PHE A 1 397  ? 115.455 101.832 72.709  1.00 31.00  ? 376  PHE A O   1 
ATOM   2425 C  CB  . PHE A 1 397  ? 118.191 102.224 71.926  1.00 31.00  ? 376  PHE A CB  1 
ATOM   2426 C  CG  . PHE A 1 397  ? 119.503 102.769 71.531  1.00 31.00  ? 376  PHE A CG  1 
ATOM   2427 C  CD1 . PHE A 1 397  ? 120.113 102.351 70.380  1.00 31.00  ? 376  PHE A CD1 1 
ATOM   2428 C  CD2 . PHE A 1 397  ? 120.117 103.721 72.306  1.00 31.00  ? 376  PHE A CD2 1 
ATOM   2429 C  CE1 . PHE A 1 397  ? 121.325 102.859 70.016  1.00 31.00  ? 376  PHE A CE1 1 
ATOM   2430 C  CE2 . PHE A 1 397  ? 121.323 104.235 71.955  1.00 31.00  ? 376  PHE A CE2 1 
ATOM   2431 C  CZ  . PHE A 1 397  ? 121.931 103.810 70.806  1.00 31.00  ? 376  PHE A CZ  1 
ATOM   2432 N  N   . LYS A 1 398  ? 114.937 101.911 70.534  1.00 59.80  ? 377  LYS A N   1 
ATOM   2433 C  CA  . LYS A 1 398  ? 113.733 101.103 70.660  1.00 59.80  ? 377  LYS A CA  1 
ATOM   2434 C  C   . LYS A 1 398  ? 113.835 100.087 69.534  1.00 59.80  ? 377  LYS A C   1 
ATOM   2435 O  O   . LYS A 1 398  ? 113.255 100.254 68.461  1.00 59.80  ? 377  LYS A O   1 
ATOM   2436 C  CB  . LYS A 1 398  ? 112.505 101.970 70.561  1.00 59.80  ? 377  LYS A CB  1 
ATOM   2437 C  CG  . LYS A 1 398  ? 111.210 101.308 70.919  1.00 59.80  ? 377  LYS A CG  1 
ATOM   2438 C  CD  . LYS A 1 398  ? 110.077 102.311 70.779  1.00 59.80  ? 377  LYS A CD  1 
ATOM   2439 C  CE  . LYS A 1 398  ? 110.177 103.401 71.834  1.00 59.80  ? 377  LYS A CE  1 
ATOM   2440 N  NZ  . LYS A 1 398  ? 109.946 102.890 73.212  1.00 59.80  ? 377  LYS A NZ  1 
ATOM   2441 N  N   . GLY A 1 399  ? 114.587 99.027  69.789  1.00 54.64  ? 378  GLY A N   1 
ATOM   2442 C  CA  . GLY A 1 399  ? 114.885 98.045  68.771  1.00 54.64  ? 378  GLY A CA  1 
ATOM   2443 C  C   . GLY A 1 399  ? 115.718 98.561  67.616  1.00 54.64  ? 378  GLY A C   1 
ATOM   2444 O  O   . GLY A 1 399  ? 115.227 98.611  66.485  1.00 54.64  ? 378  GLY A O   1 
ATOM   2445 N  N   . TYR A 1 400  ? 116.967 98.955  67.864  1.00 52.09  ? 379  TYR A N   1 
ATOM   2446 C  CA  . TYR A 1 400  ? 117.903 99.232  66.780  1.00 52.09  ? 379  TYR A CA  1 
ATOM   2447 C  C   . TYR A 1 400  ? 118.861 98.073  66.553  1.00 52.09  ? 379  TYR A C   1 
ATOM   2448 O  O   . TYR A 1 400  ? 120.006 98.292  66.146  1.00 52.09  ? 379  TYR A O   1 
ATOM   2449 C  CB  . TYR A 1 400  ? 118.723 100.502 67.020  1.00 52.09  ? 379  TYR A CB  1 
ATOM   2450 C  CG  . TYR A 1 400  ? 118.013 101.833 66.905  1.00 52.09  ? 379  TYR A CG  1 
ATOM   2451 C  CD1 . TYR A 1 400  ? 116.655 101.915 66.661  1.00 52.09  ? 379  TYR A CD1 1 
ATOM   2452 C  CD2 . TYR A 1 400  ? 118.739 103.013 66.944  1.00 52.09  ? 379  TYR A CD2 1 
ATOM   2453 C  CE1 . TYR A 1 400  ? 116.027 103.137 66.547  1.00 52.09  ? 379  TYR A CE1 1 
ATOM   2454 C  CE2 . TYR A 1 400  ? 118.121 104.234 66.816  1.00 52.09  ? 379  TYR A CE2 1 
ATOM   2455 C  CZ  . TYR A 1 400  ? 116.768 104.290 66.619  1.00 52.09  ? 379  TYR A CZ  1 
ATOM   2456 O  OH  . TYR A 1 400  ? 116.148 105.507 66.489  1.00 52.09  ? 379  TYR A OH  1 
ATOM   2457 N  N   . GLU A 1 401  ? 118.414 96.848  66.836  1.00 56.88  ? 380  GLU A N   1 
ATOM   2458 C  CA  . GLU A 1 401  ? 119.254 95.645  66.952  1.00 56.88  ? 380  GLU A CA  1 
ATOM   2459 C  C   . GLU A 1 401  ? 120.398 95.841  67.972  1.00 56.88  ? 380  GLU A C   1 
ATOM   2460 O  O   . GLU A 1 401  ? 121.459 95.219  67.887  1.00 56.88  ? 380  GLU A O   1 
ATOM   2461 C  CB  . GLU A 1 401  ? 119.781 95.176  65.583  1.00 56.88  ? 380  GLU A CB  1 
ATOM   2462 C  CG  . GLU A 1 401  ? 120.133 93.671  65.508  1.00 56.88  ? 380  GLU A CG  1 
ATOM   2463 C  CD  . GLU A 1 401  ? 120.850 93.263  64.239  1.00 56.88  ? 380  GLU A CD  1 
ATOM   2464 O  OE1 . GLU A 1 401  ? 121.114 94.131  63.388  1.00 56.88  ? 380  GLU A OE1 1 
ATOM   2465 O  OE2 . GLU A 1 401  ? 121.176 92.068  64.102  1.00 56.88  ? 380  GLU A OE2 1 
ATOM   2466 N  N   . TYR A 1 402  ? 120.209 96.729  68.945  1.00 54.58  ? 381  TYR A N   1 
ATOM   2467 C  CA  . TYR A 1 402  ? 120.888 96.651  70.228  1.00 54.58  ? 381  TYR A CA  1 
ATOM   2468 C  C   . TYR A 1 402  ? 119.920 96.223  71.312  1.00 54.58  ? 381  TYR A C   1 
ATOM   2469 O  O   . TYR A 1 402  ? 120.278 96.198  72.491  1.00 54.58  ? 381  TYR A O   1 
ATOM   2470 C  CB  . TYR A 1 402  ? 121.525 97.985  70.621  1.00 54.58  ? 381  TYR A CB  1 
ATOM   2471 C  CG  . TYR A 1 402  ? 122.768 98.395  69.870  1.00 54.58  ? 381  TYR A CG  1 
ATOM   2472 C  CD1 . TYR A 1 402  ? 123.326 97.597  68.891  1.00 54.58  ? 381  TYR A CD1 1 
ATOM   2473 C  CD2 . TYR A 1 402  ? 123.430 99.555  70.218  1.00 54.58  ? 381  TYR A CD2 1 
ATOM   2474 C  CE1 . TYR A 1 402  ? 124.471 97.983  68.241  1.00 54.58  ? 381  TYR A CE1 1 
ATOM   2475 C  CE2 . TYR A 1 402  ? 124.571 99.939  69.587  1.00 54.58  ? 381  TYR A CE2 1 
ATOM   2476 C  CZ  . TYR A 1 402  ? 125.087 99.155  68.601  1.00 54.58  ? 381  TYR A CZ  1 
ATOM   2477 O  OH  . TYR A 1 402  ? 126.237 99.552  67.971  1.00 54.58  ? 381  TYR A OH  1 
ATOM   2478 N  N   . VAL A 1 403  ? 118.681 95.953  70.925  1.00 59.69  ? 382  VAL A N   1 
ATOM   2479 C  CA  . VAL A 1 403  ? 117.652 95.345  71.747  1.00 59.69  ? 382  VAL A CA  1 
ATOM   2480 C  C   . VAL A 1 403  ? 117.396 93.904  71.308  1.00 59.69  ? 382  VAL A C   1 
ATOM   2481 O  O   . VAL A 1 403  ? 116.706 93.146  72.003  1.00 59.69  ? 382  VAL A O   1 
ATOM   2482 C  CB  . VAL A 1 403  ? 116.381 96.224  71.691  1.00 59.69  ? 382  VAL A CB  1 
ATOM   2483 C  CG1 . VAL A 1 403  ? 115.240 95.815  72.639  1.00 59.69  ? 382  VAL A CG1 1 
ATOM   2484 C  CG2 . VAL A 1 403  ? 116.769 97.661  71.974  1.00 59.69  ? 382  VAL A CG2 1 
ATOM   2485 N  N   . SER A 1 404  ? 118.047 93.465  70.232  1.00 57.10  ? 383  SER A N   1 
ATOM   2486 C  CA  . SER A 1 404  ? 117.855 92.112  69.732  1.00 57.10  ? 383  SER A CA  1 
ATOM   2487 C  C   . SER A 1 404  ? 118.485 91.040  70.609  1.00 57.10  ? 383  SER A C   1 
ATOM   2488 O  O   . SER A 1 404  ? 118.341 89.855  70.295  1.00 57.10  ? 383  SER A O   1 
ATOM   2489 C  CB  . SER A 1 404  ? 118.433 91.994  68.333  1.00 57.10  ? 383  SER A CB  1 
ATOM   2490 O  OG  . SER A 1 404  ? 119.837 92.137  68.387  1.00 57.10  ? 383  SER A OG  1 
ATOM   2491 N  N   . HIS A 1 405  ? 119.187 91.407  71.675  1.00 53.59  ? 384  HIS A N   1 
ATOM   2492 C  CA  . HIS A 1 405  ? 119.727 90.424  72.593  1.00 53.59  ? 384  HIS A CA  1 
ATOM   2493 C  C   . HIS A 1 405  ? 119.442 90.724  74.054  1.00 53.59  ? 384  HIS A C   1 
ATOM   2494 O  O   . HIS A 1 405  ? 119.638 89.841  74.890  1.00 53.59  ? 384  HIS A O   1 
ATOM   2495 C  CB  . HIS A 1 405  ? 121.240 90.275  72.382  1.00 53.59  ? 384  HIS A CB  1 
ATOM   2496 C  CG  . HIS A 1 405  ? 122.023 91.517  72.665  1.00 53.59  ? 384  HIS A CG  1 
ATOM   2497 N  ND1 . HIS A 1 405  ? 122.057 92.589  71.801  1.00 53.59  ? 384  HIS A ND1 1 
ATOM   2498 C  CD2 . HIS A 1 405  ? 122.844 91.835  73.690  1.00 53.59  ? 384  HIS A CD2 1 
ATOM   2499 C  CE1 . HIS A 1 405  ? 122.839 93.528  72.301  1.00 53.59  ? 384  HIS A CE1 1 
ATOM   2500 N  NE2 . HIS A 1 405  ? 123.333 93.093  73.443  1.00 53.59  ? 384  HIS A NE2 1 
ATOM   2501 N  N   . ILE A 1 406  ? 118.976 91.921  74.390  1.00 50.91  ? 385  ILE A N   1 
ATOM   2502 C  CA  . ILE A 1 406  ? 118.643 92.264  75.761  1.00 50.91  ? 385  ILE A CA  1 
ATOM   2503 C  C   . ILE A 1 406  ? 117.292 92.952  75.796  1.00 50.91  ? 385  ILE A C   1 
ATOM   2504 O  O   . ILE A 1 406  ? 116.846 93.558  74.824  1.00 50.91  ? 385  ILE A O   1 
ATOM   2505 C  CB  . ILE A 1 406  ? 119.696 93.173  76.418  1.00 50.91  ? 385  ILE A CB  1 
ATOM   2506 C  CG1 . ILE A 1 406  ? 119.944 94.400  75.545  1.00 50.91  ? 385  ILE A CG1 1 
ATOM   2507 C  CG2 . ILE A 1 406  ? 120.976 92.415  76.715  1.00 50.91  ? 385  ILE A CG2 1 
ATOM   2508 C  CD1 . ILE A 1 406  ? 120.712 95.468  76.227  1.00 50.91  ? 385  ILE A CD1 1 
ATOM   2509 N  N   . ASN A 1 407  ? 116.650 92.870  76.953  1.00 60.79  ? 386  ASN A N   1 
ATOM   2510 C  CA  . ASN A 1 407  ? 115.374 93.536  77.181  1.00 60.79  ? 386  ASN A CA  1 
ATOM   2511 C  C   . ASN A 1 407  ? 115.674 94.955  77.642  1.00 60.79  ? 386  ASN A C   1 
ATOM   2512 O  O   . ASN A 1 407  ? 116.071 95.173  78.789  1.00 60.79  ? 386  ASN A O   1 
ATOM   2513 C  CB  . ASN A 1 407  ? 114.546 92.759  78.199  1.00 60.79  ? 386  ASN A CB  1 
ATOM   2514 C  CG  . ASN A 1 407  ? 114.102 91.414  77.666  1.00 60.79  ? 386  ASN A CG  1 
ATOM   2515 O  OD1 . ASN A 1 407  ? 113.693 91.297  76.516  1.00 60.79  ? 386  ASN A OD1 1 
ATOM   2516 N  ND2 . ASN A 1 407  ? 114.202 90.388  78.490  1.00 60.79  ? 386  ASN A ND2 1 
ATOM   2517 N  N   . TRP A 1 408  ? 115.480 95.915  76.747  1.00 48.33  ? 387  TRP A N   1 
ATOM   2518 C  CA  . TRP A 1 408  ? 115.994 97.263  76.926  1.00 48.33  ? 387  TRP A CA  1 
ATOM   2519 C  C   . TRP A 1 408  ? 115.186 98.032  77.969  1.00 48.33  ? 387  TRP A C   1 
ATOM   2520 O  O   . TRP A 1 408  ? 113.964 98.141  77.861  1.00 48.33  ? 387  TRP A O   1 
ATOM   2521 C  CB  . TRP A 1 408  ? 115.972 97.975  75.579  1.00 48.33  ? 387  TRP A CB  1 
ATOM   2522 C  CG  . TRP A 1 408  ? 116.642 99.280  75.553  1.00 48.33  ? 387  TRP A CG  1 
ATOM   2523 C  CD1 . TRP A 1 408  ? 116.052 100.489 75.507  1.00 48.33  ? 387  TRP A CD1 1 
ATOM   2524 C  CD2 . TRP A 1 408  ? 118.043 99.515  75.559  1.00 48.33  ? 387  TRP A CD2 1 
ATOM   2525 N  NE1 . TRP A 1 408  ? 116.994 101.479 75.496  1.00 48.33  ? 387  TRP A NE1 1 
ATOM   2526 C  CE2 . TRP A 1 408  ? 118.230 100.899 75.528  1.00 48.33  ? 387  TRP A CE2 1 
ATOM   2527 C  CE3 . TRP A 1 408  ? 119.158 98.688  75.595  1.00 48.33  ? 387  TRP A CE3 1 
ATOM   2528 C  CZ2 . TRP A 1 408  ? 119.481 101.473 75.532  1.00 48.33  ? 387  TRP A CZ2 1 
ATOM   2529 C  CZ3 . TRP A 1 408  ? 120.393 99.257  75.598  1.00 48.33  ? 387  TRP A CZ3 1 
ATOM   2530 C  CH2 . TRP A 1 408  ? 120.551 100.635 75.566  1.00 48.33  ? 387  TRP A CH2 1 
ATOM   2531 N  N   . ASN A 1 409  ? 115.877 98.557  78.983  1.00 68.87  ? 388  ASN A N   1 
ATOM   2532 C  CA  . ASN A 1 409  ? 115.282 99.311  80.081  1.00 68.87  ? 388  ASN A CA  1 
ATOM   2533 C  C   . ASN A 1 409  ? 116.260 100.388 80.519  1.00 68.87  ? 388  ASN A C   1 
ATOM   2534 O  O   . ASN A 1 409  ? 117.473 100.189 80.455  1.00 68.87  ? 388  ASN A O   1 
ATOM   2535 C  CB  . ASN A 1 409  ? 114.968 98.416  81.275  1.00 68.87  ? 388  ASN A CB  1 
ATOM   2536 C  CG  . ASN A 1 409  ? 113.822 97.484  81.016  1.00 68.87  ? 388  ASN A CG  1 
ATOM   2537 O  OD1 . ASN A 1 409  ? 112.794 97.885  80.477  1.00 68.87  ? 388  ASN A OD1 1 
ATOM   2538 N  ND2 . ASN A 1 409  ? 113.989 96.222  81.391  1.00 68.87  ? 388  ASN A ND2 1 
ATOM   2539 N  N   . GLU A 1 410  ? 115.737 101.516 81.009  1.00 70.81  ? 389  GLU A N   1 
ATOM   2540 C  CA  . GLU A 1 410  ? 116.605 102.659 81.288  1.00 70.81  ? 389  GLU A CA  1 
ATOM   2541 C  C   . GLU A 1 410  ? 117.483 102.486 82.522  1.00 70.81  ? 389  GLU A C   1 
ATOM   2542 O  O   . GLU A 1 410  ? 118.315 103.361 82.786  1.00 70.81  ? 389  GLU A O   1 
ATOM   2543 C  CB  . GLU A 1 410  ? 115.803 103.950 81.440  1.00 70.81  ? 389  GLU A CB  1 
ATOM   2544 C  CG  . GLU A 1 410  ? 114.909 104.009 82.645  1.00 70.81  ? 389  GLU A CG  1 
ATOM   2545 C  CD  . GLU A 1 410  ? 113.496 103.598 82.323  1.00 70.81  ? 389  GLU A CD  1 
ATOM   2546 O  OE1 . GLU A 1 410  ? 113.268 103.074 81.215  1.00 70.81  ? 389  GLU A OE1 1 
ATOM   2547 O  OE2 . GLU A 1 410  ? 112.611 103.795 83.178  1.00 70.81  ? 389  GLU A OE2 1 
ATOM   2548 N  N   . ASP A 1 411  ? 117.331 101.404 83.283  1.00 91.49  ? 390  ASP A N   1 
ATOM   2549 C  CA  . ASP A 1 411  ? 118.368 101.063 84.248  1.00 91.49  ? 390  ASP A CA  1 
ATOM   2550 C  C   . ASP A 1 411  ? 119.636 100.623 83.537  1.00 91.49  ? 390  ASP A C   1 
ATOM   2551 O  O   . ASP A 1 411  ? 120.749 100.971 83.958  1.00 91.49  ? 390  ASP A O   1 
ATOM   2552 C  CB  . ASP A 1 411  ? 117.882 99.972  85.191  1.00 91.49  ? 390  ASP A CB  1 
ATOM   2553 C  CG  . ASP A 1 411  ? 116.871 100.480 86.188  1.00 91.49  ? 390  ASP A CG  1 
ATOM   2554 O  OD1 . ASP A 1 411  ? 116.958 101.667 86.563  1.00 91.49  ? 390  ASP A OD1 1 
ATOM   2555 O  OD2 . ASP A 1 411  ? 115.984 99.701  86.596  1.00 91.49  ? 390  ASP A OD2 1 
ATOM   2556 N  N   . LYS A 1 412  ? 119.481 99.869  82.443  1.00 71.31  ? 391  LYS A N   1 
ATOM   2557 C  CA  . LYS A 1 412  ? 120.633 99.470  81.646  1.00 71.31  ? 391  LYS A CA  1 
ATOM   2558 C  C   . LYS A 1 412  ? 121.283 100.679 80.990  1.00 71.31  ? 391  LYS A C   1 
ATOM   2559 O  O   . LYS A 1 412  ? 122.512 100.802 80.988  1.00 71.31  ? 391  LYS A O   1 
ATOM   2560 C  CB  . LYS A 1 412  ? 120.215 98.449  80.593  1.00 71.31  ? 391  LYS A CB  1 
ATOM   2561 C  CG  . LYS A 1 412  ? 119.628 97.191  81.177  1.00 71.31  ? 391  LYS A CG  1 
ATOM   2562 C  CD  . LYS A 1 412  ? 119.323 96.151  80.123  1.00 71.31  ? 391  LYS A CD  1 
ATOM   2563 C  CE  . LYS A 1 412  ? 118.661 94.946  80.762  1.00 71.31  ? 391  LYS A CE  1 
ATOM   2564 N  NZ  . LYS A 1 412  ? 119.578 94.258  81.703  1.00 71.31  ? 391  LYS A NZ  1 
ATOM   2565 N  N   . ALA A 1 413  ? 120.467 101.604 80.479  1.00 147.97 ? 392  ALA A N   1 
ATOM   2566 C  CA  . ALA A 1 413  ? 120.997 102.811 79.858  1.00 145.63 ? 392  ALA A CA  1 
ATOM   2567 C  C   . ALA A 1 413  ? 121.676 103.714 80.875  1.00 145.01 ? 392  ALA A C   1 
ATOM   2568 O  O   . ALA A 1 413  ? 122.708 104.325 80.574  1.00 143.97 ? 392  ALA A O   1 
ATOM   2569 C  CB  . ALA A 1 413  ? 119.879 103.567 79.155  1.00 120.83 ? 392  ALA A CB  1 
ATOM   2570 N  N   . ALA A 1 414  ? 121.123 103.801 82.086  1.00 104.21 ? 393  ALA A N   1 
ATOM   2571 C  CA  . ALA A 1 414  ? 121.763 104.602 83.123  1.00 104.11 ? 393  ALA A CA  1 
ATOM   2572 C  C   . ALA A 1 414  ? 123.072 103.982 83.580  1.00 103.01 ? 393  ALA A C   1 
ATOM   2573 O  O   . ALA A 1 414  ? 124.001 104.706 83.954  1.00 101.85 ? 393  ALA A O   1 
ATOM   2574 C  CB  . ALA A 1 414  ? 120.822 104.776 84.310  1.00 117.88 ? 393  ALA A CB  1 
ATOM   2575 N  N   . ALA A 1 415  ? 123.168 102.653 83.539  1.00 93.48  ? 394  ALA A N   1 
ATOM   2576 C  CA  . ALA A 1 415  ? 124.434 102.005 83.856  1.00 93.79  ? 394  ALA A CA  1 
ATOM   2577 C  C   . ALA A 1 415  ? 125.465 102.235 82.757  1.00 90.55  ? 394  ALA A C   1 
ATOM   2578 O  O   . ALA A 1 415  ? 126.657 102.410 83.048  1.00 89.66  ? 394  ALA A O   1 
ATOM   2579 C  CB  . ALA A 1 415  ? 124.200 100.520 84.088  1.00 127.02 ? 394  ALA A CB  1 
ATOM   2580 N  N   . ILE A 1 416  ? 125.020 102.249 81.494  1.00 61.42  ? 395  ILE A N   1 
ATOM   2581 C  CA  . ILE A 1 416  ? 125.905 102.555 80.367  1.00 59.58  ? 395  ILE A CA  1 
ATOM   2582 C  C   . ILE A 1 416  ? 126.449 103.972 80.478  1.00 58.55  ? 395  ILE A C   1 
ATOM   2583 O  O   . ILE A 1 416  ? 127.661 104.204 80.361  1.00 57.77  ? 395  ILE A O   1 
ATOM   2584 C  CB  . ILE A 1 416  ? 125.163 102.353 79.035  1.00 108.02 ? 395  ILE A CB  1 
ATOM   2585 C  CG1 . ILE A 1 416  ? 124.866 100.875 78.800  1.00 108.02 ? 395  ILE A CG1 1 
ATOM   2586 C  CG2 . ILE A 1 416  ? 125.964 102.906 77.895  1.00 108.02 ? 395  ILE A CG2 1 
ATOM   2587 C  CD1 . ILE A 1 416  ? 123.829 100.612 77.734  1.00 108.02 ? 395  ILE A CD1 1 
ATOM   2588 N  N   . LEU A 1 417  ? 125.557 104.934 80.718  1.00 45.94  ? 396  LEU A N   1 
ATOM   2589 C  CA  . LEU A 1 417  ? 125.967 106.324 80.868  1.00 46.08  ? 396  LEU A CA  1 
ATOM   2590 C  C   . LEU A 1 417  ? 126.855 106.526 82.086  1.00 46.50  ? 396  LEU A C   1 
ATOM   2591 O  O   . LEU A 1 417  ? 127.787 107.337 82.034  1.00 45.38  ? 396  LEU A O   1 
ATOM   2592 C  CB  . LEU A 1 417  ? 124.736 107.219 80.948  1.00 111.18 ? 396  LEU A CB  1 
ATOM   2593 C  CG  . LEU A 1 417  ? 123.965 107.362 79.641  1.00 111.18 ? 396  LEU A CG  1 
ATOM   2594 C  CD1 . LEU A 1 417  ? 122.645 108.030 79.861  1.00 111.18 ? 396  LEU A CD1 1 
ATOM   2595 C  CD2 . LEU A 1 417  ? 124.771 108.195 78.697  1.00 111.18 ? 396  LEU A CD2 1 
ATOM   2596 N  N   . GLU A 1 418  ? 126.621 105.769 83.163  1.00 47.72  ? 397  GLU A N   1 
ATOM   2597 C  CA  . GLU A 1 418  ? 127.459 105.902 84.350  1.00 48.23  ? 397  GLU A CA  1 
ATOM   2598 C  C   . GLU A 1 418  ? 128.869 105.392 84.099  1.00 47.45  ? 397  GLU A C   1 
ATOM   2599 O  O   . GLU A 1 418  ? 129.848 106.060 84.465  1.00 47.93  ? 397  GLU A O   1 
ATOM   2600 C  CB  . GLU A 1 418  ? 126.829 105.169 85.530  1.00 113.16 ? 397  GLU A CB  1 
ATOM   2601 C  CG  . GLU A 1 418  ? 127.630 105.309 86.813  1.00 113.16 ? 397  GLU A CG  1 
ATOM   2602 C  CD  . GLU A 1 418  ? 126.926 104.737 88.033  1.00 113.16 ? 397  GLU A CD  1 
ATOM   2603 O  OE1 . GLU A 1 418  ? 125.791 104.241 87.893  1.00 113.16 ? 397  GLU A OE1 1 
ATOM   2604 O  OE2 . GLU A 1 418  ? 127.510 104.784 89.136  1.00 113.16 ? 397  GLU A OE2 1 
ATOM   2605 N  N   . ALA A 1 419  ? 128.994 104.227 83.457  1.00 72.50  ? 398  ALA A N   1 
ATOM   2606 C  CA  . ALA A 1 419  ? 130.323 103.710 83.153  1.00 71.05  ? 398  ALA A CA  1 
ATOM   2607 C  C   . ALA A 1 419  ? 131.057 104.589 82.146  1.00 71.09  ? 398  ALA A C   1 
ATOM   2608 O  O   . ALA A 1 419  ? 132.280 104.773 82.265  1.00 70.19  ? 398  ALA A O   1 
ATOM   2609 C  CB  . ALA A 1 419  ? 130.226 102.278 82.645  1.00 97.09  ? 398  ALA A CB  1 
ATOM   2610 N  N   . TRP A 1 420  ? 130.330 105.173 81.187  1.00 44.41  ? 399  TRP A N   1 
ATOM   2611 C  CA  . TRP A 1 420  ? 130.971 106.085 80.248  1.00 45.18  ? 399  TRP A CA  1 
ATOM   2612 C  C   . TRP A 1 420  ? 131.449 107.345 80.950  1.00 45.38  ? 399  TRP A C   1 
ATOM   2613 O  O   . TRP A 1 420  ? 132.496 107.893 80.597  1.00 45.09  ? 399  TRP A O   1 
ATOM   2614 C  CB  . TRP A 1 420  ? 130.023 106.482 79.123  1.00 85.96  ? 399  TRP A CB  1 
ATOM   2615 C  CG  . TRP A 1 420  ? 130.740 107.207 78.031  1.00 85.96  ? 399  TRP A CG  1 
ATOM   2616 C  CD1 . TRP A 1 420  ? 131.438 106.645 77.017  1.00 85.96  ? 399  TRP A CD1 1 
ATOM   2617 C  CD2 . TRP A 1 420  ? 130.925 108.621 77.910  1.00 85.96  ? 399  TRP A CD2 1 
ATOM   2618 N  NE1 . TRP A 1 420  ? 131.991 107.617 76.226  1.00 85.96  ? 399  TRP A NE1 1 
ATOM   2619 C  CE2 . TRP A 1 420  ? 131.706 108.840 76.768  1.00 85.96  ? 399  TRP A CE2 1 
ATOM   2620 C  CE3 . TRP A 1 420  ? 130.494 109.724 78.652  1.00 85.96  ? 399  TRP A CE3 1 
ATOM   2621 C  CZ2 . TRP A 1 420  ? 132.053 110.113 76.339  1.00 85.96  ? 399  TRP A CZ2 1 
ATOM   2622 C  CZ3 . TRP A 1 420  ? 130.849 110.980 78.229  1.00 85.96  ? 399  TRP A CZ3 1 
ATOM   2623 C  CH2 . TRP A 1 420  ? 131.618 111.169 77.087  1.00 85.96  ? 399  TRP A CH2 1 
ATOM   2624 N  N   . GLN A 1 421  ? 130.691 107.831 81.931  1.00 64.45  ? 400  GLN A N   1 
ATOM   2625 C  CA  . GLN A 1 421  ? 131.091 109.058 82.608  1.00 64.84  ? 400  GLN A CA  1 
ATOM   2626 C  C   . GLN A 1 421  ? 132.296 108.835 83.510  1.00 61.91  ? 400  GLN A C   1 
ATOM   2627 O  O   . GLN A 1 421  ? 133.182 109.698 83.588  1.00 61.35  ? 400  GLN A O   1 
ATOM   2628 C  CB  . GLN A 1 421  ? 129.916 109.633 83.385  1.00 90.35  ? 400  GLN A CB  1 
ATOM   2629 C  CG  . GLN A 1 421  ? 128.923 110.310 82.482  1.00 90.35  ? 400  GLN A CG  1 
ATOM   2630 C  CD  . GLN A 1 421  ? 127.663 110.704 83.193  1.00 90.35  ? 400  GLN A CD  1 
ATOM   2631 O  OE1 . GLN A 1 421  ? 127.483 110.398 84.363  1.00 90.35  ? 400  GLN A OE1 1 
ATOM   2632 N  NE2 . GLN A 1 421  ? 126.776 111.385 82.488  1.00 90.35  ? 400  GLN A NE2 1 
ATOM   2633 N  N   . ARG A 1 422  ? 132.367 107.680 84.177  1.00 97.88  ? 401  ARG A N   1 
ATOM   2634 C  CA  . ARG A 1 422  ? 133.543 107.415 85.002  1.00 98.69  ? 401  ARG A CA  1 
ATOM   2635 C  C   . ARG A 1 422  ? 134.780 107.202 84.143  1.00 96.08  ? 401  ARG A C   1 
ATOM   2636 O  O   . ARG A 1 422  ? 135.876 107.685 84.481  1.00 95.67  ? 401  ARG A O   1 
ATOM   2637 C  CB  . ARG A 1 422  ? 133.303 106.204 85.886  1.00 98.62  ? 401  ARG A CB  1 
ATOM   2638 C  CG  . ARG A 1 422  ? 132.192 106.389 86.867  1.00 98.62  ? 401  ARG A CG  1 
ATOM   2639 C  CD  . ARG A 1 422  ? 132.074 105.171 87.726  1.00 98.62  ? 401  ARG A CD  1 
ATOM   2640 N  NE  . ARG A 1 422  ? 130.883 105.222 88.554  1.00 98.62  ? 401  ARG A NE  1 
ATOM   2641 C  CZ  . ARG A 1 422  ? 130.826 105.826 89.734  1.00 98.62  ? 401  ARG A CZ  1 
ATOM   2642 N  NH1 . ARG A 1 422  ? 131.896 106.444 90.215  1.00 98.62  ? 401  ARG A NH1 1 
ATOM   2643 N  NH2 . ARG A 1 422  ? 129.696 105.820 90.429  1.00 98.62  ? 401  ARG A NH2 1 
ATOM   2644 N  N   . THR A 1 423  ? 134.610 106.510 83.010  1.00 44.82  ? 402  THR A N   1 
ATOM   2645 C  CA  . THR A 1 423  ? 135.708 106.343 82.068  1.00 42.33  ? 402  THR A CA  1 
ATOM   2646 C  C   . THR A 1 423  ? 136.158 107.681 81.498  1.00 41.40  ? 402  THR A C   1 
ATOM   2647 O  O   . THR A 1 423  ? 137.357 107.899 81.293  1.00 40.46  ? 402  THR A O   1 
ATOM   2648 C  CB  . THR A 1 423  ? 135.271 105.394 80.957  1.00 86.91  ? 402  THR A CB  1 
ATOM   2649 O  OG1 . THR A 1 423  ? 134.774 104.189 81.546  1.00 86.91  ? 402  THR A OG1 1 
ATOM   2650 C  CG2 . THR A 1 423  ? 136.436 105.034 80.055  1.00 86.91  ? 402  THR A CG2 1 
ATOM   2651 N  N   . TYR A 1 424  ? 135.209 108.593 81.283  1.00 67.38  ? 403  TYR A N   1 
ATOM   2652 C  CA  . TYR A 1 424  ? 135.519 109.950 80.850  1.00 68.34  ? 403  TYR A CA  1 
ATOM   2653 C  C   . TYR A 1 424  ? 136.408 110.663 81.851  1.00 70.06  ? 403  TYR A C   1 
ATOM   2654 O  O   . TYR A 1 424  ? 137.408 111.281 81.471  1.00 69.08  ? 403  TYR A O   1 
ATOM   2655 C  CB  . TYR A 1 424  ? 134.227 110.738 80.666  1.00 90.02  ? 403  TYR A CB  1 
ATOM   2656 C  CG  . TYR A 1 424  ? 134.434 112.189 80.344  1.00 90.02  ? 403  TYR A CG  1 
ATOM   2657 C  CD1 . TYR A 1 424  ? 134.745 112.585 79.065  1.00 90.02  ? 403  TYR A CD1 1 
ATOM   2658 C  CD2 . TYR A 1 424  ? 134.318 113.166 81.318  1.00 90.02  ? 403  TYR A CD2 1 
ATOM   2659 C  CE1 . TYR A 1 424  ? 134.925 113.913 78.763  1.00 90.02  ? 403  TYR A CE1 1 
ATOM   2660 C  CE2 . TYR A 1 424  ? 134.523 114.485 81.021  1.00 90.02  ? 403  TYR A CE2 1 
ATOM   2661 C  CZ  . TYR A 1 424  ? 134.813 114.853 79.749  1.00 90.02  ? 403  TYR A CZ  1 
ATOM   2662 O  OH  . TYR A 1 424  ? 134.994 116.177 79.461  1.00 90.02  ? 403  TYR A OH  1 
ATOM   2663 N  N   . VAL A 1 425  ? 136.038 110.609 83.136  1.00 123.03 ? 404  VAL A N   1 
ATOM   2664 C  CA  . VAL A 1 425  ? 136.771 111.342 84.168  1.00 126.15 ? 404  VAL A CA  1 
ATOM   2665 C  C   . VAL A 1 425  ? 138.190 110.803 84.318  1.00 124.63 ? 404  VAL A C   1 
ATOM   2666 O  O   . VAL A 1 425  ? 139.156 111.571 84.442  1.00 125.92 ? 404  VAL A O   1 
ATOM   2667 C  CB  . VAL A 1 425  ? 135.992 111.286 85.491  1.00 92.25  ? 404  VAL A CB  1 
ATOM   2668 C  CG1 . VAL A 1 425  ? 136.774 111.919 86.594  1.00 92.25  ? 404  VAL A CG1 1 
ATOM   2669 C  CG2 . VAL A 1 425  ? 134.697 112.019 85.347  1.00 92.25  ? 404  VAL A CG2 1 
ATOM   2670 N  N   . GLU A 1 426  ? 138.351 109.481 84.245  1.00 111.24 ? 405  GLU A N   1 
ATOM   2671 C  CA  . GLU A 1 426  ? 139.691 108.925 84.410  1.00 111.16 ? 405  GLU A CA  1 
ATOM   2672 C  C   . GLU A 1 426  ? 140.555 109.143 83.167  1.00 110.87 ? 405  GLU A C   1 
ATOM   2673 O  O   . GLU A 1 426  ? 141.761 109.394 83.287  1.00 113.89 ? 405  GLU A O   1 
ATOM   2674 C  CB  . GLU A 1 426  ? 139.581 107.450 84.768  1.00 110.41 ? 405  GLU A CB  1 
ATOM   2675 C  CG  . GLU A 1 426  ? 138.808 107.272 86.063  1.00 110.41 ? 405  GLU A CG  1 
ATOM   2676 C  CD  . GLU A 1 426  ? 138.622 105.832 86.458  1.00 110.41 ? 405  GLU A CD  1 
ATOM   2677 O  OE1 . GLU A 1 426  ? 139.038 104.944 85.689  1.00 110.41 ? 405  GLU A OE1 1 
ATOM   2678 O  OE2 . GLU A 1 426  ? 138.040 105.586 87.534  1.00 110.41 ? 405  GLU A OE2 1 
ATOM   2679 N  N   . VAL A 1 427  ? 139.955 109.094 81.970  1.00 139.21 ? 406  VAL A N   1 
ATOM   2680 C  CA  . VAL A 1 427  ? 140.712 109.333 80.738  1.00 138.68 ? 406  VAL A CA  1 
ATOM   2681 C  C   . VAL A 1 427  ? 141.133 110.795 80.622  1.00 138.94 ? 406  VAL A C   1 
ATOM   2682 O  O   . VAL A 1 427  ? 142.274 111.098 80.244  1.00 140.20 ? 406  VAL A O   1 
ATOM   2683 C  CB  . VAL A 1 427  ? 139.904 108.867 79.516  1.00 102.77 ? 406  VAL A CB  1 
ATOM   2684 C  CG1 . VAL A 1 427  ? 140.493 109.410 78.241  1.00 102.77 ? 406  VAL A CG1 1 
ATOM   2685 C  CG2 . VAL A 1 427  ? 139.955 107.365 79.445  1.00 102.77 ? 406  VAL A CG2 1 
ATOM   2686 N  N   . VAL A 1 428  ? 140.256 111.727 80.997  1.00 147.83 ? 407  VAL A N   1 
ATOM   2687 C  CA  . VAL A 1 428  ? 140.675 113.121 80.999  1.00 149.32 ? 407  VAL A CA  1 
ATOM   2688 C  C   . VAL A 1 428  ? 141.652 113.383 82.142  1.00 149.87 ? 407  VAL A C   1 
ATOM   2689 O  O   . VAL A 1 428  ? 142.433 114.338 82.073  1.00 150.70 ? 407  VAL A O   1 
ATOM   2690 C  CB  . VAL A 1 428  ? 139.451 114.058 81.040  1.00 104.01 ? 407  VAL A CB  1 
ATOM   2691 C  CG1 . VAL A 1 428  ? 138.840 114.109 82.407  1.00 104.01 ? 407  VAL A CG1 1 
ATOM   2692 C  CG2 . VAL A 1 428  ? 139.795 115.440 80.534  1.00 104.01 ? 407  VAL A CG2 1 
ATOM   2693 N  N   . HIS A 1 429  ? 141.673 112.526 83.174  1.00 202.57 ? 408  HIS A N   1 
ATOM   2694 C  CA  . HIS A 1 429  ? 142.743 112.606 84.163  1.00 204.44 ? 408  HIS A CA  1 
ATOM   2695 C  C   . HIS A 1 429  ? 144.078 112.133 83.604  1.00 203.92 ? 408  HIS A C   1 
ATOM   2696 O  O   . HIS A 1 429  ? 145.129 112.622 84.028  1.00 206.19 ? 408  HIS A O   1 
ATOM   2697 C  CB  . HIS A 1 429  ? 142.388 111.796 85.407  1.00 108.59 ? 408  HIS A CB  1 
ATOM   2698 C  CG  . HIS A 1 429  ? 143.460 111.800 86.455  1.00 108.59 ? 408  HIS A CG  1 
ATOM   2699 N  ND1 . HIS A 1 429  ? 143.724 112.894 87.251  1.00 108.59 ? 408  HIS A ND1 1 
ATOM   2700 C  CD2 . HIS A 1 429  ? 144.346 110.845 86.825  1.00 108.59 ? 408  HIS A CD2 1 
ATOM   2701 C  CE1 . HIS A 1 429  ? 144.720 112.609 88.071  1.00 108.59 ? 408  HIS A CE1 1 
ATOM   2702 N  NE2 . HIS A 1 429  ? 145.116 111.373 87.832  1.00 108.59 ? 408  HIS A NE2 1 
ATOM   2703 N  N   . GLN A 1 430  ? 144.068 111.196 82.655  1.00 173.35 ? 409  GLN A N   1 
ATOM   2704 C  CA  . GLN A 1 430  ? 145.329 110.681 82.127  1.00 172.87 ? 409  GLN A CA  1 
ATOM   2705 C  C   . GLN A 1 430  ? 146.089 111.680 81.257  1.00 174.32 ? 409  GLN A C   1 
ATOM   2706 O  O   . GLN A 1 430  ? 147.267 111.446 80.978  1.00 173.88 ? 409  GLN A O   1 
ATOM   2707 C  CB  . GLN A 1 430  ? 145.091 109.414 81.300  1.00 109.36 ? 409  GLN A CB  1 
ATOM   2708 C  CG  . GLN A 1 430  ? 144.514 108.211 82.051  1.00 109.36 ? 409  GLN A CG  1 
ATOM   2709 C  CD  . GLN A 1 430  ? 145.444 107.630 83.096  1.00 109.36 ? 409  GLN A CD  1 
ATOM   2710 O  OE1 . GLN A 1 430  ? 145.233 107.797 84.297  1.00 109.36 ? 409  GLN A OE1 1 
ATOM   2711 N  NE2 . GLN A 1 430  ? 146.465 106.912 82.643  1.00 109.36 ? 409  GLN A NE2 1 
ATOM   2712 N  N   . SER A 1 431  ? 145.466 112.781 80.831  1.00 180.63 ? 410  SER A N   1 
ATOM   2713 C  CA  . SER A 1 431  ? 146.024 113.657 79.804  1.00 183.89 ? 410  SER A CA  1 
ATOM   2714 C  C   . SER A 1 431  ? 146.519 114.998 80.343  1.00 181.44 ? 410  SER A C   1 
ATOM   2715 O  O   . SER A 1 431  ? 146.616 115.965 79.583  1.00 180.48 ? 410  SER A O   1 
ATOM   2716 C  CB  . SER A 1 431  ? 144.986 113.906 78.716  1.00 119.41 ? 410  SER A CB  1 
ATOM   2717 O  OG  . SER A 1 431  ? 143.894 114.634 79.241  1.00 119.41 ? 410  SER A OG  1 
ATOM   2718 N  N   . VAL A 1 432  ? 146.846 115.075 81.633  1.00 183.70 ? 411  VAL A N   1 
ATOM   2719 C  CA  . VAL A 1 432  ? 147.273 116.340 82.220  1.00 183.57 ? 411  VAL A CA  1 
ATOM   2720 C  C   . VAL A 1 432  ? 148.700 116.681 81.799  1.00 184.47 ? 411  VAL A C   1 
ATOM   2721 O  O   . VAL A 1 432  ? 149.013 117.853 81.557  1.00 183.75 ? 411  VAL A O   1 
ATOM   2722 C  CB  . VAL A 1 432  ? 147.117 116.272 83.750  1.00 130.59 ? 411  VAL A CB  1 
ATOM   2723 C  CG1 . VAL A 1 432  ? 147.555 117.565 84.417  1.00 130.59 ? 411  VAL A CG1 1 
ATOM   2724 C  CG2 . VAL A 1 432  ? 145.681 115.952 84.111  1.00 130.59 ? 411  VAL A CG2 1 
ATOM   2725 N  N   . ALA A 1 433  ? 149.561 115.658 81.671  1.00 87.30  ? 412  ALA A N   1 
ATOM   2726 C  CA  . ALA A 1 433  ? 150.967 115.768 81.254  1.00 87.30  ? 412  ALA A CA  1 
ATOM   2727 C  C   . ALA A 1 433  ? 151.751 116.676 82.206  1.00 87.30  ? 412  ALA A C   1 
ATOM   2728 O  O   . ALA A 1 433  ? 152.120 117.807 81.881  1.00 87.30  ? 412  ALA A O   1 
ATOM   2729 C  CB  . ALA A 1 433  ? 151.103 116.224 79.793  1.00 87.30  ? 412  ALA A CB  1 
ATOM   2730 N  N   . GLN A 1 434  ? 151.983 116.124 83.408  1.00 91.18  ? 413  GLN A N   1 
ATOM   2731 C  CA  . GLN A 1 434  ? 152.338 116.856 84.630  1.00 91.18  ? 413  GLN A CA  1 
ATOM   2732 C  C   . GLN A 1 434  ? 153.529 117.808 84.524  1.00 91.18  ? 413  GLN A C   1 
ATOM   2733 O  O   . GLN A 1 434  ? 153.711 118.642 85.419  1.00 91.18  ? 413  GLN A O   1 
ATOM   2734 C  CB  . GLN A 1 434  ? 152.647 115.863 85.746  1.00 91.18  ? 413  GLN A CB  1 
ATOM   2735 C  CG  . GLN A 1 434  ? 153.945 115.123 85.532  1.00 91.18  ? 413  GLN A CG  1 
ATOM   2736 C  CD  . GLN A 1 434  ? 154.215 114.126 86.610  1.00 91.18  ? 413  GLN A CD  1 
ATOM   2737 O  OE1 . GLN A 1 434  ? 153.422 113.972 87.533  1.00 91.18  ? 413  GLN A OE1 1 
ATOM   2738 N  NE2 . GLN A 1 434  ? 155.349 113.449 86.517  1.00 91.18  ? 413  GLN A NE2 1 
ATOM   2739 N  N   . ASN A 1 435  ? 154.349 117.715 83.483  1.00 216.16 ? 414  ASN A N   1 
ATOM   2740 C  CA  . ASN A 1 435  ? 155.486 118.607 83.339  1.00 217.17 ? 414  ASN A CA  1 
ATOM   2741 C  C   . ASN A 1 435  ? 155.126 119.921 82.643  1.00 216.42 ? 414  ASN A C   1 
ATOM   2742 O  O   . ASN A 1 435  ? 156.027 120.667 82.248  1.00 217.58 ? 414  ASN A O   1 
ATOM   2743 C  CB  . ASN A 1 435  ? 156.631 117.863 82.630  1.00 139.88 ? 414  ASN A CB  1 
ATOM   2744 C  CG  . ASN A 1 435  ? 156.240 117.275 81.266  1.00 139.88 ? 414  ASN A CG  1 
ATOM   2745 O  OD1 . ASN A 1 435  ? 155.256 117.674 80.654  1.00 139.88 ? 414  ASN A OD1 1 
ATOM   2746 N  ND2 . ASN A 1 435  ? 157.010 116.290 80.799  1.00 139.88 ? 414  ASN A ND2 1 
ATOM   2747 N  N   . SER A 1 436  ? 153.837 120.225 82.506  1.00 177.42 ? 415  SER A N   1 
ATOM   2748 C  CA  . SER A 1 436  ? 153.361 121.377 81.758  1.00 175.68 ? 415  SER A CA  1 
ATOM   2749 C  C   . SER A 1 436  ? 152.707 122.387 82.684  1.00 174.25 ? 415  SER A C   1 
ATOM   2750 O  O   . SER A 1 436  ? 152.425 122.114 83.853  1.00 175.10 ? 415  SER A O   1 
ATOM   2751 C  CB  . SER A 1 436  ? 152.356 120.957 80.684  1.00 135.82 ? 415  SER A CB  1 
ATOM   2752 O  OG  . SER A 1 436  ? 151.158 120.500 81.285  1.00 135.82 ? 415  SER A OG  1 
ATOM   2753 N  N   . THR A 1 437  ? 152.446 123.565 82.121  1.00 84.33  ? 416  THR A N   1 
ATOM   2754 C  CA  . THR A 1 437  ? 151.817 124.635 82.878  1.00 84.33  ? 416  THR A CA  1 
ATOM   2755 C  C   . THR A 1 437  ? 150.307 124.485 82.913  1.00 84.33  ? 416  THR A C   1 
ATOM   2756 O  O   . THR A 1 437  ? 149.687 124.740 83.946  1.00 84.33  ? 416  THR A O   1 
ATOM   2757 C  CB  . THR A 1 437  ? 152.180 125.991 82.285  1.00 84.33  ? 416  THR A CB  1 
ATOM   2758 O  OG1 . THR A 1 437  ? 151.768 126.030 80.918  1.00 84.33  ? 416  THR A OG1 1 
ATOM   2759 C  CG2 . THR A 1 437  ? 153.667 126.233 82.364  1.00 84.33  ? 416  THR A CG2 1 
ATOM   2760 N  N   . GLN A 1 438  ? 149.698 124.066 81.811  1.00 83.22  ? 417  GLN A N   1 
ATOM   2761 C  CA  . GLN A 1 438  ? 148.247 124.075 81.705  1.00 83.22  ? 417  GLN A CA  1 
ATOM   2762 C  C   . GLN A 1 438  ? 147.636 122.917 82.480  1.00 83.22  ? 417  GLN A C   1 
ATOM   2763 O  O   . GLN A 1 438  ? 148.129 121.789 82.437  1.00 83.22  ? 417  GLN A O   1 
ATOM   2764 C  CB  . GLN A 1 438  ? 147.822 124.000 80.245  1.00 83.22  ? 417  GLN A CB  1 
ATOM   2765 C  CG  . GLN A 1 438  ? 148.397 125.092 79.369  1.00 83.22  ? 417  GLN A CG  1 
ATOM   2766 C  CD  . GLN A 1 438  ? 147.979 126.474 79.791  1.00 83.22  ? 417  GLN A CD  1 
ATOM   2767 O  OE1 . GLN A 1 438  ? 146.864 126.686 80.250  1.00 83.22  ? 417  GLN A OE1 1 
ATOM   2768 N  NE2 . GLN A 1 438  ? 148.871 127.435 79.606  1.00 83.22  ? 417  GLN A NE2 1 
ATOM   2769 N  N   . LYS A 1 439  ? 146.551 123.209 83.189  1.00 66.67  ? 418  LYS A N   1 
ATOM   2770 C  CA  . LYS A 1 439  ? 145.858 122.240 84.020  1.00 66.67  ? 418  LYS A CA  1 
ATOM   2771 C  C   . LYS A 1 439  ? 144.402 122.169 83.592  1.00 66.67  ? 418  LYS A C   1 
ATOM   2772 O  O   . LYS A 1 439  ? 143.731 123.198 83.497  1.00 66.67  ? 418  LYS A O   1 
ATOM   2773 C  CB  . LYS A 1 439  ? 145.979 122.624 85.487  1.00 66.67  ? 418  LYS A CB  1 
ATOM   2774 C  CG  . LYS A 1 439  ? 145.286 121.721 86.468  1.00 66.67  ? 418  LYS A CG  1 
ATOM   2775 C  CD  . LYS A 1 439  ? 145.720 122.096 87.882  1.00 66.67  ? 418  LYS A CD  1 
ATOM   2776 C  CE  . LYS A 1 439  ? 145.186 123.463 88.296  1.00 66.67  ? 418  LYS A CE  1 
ATOM   2777 N  NZ  . LYS A 1 439  ? 145.576 123.856 89.678  1.00 66.67  ? 418  LYS A NZ  1 
ATOM   2778 N  N   . VAL A 1 440  ? 143.923 120.954 83.342  1.00 95.37  ? 419  VAL A N   1 
ATOM   2779 C  CA  . VAL A 1 440  ? 142.623 120.697 82.734  1.00 94.40  ? 419  VAL A CA  1 
ATOM   2780 C  C   . VAL A 1 440  ? 141.849 119.731 83.622  1.00 94.55  ? 419  VAL A C   1 
ATOM   2781 O  O   . VAL A 1 440  ? 142.408 118.747 84.112  1.00 93.63  ? 419  VAL A O   1 
ATOM   2782 C  CB  . VAL A 1 440  ? 142.795 120.167 81.289  1.00 113.84 ? 419  VAL A CB  1 
ATOM   2783 C  CG1 . VAL A 1 440  ? 143.753 118.993 81.234  1.00 113.84 ? 419  VAL A CG1 1 
ATOM   2784 C  CG2 . VAL A 1 440  ? 141.467 119.776 80.683  1.00 113.84 ? 419  VAL A CG2 1 
ATOM   2785 N  N   . LEU A 1 441  ? 140.571 120.022 83.857  1.00 76.10  ? 420  LEU A N   1 
ATOM   2786 C  CA  . LEU A 1 441  ? 139.818 119.294 84.868  1.00 78.03  ? 420  LEU A CA  1 
ATOM   2787 C  C   . LEU A 1 441  ? 138.323 119.460 84.626  1.00 77.92  ? 420  LEU A C   1 
ATOM   2788 O  O   . LEU A 1 441  ? 137.890 120.390 83.946  1.00 78.20  ? 420  LEU A O   1 
ATOM   2789 C  CB  . LEU A 1 441  ? 140.201 119.756 86.273  1.00 96.01  ? 420  LEU A CB  1 
ATOM   2790 C  CG  . LEU A 1 441  ? 139.800 121.141 86.754  1.00 96.01  ? 420  LEU A CG  1 
ATOM   2791 C  CD1 . LEU A 1 441  ? 139.841 121.094 88.234  1.00 96.01  ? 420  LEU A CD1 1 
ATOM   2792 C  CD2 . LEU A 1 441  ? 140.748 122.223 86.289  1.00 96.01  ? 420  LEU A CD2 1 
ATOM   2793 N  N   . SER A 1 442  ? 137.540 118.552 85.211  1.00 78.39  ? 421  SER A N   1 
ATOM   2794 C  CA  . SER A 1 442  ? 136.158 118.341 84.797  1.00 79.16  ? 421  SER A CA  1 
ATOM   2795 C  C   . SER A 1 442  ? 135.393 117.565 85.854  1.00 80.26  ? 421  SER A C   1 
ATOM   2796 O  O   . SER A 1 442  ? 135.938 116.642 86.460  1.00 81.44  ? 421  SER A O   1 
ATOM   2797 C  CB  . SER A 1 442  ? 136.122 117.549 83.504  1.00 87.97  ? 421  SER A CB  1 
ATOM   2798 O  OG  . SER A 1 442  ? 136.679 116.277 83.731  1.00 87.97  ? 421  SER A OG  1 
ATOM   2799 N  N   . PHE A 1 443  ? 134.113 117.908 86.039  1.00 48.83  ? 422  PHE A N   1 
ATOM   2800 C  CA  . PHE A 1 443  ? 133.233 117.084 86.861  1.00 50.14  ? 422  PHE A CA  1 
ATOM   2801 C  C   . PHE A 1 443  ? 131.970 116.861 86.052  1.00 50.32  ? 422  PHE A C   1 
ATOM   2802 O  O   . PHE A 1 443  ? 131.535 117.752 85.323  1.00 50.70  ? 422  PHE A O   1 
ATOM   2803 C  CB  . PHE A 1 443  ? 132.918 117.719 88.248  1.00 88.07  ? 422  PHE A CB  1 
ATOM   2804 C  CG  . PHE A 1 443  ? 131.542 118.332 88.390  1.00 88.07  ? 422  PHE A CG  1 
ATOM   2805 C  CD1 . PHE A 1 443  ? 131.225 119.568 87.883  1.00 88.07  ? 422  PHE A CD1 1 
ATOM   2806 C  CD2 . PHE A 1 443  ? 130.594 117.688 89.165  1.00 88.07  ? 422  PHE A CD2 1 
ATOM   2807 C  CE1 . PHE A 1 443  ? 129.968 120.107 88.061  1.00 88.07  ? 422  PHE A CE1 1 
ATOM   2808 C  CE2 . PHE A 1 443  ? 129.343 118.227 89.350  1.00 88.07  ? 422  PHE A CE2 1 
ATOM   2809 C  CZ  . PHE A 1 443  ? 129.033 119.437 88.799  1.00 88.07  ? 422  PHE A CZ  1 
ATOM   2810 N  N   . THR A 1 444  ? 131.442 115.637 86.087  1.00 96.42  ? 423  THR A N   1 
ATOM   2811 C  CA  . THR A 1 444  ? 130.381 115.209 85.169  1.00 96.12  ? 423  THR A CA  1 
ATOM   2812 C  C   . THR A 1 444  ? 129.248 114.520 85.902  1.00 96.88  ? 423  THR A C   1 
ATOM   2813 O  O   . THR A 1 444  ? 129.237 113.292 85.952  1.00 96.92  ? 423  THR A O   1 
ATOM   2814 C  CB  . THR A 1 444  ? 130.944 114.258 84.158  1.00 100.81 ? 423  THR A CB  1 
ATOM   2815 O  OG1 . THR A 1 444  ? 131.561 113.163 84.844  1.00 100.81 ? 423  THR A OG1 1 
ATOM   2816 C  CG2 . THR A 1 444  ? 131.937 114.919 83.300  1.00 100.81 ? 423  THR A CG2 1 
ATOM   2817 N  N   . THR A 1 445  ? 128.332 115.278 86.517  1.00 42.31  ? 424  THR A N   1 
ATOM   2818 C  CA  . THR A 1 445  ? 126.975 114.892 86.952  1.00 42.31  ? 424  THR A CA  1 
ATOM   2819 C  C   . THR A 1 445  ? 126.852 113.636 87.825  1.00 42.31  ? 424  THR A C   1 
ATOM   2820 O  O   . THR A 1 445  ? 125.762 113.319 88.309  1.00 42.31  ? 424  THR A O   1 
ATOM   2821 C  CB  . THR A 1 445  ? 126.030 114.736 85.749  1.00 42.31  ? 424  THR A CB  1 
ATOM   2822 O  OG1 . THR A 1 445  ? 124.681 114.866 86.205  1.00 42.31  ? 424  THR A OG1 1 
ATOM   2823 C  CG2 . THR A 1 445  ? 126.116 113.363 85.113  1.00 42.31  ? 424  THR A CG2 1 
ATOM   2824 N  N   . THR A 1 446  ? 127.957 112.947 88.078  1.00 49.15  ? 425  THR A N   1 
ATOM   2825 C  CA  . THR A 1 446  ? 127.982 111.646 88.718  1.00 49.15  ? 425  THR A CA  1 
ATOM   2826 C  C   . THR A 1 446  ? 129.074 111.709 89.767  1.00 49.15  ? 425  THR A C   1 
ATOM   2827 O  O   . THR A 1 446  ? 129.006 111.038 90.804  1.00 49.15  ? 425  THR A O   1 
ATOM   2828 C  CB  . THR A 1 446  ? 128.227 110.549 87.680  1.00 49.15  ? 425  THR A CB  1 
ATOM   2829 O  OG1 . THR A 1 446  ? 127.174 110.589 86.712  1.00 49.15  ? 425  THR A OG1 1 
ATOM   2830 C  CG2 . THR A 1 446  ? 128.239 109.177 88.302  1.00 49.15  ? 425  THR A CG2 1 
ATOM   2831 N  N   . THR A 1 447  ? 130.069 112.565 89.536  1.00 70.81  ? 426  THR A N   1 
ATOM   2832 C  CA  . THR A 1 447  ? 130.986 112.843 90.627  1.00 70.81  ? 426  THR A CA  1 
ATOM   2833 C  C   . THR A 1 447  ? 130.299 113.671 91.697  1.00 70.81  ? 426  THR A C   1 
ATOM   2834 O  O   . THR A 1 447  ? 130.647 113.552 92.871  1.00 70.81  ? 426  THR A O   1 
ATOM   2835 C  CB  . THR A 1 447  ? 132.240 113.555 90.139  1.00 70.81  ? 426  THR A CB  1 
ATOM   2836 O  OG1 . THR A 1 447  ? 131.913 114.886 89.745  1.00 70.81  ? 426  THR A OG1 1 
ATOM   2837 C  CG2 . THR A 1 447  ? 132.822 112.823 88.956  1.00 70.81  ? 426  THR A CG2 1 
ATOM   2838 N  N   . LEU A 1 448  ? 129.309 114.485 91.311  1.00 73.55  ? 427  LEU A N   1 
ATOM   2839 C  CA  . LEU A 1 448  ? 128.431 115.134 92.281  1.00 73.55  ? 427  LEU A CA  1 
ATOM   2840 C  C   . LEU A 1 448  ? 127.631 114.108 93.074  1.00 73.55  ? 427  LEU A C   1 
ATOM   2841 O  O   . LEU A 1 448  ? 127.393 114.286 94.278  1.00 73.55  ? 427  LEU A O   1 
ATOM   2842 C  CB  . LEU A 1 448  ? 127.499 116.102 91.553  1.00 73.55  ? 427  LEU A CB  1 
ATOM   2843 C  CG  . LEU A 1 448  ? 126.537 117.028 92.297  1.00 73.55  ? 427  LEU A CG  1 
ATOM   2844 C  CD1 . LEU A 1 448  ? 126.420 118.318 91.528  1.00 73.55  ? 427  LEU A CD1 1 
ATOM   2845 C  CD2 . LEU A 1 448  ? 125.147 116.417 92.431  1.00 73.55  ? 427  LEU A CD2 1 
ATOM   2846 N  N   . ASP A 1 449  ? 127.186 113.043 92.404  1.00 73.21  ? 428  ASP A N   1 
ATOM   2847 C  CA  . ASP A 1 449  ? 126.535 111.933 93.088  1.00 73.21  ? 428  ASP A CA  1 
ATOM   2848 C  C   . ASP A 1 449  ? 127.496 111.261 94.057  1.00 73.21  ? 428  ASP A C   1 
ATOM   2849 O  O   . ASP A 1 449  ? 127.089 110.819 95.136  1.00 73.21  ? 428  ASP A O   1 
ATOM   2850 C  CB  . ASP A 1 449  ? 126.010 110.946 92.045  1.00 73.21  ? 428  ASP A CB  1 
ATOM   2851 C  CG  . ASP A 1 449  ? 125.018 109.951 92.601  1.00 73.21  ? 428  ASP A CG  1 
ATOM   2852 O  OD1 . ASP A 1 449  ? 124.688 110.004 93.798  1.00 73.21  ? 428  ASP A OD1 1 
ATOM   2853 O  OD2 . ASP A 1 449  ? 124.560 109.095 91.819  1.00 73.21  ? 428  ASP A OD2 1 
ATOM   2854 N  N   . ASP A 1 450  ? 128.782 111.221 93.719  1.00 73.28  ? 429  ASP A N   1 
ATOM   2855 C  CA  . ASP A 1 450  ? 129.764 110.754 94.683  1.00 73.28  ? 429  ASP A CA  1 
ATOM   2856 C  C   . ASP A 1 450  ? 130.062 111.792 95.765  1.00 73.28  ? 429  ASP A C   1 
ATOM   2857 O  O   . ASP A 1 450  ? 130.571 111.421 96.827  1.00 73.28  ? 429  ASP A O   1 
ATOM   2858 C  CB  . ASP A 1 450  ? 131.048 110.346 93.960  1.00 73.28  ? 429  ASP A CB  1 
ATOM   2859 C  CG  . ASP A 1 450  ? 130.874 109.078 93.138  1.00 73.28  ? 429  ASP A CG  1 
ATOM   2860 O  OD1 . ASP A 1 450  ? 130.018 108.250 93.503  1.00 73.28  ? 429  ASP A OD1 1 
ATOM   2861 O  OD2 . ASP A 1 450  ? 131.595 108.904 92.133  1.00 73.28  ? 429  ASP A OD2 1 
ATOM   2862 N  N   . ILE A 1 451  ? 129.755 113.071 95.530  1.00 90.77  ? 430  ILE A N   1 
ATOM   2863 C  CA  . ILE A 1 451  ? 129.906 114.075 96.583  1.00 90.77  ? 430  ILE A CA  1 
ATOM   2864 C  C   . ILE A 1 451  ? 128.842 113.883 97.650  1.00 90.77  ? 430  ILE A C   1 
ATOM   2865 O  O   . ILE A 1 451  ? 129.145 113.813 98.846  1.00 90.77  ? 430  ILE A O   1 
ATOM   2866 C  CB  . ILE A 1 451  ? 129.857 115.504 96.008  1.00 90.77  ? 430  ILE A CB  1 
ATOM   2867 C  CG1 . ILE A 1 451  ? 131.044 115.787 95.092  1.00 90.77  ? 430  ILE A CG1 1 
ATOM   2868 C  CG2 . ILE A 1 451  ? 129.776 116.531 97.122  1.00 90.77  ? 430  ILE A CG2 1 
ATOM   2869 C  CD1 . ILE A 1 451  ? 132.368 115.584 95.745  1.00 90.77  ? 430  ILE A CD1 1 
ATOM   2870 N  N   . LEU A 1 452  ? 127.578 113.788 97.236  1.00 79.13  ? 431  LEU A N   1 
ATOM   2871 C  CA  . LEU A 1 452  ? 126.518 113.637 98.229  1.00 79.13  ? 431  LEU A CA  1 
ATOM   2872 C  C   . LEU A 1 452  ? 126.485 112.234 98.830  1.00 79.13  ? 431  LEU A C   1 
ATOM   2873 O  O   . LEU A 1 452  ? 126.209 112.080 100.026 1.00 79.13  ? 431  LEU A O   1 
ATOM   2874 C  CB  . LEU A 1 452  ? 125.178 114.036 97.622  1.00 79.13  ? 431  LEU A CB  1 
ATOM   2875 C  CG  . LEU A 1 452  ? 124.791 113.553 96.228  1.00 79.13  ? 431  LEU A CG  1 
ATOM   2876 C  CD1 . LEU A 1 452  ? 124.184 112.184 96.203  1.00 79.13  ? 431  LEU A CD1 1 
ATOM   2877 C  CD2 . LEU A 1 452  ? 123.824 114.550 95.623  1.00 79.13  ? 431  LEU A CD2 1 
ATOM   2878 N  N   . LYS A 1 453  ? 126.786 111.197 98.042  1.00 80.93  ? 432  LYS A N   1 
ATOM   2879 C  CA  . LYS A 1 453  ? 126.852 109.862 98.632  1.00 80.93  ? 432  LYS A CA  1 
ATOM   2880 C  C   . LYS A 1 453  ? 128.106 109.676 99.466  1.00 80.93  ? 432  LYS A C   1 
ATOM   2881 O  O   . LYS A 1 453  ? 128.120 108.846 100.379 1.00 80.93  ? 432  LYS A O   1 
ATOM   2882 C  CB  . LYS A 1 453  ? 126.771 108.780 97.560  1.00 80.93  ? 432  LYS A CB  1 
ATOM   2883 C  CG  . LYS A 1 453  ? 125.386 108.619 96.974  1.00 80.93  ? 432  LYS A CG  1 
ATOM   2884 C  CD  . LYS A 1 453  ? 124.418 108.145 98.042  1.00 80.93  ? 432  LYS A CD  1 
ATOM   2885 C  CE  . LYS A 1 453  ? 124.718 106.716 98.449  1.00 80.93  ? 432  LYS A CE  1 
ATOM   2886 N  NZ  . LYS A 1 453  ? 123.745 106.189 99.440  1.00 80.93  ? 432  LYS A NZ  1 
ATOM   2887 N  N   . SER A 1 454  ? 129.164 110.428 99.180  1.00 92.46  ? 433  SER A N   1 
ATOM   2888 C  CA  . SER A 1 454  ? 130.307 110.444 100.079 1.00 92.46  ? 433  SER A CA  1 
ATOM   2889 C  C   . SER A 1 454  ? 130.059 111.305 101.305 1.00 92.46  ? 433  SER A C   1 
ATOM   2890 O  O   . SER A 1 454  ? 130.763 111.154 102.308 1.00 92.46  ? 433  SER A O   1 
ATOM   2891 C  CB  . SER A 1 454  ? 131.548 110.949 99.349  1.00 92.46  ? 433  SER A CB  1 
ATOM   2892 O  OG  . SER A 1 454  ? 132.652 111.025 100.230 1.00 92.46  ? 433  SER A OG  1 
ATOM   2893 N  N   . PHE A 1 455  ? 129.073 112.194 101.242 1.00 86.42  ? 434  PHE A N   1 
ATOM   2894 C  CA  . PHE A 1 455  ? 128.768 113.124 102.320 1.00 86.42  ? 434  PHE A CA  1 
ATOM   2895 C  C   . PHE A 1 455  ? 127.752 112.556 103.296 1.00 86.42  ? 434  PHE A C   1 
ATOM   2896 O  O   . PHE A 1 455  ? 127.768 112.922 104.474 1.00 86.42  ? 434  PHE A O   1 
ATOM   2897 C  CB  . PHE A 1 455  ? 128.277 114.447 101.716 1.00 86.42  ? 434  PHE A CB  1 
ATOM   2898 C  CG  . PHE A 1 455  ? 127.922 115.506 102.720 1.00 86.42  ? 434  PHE A CG  1 
ATOM   2899 C  CD1 . PHE A 1 455  ? 128.886 116.062 103.532 1.00 86.42  ? 434  PHE A CD1 1 
ATOM   2900 C  CD2 . PHE A 1 455  ? 126.640 116.013 102.778 1.00 86.42  ? 434  PHE A CD2 1 
ATOM   2901 C  CE1 . PHE A 1 455  ? 128.573 117.055 104.433 1.00 86.42  ? 434  PHE A CE1 1 
ATOM   2902 C  CE2 . PHE A 1 455  ? 126.319 117.010 103.671 1.00 86.42  ? 434  PHE A CE2 1 
ATOM   2903 C  CZ  . PHE A 1 455  ? 127.286 117.530 104.500 1.00 86.42  ? 434  PHE A CZ  1 
ATOM   2904 N  N   . SER A 1 456  ? 126.895 111.643 102.843 1.00 76.09  ? 435  SER A N   1 
ATOM   2905 C  CA  . SER A 1 456  ? 125.971 110.944 103.724 1.00 76.09  ? 435  SER A CA  1 
ATOM   2906 C  C   . SER A 1 456  ? 126.563 109.661 104.302 1.00 76.09  ? 435  SER A C   1 
ATOM   2907 O  O   . SER A 1 456  ? 125.810 108.758 104.684 1.00 76.09  ? 435  SER A O   1 
ATOM   2908 C  CB  . SER A 1 456  ? 124.672 110.633 102.985 1.00 76.09  ? 435  SER A CB  1 
ATOM   2909 O  OG  . SER A 1 456  ? 124.010 111.820 102.599 1.00 76.09  ? 435  SER A OG  1 
ATOM   2910 N  N   . ASP A 1 457  ? 127.888 109.562 104.369 1.00 92.89  ? 436  ASP A N   1 
ATOM   2911 C  CA  . ASP A 1 457  ? 128.575 108.378 104.859 1.00 92.89  ? 436  ASP A CA  1 
ATOM   2912 C  C   . ASP A 1 457  ? 128.901 108.551 106.336 1.00 92.89  ? 436  ASP A C   1 
ATOM   2913 O  O   . ASP A 1 457  ? 129.065 109.670 106.826 1.00 92.89  ? 436  ASP A O   1 
ATOM   2914 C  CB  . ASP A 1 457  ? 129.855 108.142 104.051 1.00 92.89  ? 436  ASP A CB  1 
ATOM   2915 C  CG  . ASP A 1 457  ? 130.498 106.804 104.342 1.00 92.89  ? 436  ASP A CG  1 
ATOM   2916 O  OD1 . ASP A 1 457  ? 129.932 105.778 103.921 1.00 92.89  ? 436  ASP A OD1 1 
ATOM   2917 O  OD2 . ASP A 1 457  ? 131.576 106.776 104.972 1.00 92.89  ? 436  ASP A OD2 1 
ATOM   2918 N  N   . VAL A 1 458  ? 128.994 107.432 107.048 1.00 81.88  ? 437  VAL A N   1 
ATOM   2919 C  CA  . VAL A 1 458  ? 129.175 107.430 108.494 1.00 81.88  ? 437  VAL A CA  1 
ATOM   2920 C  C   . VAL A 1 458  ? 130.528 106.820 108.847 1.00 81.88  ? 437  VAL A C   1 
ATOM   2921 O  O   . VAL A 1 458  ? 130.747 105.612 108.697 1.00 81.88  ? 437  VAL A O   1 
ATOM   2922 C  CB  . VAL A 1 458  ? 128.023 106.713 109.202 1.00 81.88  ? 437  VAL A CB  1 
ATOM   2923 C  CG1 . VAL A 1 458  ? 126.859 107.636 109.266 1.00 81.88  ? 437  VAL A CG1 1 
ATOM   2924 C  CG2 . VAL A 1 458  ? 127.581 105.504 108.402 1.00 81.88  ? 437  VAL A CG2 1 
ATOM   2925 N  N   . SER A 1 459  ? 131.443 107.662 109.310 1.00 90.45  ? 438  SER A N   1 
ATOM   2926 C  CA  . SER A 1 459  ? 132.718 107.191 109.841 1.00 90.45  ? 438  SER A CA  1 
ATOM   2927 C  C   . SER A 1 459  ? 132.443 106.701 111.251 1.00 90.45  ? 438  SER A C   1 
ATOM   2928 O  O   . SER A 1 459  ? 132.512 107.460 112.219 1.00 90.45  ? 438  SER A O   1 
ATOM   2929 C  CB  . SER A 1 459  ? 133.757 108.300 109.814 1.00 90.45  ? 438  SER A CB  1 
ATOM   2930 O  OG  . SER A 1 459  ? 134.013 108.717 108.486 1.00 90.45  ? 438  SER A OG  1 
ATOM   2931 N  N   . VAL A 1 460  ? 132.122 105.409 111.357 1.00 73.52  ? 439  VAL A N   1 
ATOM   2932 C  CA  . VAL A 1 460  ? 131.617 104.837 112.601 1.00 73.52  ? 439  VAL A CA  1 
ATOM   2933 C  C   . VAL A 1 460  ? 132.706 104.812 113.668 1.00 73.52  ? 439  VAL A C   1 
ATOM   2934 O  O   . VAL A 1 460  ? 132.416 104.937 114.865 1.00 73.52  ? 439  VAL A O   1 
ATOM   2935 C  CB  . VAL A 1 460  ? 131.037 103.438 112.311 1.00 73.52  ? 439  VAL A CB  1 
ATOM   2936 C  CG1 . VAL A 1 460  ? 130.474 102.772 113.556 1.00 73.52  ? 439  VAL A CG1 1 
ATOM   2937 C  CG2 . VAL A 1 460  ? 129.963 103.539 111.250 1.00 73.52  ? 439  VAL A CG2 1 
ATOM   2938 N  N   . ILE A 1 461  ? 133.973 104.735 113.257 1.00 87.91  ? 440  ILE A N   1 
ATOM   2939 C  CA  . ILE A 1 461  ? 135.058 104.664 114.226 1.00 87.91  ? 440  ILE A CA  1 
ATOM   2940 C  C   . ILE A 1 461  ? 135.270 106.015 114.905 1.00 87.91  ? 440  ILE A C   1 
ATOM   2941 O  O   . ILE A 1 461  ? 135.725 106.076 116.056 1.00 87.91  ? 440  ILE A O   1 
ATOM   2942 C  CB  . ILE A 1 461  ? 136.331 104.124 113.539 1.00 87.91  ? 440  ILE A CB  1 
ATOM   2943 C  CG1 . ILE A 1 461  ? 137.363 103.678 114.574 1.00 87.91  ? 440  ILE A CG1 1 
ATOM   2944 C  CG2 . ILE A 1 461  ? 136.920 105.122 112.551 1.00 87.91  ? 440  ILE A CG2 1 
ATOM   2945 C  CD1 . ILE A 1 461  ? 136.926 102.476 115.378 1.00 87.91  ? 440  ILE A CD1 1 
ATOM   2946 N  N   . ARG A 1 462  ? 134.888 107.112 114.246 1.00 96.81  ? 441  ARG A N   1 
ATOM   2947 C  CA  . ARG A 1 462  ? 134.911 108.409 114.909 1.00 96.81  ? 441  ARG A CA  1 
ATOM   2948 C  C   . ARG A 1 462  ? 133.762 108.543 115.898 1.00 96.81  ? 441  ARG A C   1 
ATOM   2949 O  O   . ARG A 1 462  ? 133.889 109.237 116.913 1.00 96.81  ? 441  ARG A O   1 
ATOM   2950 C  CB  . ARG A 1 462  ? 134.835 109.527 113.878 1.00 96.81  ? 441  ARG A CB  1 
ATOM   2951 C  CG  . ARG A 1 462  ? 136.000 109.579 112.920 1.00 96.81  ? 441  ARG A CG  1 
ATOM   2952 C  CD  . ARG A 1 462  ? 135.801 110.671 111.878 1.00 96.81  ? 441  ARG A CD  1 
ATOM   2953 N  NE  . ARG A 1 462  ? 135.851 112.007 112.460 1.00 96.81  ? 441  ARG A NE  1 
ATOM   2954 C  CZ  . ARG A 1 462  ? 134.797 112.805 112.591 1.00 96.81  ? 441  ARG A CZ  1 
ATOM   2955 N  NH1 . ARG A 1 462  ? 133.601 112.405 112.188 1.00 96.81  ? 441  ARG A NH1 1 
ATOM   2956 N  NH2 . ARG A 1 462  ? 134.941 114.004 113.134 1.00 96.81  ? 441  ARG A NH2 1 
ATOM   2957 N  N   . VAL A 1 463  ? 132.635 107.890 115.613 1.00 82.34  ? 442  VAL A N   1 
ATOM   2958 C  CA  . VAL A 1 463  ? 131.480 107.964 116.497 1.00 82.34  ? 442  VAL A CA  1 
ATOM   2959 C  C   . VAL A 1 463  ? 131.727 107.150 117.759 1.00 82.34  ? 442  VAL A C   1 
ATOM   2960 O  O   . VAL A 1 463  ? 131.565 107.644 118.882 1.00 82.34  ? 442  VAL A O   1 
ATOM   2961 C  CB  . VAL A 1 463  ? 130.221 107.493 115.751 1.00 82.34  ? 442  VAL A CB  1 
ATOM   2962 C  CG1 . VAL A 1 463  ? 129.017 107.524 116.662 1.00 82.34  ? 442  VAL A CG1 1 
ATOM   2963 C  CG2 . VAL A 1 463  ? 129.997 108.345 114.524 1.00 82.34  ? 442  VAL A CG2 1 
ATOM   2964 N  N   . ALA A 1 464  ? 132.139 105.892 117.592 1.00 94.24  ? 443  ALA A N   1 
ATOM   2965 C  CA  . ALA A 1 464  ? 132.450 105.056 118.742 1.00 94.24  ? 443  ALA A CA  1 
ATOM   2966 C  C   . ALA A 1 464  ? 133.676 105.557 119.487 1.00 94.24  ? 443  ALA A C   1 
ATOM   2967 O  O   . ALA A 1 464  ? 133.760 105.396 120.709 1.00 94.24  ? 443  ALA A O   1 
ATOM   2968 C  CB  . ALA A 1 464  ? 132.654 103.609 118.301 1.00 94.24  ? 443  ALA A CB  1 
ATOM   2969 N  N   . SER A 1 465  ? 134.624 106.173 118.779 1.00 100.43 ? 444  SER A N   1 
ATOM   2970 C  CA  . SER A 1 465  ? 135.767 106.765 119.463 1.00 100.43 ? 444  SER A CA  1 
ATOM   2971 C  C   . SER A 1 465  ? 135.346 107.978 120.281 1.00 100.43 ? 444  SER A C   1 
ATOM   2972 O  O   . SER A 1 465  ? 135.851 108.194 121.392 1.00 100.43 ? 444  SER A O   1 
ATOM   2973 C  CB  . SER A 1 465  ? 136.846 107.137 118.449 1.00 100.43 ? 444  SER A CB  1 
ATOM   2974 O  OG  . SER A 1 465  ? 137.336 105.979 117.794 1.00 100.43 ? 444  SER A OG  1 
ATOM   2975 N  N   . GLY A 1 466  ? 134.402 108.763 119.754 1.00 96.34  ? 445  GLY A N   1 
ATOM   2976 C  CA  . GLY A 1 466  ? 133.847 109.863 120.520 1.00 96.34  ? 445  GLY A CA  1 
ATOM   2977 C  C   . GLY A 1 466  ? 133.066 109.407 121.732 1.00 96.34  ? 445  GLY A C   1 
ATOM   2978 O  O   . GLY A 1 466  ? 133.057 110.091 122.762 1.00 96.34  ? 445  GLY A O   1 
ATOM   2979 N  N   . TYR A 1 467  ? 132.430 108.242 121.651 1.00 87.90  ? 446  TYR A N   1 
ATOM   2980 C  CA  . TYR A 1 467  ? 131.712 107.777 122.827 1.00 87.90  ? 446  TYR A CA  1 
ATOM   2981 C  C   . TYR A 1 467  ? 132.627 107.110 123.842 1.00 87.90  ? 446  TYR A C   1 
ATOM   2982 O  O   . TYR A 1 467  ? 132.335 107.158 125.036 1.00 87.90  ? 446  TYR A O   1 
ATOM   2983 C  CB  . TYR A 1 467  ? 130.584 106.831 122.434 1.00 87.90  ? 446  TYR A CB  1 
ATOM   2984 C  CG  . TYR A 1 467  ? 129.405 107.525 121.795 1.00 87.90  ? 446  TYR A CG  1 
ATOM   2985 C  CD1 . TYR A 1 467  ? 129.286 108.907 121.814 1.00 87.90  ? 446  TYR A CD1 1 
ATOM   2986 C  CD2 . TYR A 1 467  ? 128.399 106.790 121.194 1.00 87.90  ? 446  TYR A CD2 1 
ATOM   2987 C  CE1 . TYR A 1 467  ? 128.211 109.529 121.229 1.00 87.90  ? 446  TYR A CE1 1 
ATOM   2988 C  CE2 . TYR A 1 467  ? 127.322 107.406 120.617 1.00 87.90  ? 446  TYR A CE2 1 
ATOM   2989 C  CZ  . TYR A 1 467  ? 127.228 108.770 120.639 1.00 87.90  ? 446  TYR A CZ  1 
ATOM   2990 O  OH  . TYR A 1 467  ? 126.141 109.371 120.054 1.00 87.90  ? 446  TYR A OH  1 
ATOM   2991 N  N   . LEU A 1 468  ? 133.726 106.486 123.407 1.00 80.65  ? 447  LEU A N   1 
ATOM   2992 C  CA  . LEU A 1 468  ? 134.698 105.986 124.377 1.00 80.65  ? 447  LEU A CA  1 
ATOM   2993 C  C   . LEU A 1 468  ? 135.411 107.127 125.086 1.00 80.65  ? 447  LEU A C   1 
ATOM   2994 O  O   . LEU A 1 468  ? 135.732 107.014 126.277 1.00 80.65  ? 447  LEU A O   1 
ATOM   2995 C  CB  . LEU A 1 468  ? 135.709 105.069 123.701 1.00 80.65  ? 447  LEU A CB  1 
ATOM   2996 C  CG  . LEU A 1 468  ? 135.138 103.723 123.269 1.00 80.65  ? 447  LEU A CG  1 
ATOM   2997 C  CD1 . LEU A 1 468  ? 136.166 102.930 122.484 1.00 80.65  ? 447  LEU A CD1 1 
ATOM   2998 C  CD2 . LEU A 1 468  ? 134.688 102.957 124.492 1.00 80.65  ? 447  LEU A CD2 1 
ATOM   2999 N  N   . LEU A 1 469  ? 135.657 108.230 124.375 1.00 88.03  ? 448  LEU A N   1 
ATOM   3000 C  CA  . LEU A 1 469  ? 136.075 109.452 125.051 1.00 88.03  ? 448  LEU A CA  1 
ATOM   3001 C  C   . LEU A 1 469  ? 134.998 109.962 125.995 1.00 88.03  ? 448  LEU A C   1 
ATOM   3002 O  O   . LEU A 1 469  ? 135.317 110.489 127.067 1.00 88.03  ? 448  LEU A O   1 
ATOM   3003 C  CB  . LEU A 1 469  ? 136.447 110.515 124.015 1.00 88.03  ? 448  LEU A CB  1 
ATOM   3004 C  CG  . LEU A 1 469  ? 136.931 111.898 124.439 1.00 88.03  ? 448  LEU A CG  1 
ATOM   3005 C  CD1 . LEU A 1 469  ? 138.041 112.348 123.524 1.00 88.03  ? 448  LEU A CD1 1 
ATOM   3006 C  CD2 . LEU A 1 469  ? 135.790 112.888 124.330 1.00 88.03  ? 448  LEU A CD2 1 
ATOM   3007 N  N   . MET A 1 470  ? 133.722 109.798 125.626 1.00 84.38  ? 449  MET A N   1 
ATOM   3008 C  CA  . MET A 1 470  ? 132.642 110.296 126.472 1.00 84.38  ? 449  MET A CA  1 
ATOM   3009 C  C   . MET A 1 470  ? 132.524 109.488 127.761 1.00 84.38  ? 449  MET A C   1 
ATOM   3010 O  O   . MET A 1 470  ? 132.257 110.048 128.832 1.00 84.38  ? 449  MET A O   1 
ATOM   3011 C  CB  . MET A 1 470  ? 131.330 110.265 125.703 1.00 84.38  ? 449  MET A CB  1 
ATOM   3012 C  CG  . MET A 1 470  ? 130.235 111.068 126.349 1.00 84.38  ? 449  MET A CG  1 
ATOM   3013 S  SD  . MET A 1 470  ? 130.570 112.831 126.241 1.00 84.38  ? 449  MET A SD  1 
ATOM   3014 C  CE  . MET A 1 470  ? 129.499 113.464 127.519 1.00 84.38  ? 449  MET A CE  1 
ATOM   3015 N  N   . LEU A 1 471  ? 132.716 108.170 127.671 1.00 68.64  ? 450  LEU A N   1 
ATOM   3016 C  CA  . LEU A 1 471  ? 132.796 107.333 128.862 1.00 68.64  ? 450  LEU A CA  1 
ATOM   3017 C  C   . LEU A 1 471  ? 134.039 107.651 129.675 1.00 68.64  ? 450  LEU A C   1 
ATOM   3018 O  O   . LEU A 1 471  ? 134.020 107.531 130.905 1.00 68.64  ? 450  LEU A O   1 
ATOM   3019 C  CB  . LEU A 1 471  ? 132.802 105.852 128.483 1.00 68.64  ? 450  LEU A CB  1 
ATOM   3020 C  CG  . LEU A 1 471  ? 131.518 105.035 128.340 1.00 68.64  ? 450  LEU A CG  1 
ATOM   3021 C  CD1 . LEU A 1 471  ? 130.822 104.946 129.658 1.00 68.64  ? 450  LEU A CD1 1 
ATOM   3022 C  CD2 . LEU A 1 471  ? 130.576 105.602 127.317 1.00 68.64  ? 450  LEU A CD2 1 
ATOM   3023 N  N   . ALA A 1 472  ? 135.127 108.040 129.006 1.00 89.91  ? 451  ALA A N   1 
ATOM   3024 C  CA  . ALA A 1 472  ? 136.326 108.442 129.732 1.00 89.91  ? 451  ALA A CA  1 
ATOM   3025 C  C   . ALA A 1 472  ? 136.107 109.732 130.505 1.00 89.91  ? 451  ALA A C   1 
ATOM   3026 O  O   . ALA A 1 472  ? 136.715 109.930 131.562 1.00 89.91  ? 451  ALA A O   1 
ATOM   3027 C  CB  . ALA A 1 472  ? 137.503 108.604 128.773 1.00 89.91  ? 451  ALA A CB  1 
ATOM   3028 N  N   . TYR A 1 473  ? 135.253 110.618 130.006 1.00 79.18  ? 452  TYR A N   1 
ATOM   3029 C  CA  . TYR A 1 473  ? 134.973 111.817 130.783 1.00 79.18  ? 452  TYR A CA  1 
ATOM   3030 C  C   . TYR A 1 473  ? 133.981 111.530 131.903 1.00 79.18  ? 452  TYR A C   1 
ATOM   3031 O  O   . TYR A 1 473  ? 134.235 111.874 133.063 1.00 79.18  ? 452  TYR A O   1 
ATOM   3032 C  CB  . TYR A 1 473  ? 134.470 112.935 129.874 1.00 79.18  ? 452  TYR A CB  1 
ATOM   3033 C  CG  . TYR A 1 473  ? 134.121 114.180 130.641 1.00 79.18  ? 452  TYR A CG  1 
ATOM   3034 C  CD1 . TYR A 1 473  ? 135.104 114.899 131.300 1.00 79.18  ? 452  TYR A CD1 1 
ATOM   3035 C  CD2 . TYR A 1 473  ? 132.817 114.648 130.690 1.00 79.18  ? 452  TYR A CD2 1 
ATOM   3036 C  CE1 . TYR A 1 473  ? 134.797 116.036 132.005 1.00 79.18  ? 452  TYR A CE1 1 
ATOM   3037 C  CE2 . TYR A 1 473  ? 132.501 115.793 131.387 1.00 79.18  ? 452  TYR A CE2 1 
ATOM   3038 C  CZ  . TYR A 1 473  ? 133.495 116.479 132.047 1.00 79.18  ? 452  TYR A CZ  1 
ATOM   3039 O  OH  . TYR A 1 473  ? 133.185 117.618 132.750 1.00 79.18  ? 452  TYR A OH  1 
ATOM   3040 N  N   . ALA A 1 474  ? 132.866 110.866 131.579 1.00 85.68  ? 453  ALA A N   1 
ATOM   3041 C  CA  . ALA A 1 474  ? 131.820 110.610 132.564 1.00 85.68  ? 453  ALA A CA  1 
ATOM   3042 C  C   . ALA A 1 474  ? 132.255 109.645 133.656 1.00 85.68  ? 453  ALA A C   1 
ATOM   3043 O  O   . ALA A 1 474  ? 131.640 109.627 134.725 1.00 85.68  ? 453  ALA A O   1 
ATOM   3044 C  CB  . ALA A 1 474  ? 130.568 110.075 131.876 1.00 85.68  ? 453  ALA A CB  1 
ATOM   3045 N  N   . CYS A 1 475  ? 133.286 108.835 133.409 1.00 94.90  ? 454  CYS A N   1 
ATOM   3046 C  CA  . CYS A 1 475  ? 133.901 108.076 134.491 1.00 94.90  ? 454  CYS A CA  1 
ATOM   3047 C  C   . CYS A 1 475  ? 134.572 109.001 135.496 1.00 94.90  ? 454  CYS A C   1 
ATOM   3048 O  O   . CYS A 1 475  ? 134.484 108.780 136.709 1.00 94.90  ? 454  CYS A O   1 
ATOM   3049 C  CB  . CYS A 1 475  ? 134.917 107.085 133.927 1.00 94.90  ? 454  CYS A CB  1 
ATOM   3050 S  SG  . CYS A 1 475  ? 135.775 106.094 135.168 1.00 94.90  ? 454  CYS A SG  1 
ATOM   3051 N  N   . LEU A 1 476  ? 135.237 110.046 135.014 1.00 86.65  ? 455  LEU A N   1 
ATOM   3052 C  CA  . LEU A 1 476  ? 135.969 110.952 135.884 1.00 86.65  ? 455  LEU A CA  1 
ATOM   3053 C  C   . LEU A 1 476  ? 135.110 112.072 136.443 1.00 86.65  ? 455  LEU A C   1 
ATOM   3054 O  O   . LEU A 1 476  ? 135.589 112.816 137.303 1.00 86.65  ? 455  LEU A O   1 
ATOM   3055 C  CB  . LEU A 1 476  ? 137.159 111.563 135.142 1.00 86.65  ? 455  LEU A CB  1 
ATOM   3056 C  CG  . LEU A 1 476  ? 138.509 110.842 135.181 1.00 86.65  ? 455  LEU A CG  1 
ATOM   3057 C  CD1 . LEU A 1 476  ? 138.997 110.734 136.619 1.00 86.65  ? 455  LEU A CD1 1 
ATOM   3058 C  CD2 . LEU A 1 476  ? 138.489 109.478 134.507 1.00 86.65  ? 455  LEU A CD2 1 
ATOM   3059 N  N   . THR A 1 477  ? 133.874 112.230 135.965 1.00 100.94 ? 456  THR A N   1 
ATOM   3060 C  CA  . THR A 1 477  ? 132.977 113.211 136.571 1.00 100.94 ? 456  THR A CA  1 
ATOM   3061 C  C   . THR A 1 477  ? 132.595 112.812 137.988 1.00 100.94 ? 456  THR A C   1 
ATOM   3062 O  O   . THR A 1 477  ? 132.411 113.672 138.856 1.00 100.94 ? 456  THR A O   1 
ATOM   3063 C  CB  . THR A 1 477  ? 131.715 113.370 135.734 1.00 100.94 ? 456  THR A CB  1 
ATOM   3064 O  OG1 . THR A 1 477  ? 131.065 112.101 135.612 1.00 100.94 ? 456  THR A OG1 1 
ATOM   3065 C  CG2 . THR A 1 477  ? 132.048 113.896 134.376 1.00 100.94 ? 456  THR A CG2 1 
ATOM   3066 N  N   . MET A 1 478  ? 132.454 111.515 138.230 1.00 107.03 ? 457  MET A N   1 
ATOM   3067 C  CA  . MET A 1 478  ? 132.007 110.982 139.511 1.00 107.03 ? 457  MET A CA  1 
ATOM   3068 C  C   . MET A 1 478  ? 132.883 109.781 139.865 1.00 107.03 ? 457  MET A C   1 
ATOM   3069 O  O   . MET A 1 478  ? 132.559 108.625 139.590 1.00 107.03 ? 457  MET A O   1 
ATOM   3070 C  CB  . MET A 1 478  ? 130.512 110.673 139.420 1.00 107.03 ? 457  MET A CB  1 
ATOM   3071 C  CG  . MET A 1 478  ? 130.097 109.982 138.125 1.00 107.03 ? 457  MET A CG  1 
ATOM   3072 S  SD  . MET A 1 478  ? 128.331 109.988 137.830 1.00 107.03 ? 457  MET A SD  1 
ATOM   3073 C  CE  . MET A 1 478  ? 128.124 111.682 137.312 1.00 107.03 ? 457  MET A CE  1 
ATOM   3074 N  N   . LEU A 1 479  ? 134.015 110.061 140.499 1.00 104.79 ? 458  LEU A N   1 
ATOM   3075 C  CA  . LEU A 1 479  ? 134.957 109.021 140.884 1.00 104.79 ? 458  LEU A CA  1 
ATOM   3076 C  C   . LEU A 1 479  ? 135.003 108.806 142.385 1.00 104.79 ? 458  LEU A C   1 
ATOM   3077 O  O   . LEU A 1 479  ? 134.993 107.654 142.827 1.00 104.79 ? 458  LEU A O   1 
ATOM   3078 C  CB  . LEU A 1 479  ? 136.360 109.359 140.359 1.00 104.79 ? 458  LEU A CB  1 
ATOM   3079 C  CG  . LEU A 1 479  ? 137.474 108.306 140.270 1.00 104.79 ? 458  LEU A CG  1 
ATOM   3080 C  CD1 . LEU A 1 479  ? 138.274 108.091 141.558 1.00 104.79 ? 458  LEU A CD1 1 
ATOM   3081 C  CD2 . LEU A 1 479  ? 136.872 106.992 139.794 1.00 104.79 ? 458  LEU A CD2 1 
ATOM   3082 N  N   . ARG A 1 480  ? 135.041 109.898 143.160 1.00 113.00 ? 459  ARG A N   1 
ATOM   3083 C  CA  . ARG A 1 480  ? 135.004 109.901 144.622 1.00 113.00 ? 459  ARG A CA  1 
ATOM   3084 C  C   . ARG A 1 480  ? 136.157 109.112 145.228 1.00 113.00 ? 459  ARG A C   1 
ATOM   3085 O  O   . ARG A 1 480  ? 135.980 107.943 145.585 1.00 113.00 ? 459  ARG A O   1 
ATOM   3086 C  CB  . ARG A 1 480  ? 133.672 109.382 145.157 1.00 113.00 ? 459  ARG A CB  1 
ATOM   3087 C  CG  . ARG A 1 480  ? 132.441 110.110 144.655 1.00 113.00 ? 459  ARG A CG  1 
ATOM   3088 C  CD  . ARG A 1 480  ? 132.282 111.553 145.083 1.00 113.00 ? 459  ARG A CD  1 
ATOM   3089 N  NE  . ARG A 1 480  ? 132.866 112.469 144.108 1.00 113.00 ? 459  ARG A NE  1 
ATOM   3090 C  CZ  . ARG A 1 480  ? 132.896 113.789 144.246 1.00 113.00 ? 459  ARG A CZ  1 
ATOM   3091 N  NH1 . ARG A 1 480  ? 132.342 114.360 145.306 1.00 113.00 ? 459  ARG A NH1 1 
ATOM   3092 N  NH2 . ARG A 1 480  ? 133.454 114.540 143.308 1.00 113.00 ? 459  ARG A NH2 1 
ATOM   3093 N  N   . TRP A 1 481  ? 137.352 109.716 145.211 1.00 110.11 ? 460  TRP A N   1 
ATOM   3094 C  CA  . TRP A 1 481  ? 138.572 109.306 145.908 1.00 110.11 ? 460  TRP A CA  1 
ATOM   3095 C  C   . TRP A 1 481  ? 138.297 108.662 147.263 1.00 110.11 ? 460  TRP A C   1 
ATOM   3096 O  O   . TRP A 1 481  ? 138.820 107.584 147.557 1.00 110.11 ? 460  TRP A O   1 
ATOM   3097 C  CB  . TRP A 1 481  ? 139.456 110.546 146.083 1.00 110.11 ? 460  TRP A CB  1 
ATOM   3098 C  CG  . TRP A 1 481  ? 140.777 110.362 146.753 1.00 110.11 ? 460  TRP A CG  1 
ATOM   3099 C  CD1 . TRP A 1 481  ? 141.835 109.649 146.285 1.00 110.11 ? 460  TRP A CD1 1 
ATOM   3100 C  CD2 . TRP A 1 481  ? 141.201 110.941 147.995 1.00 110.11 ? 460  TRP A CD2 1 
ATOM   3101 N  NE1 . TRP A 1 481  ? 142.889 109.732 147.162 1.00 110.11 ? 460  TRP A NE1 1 
ATOM   3102 C  CE2 . TRP A 1 481  ? 142.525 110.521 148.220 1.00 110.11 ? 460  TRP A CE2 1 
ATOM   3103 C  CE3 . TRP A 1 481  ? 140.586 111.768 148.939 1.00 110.11 ? 460  TRP A CE3 1 
ATOM   3104 C  CZ2 . TRP A 1 481  ? 143.247 110.897 149.355 1.00 110.11 ? 460  TRP A CZ2 1 
ATOM   3105 C  CZ3 . TRP A 1 481  ? 141.305 112.139 150.066 1.00 110.11 ? 460  TRP A CZ3 1 
ATOM   3106 C  CH2 . TRP A 1 481  ? 142.620 111.704 150.264 1.00 110.11 ? 460  TRP A CH2 1 
ATOM   3107 N  N   . ASP A 1 482  ? 137.461 109.299 148.079 1.00 120.21 ? 461  ASP A N   1 
ATOM   3108 C  CA  . ASP A 1 482  ? 136.845 108.634 149.220 1.00 120.21 ? 461  ASP A CA  1 
ATOM   3109 C  C   . ASP A 1 482  ? 135.603 107.859 148.779 1.00 120.21 ? 461  ASP A C   1 
ATOM   3110 O  O   . ASP A 1 482  ? 134.703 108.413 148.144 1.00 120.21 ? 461  ASP A O   1 
ATOM   3111 C  CB  . ASP A 1 482  ? 136.517 109.660 150.305 1.00 120.21 ? 461  ASP A CB  1 
ATOM   3112 C  CG  . ASP A 1 482  ? 135.855 110.911 149.753 1.00 120.21 ? 461  ASP A CG  1 
ATOM   3113 O  OD1 . ASP A 1 482  ? 135.752 111.051 148.518 1.00 120.21 ? 461  ASP A OD1 1 
ATOM   3114 O  OD2 . ASP A 1 482  ? 135.445 111.766 150.564 1.00 120.21 ? 461  ASP A OD2 1 
ATOM   3115 N  N   . CYS A 1 483  ? 135.551 106.577 149.140 1.00 93.42  ? 462  CYS A N   1 
ATOM   3116 C  CA  . CYS A 1 483  ? 134.681 105.607 148.488 1.00 93.42  ? 462  CYS A CA  1 
ATOM   3117 C  C   . CYS A 1 483  ? 133.226 105.734 148.941 1.00 93.42  ? 462  CYS A C   1 
ATOM   3118 O  O   . CYS A 1 483  ? 132.829 106.683 149.623 1.00 93.42  ? 462  CYS A O   1 
ATOM   3119 C  CB  . CYS A 1 483  ? 135.183 104.189 148.749 1.00 93.42  ? 462  CYS A CB  1 
ATOM   3120 S  SG  . CYS A 1 483  ? 136.797 103.810 148.038 1.00 93.42  ? 462  CYS A SG  1 
ATOM   3121 N  N   . SER A 1 484  ? 132.414 104.794 148.442 1.00 81.21  ? 463  SER A N   1 
ATOM   3122 C  CA  . SER A 1 484  ? 131.033 104.473 148.817 1.00 81.21  ? 463  SER A CA  1 
ATOM   3123 C  C   . SER A 1 484  ? 130.014 105.521 148.382 1.00 81.21  ? 463  SER A C   1 
ATOM   3124 O  O   . SER A 1 484  ? 128.806 105.285 148.460 1.00 81.21  ? 463  SER A O   1 
ATOM   3125 C  CB  . SER A 1 484  ? 130.919 104.219 150.323 1.00 81.21  ? 463  SER A CB  1 
ATOM   3126 O  OG  . SER A 1 484  ? 129.585 103.900 150.680 1.00 81.21  ? 463  SER A OG  1 
ATOM   3127 N  N   . LYS A 1 485  ? 130.484 106.664 147.891 1.00 91.27  ? 464  LYS A N   1 
ATOM   3128 C  CA  . LYS A 1 485  ? 129.661 107.644 147.199 1.00 91.27  ? 464  LYS A CA  1 
ATOM   3129 C  C   . LYS A 1 485  ? 130.018 107.653 145.713 1.00 91.27  ? 464  LYS A C   1 
ATOM   3130 O  O   . LYS A 1 485  ? 129.648 108.578 144.985 1.00 91.27  ? 464  LYS A O   1 
ATOM   3131 C  CB  . LYS A 1 485  ? 129.853 109.019 147.856 1.00 91.27  ? 464  LYS A CB  1 
ATOM   3132 C  CG  . LYS A 1 485  ? 128.807 110.122 147.572 1.00 91.27  ? 464  LYS A CG  1 
ATOM   3133 C  CD  . LYS A 1 485  ? 127.440 109.799 148.146 1.00 91.27  ? 464  LYS A CD  1 
ATOM   3134 C  CE  . LYS A 1 485  ? 127.432 109.885 149.662 1.00 91.27  ? 464  LYS A CE  1 
ATOM   3135 N  NZ  . LYS A 1 485  ? 127.514 111.287 150.158 1.00 91.27  ? 464  LYS A NZ  1 
ATOM   3136 N  N   . SER A 1 486  ? 130.653 106.564 145.250 1.00 99.54  ? 465  SER A N   1 
ATOM   3137 C  CA  . SER A 1 486  ? 131.559 106.591 144.100 1.00 99.54  ? 465  SER A CA  1 
ATOM   3138 C  C   . SER A 1 486  ? 130.853 106.984 142.811 1.00 99.54  ? 465  SER A C   1 
ATOM   3139 O  O   . SER A 1 486  ? 131.314 107.879 142.092 1.00 99.54  ? 465  SER A O   1 
ATOM   3140 C  CB  . SER A 1 486  ? 132.238 105.230 143.945 1.00 99.54  ? 465  SER A CB  1 
ATOM   3141 O  OG  . SER A 1 486  ? 133.113 105.212 142.835 1.00 99.54  ? 465  SER A OG  1 
ATOM   3142 N  N   . GLN A 1 487  ? 129.738 106.313 142.503 1.00 87.63  ? 466  GLN A N   1 
ATOM   3143 C  CA  . GLN A 1 487  ? 128.853 106.598 141.369 1.00 87.63  ? 466  GLN A CA  1 
ATOM   3144 C  C   . GLN A 1 487  ? 129.550 106.489 140.017 1.00 87.63  ? 466  GLN A C   1 
ATOM   3145 O  O   . GLN A 1 487  ? 129.056 107.030 139.025 1.00 87.63  ? 466  GLN A O   1 
ATOM   3146 C  CB  . GLN A 1 487  ? 128.197 107.979 141.498 1.00 87.63  ? 466  GLN A CB  1 
ATOM   3147 C  CG  . GLN A 1 487  ? 127.247 108.124 142.655 1.00 87.63  ? 466  GLN A CG  1 
ATOM   3148 C  CD  . GLN A 1 487  ? 126.702 109.523 142.740 1.00 87.63  ? 466  GLN A CD  1 
ATOM   3149 O  OE1 . GLN A 1 487  ? 127.099 110.399 141.975 1.00 87.63  ? 466  GLN A OE1 1 
ATOM   3150 N  NE2 . GLN A 1 487  ? 125.792 109.747 143.675 1.00 87.63  ? 466  GLN A NE2 1 
ATOM   3151 N  N   . GLY A 1 488  ? 130.681 105.793 139.947 1.00 110.63 ? 467  GLY A N   1 
ATOM   3152 C  CA  . GLY A 1 488  ? 131.423 105.691 138.711 1.00 110.63 ? 467  GLY A CA  1 
ATOM   3153 C  C   . GLY A 1 488  ? 130.720 104.797 137.722 1.00 110.63 ? 467  GLY A C   1 
ATOM   3154 O  O   . GLY A 1 488  ? 130.367 105.248 136.626 1.00 110.63 ? 467  GLY A O   1 
ATOM   3155 N  N   . ALA A 1 489  ? 130.473 103.552 138.146 1.00 110.31 ? 468  ALA A N   1 
ATOM   3156 C  CA  . ALA A 1 489  ? 129.923 102.524 137.265 1.00 110.31 ? 468  ALA A CA  1 
ATOM   3157 C  C   . ALA A 1 489  ? 128.551 102.919 136.743 1.00 110.31 ? 468  ALA A C   1 
ATOM   3158 O  O   . ALA A 1 489  ? 128.319 102.908 135.527 1.00 110.31 ? 468  ALA A O   1 
ATOM   3159 C  CB  . ALA A 1 489  ? 129.853 101.188 138.005 1.00 110.31 ? 468  ALA A CB  1 
ATOM   3160 N  N   . VAL A 1 490  ? 127.652 103.318 137.656 1.00 93.84  ? 469  VAL A N   1 
ATOM   3161 C  CA  . VAL A 1 490  ? 126.350 103.857 137.274 1.00 93.84  ? 469  VAL A CA  1 
ATOM   3162 C  C   . VAL A 1 490  ? 126.500 105.062 136.363 1.00 93.84  ? 469  VAL A C   1 
ATOM   3163 O  O   . VAL A 1 490  ? 125.798 105.162 135.346 1.00 93.84  ? 469  VAL A O   1 
ATOM   3164 C  CB  . VAL A 1 490  ? 125.522 104.259 138.508 1.00 30.00  ? 469  VAL A CB  1 
ATOM   3165 C  CG1 . VAL A 1 490  ? 124.224 104.929 138.084 1.00 30.00  ? 469  VAL A CG1 1 
ATOM   3166 C  CG2 . VAL A 1 490  ? 125.242 103.045 139.381 1.00 30.00  ? 469  VAL A CG2 1 
ATOM   3167 N  N   . GLY A 1 491  ? 127.469 105.935 136.669 1.00 95.88  ? 470  GLY A N   1 
ATOM   3168 C  CA  . GLY A 1 491  ? 127.783 107.040 135.777 1.00 95.88  ? 470  GLY A CA  1 
ATOM   3169 C  C   . GLY A 1 491  ? 128.215 106.569 134.403 1.00 95.88  ? 470  GLY A C   1 
ATOM   3170 O  O   . GLY A 1 491  ? 127.714 107.066 133.388 1.00 95.88  ? 470  GLY A O   1 
ATOM   3171 N  N   . LEU A 1 492  ? 129.108 105.563 134.367 1.00 89.41  ? 471  LEU A N   1 
ATOM   3172 C  CA  . LEU A 1 492  ? 129.424 104.837 133.138 1.00 89.41  ? 471  LEU A CA  1 
ATOM   3173 C  C   . LEU A 1 492  ? 128.152 104.351 132.477 1.00 89.41  ? 471  LEU A C   1 
ATOM   3174 O  O   . LEU A 1 492  ? 127.824 104.755 131.350 1.00 89.41  ? 471  LEU A O   1 
ATOM   3175 C  CB  . LEU A 1 492  ? 130.318 103.634 133.440 1.00 89.41  ? 471  LEU A CB  1 
ATOM   3176 C  CG  . LEU A 1 492  ? 131.749 103.755 133.944 1.00 89.41  ? 471  LEU A CG  1 
ATOM   3177 C  CD1 . LEU A 1 492  ? 132.278 102.380 134.299 1.00 89.41  ? 471  LEU A CD1 1 
ATOM   3178 C  CD2 . LEU A 1 492  ? 132.615 104.383 132.887 1.00 89.41  ? 471  LEU A CD2 1 
ATOM   3179 N  N   . ALA A 1 493  ? 127.348 103.616 133.255 1.00 85.69  ? 472  ALA A N   1 
ATOM   3180 C  CA  . ALA A 1 493  ? 126.127 103.027 132.741 1.00 85.69  ? 472  ALA A CA  1 
ATOM   3181 C  C   . ALA A 1 493  ? 125.141 104.094 132.332 1.00 85.69  ? 472  ALA A C   1 
ATOM   3182 O  O   . ALA A 1 493  ? 124.371 103.862 131.393 1.00 85.69  ? 472  ALA A O   1 
ATOM   3183 C  CB  . ALA A 1 493  ? 125.509 102.094 133.775 1.00 85.69  ? 472  ALA A CB  1 
ATOM   3184 N  N   . GLY A 1 494  ? 125.247 105.289 132.948 1.00 72.41  ? 473  GLY A N   1 
ATOM   3185 C  CA  . GLY A 1 494  ? 124.395 106.408 132.580 1.00 72.41  ? 473  GLY A CA  1 
ATOM   3186 C  C   . GLY A 1 494  ? 124.465 106.728 131.105 1.00 72.41  ? 473  GLY A C   1 
ATOM   3187 O  O   . GLY A 1 494  ? 123.444 106.660 130.403 1.00 72.41  ? 473  GLY A O   1 
ATOM   3188 N  N   . VAL A 1 495  ? 125.698 106.882 130.589 1.00 67.14  ? 474  VAL A N   1 
ATOM   3189 C  CA  . VAL A 1 495  ? 125.896 107.264 129.193 1.00 67.14  ? 474  VAL A CA  1 
ATOM   3190 C  C   . VAL A 1 495  ? 125.358 106.181 128.284 1.00 67.14  ? 474  VAL A C   1 
ATOM   3191 O  O   . VAL A 1 495  ? 124.705 106.488 127.272 1.00 67.14  ? 474  VAL A O   1 
ATOM   3192 C  CB  . VAL A 1 495  ? 127.383 107.557 128.914 1.00 67.14  ? 474  VAL A CB  1 
ATOM   3193 C  CG1 . VAL A 1 495  ? 127.605 107.873 127.454 1.00 67.14  ? 474  VAL A CG1 1 
ATOM   3194 C  CG2 . VAL A 1 495  ? 127.846 108.716 129.753 1.00 67.14  ? 474  VAL A CG2 1 
ATOM   3195 N  N   . LEU A 1 496  ? 125.468 104.917 128.733 1.00 62.45  ? 475  LEU A N   1 
ATOM   3196 C  CA  . LEU A 1 496  ? 125.020 103.775 127.945 1.00 62.45  ? 475  LEU A CA  1 
ATOM   3197 C  C   . LEU A 1 496  ? 123.548 103.886 127.621 1.00 62.45  ? 475  LEU A C   1 
ATOM   3198 O  O   . LEU A 1 496  ? 123.180 103.865 126.438 1.00 62.45  ? 475  LEU A O   1 
ATOM   3199 C  CB  . LEU A 1 496  ? 125.293 102.462 128.674 1.00 62.45  ? 475  LEU A CB  1 
ATOM   3200 C  CG  . LEU A 1 496  ? 126.608 101.750 128.375 1.00 62.45  ? 475  LEU A CG  1 
ATOM   3201 C  CD1 . LEU A 1 496  ? 126.660 101.404 126.904 1.00 62.45  ? 475  LEU A CD1 1 
ATOM   3202 C  CD2 . LEU A 1 496  ? 127.818 102.555 128.786 1.00 62.45  ? 475  LEU A CD2 1 
ATOM   3203 N  N   . LEU A 1 497  ? 122.714 104.171 128.635 1.00 62.85  ? 476  LEU A N   1 
ATOM   3204 C  CA  . LEU A 1 497  ? 121.291 104.190 128.326 1.00 62.85  ? 476  LEU A CA  1 
ATOM   3205 C  C   . LEU A 1 497  ? 120.939 105.399 127.478 1.00 62.85  ? 476  LEU A C   1 
ATOM   3206 O  O   . LEU A 1 497  ? 120.144 105.266 126.534 1.00 62.85  ? 476  LEU A O   1 
ATOM   3207 C  CB  . LEU A 1 497  ? 120.404 104.112 129.576 1.00 62.85  ? 476  LEU A CB  1 
ATOM   3208 C  CG  . LEU A 1 497  ? 120.254 104.858 130.911 1.00 62.85  ? 476  LEU A CG  1 
ATOM   3209 C  CD1 . LEU A 1 497  ? 121.311 104.579 131.948 1.00 62.85  ? 476  LEU A CD1 1 
ATOM   3210 C  CD2 . LEU A 1 497  ? 119.923 106.350 130.758 1.00 62.85  ? 476  LEU A CD2 1 
ATOM   3211 N  N   . VAL A 1 498  ? 121.660 106.510 127.681 1.00 58.70  ? 477  VAL A N   1 
ATOM   3212 C  CA  . VAL A 1 498  ? 121.410 107.709 126.894 1.00 58.70  ? 477  VAL A CA  1 
ATOM   3213 C  C   . VAL A 1 498  ? 121.783 107.460 125.449 1.00 58.70  ? 477  VAL A C   1 
ATOM   3214 O  O   . VAL A 1 498  ? 121.030 107.831 124.535 1.00 58.70  ? 477  VAL A O   1 
ATOM   3215 C  CB  . VAL A 1 498  ? 122.167 108.908 127.488 1.00 58.70  ? 477  VAL A CB  1 
ATOM   3216 C  CG1 . VAL A 1 498  ? 121.998 110.130 126.619 1.00 58.70  ? 477  VAL A CG1 1 
ATOM   3217 C  CG2 . VAL A 1 498  ? 121.655 109.190 128.876 1.00 58.70  ? 477  VAL A CG2 1 
ATOM   3218 N  N   . ALA A 1 499  ? 122.871 106.698 125.236 1.00 50.66  ? 478  ALA A N   1 
ATOM   3219 C  CA  . ALA A 1 499  ? 123.301 106.372 123.884 1.00 50.66  ? 478  ALA A CA  1 
ATOM   3220 C  C   . ALA A 1 499  ? 122.225 105.581 123.169 1.00 50.66  ? 478  ALA A C   1 
ATOM   3221 O  O   . ALA A 1 499  ? 121.822 105.946 122.053 1.00 50.66  ? 478  ALA A O   1 
ATOM   3222 C  CB  . ALA A 1 499  ? 124.617 105.594 123.921 1.00 50.66  ? 478  ALA A CB  1 
ATOM   3223 N  N   . LEU A 1 500  ? 121.616 104.633 123.895 1.00 59.00  ? 479  LEU A N   1 
ATOM   3224 C  CA  . LEU A 1 500  ? 120.610 103.763 123.308 1.00 59.00  ? 479  LEU A CA  1 
ATOM   3225 C  C   . LEU A 1 500  ? 119.407 104.575 122.880 1.00 59.00  ? 479  LEU A C   1 
ATOM   3226 O  O   . LEU A 1 500  ? 118.868 104.360 121.783 1.00 59.00  ? 479  LEU A O   1 
ATOM   3227 C  CB  . LEU A 1 500  ? 120.217 102.682 124.313 1.00 59.00  ? 479  LEU A CB  1 
ATOM   3228 C  CG  . LEU A 1 500  ? 119.490 101.412 123.860 1.00 59.00  ? 479  LEU A CG  1 
ATOM   3229 C  CD1 . LEU A 1 500  ? 119.799 100.314 124.854 1.00 59.00  ? 479  LEU A CD1 1 
ATOM   3230 C  CD2 . LEU A 1 500  ? 117.983 101.564 123.666 1.00 59.00  ? 479  LEU A CD2 1 
ATOM   3231 N  N   . SER A 1 501  ? 119.088 105.611 123.670 1.00 61.08  ? 480  SER A N   1 
ATOM   3232 C  CA  . SER A 1 501  ? 117.893 106.401 123.420 1.00 61.08  ? 480  SER A CA  1 
ATOM   3233 C  C   . SER A 1 501  ? 117.998 107.122 122.093 1.00 61.08  ? 480  SER A C   1 
ATOM   3234 O  O   . SER A 1 501  ? 117.035 107.107 121.312 1.00 61.08  ? 480  SER A O   1 
ATOM   3235 C  CB  . SER A 1 501  ? 117.669 107.387 124.557 1.00 61.08  ? 480  SER A CB  1 
ATOM   3236 O  OG  . SER A 1 501  ? 116.503 108.138 124.319 1.00 61.08  ? 480  SER A OG  1 
ATOM   3237 N  N   . VAL A 1 502  ? 119.215 107.595 121.766 1.00 55.24  ? 481  VAL A N   1 
ATOM   3238 C  CA  . VAL A 1 502  ? 119.447 108.299 120.507 1.00 55.24  ? 481  VAL A CA  1 
ATOM   3239 C  C   . VAL A 1 502  ? 119.105 107.395 119.342 1.00 55.24  ? 481  VAL A C   1 
ATOM   3240 O  O   . VAL A 1 502  ? 118.234 107.729 118.522 1.00 55.24  ? 481  VAL A O   1 
ATOM   3241 C  CB  . VAL A 1 502  ? 120.900 108.793 120.413 1.00 55.24  ? 481  VAL A CB  1 
ATOM   3242 C  CG1 . VAL A 1 502  ? 121.152 109.415 119.058 1.00 55.24  ? 481  VAL A CG1 1 
ATOM   3243 C  CG2 . VAL A 1 502  ? 121.188 109.790 121.503 1.00 55.24  ? 481  VAL A CG2 1 
ATOM   3244 N  N   . ALA A 1 503  ? 119.646 106.168 119.372 1.00 59.78  ? 482  ALA A N   1 
ATOM   3245 C  CA  . ALA A 1 503  ? 119.429 105.231 118.277 1.00 59.78  ? 482  ALA A CA  1 
ATOM   3246 C  C   . ALA A 1 503  ? 117.969 104.863 118.184 1.00 59.78  ? 482  ALA A C   1 
ATOM   3247 O  O   . ALA A 1 503  ? 117.376 104.929 117.099 1.00 59.78  ? 482  ALA A O   1 
ATOM   3248 C  CB  . ALA A 1 503  ? 120.274 103.979 118.472 1.00 59.78  ? 482  ALA A CB  1 
ATOM   3249 N  N   . ALA A 1 504  ? 117.340 104.650 119.341 1.00 67.84  ? 483  ALA A N   1 
ATOM   3250 C  CA  . ALA A 1 504  ? 115.973 104.175 119.315 1.00 67.84  ? 483  ALA A CA  1 
ATOM   3251 C  C   . ALA A 1 504  ? 115.049 105.285 118.881 1.00 67.84  ? 483  ALA A C   1 
ATOM   3252 O  O   . ALA A 1 504  ? 114.081 105.022 118.157 1.00 67.84  ? 483  ALA A O   1 
ATOM   3253 C  CB  . ALA A 1 504  ? 115.577 103.623 120.675 1.00 67.84  ? 483  ALA A CB  1 
ATOM   3254 N  N   . GLY A 1 505  ? 115.428 106.535 119.187 1.00 68.46  ? 484  GLY A N   1 
ATOM   3255 C  CA  . GLY A 1 505  ? 114.661 107.664 118.697 1.00 68.46  ? 484  GLY A CA  1 
ATOM   3256 C  C   . GLY A 1 505  ? 114.687 107.730 117.188 1.00 68.46  ? 484  GLY A C   1 
ATOM   3257 O  O   . GLY A 1 505  ? 113.634 107.809 116.545 1.00 68.46  ? 484  GLY A O   1 
ATOM   3258 N  N   . LEU A 1 506  ? 115.876 107.544 116.605 1.00 61.76  ? 485  LEU A N   1 
ATOM   3259 C  CA  . LEU A 1 506  ? 115.976 107.550 115.158 1.00 61.76  ? 485  LEU A CA  1 
ATOM   3260 C  C   . LEU A 1 506  ? 115.290 106.336 114.569 1.00 61.76  ? 485  LEU A C   1 
ATOM   3261 O  O   . LEU A 1 506  ? 114.687 106.439 113.494 1.00 61.76  ? 485  LEU A O   1 
ATOM   3262 C  CB  . LEU A 1 506  ? 117.436 107.618 114.737 1.00 61.76  ? 485  LEU A CB  1 
ATOM   3263 C  CG  . LEU A 1 506  ? 118.096 108.923 115.185 1.00 61.76  ? 485  LEU A CG  1 
ATOM   3264 C  CD1 . LEU A 1 506  ? 119.574 108.943 114.833 1.00 61.76  ? 485  LEU A CD1 1 
ATOM   3265 C  CD2 . LEU A 1 506  ? 117.376 110.110 114.580 1.00 61.76  ? 485  LEU A CD2 1 
ATOM   3266 N  N   . GLY A 1 507  ? 115.282 105.221 115.313 1.00 66.72  ? 486  GLY A N   1 
ATOM   3267 C  CA  . GLY A 1 507  ? 114.560 104.050 114.857 1.00 66.72  ? 486  GLY A CA  1 
ATOM   3268 C  C   . GLY A 1 507  ? 113.075 104.316 114.766 1.00 66.72  ? 486  GLY A C   1 
ATOM   3269 O  O   . GLY A 1 507  ? 112.429 103.933 113.786 1.00 66.72  ? 486  GLY A O   1 
ATOM   3270 N  N   . LEU A 1 508  ? 112.545 105.075 115.730 1.00 66.67  ? 487  LEU A N   1 
ATOM   3271 C  CA  . LEU A 1 508  ? 111.137 105.430 115.678 1.00 66.67  ? 487  LEU A CA  1 
ATOM   3272 C  C   . LEU A 1 508  ? 110.875 106.384 114.527 1.00 66.67  ? 487  LEU A C   1 
ATOM   3273 O  O   . LEU A 1 508  ? 109.834 106.277 113.868 1.00 66.67  ? 487  LEU A O   1 
ATOM   3274 C  CB  . LEU A 1 508  ? 110.705 106.018 117.019 1.00 66.67  ? 487  LEU A CB  1 
ATOM   3275 C  CG  . LEU A 1 508  ? 109.224 106.149 117.383 1.00 66.67  ? 487  LEU A CG  1 
ATOM   3276 C  CD1 . LEU A 1 508  ? 108.565 107.414 116.865 1.00 66.67  ? 487  LEU A CD1 1 
ATOM   3277 C  CD2 . LEU A 1 508  ? 108.471 104.932 116.884 1.00 66.67  ? 487  LEU A CD2 1 
ATOM   3278 N  N   . CYS A 1 509  ? 111.843 107.253 114.212 1.00 75.52  ? 488  CYS A N   1 
ATOM   3279 C  CA  . CYS A 1 509  ? 111.681 108.106 113.044 1.00 75.52  ? 488  CYS A CA  1 
ATOM   3280 C  C   . CYS A 1 509  ? 111.789 107.315 111.755 1.00 75.52  ? 488  CYS A C   1 
ATOM   3281 O  O   . CYS A 1 509  ? 111.205 107.717 110.748 1.00 75.52  ? 488  CYS A O   1 
ATOM   3282 C  CB  . CYS A 1 509  ? 112.703 109.237 113.064 1.00 75.52  ? 488  CYS A CB  1 
ATOM   3283 S  SG  . CYS A 1 509  ? 112.400 110.422 114.364 1.00 75.52  ? 488  CYS A SG  1 
ATOM   3284 N  N   . SER A 1 510  ? 112.471 106.172 111.777 1.00 72.87  ? 489  SER A N   1 
ATOM   3285 C  CA  . SER A 1 510  ? 112.472 105.328 110.599 1.00 72.87  ? 489  SER A CA  1 
ATOM   3286 C  C   . SER A 1 510  ? 111.201 104.509 110.479 1.00 72.87  ? 489  SER A C   1 
ATOM   3287 O  O   . SER A 1 510  ? 110.996 103.867 109.445 1.00 72.87  ? 489  SER A O   1 
ATOM   3288 C  CB  . SER A 1 510  ? 113.684 104.403 110.617 1.00 72.87  ? 489  SER A CB  1 
ATOM   3289 O  OG  . SER A 1 510  ? 113.595 103.502 111.702 1.00 72.87  ? 489  SER A OG  1 
ATOM   3290 N  N   . LEU A 1 511  ? 110.344 104.509 111.500 1.00 66.57  ? 490  LEU A N   1 
ATOM   3291 C  CA  . LEU A 1 511  ? 109.098 103.765 111.393 1.00 66.57  ? 490  LEU A CA  1 
ATOM   3292 C  C   . LEU A 1 511  ? 107.907 104.651 111.081 1.00 66.57  ? 490  LEU A C   1 
ATOM   3293 O  O   . LEU A 1 511  ? 106.977 104.195 110.414 1.00 66.57  ? 490  LEU A O   1 
ATOM   3294 C  CB  . LEU A 1 511  ? 108.833 102.972 112.675 1.00 66.57  ? 490  LEU A CB  1 
ATOM   3295 C  CG  . LEU A 1 511  ? 109.867 101.874 112.936 1.00 66.57  ? 490  LEU A CG  1 
ATOM   3296 C  CD1 . LEU A 1 511  ? 109.597 101.188 114.257 1.00 66.57  ? 490  LEU A CD1 1 
ATOM   3297 C  CD2 . LEU A 1 511  ? 109.906 100.864 111.804 1.00 66.57  ? 490  LEU A CD2 1 
ATOM   3298 N  N   . ILE A 1 512  ? 107.903 105.896 111.545 1.00 74.80  ? 491  ILE A N   1 
ATOM   3299 C  CA  . ILE A 1 512  ? 106.895 106.869 111.104 1.00 74.80  ? 491  ILE A CA  1 
ATOM   3300 C  C   . ILE A 1 512  ? 107.520 107.626 109.938 1.00 74.80  ? 491  ILE A C   1 
ATOM   3301 O  O   . ILE A 1 512  ? 108.093 108.709 110.079 1.00 74.80  ? 491  ILE A O   1 
ATOM   3302 C  CB  . ILE A 1 512  ? 106.439 107.791 112.233 1.00 74.80  ? 491  ILE A CB  1 
ATOM   3303 C  CG1 . ILE A 1 512  ? 105.921 106.971 113.407 1.00 74.80  ? 491  ILE A CG1 1 
ATOM   3304 C  CG2 . ILE A 1 512  ? 105.310 108.695 111.759 1.00 74.80  ? 491  ILE A CG2 1 
ATOM   3305 C  CD1 . ILE A 1 512  ? 105.622 107.804 114.629 1.00 74.80  ? 491  ILE A CD1 1 
ATOM   3306 N  N   . GLY A 1 513  ? 107.447 107.018 108.761 1.00 82.26  ? 492  GLY A N   1 
ATOM   3307 C  CA  . GLY A 1 513  ? 107.606 107.738 107.514 1.00 82.26  ? 492  GLY A CA  1 
ATOM   3308 C  C   . GLY A 1 513  ? 108.984 108.246 107.138 1.00 82.26  ? 492  GLY A C   1 
ATOM   3309 O  O   . GLY A 1 513  ? 109.609 107.715 106.217 1.00 82.26  ? 492  GLY A O   1 
ATOM   3310 N  N   . ILE A 1 514  ? 109.464 109.264 107.856 1.00 82.28  ? 493  ILE A N   1 
ATOM   3311 C  CA  . ILE A 1 514  ? 110.520 110.133 107.341 1.00 82.28  ? 493  ILE A CA  1 
ATOM   3312 C  C   . ILE A 1 514  ? 111.864 109.415 107.353 1.00 82.28  ? 493  ILE A C   1 
ATOM   3313 O  O   . ILE A 1 514  ? 112.240 108.759 108.330 1.00 82.28  ? 493  ILE A O   1 
ATOM   3314 C  CB  . ILE A 1 514  ? 110.554 111.461 108.123 1.00 82.28  ? 493  ILE A CB  1 
ATOM   3315 C  CG1 . ILE A 1 514  ? 111.623 112.401 107.562 1.00 82.28  ? 493  ILE A CG1 1 
ATOM   3316 C  CG2 . ILE A 1 514  ? 110.683 111.260 109.639 1.00 82.28  ? 493  ILE A CG2 1 
ATOM   3317 C  CD1 . ILE A 1 514  ? 111.373 112.831 106.132 1.00 82.28  ? 493  ILE A CD1 1 
ATOM   3318 N  N   . SER A 1 515  ? 112.585 109.510 106.242 1.00 81.16  ? 494  SER A N   1 
ATOM   3319 C  CA  . SER A 1 515  ? 113.858 108.821 106.109 1.00 81.16  ? 494  SER A CA  1 
ATOM   3320 C  C   . SER A 1 515  ? 114.954 109.681 106.726 1.00 81.16  ? 494  SER A C   1 
ATOM   3321 O  O   . SER A 1 515  ? 114.692 110.654 107.436 1.00 81.16  ? 494  SER A O   1 
ATOM   3322 C  CB  . SER A 1 515  ? 114.130 108.493 104.646 1.00 81.16  ? 494  SER A CB  1 
ATOM   3323 O  OG  . SER A 1 515  ? 115.335 107.762 104.511 1.00 81.16  ? 494  SER A OG  1 
ATOM   3324 N  N   . PHE A 1 516  ? 116.203 109.324 106.473 1.00 69.73  ? 495  PHE A N   1 
ATOM   3325 C  CA  . PHE A 1 516  ? 117.325 110.048 107.044 1.00 69.73  ? 495  PHE A CA  1 
ATOM   3326 C  C   . PHE A 1 516  ? 117.870 111.045 106.037 1.00 69.73  ? 495  PHE A C   1 
ATOM   3327 O  O   . PHE A 1 516  ? 117.434 111.120 104.889 1.00 69.73  ? 495  PHE A O   1 
ATOM   3328 C  CB  . PHE A 1 516  ? 118.427 109.086 107.495 1.00 69.73  ? 495  PHE A CB  1 
ATOM   3329 C  CG  . PHE A 1 516  ? 118.061 108.255 108.697 1.00 69.73  ? 495  PHE A CG  1 
ATOM   3330 C  CD1 . PHE A 1 516  ? 116.970 108.585 109.485 1.00 69.73  ? 495  PHE A CD1 1 
ATOM   3331 C  CD2 . PHE A 1 516  ? 118.812 107.144 109.038 1.00 69.73  ? 495  PHE A CD2 1 
ATOM   3332 C  CE1 . PHE A 1 516  ? 116.633 107.826 110.572 1.00 69.73  ? 495  PHE A CE1 1 
ATOM   3333 C  CE2 . PHE A 1 516  ? 118.479 106.383 110.134 1.00 69.73  ? 495  PHE A CE2 1 
ATOM   3334 C  CZ  . PHE A 1 516  ? 117.389 106.726 110.900 1.00 69.73  ? 495  PHE A CZ  1 
ATOM   3335 N  N   . ASN A 1 517  ? 118.835 111.831 106.493 1.00 56.69  ? 496  ASN A N   1 
ATOM   3336 C  CA  . ASN A 1 517  ? 119.418 112.856 105.647 1.00 56.69  ? 496  ASN A CA  1 
ATOM   3337 C  C   . ASN A 1 517  ? 120.926 112.802 105.734 1.00 56.69  ? 496  ASN A C   1 
ATOM   3338 O  O   . ASN A 1 517  ? 121.498 111.862 106.291 1.00 56.69  ? 496  ASN A O   1 
ATOM   3339 C  CB  . ASN A 1 517  ? 118.952 114.250 106.048 1.00 56.69  ? 496  ASN A CB  1 
ATOM   3340 C  CG  . ASN A 1 517  ? 117.462 114.392 106.015 1.00 56.69  ? 496  ASN A CG  1 
ATOM   3341 O  OD1 . ASN A 1 517  ? 116.836 114.618 107.043 1.00 56.69  ? 496  ASN A OD1 1 
ATOM   3342 N  ND2 . ASN A 1 517  ? 116.878 114.251 104.837 1.00 56.69  ? 496  ASN A ND2 1 
ATOM   3343 N  N   . ALA A 1 518  ? 121.572 113.818 105.184 1.00 62.01  ? 497  ALA A N   1 
ATOM   3344 C  CA  . ALA A 1 518  ? 123.016 113.893 105.267 1.00 62.01  ? 497  ALA A CA  1 
ATOM   3345 C  C   . ALA A 1 518  ? 123.458 114.424 106.619 1.00 62.01  ? 497  ALA A C   1 
ATOM   3346 O  O   . ALA A 1 518  ? 124.254 113.786 107.311 1.00 62.01  ? 497  ALA A O   1 
ATOM   3347 C  CB  . ALA A 1 518  ? 123.548 114.771 104.142 1.00 62.01  ? 497  ALA A CB  1 
ATOM   3348 N  N   . ALA A 1 519  ? 122.922 115.575 107.026 1.00 56.82  ? 498  ALA A N   1 
ATOM   3349 C  CA  . ALA A 1 519  ? 123.413 116.267 108.210 1.00 56.82  ? 498  ALA A CA  1 
ATOM   3350 C  C   . ALA A 1 519  ? 123.005 115.590 109.509 1.00 56.82  ? 498  ALA A C   1 
ATOM   3351 O  O   . ALA A 1 519  ? 123.606 115.874 110.550 1.00 56.82  ? 498  ALA A O   1 
ATOM   3352 C  CB  . ALA A 1 519  ? 122.918 117.709 108.209 1.00 56.82  ? 498  ALA A CB  1 
ATOM   3353 N  N   . THR A 1 520  ? 122.003 114.711 109.472 1.00 56.25  ? 499  THR A N   1 
ATOM   3354 C  CA  . THR A 1 520  ? 121.640 113.957 110.665 1.00 56.25  ? 499  THR A CA  1 
ATOM   3355 C  C   . THR A 1 520  ? 122.732 112.967 111.034 1.00 56.25  ? 499  THR A C   1 
ATOM   3356 O  O   . THR A 1 520  ? 123.131 112.876 112.197 1.00 56.25  ? 499  THR A O   1 
ATOM   3357 C  CB  . THR A 1 520  ? 120.332 113.215 110.441 1.00 56.25  ? 499  THR A CB  1 
ATOM   3358 O  OG1 . THR A 1 520  ? 120.555 112.134 109.535 1.00 56.25  ? 499  THR A OG1 1 
ATOM   3359 C  CG2 . THR A 1 520  ? 119.340 114.144 109.824 1.00 56.25  ? 499  THR A CG2 1 
ATOM   3360 N  N   . THR A 1 521  ? 123.255 112.251 110.051 1.00 61.54  ? 500  THR A N   1 
ATOM   3361 C  CA  . THR A 1 521  ? 124.210 111.184 110.290 1.00 61.54  ? 500  THR A CA  1 
ATOM   3362 C  C   . THR A 1 521  ? 125.632 111.676 110.499 1.00 61.54  ? 500  THR A C   1 
ATOM   3363 O  O   . THR A 1 521  ? 126.548 110.851 110.522 1.00 61.54  ? 500  THR A O   1 
ATOM   3364 C  CB  . THR A 1 521  ? 124.179 110.188 109.136 1.00 61.54  ? 500  THR A CB  1 
ATOM   3365 O  OG1 . THR A 1 521  ? 124.562 110.851 107.926 1.00 61.54  ? 500  THR A OG1 1 
ATOM   3366 C  CG2 . THR A 1 521  ? 122.789 109.604 108.984 1.00 61.54  ? 500  THR A CG2 1 
ATOM   3367 N  N   . GLN A 1 522  ? 125.853 112.967 110.625 1.00 68.10  ? 501  GLN A N   1 
ATOM   3368 C  CA  . GLN A 1 522  ? 127.093 113.411 111.251 1.00 68.10  ? 501  GLN A CA  1 
ATOM   3369 C  C   . GLN A 1 522  ? 126.851 114.348 112.420 1.00 68.10  ? 501  GLN A C   1 
ATOM   3370 O  O   . GLN A 1 522  ? 127.575 114.273 113.409 1.00 68.10  ? 501  GLN A O   1 
ATOM   3371 C  CB  . GLN A 1 522  ? 128.043 114.098 110.260 1.00 68.10  ? 501  GLN A CB  1 
ATOM   3372 C  CG  . GLN A 1 522  ? 128.707 113.163 109.272 1.00 68.10  ? 501  GLN A CG  1 
ATOM   3373 C  CD  . GLN A 1 522  ? 127.902 112.988 108.014 1.00 68.10  ? 501  GLN A CD  1 
ATOM   3374 O  OE1 . GLN A 1 522  ? 127.033 113.797 107.714 1.00 68.10  ? 501  GLN A OE1 1 
ATOM   3375 N  NE2 . GLN A 1 522  ? 128.197 111.940 107.258 1.00 68.10  ? 501  GLN A NE2 1 
ATOM   3376 N  N   . VAL A 1 523  ? 125.841 115.209 112.343 1.00 58.21  ? 502  VAL A N   1 
ATOM   3377 C  CA  . VAL A 1 523  ? 125.626 116.182 113.405 1.00 58.21  ? 502  VAL A CA  1 
ATOM   3378 C  C   . VAL A 1 523  ? 124.846 115.568 114.555 1.00 58.21  ? 502  VAL A C   1 
ATOM   3379 O  O   . VAL A 1 523  ? 125.231 115.699 115.722 1.00 58.21  ? 502  VAL A O   1 
ATOM   3380 C  CB  . VAL A 1 523  ? 124.904 117.415 112.846 1.00 58.21  ? 502  VAL A CB  1 
ATOM   3381 C  CG1 . VAL A 1 523  ? 124.546 118.371 113.962 1.00 58.21  ? 502  VAL A CG1 1 
ATOM   3382 C  CG2 . VAL A 1 523  ? 125.774 118.088 111.820 1.00 58.21  ? 502  VAL A CG2 1 
ATOM   3383 N  N   . LEU A 1 524  ? 123.766 114.867 114.225 1.00 41.24  ? 503  LEU A N   1 
ATOM   3384 C  CA  . LEU A 1 524  ? 122.732 114.528 115.201 1.00 41.24  ? 503  LEU A CA  1 
ATOM   3385 C  C   . LEU A 1 524  ? 123.159 113.621 116.357 1.00 41.24  ? 503  LEU A C   1 
ATOM   3386 O  O   . LEU A 1 524  ? 122.626 113.822 117.461 1.00 41.24  ? 503  LEU A O   1 
ATOM   3387 C  CB  . LEU A 1 524  ? 121.539 113.936 114.441 1.00 41.24  ? 503  LEU A CB  1 
ATOM   3388 C  CG  . LEU A 1 524  ? 120.142 113.798 115.040 1.00 41.24  ? 503  LEU A CG  1 
ATOM   3389 C  CD1 . LEU A 1 524  ? 119.942 112.542 115.859 1.00 41.24  ? 503  LEU A CD1 1 
ATOM   3390 C  CD2 . LEU A 1 524  ? 119.851 115.024 115.863 1.00 41.24  ? 503  LEU A CD2 1 
ATOM   3391 N  N   . PRO A 1 525  ? 124.054 112.603 116.206 1.00 51.16  ? 504  PRO A N   1 
ATOM   3392 C  CA  . PRO A 1 525  ? 124.498 111.890 117.410 1.00 51.16  ? 504  PRO A CA  1 
ATOM   3393 C  C   . PRO A 1 525  ? 125.335 112.749 118.337 1.00 51.16  ? 504  PRO A C   1 
ATOM   3394 O  O   . PRO A 1 525  ? 125.117 112.758 119.552 1.00 51.16  ? 504  PRO A O   1 
ATOM   3395 C  CB  . PRO A 1 525  ? 125.319 110.728 116.849 1.00 51.16  ? 504  PRO A CB  1 
ATOM   3396 C  CG  . PRO A 1 525  ? 124.797 110.516 115.531 1.00 51.16  ? 504  PRO A CG  1 
ATOM   3397 C  CD  . PRO A 1 525  ? 124.482 111.858 115.008 1.00 51.16  ? 504  PRO A CD  1 
ATOM   3398 N  N   . PHE A 1 526  ? 126.287 113.485 117.770 1.00 59.03  ? 505  PHE A N   1 
ATOM   3399 C  CA  . PHE A 1 526  ? 127.158 114.306 118.596 1.00 59.03  ? 505  PHE A CA  1 
ATOM   3400 C  C   . PHE A 1 526  ? 126.416 115.493 119.192 1.00 59.03  ? 505  PHE A C   1 
ATOM   3401 O  O   . PHE A 1 526  ? 126.760 115.952 120.284 1.00 59.03  ? 505  PHE A O   1 
ATOM   3402 C  CB  . PHE A 1 526  ? 128.349 114.777 117.771 1.00 59.03  ? 505  PHE A CB  1 
ATOM   3403 C  CG  . PHE A 1 526  ? 129.234 113.662 117.302 1.00 59.03  ? 505  PHE A CG  1 
ATOM   3404 C  CD1 . PHE A 1 526  ? 130.130 113.063 118.169 1.00 59.03  ? 505  PHE A CD1 1 
ATOM   3405 C  CD2 . PHE A 1 526  ? 129.180 113.221 115.992 1.00 59.03  ? 505  PHE A CD2 1 
ATOM   3406 C  CE1 . PHE A 1 526  ? 130.952 112.038 117.742 1.00 59.03  ? 505  PHE A CE1 1 
ATOM   3407 C  CE2 . PHE A 1 526  ? 129.999 112.201 115.557 1.00 59.03  ? 505  PHE A CE2 1 
ATOM   3408 C  CZ  . PHE A 1 526  ? 130.885 111.608 116.435 1.00 59.03  ? 505  PHE A CZ  1 
ATOM   3409 N  N   . LEU A 1 527  ? 125.396 115.997 118.500 1.00 50.64  ? 506  LEU A N   1 
ATOM   3410 C  CA  . LEU A 1 527  ? 124.543 117.031 119.072 1.00 50.64  ? 506  LEU A CA  1 
ATOM   3411 C  C   . LEU A 1 527  ? 123.688 116.456 120.192 1.00 50.64  ? 506  LEU A C   1 
ATOM   3412 O  O   . LEU A 1 527  ? 123.788 116.883 121.350 1.00 50.64  ? 506  LEU A O   1 
ATOM   3413 C  CB  . LEU A 1 527  ? 123.670 117.640 117.972 1.00 50.64  ? 506  LEU A CB  1 
ATOM   3414 C  CG  . LEU A 1 527  ? 122.798 118.891 118.140 1.00 50.64  ? 506  LEU A CG  1 
ATOM   3415 C  CD1 . LEU A 1 527  ? 121.434 118.635 118.781 1.00 50.64  ? 506  LEU A CD1 1 
ATOM   3416 C  CD2 . LEU A 1 527  ? 123.558 119.946 118.913 1.00 50.64  ? 506  LEU A CD2 1 
ATOM   3417 N  N   . ALA A 1 528  ? 122.853 115.464 119.864 1.00 39.38  ? 507  ALA A N   1 
ATOM   3418 C  CA  . ALA A 1 528  ? 121.839 114.964 120.784 1.00 39.38  ? 507  ALA A CA  1 
ATOM   3419 C  C   . ALA A 1 528  ? 122.429 114.259 121.994 1.00 39.38  ? 507  ALA A C   1 
ATOM   3420 O  O   . ALA A 1 528  ? 121.764 114.182 123.032 1.00 39.38  ? 507  ALA A O   1 
ATOM   3421 C  CB  . ALA A 1 528  ? 120.897 114.015 120.050 1.00 39.38  ? 507  ALA A CB  1 
ATOM   3422 N  N   . LEU A 1 529  ? 123.659 113.765 121.897 1.00 51.17  ? 508  LEU A N   1 
ATOM   3423 C  CA  . LEU A 1 529  ? 124.291 113.175 123.067 1.00 51.17  ? 508  LEU A CA  1 
ATOM   3424 C  C   . LEU A 1 529  ? 124.688 114.259 124.060 1.00 51.17  ? 508  LEU A C   1 
ATOM   3425 O  O   . LEU A 1 529  ? 124.216 114.270 125.204 1.00 51.17  ? 508  LEU A O   1 
ATOM   3426 C  CB  . LEU A 1 529  ? 125.489 112.332 122.633 1.00 51.17  ? 508  LEU A CB  1 
ATOM   3427 C  CG  . LEU A 1 529  ? 126.134 111.339 123.601 1.00 51.17  ? 508  LEU A CG  1 
ATOM   3428 C  CD1 . LEU A 1 529  ? 127.190 111.955 124.500 1.00 51.17  ? 508  LEU A CD1 1 
ATOM   3429 C  CD2 . LEU A 1 529  ? 125.047 110.698 124.435 1.00 51.17  ? 508  LEU A CD2 1 
ATOM   3430 N  N   . GLY A 1 530  ? 125.534 115.198 123.623 1.00 55.35  ? 509  GLY A N   1 
ATOM   3431 C  CA  . GLY A 1 530  ? 125.996 116.286 124.470 1.00 55.35  ? 509  GLY A CA  1 
ATOM   3432 C  C   . GLY A 1 530  ? 124.891 117.178 124.996 1.00 55.35  ? 509  GLY A C   1 
ATOM   3433 O  O   . GLY A 1 530  ? 125.059 117.804 126.044 1.00 55.35  ? 509  GLY A O   1 
ATOM   3434 N  N   . VAL A 1 531  ? 123.763 117.245 124.293 1.00 55.66  ? 510  VAL A N   1 
ATOM   3435 C  CA  . VAL A 1 531  ? 122.572 117.845 124.876 1.00 55.66  ? 510  VAL A CA  1 
ATOM   3436 C  C   . VAL A 1 531  ? 121.936 116.893 125.882 1.00 55.66  ? 510  VAL A C   1 
ATOM   3437 O  O   . VAL A 1 531  ? 121.448 117.317 126.937 1.00 55.66  ? 510  VAL A O   1 
ATOM   3438 C  CB  . VAL A 1 531  ? 121.603 118.249 123.751 1.00 55.66  ? 510  VAL A CB  1 
ATOM   3439 C  CG1 . VAL A 1 531  ? 120.265 118.699 124.291 1.00 55.66  ? 510  VAL A CG1 1 
ATOM   3440 C  CG2 . VAL A 1 531  ? 122.226 119.354 122.933 1.00 55.66  ? 510  VAL A CG2 1 
ATOM   3441 N  N   . GLY A 1 532  ? 121.990 115.587 125.612 1.00 52.32  ? 511  GLY A N   1 
ATOM   3442 C  CA  . GLY A 1 532  ? 121.240 114.641 126.422 1.00 52.32  ? 511  GLY A CA  1 
ATOM   3443 C  C   . GLY A 1 532  ? 121.818 114.322 127.786 1.00 52.32  ? 511  GLY A C   1 
ATOM   3444 O  O   . GLY A 1 532  ? 121.071 113.967 128.700 1.00 52.32  ? 511  GLY A O   1 
ATOM   3445 N  N   . VAL A 1 533  ? 123.135 114.449 127.956 1.00 66.10  ? 512  VAL A N   1 
ATOM   3446 C  CA  . VAL A 1 533  ? 123.793 113.945 129.165 1.00 66.10  ? 512  VAL A CA  1 
ATOM   3447 C  C   . VAL A 1 533  ? 123.624 114.875 130.374 1.00 66.10  ? 512  VAL A C   1 
ATOM   3448 O  O   . VAL A 1 533  ? 123.715 114.410 131.525 1.00 66.10  ? 512  VAL A O   1 
ATOM   3449 C  CB  . VAL A 1 533  ? 125.256 113.649 128.770 1.00 66.10  ? 512  VAL A CB  1 
ATOM   3450 C  CG1 . VAL A 1 533  ? 126.139 113.223 129.926 1.00 66.10  ? 512  VAL A CG1 1 
ATOM   3451 C  CG2 . VAL A 1 533  ? 125.282 112.539 127.749 1.00 66.10  ? 512  VAL A CG2 1 
ATOM   3452 N  N   . ASP A 1 534  ? 123.282 116.153 130.147 1.00 75.72  ? 513  ASP A N   1 
ATOM   3453 C  CA  . ASP A 1 534  ? 123.251 117.162 131.212 1.00 75.72  ? 513  ASP A CA  1 
ATOM   3454 C  C   . ASP A 1 534  ? 122.224 116.855 132.298 1.00 75.72  ? 513  ASP A C   1 
ATOM   3455 O  O   . ASP A 1 534  ? 122.465 117.137 133.479 1.00 75.72  ? 513  ASP A O   1 
ATOM   3456 C  CB  . ASP A 1 534  ? 122.946 118.533 130.618 1.00 75.72  ? 513  ASP A CB  1 
ATOM   3457 C  CG  . ASP A 1 534  ? 124.031 119.015 129.701 1.00 75.72  ? 513  ASP A CG  1 
ATOM   3458 O  OD1 . ASP A 1 534  ? 125.197 118.642 129.927 1.00 75.72  ? 513  ASP A OD1 1 
ATOM   3459 O  OD2 . ASP A 1 534  ? 123.717 119.757 128.748 1.00 75.72  ? 513  ASP A OD2 1 
ATOM   3460 N  N   . ASP A 1 535  ? 121.088 116.268 131.923 1.00 78.56  ? 514  ASP A N   1 
ATOM   3461 C  CA  . ASP A 1 535  ? 120.074 115.901 132.901 1.00 78.56  ? 514  ASP A CA  1 
ATOM   3462 C  C   . ASP A 1 535  ? 120.529 114.732 133.760 1.00 78.56  ? 514  ASP A C   1 
ATOM   3463 O  O   . ASP A 1 535  ? 120.189 114.661 134.945 1.00 78.56  ? 514  ASP A O   1 
ATOM   3464 C  CB  . ASP A 1 535  ? 118.791 115.552 132.170 1.00 78.56  ? 514  ASP A CB  1 
ATOM   3465 C  CG  . ASP A 1 535  ? 118.320 116.679 131.288 1.00 78.56  ? 514  ASP A CG  1 
ATOM   3466 O  OD1 . ASP A 1 535  ? 118.622 117.845 131.612 1.00 78.56  ? 514  ASP A OD1 1 
ATOM   3467 O  OD2 . ASP A 1 535  ? 117.666 116.406 130.260 1.00 78.56  ? 514  ASP A OD2 1 
ATOM   3468 N  N   . VAL A 1 536  ? 121.298 113.815 133.173 1.00 71.45  ? 515  VAL A N   1 
ATOM   3469 C  CA  . VAL A 1 536  ? 121.863 112.702 133.923 1.00 71.45  ? 515  VAL A CA  1 
ATOM   3470 C  C   . VAL A 1 536  ? 122.884 113.201 134.930 1.00 71.45  ? 515  VAL A C   1 
ATOM   3471 O  O   . VAL A 1 536  ? 122.900 112.757 136.086 1.00 71.45  ? 515  VAL A O   1 
ATOM   3472 C  CB  . VAL A 1 536  ? 122.476 111.686 132.948 1.00 71.45  ? 515  VAL A CB  1 
ATOM   3473 C  CG1 . VAL A 1 536  ? 123.198 110.585 133.689 1.00 71.45  ? 515  VAL A CG1 1 
ATOM   3474 C  CG2 . VAL A 1 536  ? 121.401 111.101 132.076 1.00 71.45  ? 515  VAL A CG2 1 
ATOM   3475 N  N   . PHE A 1 537  ? 123.737 114.146 134.520 1.00 71.48  ? 516  PHE A N   1 
ATOM   3476 C  CA  . PHE A 1 537  ? 124.674 114.739 135.470 1.00 71.48  ? 516  PHE A CA  1 
ATOM   3477 C  C   . PHE A 1 537  ? 123.963 115.535 136.560 1.00 71.48  ? 516  PHE A C   1 
ATOM   3478 O  O   . PHE A 1 537  ? 124.422 115.555 137.713 1.00 71.48  ? 516  PHE A O   1 
ATOM   3479 C  CB  . PHE A 1 537  ? 125.682 115.617 134.736 1.00 71.48  ? 516  PHE A CB  1 
ATOM   3480 C  CG  . PHE A 1 537  ? 126.759 114.841 134.032 1.00 71.48  ? 516  PHE A CG  1 
ATOM   3481 C  CD1 . PHE A 1 537  ? 127.030 113.531 134.382 1.00 71.48  ? 516  PHE A CD1 1 
ATOM   3482 C  CD2 . PHE A 1 537  ? 127.496 115.420 133.014 1.00 71.48  ? 516  PHE A CD2 1 
ATOM   3483 C  CE1 . PHE A 1 537  ? 128.022 112.821 133.738 1.00 71.48  ? 516  PHE A CE1 1 
ATOM   3484 C  CE2 . PHE A 1 537  ? 128.486 114.714 132.366 1.00 71.48  ? 516  PHE A CE2 1 
ATOM   3485 C  CZ  . PHE A 1 537  ? 128.749 113.414 132.729 1.00 71.48  ? 516  PHE A CZ  1 
ATOM   3486 N  N   . LEU A 1 538  ? 122.830 116.152 136.233 1.00 60.89  ? 517  LEU A N   1 
ATOM   3487 C  CA  . LEU A 1 538  ? 122.076 116.897 137.235 1.00 60.89  ? 517  LEU A CA  1 
ATOM   3488 C  C   . LEU A 1 538  ? 121.444 115.967 138.265 1.00 60.89  ? 517  LEU A C   1 
ATOM   3489 O  O   . LEU A 1 538  ? 121.507 116.239 139.469 1.00 60.89  ? 517  LEU A O   1 
ATOM   3490 C  CB  . LEU A 1 538  ? 121.035 117.767 136.530 1.00 60.89  ? 517  LEU A CB  1 
ATOM   3491 C  CG  . LEU A 1 538  ? 120.235 118.869 137.225 1.00 60.89  ? 517  LEU A CG  1 
ATOM   3492 C  CD1 . LEU A 1 538  ? 118.963 118.355 137.842 1.00 60.89  ? 517  LEU A CD1 1 
ATOM   3493 C  CD2 . LEU A 1 538  ? 121.093 119.544 138.274 1.00 60.89  ? 517  LEU A CD2 1 
ATOM   3494 N  N   . LEU A 1 539  ? 120.834 114.864 137.819 1.00 66.10  ? 518  LEU A N   1 
ATOM   3495 C  CA  . LEU A 1 539  ? 120.250 113.930 138.780 1.00 66.10  ? 518  LEU A CA  1 
ATOM   3496 C  C   . LEU A 1 539  ? 121.311 113.200 139.586 1.00 66.10  ? 518  LEU A C   1 
ATOM   3497 O  O   . LEU A 1 539  ? 121.059 112.828 140.736 1.00 66.10  ? 518  LEU A O   1 
ATOM   3498 C  CB  . LEU A 1 539  ? 119.361 112.908 138.087 1.00 66.10  ? 518  LEU A CB  1 
ATOM   3499 C  CG  . LEU A 1 539  ? 118.044 113.395 137.503 1.00 66.10  ? 518  LEU A CG  1 
ATOM   3500 C  CD1 . LEU A 1 539  ? 117.354 112.247 136.810 1.00 66.10  ? 518  LEU A CD1 1 
ATOM   3501 C  CD2 . LEU A 1 539  ? 117.175 113.948 138.595 1.00 66.10  ? 518  LEU A CD2 1 
ATOM   3502 N  N   . ALA A 1 540  ? 122.490 112.972 139.007 1.00 75.38  ? 519  ALA A N   1 
ATOM   3503 C  CA  . ALA A 1 540  ? 123.579 112.417 139.800 1.00 75.38  ? 519  ALA A CA  1 
ATOM   3504 C  C   . ALA A 1 540  ? 124.049 113.407 140.856 1.00 75.38  ? 519  ALA A C   1 
ATOM   3505 O  O   . ALA A 1 540  ? 124.454 112.997 141.952 1.00 75.38  ? 519  ALA A O   1 
ATOM   3506 C  CB  . ALA A 1 540  ? 124.736 112.007 138.898 1.00 75.38  ? 519  ALA A CB  1 
ATOM   3507 N  N   . HIS A 1 541  ? 123.988 114.707 140.552 1.00 85.82  ? 520  HIS A N   1 
ATOM   3508 C  CA  . HIS A 1 541  ? 124.257 115.724 141.566 1.00 85.82  ? 520  HIS A CA  1 
ATOM   3509 C  C   . HIS A 1 541  ? 123.219 115.708 142.679 1.00 85.82  ? 520  HIS A C   1 
ATOM   3510 O  O   . HIS A 1 541  ? 123.571 115.802 143.862 1.00 85.82  ? 520  HIS A O   1 
ATOM   3511 C  CB  . HIS A 1 541  ? 124.312 117.099 140.914 1.00 85.82  ? 520  HIS A CB  1 
ATOM   3512 C  CG  . HIS A 1 541  ? 124.489 118.221 141.882 1.00 85.82  ? 520  HIS A CG  1 
ATOM   3513 N  ND1 . HIS A 1 541  ? 123.423 118.892 142.443 1.00 85.82  ? 520  HIS A ND1 1 
ATOM   3514 C  CD2 . HIS A 1 541  ? 125.604 118.787 142.399 1.00 85.82  ? 520  HIS A CD2 1 
ATOM   3515 C  CE1 . HIS A 1 541  ? 123.875 119.833 143.251 1.00 85.82  ? 520  HIS A CE1 1 
ATOM   3516 N  NE2 . HIS A 1 541  ? 125.195 119.787 143.247 1.00 85.82  ? 520  HIS A NE2 1 
ATOM   3517 N  N   . ALA A 1 542  ? 121.937 115.589 142.322 1.00 74.98  ? 521  ALA A N   1 
ATOM   3518 C  CA  . ALA A 1 542  ? 120.891 115.516 143.336 1.00 74.98  ? 521  ALA A CA  1 
ATOM   3519 C  C   . ALA A 1 542  ? 120.997 114.250 144.163 1.00 74.98  ? 521  ALA A C   1 
ATOM   3520 O  O   . ALA A 1 542  ? 120.591 114.235 145.327 1.00 74.98  ? 521  ALA A O   1 
ATOM   3521 C  CB  . ALA A 1 542  ? 119.512 115.584 142.696 1.00 74.98  ? 521  ALA A CB  1 
ATOM   3522 N  N   . PHE A 1 543  ? 121.547 113.189 143.591 1.00 81.71  ? 522  PHE A N   1 
ATOM   3523 C  CA  . PHE A 1 543  ? 121.753 111.973 144.351 1.00 81.71  ? 522  PHE A CA  1 
ATOM   3524 C  C   . PHE A 1 543  ? 123.019 112.034 145.185 1.00 81.71  ? 522  PHE A C   1 
ATOM   3525 O  O   . PHE A 1 543  ? 123.165 111.259 146.135 1.00 81.71  ? 522  PHE A O   1 
ATOM   3526 C  CB  . PHE A 1 543  ? 121.808 110.789 143.403 1.00 81.71  ? 522  PHE A CB  1 
ATOM   3527 C  CG  . PHE A 1 543  ? 121.670 109.479 144.076 1.00 81.71  ? 522  PHE A CG  1 
ATOM   3528 C  CD1 . PHE A 1 543  ? 120.427 109.043 144.490 1.00 81.71  ? 522  PHE A CD1 1 
ATOM   3529 C  CD2 . PHE A 1 543  ? 122.770 108.676 144.284 1.00 81.71  ? 522  PHE A CD2 1 
ATOM   3530 C  CE1 . PHE A 1 543  ? 120.278 107.826 145.104 1.00 81.71  ? 522  PHE A CE1 1 
ATOM   3531 C  CE2 . PHE A 1 543  ? 122.637 107.458 144.903 1.00 81.71  ? 522  PHE A CE2 1 
ATOM   3532 C  CZ  . PHE A 1 543  ? 121.385 107.031 145.308 1.00 81.71  ? 522  PHE A CZ  1 
ATOM   3533 N  N   . SER A 1 544  ? 123.934 112.941 144.854 1.00 97.16  ? 523  SER A N   1 
ATOM   3534 C  CA  . SER A 1 544  ? 125.173 113.057 145.606 1.00 97.16  ? 523  SER A CA  1 
ATOM   3535 C  C   . SER A 1 544  ? 125.078 114.041 146.757 1.00 97.16  ? 523  SER A C   1 
ATOM   3536 O  O   . SER A 1 544  ? 125.818 113.899 147.735 1.00 97.16  ? 523  SER A O   1 
ATOM   3537 C  CB  . SER A 1 544  ? 126.316 113.471 144.683 1.00 97.16  ? 523  SER A CB  1 
ATOM   3538 O  OG  . SER A 1 544  ? 127.515 113.631 145.416 1.00 97.16  ? 523  SER A OG  1 
ATOM   3539 N  N   . GLU A 1 545  ? 124.195 115.041 146.663 1.00 108.68 ? 524  GLU A N   1 
ATOM   3540 C  CA  . GLU A 1 545  ? 124.085 116.022 147.741 1.00 108.68 ? 524  GLU A CA  1 
ATOM   3541 C  C   . GLU A 1 545  ? 123.454 115.414 148.985 1.00 108.68 ? 524  GLU A C   1 
ATOM   3542 O  O   . GLU A 1 545  ? 123.966 115.579 150.096 1.00 108.68 ? 524  GLU A O   1 
ATOM   3543 C  CB  . GLU A 1 545  ? 123.283 117.240 147.282 1.00 108.68 ? 524  GLU A CB  1 
ATOM   3544 C  CG  . GLU A 1 545  ? 124.025 118.176 146.350 1.00 108.68 ? 524  GLU A CG  1 
ATOM   3545 C  CD  . GLU A 1 545  ? 125.156 118.917 147.039 1.00 108.68 ? 524  GLU A CD  1 
ATOM   3546 O  OE1 . GLU A 1 545  ? 125.044 119.199 148.250 1.00 108.68 ? 524  GLU A OE1 1 
ATOM   3547 O  OE2 . GLU A 1 545  ? 126.158 119.224 146.362 1.00 108.68 ? 524  GLU A OE2 1 
ATOM   3548 N  N   . THR A 1 546  ? 122.353 114.692 148.820 1.00 107.68 ? 525  THR A N   1 
ATOM   3549 C  CA  . THR A 1 546  ? 121.631 114.126 149.945 1.00 107.68 ? 525  THR A CA  1 
ATOM   3550 C  C   . THR A 1 546  ? 122.164 112.728 150.303 1.00 107.68 ? 525  THR A C   1 
ATOM   3551 O  O   . THR A 1 546  ? 121.491 111.974 151.015 1.00 107.68 ? 525  THR A O   1 
ATOM   3552 C  CB  . THR A 1 546  ? 120.136 114.100 149.604 1.00 107.68 ? 525  THR A CB  1 
ATOM   3553 O  OG1 . THR A 1 546  ? 119.829 115.258 148.823 1.00 107.68 ? 525  THR A OG1 1 
ATOM   3554 C  CG2 . THR A 1 546  ? 119.271 114.218 150.865 1.00 107.68 ? 525  THR A CG2 1 
ATOM   3555 N  N   . GLY A 1 547  ? 123.388 112.410 149.857 1.00 110.73 ? 526  GLY A N   1 
ATOM   3556 C  CA  . GLY A 1 547  ? 123.926 111.072 149.642 1.00 110.73 ? 526  GLY A CA  1 
ATOM   3557 C  C   . GLY A 1 547  ? 123.665 109.992 150.670 1.00 110.73 ? 526  GLY A C   1 
ATOM   3558 O  O   . GLY A 1 547  ? 122.943 109.031 150.392 1.00 110.73 ? 526  GLY A O   1 
ATOM   3559 N  N   . GLN A 1 548  ? 124.217 110.148 151.867 1.00 114.86 ? 527  GLN A N   1 
ATOM   3560 C  CA  . GLN A 1 548  ? 123.906 109.265 152.988 1.00 114.86 ? 527  GLN A CA  1 
ATOM   3561 C  C   . GLN A 1 548  ? 123.456 110.176 154.123 1.00 114.86 ? 527  GLN A C   1 
ATOM   3562 O  O   . GLN A 1 548  ? 124.227 110.513 155.022 1.00 114.86 ? 527  GLN A O   1 
ATOM   3563 C  CB  . GLN A 1 548  ? 125.111 108.408 153.355 1.00 114.86 ? 527  GLN A CB  1 
ATOM   3564 C  CG  . GLN A 1 548  ? 125.477 107.408 152.268 1.00 114.86 ? 527  GLN A CG  1 
ATOM   3565 C  CD  . GLN A 1 548  ? 126.756 106.664 152.557 1.00 114.86 ? 527  GLN A CD  1 
ATOM   3566 O  OE1 . GLN A 1 548  ? 127.445 106.948 153.536 1.00 114.86 ? 527  GLN A OE1 1 
ATOM   3567 N  NE2 . GLN A 1 548  ? 127.085 105.703 151.704 1.00 114.86 ? 527  GLN A NE2 1 
ATOM   3568 N  N   . ASN A 1 549  ? 122.182 110.553 154.080 1.00 125.75 ? 528  ASN A N   1 
ATOM   3569 C  CA  . ASN A 1 549  ? 121.599 111.469 155.043 1.00 125.75 ? 528  ASN A CA  1 
ATOM   3570 C  C   . ASN A 1 549  ? 121.210 110.700 156.308 1.00 125.75 ? 528  ASN A C   1 
ATOM   3571 O  O   . ASN A 1 549  ? 121.227 109.465 156.347 1.00 125.75 ? 528  ASN A O   1 
ATOM   3572 C  CB  . ASN A 1 549  ? 120.395 112.179 154.407 1.00 125.75 ? 528  ASN A CB  1 
ATOM   3573 C  CG  . ASN A 1 549  ? 119.962 113.418 155.167 1.00 125.75 ? 528  ASN A CG  1 
ATOM   3574 O  OD1 . ASN A 1 549  ? 120.508 113.735 156.220 1.00 125.75 ? 528  ASN A OD1 1 
ATOM   3575 N  ND2 . ASN A 1 549  ? 118.981 114.126 154.631 1.00 125.75 ? 528  ASN A ND2 1 
ATOM   3576 N  N   . LYS A 1 550  ? 120.900 111.447 157.371 1.00 129.12 ? 529  LYS A N   1 
ATOM   3577 C  CA  . LYS A 1 550  ? 120.361 110.831 158.576 1.00 129.12 ? 529  LYS A CA  1 
ATOM   3578 C  C   . LYS A 1 550  ? 119.005 110.196 158.310 1.00 129.12 ? 529  LYS A C   1 
ATOM   3579 O  O   . LYS A 1 550  ? 118.838 108.979 158.443 1.00 129.12 ? 529  LYS A O   1 
ATOM   3580 C  CB  . LYS A 1 550  ? 120.256 111.867 159.696 1.00 129.12 ? 529  LYS A CB  1 
ATOM   3581 C  CG  . LYS A 1 550  ? 121.582 112.271 160.303 1.00 129.12 ? 529  LYS A CG  1 
ATOM   3582 C  CD  . LYS A 1 550  ? 122.150 111.119 161.119 1.00 129.12 ? 529  LYS A CD  1 
ATOM   3583 C  CE  . LYS A 1 550  ? 123.469 111.470 161.788 1.00 129.12 ? 529  LYS A CE  1 
ATOM   3584 N  NZ  . LYS A 1 550  ? 123.301 112.449 162.891 1.00 129.12 ? 529  LYS A NZ  1 
ATOM   3585 N  N   . ARG A 1 551  ? 118.032 111.001 157.905 1.00 125.64 ? 530  ARG A N   1 
ATOM   3586 C  CA  . ARG A 1 551  ? 116.652 110.552 157.931 1.00 125.64 ? 530  ARG A CA  1 
ATOM   3587 C  C   . ARG A 1 551  ? 116.296 109.703 156.717 1.00 125.64 ? 530  ARG A C   1 
ATOM   3588 O  O   . ARG A 1 551  ? 116.712 109.984 155.587 1.00 125.64 ? 530  ARG A O   1 
ATOM   3589 C  CB  . ARG A 1 551  ? 115.706 111.748 158.058 1.00 125.64 ? 530  ARG A CB  1 
ATOM   3590 C  CG  . ARG A 1 551  ? 115.710 112.735 156.910 1.00 125.64 ? 530  ARG A CG  1 
ATOM   3591 C  CD  . ARG A 1 551  ? 114.812 113.912 157.214 1.00 125.64 ? 530  ARG A CD  1 
ATOM   3592 N  NE  . ARG A 1 551  ? 115.325 114.692 158.336 1.00 125.64 ? 530  ARG A NE  1 
ATOM   3593 C  CZ  . ARG A 1 551  ? 114.762 114.726 159.538 1.00 125.64 ? 530  ARG A CZ  1 
ATOM   3594 N  NH1 . ARG A 1 551  ? 113.665 114.019 159.771 1.00 125.64 ? 530  ARG A NH1 1 
ATOM   3595 N  NH2 . ARG A 1 551  ? 115.298 115.457 160.506 1.00 125.64 ? 530  ARG A NH2 1 
ATOM   3596 N  N   . ILE A 1 552  ? 115.557 108.630 157.002 1.00 128.65 ? 531  ILE A N   1 
ATOM   3597 C  CA  . ILE A 1 552  ? 114.844 107.679 156.136 1.00 128.65 ? 531  ILE A CA  1 
ATOM   3598 C  C   . ILE A 1 552  ? 115.548 107.343 154.815 1.00 128.65 ? 531  ILE A C   1 
ATOM   3599 O  O   . ILE A 1 552  ? 115.174 107.843 153.744 1.00 128.65 ? 531  ILE A O   1 
ATOM   3600 C  CB  . ILE A 1 552  ? 113.363 108.115 155.981 1.00 128.65 ? 531  ILE A CB  1 
ATOM   3601 C  CG1 . ILE A 1 552  ? 112.520 107.015 155.323 1.00 128.65 ? 531  ILE A CG1 1 
ATOM   3602 C  CG2 . ILE A 1 552  ? 113.131 109.558 155.423 1.00 128.65 ? 531  ILE A CG2 1 
ATOM   3603 C  CD1 . ILE A 1 552  ? 111.039 107.259 155.412 1.00 128.65 ? 531  ILE A CD1 1 
ATOM   3604 N  N   . PRO A 1 553  ? 116.612 106.543 154.835 1.00 118.70 ? 532  PRO A N   1 
ATOM   3605 C  CA  . PRO A 1 553  ? 117.089 105.924 153.598 1.00 118.70 ? 532  PRO A CA  1 
ATOM   3606 C  C   . PRO A 1 553  ? 116.320 104.637 153.322 1.00 118.70 ? 532  PRO A C   1 
ATOM   3607 O  O   . PRO A 1 553  ? 115.517 104.180 154.138 1.00 118.70 ? 532  PRO A O   1 
ATOM   3608 C  CB  . PRO A 1 553  ? 118.560 105.634 153.902 1.00 118.70 ? 532  PRO A CB  1 
ATOM   3609 C  CG  . PRO A 1 553  ? 118.566 105.370 155.349 1.00 118.70 ? 532  PRO A CG  1 
ATOM   3610 C  CD  . PRO A 1 553  ? 117.532 106.268 155.954 1.00 118.70 ? 532  PRO A CD  1 
ATOM   3611 N  N   . PHE A 1 554  ? 116.546 104.093 152.118 1.00 99.93  ? 533  PHE A N   1 
ATOM   3612 C  CA  . PHE A 1 554  ? 115.963 102.848 151.603 1.00 99.93  ? 533  PHE A CA  1 
ATOM   3613 C  C   . PHE A 1 554  ? 114.445 102.830 151.465 1.00 99.93  ? 533  PHE A C   1 
ATOM   3614 O  O   . PHE A 1 554  ? 113.881 101.802 151.080 1.00 99.93  ? 533  PHE A O   1 
ATOM   3615 C  CB  . PHE A 1 554  ? 116.367 101.632 152.448 1.00 99.93  ? 533  PHE A CB  1 
ATOM   3616 C  CG  . PHE A 1 554  ? 117.691 101.035 152.077 1.00 99.93  ? 533  PHE A CG  1 
ATOM   3617 C  CD1 . PHE A 1 554  ? 118.303 101.340 150.880 1.00 99.93  ? 533  PHE A CD1 1 
ATOM   3618 C  CD2 . PHE A 1 554  ? 118.306 100.136 152.923 1.00 99.93  ? 533  PHE A CD2 1 
ATOM   3619 C  CE1 . PHE A 1 554  ? 119.515 100.775 150.548 1.00 99.93  ? 533  PHE A CE1 1 
ATOM   3620 C  CE2 . PHE A 1 554  ? 119.520 99.567  152.587 1.00 99.93  ? 533  PHE A CE2 1 
ATOM   3621 C  CZ  . PHE A 1 554  ? 120.121 99.889  151.398 1.00 99.93  ? 533  PHE A CZ  1 
ATOM   3622 N  N   . GLU A 1 555  ? 113.765 103.926 151.770 1.00 119.99 ? 534  GLU A N   1 
ATOM   3623 C  CA  . GLU A 1 555  ? 112.324 103.960 151.582 1.00 119.99 ? 534  GLU A CA  1 
ATOM   3624 C  C   . GLU A 1 555  ? 111.936 105.221 150.832 1.00 119.99 ? 534  GLU A C   1 
ATOM   3625 O  O   . GLU A 1 555  ? 111.024 105.215 150.000 1.00 119.99 ? 534  GLU A O   1 
ATOM   3626 C  CB  . GLU A 1 555  ? 111.606 103.877 152.929 1.00 119.99 ? 534  GLU A CB  1 
ATOM   3627 C  CG  . GLU A 1 555  ? 110.093 103.877 152.829 1.00 119.99 ? 534  GLU A CG  1 
ATOM   3628 C  CD  . GLU A 1 555  ? 109.415 103.594 154.149 1.00 119.99 ? 534  GLU A CD  1 
ATOM   3629 O  OE1 . GLU A 1 555  ? 110.124 103.337 155.141 1.00 119.99 ? 534  GLU A OE1 1 
ATOM   3630 O  OE2 . GLU A 1 555  ? 108.170 103.637 154.197 1.00 119.99 ? 534  GLU A OE2 1 
ATOM   3631 N  N   . ASP A 1 556  ? 112.658 106.300 151.101 1.00 116.57 ? 535  ASP A N   1 
ATOM   3632 C  CA  . ASP A 1 556  ? 112.214 107.634 150.752 1.00 116.57 ? 535  ASP A CA  1 
ATOM   3633 C  C   . ASP A 1 556  ? 113.159 108.329 149.790 1.00 116.57 ? 535  ASP A C   1 
ATOM   3634 O  O   . ASP A 1 556  ? 112.826 109.406 149.285 1.00 116.57 ? 535  ASP A O   1 
ATOM   3635 C  CB  . ASP A 1 556  ? 112.096 108.474 152.026 1.00 116.57 ? 535  ASP A CB  1 
ATOM   3636 C  CG  . ASP A 1 556  ? 111.143 109.623 151.888 1.00 116.57 ? 535  ASP A CG  1 
ATOM   3637 O  OD1 . ASP A 1 556  ? 109.936 109.387 152.081 1.00 116.57 ? 535  ASP A OD1 1 
ATOM   3638 O  OD2 . ASP A 1 556  ? 111.591 110.744 151.586 1.00 116.57 ? 535  ASP A OD2 1 
ATOM   3639 N  N   . ARG A 1 557  ? 114.319 107.738 149.513 1.00 90.04  ? 536  ARG A N   1 
ATOM   3640 C  CA  . ARG A 1 557  ? 115.416 108.511 148.954 1.00 90.04  ? 536  ARG A CA  1 
ATOM   3641 C  C   . ARG A 1 557  ? 115.238 108.798 147.466 1.00 90.04  ? 536  ARG A C   1 
ATOM   3642 O  O   . ARG A 1 557  ? 115.472 109.931 147.028 1.00 90.04  ? 536  ARG A O   1 
ATOM   3643 C  CB  . ARG A 1 557  ? 116.734 107.795 149.222 1.00 90.04  ? 536  ARG A CB  1 
ATOM   3644 C  CG  . ARG A 1 557  ? 117.881 108.525 148.615 1.00 90.04  ? 536  ARG A CG  1 
ATOM   3645 C  CD  . ARG A 1 557  ? 118.038 109.912 149.226 1.00 90.04  ? 536  ARG A CD  1 
ATOM   3646 N  NE  . ARG A 1 557  ? 118.915 110.718 148.395 1.00 90.04  ? 536  ARG A NE  1 
ATOM   3647 C  CZ  . ARG A 1 557  ? 120.234 110.695 148.480 1.00 90.04  ? 536  ARG A CZ  1 
ATOM   3648 N  NH1 . ARG A 1 557  ? 120.967 111.448 147.677 1.00 90.04  ? 536  ARG A NH1 1 
ATOM   3649 N  NH2 . ARG A 1 557  ? 120.818 109.908 149.369 1.00 90.04  ? 536  ARG A NH2 1 
ATOM   3650 N  N   . THR A 1 558  ? 114.820 107.799 146.684 1.00 87.38  ? 537  THR A N   1 
ATOM   3651 C  CA  . THR A 1 558  ? 114.605 108.004 145.254 1.00 87.38  ? 537  THR A CA  1 
ATOM   3652 C  C   . THR A 1 558  ? 113.469 108.991 144.998 1.00 87.38  ? 537  THR A C   1 
ATOM   3653 O  O   . THR A 1 558  ? 113.554 109.821 144.081 1.00 87.38  ? 537  THR A O   1 
ATOM   3654 C  CB  . THR A 1 558  ? 114.346 106.652 144.583 1.00 87.38  ? 537  THR A CB  1 
ATOM   3655 O  OG1 . THR A 1 558  ? 115.525 105.845 144.691 1.00 87.38  ? 537  THR A OG1 1 
ATOM   3656 C  CG2 . THR A 1 558  ? 113.974 106.786 143.119 1.00 87.38  ? 537  THR A CG2 1 
ATOM   3657 N  N   . GLY A 1 559  ? 112.434 108.965 145.841 1.00 86.68  ? 538  GLY A N   1 
ATOM   3658 C  CA  . GLY A 1 559  ? 111.378 109.957 145.738 1.00 86.68  ? 538  GLY A CA  1 
ATOM   3659 C  C   . GLY A 1 559  ? 111.837 111.359 146.075 1.00 86.68  ? 538  GLY A C   1 
ATOM   3660 O  O   . GLY A 1 559  ? 111.376 112.329 145.467 1.00 86.68  ? 538  GLY A O   1 
ATOM   3661 N  N   . GLU A 1 560  ? 112.764 111.489 147.019 1.00 88.91  ? 539  GLU A N   1 
ATOM   3662 C  CA  . GLU A 1 560  ? 113.294 112.804 147.351 1.00 88.91  ? 539  GLU A CA  1 
ATOM   3663 C  C   . GLU A 1 560  ? 114.293 113.274 146.302 1.00 88.91  ? 539  GLU A C   1 
ATOM   3664 O  O   . GLU A 1 560  ? 114.277 114.451 145.916 1.00 88.91  ? 539  GLU A O   1 
ATOM   3665 C  CB  . GLU A 1 560  ? 113.929 112.761 148.739 1.00 88.91  ? 539  GLU A CB  1 
ATOM   3666 C  CG  . GLU A 1 560  ? 114.269 114.102 149.344 1.00 88.91  ? 539  GLU A CG  1 
ATOM   3667 C  CD  . GLU A 1 560  ? 115.659 114.569 148.985 1.00 88.91  ? 539  GLU A CD  1 
ATOM   3668 O  OE1 . GLU A 1 560  ? 116.513 113.702 148.705 1.00 88.91  ? 539  GLU A OE1 1 
ATOM   3669 O  OE2 . GLU A 1 560  ? 115.903 115.794 148.985 1.00 88.91  ? 539  GLU A OE2 1 
ATOM   3670 N  N   . CYS A 1 561  ? 115.169 112.365 145.851 1.00 80.40  ? 540  CYS A N   1 
ATOM   3671 C  CA  . CYS A 1 561  ? 116.161 112.687 144.826 1.00 80.40  ? 540  CYS A CA  1 
ATOM   3672 C  C   . CYS A 1 561  ? 115.505 113.117 143.526 1.00 80.40  ? 540  CYS A C   1 
ATOM   3673 O  O   . CYS A 1 561  ? 115.966 114.059 142.873 1.00 80.40  ? 540  CYS A O   1 
ATOM   3674 C  CB  . CYS A 1 561  ? 117.064 111.486 144.573 1.00 80.40  ? 540  CYS A CB  1 
ATOM   3675 S  SG  . CYS A 1 561  ? 118.237 111.733 143.239 1.00 80.40  ? 540  CYS A SG  1 
ATOM   3676 N  N   . LEU A 1 562  ? 114.428 112.450 143.138 1.00 80.66  ? 541  LEU A N   1 
ATOM   3677 C  CA  . LEU A 1 562  ? 113.633 112.965 142.036 1.00 80.66  ? 541  LEU A CA  1 
ATOM   3678 C  C   . LEU A 1 562  ? 112.920 114.253 142.423 1.00 80.66  ? 541  LEU A C   1 
ATOM   3679 O  O   . LEU A 1 562  ? 112.775 115.156 141.589 1.00 80.66  ? 541  LEU A O   1 
ATOM   3680 C  CB  . LEU A 1 562  ? 112.623 111.920 141.581 1.00 80.66  ? 541  LEU A CB  1 
ATOM   3681 C  CG  . LEU A 1 562  ? 113.147 110.760 140.764 1.00 80.66  ? 541  LEU A CG  1 
ATOM   3682 C  CD1 . LEU A 1 562  ? 112.024 109.800 140.501 1.00 80.66  ? 541  LEU A CD1 1 
ATOM   3683 C  CD2 . LEU A 1 562  ? 113.656 111.337 139.481 1.00 80.66  ? 541  LEU A CD2 1 
ATOM   3684 N  N   . LYS A 1 563  ? 112.480 114.356 143.681 1.00 71.80  ? 542  LYS A N   1 
ATOM   3685 C  CA  . LYS A 1 563  ? 111.552 115.412 144.076 1.00 71.80  ? 542  LYS A CA  1 
ATOM   3686 C  C   . LYS A 1 563  ? 112.204 116.783 144.032 1.00 71.80  ? 542  LYS A C   1 
ATOM   3687 O  O   . LYS A 1 563  ? 111.578 117.759 143.610 1.00 71.80  ? 542  LYS A O   1 
ATOM   3688 C  CB  . LYS A 1 563  ? 111.009 115.131 145.475 1.00 71.80  ? 542  LYS A CB  1 
ATOM   3689 C  CG  . LYS A 1 563  ? 110.010 116.160 145.966 1.00 71.80  ? 542  LYS A CG  1 
ATOM   3690 C  CD  . LYS A 1 563  ? 109.430 115.814 147.327 1.00 71.80  ? 542  LYS A CD  1 
ATOM   3691 C  CE  . LYS A 1 563  ? 110.424 116.063 148.441 1.00 71.80  ? 542  LYS A CE  1 
ATOM   3692 N  NZ  . LYS A 1 563  ? 109.817 115.836 149.772 1.00 71.80  ? 542  LYS A NZ  1 
ATOM   3693 N  N   . ARG A 1 564  ? 113.471 116.872 144.415 1.00 84.55  ? 543  ARG A N   1 
ATOM   3694 C  CA  . ARG A 1 564  ? 114.104 118.178 144.495 1.00 84.55  ? 543  ARG A CA  1 
ATOM   3695 C  C   . ARG A 1 564  ? 114.591 118.718 143.152 1.00 84.55  ? 543  ARG A C   1 
ATOM   3696 O  O   . ARG A 1 564  ? 115.053 119.862 143.108 1.00 84.55  ? 543  ARG A O   1 
ATOM   3697 C  CB  . ARG A 1 564  ? 115.259 118.122 145.496 1.00 84.55  ? 543  ARG A CB  1 
ATOM   3698 C  CG  . ARG A 1 564  ? 116.300 117.071 145.182 1.00 84.55  ? 543  ARG A CG  1 
ATOM   3699 C  CD  . ARG A 1 564  ? 117.381 117.017 146.248 1.00 84.55  ? 543  ARG A CD  1 
ATOM   3700 N  NE  . ARG A 1 564  ? 118.238 118.198 146.224 1.00 84.55  ? 543  ARG A NE  1 
ATOM   3701 C  CZ  . ARG A 1 564  ? 119.074 118.535 147.199 1.00 84.55  ? 543  ARG A CZ  1 
ATOM   3702 N  NH1 . ARG A 1 564  ? 119.165 117.784 148.287 1.00 84.55  ? 543  ARG A NH1 1 
ATOM   3703 N  NH2 . ARG A 1 564  ? 119.819 119.626 147.088 1.00 84.55  ? 543  ARG A NH2 1 
ATOM   3704 N  N   . THR A 1 565  ? 114.507 117.941 142.059 1.00 67.42  ? 544  THR A N   1 
ATOM   3705 C  CA  . THR A 1 565  ? 115.038 118.369 140.765 1.00 67.42  ? 544  THR A CA  1 
ATOM   3706 C  C   . THR A 1 565  ? 114.153 118.065 139.561 1.00 67.42  ? 544  THR A C   1 
ATOM   3707 O  O   . THR A 1 565  ? 114.533 118.425 138.435 1.00 67.42  ? 544  THR A O   1 
ATOM   3708 C  CB  . THR A 1 565  ? 116.413 117.734 140.513 1.00 67.42  ? 544  THR A CB  1 
ATOM   3709 O  OG1 . THR A 1 565  ? 116.344 116.329 140.769 1.00 67.42  ? 544  THR A OG1 1 
ATOM   3710 C  CG2 . THR A 1 565  ? 117.510 118.382 141.343 1.00 67.42  ? 544  THR A CG2 1 
ATOM   3711 N  N   . GLY A 1 566  ? 112.995 117.431 139.751 1.00 76.84  ? 545  GLY A N   1 
ATOM   3712 C  CA  . GLY A 1 566  ? 112.248 116.899 138.620 1.00 76.84  ? 545  GLY A CA  1 
ATOM   3713 C  C   . GLY A 1 566  ? 111.648 117.961 137.718 1.00 76.84  ? 545  GLY A C   1 
ATOM   3714 O  O   . GLY A 1 566  ? 111.647 117.810 136.492 1.00 76.84  ? 545  GLY A O   1 
ATOM   3715 N  N   . ALA A 1 567  ? 111.138 119.049 138.303 1.00 67.57  ? 546  ALA A N   1 
ATOM   3716 C  CA  . ALA A 1 567  ? 110.544 120.110 137.493 1.00 67.57  ? 546  ALA A CA  1 
ATOM   3717 C  C   . ALA A 1 567  ? 111.601 120.870 136.705 1.00 67.57  ? 546  ALA A C   1 
ATOM   3718 O  O   . ALA A 1 567  ? 111.306 121.411 135.634 1.00 67.57  ? 546  ALA A O   1 
ATOM   3719 C  CB  . ALA A 1 567  ? 109.746 121.069 138.373 1.00 67.57  ? 546  ALA A CB  1 
ATOM   3720 N  N   . SER A 1 568  ? 112.830 120.910 137.212 1.00 56.79  ? 547  SER A N   1 
ATOM   3721 C  CA  . SER A 1 568  ? 113.938 121.432 136.425 1.00 56.79  ? 547  SER A CA  1 
ATOM   3722 C  C   . SER A 1 568  ? 114.237 120.524 135.238 1.00 56.79  ? 547  SER A C   1 
ATOM   3723 O  O   . SER A 1 568  ? 114.387 121.002 134.103 1.00 56.79  ? 547  SER A O   1 
ATOM   3724 C  CB  . SER A 1 568  ? 115.170 121.591 137.312 1.00 56.79  ? 547  SER A CB  1 
ATOM   3725 O  OG  . SER A 1 568  ? 116.280 122.035 136.563 1.00 56.79  ? 547  SER A OG  1 
ATOM   3726 N  N   . VAL A 1 569  ? 114.304 119.207 135.482 1.00 58.15  ? 548  VAL A N   1 
ATOM   3727 C  CA  . VAL A 1 569  ? 114.629 118.254 134.415 1.00 58.15  ? 548  VAL A CA  1 
ATOM   3728 C  C   . VAL A 1 569  ? 113.547 118.232 133.340 1.00 58.15  ? 548  VAL A C   1 
ATOM   3729 O  O   . VAL A 1 569  ? 113.846 118.094 132.148 1.00 58.15  ? 548  VAL A O   1 
ATOM   3730 C  CB  . VAL A 1 569  ? 114.880 116.857 135.027 1.00 58.15  ? 548  VAL A CB  1 
ATOM   3731 C  CG1 . VAL A 1 569  ? 115.085 115.795 133.968 1.00 58.15  ? 548  VAL A CG1 1 
ATOM   3732 C  CG2 . VAL A 1 569  ? 116.102 116.900 135.904 1.00 58.15  ? 548  VAL A CG2 1 
ATOM   3733 N  N   . ALA A 1 570  ? 112.290 118.447 133.716 1.00 56.29  ? 549  ALA A N   1 
ATOM   3734 C  CA  . ALA A 1 570  ? 111.261 118.575 132.692 1.00 56.29  ? 549  ALA A CA  1 
ATOM   3735 C  C   . ALA A 1 570  ? 111.298 119.937 132.008 1.00 56.29  ? 549  ALA A C   1 
ATOM   3736 O  O   . ALA A 1 570  ? 111.006 120.029 130.808 1.00 56.29  ? 549  ALA A O   1 
ATOM   3737 C  CB  . ALA A 1 570  ? 109.883 118.324 133.297 1.00 56.29  ? 549  ALA A CB  1 
ATOM   3738 N  N   . LEU A 1 571  ? 111.669 120.986 132.747 1.00 50.42  ? 550  LEU A N   1 
ATOM   3739 C  CA  . LEU A 1 571  ? 111.676 122.343 132.202 1.00 50.42  ? 550  LEU A CA  1 
ATOM   3740 C  C   . LEU A 1 571  ? 112.708 122.514 131.095 1.00 50.42  ? 550  LEU A C   1 
ATOM   3741 O  O   . LEU A 1 571  ? 112.413 123.128 130.056 1.00 50.42  ? 550  LEU A O   1 
ATOM   3742 C  CB  . LEU A 1 571  ? 111.918 123.331 133.339 1.00 50.42  ? 550  LEU A CB  1 
ATOM   3743 C  CG  . LEU A 1 571  ? 112.148 124.817 133.103 1.00 50.42  ? 550  LEU A CG  1 
ATOM   3744 C  CD1 . LEU A 1 571  ? 111.043 125.435 132.313 1.00 50.42  ? 550  LEU A CD1 1 
ATOM   3745 C  CD2 . LEU A 1 571  ? 112.204 125.477 134.454 1.00 50.42  ? 550  LEU A CD2 1 
ATOM   3746 N  N   . THR A 1 572  ? 113.912 121.969 131.293 1.00 49.89  ? 551  THR A N   1 
ATOM   3747 C  CA  . THR A 1 572  ? 114.937 122.048 130.258 1.00 49.89  ? 551  THR A CA  1 
ATOM   3748 C  C   . THR A 1 572  ? 114.511 121.304 128.999 1.00 49.89  ? 551  THR A C   1 
ATOM   3749 O  O   . THR A 1 572  ? 114.708 121.795 127.876 1.00 49.89  ? 551  THR A O   1 
ATOM   3750 C  CB  . THR A 1 572  ? 116.252 121.478 130.780 1.00 49.89  ? 551  THR A CB  1 
ATOM   3751 O  OG1 . THR A 1 572  ? 116.087 120.088 131.071 1.00 49.89  ? 551  THR A OG1 1 
ATOM   3752 C  CG2 . THR A 1 572  ? 116.676 122.197 132.035 1.00 49.89  ? 551  THR A CG2 1 
ATOM   3753 N  N   . SER A 1 573  ? 113.878 120.142 129.174 1.00 49.74  ? 552  SER A N   1 
ATOM   3754 C  CA  . SER A 1 573  ? 113.505 119.311 128.039 1.00 49.74  ? 552  SER A CA  1 
ATOM   3755 C  C   . SER A 1 573  ? 112.392 119.946 127.222 1.00 49.74  ? 552  SER A C   1 
ATOM   3756 O  O   . SER A 1 573  ? 112.472 119.981 125.990 1.00 49.74  ? 552  SER A O   1 
ATOM   3757 C  CB  . SER A 1 573  ? 113.085 117.933 128.518 1.00 49.74  ? 552  SER A CB  1 
ATOM   3758 O  OG  . SER A 1 573  ? 112.610 117.182 127.424 1.00 49.74  ? 552  SER A OG  1 
ATOM   3759 N  N   . ILE A 1 574  ? 111.349 120.457 127.891 1.00 57.52  ? 553  ILE A N   1 
ATOM   3760 C  CA  . ILE A 1 574  ? 110.259 121.145 127.193 1.00 57.52  ? 553  ILE A CA  1 
ATOM   3761 C  C   . ILE A 1 574  ? 110.781 122.379 126.468 1.00 57.52  ? 553  ILE A C   1 
ATOM   3762 O  O   . ILE A 1 574  ? 110.410 122.651 125.311 1.00 57.52  ? 553  ILE A O   1 
ATOM   3763 C  CB  . ILE A 1 574  ? 109.138 121.496 128.186 1.00 57.52  ? 553  ILE A CB  1 
ATOM   3764 C  CG1 . ILE A 1 574  ? 108.494 120.228 128.731 1.00 57.52  ? 553  ILE A CG1 1 
ATOM   3765 C  CG2 . ILE A 1 574  ? 108.081 122.359 127.549 1.00 57.52  ? 553  ILE A CG2 1 
ATOM   3766 C  CD1 . ILE A 1 574  ? 107.839 119.386 127.674 1.00 57.52  ? 553  ILE A CD1 1 
ATOM   3767 N  N   . SER A 1 575  ? 111.715 123.097 127.106 1.00 52.51  ? 554  SER A N   1 
ATOM   3768 C  CA  . SER A 1 575  ? 112.336 124.246 126.458 1.00 52.51  ? 554  SER A CA  1 
ATOM   3769 C  C   . SER A 1 575  ? 113.161 123.850 125.242 1.00 52.51  ? 554  SER A C   1 
ATOM   3770 O  O   . SER A 1 575  ? 113.351 124.670 124.339 1.00 52.51  ? 554  SER A O   1 
ATOM   3771 C  CB  . SER A 1 575  ? 113.214 124.996 127.449 1.00 52.51  ? 554  SER A CB  1 
ATOM   3772 O  OG  . SER A 1 575  ? 114.360 124.236 127.782 1.00 52.51  ? 554  SER A OG  1 
ATOM   3773 N  N   . ASN A 1 576  ? 113.659 122.615 125.188 1.00 48.81  ? 555  ASN A N   1 
ATOM   3774 C  CA  . ASN A 1 576  ? 114.313 122.176 123.959 1.00 48.81  ? 555  ASN A CA  1 
ATOM   3775 C  C   . ASN A 1 576  ? 113.303 121.779 122.886 1.00 48.81  ? 555  ASN A C   1 
ATOM   3776 O  O   . ASN A 1 576  ? 113.516 122.049 121.694 1.00 48.81  ? 555  ASN A O   1 
ATOM   3777 C  CB  . ASN A 1 576  ? 115.250 121.014 124.262 1.00 48.81  ? 555  ASN A CB  1 
ATOM   3778 C  CG  . ASN A 1 576  ? 116.432 121.431 125.099 1.00 48.81  ? 555  ASN A CG  1 
ATOM   3779 O  OD1 . ASN A 1 576  ? 117.007 122.492 124.888 1.00 48.81  ? 555  ASN A OD1 1 
ATOM   3780 N  ND2 . ASN A 1 576  ? 116.807 120.595 126.051 1.00 48.81  ? 555  ASN A ND2 1 
ATOM   3781 N  N   . VAL A 1 577  ? 112.195 121.154 123.298 1.00 42.35  ? 556  VAL A N   1 
ATOM   3782 C  CA  . VAL A 1 577  ? 111.218 120.610 122.355 1.00 42.35  ? 556  VAL A CA  1 
ATOM   3783 C  C   . VAL A 1 577  ? 110.519 121.716 121.580 1.00 42.35  ? 556  VAL A C   1 
ATOM   3784 O  O   . VAL A 1 577  ? 110.317 121.598 120.362 1.00 42.35  ? 556  VAL A O   1 
ATOM   3785 C  CB  . VAL A 1 577  ? 110.215 119.718 123.105 1.00 42.35  ? 556  VAL A CB  1 
ATOM   3786 C  CG1 . VAL A 1 577  ? 109.072 119.295 122.223 1.00 42.35  ? 556  VAL A CG1 1 
ATOM   3787 C  CG2 . VAL A 1 577  ? 110.913 118.509 123.583 1.00 42.35  ? 556  VAL A CG2 1 
ATOM   3788 N  N   . THR A 1 578  ? 110.162 122.819 122.257 1.00 35.51  ? 557  THR A N   1 
ATOM   3789 C  CA  . THR A 1 578  ? 109.538 123.929 121.533 1.00 35.51  ? 557  THR A CA  1 
ATOM   3790 C  C   . THR A 1 578  ? 110.491 124.554 120.525 1.00 35.51  ? 557  THR A C   1 
ATOM   3791 O  O   . THR A 1 578  ? 110.061 124.969 119.440 1.00 35.51  ? 557  THR A O   1 
ATOM   3792 C  CB  . THR A 1 578  ? 109.047 125.002 122.497 1.00 35.51  ? 557  THR A CB  1 
ATOM   3793 O  OG1 . THR A 1 578  ? 110.157 125.528 123.227 1.00 35.51  ? 557  THR A OG1 1 
ATOM   3794 C  CG2 . THR A 1 578  ? 108.038 124.426 123.462 1.00 35.51  ? 557  THR A CG2 1 
ATOM   3795 N  N   . ALA A 1 579  ? 111.784 124.580 120.845 1.00 26.86  ? 558  ALA A N   1 
ATOM   3796 C  CA  . ALA A 1 579  ? 112.768 125.103 119.911 1.00 26.86  ? 558  ALA A CA  1 
ATOM   3797 C  C   . ALA A 1 579  ? 112.932 124.203 118.701 1.00 26.86  ? 558  ALA A C   1 
ATOM   3798 O  O   . ALA A 1 579  ? 113.149 124.698 117.591 1.00 26.86  ? 558  ALA A O   1 
ATOM   3799 C  CB  . ALA A 1 579  ? 114.110 125.283 120.607 1.00 26.86  ? 558  ALA A CB  1 
ATOM   3800 N  N   . PHE A 1 580  ? 112.821 122.889 118.873 1.00 35.06  ? 559  PHE A N   1 
ATOM   3801 C  CA  . PHE A 1 580  ? 112.964 122.038 117.695 1.00 35.06  ? 559  PHE A CA  1 
ATOM   3802 C  C   . PHE A 1 580  ? 111.704 121.986 116.843 1.00 35.06  ? 559  PHE A C   1 
ATOM   3803 O  O   . PHE A 1 580  ? 111.805 121.805 115.624 1.00 35.06  ? 559  PHE A O   1 
ATOM   3804 C  CB  . PHE A 1 580  ? 113.382 120.633 118.099 1.00 35.06  ? 559  PHE A CB  1 
ATOM   3805 C  CG  . PHE A 1 580  ? 114.800 120.545 118.550 1.00 35.06  ? 559  PHE A CG  1 
ATOM   3806 C  CD1 . PHE A 1 580  ? 115.701 121.538 118.225 1.00 35.06  ? 559  PHE A CD1 1 
ATOM   3807 C  CD2 . PHE A 1 580  ? 115.234 119.481 119.306 1.00 35.06  ? 559  PHE A CD2 1 
ATOM   3808 C  CE1 . PHE A 1 580  ? 117.001 121.468 118.642 1.00 35.06  ? 559  PHE A CE1 1 
ATOM   3809 C  CE2 . PHE A 1 580  ? 116.544 119.413 119.726 1.00 35.06  ? 559  PHE A CE2 1 
ATOM   3810 C  CZ  . PHE A 1 580  ? 117.425 120.408 119.391 1.00 35.06  ? 559  PHE A CZ  1 
ATOM   3811 N  N   . PHE A 1 581  ? 110.521 122.136 117.438 1.00 45.00  ? 560  PHE A N   1 
ATOM   3812 C  CA  . PHE A 1 581  ? 109.318 122.225 116.616 1.00 45.00  ? 560  PHE A CA  1 
ATOM   3813 C  C   . PHE A 1 581  ? 109.274 123.532 115.835 1.00 45.00  ? 560  PHE A C   1 
ATOM   3814 O  O   . PHE A 1 581  ? 109.088 123.529 114.607 1.00 45.00  ? 560  PHE A O   1 
ATOM   3815 C  CB  . PHE A 1 581  ? 108.068 122.067 117.472 1.00 45.00  ? 560  PHE A CB  1 
ATOM   3816 C  CG  . PHE A 1 581  ? 107.755 120.649 117.833 1.00 45.00  ? 560  PHE A CG  1 
ATOM   3817 C  CD1 . PHE A 1 581  ? 108.393 119.596 117.194 1.00 45.00  ? 560  PHE A CD1 1 
ATOM   3818 C  CD2 . PHE A 1 581  ? 106.789 120.365 118.782 1.00 45.00  ? 560  PHE A CD2 1 
ATOM   3819 C  CE1 . PHE A 1 581  ? 108.093 118.289 117.515 1.00 45.00  ? 560  PHE A CE1 1 
ATOM   3820 C  CE2 . PHE A 1 581  ? 106.483 119.058 119.106 1.00 45.00  ? 560  PHE A CE2 1 
ATOM   3821 C  CZ  . PHE A 1 581  ? 107.138 118.018 118.470 1.00 45.00  ? 560  PHE A CZ  1 
ATOM   3822 N  N   . MET A 1 582  ? 109.466 124.662 116.524 1.00 52.76  ? 561  MET A N   1 
ATOM   3823 C  CA  . MET A 1 582  ? 109.463 125.943 115.827 1.00 52.76  ? 561  MET A CA  1 
ATOM   3824 C  C   . MET A 1 582  ? 110.649 126.095 114.888 1.00 52.76  ? 561  MET A C   1 
ATOM   3825 O  O   . MET A 1 582  ? 110.569 126.868 113.931 1.00 52.76  ? 561  MET A O   1 
ATOM   3826 C  CB  . MET A 1 582  ? 109.446 127.088 116.825 1.00 52.76  ? 561  MET A CB  1 
ATOM   3827 C  CG  . MET A 1 582  ? 108.205 127.150 117.685 1.00 52.76  ? 561  MET A CG  1 
ATOM   3828 S  SD  . MET A 1 582  ? 106.714 127.508 116.756 1.00 52.76  ? 561  MET A SD  1 
ATOM   3829 C  CE  . MET A 1 582  ? 105.484 127.252 118.026 1.00 52.76  ? 561  MET A CE  1 
ATOM   3830 N  N   . ALA A 1 583  ? 111.739 125.368 115.128 1.00 36.01  ? 562  ALA A N   1 
ATOM   3831 C  CA  . ALA A 1 583  ? 112.772 125.259 114.111 1.00 36.01  ? 562  ALA A CA  1 
ATOM   3832 C  C   . ALA A 1 583  ? 112.305 124.416 112.936 1.00 36.01  ? 562  ALA A C   1 
ATOM   3833 O  O   . ALA A 1 583  ? 112.691 124.682 111.795 1.00 36.01  ? 562  ALA A O   1 
ATOM   3834 C  CB  . ALA A 1 583  ? 114.040 124.660 114.707 1.00 36.01  ? 562  ALA A CB  1 
ATOM   3835 N  N   . ALA A 1 584  ? 111.474 123.405 113.189 1.00 40.19  ? 563  ALA A N   1 
ATOM   3836 C  CA  . ALA A 1 584  ? 111.010 122.528 112.124 1.00 40.19  ? 563  ALA A CA  1 
ATOM   3837 C  C   . ALA A 1 584  ? 109.922 123.145 111.264 1.00 40.19  ? 563  ALA A C   1 
ATOM   3838 O  O   . ALA A 1 584  ? 109.566 122.548 110.243 1.00 40.19  ? 563  ALA A O   1 
ATOM   3839 C  CB  . ALA A 1 584  ? 110.488 121.213 112.699 1.00 40.19  ? 563  ALA A CB  1 
ATOM   3840 N  N   . LEU A 1 585  ? 109.373 124.303 111.653 1.00 47.51  ? 564  LEU A N   1 
ATOM   3841 C  CA  . LEU A 1 585  ? 108.354 124.964 110.832 1.00 47.51  ? 564  LEU A CA  1 
ATOM   3842 C  C   . LEU A 1 585  ? 108.851 125.440 109.470 1.00 47.51  ? 564  LEU A C   1 
ATOM   3843 O  O   . LEU A 1 585  ? 108.024 125.689 108.591 1.00 47.51  ? 564  LEU A O   1 
ATOM   3844 C  CB  . LEU A 1 585  ? 107.752 126.162 111.564 1.00 47.51  ? 564  LEU A CB  1 
ATOM   3845 C  CG  . LEU A 1 585  ? 106.399 125.967 112.247 1.00 47.51  ? 564  LEU A CG  1 
ATOM   3846 C  CD1 . LEU A 1 585  ? 105.331 125.740 111.198 1.00 47.51  ? 564  LEU A CD1 1 
ATOM   3847 C  CD2 . LEU A 1 585  ? 106.406 124.812 113.213 1.00 47.51  ? 564  LEU A CD2 1 
ATOM   3848 N  N   . ILE A 1 586  ? 110.156 125.578 109.266 1.00 57.68  ? 565  ILE A N   1 
ATOM   3849 C  CA  . ILE A 1 586  ? 110.670 126.175 108.034 1.00 57.68  ? 565  ILE A CA  1 
ATOM   3850 C  C   . ILE A 1 586  ? 110.594 125.172 106.887 1.00 57.68  ? 565  ILE A C   1 
ATOM   3851 O  O   . ILE A 1 586  ? 110.427 123.970 107.131 1.00 57.68  ? 565  ILE A O   1 
ATOM   3852 C  CB  . ILE A 1 586  ? 112.110 126.678 108.217 1.00 57.68  ? 565  ILE A CB  1 
ATOM   3853 C  CG1 . ILE A 1 586  ? 113.054 125.523 108.506 1.00 57.68  ? 565  ILE A CG1 1 
ATOM   3854 C  CG2 . ILE A 1 586  ? 112.177 127.704 109.317 1.00 57.68  ? 565  ILE A CG2 1 
ATOM   3855 C  CD1 . ILE A 1 586  ? 114.493 125.913 108.400 1.00 57.68  ? 565  ILE A CD1 1 
ATOM   3856 N  N   . PRO A 1 587  ? 110.695 125.619 105.618 1.00 52.69  ? 566  PRO A N   1 
ATOM   3857 C  CA  . PRO A 1 587  ? 110.977 124.697 104.505 1.00 52.69  ? 566  PRO A CA  1 
ATOM   3858 C  C   . PRO A 1 587  ? 112.419 124.216 104.475 1.00 52.69  ? 566  PRO A C   1 
ATOM   3859 O  O   . PRO A 1 587  ? 113.085 124.225 105.513 1.00 52.69  ? 566  PRO A O   1 
ATOM   3860 C  CB  . PRO A 1 587  ? 110.640 125.528 103.268 1.00 52.69  ? 566  PRO A CB  1 
ATOM   3861 C  CG  . PRO A 1 587  ? 110.776 126.920 103.700 1.00 52.69  ? 566  PRO A CG  1 
ATOM   3862 C  CD  . PRO A 1 587  ? 110.314 126.951 105.112 1.00 52.69  ? 566  PRO A CD  1 
ATOM   3863 N  N   . ILE A 1 588  ? 112.867 123.733 103.314 1.00 57.20  ? 567  ILE A N   1 
ATOM   3864 C  CA  . ILE A 1 588  ? 114.165 123.092 103.078 1.00 57.20  ? 567  ILE A CA  1 
ATOM   3865 C  C   . ILE A 1 588  ? 114.175 121.811 103.899 1.00 57.20  ? 567  ILE A C   1 
ATOM   3866 O  O   . ILE A 1 588  ? 114.723 121.780 105.010 1.00 57.20  ? 567  ILE A O   1 
ATOM   3867 C  CB  . ILE A 1 588  ? 115.355 124.020 103.387 1.00 57.20  ? 567  ILE A CB  1 
ATOM   3868 C  CG1 . ILE A 1 588  ? 115.201 125.320 102.612 1.00 57.20  ? 567  ILE A CG1 1 
ATOM   3869 C  CG2 . ILE A 1 588  ? 116.672 123.386 102.981 1.00 57.20  ? 567  ILE A CG2 1 
ATOM   3870 C  CD1 . ILE A 1 588  ? 116.142 126.381 103.056 1.00 57.20  ? 567  ILE A CD1 1 
ATOM   3871 N  N   . PRO A 1 589  ? 113.511 120.754 103.413 1.00 57.93  ? 568  PRO A N   1 
ATOM   3872 C  CA  . PRO A 1 589  ? 113.168 119.595 104.252 1.00 57.93  ? 568  PRO A CA  1 
ATOM   3873 C  C   . PRO A 1 589  ? 114.341 118.760 104.741 1.00 57.93  ? 568  PRO A C   1 
ATOM   3874 O  O   . PRO A 1 589  ? 114.108 117.789 105.468 1.00 57.93  ? 568  PRO A O   1 
ATOM   3875 C  CB  . PRO A 1 589  ? 112.286 118.761 103.324 1.00 57.93  ? 568  PRO A CB  1 
ATOM   3876 C  CG  . PRO A 1 589  ? 112.800 119.078 101.975 1.00 57.93  ? 568  PRO A CG  1 
ATOM   3877 C  CD  . PRO A 1 589  ? 113.198 120.518 101.999 1.00 57.93  ? 568  PRO A CD  1 
ATOM   3878 N  N   . ALA A 1 590  ? 115.582 119.065 104.362 1.00 52.03  ? 569  ALA A N   1 
ATOM   3879 C  CA  . ALA A 1 590  ? 116.708 118.514 105.099 1.00 52.03  ? 569  ALA A CA  1 
ATOM   3880 C  C   . ALA A 1 590  ? 116.718 119.045 106.522 1.00 52.03  ? 569  ALA A C   1 
ATOM   3881 O  O   . ALA A 1 590  ? 117.035 118.316 107.466 1.00 52.03  ? 569  ALA A O   1 
ATOM   3882 C  CB  . ALA A 1 590  ? 118.018 118.850 104.398 1.00 52.03  ? 569  ALA A CB  1 
ATOM   3883 N  N   . LEU A 1 591  ? 116.339 120.305 106.697 1.00 45.06  ? 570  LEU A N   1 
ATOM   3884 C  CA  . LEU A 1 591  ? 116.331 120.919 108.013 1.00 45.06  ? 570  LEU A CA  1 
ATOM   3885 C  C   . LEU A 1 591  ? 115.068 120.583 108.783 1.00 45.06  ? 570  LEU A C   1 
ATOM   3886 O  O   . LEU A 1 591  ? 115.120 120.432 110.008 1.00 45.06  ? 570  LEU A O   1 
ATOM   3887 C  CB  . LEU A 1 591  ? 116.477 122.421 107.852 1.00 45.06  ? 570  LEU A CB  1 
ATOM   3888 C  CG  . LEU A 1 591  ? 117.771 122.677 107.087 1.00 45.06  ? 570  LEU A CG  1 
ATOM   3889 C  CD1 . LEU A 1 591  ? 117.820 124.096 106.609 1.00 45.06  ? 570  LEU A CD1 1 
ATOM   3890 C  CD2 . LEU A 1 591  ? 118.968 122.371 107.958 1.00 45.06  ? 570  LEU A CD2 1 
ATOM   3891 N  N   . ARG A 1 592  ? 113.939 120.467 108.087 1.00 66.21  ? 571  ARG A N   1 
ATOM   3892 C  CA  . ARG A 1 592  ? 112.708 119.995 108.712 1.00 66.21  ? 571  ARG A CA  1 
ATOM   3893 C  C   . ARG A 1 592  ? 112.844 118.545 109.161 1.00 66.21  ? 571  ARG A C   1 
ATOM   3894 O  O   . ARG A 1 592  ? 112.523 118.195 110.307 1.00 66.21  ? 571  ARG A O   1 
ATOM   3895 C  CB  . ARG A 1 592  ? 111.549 120.155 107.731 1.00 66.21  ? 571  ARG A CB  1 
ATOM   3896 C  CG  . ARG A 1 592  ? 110.211 119.737 108.262 1.00 66.21  ? 571  ARG A CG  1 
ATOM   3897 C  CD  . ARG A 1 592  ? 109.117 120.049 107.265 1.00 66.21  ? 571  ARG A CD  1 
ATOM   3898 N  NE  . ARG A 1 592  ? 108.903 121.485 107.130 1.00 66.21  ? 571  ARG A NE  1 
ATOM   3899 C  CZ  . ARG A 1 592  ? 108.113 122.039 106.216 1.00 66.21  ? 571  ARG A CZ  1 
ATOM   3900 N  NH1 . ARG A 1 592  ? 107.463 121.276 105.352 1.00 66.21  ? 571  ARG A NH1 1 
ATOM   3901 N  NH2 . ARG A 1 592  ? 107.975 123.356 106.165 1.00 66.21  ? 571  ARG A NH2 1 
ATOM   3902 N  N   . ALA A 1 593  ? 113.364 117.696 108.284 1.00 58.11  ? 572  ALA A N   1 
ATOM   3903 C  CA  . ALA A 1 593  ? 113.577 116.302 108.623 1.00 58.11  ? 572  ALA A CA  1 
ATOM   3904 C  C   . ALA A 1 593  ? 114.790 116.081 109.512 1.00 58.11  ? 572  ALA A C   1 
ATOM   3905 O  O   . ALA A 1 593  ? 114.963 114.976 110.027 1.00 58.11  ? 572  ALA A O   1 
ATOM   3906 C  CB  . ALA A 1 593  ? 113.716 115.482 107.348 1.00 58.11  ? 572  ALA A CB  1 
ATOM   3907 N  N   . PHE A 1 594  ? 115.641 117.087 109.690 1.00 50.12  ? 573  PHE A N   1 
ATOM   3908 C  CA  . PHE A 1 594  ? 116.664 117.023 110.725 1.00 50.12  ? 573  PHE A CA  1 
ATOM   3909 C  C   . PHE A 1 594  ? 116.078 117.336 112.092 1.00 50.12  ? 573  PHE A C   1 
ATOM   3910 O  O   . PHE A 1 594  ? 116.201 116.547 113.039 1.00 50.12  ? 573  PHE A O   1 
ATOM   3911 C  CB  . PHE A 1 594  ? 117.792 117.998 110.400 1.00 50.12  ? 573  PHE A CB  1 
ATOM   3912 C  CG  . PHE A 1 594  ? 118.783 118.171 111.505 1.00 50.12  ? 573  PHE A CG  1 
ATOM   3913 C  CD1 . PHE A 1 594  ? 119.661 117.160 111.828 1.00 50.12  ? 573  PHE A CD1 1 
ATOM   3914 C  CD2 . PHE A 1 594  ? 118.847 119.358 112.211 1.00 50.12  ? 573  PHE A CD2 1 
ATOM   3915 C  CE1 . PHE A 1 594  ? 120.579 117.323 112.845 1.00 50.12  ? 573  PHE A CE1 1 
ATOM   3916 C  CE2 . PHE A 1 594  ? 119.766 119.528 113.226 1.00 50.12  ? 573  PHE A CE2 1 
ATOM   3917 C  CZ  . PHE A 1 594  ? 120.631 118.510 113.542 1.00 50.12  ? 573  PHE A CZ  1 
ATOM   3918 N  N   . SER A 1 595  ? 115.421 118.486 112.200 1.00 37.72  ? 574  SER A N   1 
ATOM   3919 C  CA  . SER A 1 595  ? 114.972 118.966 113.492 1.00 37.72  ? 574  SER A CA  1 
ATOM   3920 C  C   . SER A 1 595  ? 113.782 118.196 114.037 1.00 37.72  ? 574  SER A C   1 
ATOM   3921 O  O   . SER A 1 595  ? 113.601 118.171 115.257 1.00 37.72  ? 574  SER A O   1 
ATOM   3922 C  CB  . SER A 1 595  ? 114.654 120.443 113.390 1.00 37.72  ? 574  SER A CB  1 
ATOM   3923 O  OG  . SER A 1 595  ? 113.678 120.631 112.397 1.00 37.72  ? 574  SER A OG  1 
ATOM   3924 N  N   . LEU A 1 596  ? 112.969 117.562 113.190 1.00 38.55  ? 575  LEU A N   1 
ATOM   3925 C  CA  . LEU A 1 596  ? 111.954 116.674 113.749 1.00 38.55  ? 575  LEU A CA  1 
ATOM   3926 C  C   . LEU A 1 596  ? 112.585 115.442 114.385 1.00 38.55  ? 575  LEU A C   1 
ATOM   3927 O  O   . LEU A 1 596  ? 112.099 114.950 115.412 1.00 38.55  ? 575  LEU A O   1 
ATOM   3928 C  CB  . LEU A 1 596  ? 110.937 116.263 112.691 1.00 38.55  ? 575  LEU A CB  1 
ATOM   3929 C  CG  . LEU A 1 596  ? 109.931 117.333 112.296 1.00 38.55  ? 575  LEU A CG  1 
ATOM   3930 C  CD1 . LEU A 1 596  ? 109.029 116.802 111.202 1.00 38.55  ? 575  LEU A CD1 1 
ATOM   3931 C  CD2 . LEU A 1 596  ? 109.128 117.742 113.505 1.00 38.55  ? 575  LEU A CD2 1 
ATOM   3932 N  N   . GLN A 1 597  ? 113.672 114.940 113.796 1.00 45.06  ? 576  GLN A N   1 
ATOM   3933 C  CA  . GLN A 1 597  ? 114.393 113.827 114.402 1.00 45.06  ? 576  GLN A CA  1 
ATOM   3934 C  C   . GLN A 1 597  ? 115.039 114.244 115.711 1.00 45.06  ? 576  GLN A C   1 
ATOM   3935 O  O   . GLN A 1 597  ? 115.022 113.479 116.685 1.00 45.06  ? 576  GLN A O   1 
ATOM   3936 C  CB  . GLN A 1 597  ? 115.448 113.293 113.442 1.00 45.06  ? 576  GLN A CB  1 
ATOM   3937 C  CG  . GLN A 1 597  ? 114.883 112.591 112.236 1.00 45.06  ? 576  GLN A CG  1 
ATOM   3938 C  CD  . GLN A 1 597  ? 115.962 112.165 111.274 1.00 45.06  ? 576  GLN A CD  1 
ATOM   3939 O  OE1 . GLN A 1 597  ? 117.136 112.432 111.496 1.00 45.06  ? 576  GLN A OE1 1 
ATOM   3940 N  NE2 . GLN A 1 597  ? 115.570 111.505 110.195 1.00 45.06  ? 576  GLN A NE2 1 
ATOM   3941 N  N   . ALA A 1 598  ? 115.588 115.458 115.763 1.00 35.66  ? 577  ALA A N   1 
ATOM   3942 C  CA  . ALA A 1 598  ? 116.145 115.940 117.021 1.00 35.66  ? 577  ALA A CA  1 
ATOM   3943 C  C   . ALA A 1 598  ? 115.067 116.139 118.080 1.00 35.66  ? 577  ALA A C   1 
ATOM   3944 O  O   . ALA A 1 598  ? 115.322 115.901 119.266 1.00 35.66  ? 577  ALA A O   1 
ATOM   3945 C  CB  . ALA A 1 598  ? 116.919 117.234 116.796 1.00 35.66  ? 577  ALA A CB  1 
ATOM   3946 N  N   . ALA A 1 599  ? 113.854 116.527 117.674 1.00 33.77  ? 578  ALA A N   1 
ATOM   3947 C  CA  . ALA A 1 599  ? 112.761 116.656 118.633 1.00 33.77  ? 578  ALA A CA  1 
ATOM   3948 C  C   . ALA A 1 599  ? 112.334 115.303 119.185 1.00 33.77  ? 578  ALA A C   1 
ATOM   3949 O  O   . ALA A 1 599  ? 112.062 115.178 120.388 1.00 33.77  ? 578  ALA A O   1 
ATOM   3950 C  CB  . ALA A 1 599  ? 111.572 117.353 117.984 1.00 33.77  ? 578  ALA A CB  1 
ATOM   3951 N  N   . VAL A 1 600  ? 112.269 114.283 118.324 1.00 41.12  ? 579  VAL A N   1 
ATOM   3952 C  CA  . VAL A 1 600  ? 111.903 112.942 118.777 1.00 41.12  ? 579  VAL A CA  1 
ATOM   3953 C  C   . VAL A 1 600  ? 112.954 112.390 119.730 1.00 41.12  ? 579  VAL A C   1 
ATOM   3954 O  O   . VAL A 1 600  ? 112.621 111.797 120.767 1.00 41.12  ? 579  VAL A O   1 
ATOM   3955 C  CB  . VAL A 1 600  ? 111.682 112.015 117.568 1.00 41.12  ? 579  VAL A CB  1 
ATOM   3956 C  CG1 . VAL A 1 600  ? 111.556 110.568 117.992 1.00 41.12  ? 579  VAL A CG1 1 
ATOM   3957 C  CG2 . VAL A 1 600  ? 110.436 112.429 116.816 1.00 41.12  ? 579  VAL A CG2 1 
ATOM   3958 N  N   . VAL A 1 601  ? 114.233 112.625 119.429 1.00 38.79  ? 580  VAL A N   1 
ATOM   3959 C  CA  . VAL A 1 601  ? 115.288 112.157 120.323 1.00 38.79  ? 580  VAL A CA  1 
ATOM   3960 C  C   . VAL A 1 601  ? 115.276 112.923 121.648 1.00 38.79  ? 580  VAL A C   1 
ATOM   3961 O  O   . VAL A 1 601  ? 115.586 112.356 122.700 1.00 38.79  ? 580  VAL A O   1 
ATOM   3962 C  CB  . VAL A 1 601  ? 116.638 112.236 119.585 1.00 38.79  ? 580  VAL A CB  1 
ATOM   3963 C  CG1 . VAL A 1 601  ? 117.804 111.896 120.477 1.00 38.79  ? 580  VAL A CG1 1 
ATOM   3964 C  CG2 . VAL A 1 601  ? 116.629 111.262 118.445 1.00 38.79  ? 580  VAL A CG2 1 
ATOM   3965 N  N   . VAL A 1 602  ? 114.846 114.186 121.647 1.00 45.08  ? 581  VAL A N   1 
ATOM   3966 C  CA  . VAL A 1 602  ? 114.807 114.929 122.905 1.00 45.08  ? 581  VAL A CA  1 
ATOM   3967 C  C   . VAL A 1 602  ? 113.643 114.484 123.791 1.00 45.08  ? 581  VAL A C   1 
ATOM   3968 O  O   . VAL A 1 602  ? 113.826 114.294 124.999 1.00 45.08  ? 581  VAL A O   1 
ATOM   3969 C  CB  . VAL A 1 602  ? 114.799 116.445 122.629 1.00 45.08  ? 581  VAL A CB  1 
ATOM   3970 C  CG1 . VAL A 1 602  ? 114.401 117.235 123.852 1.00 45.08  ? 581  VAL A CG1 1 
ATOM   3971 C  CG2 . VAL A 1 602  ? 116.192 116.881 122.247 1.00 45.08  ? 581  VAL A CG2 1 
ATOM   3972 N  N   . VAL A 1 603  ? 112.443 114.283 123.226 1.00 56.14  ? 582  VAL A N   1 
ATOM   3973 C  CA  . VAL A 1 603  ? 111.307 113.812 124.031 1.00 56.14  ? 582  VAL A CA  1 
ATOM   3974 C  C   . VAL A 1 603  ? 111.564 112.406 124.547 1.00 56.14  ? 582  VAL A C   1 
ATOM   3975 O  O   . VAL A 1 603  ? 111.433 112.118 125.749 1.00 56.14  ? 582  VAL A O   1 
ATOM   3976 C  CB  . VAL A 1 603  ? 110.005 113.835 123.211 1.00 56.14  ? 582  VAL A CB  1 
ATOM   3977 C  CG1 . VAL A 1 603  ? 108.860 113.286 124.030 1.00 56.14  ? 582  VAL A CG1 1 
ATOM   3978 C  CG2 . VAL A 1 603  ? 109.675 115.208 122.742 1.00 56.14  ? 582  VAL A CG2 1 
ATOM   3979 N  N   . PHE A 1 604  ? 111.933 111.521 123.625 1.00 64.58  ? 583  PHE A N   1 
ATOM   3980 C  CA  . PHE A 1 604  ? 112.212 110.127 123.926 1.00 64.58  ? 583  PHE A CA  1 
ATOM   3981 C  C   . PHE A 1 604  ? 113.349 109.995 124.934 1.00 64.58  ? 583  PHE A C   1 
ATOM   3982 O  O   . PHE A 1 604  ? 113.299 109.163 125.848 1.00 64.58  ? 583  PHE A O   1 
ATOM   3983 C  CB  . PHE A 1 604  ? 112.550 109.451 122.606 1.00 64.58  ? 583  PHE A CB  1 
ATOM   3984 C  CG  . PHE A 1 604  ? 112.675 107.995 122.685 1.00 64.58  ? 583  PHE A CG  1 
ATOM   3985 C  CD1 . PHE A 1 604  ? 111.549 107.200 122.771 1.00 64.58  ? 583  PHE A CD1 1 
ATOM   3986 C  CD2 . PHE A 1 604  ? 113.917 107.409 122.631 1.00 64.58  ? 583  PHE A CD2 1 
ATOM   3987 C  CE1 . PHE A 1 604  ? 111.670 105.836 122.828 1.00 64.58  ? 583  PHE A CE1 1 
ATOM   3988 C  CE2 . PHE A 1 604  ? 114.047 106.057 122.695 1.00 64.58  ? 583  PHE A CE2 1 
ATOM   3989 C  CZ  . PHE A 1 604  ? 112.929 105.262 122.783 1.00 64.58  ? 583  PHE A CZ  1 
ATOM   3990 N  N   . ASN A 1 605  ? 114.346 110.868 124.818 1.00 70.53  ? 584  ASN A N   1 
ATOM   3991 C  CA  . ASN A 1 605  ? 115.475 110.875 125.735 1.00 70.53  ? 584  ASN A CA  1 
ATOM   3992 C  C   . ASN A 1 605  ? 115.077 111.413 127.097 1.00 70.53  ? 584  ASN A C   1 
ATOM   3993 O  O   . ASN A 1 605  ? 115.620 110.971 128.113 1.00 70.53  ? 584  ASN A O   1 
ATOM   3994 C  CB  . ASN A 1 605  ? 116.601 111.709 125.128 1.00 70.53  ? 584  ASN A CB  1 
ATOM   3995 C  CG  . ASN A 1 605  ? 117.945 111.421 125.743 1.00 70.53  ? 584  ASN A CG  1 
ATOM   3996 O  OD1 . ASN A 1 605  ? 118.060 110.632 126.676 1.00 70.53  ? 584  ASN A OD1 1 
ATOM   3997 N  ND2 . ASN A 1 605  ? 118.987 112.036 125.192 1.00 70.53  ? 584  ASN A ND2 1 
ATOM   3998 N  N   . PHE A 1 606  ? 114.134 112.358 127.137 1.00 68.82  ? 585  PHE A N   1 
ATOM   3999 C  CA  . PHE A 1 606  ? 113.606 112.846 128.408 1.00 68.82  ? 585  PHE A CA  1 
ATOM   4000 C  C   . PHE A 1 606  ? 112.923 111.742 129.196 1.00 68.82  ? 585  PHE A C   1 
ATOM   4001 O  O   . PHE A 1 606  ? 113.244 111.519 130.374 1.00 68.82  ? 585  PHE A O   1 
ATOM   4002 C  CB  . PHE A 1 606  ? 112.624 113.986 128.173 1.00 68.82  ? 585  PHE A CB  1 
ATOM   4003 C  CG  . PHE A 1 606  ? 111.783 114.294 129.367 1.00 68.82  ? 585  PHE A CG  1 
ATOM   4004 C  CD1 . PHE A 1 606  ? 112.345 114.861 130.497 1.00 68.82  ? 585  PHE A CD1 1 
ATOM   4005 C  CD2 . PHE A 1 606  ? 110.428 114.016 129.359 1.00 68.82  ? 585  PHE A CD2 1 
ATOM   4006 C  CE1 . PHE A 1 606  ? 111.573 115.135 131.601 1.00 68.82  ? 585  PHE A CE1 1 
ATOM   4007 C  CE2 . PHE A 1 606  ? 109.651 114.291 130.456 1.00 68.82  ? 585  PHE A CE2 1 
ATOM   4008 C  CZ  . PHE A 1 606  ? 110.224 114.854 131.579 1.00 68.82  ? 585  PHE A CZ  1 
ATOM   4009 N  N   . ALA A 1 607  ? 111.961 111.053 128.567 1.00 65.04  ? 586  ALA A N   1 
ATOM   4010 C  CA  . ALA A 1 607  ? 111.272 109.963 129.256 1.00 65.04  ? 586  ALA A CA  1 
ATOM   4011 C  C   . ALA A 1 607  ? 112.225 108.830 129.598 1.00 65.04  ? 586  ALA A C   1 
ATOM   4012 O  O   . ALA A 1 607  ? 112.063 108.164 130.631 1.00 65.04  ? 586  ALA A O   1 
ATOM   4013 C  CB  . ALA A 1 607  ? 110.120 109.442 128.401 1.00 65.04  ? 586  ALA A CB  1 
ATOM   4014 N  N   . MET A 1 608  ? 113.256 108.651 128.770 1.00 84.98  ? 587  MET A N   1 
ATOM   4015 C  CA  . MET A 1 608  ? 114.252 107.611 128.984 1.00 84.98  ? 587  MET A CA  1 
ATOM   4016 C  C   . MET A 1 608  ? 115.080 107.894 130.233 1.00 84.98  ? 587  MET A C   1 
ATOM   4017 O  O   . MET A 1 608  ? 115.311 106.995 131.054 1.00 84.98  ? 587  MET A O   1 
ATOM   4018 C  CB  . MET A 1 608  ? 115.147 107.542 127.749 1.00 84.98  ? 587  MET A CB  1 
ATOM   4019 C  CG  . MET A 1 608  ? 115.778 106.206 127.495 1.00 84.98  ? 587  MET A CG  1 
ATOM   4020 S  SD  . MET A 1 608  ? 117.280 105.732 128.310 1.00 84.98  ? 587  MET A SD  1 
ATOM   4021 C  CE  . MET A 1 608  ? 117.267 104.022 127.774 1.00 84.98  ? 587  MET A CE  1 
ATOM   4022 N  N   . VAL A 1 609  ? 115.494 109.152 130.409 1.00 76.47  ? 588  VAL A N   1 
ATOM   4023 C  CA  . VAL A 1 609  ? 116.311 109.529 131.558 1.00 76.47  ? 588  VAL A CA  1 
ATOM   4024 C  C   . VAL A 1 609  ? 115.483 109.546 132.836 1.00 76.47  ? 588  VAL A C   1 
ATOM   4025 O  O   . VAL A 1 609  ? 115.829 108.873 133.816 1.00 76.47  ? 588  VAL A O   1 
ATOM   4026 C  CB  . VAL A 1 609  ? 116.991 110.889 131.316 1.00 76.47  ? 588  VAL A CB  1 
ATOM   4027 C  CG1 . VAL A 1 609  ? 117.583 111.418 132.603 1.00 76.47  ? 588  VAL A CG1 1 
ATOM   4028 C  CG2 . VAL A 1 609  ? 118.093 110.742 130.283 1.00 76.47  ? 588  VAL A CG2 1 
ATOM   4029 N  N   . LEU A 1 610  ? 114.385 110.313 132.854 1.00 64.57  ? 589  LEU A N   1 
ATOM   4030 C  CA  . LEU A 1 610  ? 113.642 110.465 134.102 1.00 64.57  ? 589  LEU A CA  1 
ATOM   4031 C  C   . LEU A 1 610  ? 112.891 109.199 134.496 1.00 64.57  ? 589  LEU A C   1 
ATOM   4032 O  O   . LEU A 1 610  ? 112.584 109.025 135.678 1.00 64.57  ? 589  LEU A O   1 
ATOM   4033 C  CB  . LEU A 1 610  ? 112.679 111.656 134.008 1.00 64.57  ? 589  LEU A CB  1 
ATOM   4034 C  CG  . LEU A 1 610  ? 111.924 112.190 135.238 1.00 64.57  ? 589  LEU A CG  1 
ATOM   4035 C  CD1 . LEU A 1 610  ? 111.778 113.688 135.162 1.00 64.57  ? 589  LEU A CD1 1 
ATOM   4036 C  CD2 . LEU A 1 610  ? 110.540 111.588 135.369 1.00 64.57  ? 589  LEU A CD2 1 
ATOM   4037 N  N   . LEU A 1 611  ? 112.603 108.294 133.564 1.00 59.92  ? 590  LEU A N   1 
ATOM   4038 C  CA  . LEU A 1 611  ? 111.865 107.105 133.952 1.00 59.92  ? 590  LEU A CA  1 
ATOM   4039 C  C   . LEU A 1 611  ? 112.694 105.832 133.999 1.00 59.92  ? 590  LEU A C   1 
ATOM   4040 O  O   . LEU A 1 611  ? 112.211 104.836 134.541 1.00 59.92  ? 590  LEU A O   1 
ATOM   4041 C  CB  . LEU A 1 611  ? 110.666 106.892 133.024 1.00 59.92  ? 590  LEU A CB  1 
ATOM   4042 C  CG  . LEU A 1 611  ? 109.592 107.974 133.143 1.00 59.92  ? 590  LEU A CG  1 
ATOM   4043 C  CD1 . LEU A 1 611  ? 108.444 107.708 132.182 1.00 59.92  ? 590  LEU A CD1 1 
ATOM   4044 C  CD2 . LEU A 1 611  ? 109.089 108.095 134.570 1.00 59.92  ? 590  LEU A CD2 1 
ATOM   4045 N  N   . ILE A 1 612  ? 113.910 105.815 133.451 1.00 65.05  ? 591  ILE A N   1 
ATOM   4046 C  CA  . ILE A 1 612  ? 114.705 104.589 133.495 1.00 65.05  ? 591  ILE A CA  1 
ATOM   4047 C  C   . ILE A 1 612  ? 115.973 104.805 134.317 1.00 65.05  ? 591  ILE A C   1 
ATOM   4048 O  O   . ILE A 1 612  ? 116.460 103.884 134.982 1.00 65.05  ? 591  ILE A O   1 
ATOM   4049 C  CB  . ILE A 1 612  ? 115.006 104.096 132.065 1.00 65.05  ? 591  ILE A CB  1 
ATOM   4050 C  CG1 . ILE A 1 612  ? 113.697 103.787 131.350 1.00 65.05  ? 591  ILE A CG1 1 
ATOM   4051 C  CG2 . ILE A 1 612  ? 115.848 102.834 132.050 1.00 65.05  ? 591  ILE A CG2 1 
ATOM   4052 C  CD1 . ILE A 1 612  ? 112.889 102.713 132.029 1.00 65.05  ? 591  ILE A CD1 1 
ATOM   4053 N  N   . PHE A 1 613  ? 116.489 106.023 134.323 1.00 63.29  ? 592  PHE A N   1 
ATOM   4054 C  CA  . PHE A 1 613  ? 117.679 106.281 135.128 1.00 63.29  ? 592  PHE A CA  1 
ATOM   4055 C  C   . PHE A 1 613  ? 117.462 106.233 136.649 1.00 63.29  ? 592  PHE A C   1 
ATOM   4056 O  O   . PHE A 1 613  ? 118.394 105.827 137.356 1.00 63.29  ? 592  PHE A O   1 
ATOM   4057 C  CB  . PHE A 1 613  ? 118.290 107.613 134.699 1.00 63.29  ? 592  PHE A CB  1 
ATOM   4058 C  CG  . PHE A 1 613  ? 119.611 107.904 135.327 1.00 63.29  ? 592  PHE A CG  1 
ATOM   4059 C  CD1 . PHE A 1 613  ? 120.714 107.143 135.018 1.00 63.29  ? 592  PHE A CD1 1 
ATOM   4060 C  CD2 . PHE A 1 613  ? 119.765 108.977 136.178 1.00 63.29  ? 592  PHE A CD2 1 
ATOM   4061 C  CE1 . PHE A 1 613  ? 121.935 107.417 135.580 1.00 63.29  ? 592  PHE A CE1 1 
ATOM   4062 C  CE2 . PHE A 1 613  ? 120.989 109.258 136.736 1.00 63.29  ? 592  PHE A CE2 1 
ATOM   4063 C  CZ  . PHE A 1 613  ? 122.073 108.476 136.438 1.00 63.29  ? 592  PHE A CZ  1 
ATOM   4064 N  N   . PRO A 1 614  ? 116.295 106.599 137.219 1.00 68.37  ? 593  PRO A N   1 
ATOM   4065 C  CA  . PRO A 1 614  ? 116.079 106.290 138.642 1.00 68.37  ? 593  PRO A CA  1 
ATOM   4066 C  C   . PRO A 1 614  ? 116.000 104.812 138.973 1.00 68.37  ? 593  PRO A C   1 
ATOM   4067 O  O   . PRO A 1 614  ? 116.130 104.466 140.151 1.00 68.37  ? 593  PRO A O   1 
ATOM   4068 C  CB  . PRO A 1 614  ? 114.755 106.990 138.957 1.00 68.37  ? 593  PRO A CB  1 
ATOM   4069 C  CG  . PRO A 1 614  ? 114.728 108.094 138.069 1.00 68.37  ? 593  PRO A CG  1 
ATOM   4070 C  CD  . PRO A 1 614  ? 115.319 107.622 136.797 1.00 68.37  ? 593  PRO A CD  1 
ATOM   4071 N  N   . ALA A 1 615  ? 115.776 103.930 138.001 1.00 65.80  ? 594  ALA A N   1 
ATOM   4072 C  CA  . ALA A 1 615  ? 115.865 102.508 138.300 1.00 65.80  ? 594  ALA A CA  1 
ATOM   4073 C  C   . ALA A 1 615  ? 117.309 102.100 138.566 1.00 65.80  ? 594  ALA A C   1 
ATOM   4074 O  O   . ALA A 1 615  ? 117.582 101.358 139.516 1.00 65.80  ? 594  ALA A O   1 
ATOM   4075 C  CB  . ALA A 1 615  ? 115.266 101.687 137.163 1.00 65.80  ? 594  ALA A CB  1 
ATOM   4076 N  N   . ILE A 1 616  ? 118.252 102.600 137.764 1.00 68.34  ? 595  ILE A N   1 
ATOM   4077 C  CA  . ILE A 1 616  ? 119.652 102.307 138.051 1.00 68.34  ? 595  ILE A CA  1 
ATOM   4078 C  C   . ILE A 1 616  ? 120.142 103.125 139.241 1.00 68.34  ? 595  ILE A C   1 
ATOM   4079 O  O   . ILE A 1 616  ? 121.137 102.751 139.875 1.00 68.34  ? 595  ILE A O   1 
ATOM   4080 C  CB  . ILE A 1 616  ? 120.533 102.516 136.803 1.00 68.34  ? 595  ILE A CB  1 
ATOM   4081 C  CG1 . ILE A 1 616  ? 121.808 101.687 136.892 1.00 68.34  ? 595  ILE A CG1 1 
ATOM   4082 C  CG2 . ILE A 1 616  ? 120.973 103.941 136.666 1.00 68.34  ? 595  ILE A CG2 1 
ATOM   4083 C  CD1 . ILE A 1 616  ? 121.566 100.213 136.825 1.00 68.34  ? 595  ILE A CD1 1 
ATOM   4084 N  N   . LEU A 1 617  ? 119.449 104.212 139.599 1.00 71.46  ? 596  LEU A N   1 
ATOM   4085 C  CA  . LEU A 1 617  ? 119.704 104.822 140.899 1.00 71.46  ? 596  LEU A CA  1 
ATOM   4086 C  C   . LEU A 1 617  ? 119.230 103.920 142.029 1.00 71.46  ? 596  LEU A C   1 
ATOM   4087 O  O   . LEU A 1 617  ? 119.880 103.837 143.078 1.00 71.46  ? 596  LEU A O   1 
ATOM   4088 C  CB  . LEU A 1 617  ? 119.034 106.188 141.003 1.00 71.46  ? 596  LEU A CB  1 
ATOM   4089 C  CG  . LEU A 1 617  ? 119.680 107.320 140.218 1.00 71.46  ? 596  LEU A CG  1 
ATOM   4090 C  CD1 . LEU A 1 617  ? 118.878 108.598 140.379 1.00 71.46  ? 596  LEU A CD1 1 
ATOM   4091 C  CD2 . LEU A 1 617  ? 121.112 107.505 140.686 1.00 71.46  ? 596  LEU A CD2 1 
ATOM   4092 N  N   . SER A 1 618  ? 118.103 103.234 141.827 1.00 71.09  ? 597  SER A N   1 
ATOM   4093 C  CA  . SER A 1 618  ? 117.571 102.349 142.856 1.00 71.09  ? 597  SER A CA  1 
ATOM   4094 C  C   . SER A 1 618  ? 118.480 101.150 143.068 1.00 71.09  ? 597  SER A C   1 
ATOM   4095 O  O   . SER A 1 618  ? 118.793 100.799 144.210 1.00 71.09  ? 597  SER A O   1 
ATOM   4096 C  CB  . SER A 1 618  ? 116.162 101.898 142.479 1.00 71.09  ? 597  SER A CB  1 
ATOM   4097 O  OG  . SER A 1 618  ? 115.619 101.024 143.451 1.00 71.09  ? 597  SER A OG  1 
ATOM   4098 N  N   . MET A 1 619  ? 118.940 100.532 141.982 1.00 74.77  ? 598  MET A N   1 
ATOM   4099 C  CA  . MET A 1 619  ? 119.841 99.402  142.139 1.00 74.77  ? 598  MET A CA  1 
ATOM   4100 C  C   . MET A 1 619  ? 121.221 99.838  142.599 1.00 74.77  ? 598  MET A C   1 
ATOM   4101 O  O   . MET A 1 619  ? 121.888 99.090  143.326 1.00 74.77  ? 598  MET A O   1 
ATOM   4102 C  CB  . MET A 1 619  ? 119.929 98.606  140.846 1.00 74.77  ? 598  MET A CB  1 
ATOM   4103 C  CG  . MET A 1 619  ? 118.714 97.757  140.604 1.00 74.77  ? 598  MET A CG  1 
ATOM   4104 S  SD  . MET A 1 619  ? 118.499 96.642  142.006 1.00 74.77  ? 598  MET A SD  1 
ATOM   4105 C  CE  . MET A 1 619  ? 119.941 95.584  141.865 1.00 74.77  ? 598  MET A CE  1 
ATOM   4106 N  N   . ASP A 1 620  ? 121.659 101.039 142.210 1.00 67.87  ? 599  ASP A N   1 
ATOM   4107 C  CA  . ASP A 1 620  ? 122.910 101.557 142.753 1.00 67.87  ? 599  ASP A CA  1 
ATOM   4108 C  C   . ASP A 1 620  ? 122.816 101.809 144.246 1.00 67.87  ? 599  ASP A C   1 
ATOM   4109 O  O   . ASP A 1 620  ? 123.802 101.622 144.969 1.00 67.87  ? 599  ASP A O   1 
ATOM   4110 C  CB  . ASP A 1 620  ? 123.318 102.844 142.053 1.00 67.87  ? 599  ASP A CB  1 
ATOM   4111 C  CG  . ASP A 1 620  ? 124.577 103.430 142.635 1.00 67.87  ? 599  ASP A CG  1 
ATOM   4112 O  OD1 . ASP A 1 620  ? 125.661 102.870 142.396 1.00 67.87  ? 599  ASP A OD1 1 
ATOM   4113 O  OD2 . ASP A 1 620  ? 124.480 104.437 143.363 1.00 67.87  ? 599  ASP A OD2 1 
ATOM   4114 N  N   . LEU A 1 621  ? 121.644 102.200 144.733 1.00 78.17  ? 600  LEU A N   1 
ATOM   4115 C  CA  . LEU A 1 621  ? 121.556 102.526 146.146 1.00 78.17  ? 600  LEU A CA  1 
ATOM   4116 C  C   . LEU A 1 621  ? 121.344 101.271 146.987 1.00 78.17  ? 600  LEU A C   1 
ATOM   4117 O  O   . LEU A 1 621  ? 121.915 101.168 148.082 1.00 78.17  ? 600  LEU A O   1 
ATOM   4118 C  CB  . LEU A 1 621  ? 120.465 103.574 146.359 1.00 78.17  ? 600  LEU A CB  1 
ATOM   4119 C  CG  . LEU A 1 621  ? 120.475 104.444 147.620 1.00 78.17  ? 600  LEU A CG  1 
ATOM   4120 C  CD1 . LEU A 1 621  ? 119.732 103.837 148.758 1.00 78.17  ? 600  LEU A CD1 1 
ATOM   4121 C  CD2 . LEU A 1 621  ? 121.913 104.726 148.044 1.00 78.17  ? 600  LEU A CD2 1 
ATOM   4122 N  N   . TYR A 1 622  ? 120.554 100.305 146.481 1.00 66.63  ? 601  TYR A N   1 
ATOM   4123 C  CA  . TYR A 1 622  ? 120.463 98.985  147.112 1.00 66.63  ? 601  TYR A CA  1 
ATOM   4124 C  C   . TYR A 1 622  ? 121.822 98.319  147.210 1.00 66.63  ? 601  TYR A C   1 
ATOM   4125 O  O   . TYR A 1 622  ? 122.180 97.775  148.259 1.00 66.63  ? 601  TYR A O   1 
ATOM   4126 C  CB  . TYR A 1 622  ? 119.523 98.050  146.350 1.00 66.63  ? 601  TYR A CB  1 
ATOM   4127 C  CG  . TYR A 1 622  ? 118.063 98.130  146.697 1.00 66.63  ? 601  TYR A CG  1 
ATOM   4128 C  CD1 . TYR A 1 622  ? 117.625 98.833  147.801 1.00 66.63  ? 601  TYR A CD1 1 
ATOM   4129 C  CD2 . TYR A 1 622  ? 117.124 97.445  145.944 1.00 66.63  ? 601  TYR A CD2 1 
ATOM   4130 C  CE1 . TYR A 1 622  ? 116.277 98.889  148.125 1.00 66.63  ? 601  TYR A CE1 1 
ATOM   4131 C  CE2 . TYR A 1 622  ? 115.781 97.492  146.258 1.00 66.63  ? 601  TYR A CE2 1 
ATOM   4132 C  CZ  . TYR A 1 622  ? 115.363 98.211  147.347 1.00 66.63  ? 601  TYR A CZ  1 
ATOM   4133 O  OH  . TYR A 1 622  ? 114.021 98.247  147.642 1.00 66.63  ? 601  TYR A OH  1 
ATOM   4134 N  N   . ARG A 1 623  ? 122.586 98.330  146.118 1.00 76.94  ? 602  ARG A N   1 
ATOM   4135 C  CA  . ARG A 1 623  ? 123.886 97.675  146.159 1.00 76.94  ? 602  ARG A CA  1 
ATOM   4136 C  C   . ARG A 1 623  ? 124.871 98.465  147.011 1.00 76.94  ? 602  ARG A C   1 
ATOM   4137 O  O   . ARG A 1 623  ? 125.291 98.013  148.079 1.00 76.94  ? 602  ARG A O   1 
ATOM   4138 C  CB  . ARG A 1 623  ? 124.436 97.484  144.744 1.00 76.94  ? 602  ARG A CB  1 
ATOM   4139 C  CG  . ARG A 1 623  ? 123.724 96.455  143.871 1.00 76.94  ? 602  ARG A CG  1 
ATOM   4140 C  CD  . ARG A 1 623  ? 123.809 95.055  144.452 1.00 76.94  ? 602  ARG A CD  1 
ATOM   4141 N  NE  . ARG A 1 623  ? 122.592 94.686  145.169 1.00 76.94  ? 602  ARG A NE  1 
ATOM   4142 C  CZ  . ARG A 1 623  ? 122.512 93.698  146.052 1.00 76.94  ? 602  ARG A CZ  1 
ATOM   4143 N  NH1 . ARG A 1 623  ? 123.595 92.997  146.356 1.00 76.94  ? 602  ARG A NH1 1 
ATOM   4144 N  NH2 . ARG A 1 623  ? 121.356 93.427  146.643 1.00 76.94  ? 602  ARG A NH2 1 
ATOM   4145 N  N   . ARG A 1 624  ? 125.201 99.673  146.590 1.00 65.87  ? 603  ARG A N   1 
ATOM   4146 C  CA  . ARG A 1 624  ? 126.345 100.364 147.149 1.00 65.87  ? 603  ARG A CA  1 
ATOM   4147 C  C   . ARG A 1 624  ? 125.989 101.267 148.319 1.00 65.87  ? 603  ARG A C   1 
ATOM   4148 O  O   . ARG A 1 624  ? 126.813 102.101 148.703 1.00 65.87  ? 603  ARG A O   1 
ATOM   4149 C  CB  . ARG A 1 624  ? 127.039 101.158 146.048 1.00 65.87  ? 603  ARG A CB  1 
ATOM   4150 C  CG  . ARG A 1 624  ? 127.580 100.275 144.932 1.00 65.87  ? 603  ARG A CG  1 
ATOM   4151 C  CD  . ARG A 1 624  ? 128.214 101.112 143.843 1.00 65.87  ? 603  ARG A CD  1 
ATOM   4152 N  NE  . ARG A 1 624  ? 129.405 101.805 144.322 1.00 65.87  ? 603  ARG A NE  1 
ATOM   4153 C  CZ  . ARG A 1 624  ? 130.636 101.316 144.235 1.00 65.87  ? 603  ARG A CZ  1 
ATOM   4154 N  NH1 . ARG A 1 624  ? 130.837 100.138 143.671 1.00 65.87  ? 603  ARG A NH1 1 
ATOM   4155 N  NH2 . ARG A 1 624  ? 131.666 102.003 144.700 1.00 65.87  ? 603  ARG A NH2 1 
ATOM   4156 N  N   . GLU A 1 625  ? 124.789 101.132 148.893 1.00 103.08 ? 604  GLU A N   1 
ATOM   4157 C  CA  . GLU A 1 625  ? 124.516 101.815 150.156 1.00 103.08 ? 604  GLU A CA  1 
ATOM   4158 C  C   . GLU A 1 625  ? 125.179 101.119 151.336 1.00 103.08 ? 604  GLU A C   1 
ATOM   4159 O  O   . GLU A 1 625  ? 125.965 101.733 152.066 1.00 103.08 ? 604  GLU A O   1 
ATOM   4160 C  CB  . GLU A 1 625  ? 123.013 101.924 150.404 1.00 103.08 ? 604  GLU A CB  1 
ATOM   4161 C  CG  . GLU A 1 625  ? 122.654 102.352 151.833 1.00 103.08 ? 604  GLU A CG  1 
ATOM   4162 C  CD  . GLU A 1 625  ? 123.139 103.735 152.214 1.00 103.08 ? 604  GLU A CD  1 
ATOM   4163 O  OE1 . GLU A 1 625  ? 123.259 104.608 151.329 1.00 103.08 ? 604  GLU A OE1 1 
ATOM   4164 O  OE2 . GLU A 1 625  ? 123.407 103.948 153.416 1.00 103.08 ? 604  GLU A OE2 1 
ATOM   4165 N  N   . ASP A 1 626  ? 124.875 99.840  151.542 1.00 108.25 ? 605  ASP A N   1 
ATOM   4166 C  CA  . ASP A 1 626  ? 125.388 99.087  152.676 1.00 108.25 ? 605  ASP A CA  1 
ATOM   4167 C  C   . ASP A 1 626  ? 126.717 98.404  152.348 1.00 108.25 ? 605  ASP A C   1 
ATOM   4168 O  O   . ASP A 1 626  ? 127.077 97.413  152.993 1.00 108.25 ? 605  ASP A O   1 
ATOM   4169 C  CB  . ASP A 1 626  ? 124.335 98.071  153.128 1.00 108.25 ? 605  ASP A CB  1 
ATOM   4170 C  CG  . ASP A 1 626  ? 124.477 97.681  154.586 1.00 108.25 ? 605  ASP A CG  1 
ATOM   4171 O  OD1 . ASP A 1 626  ? 125.407 98.175  155.249 1.00 108.25 ? 605  ASP A OD1 1 
ATOM   4172 O  OD2 . ASP A 1 626  ? 123.649 96.888  155.077 1.00 108.25 ? 605  ASP A OD2 1 
ATOM   4173 N  N   . ARG A 1 627  ? 127.440 98.931  151.354 1.00 89.72  ? 606  ARG A N   1 
ATOM   4174 C  CA  . ARG A 1 627  ? 128.719 98.434  150.844 1.00 89.72  ? 606  ARG A CA  1 
ATOM   4175 C  C   . ARG A 1 627  ? 128.591 96.973  150.398 1.00 89.72  ? 606  ARG A C   1 
ATOM   4176 O  O   . ARG A 1 627  ? 129.170 96.056  150.983 1.00 89.72  ? 606  ARG A O   1 
ATOM   4177 C  CB  . ARG A 1 627  ? 129.850 98.634  151.862 1.00 89.72  ? 606  ARG A CB  1 
ATOM   4178 C  CG  . ARG A 1 627  ? 131.244 98.556  151.245 1.00 89.72  ? 606  ARG A CG  1 
ATOM   4179 C  CD  . ARG A 1 627  ? 132.345 98.925  152.224 1.00 89.72  ? 606  ARG A CD  1 
ATOM   4180 N  NE  . ARG A 1 627  ? 133.647 98.934  151.564 1.00 89.72  ? 606  ARG A NE  1 
ATOM   4181 C  CZ  . ARG A 1 627  ? 134.798 99.205  152.169 1.00 89.72  ? 606  ARG A CZ  1 
ATOM   4182 N  NH1 . ARG A 1 627  ? 135.930 99.190  151.479 1.00 89.72  ? 606  ARG A NH1 1 
ATOM   4183 N  NH2 . ARG A 1 627  ? 134.821 99.477  153.465 1.00 89.72  ? 606  ARG A NH2 1 
ATOM   4184 N  N   . ARG A 1 628  ? 127.795 96.818  149.332 1.00 77.75  ? 607  ARG A N   1 
ATOM   4185 C  CA  . ARG A 1 628  ? 127.401 95.581  148.615 1.00 77.75  ? 607  ARG A CA  1 
ATOM   4186 C  C   . ARG A 1 628  ? 127.399 94.284  149.412 1.00 77.75  ? 607  ARG A C   1 
ATOM   4187 O  O   . ARG A 1 628  ? 126.791 94.218  150.478 1.00 77.75  ? 607  ARG A O   1 
ATOM   4188 C  CB  . ARG A 1 628  ? 128.266 95.390  147.353 1.00 77.75  ? 607  ARG A CB  1 
ATOM   4189 C  CG  . ARG A 1 628  ? 129.603 94.669  147.475 1.00 77.75  ? 607  ARG A CG  1 
ATOM   4190 C  CD  . ARG A 1 628  ? 130.693 95.500  148.117 1.00 77.75  ? 607  ARG A CD  1 
ATOM   4191 N  NE  . ARG A 1 628  ? 130.783 96.856  147.582 1.00 77.75  ? 607  ARG A NE  1 
ATOM   4192 C  CZ  . ARG A 1 628  ? 131.473 97.207  146.509 1.00 77.75  ? 607  ARG A CZ  1 
ATOM   4193 N  NH1 . ARG A 1 628  ? 131.489 98.473  146.126 1.00 77.75  ? 607  ARG A NH1 1 
ATOM   4194 N  NH2 . ARG A 1 628  ? 132.165 96.302  145.835 1.00 77.75  ? 607  ARG A NH2 1 
ATOM   4195 N  N   . LYS A 1 750  ? 139.325 116.312 144.965 1.00 72.00  ? 729  LYS A N   1 
ATOM   4196 C  CA  . LYS A 1 750  ? 139.255 117.755 144.781 1.00 72.00  ? 729  LYS A CA  1 
ATOM   4197 C  C   . LYS A 1 750  ? 137.823 118.212 144.550 1.00 72.00  ? 729  LYS A C   1 
ATOM   4198 O  O   . LYS A 1 750  ? 137.559 119.036 143.678 1.00 72.00  ? 729  LYS A O   1 
ATOM   4199 C  CB  . LYS A 1 750  ? 140.139 118.188 143.611 1.00 30.00  ? 729  LYS A CB  1 
ATOM   4200 N  N   . TRP A 1 751  ? 136.896 117.656 145.326 1.00 101.95 ? 730  TRP A N   1 
ATOM   4201 C  CA  . TRP A 1 751  ? 135.526 118.150 145.379 1.00 101.95 ? 730  TRP A CA  1 
ATOM   4202 C  C   . TRP A 1 751  ? 135.376 119.232 146.436 1.00 101.95 ? 730  TRP A C   1 
ATOM   4203 O  O   . TRP A 1 751  ? 134.483 120.091 146.336 1.00 101.95 ? 730  TRP A O   1 
ATOM   4204 C  CB  . TRP A 1 751  ? 134.552 117.003 145.660 1.00 30.00  ? 730  TRP A CB  1 
ATOM   4205 N  N   . THR A 1 752  ? 136.238 119.165 147.459 1.00 90.78  ? 731  THR A N   1 
ATOM   4206 C  CA  . THR A 1 752  ? 136.352 120.236 148.441 1.00 90.78  ? 731  THR A CA  1 
ATOM   4207 C  C   . THR A 1 752  ? 136.728 121.543 147.768 1.00 90.78  ? 731  THR A C   1 
ATOM   4208 O  O   . THR A 1 752  ? 136.174 122.594 148.093 1.00 90.78  ? 731  THR A O   1 
ATOM   4209 C  CB  . THR A 1 752  ? 137.389 119.876 149.520 1.00 30.00  ? 731  THR A CB  1 
ATOM   4210 N  N   . LEU A 1 753  ? 137.634 121.492 146.800 1.00 83.79  ? 732  LEU A N   1 
ATOM   4211 C  CA  . LEU A 1 753  ? 137.924 122.668 145.996 1.00 83.79  ? 732  LEU A CA  1 
ATOM   4212 C  C   . LEU A 1 753  ? 136.947 122.864 144.843 1.00 83.79  ? 732  LEU A C   1 
ATOM   4213 O  O   . LEU A 1 753  ? 137.194 123.733 144.004 1.00 83.79  ? 732  LEU A O   1 
ATOM   4214 C  CB  . LEU A 1 753  ? 139.352 122.588 145.450 1.00 30.00  ? 732  LEU A CB  1 
ATOM   4215 N  N   . SER A 1 754  ? 135.866 122.082 144.760 1.00 99.88  ? 733  SER A N   1 
ATOM   4216 C  CA  . SER A 1 754  ? 134.818 122.286 143.760 1.00 99.88  ? 733  SER A CA  1 
ATOM   4217 C  C   . SER A 1 754  ? 133.618 123.035 144.327 1.00 99.88  ? 733  SER A C   1 
ATOM   4218 O  O   . SER A 1 754  ? 133.249 124.100 143.816 1.00 99.88  ? 733  SER A O   1 
ATOM   4219 C  CB  . SER A 1 754  ? 134.363 120.943 143.186 1.00 30.00  ? 733  SER A CB  1 
ATOM   4220 N  N   . SER A 1 755  ? 132.999 122.506 145.388 1.00 98.20  ? 734  SER A N   1 
ATOM   4221 C  CA  . SER A 1 755  ? 132.021 123.309 146.117 1.00 98.20  ? 734  SER A CA  1 
ATOM   4222 C  C   . SER A 1 755  ? 132.709 124.473 146.815 1.00 98.20  ? 734  SER A C   1 
ATOM   4223 O  O   . SER A 1 755  ? 132.176 125.588 146.874 1.00 98.20  ? 734  SER A O   1 
ATOM   4224 C  CB  . SER A 1 755  ? 131.265 122.453 147.135 1.00 30.00  ? 734  SER A CB  1 
ATOM   4225 N  N   . PHE A 1 756  ? 133.913 124.239 147.322 1.00 109.05 ? 735  PHE A N   1 
ATOM   4226 C  CA  . PHE A 1 756  ? 134.724 125.353 147.770 1.00 109.05 ? 735  PHE A CA  1 
ATOM   4227 C  C   . PHE A 1 756  ? 135.535 125.974 146.651 1.00 109.05 ? 735  PHE A C   1 
ATOM   4228 O  O   . PHE A 1 756  ? 136.365 126.826 146.947 1.00 109.05 ? 735  PHE A O   1 
ATOM   4229 C  CB  . PHE A 1 756  ? 135.658 124.902 148.894 1.00 30.00  ? 735  PHE A CB  1 
ATOM   4230 N  N   . ALA A 1 757  ? 135.362 125.545 145.392 1.00 107.37 ? 736  ALA A N   1 
ATOM   4231 C  CA  . ALA A 1 757  ? 135.693 126.444 144.292 1.00 107.37 ? 736  ALA A CA  1 
ATOM   4232 C  C   . ALA A 1 757  ? 134.570 127.431 144.061 1.00 107.37 ? 736  ALA A C   1 
ATOM   4233 O  O   . ALA A 1 757  ? 134.823 128.570 143.659 1.00 107.37 ? 736  ALA A O   1 
ATOM   4234 C  CB  . ALA A 1 757  ? 135.984 125.655 143.024 1.00 30.00  ? 736  ALA A CB  1 
ATOM   4235 N  N   . GLU A 1 758  ? 133.330 127.024 144.329 1.00 108.81 ? 737  GLU A N   1 
ATOM   4236 C  CA  . GLU A 1 758  ? 132.270 128.013 144.446 1.00 108.81 ? 737  GLU A CA  1 
ATOM   4237 C  C   . GLU A 1 758  ? 132.427 128.861 145.701 1.00 108.81 ? 737  GLU A C   1 
ATOM   4238 O  O   . GLU A 1 758  ? 131.826 129.936 145.782 1.00 108.81 ? 737  GLU A O   1 
ATOM   4239 C  CB  . GLU A 1 758  ? 130.902 127.328 144.446 1.00 30.00  ? 737  GLU A CB  1 
ATOM   4240 N  N   . LYS A 1 759  ? 133.206 128.398 146.683 1.00 99.64  ? 738  LYS A N   1 
ATOM   4241 C  CA  . LYS A 1 759  ? 133.667 129.255 147.769 1.00 99.64  ? 738  LYS A CA  1 
ATOM   4242 C  C   . LYS A 1 759  ? 135.103 129.766 147.522 1.00 99.64  ? 738  LYS A C   1 
ATOM   4243 O  O   . LYS A 1 759  ? 135.675 130.460 148.367 1.00 99.64  ? 738  LYS A O   1 
ATOM   4244 C  CB  . LYS A 1 759  ? 133.511 128.506 149.103 1.00 99.64  ? 738  LYS A CB  1 
ATOM   4245 C  CG  . LYS A 1 759  ? 133.553 129.337 150.379 1.00 99.64  ? 738  LYS A CG  1 
ATOM   4246 C  CD  . LYS A 1 759  ? 132.483 130.422 150.381 1.00 99.64  ? 738  LYS A CD  1 
ATOM   4247 C  CE  . LYS A 1 759  ? 131.090 129.853 150.542 1.00 99.64  ? 738  LYS A CE  1 
ATOM   4248 N  NZ  . LYS A 1 759  ? 130.087 130.944 150.680 1.00 99.64  ? 738  LYS A NZ  1 
ATOM   4249 N  N   . HIS A 1 760  ? 135.683 129.466 146.360 1.00 95.46  ? 739  HIS A N   1 
ATOM   4250 C  CA  . HIS A 1 760  ? 136.791 130.239 145.813 1.00 95.46  ? 739  HIS A CA  1 
ATOM   4251 C  C   . HIS A 1 760  ? 136.328 131.239 144.772 1.00 95.46  ? 739  HIS A C   1 
ATOM   4252 O  O   . HIS A 1 760  ? 137.156 131.945 144.192 1.00 95.46  ? 739  HIS A O   1 
ATOM   4253 C  CB  . HIS A 1 760  ? 137.863 129.346 145.174 1.00 95.46  ? 739  HIS A CB  1 
ATOM   4254 C  CG  . HIS A 1 760  ? 138.903 128.835 146.124 1.00 95.46  ? 739  HIS A CG  1 
ATOM   4255 N  ND1 . HIS A 1 760  ? 139.816 129.667 146.736 1.00 95.46  ? 739  HIS A ND1 1 
ATOM   4256 C  CD2 . HIS A 1 760  ? 139.250 127.576 146.480 1.00 95.46  ? 739  HIS A CD2 1 
ATOM   4257 C  CE1 . HIS A 1 760  ? 140.641 128.948 147.474 1.00 95.46  ? 739  HIS A CE1 1 
ATOM   4258 N  NE2 . HIS A 1 760  ? 140.316 127.675 147.340 1.00 95.46  ? 739  HIS A NE2 1 
ATOM   4259 N  N   . TYR A 1 761  ? 135.051 131.304 144.519 1.00 90.05  ? 740  TYR A N   1 
ATOM   4260 C  CA  . TYR A 1 761  ? 134.485 132.068 143.420 1.00 90.05  ? 740  TYR A CA  1 
ATOM   4261 C  C   . TYR A 1 761  ? 133.371 132.995 143.873 1.00 90.05  ? 740  TYR A C   1 
ATOM   4262 O  O   . TYR A 1 761  ? 133.264 134.115 143.373 1.00 90.05  ? 740  TYR A O   1 
ATOM   4263 C  CB  . TYR A 1 761  ? 133.999 131.058 142.365 1.00 90.05  ? 740  TYR A CB  1 
ATOM   4264 C  CG  . TYR A 1 761  ? 133.429 131.647 141.107 1.00 90.05  ? 740  TYR A CG  1 
ATOM   4265 C  CD1 . TYR A 1 761  ? 134.241 132.294 140.193 1.00 90.05  ? 740  TYR A CD1 1 
ATOM   4266 C  CD2 . TYR A 1 761  ? 132.089 131.501 140.807 1.00 90.05  ? 740  TYR A CD2 1 
ATOM   4267 C  CE1 . TYR A 1 761  ? 133.715 132.821 139.041 1.00 90.05  ? 740  TYR A CE1 1 
ATOM   4268 C  CE2 . TYR A 1 761  ? 131.554 132.020 139.662 1.00 90.05  ? 740  TYR A CE2 1 
ATOM   4269 C  CZ  . TYR A 1 761  ? 132.369 132.678 138.783 1.00 90.05  ? 740  TYR A CZ  1 
ATOM   4270 O  OH  . TYR A 1 761  ? 131.826 133.193 137.637 1.00 90.05  ? 740  TYR A OH  1 
ATOM   4271 N  N   . ALA A 1 762  ? 132.557 132.564 144.821 1.00 100.88 ? 741  ALA A N   1 
ATOM   4272 C  CA  . ALA A 1 762  ? 131.547 133.414 145.438 1.00 100.88 ? 741  ALA A CA  1 
ATOM   4273 C  C   . ALA A 1 762  ? 132.153 134.450 146.396 1.00 100.88 ? 741  ALA A C   1 
ATOM   4274 O  O   . ALA A 1 762  ? 131.599 135.548 146.495 1.00 100.88 ? 741  ALA A O   1 
ATOM   4275 C  CB  . ALA A 1 762  ? 130.480 132.560 146.133 1.00 100.88 ? 741  ALA A CB  1 
ATOM   4276 N  N   . PRO A 1 763  ? 133.254 134.187 147.121 1.00 100.28 ? 742  PRO A N   1 
ATOM   4277 C  CA  . PRO A 1 763  ? 134.017 135.320 147.668 1.00 100.28 ? 742  PRO A CA  1 
ATOM   4278 C  C   . PRO A 1 763  ? 134.689 136.184 146.616 1.00 100.28 ? 742  PRO A C   1 
ATOM   4279 O  O   . PRO A 1 763  ? 135.061 137.320 146.935 1.00 100.28 ? 742  PRO A O   1 
ATOM   4280 C  CB  . PRO A 1 763  ? 135.049 134.648 148.577 1.00 100.28 ? 742  PRO A CB  1 
ATOM   4281 C  CG  . PRO A 1 763  ? 134.381 133.443 149.029 1.00 100.28 ? 742  PRO A CG  1 
ATOM   4282 C  CD  . PRO A 1 763  ? 133.597 132.955 147.859 1.00 100.28 ? 742  PRO A CD  1 
ATOM   4283 N  N   . PHE A 1 764  ? 134.879 135.698 145.387 1.00 104.62 ? 743  PHE A N   1 
ATOM   4284 C  CA  . PHE A 1 764  ? 135.311 136.599 144.325 1.00 104.62 ? 743  PHE A CA  1 
ATOM   4285 C  C   . PHE A 1 764  ? 134.134 137.345 143.723 1.00 104.62 ? 743  PHE A C   1 
ATOM   4286 O  O   . PHE A 1 764  ? 134.304 138.446 143.191 1.00 104.62 ? 743  PHE A O   1 
ATOM   4287 C  CB  . PHE A 1 764  ? 136.061 135.831 143.244 1.00 104.62 ? 743  PHE A CB  1 
ATOM   4288 C  CG  . PHE A 1 764  ? 136.616 136.704 142.161 1.00 104.62 ? 743  PHE A CG  1 
ATOM   4289 C  CD1 . PHE A 1 764  ? 137.704 137.527 142.410 1.00 104.62 ? 743  PHE A CD1 1 
ATOM   4290 C  CD2 . PHE A 1 764  ? 136.058 136.694 140.893 1.00 104.62 ? 743  PHE A CD2 1 
ATOM   4291 C  CE1 . PHE A 1 764  ? 138.223 138.324 141.417 1.00 104.62 ? 743  PHE A CE1 1 
ATOM   4292 C  CE2 . PHE A 1 764  ? 136.576 137.488 139.894 1.00 104.62 ? 743  PHE A CE2 1 
ATOM   4293 C  CZ  . PHE A 1 764  ? 137.660 138.304 140.156 1.00 104.62 ? 743  PHE A CZ  1 
ATOM   4294 N  N   . LEU A 1 765  ? 132.935 136.771 143.826 1.00 89.68  ? 744  LEU A N   1 
ATOM   4295 C  CA  . LEU A 1 765  ? 131.700 137.497 143.557 1.00 89.68  ? 744  LEU A CA  1 
ATOM   4296 C  C   . LEU A 1 765  ? 131.450 138.596 144.583 1.00 89.68  ? 744  LEU A C   1 
ATOM   4297 O  O   . LEU A 1 765  ? 130.696 139.531 144.304 1.00 89.68  ? 744  LEU A O   1 
ATOM   4298 C  CB  . LEU A 1 765  ? 130.537 136.493 143.526 1.00 89.68  ? 744  LEU A CB  1 
ATOM   4299 C  CG  . LEU A 1 765  ? 129.098 136.773 143.077 1.00 89.68  ? 744  LEU A CG  1 
ATOM   4300 C  CD1 . LEU A 1 765  ? 128.202 137.393 144.152 1.00 89.68  ? 744  LEU A CD1 1 
ATOM   4301 C  CD2 . LEU A 1 765  ? 129.134 137.643 141.848 1.00 89.68  ? 744  LEU A CD2 1 
ATOM   4302 N  N   . LEU A 1 766  ? 132.094 138.520 145.745 1.00 86.47  ? 745  LEU A N   1 
ATOM   4303 C  CA  . LEU A 1 766  ? 131.885 139.442 146.856 1.00 86.47  ? 745  LEU A CA  1 
ATOM   4304 C  C   . LEU A 1 766  ? 132.912 140.564 146.882 1.00 86.47  ? 745  LEU A C   1 
ATOM   4305 O  O   . LEU A 1 766  ? 133.400 140.940 147.949 1.00 86.47  ? 745  LEU A O   1 
ATOM   4306 C  CB  . LEU A 1 766  ? 131.878 138.688 148.183 1.00 86.47  ? 745  LEU A CB  1 
ATOM   4307 C  CG  . LEU A 1 766  ? 130.633 137.879 148.559 1.00 86.47  ? 745  LEU A CG  1 
ATOM   4308 C  CD1 . LEU A 1 766  ? 130.894 137.000 149.763 1.00 86.47  ? 745  LEU A CD1 1 
ATOM   4309 C  CD2 . LEU A 1 766  ? 129.484 138.816 148.854 1.00 86.47  ? 745  LEU A CD2 1 
ATOM   4310 N  N   . LYS A 1 767  ? 133.300 141.080 145.727 1.00 83.32  ? 746  LYS A N   1 
ATOM   4311 C  CA  . LYS A 1 767  ? 133.809 142.441 145.730 1.00 83.32  ? 746  LYS A CA  1 
ATOM   4312 C  C   . LYS A 1 767  ? 132.557 143.308 145.688 1.00 83.32  ? 746  LYS A C   1 
ATOM   4313 O  O   . LYS A 1 767  ? 131.797 143.240 144.715 1.00 83.32  ? 746  LYS A O   1 
ATOM   4314 C  CB  . LYS A 1 767  ? 134.744 142.700 144.553 1.00 83.32  ? 746  LYS A CB  1 
ATOM   4315 C  CG  . LYS A 1 767  ? 135.473 144.017 144.626 1.00 83.32  ? 746  LYS A CG  1 
ATOM   4316 C  CD  . LYS A 1 767  ? 136.355 144.057 145.863 1.00 83.32  ? 746  LYS A CD  1 
ATOM   4317 C  CE  . LYS A 1 767  ? 137.503 143.068 145.777 1.00 83.32  ? 746  LYS A CE  1 
ATOM   4318 N  NZ  . LYS A 1 767  ? 138.365 143.102 146.994 1.00 83.32  ? 746  LYS A NZ  1 
ATOM   4319 N  N   . PRO A 1 768  ? 132.300 144.118 146.721 1.00 101.47 ? 747  PRO A N   1 
ATOM   4320 C  CA  . PRO A 1 768  ? 130.909 144.406 147.095 1.00 101.47 ? 747  PRO A CA  1 
ATOM   4321 C  C   . PRO A 1 768  ? 130.178 145.375 146.190 1.00 101.47 ? 747  PRO A C   1 
ATOM   4322 O  O   . PRO A 1 768  ? 129.017 145.149 145.839 1.00 101.47 ? 747  PRO A O   1 
ATOM   4323 C  CB  . PRO A 1 768  ? 131.054 145.023 148.494 1.00 101.47 ? 747  PRO A CB  1 
ATOM   4324 C  CG  . PRO A 1 768  ? 132.442 144.692 148.946 1.00 101.47 ? 747  PRO A CG  1 
ATOM   4325 C  CD  . PRO A 1 768  ? 133.245 144.685 147.693 1.00 101.47 ? 747  PRO A CD  1 
ATOM   4326 N  N   . LYS A 1 769  ? 130.839 146.460 145.810 1.00 87.20  ? 748  LYS A N   1 
ATOM   4327 C  CA  . LYS A 1 769  ? 130.204 147.485 144.996 1.00 87.20  ? 748  LYS A CA  1 
ATOM   4328 C  C   . LYS A 1 769  ? 131.170 147.969 143.929 1.00 87.20  ? 748  LYS A C   1 
ATOM   4329 O  O   . LYS A 1 769  ? 131.300 149.169 143.673 1.00 87.20  ? 748  LYS A O   1 
ATOM   4330 C  CB  . LYS A 1 769  ? 129.705 148.663 145.841 1.00 87.20  ? 748  LYS A CB  1 
ATOM   4331 C  CG  . LYS A 1 769  ? 128.332 148.499 146.519 1.00 87.20  ? 748  LYS A CG  1 
ATOM   4332 C  CD  . LYS A 1 769  ? 128.420 147.799 147.857 1.00 87.20  ? 748  LYS A CD  1 
ATOM   4333 C  CE  . LYS A 1 769  ? 127.090 147.770 148.566 1.00 87.20  ? 748  LYS A CE  1 
ATOM   4334 N  NZ  . LYS A 1 769  ? 127.189 146.993 149.828 1.00 87.20  ? 748  LYS A NZ  1 
ATOM   4335 N  N   . ALA A 1 770  ? 131.873 147.040 143.299 1.00 88.10  ? 749  ALA A N   1 
ATOM   4336 C  CA  . ALA A 1 770  ? 132.741 147.381 142.187 1.00 88.10  ? 749  ALA A CA  1 
ATOM   4337 C  C   . ALA A 1 770  ? 132.542 146.441 141.012 1.00 88.10  ? 749  ALA A C   1 
ATOM   4338 O  O   . ALA A 1 770  ? 133.312 146.506 140.049 1.00 88.10  ? 749  ALA A O   1 
ATOM   4339 C  CB  . ALA A 1 770  ? 134.212 147.380 142.612 1.00 88.10  ? 749  ALA A CB  1 
ATOM   4340 N  N   . LYS A 1 771  ? 131.528 145.577 141.055 1.00 71.18  ? 750  LYS A N   1 
ATOM   4341 C  CA  . LYS A 1 771  ? 131.245 144.678 139.949 1.00 71.18  ? 750  LYS A CA  1 
ATOM   4342 C  C   . LYS A 1 771  ? 130.362 145.317 138.894 1.00 71.18  ? 750  LYS A C   1 
ATOM   4343 O  O   . LYS A 1 771  ? 129.764 144.604 138.083 1.00 71.18  ? 750  LYS A O   1 
ATOM   4344 C  CB  . LYS A 1 771  ? 130.613 143.382 140.457 1.00 71.18  ? 750  LYS A CB  1 
ATOM   4345 C  CG  . LYS A 1 771  ? 131.487 142.550 141.404 1.00 71.18  ? 750  LYS A CG  1 
ATOM   4346 C  CD  . LYS A 1 771  ? 132.668 141.855 140.713 1.00 71.18  ? 750  LYS A CD  1 
ATOM   4347 C  CE  . LYS A 1 771  ? 134.007 142.552 140.970 1.00 71.18  ? 750  LYS A CE  1 
ATOM   4348 N  NZ  . LYS A 1 771  ? 135.163 141.823 140.400 1.00 71.18  ? 750  LYS A NZ  1 
ATOM   4349 N  N   . VAL A 1 772  ? 130.273 146.649 138.883 1.00 87.58  ? 751  VAL A N   1 
ATOM   4350 C  CA  . VAL A 1 772  ? 129.713 147.368 137.749 1.00 87.58  ? 751  VAL A CA  1 
ATOM   4351 C  C   . VAL A 1 772  ? 130.626 147.218 136.529 1.00 87.58  ? 751  VAL A C   1 
ATOM   4352 O  O   . VAL A 1 772  ? 130.150 147.250 135.383 1.00 87.58  ? 751  VAL A O   1 
ATOM   4353 C  CB  . VAL A 1 772  ? 129.476 148.833 138.178 1.00 87.58  ? 751  VAL A CB  1 
ATOM   4354 C  CG1 . VAL A 1 772  ? 128.859 149.664 137.080 1.00 87.58  ? 751  VAL A CG1 1 
ATOM   4355 C  CG2 . VAL A 1 772  ? 128.575 148.881 139.395 1.00 87.58  ? 751  VAL A CG2 1 
ATOM   4356 N  N   . VAL A 1 773  ? 131.928 147.003 136.769 1.00 96.98  ? 752  VAL A N   1 
ATOM   4357 C  CA  . VAL A 1 773  ? 132.918 146.666 135.745 1.00 96.98  ? 752  VAL A CA  1 
ATOM   4358 C  C   . VAL A 1 773  ? 132.498 145.463 134.905 1.00 96.98  ? 752  VAL A C   1 
ATOM   4359 O  O   . VAL A 1 773  ? 132.689 145.462 133.682 1.00 96.98  ? 752  VAL A O   1 
ATOM   4360 C  CB  . VAL A 1 773  ? 134.276 146.439 136.438 1.00 96.98  ? 752  VAL A CB  1 
ATOM   4361 C  CG1 . VAL A 1 773  ? 135.288 145.822 135.508 1.00 96.98  ? 752  VAL A CG1 1 
ATOM   4362 C  CG2 . VAL A 1 773  ? 134.803 147.757 136.965 1.00 96.98  ? 752  VAL A CG2 1 
ATOM   4363 N  N   . VAL A 1 774  ? 131.897 144.442 135.534 1.00 82.52  ? 753  VAL A N   1 
ATOM   4364 C  CA  . VAL A 1 774  ? 131.380 143.279 134.809 1.00 82.52  ? 753  VAL A CA  1 
ATOM   4365 C  C   . VAL A 1 774  ? 130.291 143.692 133.830 1.00 82.52  ? 753  VAL A C   1 
ATOM   4366 O  O   . VAL A 1 774  ? 130.269 143.247 132.670 1.00 82.52  ? 753  VAL A O   1 
ATOM   4367 C  CB  . VAL A 1 774  ? 130.869 142.224 135.805 1.00 82.52  ? 753  VAL A CB  1 
ATOM   4368 C  CG1 . VAL A 1 774  ? 130.200 141.076 135.081 1.00 82.52  ? 753  VAL A CG1 1 
ATOM   4369 C  CG2 . VAL A 1 774  ? 132.017 141.714 136.645 1.00 82.52  ? 753  VAL A CG2 1 
ATOM   4370 N  N   . ILE A 1 775  ? 129.399 144.585 134.272 1.00 84.31  ? 754  ILE A N   1 
ATOM   4371 C  CA  . ILE A 1 775  ? 128.365 145.117 133.395 1.00 84.31  ? 754  ILE A CA  1 
ATOM   4372 C  C   . ILE A 1 775  ? 128.993 145.904 132.252 1.00 84.31  ? 754  ILE A C   1 
ATOM   4373 O  O   . ILE A 1 775  ? 128.501 145.857 131.121 1.00 84.31  ? 754  ILE A O   1 
ATOM   4374 C  CB  . ILE A 1 775  ? 127.370 145.973 134.201 1.00 84.31  ? 754  ILE A CB  1 
ATOM   4375 C  CG1 . ILE A 1 775  ? 126.851 145.186 135.398 1.00 84.31  ? 754  ILE A CG1 1 
ATOM   4376 C  CG2 . ILE A 1 775  ? 126.179 146.342 133.351 1.00 84.31  ? 754  ILE A CG2 1 
ATOM   4377 C  CD1 . ILE A 1 775  ? 126.078 146.028 136.393 1.00 84.31  ? 754  ILE A CD1 1 
ATOM   4378 N  N   . PHE A 1 776  ? 130.126 146.574 132.499 1.00 99.77  ? 755  PHE A N   1 
ATOM   4379 C  CA  . PHE A 1 776  ? 130.842 147.217 131.397 1.00 99.77  ? 755  PHE A CA  1 
ATOM   4380 C  C   . PHE A 1 776  ? 131.478 146.210 130.447 1.00 99.77  ? 755  PHE A C   1 
ATOM   4381 O  O   . PHE A 1 776  ? 131.609 146.500 129.249 1.00 99.77  ? 755  PHE A O   1 
ATOM   4382 C  CB  . PHE A 1 776  ? 131.915 148.164 131.916 1.00 99.77  ? 755  PHE A CB  1 
ATOM   4383 C  CG  . PHE A 1 776  ? 131.376 149.425 132.502 1.00 99.77  ? 755  PHE A CG  1 
ATOM   4384 C  CD1 . PHE A 1 776  ? 130.860 150.411 131.681 1.00 99.77  ? 755  PHE A CD1 1 
ATOM   4385 C  CD2 . PHE A 1 776  ? 131.446 149.652 133.859 1.00 99.77  ? 755  PHE A CD2 1 
ATOM   4386 C  CE1 . PHE A 1 776  ? 130.379 151.581 132.212 1.00 99.77  ? 755  PHE A CE1 1 
ATOM   4387 C  CE2 . PHE A 1 776  ? 130.978 150.820 134.397 1.00 99.77  ? 755  PHE A CE2 1 
ATOM   4388 C  CZ  . PHE A 1 776  ? 130.440 151.789 133.574 1.00 99.77  ? 755  PHE A CZ  1 
ATOM   4389 N  N   . LEU A 1 777  ? 131.894 145.045 130.951 1.00 96.48  ? 756  LEU A N   1 
ATOM   4390 C  CA  . LEU A 1 777  ? 132.422 144.007 130.072 1.00 96.48  ? 756  LEU A CA  1 
ATOM   4391 C  C   . LEU A 1 777  ? 131.345 143.484 129.136 1.00 96.48  ? 756  LEU A C   1 
ATOM   4392 O  O   . LEU A 1 777  ? 131.594 143.293 127.936 1.00 96.48  ? 756  LEU A O   1 
ATOM   4393 C  CB  . LEU A 1 777  ? 133.015 142.861 130.889 1.00 96.48  ? 756  LEU A CB  1 
ATOM   4394 C  CG  . LEU A 1 777  ? 134.352 143.094 131.587 1.00 96.48  ? 756  LEU A CG  1 
ATOM   4395 C  CD1 . LEU A 1 777  ? 134.683 141.958 132.538 1.00 96.48  ? 756  LEU A CD1 1 
ATOM   4396 C  CD2 . LEU A 1 777  ? 135.436 143.219 130.541 1.00 96.48  ? 756  LEU A CD2 1 
ATOM   4397 N  N   . PHE A 1 778  ? 130.131 143.286 129.648 1.00 82.10  ? 757  PHE A N   1 
ATOM   4398 C  CA  . PHE A 1 778  ? 129.080 142.785 128.773 1.00 82.10  ? 757  PHE A CA  1 
ATOM   4399 C  C   . PHE A 1 778  ? 128.437 143.883 127.939 1.00 82.10  ? 757  PHE A C   1 
ATOM   4400 O  O   . PHE A 1 778  ? 127.820 143.581 126.912 1.00 82.10  ? 757  PHE A O   1 
ATOM   4401 C  CB  . PHE A 1 778  ? 128.049 142.020 129.593 1.00 82.10  ? 757  PHE A CB  1 
ATOM   4402 C  CG  . PHE A 1 778  ? 128.569 140.714 130.121 1.00 82.10  ? 757  PHE A CG  1 
ATOM   4403 C  CD1 . PHE A 1 778  ? 129.659 140.098 129.523 1.00 82.10  ? 757  PHE A CD1 1 
ATOM   4404 C  CD2 . PHE A 1 778  ? 128.012 140.126 131.234 1.00 82.10  ? 757  PHE A CD2 1 
ATOM   4405 C  CE1 . PHE A 1 778  ? 130.161 138.908 130.012 1.00 82.10  ? 757  PHE A CE1 1 
ATOM   4406 C  CE2 . PHE A 1 778  ? 128.515 138.935 131.726 1.00 82.10  ? 757  PHE A CE2 1 
ATOM   4407 C  CZ  . PHE A 1 778  ? 129.583 138.326 131.113 1.00 82.10  ? 757  PHE A CZ  1 
ATOM   4408 N  N   . LEU A 1 779  ? 128.588 145.148 128.335 1.00 89.22  ? 758  LEU A N   1 
ATOM   4409 C  CA  . LEU A 1 779  ? 128.262 146.237 127.421 1.00 89.22  ? 758  LEU A CA  1 
ATOM   4410 C  C   . LEU A 1 779  ? 129.234 146.273 126.251 1.00 89.22  ? 758  LEU A C   1 
ATOM   4411 O  O   . LEU A 1 779  ? 128.825 146.512 125.108 1.00 89.22  ? 758  LEU A O   1 
ATOM   4412 C  CB  . LEU A 1 779  ? 128.263 147.577 128.151 1.00 89.22  ? 758  LEU A CB  1 
ATOM   4413 C  CG  . LEU A 1 779  ? 127.084 147.904 129.063 1.00 89.22  ? 758  LEU A CG  1 
ATOM   4414 C  CD1 . LEU A 1 779  ? 127.368 149.185 129.801 1.00 89.22  ? 758  LEU A CD1 1 
ATOM   4415 C  CD2 . LEU A 1 779  ? 125.791 148.014 128.277 1.00 89.22  ? 758  LEU A CD2 1 
ATOM   4416 N  N   . GLY A 1 780  ? 130.522 146.045 126.522 1.00 89.68  ? 759  GLY A N   1 
ATOM   4417 C  CA  . GLY A 1 780  ? 131.500 146.018 125.446 1.00 89.68  ? 759  GLY A CA  1 
ATOM   4418 C  C   . GLY A 1 780  ? 131.272 144.865 124.487 1.00 89.68  ? 759  GLY A C   1 
ATOM   4419 O  O   . GLY A 1 780  ? 131.256 145.050 123.262 1.00 89.68  ? 759  GLY A O   1 
ATOM   4420 N  N   . LEU A 1 781  ? 131.047 143.664 125.032 1.00 83.36  ? 760  LEU A N   1 
ATOM   4421 C  CA  . LEU A 1 781  ? 130.762 142.508 124.186 1.00 83.36  ? 760  LEU A CA  1 
ATOM   4422 C  C   . LEU A 1 781  ? 129.426 142.655 123.470 1.00 83.36  ? 760  LEU A C   1 
ATOM   4423 O  O   . LEU A 1 781  ? 129.261 142.144 122.355 1.00 83.36  ? 760  LEU A O   1 
ATOM   4424 C  CB  . LEU A 1 781  ? 130.798 141.239 125.037 1.00 83.36  ? 760  LEU A CB  1 
ATOM   4425 C  CG  . LEU A 1 781  ? 130.863 139.858 124.397 1.00 83.36  ? 760  LEU A CG  1 
ATOM   4426 C  CD1 . LEU A 1 781  ? 131.691 138.966 125.284 1.00 83.36  ? 760  LEU A CD1 1 
ATOM   4427 C  CD2 . LEU A 1 781  ? 129.499 139.260 124.266 1.00 83.36  ? 760  LEU A CD2 1 
ATOM   4428 N  N   . LEU A 1 782  ? 128.482 143.379 124.071 1.00 78.88  ? 761  LEU A N   1 
ATOM   4429 C  CA  . LEU A 1 782  ? 127.198 143.583 123.416 1.00 78.88  ? 761  LEU A CA  1 
ATOM   4430 C  C   . LEU A 1 782  ? 127.320 144.562 122.251 1.00 78.88  ? 761  LEU A C   1 
ATOM   4431 O  O   . LEU A 1 782  ? 126.691 144.366 121.202 1.00 78.88  ? 761  LEU A O   1 
ATOM   4432 C  CB  . LEU A 1 782  ? 126.168 144.048 124.447 1.00 78.88  ? 761  LEU A CB  1 
ATOM   4433 C  CG  . LEU A 1 782  ? 124.671 144.041 124.112 1.00 78.88  ? 761  LEU A CG  1 
ATOM   4434 C  CD1 . LEU A 1 782  ? 124.171 145.313 123.425 1.00 78.88  ? 761  LEU A CD1 1 
ATOM   4435 C  CD2 . LEU A 1 782  ? 124.363 142.834 123.250 1.00 78.88  ? 761  LEU A CD2 1 
ATOM   4436 N  N   . GLY A 1 783  ? 128.124 145.617 122.408 1.00 82.61  ? 762  GLY A N   1 
ATOM   4437 C  CA  . GLY A 1 783  ? 128.324 146.545 121.306 1.00 82.61  ? 762  GLY A CA  1 
ATOM   4438 C  C   . GLY A 1 783  ? 129.086 145.921 120.154 1.00 82.61  ? 762  GLY A C   1 
ATOM   4439 O  O   . GLY A 1 783  ? 128.741 146.136 118.981 1.00 82.61  ? 762  GLY A O   1 
ATOM   4440 N  N   . VAL A 1 784  ? 130.119 145.126 120.476 1.00 75.86  ? 763  VAL A N   1 
ATOM   4441 C  CA  . VAL A 1 784  ? 130.848 144.353 119.468 1.00 75.86  ? 763  VAL A CA  1 
ATOM   4442 C  C   . VAL A 1 784  ? 129.909 143.401 118.732 1.00 75.86  ? 763  VAL A C   1 
ATOM   4443 O  O   . VAL A 1 784  ? 129.978 143.253 117.501 1.00 75.86  ? 763  VAL A O   1 
ATOM   4444 C  CB  . VAL A 1 784  ? 132.021 143.610 120.137 1.00 75.86  ? 763  VAL A CB  1 
ATOM   4445 C  CG1 . VAL A 1 784  ? 132.633 142.590 119.215 1.00 75.86  ? 763  VAL A CG1 1 
ATOM   4446 C  CG2 . VAL A 1 784  ? 133.082 144.600 120.557 1.00 75.86  ? 763  VAL A CG2 1 
ATOM   4447 N  N   . SER A 1 785  ? 128.969 142.803 119.458 1.00 75.48  ? 764  SER A N   1 
ATOM   4448 C  CA  . SER A 1 785  ? 128.026 141.912 118.805 1.00 75.48  ? 764  SER A CA  1 
ATOM   4449 C  C   . SER A 1 785  ? 126.998 142.658 117.961 1.00 75.48  ? 764  SER A C   1 
ATOM   4450 O  O   . SER A 1 785  ? 126.516 142.101 116.972 1.00 75.48  ? 764  SER A O   1 
ATOM   4451 C  CB  . SER A 1 785  ? 127.323 141.074 119.846 1.00 75.48  ? 764  SER A CB  1 
ATOM   4452 O  OG  . SER A 1 785  ? 126.530 141.901 120.663 1.00 75.48  ? 764  SER A OG  1 
ATOM   4453 N  N   . LEU A 1 786  ? 126.642 143.900 118.307 1.00 62.73  ? 765  LEU A N   1 
ATOM   4454 C  CA  . LEU A 1 786  ? 125.675 144.606 117.460 1.00 62.73  ? 765  LEU A CA  1 
ATOM   4455 C  C   . LEU A 1 786  ? 126.293 145.146 116.177 1.00 62.73  ? 765  LEU A C   1 
ATOM   4456 O  O   . LEU A 1 786  ? 125.640 145.133 115.119 1.00 62.73  ? 765  LEU A O   1 
ATOM   4457 C  CB  . LEU A 1 786  ? 124.984 145.726 118.226 1.00 62.73  ? 765  LEU A CB  1 
ATOM   4458 C  CG  . LEU A 1 786  ? 123.605 145.306 118.731 1.00 62.73  ? 765  LEU A CG  1 
ATOM   4459 C  CD1 . LEU A 1 786  ? 123.683 144.317 119.867 1.00 62.73  ? 765  LEU A CD1 1 
ATOM   4460 C  CD2 . LEU A 1 786  ? 122.783 146.531 119.122 1.00 62.73  ? 765  LEU A CD2 1 
ATOM   4461 N  N   . TYR A 1 787  ? 127.544 145.613 116.229 1.00 69.02  ? 766  TYR A N   1 
ATOM   4462 C  CA  . TYR A 1 787  ? 128.238 145.858 114.969 1.00 69.02  ? 766  TYR A CA  1 
ATOM   4463 C  C   . TYR A 1 787  ? 128.412 144.566 114.172 1.00 69.02  ? 766  TYR A C   1 
ATOM   4464 O  O   . TYR A 1 787  ? 128.357 144.575 112.928 1.00 69.02  ? 766  TYR A O   1 
ATOM   4465 C  CB  . TYR A 1 787  ? 129.580 146.522 115.223 1.00 69.02  ? 766  TYR A CB  1 
ATOM   4466 C  CG  . TYR A 1 787  ? 130.329 146.797 113.955 1.00 69.02  ? 766  TYR A CG  1 
ATOM   4467 C  CD1 . TYR A 1 787  ? 129.923 147.805 113.092 1.00 69.02  ? 766  TYR A CD1 1 
ATOM   4468 C  CD2 . TYR A 1 787  ? 131.444 146.048 113.615 1.00 69.02  ? 766  TYR A CD2 1 
ATOM   4469 C  CE1 . TYR A 1 787  ? 130.607 148.054 111.926 1.00 69.02  ? 766  TYR A CE1 1 
ATOM   4470 C  CE2 . TYR A 1 787  ? 132.137 146.293 112.459 1.00 69.02  ? 766  TYR A CE2 1 
ATOM   4471 C  CZ  . TYR A 1 787  ? 131.714 147.291 111.613 1.00 69.02  ? 766  TYR A CZ  1 
ATOM   4472 O  OH  . TYR A 1 787  ? 132.412 147.526 110.451 1.00 69.02  ? 766  TYR A OH  1 
ATOM   4473 N  N   . GLY A 1 788  ? 128.572 143.442 114.871 1.00 60.69  ? 767  GLY A N   1 
ATOM   4474 C  CA  . GLY A 1 788  ? 128.465 142.154 114.215 1.00 60.69  ? 767  GLY A CA  1 
ATOM   4475 C  C   . GLY A 1 788  ? 127.128 141.904 113.546 1.00 60.69  ? 767  GLY A C   1 
ATOM   4476 O  O   . GLY A 1 788  ? 127.078 141.267 112.494 1.00 60.69  ? 767  GLY A O   1 
ATOM   4477 N  N   . THR A 1 789  ? 126.033 142.400 114.132 1.00 66.84  ? 768  THR A N   1 
ATOM   4478 C  CA  . THR A 1 789  ? 124.742 142.252 113.470 1.00 66.84  ? 768  THR A CA  1 
ATOM   4479 C  C   . THR A 1 789  ? 124.664 143.092 112.208 1.00 66.84  ? 768  THR A C   1 
ATOM   4480 O  O   . THR A 1 789  ? 124.017 142.677 111.239 1.00 66.84  ? 768  THR A O   1 
ATOM   4481 C  CB  . THR A 1 789  ? 123.575 142.627 114.386 1.00 66.84  ? 768  THR A CB  1 
ATOM   4482 O  OG1 . THR A 1 789  ? 123.703 143.991 114.796 1.00 66.84  ? 768  THR A OG1 1 
ATOM   4483 C  CG2 . THR A 1 789  ? 123.506 141.732 115.599 1.00 66.84  ? 768  THR A CG2 1 
ATOM   4484 N  N   . THR A 1 790  ? 125.311 144.260 112.177 1.00 63.51  ? 769  THR A N   1 
ATOM   4485 C  CA  . THR A 1 790  ? 125.322 144.989 110.911 1.00 63.51  ? 769  THR A CA  1 
ATOM   4486 C  C   . THR A 1 790  ? 126.491 144.610 110.006 1.00 63.51  ? 769  THR A C   1 
ATOM   4487 O  O   . THR A 1 790  ? 126.746 145.315 109.025 1.00 63.51  ? 769  THR A O   1 
ATOM   4488 C  CB  . THR A 1 790  ? 125.291 146.506 111.123 1.00 63.51  ? 769  THR A CB  1 
ATOM   4489 O  OG1 . THR A 1 790  ? 125.189 147.145 109.847 1.00 63.51  ? 769  THR A OG1 1 
ATOM   4490 C  CG2 . THR A 1 790  ? 126.524 147.006 111.817 1.00 63.51  ? 769  THR A CG2 1 
ATOM   4491 N  N   . ARG A 1 791  ? 127.188 143.506 110.283 1.00 58.62  ? 770  ARG A N   1 
ATOM   4492 C  CA  . ARG A 1 791  ? 127.998 142.905 109.223 1.00 58.62  ? 770  ARG A CA  1 
ATOM   4493 C  C   . ARG A 1 791  ? 127.618 141.475 108.850 1.00 58.62  ? 770  ARG A C   1 
ATOM   4494 O  O   . ARG A 1 791  ? 128.503 140.629 108.702 1.00 58.62  ? 770  ARG A O   1 
ATOM   4495 C  CB  . ARG A 1 791  ? 129.475 142.900 109.593 1.00 58.62  ? 770  ARG A CB  1 
ATOM   4496 C  CG  . ARG A 1 791  ? 130.171 144.227 109.514 1.00 58.62  ? 770  ARG A CG  1 
ATOM   4497 C  CD  . ARG A 1 791  ? 131.648 144.030 109.778 1.00 58.62  ? 770  ARG A CD  1 
ATOM   4498 N  NE  . ARG A 1 791  ? 132.314 143.266 108.724 1.00 58.62  ? 770  ARG A NE  1 
ATOM   4499 C  CZ  . ARG A 1 791  ? 132.765 142.023 108.863 1.00 58.62  ? 770  ARG A CZ  1 
ATOM   4500 N  NH1 . ARG A 1 791  ? 132.610 141.385 110.012 1.00 58.62  ? 770  ARG A NH1 1 
ATOM   4501 N  NH2 . ARG A 1 791  ? 133.359 141.415 107.849 1.00 58.62  ? 770  ARG A NH2 1 
ATOM   4502 N  N   . VAL A 1 792  ? 126.332 141.180 108.677 1.00 77.32  ? 771  VAL A N   1 
ATOM   4503 C  CA  . VAL A 1 792  ? 125.881 139.848 108.274 1.00 77.32  ? 771  VAL A CA  1 
ATOM   4504 C  C   . VAL A 1 792  ? 125.418 139.915 106.827 1.00 77.32  ? 771  VAL A C   1 
ATOM   4505 O  O   . VAL A 1 792  ? 124.635 140.799 106.461 1.00 77.32  ? 771  VAL A O   1 
ATOM   4506 C  CB  . VAL A 1 792  ? 124.740 139.328 109.164 1.00 77.32  ? 771  VAL A CB  1 
ATOM   4507 C  CG1 . VAL A 1 792  ? 124.372 137.910 108.779 1.00 77.32  ? 771  VAL A CG1 1 
ATOM   4508 C  CG2 . VAL A 1 792  ? 125.113 139.405 110.610 1.00 77.32  ? 771  VAL A CG2 1 
ATOM   4509 N  N   . ARG A 1 793  ? 125.891 138.990 106.010 1.00 76.78  ? 772  ARG A N   1 
ATOM   4510 C  CA  . ARG A 1 793  ? 125.400 138.846 104.654 1.00 76.78  ? 772  ARG A CA  1 
ATOM   4511 C  C   . ARG A 1 793  ? 124.850 137.438 104.484 1.00 76.78  ? 772  ARG A C   1 
ATOM   4512 O  O   . ARG A 1 793  ? 124.756 136.675 105.442 1.00 76.78  ? 772  ARG A O   1 
ATOM   4513 C  CB  . ARG A 1 793  ? 126.501 139.168 103.646 1.00 76.78  ? 772  ARG A CB  1 
ATOM   4514 C  CG  . ARG A 1 793  ? 126.972 140.611 103.752 1.00 76.78  ? 772  ARG A CG  1 
ATOM   4515 C  CD  . ARG A 1 793  ? 125.840 141.561 103.395 1.00 76.78  ? 772  ARG A CD  1 
ATOM   4516 N  NE  . ARG A 1 793  ? 126.259 142.956 103.418 1.00 76.78  ? 772  ARG A NE  1 
ATOM   4517 C  CZ  . ARG A 1 793  ? 126.155 143.746 104.479 1.00 76.78  ? 772  ARG A CZ  1 
ATOM   4518 N  NH1 . ARG A 1 793  ? 126.558 145.006 104.414 1.00 76.78  ? 772  ARG A NH1 1 
ATOM   4519 N  NH2 . ARG A 1 793  ? 125.645 143.277 105.607 1.00 76.78  ? 772  ARG A NH2 1 
ATOM   4520 N  N   . ASP A 1 794  ? 124.458 137.099 103.262 1.00 73.11  ? 773  ASP A N   1 
ATOM   4521 C  CA  . ASP A 1 794  ? 123.896 135.791 102.963 1.00 73.11  ? 773  ASP A CA  1 
ATOM   4522 C  C   . ASP A 1 794  ? 124.903 134.990 102.152 1.00 73.11  ? 773  ASP A C   1 
ATOM   4523 O  O   . ASP A 1 794  ? 125.925 135.515 101.714 1.00 73.11  ? 773  ASP A O   1 
ATOM   4524 C  CB  . ASP A 1 794  ? 122.571 135.929 102.213 1.00 73.11  ? 773  ASP A CB  1 
ATOM   4525 C  CG  . ASP A 1 794  ? 121.502 136.603 103.050 1.00 73.11  ? 773  ASP A CG  1 
ATOM   4526 O  OD1 . ASP A 1 794  ? 121.559 136.490 104.289 1.00 73.11  ? 773  ASP A OD1 1 
ATOM   4527 O  OD2 . ASP A 1 794  ? 120.605 137.250 102.471 1.00 73.11  ? 773  ASP A OD2 1 
ATOM   4528 N  N   . GLY A 1 795  ? 124.612 133.710 101.936 1.00 69.21  ? 774  GLY A N   1 
ATOM   4529 C  CA  . GLY A 1 795  ? 125.652 132.856 101.396 1.00 69.21  ? 774  GLY A CA  1 
ATOM   4530 C  C   . GLY A 1 795  ? 125.317 131.415 101.079 1.00 69.21  ? 774  GLY A C   1 
ATOM   4531 O  O   . GLY A 1 795  ? 124.358 131.129 100.355 1.00 69.21  ? 774  GLY A O   1 
ATOM   4532 N  N   . LEU A 1 796  ? 125.958 130.503 101.801 1.00 71.27  ? 775  LEU A N   1 
ATOM   4533 C  CA  . LEU A 1 796  ? 125.757 129.074 101.588 1.00 71.27  ? 775  LEU A CA  1 
ATOM   4534 C  C   . LEU A 1 796  ? 126.150 128.603 100.195 1.00 71.27  ? 775  LEU A C   1 
ATOM   4535 O  O   . LEU A 1 796  ? 125.400 127.898 99.526  1.00 71.27  ? 775  LEU A O   1 
ATOM   4536 C  CB  . LEU A 1 796  ? 124.307 128.683 101.872 1.00 71.27  ? 775  LEU A CB  1 
ATOM   4537 C  CG  . LEU A 1 796  ? 124.008 127.190 101.734 1.00 71.27  ? 775  LEU A CG  1 
ATOM   4538 C  CD1 . LEU A 1 796  ? 125.184 126.370 102.237 1.00 71.27  ? 775  LEU A CD1 1 
ATOM   4539 C  CD2 . LEU A 1 796  ? 122.732 126.813 102.467 1.00 71.27  ? 775  LEU A CD2 1 
ATOM   4540 N  N   . ASP A 1 797  ? 127.339 129.017 99.764  1.00 82.15  ? 776  ASP A N   1 
ATOM   4541 C  CA  . ASP A 1 797  ? 127.876 128.641 98.462  1.00 82.15  ? 776  ASP A CA  1 
ATOM   4542 C  C   . ASP A 1 797  ? 128.124 127.137 98.377  1.00 82.15  ? 776  ASP A C   1 
ATOM   4543 O  O   . ASP A 1 797  ? 128.428 126.485 99.371  1.00 82.15  ? 776  ASP A O   1 
ATOM   4544 C  CB  . ASP A 1 797  ? 129.161 129.408 98.161  1.00 82.15  ? 776  ASP A CB  1 
ATOM   4545 C  CG  . ASP A 1 797  ? 129.450 129.487 96.680  1.00 82.15  ? 776  ASP A CG  1 
ATOM   4546 O  OD1 . ASP A 1 797  ? 129.442 128.425 96.027  1.00 82.15  ? 776  ASP A OD1 1 
ATOM   4547 O  OD2 . ASP A 1 797  ? 129.675 130.604 96.170  1.00 82.15  ? 776  ASP A OD2 1 
ATOM   4548 N  N   . LEU A 1 798  ? 128.025 126.608 97.163  1.00 80.71  ? 777  LEU A N   1 
ATOM   4549 C  CA  . LEU A 1 798  ? 128.140 125.175 96.886  1.00 80.71  ? 777  LEU A CA  1 
ATOM   4550 C  C   . LEU A 1 798  ? 129.436 124.449 97.245  1.00 80.71  ? 777  LEU A C   1 
ATOM   4551 O  O   . LEU A 1 798  ? 129.389 123.294 97.656  1.00 80.71  ? 777  LEU A O   1 
ATOM   4552 C  CB  . LEU A 1 798  ? 127.804 124.897 95.419  1.00 80.71  ? 777  LEU A CB  1 
ATOM   4553 C  CG  . LEU A 1 798  ? 128.653 123.819 94.745  1.00 80.71  ? 777  LEU A CG  1 
ATOM   4554 C  CD1 . LEU A 1 798  ? 128.342 122.443 95.312  1.00 80.71  ? 777  LEU A CD1 1 
ATOM   4555 C  CD2 . LEU A 1 798  ? 128.444 123.837 93.240  1.00 80.71  ? 777  LEU A CD2 1 
ATOM   4556 N  N   . THR A 1 799  ? 130.590 125.088 97.097  1.00 80.06  ? 778  THR A N   1 
ATOM   4557 C  CA  . THR A 1 799  ? 131.840 124.377 97.368  1.00 80.06  ? 778  THR A CA  1 
ATOM   4558 C  C   . THR A 1 799  ? 132.279 124.262 98.831  1.00 80.06  ? 778  THR A C   1 
ATOM   4559 O  O   . THR A 1 799  ? 133.375 124.690 99.188  1.00 80.06  ? 778  THR A O   1 
ATOM   4560 C  CB  . THR A 1 799  ? 133.004 125.036 96.602  1.00 80.06  ? 778  THR A CB  1 
ATOM   4561 O  OG1 . THR A 1 799  ? 134.254 124.546 97.107  1.00 80.06  ? 778  THR A OG1 1 
ATOM   4562 C  CG2 . THR A 1 799  ? 132.961 126.548 96.775  1.00 80.06  ? 778  THR A CG2 1 
ATOM   4563 N  N   . ASP A 1 800  ? 131.439 123.673 99.675  1.00 89.78  ? 779  ASP A N   1 
ATOM   4564 C  CA  . ASP A 1 800  ? 131.812 123.455 101.064 1.00 89.78  ? 779  ASP A CA  1 
ATOM   4565 C  C   . ASP A 1 800  ? 131.642 121.987 101.435 1.00 89.78  ? 779  ASP A C   1 
ATOM   4566 O  O   . ASP A 1 800  ? 132.379 121.457 102.261 1.00 89.78  ? 779  ASP A O   1 
ATOM   4567 C  CB  . ASP A 1 800  ? 131.022 124.361 102.005 1.00 89.78  ? 779  ASP A CB  1 
ATOM   4568 C  CG  . ASP A 1 800  ? 129.541 124.317 101.745 1.00 89.78  ? 779  ASP A CG  1 
ATOM   4569 O  OD1 . ASP A 1 800  ? 129.073 123.318 101.162 1.00 89.78  ? 779  ASP A OD1 1 
ATOM   4570 O  OD2 . ASP A 1 800  ? 128.847 125.280 102.128 1.00 89.78  ? 779  ASP A OD2 1 
ATOM   4571 N  N   . ILE A 1 801  ? 130.669 121.335 100.812 1.00 95.40  ? 780  ILE A N   1 
ATOM   4572 C  CA  . ILE A 1 801  ? 130.404 119.925 101.071 1.00 95.40  ? 780  ILE A CA  1 
ATOM   4573 C  C   . ILE A 1 801  ? 131.575 119.047 100.648 1.00 95.40  ? 780  ILE A C   1 
ATOM   4574 O  O   . ILE A 1 801  ? 131.920 118.080 101.325 1.00 95.40  ? 780  ILE A O   1 
ATOM   4575 C  CB  . ILE A 1 801  ? 129.104 119.439 100.397 1.00 95.40  ? 780  ILE A CB  1 
ATOM   4576 C  CG1 . ILE A 1 801  ? 129.027 119.918 98.949  1.00 95.40  ? 780  ILE A CG1 1 
ATOM   4577 C  CG2 . ILE A 1 801  ? 127.890 119.919 101.174 1.00 95.40  ? 780  ILE A CG2 1 
ATOM   4578 C  CD1 . ILE A 1 801  ? 127.741 119.532 98.254  1.00 95.40  ? 780  ILE A CD1 1 
ATOM   4579 N  N   . VAL A 1 802  ? 132.180 119.381 99.517  1.00 98.90  ? 781  VAL A N   1 
ATOM   4580 C  CA  . VAL A 1 802  ? 133.307 118.617 99.012  1.00 98.90  ? 781  VAL A CA  1 
ATOM   4581 C  C   . VAL A 1 802  ? 134.606 119.002 99.709  1.00 98.90  ? 781  VAL A C   1 
ATOM   4582 O  O   . VAL A 1 802  ? 134.946 120.181 99.792  1.00 98.90  ? 781  VAL A O   1 
ATOM   4583 C  CB  . VAL A 1 802  ? 133.472 118.828 97.502  1.00 98.90  ? 781  VAL A CB  1 
ATOM   4584 C  CG1 . VAL A 1 802  ? 134.672 118.048 96.989  1.00 98.90  ? 781  VAL A CG1 1 
ATOM   4585 C  CG2 . VAL A 1 802  ? 132.198 118.428 96.772  1.00 98.90  ? 781  VAL A CG2 1 
ATOM   4586 N  N   . PRO A 1 803  ? 135.343 117.999 100.198 1.00 91.13  ? 782  PRO A N   1 
ATOM   4587 C  CA  . PRO A 1 803  ? 136.624 118.132 100.898 1.00 91.13  ? 782  PRO A CA  1 
ATOM   4588 C  C   . PRO A 1 803  ? 137.692 118.764 100.016 1.00 91.13  ? 782  PRO A C   1 
ATOM   4589 O  O   . PRO A 1 803  ? 137.830 118.420 98.841  1.00 91.13  ? 782  PRO A O   1 
ATOM   4590 C  CB  . PRO A 1 803  ? 136.981 116.684 101.243 1.00 91.13  ? 782  PRO A CB  1 
ATOM   4591 C  CG  . PRO A 1 803  ? 135.681 115.973 101.240 1.00 91.13  ? 782  PRO A CG  1 
ATOM   4592 C  CD  . PRO A 1 803  ? 134.876 116.607 100.164 1.00 91.13  ? 782  PRO A CD  1 
ATOM   4593 N  N   . ARG A 1 804  ? 138.452 119.694 100.600 1.00 86.52  ? 783  ARG A N   1 
ATOM   4594 C  CA  . ARG A 1 804  ? 139.548 120.356 99.900  1.00 86.52  ? 783  ARG A CA  1 
ATOM   4595 C  C   . ARG A 1 804  ? 140.676 119.349 99.643  1.00 86.52  ? 783  ARG A C   1 
ATOM   4596 O  O   . ARG A 1 804  ? 140.742 118.289 100.270 1.00 86.52  ? 783  ARG A O   1 
ATOM   4597 C  CB  . ARG A 1 804  ? 140.027 121.576 100.713 1.00 86.52  ? 783  ARG A CB  1 
ATOM   4598 C  CG  . ARG A 1 804  ? 141.012 122.539 100.016 1.00 86.52  ? 783  ARG A CG  1 
ATOM   4599 C  CD  . ARG A 1 804  ? 141.417 123.750 100.839 1.00 86.52  ? 783  ARG A CD  1 
ATOM   4600 N  NE  . ARG A 1 804  ? 140.366 124.755 100.906 1.00 86.52  ? 783  ARG A NE  1 
ATOM   4601 C  CZ  . ARG A 1 804  ? 140.444 125.868 101.626 1.00 86.52  ? 783  ARG A CZ  1 
ATOM   4602 N  NH1 . ARG A 1 804  ? 141.529 126.121 102.339 1.00 86.52  ? 783  ARG A NH1 1 
ATOM   4603 N  NH2 . ARG A 1 804  ? 139.440 126.731 101.624 1.00 86.52  ? 783  ARG A NH2 1 
ATOM   4604 N  N   . GLU A 1 805  ? 141.543 119.690 98.681  1.00 102.07 ? 784  GLU A N   1 
ATOM   4605 C  CA  . GLU A 1 805  ? 142.630 118.948 98.027  1.00 102.07 ? 784  GLU A CA  1 
ATOM   4606 C  C   . GLU A 1 805  ? 142.085 117.955 97.016  1.00 102.07 ? 784  GLU A C   1 
ATOM   4607 O  O   . GLU A 1 805  ? 142.852 117.125 96.523  1.00 102.07 ? 784  GLU A O   1 
ATOM   4608 C  CB  . GLU A 1 805  ? 143.592 118.210 98.977  1.00 102.07 ? 784  GLU A CB  1 
ATOM   4609 C  CG  . GLU A 1 805  ? 144.559 119.106 99.713  1.00 102.07 ? 784  GLU A CG  1 
ATOM   4610 C  CD  . GLU A 1 805  ? 145.606 119.693 98.792  1.00 102.07 ? 784  GLU A CD  1 
ATOM   4611 O  OE1 . GLU A 1 805  ? 145.971 119.022 97.807  1.00 102.07 ? 784  GLU A OE1 1 
ATOM   4612 O  OE2 . GLU A 1 805  ? 146.071 120.821 99.053  1.00 102.07 ? 784  GLU A OE2 1 
ATOM   4613 N  N   . THR A 1 806  ? 140.808 118.013 96.676  1.00 91.81  ? 785  THR A N   1 
ATOM   4614 C  CA  . THR A 1 806  ? 140.279 117.159 95.632  1.00 91.81  ? 785  THR A CA  1 
ATOM   4615 C  C   . THR A 1 806  ? 140.073 117.951 94.347  1.00 91.81  ? 785  THR A C   1 
ATOM   4616 O  O   . THR A 1 806  ? 139.878 119.172 94.361  1.00 91.81  ? 785  THR A O   1 
ATOM   4617 C  CB  . THR A 1 806  ? 138.973 116.512 96.070  1.00 91.81  ? 785  THR A CB  1 
ATOM   4618 O  OG1 . THR A 1 806  ? 138.006 117.528 96.355  1.00 91.81  ? 785  THR A OG1 1 
ATOM   4619 C  CG2 . THR A 1 806  ? 139.200 115.667 97.305  1.00 91.81  ? 785  THR A CG2 1 
ATOM   4620 N  N   . ARG A 1 807  ? 140.120 117.228 93.228  1.00 88.33  ? 786  ARG A N   1 
ATOM   4621 C  CA  . ARG A 1 807  ? 140.121 117.891 91.934  1.00 88.33  ? 786  ARG A CA  1 
ATOM   4622 C  C   . ARG A 1 807  ? 138.744 118.448 91.598  1.00 88.33  ? 786  ARG A C   1 
ATOM   4623 O  O   . ARG A 1 807  ? 138.638 119.445 90.874  1.00 88.33  ? 786  ARG A O   1 
ATOM   4624 C  CB  . ARG A 1 807  ? 140.588 116.917 90.860  1.00 88.33  ? 786  ARG A CB  1 
ATOM   4625 C  CG  . ARG A 1 807  ? 141.024 117.573 89.566  1.00 88.33  ? 786  ARG A CG  1 
ATOM   4626 C  CD  . ARG A 1 807  ? 141.335 116.497 88.562  1.00 88.33  ? 786  ARG A CD  1 
ATOM   4627 N  NE  . ARG A 1 807  ? 141.860 116.987 87.296  1.00 88.33  ? 786  ARG A NE  1 
ATOM   4628 C  CZ  . ARG A 1 807  ? 142.026 116.206 86.238  1.00 88.33  ? 786  ARG A CZ  1 
ATOM   4629 N  NH1 . ARG A 1 807  ? 141.660 114.942 86.309  1.00 88.33  ? 786  ARG A NH1 1 
ATOM   4630 N  NH2 . ARG A 1 807  ? 142.521 116.681 85.111  1.00 88.33  ? 786  ARG A NH2 1 
ATOM   4631 N  N   . GLU A 1 808  ? 137.682 117.842 92.132  1.00 86.92  ? 787  GLU A N   1 
ATOM   4632 C  CA  . GLU A 1 808  ? 136.355 118.413 91.945  1.00 86.92  ? 787  GLU A CA  1 
ATOM   4633 C  C   . GLU A 1 808  ? 136.153 119.637 92.827  1.00 86.92  ? 787  GLU A C   1 
ATOM   4634 O  O   . GLU A 1 808  ? 135.353 120.512 92.487  1.00 86.92  ? 787  GLU A O   1 
ATOM   4635 C  CB  . GLU A 1 808  ? 135.283 117.358 92.217  1.00 86.92  ? 787  GLU A CB  1 
ATOM   4636 C  CG  . GLU A 1 808  ? 135.110 116.986 93.671  1.00 86.92  ? 787  GLU A CG  1 
ATOM   4637 C  CD  . GLU A 1 808  ? 136.080 115.926 94.152  1.00 86.92  ? 787  GLU A CD  1 
ATOM   4638 O  OE1 . GLU A 1 808  ? 137.055 115.617 93.434  1.00 86.92  ? 787  GLU A OE1 1 
ATOM   4639 O  OE2 . GLU A 1 808  ? 135.881 115.414 95.274  1.00 86.92  ? 787  GLU A OE2 1 
ATOM   4640 N  N   . TYR A 1 809  ? 136.873 119.731 93.946  1.00 87.85  ? 788  TYR A N   1 
ATOM   4641 C  CA  . TYR A 1 809  ? 136.897 120.984 94.686  1.00 87.85  ? 788  TYR A CA  1 
ATOM   4642 C  C   . TYR A 1 809  ? 137.604 122.057 93.882  1.00 87.85  ? 788  TYR A C   1 
ATOM   4643 O  O   . TYR A 1 809  ? 137.164 123.217 93.861  1.00 87.85  ? 788  TYR A O   1 
ATOM   4644 C  CB  . TYR A 1 809  ? 137.589 120.802 96.032  1.00 87.85  ? 788  TYR A CB  1 
ATOM   4645 C  CG  . TYR A 1 809  ? 137.569 122.034 96.904  1.00 87.85  ? 788  TYR A CG  1 
ATOM   4646 C  CD1 . TYR A 1 809  ? 136.453 122.343 97.663  1.00 87.85  ? 788  TYR A CD1 1 
ATOM   4647 C  CD2 . TYR A 1 809  ? 138.658 122.893 96.955  1.00 87.85  ? 788  TYR A CD2 1 
ATOM   4648 C  CE1 . TYR A 1 809  ? 136.426 123.459 98.457  1.00 87.85  ? 788  TYR A CE1 1 
ATOM   4649 C  CE2 . TYR A 1 809  ? 138.635 124.016 97.741  1.00 87.85  ? 788  TYR A CE2 1 
ATOM   4650 C  CZ  . TYR A 1 809  ? 137.514 124.296 98.491  1.00 87.85  ? 788  TYR A CZ  1 
ATOM   4651 O  OH  . TYR A 1 809  ? 137.479 125.419 99.288  1.00 87.85  ? 788  TYR A OH  1 
ATOM   4652 N  N   . ASP A 1 810  ? 138.702 121.676 93.219  1.00 86.25  ? 789  ASP A N   1 
ATOM   4653 C  CA  . ASP A 1 810  ? 139.412 122.598 92.337  1.00 86.25  ? 789  ASP A CA  1 
ATOM   4654 C  C   . ASP A 1 810  ? 138.500 123.089 91.222  1.00 86.25  ? 789  ASP A C   1 
ATOM   4655 O  O   . ASP A 1 810  ? 138.518 124.273 90.854  1.00 86.25  ? 789  ASP A O   1 
ATOM   4656 C  CB  . ASP A 1 810  ? 140.637 121.901 91.744  1.00 86.25  ? 789  ASP A CB  1 
ATOM   4657 C  CG  . ASP A 1 810  ? 141.551 121.314 92.799  1.00 86.25  ? 789  ASP A CG  1 
ATOM   4658 O  OD1 . ASP A 1 810  ? 141.534 121.793 93.951  1.00 86.25  ? 789  ASP A OD1 1 
ATOM   4659 O  OD2 . ASP A 1 810  ? 142.302 120.374 92.472  1.00 86.25  ? 789  ASP A OD2 1 
ATOM   4660 N  N   . PHE A 1 811  ? 137.639 122.200 90.733  1.00 57.41  ? 790  PHE A N   1 
ATOM   4661 C  CA  . PHE A 1 811  ? 136.731 122.516 89.644  1.00 57.41  ? 790  PHE A CA  1 
ATOM   4662 C  C   . PHE A 1 811  ? 135.600 123.433 90.084  1.00 57.41  ? 790  PHE A C   1 
ATOM   4663 O  O   . PHE A 1 811  ? 135.275 124.399 89.386  1.00 57.41  ? 790  PHE A O   1 
ATOM   4664 C  CB  . PHE A 1 811  ? 136.145 121.234 89.081  1.00 57.41  ? 790  PHE A CB  1 
ATOM   4665 C  CG  . PHE A 1 811  ? 135.387 121.449 87.847  1.00 57.41  ? 790  PHE A CG  1 
ATOM   4666 C  CD1 . PHE A 1 811  ? 136.058 121.563 86.657  1.00 57.41  ? 790  PHE A CD1 1 
ATOM   4667 C  CD2 . PHE A 1 811  ? 134.017 121.594 87.855  1.00 57.41  ? 790  PHE A CD2 1 
ATOM   4668 C  CE1 . PHE A 1 811  ? 135.380 121.788 85.511  1.00 57.41  ? 790  PHE A CE1 1 
ATOM   4669 C  CE2 . PHE A 1 811  ? 133.354 121.844 86.705  1.00 57.41  ? 790  PHE A CE2 1 
ATOM   4670 C  CZ  . PHE A 1 811  ? 134.025 121.908 85.549  1.00 57.41  ? 790  PHE A CZ  1 
ATOM   4671 N  N   . ILE A 1 812  ? 134.928 123.086 91.186  1.00 68.97  ? 791  ILE A N   1 
ATOM   4672 C  CA  . ILE A 1 812  ? 133.792 123.874 91.652  1.00 68.97  ? 791  ILE A CA  1 
ATOM   4673 C  C   . ILE A 1 812  ? 134.251 125.265 92.060  1.00 68.97  ? 791  ILE A C   1 
ATOM   4674 O  O   . ILE A 1 812  ? 133.568 126.270 91.800  1.00 68.97  ? 791  ILE A O   1 
ATOM   4675 C  CB  . ILE A 1 812  ? 133.080 123.129 92.793  1.00 68.97  ? 791  ILE A CB  1 
ATOM   4676 C  CG1 . ILE A 1 812  ? 132.430 121.859 92.263  1.00 68.97  ? 791  ILE A CG1 1 
ATOM   4677 C  CG2 . ILE A 1 812  ? 132.015 123.968 93.428  1.00 68.97  ? 791  ILE A CG2 1 
ATOM   4678 C  CD1 . ILE A 1 812  ? 131.954 120.941 93.345  1.00 68.97  ? 791  ILE A CD1 1 
ATOM   4679 N  N   . ALA A 1 813  ? 135.462 125.351 92.611  1.00 52.70  ? 792  ALA A N   1 
ATOM   4680 C  CA  . ALA A 1 813  ? 136.089 126.649 92.793  1.00 52.70  ? 792  ALA A CA  1 
ATOM   4681 C  C   . ALA A 1 813  ? 136.347 127.343 91.462  1.00 52.70  ? 792  ALA A C   1 
ATOM   4682 O  O   . ALA A 1 813  ? 136.209 128.567 91.377  1.00 52.70  ? 792  ALA A O   1 
ATOM   4683 C  CB  . ALA A 1 813  ? 137.389 126.495 93.571  1.00 52.70  ? 792  ALA A CB  1 
ATOM   4684 N  N   . ALA A 1 814  ? 136.676 126.584 90.407  1.00 55.20  ? 793  ALA A N   1 
ATOM   4685 C  CA  . ALA A 1 814  ? 136.970 127.214 89.120  1.00 55.20  ? 793  ALA A CA  1 
ATOM   4686 C  C   . ALA A 1 814  ? 135.724 127.828 88.491  1.00 55.20  ? 793  ALA A C   1 
ATOM   4687 O  O   . ALA A 1 814  ? 135.725 129.015 88.152  1.00 55.20  ? 793  ALA A O   1 
ATOM   4688 C  CB  . ALA A 1 814  ? 137.624 126.221 88.162  1.00 55.20  ? 793  ALA A CB  1 
ATOM   4689 N  N   . GLN A 1 815  ? 134.636 127.067 88.353  1.00 52.14  ? 794  GLN A N   1 
ATOM   4690 C  CA  . GLN A 1 815  ? 133.484 127.693 87.712  1.00 52.14  ? 794  GLN A CA  1 
ATOM   4691 C  C   . GLN A 1 815  ? 132.732 128.632 88.639  1.00 52.14  ? 794  GLN A C   1 
ATOM   4692 O  O   . GLN A 1 815  ? 131.921 129.427 88.160  1.00 52.14  ? 794  GLN A O   1 
ATOM   4693 C  CB  . GLN A 1 815  ? 132.480 126.684 87.159  1.00 52.14  ? 794  GLN A CB  1 
ATOM   4694 C  CG  . GLN A 1 815  ? 131.580 126.057 88.182  1.00 52.14  ? 794  GLN A CG  1 
ATOM   4695 C  CD  . GLN A 1 815  ? 130.455 125.293 87.534  1.00 52.14  ? 794  GLN A CD  1 
ATOM   4696 O  OE1 . GLN A 1 815  ? 130.333 125.281 86.315  1.00 52.14  ? 794  GLN A OE1 1 
ATOM   4697 N  NE2 . GLN A 1 815  ? 129.606 124.675 88.344  1.00 52.14  ? 794  GLN A NE2 1 
ATOM   4698 N  N   . PHE A 1 816  ? 132.974 128.581 89.944  1.00 66.44  ? 795  PHE A N   1 
ATOM   4699 C  CA  . PHE A 1 816  ? 132.427 129.629 90.791  1.00 66.44  ? 795  PHE A CA  1 
ATOM   4700 C  C   . PHE A 1 816  ? 133.382 130.801 90.950  1.00 66.44  ? 795  PHE A C   1 
ATOM   4701 O  O   . PHE A 1 816  ? 133.060 131.758 91.660  1.00 66.44  ? 795  PHE A O   1 
ATOM   4702 C  CB  . PHE A 1 816  ? 132.021 129.055 92.144  1.00 66.44  ? 795  PHE A CB  1 
ATOM   4703 C  CG  . PHE A 1 816  ? 130.791 128.198 92.078  1.00 66.44  ? 795  PHE A CG  1 
ATOM   4704 C  CD1 . PHE A 1 816  ? 129.911 128.306 91.010  1.00 66.44  ? 795  PHE A CD1 1 
ATOM   4705 C  CD2 . PHE A 1 816  ? 130.525 127.270 93.062  1.00 66.44  ? 795  PHE A CD2 1 
ATOM   4706 C  CE1 . PHE A 1 816  ? 128.785 127.513 90.939  1.00 66.44  ? 795  PHE A CE1 1 
ATOM   4707 C  CE2 . PHE A 1 816  ? 129.402 126.476 92.992  1.00 66.44  ? 795  PHE A CE2 1 
ATOM   4708 C  CZ  . PHE A 1 816  ? 128.531 126.599 91.933  1.00 66.44  ? 795  PHE A CZ  1 
ATOM   4709 N  N   . LYS A 1 817  ? 134.544 130.747 90.302  1.00 53.06  ? 796  LYS A N   1 
ATOM   4710 C  CA  . LYS A 1 817  ? 135.336 131.945 90.057  1.00 53.06  ? 796  LYS A CA  1 
ATOM   4711 C  C   . LYS A 1 817  ? 134.993 132.580 88.712  1.00 53.06  ? 796  LYS A C   1 
ATOM   4712 O  O   . LYS A 1 817  ? 134.571 133.737 88.656  1.00 53.06  ? 796  LYS A O   1 
ATOM   4713 C  CB  . LYS A 1 817  ? 136.831 131.619 90.103  1.00 53.06  ? 796  LYS A CB  1 
ATOM   4714 C  CG  . LYS A 1 817  ? 137.444 131.519 91.476  1.00 53.06  ? 796  LYS A CG  1 
ATOM   4715 C  CD  . LYS A 1 817  ? 138.841 130.934 91.380  1.00 53.06  ? 796  LYS A CD  1 
ATOM   4716 C  CE  . LYS A 1 817  ? 139.909 132.009 91.277  1.00 53.06  ? 796  LYS A CE  1 
ATOM   4717 N  NZ  . LYS A 1 817  ? 139.962 132.725 89.972  1.00 53.06  ? 796  LYS A NZ  1 
ATOM   4718 N  N   . TYR A 1 818  ? 135.166 131.832 87.622  1.00 61.40  ? 797  TYR A N   1 
ATOM   4719 C  CA  . TYR A 1 818  ? 135.182 132.446 86.300  1.00 61.40  ? 797  TYR A CA  1 
ATOM   4720 C  C   . TYR A 1 818  ? 133.794 132.517 85.674  1.00 61.40  ? 797  TYR A C   1 
ATOM   4721 O  O   . TYR A 1 818  ? 133.298 133.602 85.355  1.00 61.40  ? 797  TYR A O   1 
ATOM   4722 C  CB  . TYR A 1 818  ? 136.097 131.659 85.362  1.00 61.40  ? 797  TYR A CB  1 
ATOM   4723 C  CG  . TYR A 1 818  ? 137.481 131.410 85.875  1.00 61.40  ? 797  TYR A CG  1 
ATOM   4724 C  CD1 . TYR A 1 818  ? 138.409 132.426 85.944  1.00 61.40  ? 797  TYR A CD1 1 
ATOM   4725 C  CD2 . TYR A 1 818  ? 137.878 130.133 86.235  1.00 61.40  ? 797  TYR A CD2 1 
ATOM   4726 C  CE1 . TYR A 1 818  ? 139.675 132.182 86.411  1.00 61.40  ? 797  TYR A CE1 1 
ATOM   4727 C  CE2 . TYR A 1 818  ? 139.144 129.876 86.704  1.00 61.40  ? 797  TYR A CE2 1 
ATOM   4728 C  CZ  . TYR A 1 818  ? 140.040 130.907 86.784  1.00 61.40  ? 797  TYR A CZ  1 
ATOM   4729 O  OH  . TYR A 1 818  ? 141.317 130.678 87.243  1.00 61.40  ? 797  TYR A OH  1 
ATOM   4730 N  N   . PHE A 1 819  ? 133.168 131.363 85.475  1.00 41.47  ? 798  PHE A N   1 
ATOM   4731 C  CA  . PHE A 1 819  ? 132.028 131.222 84.573  1.00 41.47  ? 798  PHE A CA  1 
ATOM   4732 C  C   . PHE A 1 819  ? 130.740 131.357 85.368  1.00 41.47  ? 798  PHE A C   1 
ATOM   4733 O  O   . PHE A 1 819  ? 130.282 130.403 85.998  1.00 41.47  ? 798  PHE A O   1 
ATOM   4734 C  CB  . PHE A 1 819  ? 132.083 129.879 83.858  1.00 41.47  ? 798  PHE A CB  1 
ATOM   4735 C  CG  . PHE A 1 819  ? 133.280 129.709 82.988  1.00 41.47  ? 798  PHE A CG  1 
ATOM   4736 C  CD1 . PHE A 1 819  ? 133.325 130.295 81.748  1.00 41.47  ? 798  PHE A CD1 1 
ATOM   4737 C  CD2 . PHE A 1 819  ? 134.358 128.962 83.413  1.00 41.47  ? 798  PHE A CD2 1 
ATOM   4738 C  CE1 . PHE A 1 819  ? 134.422 130.141 80.952  1.00 41.47  ? 798  PHE A CE1 1 
ATOM   4739 C  CE2 . PHE A 1 819  ? 135.458 128.809 82.615  1.00 41.47  ? 798  PHE A CE2 1 
ATOM   4740 C  CZ  . PHE A 1 819  ? 135.490 129.399 81.386  1.00 41.47  ? 798  PHE A CZ  1 
ATOM   4741 N  N   . SER A 1 820  ? 130.129 132.527 85.306  1.00 77.91  ? 799  SER A N   1 
ATOM   4742 C  CA  . SER A 1 820  ? 128.906 132.796 86.047  1.00 78.35  ? 799  SER A CA  1 
ATOM   4743 C  C   . SER A 1 820  ? 127.699 132.907 85.121  1.00 77.14  ? 799  SER A C   1 
ATOM   4744 O  O   . SER A 1 820  ? 126.846 133.779 85.287  1.00 77.02  ? 799  SER A O   1 
ATOM   4745 C  CB  . SER A 1 820  ? 129.061 134.054 86.889  1.00 108.00 ? 799  SER A CB  1 
ATOM   4746 O  OG  . SER A 1 820  ? 129.220 135.192 86.074  1.00 108.00 ? 799  SER A OG  1 
ATOM   4747 N  N   . PHE A 1 821  ? 127.620 132.033 84.125  1.00 74.84  ? 800  PHE A N   1 
ATOM   4748 C  CA  . PHE A 1 821  ? 126.453 131.947 83.263  1.00 74.07  ? 800  PHE A CA  1 
ATOM   4749 C  C   . PHE A 1 821  ? 125.549 130.831 83.764  1.00 74.47  ? 800  PHE A C   1 
ATOM   4750 O  O   . PHE A 1 821  ? 126.028 129.761 84.145  1.00 73.96  ? 800  PHE A O   1 
ATOM   4751 C  CB  . PHE A 1 821  ? 126.856 131.702 81.799  1.00 98.56  ? 800  PHE A CB  1 
ATOM   4752 C  CG  . PHE A 1 821  ? 127.455 130.351 81.535  1.00 98.56  ? 800  PHE A CG  1 
ATOM   4753 C  CD1 . PHE A 1 821  ? 128.793 130.118 81.761  1.00 98.56  ? 800  PHE A CD1 1 
ATOM   4754 C  CD2 . PHE A 1 821  ? 126.684 129.325 81.018  1.00 98.56  ? 800  PHE A CD2 1 
ATOM   4755 C  CE1 . PHE A 1 821  ? 129.337 128.882 81.520  1.00 98.56  ? 800  PHE A CE1 1 
ATOM   4756 C  CE2 . PHE A 1 821  ? 127.224 128.090 80.778  1.00 98.56  ? 800  PHE A CE2 1 
ATOM   4757 C  CZ  . PHE A 1 821  ? 128.551 127.870 81.026  1.00 98.56  ? 800  PHE A CZ  1 
ATOM   4758 N  N   . TYR A 1 822  ? 124.247 131.079 83.764  1.00 36.79  ? 801  TYR A N   1 
ATOM   4759 C  CA  . TYR A 1 822  ? 123.263 130.054 84.068  1.00 37.81  ? 801  TYR A CA  1 
ATOM   4760 C  C   . TYR A 1 822  ? 122.299 129.916 82.902  1.00 35.93  ? 801  TYR A C   1 
ATOM   4761 O  O   . TYR A 1 822  ? 122.243 130.761 82.008  1.00 34.24  ? 801  TYR A O   1 
ATOM   4762 C  CB  . TYR A 1 822  ? 122.509 130.378 85.362  1.00 84.90  ? 801  TYR A CB  1 
ATOM   4763 C  CG  . TYR A 1 822  ? 123.311 130.166 86.627  1.00 84.90  ? 801  TYR A CG  1 
ATOM   4764 C  CD1 . TYR A 1 822  ? 124.340 129.242 86.674  1.00 84.90  ? 801  TYR A CD1 1 
ATOM   4765 C  CD2 . TYR A 1 822  ? 123.065 130.918 87.759  1.00 84.90  ? 801  TYR A CD2 1 
ATOM   4766 C  CE1 . TYR A 1 822  ? 125.082 129.054 87.815  1.00 84.90  ? 801  TYR A CE1 1 
ATOM   4767 C  CE2 . TYR A 1 822  ? 123.803 130.737 88.904  1.00 84.90  ? 801  TYR A CE2 1 
ATOM   4768 C  CZ  . TYR A 1 822  ? 124.812 129.807 88.925  1.00 84.90  ? 801  TYR A CZ  1 
ATOM   4769 O  OH  . TYR A 1 822  ? 125.557 129.620 90.060  1.00 84.90  ? 801  TYR A OH  1 
ATOM   4770 N  N   . ASN A 1 823  ? 121.527 128.837 82.924  1.00 41.80  ? 802  ASN A N   1 
ATOM   4771 C  CA  . ASN A 1 823  ? 120.637 128.459 81.832  1.00 40.94  ? 802  ASN A CA  1 
ATOM   4772 C  C   . ASN A 1 823  ? 119.205 128.686 82.291  1.00 41.59  ? 802  ASN A C   1 
ATOM   4773 O  O   . ASN A 1 823  ? 118.693 127.932 83.120  1.00 43.58  ? 802  ASN A O   1 
ATOM   4774 C  CB  . ASN A 1 823  ? 120.866 126.998 81.451  1.00 77.83  ? 802  ASN A CB  1 
ATOM   4775 C  CG  . ASN A 1 823  ? 120.419 126.668 80.038  1.00 77.83  ? 802  ASN A CG  1 
ATOM   4776 O  OD1 . ASN A 1 823  ? 120.753 125.611 79.514  1.00 77.83  ? 802  ASN A OD1 1 
ATOM   4777 N  ND2 . ASN A 1 823  ? 119.674 127.564 79.413  1.00 77.83  ? 802  ASN A ND2 1 
ATOM   4778 N  N   . MET A 1 824  ? 118.553 129.693 81.736  1.00 54.90  ? 803  MET A N   1 
ATOM   4779 C  CA  . MET A 1 824  ? 117.192 130.037 82.126  1.00 55.38  ? 803  MET A CA  1 
ATOM   4780 C  C   . MET A 1 824  ? 116.248 129.810 80.953  1.00 53.41  ? 803  MET A C   1 
ATOM   4781 O  O   . MET A 1 824  ? 116.142 130.644 80.054  1.00 52.50  ? 803  MET A O   1 
ATOM   4782 C  CB  . MET A 1 824  ? 117.113 131.479 82.618  1.00 77.26  ? 803  MET A CB  1 
ATOM   4783 C  CG  . MET A 1 824  ? 115.713 131.918 82.990  1.00 77.26  ? 803  MET A CG  1 
ATOM   4784 S  SD  . MET A 1 824  ? 115.625 133.603 83.586  1.00 77.26  ? 803  MET A SD  1 
ATOM   4785 C  CE  . MET A 1 824  ? 116.011 134.519 82.104  1.00 77.26  ? 803  MET A CE  1 
ATOM   4786 N  N   . TYR A 1 825  ? 115.563 128.681 80.964  1.00 54.30  ? 804  TYR A N   1 
ATOM   4787 C  CA  . TYR A 1 825  ? 114.380 128.553 80.145  1.00 53.11  ? 804  TYR A CA  1 
ATOM   4788 C  C   . TYR A 1 825  ? 113.260 129.311 80.826  1.00 52.46  ? 804  TYR A C   1 
ATOM   4789 O  O   . TYR A 1 825  ? 113.236 129.434 82.049  1.00 76.55  ? 804  TYR A O   1 
ATOM   4790 C  CB  . TYR A 1 825  ? 113.989 127.092 79.981  1.00 80.51  ? 804  TYR A CB  1 
ATOM   4791 C  CG  . TYR A 1 825  ? 115.099 126.254 79.425  1.00 80.51  ? 804  TYR A CG  1 
ATOM   4792 C  CD1 . TYR A 1 825  ? 115.392 126.269 78.073  1.00 80.51  ? 804  TYR A CD1 1 
ATOM   4793 C  CD2 . TYR A 1 825  ? 115.863 125.449 80.258  1.00 80.51  ? 804  TYR A CD2 1 
ATOM   4794 C  CE1 . TYR A 1 825  ? 116.412 125.506 77.566  1.00 80.51  ? 804  TYR A CE1 1 
ATOM   4795 C  CE2 . TYR A 1 825  ? 116.882 124.682 79.759  1.00 80.51  ? 804  TYR A CE2 1 
ATOM   4796 C  CZ  . TYR A 1 825  ? 117.152 124.718 78.416  1.00 80.51  ? 804  TYR A CZ  1 
ATOM   4797 O  OH  . TYR A 1 825  ? 118.170 123.952 77.915  1.00 80.51  ? 804  TYR A OH  1 
ATOM   4798 N  N   . ILE A 1 826  ? 112.349 129.853 80.031  1.00 30.34  ? 805  ILE A N   1 
ATOM   4799 C  CA  . ILE A 1 826  ? 111.130 130.467 80.542  1.00 30.18  ? 805  ILE A CA  1 
ATOM   4800 C  C   . ILE A 1 826  ? 109.986 129.965 79.689  1.00 29.84  ? 805  ILE A C   1 
ATOM   4801 O  O   . ILE A 1 826  ? 110.017 130.102 78.463  1.00 29.07  ? 805  ILE A O   1 
ATOM   4802 C  CB  . ILE A 1 826  ? 111.199 131.999 80.550  1.00 72.94  ? 805  ILE A CB  1 
ATOM   4803 C  CG1 . ILE A 1 826  ? 112.084 132.439 81.706  1.00 72.94  ? 805  ILE A CG1 1 
ATOM   4804 C  CG2 . ILE A 1 826  ? 109.828 132.611 80.673  1.00 72.94  ? 805  ILE A CG2 1 
ATOM   4805 C  CD1 . ILE A 1 826  ? 112.445 133.835 81.708  1.00 72.94  ? 805  ILE A CD1 1 
ATOM   4806 N  N   . VAL A 1 827  ? 108.989 129.377 80.333  1.00 34.42  ? 806  VAL A N   1 
ATOM   4807 C  CA  . VAL A 1 827  ? 108.067 128.464 79.684  1.00 34.20  ? 806  VAL A CA  1 
ATOM   4808 C  C   . VAL A 1 827  ? 106.640 128.979 79.815  1.00 34.11  ? 806  VAL A C   1 
ATOM   4809 O  O   . VAL A 1 827  ? 106.190 129.311 80.915  1.00 34.87  ? 806  VAL A O   1 
ATOM   4810 C  CB  . VAL A 1 827  ? 108.240 127.043 80.250  1.00 71.94  ? 806  VAL A CB  1 
ATOM   4811 C  CG1 . VAL A 1 827  ? 108.378 127.062 81.718  1.00 71.94  ? 806  VAL A CG1 1 
ATOM   4812 C  CG2 . VAL A 1 827  ? 107.061 126.238 79.949  1.00 71.94  ? 806  VAL A CG2 1 
ATOM   4813 N  N   . THR A 1 828  ? 105.947 129.083 78.684  1.00 29.66  ? 807  THR A N   1 
ATOM   4814 C  CA  . THR A 1 828  ? 104.534 129.413 78.650  1.00 30.19  ? 807  THR A CA  1 
ATOM   4815 C  C   . THR A 1 828  ? 103.680 128.159 78.827  1.00 30.53  ? 807  THR A C   1 
ATOM   4816 O  O   . THR A 1 828  ? 104.163 127.033 78.778  1.00 29.95  ? 807  THR A O   1 
ATOM   4817 C  CB  . THR A 1 828  ? 104.191 130.158 77.358  1.00 86.16  ? 807  THR A CB  1 
ATOM   4818 O  OG1 . THR A 1 828  ? 102.771 130.305 77.247  1.00 86.16  ? 807  THR A OG1 1 
ATOM   4819 C  CG2 . THR A 1 828  ? 104.741 129.463 76.143  1.00 86.16  ? 807  THR A CG2 1 
ATOM   4820 N  N   . GLN A 1 829  ? 102.386 128.366 79.043  1.00 47.61  ? 808  GLN A N   1 
ATOM   4821 C  CA  . GLN A 1 829  ? 101.565 127.340 79.679  1.00 49.08  ? 808  GLN A CA  1 
ATOM   4822 C  C   . GLN A 1 829  ? 100.092 127.618 79.413  1.00 49.59  ? 808  GLN A C   1 
ATOM   4823 O  O   . GLN A 1 829  ? 99.573  128.636 79.879  1.00 49.66  ? 808  GLN A O   1 
ATOM   4824 C  CB  . GLN A 1 829  ? 101.847 127.333 81.174  1.00 107.19 ? 808  GLN A CB  1 
ATOM   4825 C  CG  . GLN A 1 829  ? 100.998 126.408 82.003  1.00 107.19 ? 808  GLN A CG  1 
ATOM   4826 C  CD  . GLN A 1 829  ? 101.287 126.551 83.485  1.00 107.19 ? 808  GLN A CD  1 
ATOM   4827 O  OE1 . GLN A 1 829  ? 102.044 127.428 83.901  1.00 107.19 ? 808  GLN A OE1 1 
ATOM   4828 N  NE2 . GLN A 1 829  ? 100.692 125.684 84.287  1.00 107.19 ? 808  GLN A NE2 1 
ATOM   4829 N  N   . LYS A 1 830  ? 99.431  126.729 78.670  1.00 76.77  ? 809  LYS A N   1 
ATOM   4830 C  CA  . LYS A 1 830  ? 97.975  126.577 78.604  1.00 78.34  ? 809  LYS A CA  1 
ATOM   4831 C  C   . LYS A 1 830  ? 97.223  127.800 78.076  1.00 79.96  ? 809  LYS A C   1 
ATOM   4832 O  O   . LYS A 1 830  ? 95.994  127.845 78.181  1.00 80.56  ? 809  LYS A O   1 
ATOM   4833 C  CB  . LYS A 1 830  ? 97.396  126.202 79.975  1.00 98.80  ? 809  LYS A CB  1 
ATOM   4834 C  CG  . LYS A 1 830  ? 97.872  124.883 80.537  1.00 98.80  ? 809  LYS A CG  1 
ATOM   4835 C  CD  . LYS A 1 830  ? 97.414  123.749 79.667  1.00 98.80  ? 809  LYS A CD  1 
ATOM   4836 C  CE  . LYS A 1 830  ? 95.918  123.573 79.740  1.00 98.80  ? 809  LYS A CE  1 
ATOM   4837 N  NZ  . LYS A 1 830  ? 95.469  122.438 78.896  1.00 98.80  ? 809  LYS A NZ  1 
ATOM   4838 N  N   . ALA A 1 831  ? 97.901  128.778 77.488  1.00 47.96  ? 810  ALA A N   1 
ATOM   4839 C  CA  . ALA A 1 831  ? 97.281  130.060 77.173  1.00 47.96  ? 810  ALA A CA  1 
ATOM   4840 C  C   . ALA A 1 831  ? 96.432  129.963 75.906  1.00 47.96  ? 810  ALA A C   1 
ATOM   4841 O  O   . ALA A 1 831  ? 96.124  128.877 75.410  1.00 47.96  ? 810  ALA A O   1 
ATOM   4842 C  CB  . ALA A 1 831  ? 98.351  131.136 77.043  1.00 47.96  ? 810  ALA A CB  1 
ATOM   4843 N  N   . ASP A 1 832  ? 96.018  131.113 75.378  1.00 52.49  ? 811  ASP A N   1 
ATOM   4844 C  CA  . ASP A 1 832  ? 95.207  131.194 74.163  1.00 52.49  ? 811  ASP A CA  1 
ATOM   4845 C  C   . ASP A 1 832  ? 96.101  131.673 73.020  1.00 52.49  ? 811  ASP A C   1 
ATOM   4846 O  O   . ASP A 1 832  ? 96.088  132.842 72.645  1.00 52.49  ? 811  ASP A O   1 
ATOM   4847 C  CB  . ASP A 1 832  ? 94.029  132.136 74.380  1.00 52.49  ? 811  ASP A CB  1 
ATOM   4848 C  CG  . ASP A 1 832  ? 93.005  132.074 73.260  1.00 52.49  ? 811  ASP A CG  1 
ATOM   4849 O  OD1 . ASP A 1 832  ? 93.150  131.242 72.342  1.00 52.49  ? 811  ASP A OD1 1 
ATOM   4850 O  OD2 . ASP A 1 832  ? 92.053  132.883 73.288  1.00 52.49  ? 811  ASP A OD2 1 
ATOM   4851 N  N   . TYR A 1 833  ? 96.823  130.735 72.417  1.00 40.81  ? 812  TYR A N   1 
ATOM   4852 C  CA  . TYR A 1 833  ? 97.888  131.031 71.462  1.00 40.81  ? 812  TYR A CA  1 
ATOM   4853 C  C   . TYR A 1 833  ? 97.502  131.658 70.122  1.00 40.81  ? 812  TYR A C   1 
ATOM   4854 O  O   . TYR A 1 833  ? 98.314  132.423 69.595  1.00 40.81  ? 812  TYR A O   1 
ATOM   4855 C  CB  . TYR A 1 833  ? 98.695  129.768 71.188  1.00 40.81  ? 812  TYR A CB  1 
ATOM   4856 C  CG  . TYR A 1 833  ? 99.524  129.354 72.352  1.00 40.81  ? 812  TYR A CG  1 
ATOM   4857 C  CD1 . TYR A 1 833  ? 100.718 129.989 72.627  1.00 40.81  ? 812  TYR A CD1 1 
ATOM   4858 C  CD2 . TYR A 1 833  ? 99.112  128.333 73.180  1.00 40.81  ? 812  TYR A CD2 1 
ATOM   4859 C  CE1 . TYR A 1 833  ? 101.482 129.610 73.697  1.00 40.81  ? 812  TYR A CE1 1 
ATOM   4860 C  CE2 . TYR A 1 833  ? 99.864  127.949 74.248  1.00 40.81  ? 812  TYR A CE2 1 
ATOM   4861 C  CZ  . TYR A 1 833  ? 101.045 128.589 74.504  1.00 40.81  ? 812  TYR A CZ  1 
ATOM   4862 O  OH  . TYR A 1 833  ? 101.782 128.191 75.584  1.00 40.81  ? 812  TYR A OH  1 
ATOM   4863 N  N   . PRO A 1 834  ? 96.355  131.362 69.491  1.00 53.45  ? 813  PRO A N   1 
ATOM   4864 C  CA  . PRO A 1 834  ? 95.985  132.193 68.335  1.00 53.45  ? 813  PRO A CA  1 
ATOM   4865 C  C   . PRO A 1 834  ? 95.666  133.625 68.709  1.00 53.45  ? 813  PRO A C   1 
ATOM   4866 O  O   . PRO A 1 834  ? 95.919  134.534 67.911  1.00 53.45  ? 813  PRO A O   1 
ATOM   4867 C  CB  . PRO A 1 834  ? 94.759  131.478 67.758  1.00 53.45  ? 813  PRO A CB  1 
ATOM   4868 C  CG  . PRO A 1 834  ? 94.915  130.106 68.165  1.00 53.45  ? 813  PRO A CG  1 
ATOM   4869 C  CD  . PRO A 1 834  ? 95.521  130.145 69.525  1.00 53.45  ? 813  PRO A CD  1 
ATOM   4870 N  N   . ASN A 1 835  ? 95.138  133.860 69.903  1.00 62.53  ? 814  ASN A N   1 
ATOM   4871 C  CA  . ASN A 1 835  ? 94.757  135.203 70.303  1.00 62.53  ? 814  ASN A CA  1 
ATOM   4872 C  C   . ASN A 1 835  ? 95.881  135.904 71.050  1.00 62.53  ? 814  ASN A C   1 
ATOM   4873 O  O   . ASN A 1 835  ? 96.181  137.067 70.771  1.00 62.53  ? 814  ASN A O   1 
ATOM   4874 C  CB  . ASN A 1 835  ? 93.495  135.138 71.156  1.00 62.53  ? 814  ASN A CB  1 
ATOM   4875 C  CG  . ASN A 1 835  ? 92.291  134.675 70.363  1.00 62.53  ? 814  ASN A CG  1 
ATOM   4876 O  OD1 . ASN A 1 835  ? 92.069  135.122 69.239  1.00 62.53  ? 814  ASN A OD1 1 
ATOM   4877 N  ND2 . ASN A 1 835  ? 91.522  133.753 70.931  1.00 62.53  ? 814  ASN A ND2 1 
ATOM   4878 N  N   . ILE A 1 836  ? 96.523  135.218 71.991  1.00 61.47  ? 815  ILE A N   1 
ATOM   4879 C  CA  . ILE A 1 836  ? 97.632  135.820 72.718  1.00 61.47  ? 815  ILE A CA  1 
ATOM   4880 C  C   . ILE A 1 836  ? 98.870  135.674 71.851  1.00 61.47  ? 815  ILE A C   1 
ATOM   4881 O  O   . ILE A 1 836  ? 99.598  134.682 71.937  1.00 61.47  ? 815  ILE A O   1 
ATOM   4882 C  CB  . ILE A 1 836  ? 97.823  135.168 74.099  1.00 61.47  ? 815  ILE A CB  1 
ATOM   4883 C  CG1 . ILE A 1 836  ? 96.533  135.285 74.898  1.00 61.47  ? 815  ILE A CG1 1 
ATOM   4884 C  CG2 . ILE A 1 836  ? 98.928  135.834 74.874  1.00 61.47  ? 815  ILE A CG2 1 
ATOM   4885 C  CD1 . ILE A 1 836  ? 96.509  134.444 76.143  1.00 61.47  ? 815  ILE A CD1 1 
ATOM   4886 N  N   . GLN A 1 837  ? 99.096  136.640 70.977  1.00 55.54  ? 816  GLN A N   1 
ATOM   4887 C  CA  . GLN A 1 837  ? 100.310 136.622 70.185  1.00 55.54  ? 816  GLN A CA  1 
ATOM   4888 C  C   . GLN A 1 837  ? 101.190 137.820 70.473  1.00 55.54  ? 816  GLN A C   1 
ATOM   4889 O  O   . GLN A 1 837  ? 102.365 137.641 70.798  1.00 55.54  ? 816  GLN A O   1 
ATOM   4890 C  CB  . GLN A 1 837  ? 99.989  136.550 68.692  1.00 55.54  ? 816  GLN A CB  1 
ATOM   4891 C  CG  . GLN A 1 837  ? 99.321  135.261 68.302  1.00 55.54  ? 816  GLN A CG  1 
ATOM   4892 C  CD  . GLN A 1 837  ? 99.132  135.123 66.815  1.00 55.54  ? 816  GLN A CD  1 
ATOM   4893 O  OE1 . GLN A 1 837  ? 99.496  136.005 66.050  1.00 55.54  ? 816  GLN A OE1 1 
ATOM   4894 N  NE2 . GLN A 1 837  ? 98.556  134.010 66.397  1.00 55.54  ? 816  GLN A NE2 1 
ATOM   4895 N  N   . HIS A 1 838  ? 100.642 139.039 70.407  1.00 57.00  ? 817  HIS A N   1 
ATOM   4896 C  CA  . HIS A 1 838  ? 101.429 140.245 70.641  1.00 57.00  ? 817  HIS A CA  1 
ATOM   4897 C  C   . HIS A 1 838  ? 101.912 140.368 72.080  1.00 57.00  ? 817  HIS A C   1 
ATOM   4898 O  O   . HIS A 1 838  ? 102.905 141.060 72.331  1.00 57.00  ? 817  HIS A O   1 
ATOM   4899 C  CB  . HIS A 1 838  ? 100.608 141.470 70.273  1.00 57.00  ? 817  HIS A CB  1 
ATOM   4900 C  CG  . HIS A 1 838  ? 99.417  141.680 71.152  1.00 57.00  ? 817  HIS A CG  1 
ATOM   4901 N  ND1 . HIS A 1 838  ? 98.255  140.952 71.016  1.00 57.00  ? 817  HIS A ND1 1 
ATOM   4902 C  CD2 . HIS A 1 838  ? 99.201  142.549 72.168  1.00 57.00  ? 817  HIS A CD2 1 
ATOM   4903 C  CE1 . HIS A 1 838  ? 97.378  141.358 71.915  1.00 57.00  ? 817  HIS A CE1 1 
ATOM   4904 N  NE2 . HIS A 1 838  ? 97.926  142.328 72.626  1.00 57.00  ? 817  HIS A NE2 1 
ATOM   4905 N  N   . LEU A 1 839  ? 101.239 139.706 73.024  1.00 51.61  ? 818  LEU A N   1 
ATOM   4906 C  CA  . LEU A 1 839  ? 101.726 139.676 74.394  1.00 51.61  ? 818  LEU A CA  1 
ATOM   4907 C  C   . LEU A 1 839  ? 103.002 138.862 74.520  1.00 51.61  ? 818  LEU A C   1 
ATOM   4908 O  O   . LEU A 1 839  ? 103.794 139.104 75.434  1.00 51.61  ? 818  LEU A O   1 
ATOM   4909 C  CB  . LEU A 1 839  ? 100.669 139.097 75.324  1.00 51.61  ? 818  LEU A CB  1 
ATOM   4910 C  CG  . LEU A 1 839  ? 99.339  139.829 75.325  1.00 51.61  ? 818  LEU A CG  1 
ATOM   4911 C  CD1 . LEU A 1 839  ? 98.415  139.180 76.325  1.00 51.61  ? 818  LEU A CD1 1 
ATOM   4912 C  CD2 . LEU A 1 839  ? 99.516  141.308 75.601  1.00 51.61  ? 818  LEU A CD2 1 
ATOM   4913 N  N   . LEU A 1 840  ? 103.206 137.881 73.643  1.00 54.70  ? 819  LEU A N   1 
ATOM   4914 C  CA  . LEU A 1 840  ? 104.462 137.146 73.647  1.00 54.70  ? 819  LEU A CA  1 
ATOM   4915 C  C   . LEU A 1 840  ? 105.611 138.047 73.226  1.00 54.70  ? 819  LEU A C   1 
ATOM   4916 O  O   . LEU A 1 840  ? 106.696 138.005 73.819  1.00 54.70  ? 819  LEU A O   1 
ATOM   4917 C  CB  . LEU A 1 840  ? 104.344 135.941 72.731  1.00 54.70  ? 819  LEU A CB  1 
ATOM   4918 C  CG  . LEU A 1 840  ? 103.324 134.936 73.240  1.00 54.70  ? 819  LEU A CG  1 
ATOM   4919 C  CD1 . LEU A 1 840  ? 102.906 133.973 72.171  1.00 54.70  ? 819  LEU A CD1 1 
ATOM   4920 C  CD2 . LEU A 1 840  ? 103.978 134.177 74.334  1.00 54.70  ? 819  LEU A CD2 1 
ATOM   4921 N  N   . TYR A 1 841  ? 105.371 138.907 72.244  1.00 62.95  ? 820  TYR A N   1 
ATOM   4922 C  CA  . TYR A 1 841  ? 106.385 139.871 71.857  1.00 62.95  ? 820  TYR A CA  1 
ATOM   4923 C  C   . TYR A 1 841  ? 106.586 140.919 72.935  1.00 62.95  ? 820  TYR A C   1 
ATOM   4924 O  O   . TYR A 1 841  ? 107.708 141.399 73.122  1.00 62.95  ? 820  TYR A O   1 
ATOM   4925 C  CB  . TYR A 1 841  ? 105.987 140.528 70.549  1.00 62.95  ? 820  TYR A CB  1 
ATOM   4926 C  CG  . TYR A 1 841  ? 105.828 139.526 69.454  1.00 62.95  ? 820  TYR A CG  1 
ATOM   4927 C  CD1 . TYR A 1 841  ? 106.915 139.054 68.754  1.00 62.95  ? 820  TYR A CD1 1 
ATOM   4928 C  CD2 . TYR A 1 841  ? 104.581 139.032 69.135  1.00 62.95  ? 820  TYR A CD2 1 
ATOM   4929 C  CE1 . TYR A 1 841  ? 106.752 138.127 67.758  1.00 62.95  ? 820  TYR A CE1 1 
ATOM   4930 C  CE2 . TYR A 1 841  ? 104.416 138.092 68.160  1.00 62.95  ? 820  TYR A CE2 1 
ATOM   4931 C  CZ  . TYR A 1 841  ? 105.504 137.652 67.470  1.00 62.95  ? 820  TYR A CZ  1 
ATOM   4932 O  OH  . TYR A 1 841  ? 105.348 136.723 66.481  1.00 62.95  ? 820  TYR A OH  1 
ATOM   4933 N  N   . ASP A 1 842  ? 105.526 141.272 73.666  1.00 68.07  ? 821  ASP A N   1 
ATOM   4934 C  CA  . ASP A 1 842  ? 105.664 142.264 74.726  1.00 68.07  ? 821  ASP A CA  1 
ATOM   4935 C  C   . ASP A 1 842  ? 106.445 141.705 75.910  1.00 68.07  ? 821  ASP A C   1 
ATOM   4936 O  O   . ASP A 1 842  ? 107.276 142.409 76.500  1.00 68.07  ? 821  ASP A O   1 
ATOM   4937 C  CB  . ASP A 1 842  ? 104.285 142.750 75.154  1.00 68.07  ? 821  ASP A CB  1 
ATOM   4938 C  CG  . ASP A 1 842  ? 104.350 143.906 76.117  1.00 68.07  ? 821  ASP A CG  1 
ATOM   4939 O  OD1 . ASP A 1 842  ? 104.774 145.004 75.708  1.00 68.07  ? 821  ASP A OD1 1 
ATOM   4940 O  OD2 . ASP A 1 842  ? 103.939 143.737 77.274  1.00 68.07  ? 821  ASP A OD2 1 
ATOM   4941 N  N   . LEU A 1 843  ? 106.197 140.440 76.259  1.00 51.39  ? 822  LEU A N   1 
ATOM   4942 C  CA  . LEU A 1 843  ? 106.962 139.767 77.305  1.00 51.39  ? 822  LEU A CA  1 
ATOM   4943 C  C   . LEU A 1 843  ? 108.431 139.673 76.921  1.00 51.39  ? 822  LEU A C   1 
ATOM   4944 O  O   . LEU A 1 843  ? 109.327 140.062 77.694  1.00 51.39  ? 822  LEU A O   1 
ATOM   4945 C  CB  . LEU A 1 843  ? 106.365 138.380 77.544  1.00 51.39  ? 822  LEU A CB  1 
ATOM   4946 C  CG  . LEU A 1 843  ? 106.823 137.460 78.669  1.00 51.39  ? 822  LEU A CG  1 
ATOM   4947 C  CD1 . LEU A 1 843  ? 105.661 136.667 79.147  1.00 51.39  ? 822  LEU A CD1 1 
ATOM   4948 C  CD2 . LEU A 1 843  ? 107.826 136.500 78.166  1.00 51.39  ? 822  LEU A CD2 1 
ATOM   4949 N  N   . HIS A 1 844  ? 108.691 139.202 75.703  1.00 57.21  ? 823  HIS A N   1 
ATOM   4950 C  CA  . HIS A 1 844  ? 110.055 139.085 75.221  1.00 57.21  ? 823  HIS A CA  1 
ATOM   4951 C  C   . HIS A 1 844  ? 110.734 140.439 75.061  1.00 57.21  ? 823  HIS A C   1 
ATOM   4952 O  O   . HIS A 1 844  ? 111.963 140.508 75.107  1.00 57.21  ? 823  HIS A O   1 
ATOM   4953 C  CB  . HIS A 1 844  ? 110.045 138.325 73.909  1.00 57.21  ? 823  HIS A CB  1 
ATOM   4954 C  CG  . HIS A 1 844  ? 111.402 138.013 73.381  1.00 57.21  ? 823  HIS A CG  1 
ATOM   4955 N  ND1 . HIS A 1 844  ? 112.236 137.101 73.985  1.00 57.21  ? 823  HIS A ND1 1 
ATOM   4956 C  CD2 . HIS A 1 844  ? 112.059 138.462 72.289  1.00 57.21  ? 823  HIS A CD2 1 
ATOM   4957 C  CE1 . HIS A 1 844  ? 113.358 137.019 73.297  1.00 57.21  ? 823  HIS A CE1 1 
ATOM   4958 N  NE2 . HIS A 1 844  ? 113.277 137.832 72.263  1.00 57.21  ? 823  HIS A NE2 1 
ATOM   4959 N  N   . ARG A 1 845  ? 109.969 141.517 74.902  1.00 68.61  ? 824  ARG A N   1 
ATOM   4960 C  CA  . ARG A 1 845  ? 110.563 142.844 74.995  1.00 68.61  ? 824  ARG A CA  1 
ATOM   4961 C  C   . ARG A 1 845  ? 110.881 143.237 76.431  1.00 68.61  ? 824  ARG A C   1 
ATOM   4962 O  O   . ARG A 1 845  ? 111.821 144.004 76.654  1.00 68.61  ? 824  ARG A O   1 
ATOM   4963 C  CB  . ARG A 1 845  ? 109.648 143.901 74.373  1.00 68.61  ? 824  ARG A CB  1 
ATOM   4964 C  CG  . ARG A 1 845  ? 109.689 143.982 72.868  1.00 68.61  ? 824  ARG A CG  1 
ATOM   4965 C  CD  . ARG A 1 845  ? 108.990 145.243 72.398  1.00 68.61  ? 824  ARG A CD  1 
ATOM   4966 N  NE  . ARG A 1 845  ? 107.548 145.210 72.609  1.00 68.61  ? 824  ARG A NE  1 
ATOM   4967 C  CZ  . ARG A 1 845  ? 106.673 144.816 71.690  1.00 68.61  ? 824  ARG A CZ  1 
ATOM   4968 N  NH1 . ARG A 1 845  ? 107.093 144.436 70.493  1.00 68.61  ? 824  ARG A NH1 1 
ATOM   4969 N  NH2 . ARG A 1 845  ? 105.374 144.818 71.958  1.00 68.61  ? 824  ARG A NH2 1 
ATOM   4970 N  N   . SER A 1 846  ? 110.105 142.757 77.409  1.00 55.23  ? 825  SER A N   1 
ATOM   4971 C  CA  . SER A 1 846  ? 110.393 143.108 78.798  1.00 55.23  ? 825  SER A CA  1 
ATOM   4972 C  C   . SER A 1 846  ? 111.650 142.416 79.307  1.00 55.23  ? 825  SER A C   1 
ATOM   4973 O  O   . SER A 1 846  ? 112.370 142.954 80.174  1.00 55.23  ? 825  SER A O   1 
ATOM   4974 C  CB  . SER A 1 846  ? 109.203 142.752 79.670  1.00 55.23  ? 825  SER A CB  1 
ATOM   4975 O  OG  . SER A 1 846  ? 108.992 141.363 79.639  1.00 55.23  ? 825  SER A OG  1 
ATOM   4976 N  N   . PHE A 1 847  ? 111.963 141.243 78.759  1.00 57.41  ? 826  PHE A N   1 
ATOM   4977 C  CA  . PHE A 1 847  ? 113.197 140.600 79.195  1.00 57.41  ? 826  PHE A CA  1 
ATOM   4978 C  C   . PHE A 1 847  ? 114.445 141.328 78.727  1.00 57.41  ? 826  PHE A C   1 
ATOM   4979 O  O   . PHE A 1 847  ? 115.518 141.092 79.285  1.00 57.41  ? 826  PHE A O   1 
ATOM   4980 C  CB  . PHE A 1 847  ? 113.225 139.156 78.742  1.00 57.41  ? 826  PHE A CB  1 
ATOM   4981 C  CG  . PHE A 1 847  ? 112.308 138.291 79.512  1.00 57.41  ? 826  PHE A CG  1 
ATOM   4982 C  CD1 . PHE A 1 847  ? 111.862 138.675 80.756  1.00 57.41  ? 826  PHE A CD1 1 
ATOM   4983 C  CD2 . PHE A 1 847  ? 111.863 137.113 78.989  1.00 57.41  ? 826  PHE A CD2 1 
ATOM   4984 C  CE1 . PHE A 1 847  ? 111.010 137.892 81.466  1.00 57.41  ? 826  PHE A CE1 1 
ATOM   4985 C  CE2 . PHE A 1 847  ? 111.000 136.329 79.692  1.00 57.41  ? 826  PHE A CE2 1 
ATOM   4986 C  CZ  . PHE A 1 847  ? 110.567 136.723 80.930  1.00 57.41  ? 826  PHE A CZ  1 
ATOM   4987 N  N   . SER A 1 848  ? 114.330 142.218 77.740  1.00 65.04  ? 827  SER A N   1 
ATOM   4988 C  CA  . SER A 1 848  ? 115.392 143.191 77.514  1.00 65.04  ? 827  SER A CA  1 
ATOM   4989 C  C   . SER A 1 848  ? 115.574 144.090 78.723  1.00 65.04  ? 827  SER A C   1 
ATOM   4990 O  O   . SER A 1 848  ? 116.698 144.494 79.031  1.00 65.04  ? 827  SER A O   1 
ATOM   4991 C  CB  . SER A 1 848  ? 115.093 144.040 76.281  1.00 65.04  ? 827  SER A CB  1 
ATOM   4992 O  OG  . SER A 1 848  ? 113.967 144.876 76.484  1.00 65.04  ? 827  SER A OG  1 
ATOM   4993 N  N   . ASN A 1 849  ? 114.488 144.399 79.427  1.00 70.20  ? 828  ASN A N   1 
ATOM   4994 C  CA  . ASN A 1 849  ? 114.543 145.260 80.595  1.00 70.20  ? 828  ASN A CA  1 
ATOM   4995 C  C   . ASN A 1 849  ? 114.829 144.488 81.872  1.00 70.20  ? 828  ASN A C   1 
ATOM   4996 O  O   . ASN A 1 849  ? 114.788 145.081 82.952  1.00 70.20  ? 828  ASN A O   1 
ATOM   4997 C  CB  . ASN A 1 849  ? 113.231 146.035 80.733  1.00 70.20  ? 828  ASN A CB  1 
ATOM   4998 C  CG  . ASN A 1 849  ? 113.404 147.380 81.409  1.00 70.20  ? 828  ASN A CG  1 
ATOM   4999 O  OD1 . ASN A 1 849  ? 112.498 148.210 81.383  1.00 70.20  ? 828  ASN A OD1 1 
ATOM   5000 N  ND2 . ASN A 1 849  ? 114.569 147.614 81.995  1.00 70.20  ? 828  ASN A ND2 1 
ATOM   5001 N  N   . VAL A 1 850  ? 115.090 143.179 81.784  1.00 65.41  ? 829  VAL A N   1 
ATOM   5002 C  CA  . VAL A 1 850  ? 115.580 142.445 82.961  1.00 65.41  ? 829  VAL A CA  1 
ATOM   5003 C  C   . VAL A 1 850  ? 116.960 142.936 83.403  1.00 65.41  ? 829  VAL A C   1 
ATOM   5004 O  O   . VAL A 1 850  ? 117.201 143.110 84.602  1.00 65.41  ? 829  VAL A O   1 
ATOM   5005 C  CB  . VAL A 1 850  ? 115.570 140.927 82.700  1.00 65.41  ? 829  VAL A CB  1 
ATOM   5006 C  CG1 . VAL A 1 850  ? 116.370 140.170 83.742  1.00 65.41  ? 829  VAL A CG1 1 
ATOM   5007 C  CG2 . VAL A 1 850  ? 114.179 140.437 82.783  1.00 65.41  ? 829  VAL A CG2 1 
ATOM   5008 N  N   . LYS A 1 851  ? 117.866 143.168 82.448  1.00 57.22  ? 830  LYS A N   1 
ATOM   5009 C  CA  . LYS A 1 851  ? 119.260 143.691 82.448  1.00 57.22  ? 830  LYS A CA  1 
ATOM   5010 C  C   . LYS A 1 851  ? 120.337 142.651 82.789  1.00 57.22  ? 830  LYS A C   1 
ATOM   5011 O  O   . LYS A 1 851  ? 121.534 142.990 82.738  1.00 57.22  ? 830  LYS A O   1 
ATOM   5012 C  CB  . LYS A 1 851  ? 119.494 144.929 83.345  1.00 57.22  ? 830  LYS A CB  1 
ATOM   5013 C  CG  . LYS A 1 851  ? 119.849 144.715 84.825  1.00 57.22  ? 830  LYS A CG  1 
ATOM   5014 C  CD  . LYS A 1 851  ? 119.902 146.021 85.579  1.00 57.22  ? 830  LYS A CD  1 
ATOM   5015 C  CE  . LYS A 1 851  ? 120.204 145.780 87.036  1.00 57.22  ? 830  LYS A CE  1 
ATOM   5016 N  NZ  . LYS A 1 851  ? 121.582 145.264 87.208  1.00 57.22  ? 830  LYS A NZ  1 
ATOM   5017 N  N   . TYR A 1 852  ? 119.984 141.396 83.061  1.00 41.98  ? 831  TYR A N   1 
ATOM   5018 C  CA  . TYR A 1 852  ? 120.980 140.351 83.265  1.00 41.98  ? 831  TYR A CA  1 
ATOM   5019 C  C   . TYR A 1 852  ? 121.016 139.302 82.160  1.00 41.98  ? 831  TYR A C   1 
ATOM   5020 O  O   . TYR A 1 852  ? 121.678 138.282 82.328  1.00 41.98  ? 831  TYR A O   1 
ATOM   5021 C  CB  . TYR A 1 852  ? 120.749 139.642 84.597  1.00 41.98  ? 831  TYR A CB  1 
ATOM   5022 C  CG  . TYR A 1 852  ? 121.241 140.382 85.800  1.00 41.98  ? 831  TYR A CG  1 
ATOM   5023 C  CD1 . TYR A 1 852  ? 122.131 141.434 85.675  1.00 41.98  ? 831  TYR A CD1 1 
ATOM   5024 C  CD2 . TYR A 1 852  ? 120.835 140.014 87.069  1.00 41.98  ? 831  TYR A CD2 1 
ATOM   5025 C  CE1 . TYR A 1 852  ? 122.594 142.110 86.793  1.00 41.98  ? 831  TYR A CE1 1 
ATOM   5026 C  CE2 . TYR A 1 852  ? 121.285 140.685 88.184  1.00 41.98  ? 831  TYR A CE2 1 
ATOM   5027 C  CZ  . TYR A 1 852  ? 122.163 141.728 88.041  1.00 41.98  ? 831  TYR A CZ  1 
ATOM   5028 O  OH  . TYR A 1 852  ? 122.611 142.384 89.157  1.00 41.98  ? 831  TYR A OH  1 
ATOM   5029 N  N   . VAL A 1 853  ? 120.370 139.534 81.024  1.00 39.02  ? 832  VAL A N   1 
ATOM   5030 C  CA  . VAL A 1 853  ? 120.003 138.420 80.158  1.00 39.02  ? 832  VAL A CA  1 
ATOM   5031 C  C   . VAL A 1 853  ? 121.001 138.058 79.062  1.00 39.02  ? 832  VAL A C   1 
ATOM   5032 O  O   . VAL A 1 853  ? 120.661 137.254 78.189  1.00 39.02  ? 832  VAL A O   1 
ATOM   5033 C  CB  . VAL A 1 853  ? 118.636 138.687 79.518  1.00 39.02  ? 832  VAL A CB  1 
ATOM   5034 C  CG1 . VAL A 1 853  ? 117.568 138.594 80.550  1.00 39.02  ? 832  VAL A CG1 1 
ATOM   5035 C  CG2 . VAL A 1 853  ? 118.637 140.059 78.912  1.00 39.02  ? 832  VAL A CG2 1 
ATOM   5036 N  N   . MET A 1 854  ? 122.203 138.650 79.078  1.00 52.28  ? 833  MET A N   1 
ATOM   5037 C  CA  . MET A 1 854  ? 123.345 138.268 78.222  1.00 52.28  ? 833  MET A CA  1 
ATOM   5038 C  C   . MET A 1 854  ? 122.970 138.324 76.738  1.00 52.28  ? 833  MET A C   1 
ATOM   5039 O  O   . MET A 1 854  ? 122.831 137.290 76.088  1.00 52.28  ? 833  MET A O   1 
ATOM   5040 C  CB  . MET A 1 854  ? 123.863 136.863 78.559  1.00 52.28  ? 833  MET A CB  1 
ATOM   5041 C  CG  . MET A 1 854  ? 125.271 136.566 78.061  1.00 52.28  ? 833  MET A CG  1 
ATOM   5042 S  SD  . MET A 1 854  ? 125.585 134.799 77.947  1.00 52.28  ? 833  MET A SD  1 
ATOM   5043 C  CE  . MET A 1 854  ? 125.473 134.280 79.618  1.00 52.28  ? 833  MET A CE  1 
ATOM   5044 N  N   . LEU A 1 855  ? 122.756 139.548 76.242  1.00 63.91  ? 834  LEU A N   1 
ATOM   5045 C  CA  . LEU A 1 855  ? 121.794 139.804 75.169  1.00 63.91  ? 834  LEU A CA  1 
ATOM   5046 C  C   . LEU A 1 855  ? 121.997 139.032 73.866  1.00 63.91  ? 834  LEU A C   1 
ATOM   5047 O  O   . LEU A 1 855  ? 121.377 137.978 73.695  1.00 63.91  ? 834  LEU A O   1 
ATOM   5048 C  CB  . LEU A 1 855  ? 121.810 141.302 74.846  1.00 63.91  ? 834  LEU A CB  1 
ATOM   5049 C  CG  . LEU A 1 855  ? 120.923 142.334 75.556  1.00 63.91  ? 834  LEU A CG  1 
ATOM   5050 C  CD1 . LEU A 1 855  ? 119.482 142.125 75.218  1.00 63.91  ? 834  LEU A CD1 1 
ATOM   5051 C  CD2 . LEU A 1 855  ? 121.090 142.320 77.061  1.00 63.91  ? 834  LEU A CD2 1 
ATOM   5052 N  N   . GLU A 1 856  ? 122.918 139.485 73.011  1.00 101.25 ? 835  GLU A N   1 
ATOM   5053 C  CA  . GLU A 1 856  ? 123.273 138.880 71.724  1.00 101.25 ? 835  GLU A CA  1 
ATOM   5054 C  C   . GLU A 1 856  ? 124.327 139.816 71.151  1.00 101.25 ? 835  GLU A C   1 
ATOM   5055 O  O   . GLU A 1 856  ? 124.686 140.793 71.814  1.00 101.25 ? 835  GLU A O   1 
ATOM   5056 C  CB  . GLU A 1 856  ? 122.083 138.758 70.757  1.00 101.25 ? 835  GLU A CB  1 
ATOM   5057 C  CG  . GLU A 1 856  ? 122.206 137.679 69.682  1.00 101.25 ? 835  GLU A CG  1 
ATOM   5058 C  CD  . GLU A 1 856  ? 121.005 137.638 68.764  1.00 101.25 ? 835  GLU A CD  1 
ATOM   5059 O  OE1 . GLU A 1 856  ? 120.129 138.512 68.893  1.00 101.25 ? 835  GLU A OE1 1 
ATOM   5060 O  OE2 . GLU A 1 856  ? 120.925 136.721 67.924  1.00 101.25 ? 835  GLU A OE2 1 
ATOM   5061 N  N   . GLU A 1 857  ? 124.835 139.567 69.949  1.00 96.41  ? 836  GLU A N   1 
ATOM   5062 C  CA  . GLU A 1 857  ? 125.452 140.641 69.186  1.00 96.41  ? 836  GLU A CA  1 
ATOM   5063 C  C   . GLU A 1 857  ? 124.372 141.290 68.316  1.00 96.41  ? 836  GLU A C   1 
ATOM   5064 O  O   . GLU A 1 857  ? 123.553 140.592 67.707  1.00 96.41  ? 836  GLU A O   1 
ATOM   5065 C  CB  . GLU A 1 857  ? 126.646 140.145 68.358  1.00 96.41  ? 836  GLU A CB  1 
ATOM   5066 C  CG  . GLU A 1 857  ? 126.369 139.313 67.109  1.00 96.41  ? 836  GLU A CG  1 
ATOM   5067 C  CD  . GLU A 1 857  ? 126.218 137.834 67.383  1.00 96.41  ? 836  GLU A CD  1 
ATOM   5068 O  OE1 . GLU A 1 857  ? 126.044 137.445 68.558  1.00 96.41  ? 836  GLU A OE1 1 
ATOM   5069 O  OE2 . GLU A 1 857  ? 126.266 137.050 66.414  1.00 96.41  ? 836  GLU A OE2 1 
ATOM   5070 N  N   . ASN A 1 858  ? 124.292 142.621 68.348  1.00 99.91  ? 837  ASN A N   1 
ATOM   5071 C  CA  . ASN A 1 858  ? 125.035 143.458 69.280  1.00 99.91  ? 837  ASN A CA  1 
ATOM   5072 C  C   . ASN A 1 858  ? 124.194 143.845 70.503  1.00 99.91  ? 837  ASN A C   1 
ATOM   5073 O  O   . ASN A 1 858  ? 124.641 143.662 71.631  1.00 99.91  ? 837  ASN A O   1 
ATOM   5074 C  CB  . ASN A 1 858  ? 125.587 144.691 68.552  1.00 99.91  ? 837  ASN A CB  1 
ATOM   5075 C  CG  . ASN A 1 858  ? 124.530 145.442 67.766  1.00 99.91  ? 837  ASN A CG  1 
ATOM   5076 O  OD1 . ASN A 1 858  ? 123.346 145.111 67.814  1.00 99.91  ? 837  ASN A OD1 1 
ATOM   5077 N  ND2 . ASN A 1 858  ? 124.955 146.466 67.039  1.00 99.91  ? 837  ASN A ND2 1 
ATOM   5078 N  N   . LYS A 1 859  ? 122.995 144.405 70.293  1.00 110.92 ? 838  LYS A N   1 
ATOM   5079 C  CA  . LYS A 1 859  ? 122.029 144.630 71.373  1.00 110.92 ? 838  LYS A CA  1 
ATOM   5080 C  C   . LYS A 1 859  ? 120.677 144.111 70.898  1.00 110.92 ? 838  LYS A C   1 
ATOM   5081 O  O   . LYS A 1 859  ? 119.808 144.898 70.531  1.00 110.92 ? 838  LYS A O   1 
ATOM   5082 C  CB  . LYS A 1 859  ? 121.936 146.114 71.758  1.00 110.92 ? 838  LYS A CB  1 
ATOM   5083 C  CG  . LYS A 1 859  ? 123.031 146.659 72.661  1.00 110.92 ? 838  LYS A CG  1 
ATOM   5084 C  CD  . LYS A 1 859  ? 124.279 147.067 71.893  1.00 110.92 ? 838  LYS A CD  1 
ATOM   5085 C  CE  . LYS A 1 859  ? 125.294 147.731 72.806  1.00 110.92 ? 838  LYS A CE  1 
ATOM   5086 N  NZ  . LYS A 1 859  ? 126.552 148.070 72.096  1.00 110.92 ? 838  LYS A NZ  1 
ATOM   5087 N  N   . GLN A 1 860  ? 120.474 142.801 70.974  1.00 78.31  ? 839  GLN A N   1 
ATOM   5088 C  CA  . GLN A 1 860  ? 119.232 142.159 70.559  1.00 78.31  ? 839  GLN A CA  1 
ATOM   5089 C  C   . GLN A 1 860  ? 119.032 140.958 71.473  1.00 78.31  ? 839  GLN A C   1 
ATOM   5090 O  O   . GLN A 1 860  ? 119.886 140.652 72.301  1.00 78.31  ? 839  GLN A O   1 
ATOM   5091 C  CB  . GLN A 1 860  ? 119.276 141.733 69.082  1.00 78.31  ? 839  GLN A CB  1 
ATOM   5092 C  CG  . GLN A 1 860  ? 119.385 142.841 68.008  1.00 78.31  ? 839  GLN A CG  1 
ATOM   5093 C  CD  . GLN A 1 860  ? 118.142 143.703 67.876  1.00 78.31  ? 839  GLN A CD  1 
ATOM   5094 O  OE1 . GLN A 1 860  ? 118.121 144.864 68.279  1.00 78.31  ? 839  GLN A OE1 1 
ATOM   5095 N  NE2 . GLN A 1 860  ? 117.108 143.144 67.270  1.00 78.31  ? 839  GLN A NE2 1 
ATOM   5096 N  N   . LEU A 1 861  ? 117.922 140.252 71.315  1.00 56.10  ? 840  LEU A N   1 
ATOM   5097 C  CA  . LEU A 1 861  ? 117.646 139.110 72.172  1.00 56.10  ? 840  LEU A CA  1 
ATOM   5098 C  C   . LEU A 1 861  ? 117.585 137.830 71.353  1.00 56.10  ? 840  LEU A C   1 
ATOM   5099 O  O   . LEU A 1 861  ? 117.364 137.878 70.139  1.00 56.10  ? 840  LEU A O   1 
ATOM   5100 C  CB  . LEU A 1 861  ? 116.328 139.287 72.939  1.00 56.10  ? 840  LEU A CB  1 
ATOM   5101 C  CG  . LEU A 1 861  ? 116.324 140.207 74.152  1.00 56.10  ? 840  LEU A CG  1 
ATOM   5102 C  CD1 . LEU A 1 861  ? 116.099 141.634 73.712  1.00 56.10  ? 840  LEU A CD1 1 
ATOM   5103 C  CD2 . LEU A 1 861  ? 115.289 139.771 75.151  1.00 56.10  ? 840  LEU A CD2 1 
ATOM   5104 N  N   . PRO A 1 862  ? 117.806 136.668 71.973  1.00 50.89  ? 841  PRO A N   1 
ATOM   5105 C  CA  . PRO A 1 862  ? 117.637 135.403 71.248  1.00 50.89  ? 841  PRO A CA  1 
ATOM   5106 C  C   . PRO A 1 862  ? 116.179 135.184 70.885  1.00 50.89  ? 841  PRO A C   1 
ATOM   5107 O  O   . PRO A 1 862  ? 115.301 135.259 71.745  1.00 50.89  ? 841  PRO A O   1 
ATOM   5108 C  CB  . PRO A 1 862  ? 118.127 134.352 72.247  1.00 50.89  ? 841  PRO A CB  1 
ATOM   5109 C  CG  . PRO A 1 862  ? 119.038 135.074 73.122  1.00 50.89  ? 841  PRO A CG  1 
ATOM   5110 C  CD  . PRO A 1 862  ? 118.467 136.442 73.268  1.00 50.89  ? 841  PRO A CD  1 
ATOM   5111 N  N   . LYS A 1 863  ? 115.934 134.888 69.612  1.00 42.29  ? 842  LYS A N   1 
ATOM   5112 C  CA  . LYS A 1 863  ? 114.589 134.971 69.059  1.00 42.98  ? 842  LYS A CA  1 
ATOM   5113 C  C   . LYS A 1 863  ? 113.691 133.846 69.566  1.00 40.07  ? 842  LYS A C   1 
ATOM   5114 O  O   . LYS A 1 863  ? 114.104 132.693 69.688  1.00 39.42  ? 842  LYS A O   1 
ATOM   5115 C  CB  . LYS A 1 863  ? 114.658 134.966 67.534  1.00 93.64  ? 842  LYS A CB  1 
ATOM   5116 C  CG  . LYS A 1 863  ? 115.303 136.224 66.970  1.00 93.64  ? 842  LYS A CG  1 
ATOM   5117 C  CD  . LYS A 1 863  ? 115.643 136.107 65.488  1.00 93.64  ? 842  LYS A CD  1 
ATOM   5118 C  CE  . LYS A 1 863  ? 114.432 136.191 64.591  1.00 93.64  ? 842  LYS A CE  1 
ATOM   5119 N  NZ  . LYS A 1 863  ? 114.766 136.177 63.146  1.00 93.64  ? 842  LYS A NZ  1 
ATOM   5120 N  N   . MET A 1 864  ? 112.460 134.220 69.891  1.00 38.17  ? 843  MET A N   1 
ATOM   5121 C  CA  . MET A 1 864  ? 111.380 133.325 70.264  1.00 36.59  ? 843  MET A CA  1 
ATOM   5122 C  C   . MET A 1 864  ? 111.014 132.436 69.077  1.00 34.58  ? 843  MET A C   1 
ATOM   5123 O  O   . MET A 1 864  ? 111.322 132.744 67.929  1.00 33.23  ? 843  MET A O   1 
ATOM   5124 C  CB  . MET A 1 864  ? 110.190 134.183 70.727  1.00 94.18  ? 843  MET A CB  1 
ATOM   5125 C  CG  . MET A 1 864  ? 108.964 133.486 71.266  1.00 94.18  ? 843  MET A CG  1 
ATOM   5126 S  SD  . MET A 1 864  ? 107.638 134.602 71.696  1.00 94.18  ? 843  MET A SD  1 
ATOM   5127 C  CE  . MET A 1 864  ? 108.256 135.187 73.250  1.00 94.18  ? 843  MET A CE  1 
ATOM   5128 N  N   . TRP A 1 865  ? 110.350 131.310 69.355  1.00 35.06  ? 844  TRP A N   1 
ATOM   5129 C  CA  . TRP A 1 865  ? 109.828 130.487 68.274  1.00 34.93  ? 844  TRP A CA  1 
ATOM   5130 C  C   . TRP A 1 865  ? 108.717 131.164 67.482  1.00 36.60  ? 844  TRP A C   1 
ATOM   5131 O  O   . TRP A 1 865  ? 108.448 130.750 66.350  1.00 36.69  ? 844  TRP A O   1 
ATOM   5132 C  CB  . TRP A 1 865  ? 109.333 129.161 68.816  1.00 83.97  ? 844  TRP A CB  1 
ATOM   5133 C  CG  . TRP A 1 865  ? 108.291 129.259 69.848  1.00 83.97  ? 844  TRP A CG  1 
ATOM   5134 C  CD1 . TRP A 1 865  ? 108.483 129.353 71.182  1.00 83.97  ? 844  TRP A CD1 1 
ATOM   5135 C  CD2 . TRP A 1 865  ? 106.883 129.222 69.647  1.00 83.97  ? 844  TRP A CD2 1 
ATOM   5136 N  NE1 . TRP A 1 865  ? 107.281 129.396 71.833  1.00 83.97  ? 844  TRP A NE1 1 
ATOM   5137 C  CE2 . TRP A 1 865  ? 106.280 129.313 70.907  1.00 83.97  ? 844  TRP A CE2 1 
ATOM   5138 C  CE3 . TRP A 1 865  ? 106.074 129.131 68.522  1.00 83.97  ? 844  TRP A CE3 1 
ATOM   5139 C  CZ2 . TRP A 1 865  ? 104.909 129.316 71.074  1.00 83.97  ? 844  TRP A CZ2 1 
ATOM   5140 C  CZ3 . TRP A 1 865  ? 104.713 129.128 68.690  1.00 83.97  ? 844  TRP A CZ3 1 
ATOM   5141 C  CH2 . TRP A 1 865  ? 104.143 129.218 69.954  1.00 83.97  ? 844  TRP A CH2 1 
ATOM   5142 N  N   . LEU A 1 866  ? 108.071 132.193 68.037  1.00 37.44  ? 845  LEU A N   1 
ATOM   5143 C  CA  . LEU A 1 866  ? 107.201 133.044 67.232  1.00 38.65  ? 845  LEU A CA  1 
ATOM   5144 C  C   . LEU A 1 866  ? 107.968 133.735 66.122  1.00 38.28  ? 845  LEU A C   1 
ATOM   5145 O  O   . LEU A 1 866  ? 107.419 133.972 65.044  1.00 38.29  ? 845  LEU A O   1 
ATOM   5146 C  CB  . LEU A 1 866  ? 106.526 134.105 68.094  1.00 90.11  ? 845  LEU A CB  1 
ATOM   5147 C  CG  . LEU A 1 866  ? 105.132 133.885 68.666  1.00 90.11  ? 845  LEU A CG  1 
ATOM   5148 C  CD1 . LEU A 1 866  ? 104.134 133.805 67.542  1.00 90.11  ? 845  LEU A CD1 1 
ATOM   5149 C  CD2 . LEU A 1 866  ? 105.081 132.644 69.496  1.00 90.11  ? 845  LEU A CD2 1 
ATOM   5150 N  N   . HIS A 1 867  ? 109.229 134.066 66.365  1.00 38.02  ? 846  HIS A N   1 
ATOM   5151 C  CA  . HIS A 1 867  ? 110.004 134.777 65.362  1.00 38.27  ? 846  HIS A CA  1 
ATOM   5152 C  C   . HIS A 1 867  ? 110.372 133.864 64.206  1.00 36.90  ? 846  HIS A C   1 
ATOM   5153 O  O   . HIS A 1 867  ? 110.160 134.214 63.042  1.00 37.74  ? 846  HIS A O   1 
ATOM   5154 C  CB  . HIS A 1 867  ? 111.247 135.372 66.008  1.00 78.96  ? 846  HIS A CB  1 
ATOM   5155 C  CG  . HIS A 1 867  ? 110.965 136.524 66.919  1.00 78.96  ? 846  HIS A CG  1 
ATOM   5156 N  ND1 . HIS A 1 867  ? 111.884 137.012 67.819  1.00 78.96  ? 846  HIS A ND1 1 
ATOM   5157 C  CD2 . HIS A 1 867  ? 109.869 137.302 67.043  1.00 78.96  ? 846  HIS A CD2 1 
ATOM   5158 C  CE1 . HIS A 1 867  ? 111.354 138.026 68.478  1.00 78.96  ? 846  HIS A CE1 1 
ATOM   5159 N  NE2 . HIS A 1 867  ? 110.132 138.224 68.024  1.00 78.96  ? 846  HIS A NE2 1 
ATOM   5160 N  N   . TYR A 1 868  ? 110.923 132.686 64.508  1.00 35.22  ? 847  TYR A N   1 
ATOM   5161 C  CA  . TYR A 1 868  ? 111.281 131.723 63.470  1.00 33.75  ? 847  TYR A CA  1 
ATOM   5162 C  C   . TYR A 1 868  ? 110.057 131.193 62.743  1.00 34.39  ? 847  TYR A C   1 
ATOM   5163 O  O   . TYR A 1 868  ? 110.113 130.939 61.536  1.00 41.16  ? 847  TYR A O   1 
ATOM   5164 C  CB  . TYR A 1 868  ? 112.070 130.578 64.092  1.00 74.72  ? 847  TYR A CB  1 
ATOM   5165 C  CG  . TYR A 1 868  ? 113.483 130.941 64.461  1.00 74.72  ? 847  TYR A CG  1 
ATOM   5166 C  CD1 . TYR A 1 868  ? 114.160 131.933 63.791  1.00 74.72  ? 847  TYR A CD1 1 
ATOM   5167 C  CD2 . TYR A 1 868  ? 114.112 130.336 65.519  1.00 74.72  ? 847  TYR A CD2 1 
ATOM   5168 C  CE1 . TYR A 1 868  ? 115.450 132.266 64.138  1.00 74.72  ? 847  TYR A CE1 1 
ATOM   5169 C  CE2 . TYR A 1 868  ? 115.390 130.664 65.877  1.00 74.72  ? 847  TYR A CE2 1 
ATOM   5170 C  CZ  . TYR A 1 868  ? 116.052 131.631 65.189  1.00 74.72  ? 847  TYR A CZ  1 
ATOM   5171 O  OH  . TYR A 1 868  ? 117.332 131.963 65.542  1.00 74.72  ? 847  TYR A OH  1 
ATOM   5172 N  N   . PHE A 1 869  ? 108.940 131.062 63.449  1.00 34.96  ? 848  PHE A N   1 
ATOM   5173 C  CA  . PHE A 1 869  ? 107.715 130.571 62.832  1.00 35.74  ? 848  PHE A CA  1 
ATOM   5174 C  C   . PHE A 1 869  ? 107.097 131.615 61.908  1.00 37.37  ? 848  PHE A C   1 
ATOM   5175 O  O   . PHE A 1 869  ? 106.767 131.318 60.750  1.00 38.68  ? 848  PHE A O   1 
ATOM   5176 C  CB  . PHE A 1 869  ? 106.756 130.165 63.936  1.00 77.50  ? 848  PHE A CB  1 
ATOM   5177 C  CG  . PHE A 1 869  ? 105.446 129.725 63.454  1.00 77.50  ? 848  PHE A CG  1 
ATOM   5178 C  CD1 . PHE A 1 869  ? 105.324 128.590 62.712  1.00 77.50  ? 848  PHE A CD1 1 
ATOM   5179 C  CD2 . PHE A 1 869  ? 104.316 130.413 63.802  1.00 77.50  ? 848  PHE A CD2 1 
ATOM   5180 C  CE1 . PHE A 1 869  ? 104.094 128.164 62.282  1.00 77.50  ? 848  PHE A CE1 1 
ATOM   5181 C  CE2 . PHE A 1 869  ? 103.090 129.990 63.377  1.00 77.50  ? 848  PHE A CE2 1 
ATOM   5182 C  CZ  . PHE A 1 869  ? 102.984 128.859 62.620  1.00 77.50  ? 848  PHE A CZ  1 
ATOM   5183 N  N   . ARG A 1 870  ? 106.953 132.849 62.405  1.00 39.07  ? 849  ARG A N   1 
ATOM   5184 C  CA  . ARG A 1 870  ? 106.408 133.945 61.611  1.00 40.31  ? 849  ARG A CA  1 
ATOM   5185 C  C   . ARG A 1 870  ? 107.303 134.269 60.427  1.00 39.42  ? 849  ARG A C   1 
ATOM   5186 O  O   . ARG A 1 870  ? 106.817 134.551 59.325  1.00 39.67  ? 849  ARG A O   1 
ATOM   5187 C  CB  . ARG A 1 870  ? 106.233 135.168 62.503  1.00 84.67  ? 849  ARG A CB  1 
ATOM   5188 C  CG  . ARG A 1 870  ? 105.701 136.379 61.814  1.00 84.67  ? 849  ARG A CG  1 
ATOM   5189 C  CD  . ARG A 1 870  ? 105.517 137.550 62.760  1.00 84.67  ? 849  ARG A CD  1 
ATOM   5190 N  NE  . ARG A 1 870  ? 106.760 138.011 63.373  1.00 84.67  ? 849  ARG A NE  1 
ATOM   5191 C  CZ  . ARG A 1 870  ? 107.607 138.865 62.812  1.00 84.67  ? 849  ARG A CZ  1 
ATOM   5192 N  NH1 . ARG A 1 870  ? 107.359 139.355 61.612  1.00 84.67  ? 849  ARG A NH1 1 
ATOM   5193 N  NH2 . ARG A 1 870  ? 108.711 139.221 63.445  1.00 84.67  ? 849  ARG A NH2 1 
ATOM   5194 N  N   . ASP A 1 871  ? 108.614 134.197 60.633  1.00 38.14  ? 850  ASP A N   1 
ATOM   5195 C  CA  . ASP A 1 871  ? 109.565 134.389 59.549  1.00 37.48  ? 850  ASP A CA  1 
ATOM   5196 C  C   . ASP A 1 871  ? 109.451 133.278 58.512  1.00 36.56  ? 850  ASP A C   1 
ATOM   5197 O  O   . ASP A 1 871  ? 109.603 133.536 57.309  1.00 42.50  ? 850  ASP A O   1 
ATOM   5198 C  CB  . ASP A 1 871  ? 110.972 134.446 60.134  1.00 94.23  ? 850  ASP A CB  1 
ATOM   5199 C  CG  . ASP A 1 871  ? 111.991 135.007 59.179  1.00 94.23  ? 850  ASP A CG  1 
ATOM   5200 O  OD1 . ASP A 1 871  ? 111.636 135.408 58.055  1.00 94.23  ? 850  ASP A OD1 1 
ATOM   5201 O  OD2 . ASP A 1 871  ? 113.174 135.046 59.570  1.00 94.23  ? 850  ASP A OD2 1 
ATOM   5202 N  N   . TRP A 1 872  ? 109.155 132.052 58.950  1.00 57.49  ? 851  TRP A N   1 
ATOM   5203 C  CA  . TRP A 1 872  ? 108.992 130.956 58.003  1.00 57.97  ? 851  TRP A CA  1 
ATOM   5204 C  C   . TRP A 1 872  ? 107.757 131.148 57.139  1.00 58.37  ? 851  TRP A C   1 
ATOM   5205 O  O   . TRP A 1 872  ? 107.822 130.991 55.913  1.00 57.32  ? 851  TRP A O   1 
ATOM   5206 C  CB  . TRP A 1 872  ? 108.917 129.627 58.738  1.00 78.17  ? 851  TRP A CB  1 
ATOM   5207 C  CG  . TRP A 1 872  ? 108.788 128.489 57.811  1.00 78.17  ? 851  TRP A CG  1 
ATOM   5208 C  CD1 . TRP A 1 872  ? 109.712 128.061 56.919  1.00 78.17  ? 851  TRP A CD1 1 
ATOM   5209 C  CD2 . TRP A 1 872  ? 107.657 127.634 57.658  1.00 78.17  ? 851  TRP A CD2 1 
ATOM   5210 N  NE1 . TRP A 1 872  ? 109.235 126.983 56.225  1.00 78.17  ? 851  TRP A NE1 1 
ATOM   5211 C  CE2 . TRP A 1 872  ? 107.971 126.704 56.664  1.00 78.17  ? 851  TRP A CE2 1 
ATOM   5212 C  CE3 . TRP A 1 872  ? 106.410 127.562 58.270  1.00 78.17  ? 851  TRP A CE3 1 
ATOM   5213 C  CZ2 . TRP A 1 872  ? 107.085 125.724 56.264  1.00 78.17  ? 851  TRP A CZ2 1 
ATOM   5214 C  CZ3 . TRP A 1 872  ? 105.537 126.582 57.874  1.00 78.17  ? 851  TRP A CZ3 1 
ATOM   5215 C  CH2 . TRP A 1 872  ? 105.874 125.681 56.881  1.00 78.17  ? 851  TRP A CH2 1 
ATOM   5216 N  N   . LEU A 1 873  ? 106.623 131.498 57.754  1.00 42.83  ? 852  LEU A N   1 
ATOM   5217 C  CA  . LEU A 1 873  ? 105.409 131.691 56.963  1.00 44.10  ? 852  LEU A CA  1 
ATOM   5218 C  C   . LEU A 1 873  ? 105.511 132.899 56.037  1.00 44.81  ? 852  LEU A C   1 
ATOM   5219 O  O   . LEU A 1 873  ? 104.963 132.868 54.925  1.00 45.67  ? 852  LEU A O   1 
ATOM   5220 C  CB  . LEU A 1 873  ? 104.194 131.830 57.870  1.00 78.63  ? 852  LEU A CB  1 
ATOM   5221 C  CG  . LEU A 1 873  ? 103.731 130.594 58.634  1.00 78.63  ? 852  LEU A CG  1 
ATOM   5222 C  CD1 . LEU A 1 873  ? 102.582 130.939 59.544  1.00 78.63  ? 852  LEU A CD1 1 
ATOM   5223 C  CD2 . LEU A 1 873  ? 103.323 129.518 57.677  1.00 78.63  ? 852  LEU A CD2 1 
ATOM   5224 N  N   . GLN A 1 874  ? 106.213 133.953 56.466  1.00 44.81  ? 853  GLN A N   1 
ATOM   5225 C  CA  . GLN A 1 874  ? 106.513 135.057 55.556  1.00 45.61  ? 853  GLN A CA  1 
ATOM   5226 C  C   . GLN A 1 874  ? 107.357 134.588 54.376  1.00 45.84  ? 853  GLN A C   1 
ATOM   5227 O  O   . GLN A 1 874  ? 107.128 135.010 53.232  1.00 47.18  ? 853  GLN A O   1 
ATOM   5228 C  CB  . GLN A 1 874  ? 107.221 136.184 56.306  1.00 93.14  ? 853  GLN A CB  1 
ATOM   5229 C  CG  . GLN A 1 874  ? 107.743 137.301 55.410  1.00 93.14  ? 853  GLN A CG  1 
ATOM   5230 C  CD  . GLN A 1 874  ? 106.659 138.074 54.689  1.00 93.14  ? 853  GLN A CD  1 
ATOM   5231 O  OE1 . GLN A 1 874  ? 106.306 137.763 53.558  1.00 93.14  ? 853  GLN A OE1 1 
ATOM   5232 N  NE2 . GLN A 1 874  ? 106.195 139.148 55.304  1.00 93.14  ? 853  GLN A NE2 1 
ATOM   5233 N  N   . GLY A 1 875  ? 108.311 133.687 54.629  1.00 40.41  ? 854  GLY A N   1 
ATOM   5234 C  CA  . GLY A 1 875  ? 109.116 133.146 53.542  1.00 40.19  ? 854  GLY A CA  1 
ATOM   5235 C  C   . GLY A 1 875  ? 108.305 132.347 52.539  1.00 41.43  ? 854  GLY A C   1 
ATOM   5236 O  O   . GLY A 1 875  ? 108.537 132.434 51.328  1.00 41.49  ? 854  GLY A O   1 
ATOM   5237 N  N   . LEU A 1 876  ? 107.325 131.583 53.025  1.00 51.47  ? 855  LEU A N   1 
ATOM   5238 C  CA  . LEU A 1 876  ? 106.437 130.861 52.117  1.00 53.17  ? 855  LEU A CA  1 
ATOM   5239 C  C   . LEU A 1 876  ? 105.555 131.811 51.318  1.00 55.06  ? 855  LEU A C   1 
ATOM   5240 O  O   . LEU A 1 876  ? 105.249 131.538 50.150  1.00 56.07  ? 855  LEU A O   1 
ATOM   5241 C  CB  . LEU A 1 876  ? 105.566 129.870 52.881  1.00 95.75  ? 855  LEU A CB  1 
ATOM   5242 C  CG  . LEU A 1 876  ? 106.011 128.418 52.981  1.00 95.75  ? 855  LEU A CG  1 
ATOM   5243 C  CD1 . LEU A 1 876  ? 105.972 127.839 51.612  1.00 95.75  ? 855  LEU A CD1 1 
ATOM   5244 C  CD2 . LEU A 1 876  ? 107.396 128.287 53.546  1.00 95.75  ? 855  LEU A CD2 1 
ATOM   5245 N  N   . GLN A 1 877  ? 105.130 132.926 51.921  1.00 77.83  ? 856  GLN A N   1 
ATOM   5246 C  CA  . GLN A 1 877  ? 104.299 133.869 51.178  1.00 79.46  ? 856  GLN A CA  1 
ATOM   5247 C  C   . GLN A 1 877  ? 105.087 134.566 50.075  1.00 77.18  ? 856  GLN A C   1 
ATOM   5248 O  O   . GLN A 1 877  ? 104.627 134.636 48.928  1.00 78.43  ? 856  GLN A O   1 
ATOM   5249 C  CB  . GLN A 1 877  ? 103.673 134.896 52.114  1.00 103.95 ? 856  GLN A CB  1 
ATOM   5250 C  CG  . GLN A 1 877  ? 102.972 135.995 51.357  1.00 103.95 ? 856  GLN A CG  1 
ATOM   5251 C  CD  . GLN A 1 877  ? 102.220 136.940 52.244  1.00 103.95 ? 856  GLN A CD  1 
ATOM   5252 O  OE1 . GLN A 1 877  ? 102.038 136.682 53.427  1.00 103.95 ? 856  GLN A OE1 1 
ATOM   5253 N  NE2 . GLN A 1 877  ? 101.847 138.090 51.693  1.00 103.95 ? 856  GLN A NE2 1 
ATOM   5254 N  N   . ASP A 1 878  ? 106.279 135.073 50.400  1.00 53.63  ? 857  ASP A N   1 
ATOM   5255 C  CA  . ASP A 1 878  ? 107.098 135.751 49.395  1.00 53.10  ? 857  ASP A CA  1 
ATOM   5256 C  C   . ASP A 1 878  ? 107.562 134.796 48.304  1.00 55.17  ? 857  ASP A C   1 
ATOM   5257 O  O   . ASP A 1 878  ? 107.657 135.184 47.132  1.00 55.85  ? 857  ASP A O   1 
ATOM   5258 C  CB  . ASP A 1 878  ? 108.302 136.420 50.054  1.00 115.30 ? 857  ASP A CB  1 
ATOM   5259 C  CG  . ASP A 1 878  ? 107.939 137.697 50.771  1.00 115.30 ? 857  ASP A CG  1 
ATOM   5260 O  OD1 . ASP A 1 878  ? 106.998 138.380 50.321  1.00 115.30 ? 857  ASP A OD1 1 
ATOM   5261 O  OD2 . ASP A 1 878  ? 108.597 138.018 51.782  1.00 115.30 ? 857  ASP A OD2 1 
ATOM   5262 N  N   . ALA A 1 879  ? 107.842 133.543 48.662  1.00 49.93  ? 858  ALA A N   1 
ATOM   5263 C  CA  . ALA A 1 879  ? 108.156 132.562 47.634  1.00 50.81  ? 858  ALA A CA  1 
ATOM   5264 C  C   . ALA A 1 879  ? 106.936 132.228 46.788  1.00 51.18  ? 858  ALA A C   1 
ATOM   5265 O  O   . ALA A 1 879  ? 107.080 131.892 45.610  1.00 51.31  ? 858  ALA A O   1 
ATOM   5266 C  CB  . ALA A 1 879  ? 108.726 131.297 48.267  1.00 111.83 ? 858  ALA A CB  1 
ATOM   5267 N  N   . PHE A 1 880  ? 105.734 132.328 47.355  1.00 77.58  ? 859  PHE A N   1 
ATOM   5268 C  CA  . PHE A 1 880  ? 104.539 132.038 46.572  1.00 78.22  ? 859  PHE A CA  1 
ATOM   5269 C  C   . PHE A 1 880  ? 104.254 133.144 45.570  1.00 79.96  ? 859  PHE A C   1 
ATOM   5270 O  O   . PHE A 1 880  ? 104.013 132.872 44.389  1.00 79.81  ? 859  PHE A O   1 
ATOM   5271 C  CB  . PHE A 1 880  ? 103.337 131.836 47.481  1.00 103.29 ? 859  PHE A CB  1 
ATOM   5272 C  CG  . PHE A 1 880  ? 102.071 131.555 46.738  1.00 103.29 ? 859  PHE A CG  1 
ATOM   5273 C  CD1 . PHE A 1 880  ? 101.860 130.325 46.152  1.00 103.29 ? 859  PHE A CD1 1 
ATOM   5274 C  CD2 . PHE A 1 880  ? 101.089 132.524 46.621  1.00 103.29 ? 859  PHE A CD2 1 
ATOM   5275 C  CE1 . PHE A 1 880  ? 100.693 130.061 45.467  1.00 103.29 ? 859  PHE A CE1 1 
ATOM   5276 C  CE2 . PHE A 1 880  ? 99.922  132.267 45.933  1.00 103.29 ? 859  PHE A CE2 1 
ATOM   5277 C  CZ  . PHE A 1 880  ? 99.725  131.033 45.356  1.00 103.29 ? 859  PHE A CZ  1 
ATOM   5278 N  N   . ASP A 1 881  ? 104.256 134.398 46.024  1.00 121.30 ? 860  ASP A N   1 
ATOM   5279 C  CA  . ASP A 1 881  ? 103.951 135.495 45.113  1.00 125.04 ? 860  ASP A CA  1 
ATOM   5280 C  C   . ASP A 1 881  ? 105.089 135.752 44.137  1.00 126.96 ? 860  ASP A C   1 
ATOM   5281 O  O   . ASP A 1 881  ? 104.848 136.247 43.031  1.00 125.06 ? 860  ASP A O   1 
ATOM   5282 C  CB  . ASP A 1 881  ? 103.617 136.764 45.892  1.00 128.22 ? 860  ASP A CB  1 
ATOM   5283 C  CG  . ASP A 1 881  ? 102.255 136.700 46.547  1.00 128.22 ? 860  ASP A CG  1 
ATOM   5284 O  OD1 . ASP A 1 881  ? 101.387 135.966 46.035  1.00 128.22 ? 860  ASP A OD1 1 
ATOM   5285 O  OD2 . ASP A 1 881  ? 102.043 137.400 47.557  1.00 128.22 ? 860  ASP A OD2 1 
ATOM   5286 N  N   . SER A 1 882  ? 106.325 135.429 44.516  1.00 148.85 ? 861  SER A N   1 
ATOM   5287 C  CA  . SER A 1 882  ? 107.402 135.452 43.533  1.00 152.01 ? 861  SER A CA  1 
ATOM   5288 C  C   . SER A 1 882  ? 107.250 134.316 42.533  1.00 156.25 ? 861  SER A C   1 
ATOM   5289 O  O   . SER A 1 882  ? 107.540 134.484 41.344  1.00 156.53 ? 861  SER A O   1 
ATOM   5290 C  CB  . SER A 1 882  ? 108.759 135.367 44.225  1.00 137.26 ? 861  SER A CB  1 
ATOM   5291 O  OG  . SER A 1 882  ? 109.802 135.284 43.270  1.00 137.26 ? 861  SER A OG  1 
ATOM   5292 N  N   . ASP A 1 883  ? 106.792 133.153 42.997  1.00 210.35 ? 862  ASP A N   1 
ATOM   5293 C  CA  . ASP A 1 883  ? 106.672 131.991 42.125  1.00 215.74 ? 862  ASP A CA  1 
ATOM   5294 C  C   . ASP A 1 883  ? 105.481 132.138 41.189  1.00 217.89 ? 862  ASP A C   1 
ATOM   5295 O  O   . ASP A 1 883  ? 105.641 132.204 39.968  1.00 218.26 ? 862  ASP A O   1 
ATOM   5296 C  CB  . ASP A 1 883  ? 106.545 130.717 42.969  1.00 149.94 ? 862  ASP A CB  1 
ATOM   5297 C  CG  . ASP A 1 883  ? 106.727 129.438 42.160  1.00 149.94 ? 862  ASP A CG  1 
ATOM   5298 O  OD1 . ASP A 1 883  ? 106.976 129.497 40.939  1.00 149.94 ? 862  ASP A OD1 1 
ATOM   5299 O  OD2 . ASP A 1 883  ? 106.611 128.354 42.763  1.00 149.94 ? 862  ASP A OD2 1 
ATOM   5300 N  N   . TRP A 1 884  ? 104.278 132.205 41.742  1.00 245.59 ? 863  TRP A N   1 
ATOM   5301 C  CA  . TRP A 1 884  ? 103.079 132.277 40.928  1.00 246.99 ? 863  TRP A CA  1 
ATOM   5302 C  C   . TRP A 1 884  ? 102.269 133.493 41.324  1.00 244.84 ? 863  TRP A C   1 
ATOM   5303 O  O   . TRP A 1 884  ? 101.900 133.650 42.491  1.00 245.20 ? 863  TRP A O   1 
ATOM   5304 C  CB  . TRP A 1 884  ? 102.250 131.003 41.048  1.00 135.59 ? 863  TRP A CB  1 
ATOM   5305 C  CG  . TRP A 1 884  ? 102.926 129.883 40.386  1.00 135.59 ? 863  TRP A CG  1 
ATOM   5306 C  CD1 . TRP A 1 884  ? 103.624 128.885 40.981  1.00 135.59 ? 863  TRP A CD1 1 
ATOM   5307 C  CD2 . TRP A 1 884  ? 103.018 129.657 38.974  1.00 135.59 ? 863  TRP A CD2 1 
ATOM   5308 N  NE1 . TRP A 1 884  ? 104.131 128.032 40.031  1.00 135.59 ? 863  TRP A NE1 1 
ATOM   5309 C  CE2 . TRP A 1 884  ? 103.774 128.486 38.790  1.00 135.59 ? 863  TRP A CE2 1 
ATOM   5310 C  CE3 . TRP A 1 884  ? 102.522 130.325 37.851  1.00 135.59 ? 863  TRP A CE3 1 
ATOM   5311 C  CZ2 . TRP A 1 884  ? 104.050 127.967 37.531  1.00 135.59 ? 863  TRP A CZ2 1 
ATOM   5312 C  CZ3 . TRP A 1 884  ? 102.800 129.813 36.605  1.00 135.59 ? 863  TRP A CZ3 1 
ATOM   5313 C  CH2 . TRP A 1 884  ? 103.556 128.644 36.452  1.00 135.59 ? 863  TRP A CH2 1 
ATOM   5314 N  N   . GLU A 1 885  ? 102.016 134.356 40.357  1.00 103.00 ? 864  GLU A N   1 
ATOM   5315 C  CA  . GLU A 1 885  ? 101.097 135.440 40.595  1.00 103.00 ? 864  GLU A CA  1 
ATOM   5316 C  C   . GLU A 1 885  ? 99.761  134.682 40.610  1.00 103.00 ? 864  GLU A C   1 
ATOM   5317 O  O   . GLU A 1 885  ? 99.523  133.804 39.772  1.00 103.00 ? 864  GLU A O   1 
ATOM   5318 C  CB  . GLU A 1 885  ? 101.136 136.441 39.446  1.00 103.00 ? 864  GLU A CB  1 
ATOM   5319 C  CG  . GLU A 1 885  ? 102.538 136.818 38.996  1.00 103.00 ? 864  GLU A CG  1 
ATOM   5320 C  CD  . GLU A 1 885  ? 103.261 135.673 38.320  1.00 103.00 ? 864  GLU A CD  1 
ATOM   5321 O  OE1 . GLU A 1 885  ? 102.735 134.541 38.353  1.00 103.00 ? 864  GLU A OE1 1 
ATOM   5322 O  OE2 . GLU A 1 885  ? 104.355 135.898 37.765  1.00 103.00 ? 864  GLU A OE2 1 
ATOM   5323 N  N   . THR A 1 886  ? 98.855  135.011 41.518  1.00 101.93 ? 865  THR A N   1 
ATOM   5324 C  CA  . THR A 1 886  ? 97.598  134.268 41.538  1.00 101.93 ? 865  THR A CA  1 
ATOM   5325 C  C   . THR A 1 886  ? 96.804  134.469 40.246  1.00 101.93 ? 865  THR A C   1 
ATOM   5326 O  O   . THR A 1 886  ? 96.817  135.543 39.646  1.00 101.93 ? 865  THR A O   1 
ATOM   5327 C  CB  . THR A 1 886  ? 96.741  134.563 42.781  1.00 30.00  ? 865  THR A CB  1 
ATOM   5328 O  OG1 . THR A 1 886  ? 96.394  133.325 43.410  1.00 30.00  ? 865  THR A OG1 1 
ATOM   5329 C  CG2 . THR A 1 886  ? 95.465  135.313 42.405  1.00 30.00  ? 865  THR A CG2 1 
ATOM   5330 N  N   . GLY A 1 887  ? 96.096  133.424 39.841  1.00 96.55  ? 866  GLY A N   1 
ATOM   5331 C  CA  . GLY A 1 887  ? 95.336  133.421 38.605  1.00 96.55  ? 866  GLY A CA  1 
ATOM   5332 C  C   . GLY A 1 887  ? 95.385  132.003 38.081  1.00 96.55  ? 866  GLY A C   1 
ATOM   5333 O  O   . GLY A 1 887  ? 94.411  131.505 37.517  1.00 96.55  ? 866  GLY A O   1 
ATOM   5334 N  N   . LYS A 1 888  ? 96.523  131.354 38.292  1.00 109.13 ? 867  LYS A N   1 
ATOM   5335 C  CA  . LYS A 1 888  ? 96.680  129.969 37.911  1.00 109.13 ? 867  LYS A CA  1 
ATOM   5336 C  C   . LYS A 1 888  ? 96.229  129.320 39.200  1.00 109.13 ? 867  LYS A C   1 
ATOM   5337 O  O   . LYS A 1 888  ? 96.883  129.441 40.234  1.00 109.13 ? 867  LYS A O   1 
ATOM   5338 C  CB  . LYS A 1 888  ? 98.139  129.658 37.614  1.00 30.00  ? 867  LYS A CB  1 
ATOM   5339 C  CG  . LYS A 1 888  ? 98.341  128.645 36.503  1.00 30.00  ? 867  LYS A CG  1 
ATOM   5340 C  CD  . LYS A 1 888  ? 97.162  127.693 36.405  1.00 30.00  ? 867  LYS A CD  1 
ATOM   5341 C  CE  . LYS A 1 888  ? 97.379  126.669 35.305  1.00 30.00  ? 867  LYS A CE  1 
ATOM   5342 N  NZ  . LYS A 1 888  ? 98.825  126.472 35.009  1.00 30.00  ? 867  LYS A NZ  1 
ATOM   5343 N  N   . ILE A 1 889  ? 95.081  128.665 39.150  1.00 30.00  ? 868  ILE A N   1 
ATOM   5344 C  CA  . ILE A 1 889  ? 94.490  128.117 40.356  1.00 30.00  ? 868  ILE A CA  1 
ATOM   5345 C  C   . ILE A 1 889  ? 93.973  126.697 40.268  1.00 30.00  ? 868  ILE A C   1 
ATOM   5346 O  O   . ILE A 1 889  ? 93.961  126.083 39.200  1.00 30.00  ? 868  ILE A O   1 
ATOM   5347 C  CB  . ILE A 1 889  ? 93.355  129.022 40.870  1.00 30.00  ? 868  ILE A CB  1 
ATOM   5348 C  CG1 . ILE A 1 889  ? 92.826  129.904 39.737  1.00 30.00  ? 868  ILE A CG1 1 
ATOM   5349 C  CG2 . ILE A 1 889  ? 93.840  129.874 42.032  1.00 30.00  ? 868  ILE A CG2 1 
ATOM   5350 C  CD1 . ILE A 1 889  ? 93.752  131.039 39.354  1.00 30.00  ? 868  ILE A CD1 1 
ATOM   5351 N  N   . MET A 1 890  ? 93.624  126.191 41.449  1.00 88.60  ? 869  MET A N   1 
ATOM   5352 C  CA  . MET A 1 890  ? 93.080  124.858 41.679  1.00 88.60  ? 869  MET A CA  1 
ATOM   5353 C  C   . MET A 1 890  ? 94.049  123.759 41.307  1.00 88.60  ? 869  MET A C   1 
ATOM   5354 O  O   . MET A 1 890  ? 95.260  123.928 41.419  1.00 88.60  ? 869  MET A O   1 
ATOM   5355 C  CB  . MET A 1 890  ? 91.722  124.649 40.992  1.00 88.60  ? 869  MET A CB  1 
ATOM   5356 C  CG  . MET A 1 890  ? 90.683  125.702 41.335  1.00 88.60  ? 869  MET A CG  1 
ATOM   5357 S  SD  . MET A 1 890  ? 89.087  124.978 41.749  1.00 88.60  ? 869  MET A SD  1 
ATOM   5358 C  CE  . MET A 1 890  ? 88.246  125.098 40.173  1.00 88.60  ? 869  MET A CE  1 
ATOM   5359 N  N   . PRO A 1 891  ? 93.507  122.636 40.835  1.00 83.18  ? 870  PRO A N   1 
ATOM   5360 C  CA  . PRO A 1 891  ? 94.284  121.454 40.467  1.00 83.18  ? 870  PRO A CA  1 
ATOM   5361 C  C   . PRO A 1 891  ? 95.242  121.705 39.311  1.00 83.18  ? 870  PRO A C   1 
ATOM   5362 O  O   . PRO A 1 891  ? 94.940  122.471 38.395  1.00 83.18  ? 870  PRO A O   1 
ATOM   5363 C  CB  . PRO A 1 891  ? 93.207  120.445 40.051  1.00 83.18  ? 870  PRO A CB  1 
ATOM   5364 C  CG  . PRO A 1 891  ? 91.942  120.943 40.666  1.00 83.18  ? 870  PRO A CG  1 
ATOM   5365 C  CD  . PRO A 1 891  ? 92.066  122.432 40.630  1.00 83.18  ? 870  PRO A CD  1 
ATOM   5366 N  N   . ASN A 1 892  ? 96.408  121.075 39.401  1.00 94.90  ? 871  ASN A N   1 
ATOM   5367 C  CA  . ASN A 1 892  ? 97.454  121.146 38.386  1.00 94.90  ? 871  ASN A CA  1 
ATOM   5368 C  C   . ASN A 1 892  ? 97.982  122.533 38.029  1.00 94.90  ? 871  ASN A C   1 
ATOM   5369 O  O   . ASN A 1 892  ? 98.258  122.804 36.862  1.00 94.90  ? 871  ASN A O   1 
ATOM   5370 C  CB  . ASN A 1 892  ? 96.961  120.463 37.110  1.00 30.00  ? 871  ASN A CB  1 
ATOM   5371 C  CG  . ASN A 1 892  ? 96.818  118.962 37.269  1.00 30.00  ? 871  ASN A CG  1 
ATOM   5372 O  OD1 . ASN A 1 892  ? 97.450  118.355 38.133  1.00 30.00  ? 871  ASN A OD1 1 
ATOM   5373 N  ND2 . ASN A 1 892  ? 95.985  118.354 36.433  1.00 30.00  ? 871  ASN A ND2 1 
ATOM   5374 N  N   . ASN A 1 893  ? 98.122  123.415 39.010  1.00 106.21 ? 872  ASN A N   1 
ATOM   5375 C  CA  . ASN A 1 893  ? 98.694  124.718 38.703  1.00 106.21 ? 872  ASN A CA  1 
ATOM   5376 C  C   . ASN A 1 893  ? 100.183 124.662 38.998  1.00 106.21 ? 872  ASN A C   1 
ATOM   5377 O  O   . ASN A 1 893  ? 101.005 125.199 38.255  1.00 106.21 ? 872  ASN A O   1 
ATOM   5378 C  CB  . ASN A 1 893  ? 98.022  125.833 39.516  1.00 30.00  ? 872  ASN A CB  1 
ATOM   5379 C  CG  . ASN A 1 893  ? 98.952  127.013 39.806  1.00 30.00  ? 872  ASN A CG  1 
ATOM   5380 O  OD1 . ASN A 1 893  ? 99.850  127.336 39.028  1.00 30.00  ? 872  ASN A OD1 1 
ATOM   5381 N  ND2 . ASN A 1 893  ? 98.722  127.671 40.935  1.00 30.00  ? 872  ASN A ND2 1 
ATOM   5382 N  N   . TYR A 1 894  ? 100.447 124.136 40.192  1.00 90.30  ? 873  TYR A N   1 
ATOM   5383 C  CA  . TYR A 1 894  ? 101.754 123.937 40.826  1.00 90.30  ? 873  TYR A CA  1 
ATOM   5384 C  C   . TYR A 1 894  ? 102.803 122.922 40.331  1.00 90.30  ? 873  TYR A C   1 
ATOM   5385 O  O   . TYR A 1 894  ? 104.000 123.215 40.353  1.00 90.30  ? 873  TYR A O   1 
ATOM   5386 C  CB  . TYR A 1 894  ? 101.568 123.760 42.339  1.00 90.30  ? 873  TYR A CB  1 
ATOM   5387 C  CG  . TYR A 1 894  ? 100.609 122.665 42.761  1.00 90.30  ? 873  TYR A CG  1 
ATOM   5388 C  CD1 . TYR A 1 894  ? 99.471  122.375 42.025  1.00 90.30  ? 873  TYR A CD1 1 
ATOM   5389 C  CD2 . TYR A 1 894  ? 100.839 121.936 43.916  1.00 90.30  ? 873  TYR A CD2 1 
ATOM   5390 C  CE1 . TYR A 1 894  ? 98.597  121.383 42.423  1.00 90.30  ? 873  TYR A CE1 1 
ATOM   5391 C  CE2 . TYR A 1 894  ? 99.973  120.943 44.322  1.00 90.30  ? 873  TYR A CE2 1 
ATOM   5392 C  CZ  . TYR A 1 894  ? 98.854  120.670 43.574  1.00 90.30  ? 873  TYR A CZ  1 
ATOM   5393 O  OH  . TYR A 1 894  ? 97.996  119.677 43.985  1.00 90.30  ? 873  TYR A OH  1 
ATOM   5394 N  N   . LYS A 1 895  ? 102.371 121.755 39.863  1.00 94.22  ? 874  LYS A N   1 
ATOM   5395 C  CA  . LYS A 1 895  ? 103.327 120.696 39.533  1.00 94.22  ? 874  LYS A CA  1 
ATOM   5396 C  C   . LYS A 1 895  ? 104.376 121.088 38.509  1.00 94.22  ? 874  LYS A C   1 
ATOM   5397 O  O   . LYS A 1 895  ? 105.558 120.801 38.680  1.00 94.22  ? 874  LYS A O   1 
ATOM   5398 C  CB  . LYS A 1 895  ? 102.576 119.460 39.038  1.00 94.22  ? 874  LYS A CB  1 
ATOM   5399 C  CG  . LYS A 1 895  ? 102.423 119.395 37.528  1.00 94.22  ? 874  LYS A CG  1 
ATOM   5400 C  CD  . LYS A 1 895  ? 102.808 118.023 36.998  1.00 94.22  ? 874  LYS A CD  1 
ATOM   5401 C  CE  . LYS A 1 895  ? 101.632 117.061 37.029  1.00 94.22  ? 874  LYS A CE  1 
ATOM   5402 N  NZ  . LYS A 1 895  ? 100.961 117.049 38.357  1.00 94.22  ? 874  LYS A NZ  1 
ATOM   5403 N  N   . ASN A 1 896  ? 103.949 121.761 37.460  1.00 89.15  ? 875  ASN A N   1 
ATOM   5404 C  CA  . ASN A 1 896  ? 104.855 122.245 36.424  1.00 89.15  ? 875  ASN A CA  1 
ATOM   5405 C  C   . ASN A 1 896  ? 105.666 123.400 36.995  1.00 89.15  ? 875  ASN A C   1 
ATOM   5406 O  O   . ASN A 1 896  ? 105.272 124.566 36.922  1.00 89.15  ? 875  ASN A O   1 
ATOM   5407 C  CB  . ASN A 1 896  ? 104.072 122.661 35.189  1.00 89.15  ? 875  ASN A CB  1 
ATOM   5408 C  CG  . ASN A 1 896  ? 104.952 122.887 33.979  1.00 89.15  ? 875  ASN A CG  1 
ATOM   5409 O  OD1 . ASN A 1 896  ? 106.160 122.655 34.008  1.00 89.15  ? 875  ASN A OD1 1 
ATOM   5410 N  ND2 . ASN A 1 896  ? 104.335 123.358 32.906  1.00 89.15  ? 875  ASN A ND2 1 
ATOM   5411 N  N   . GLY A 1 897  ? 106.807 123.055 37.592  1.00 124.47 ? 876  GLY A N   1 
ATOM   5412 C  CA  . GLY A 1 897  ? 107.823 124.018 37.971  1.00 124.47 ? 876  GLY A CA  1 
ATOM   5413 C  C   . GLY A 1 897  ? 107.453 124.958 39.098  1.00 124.47 ? 876  GLY A C   1 
ATOM   5414 O  O   . GLY A 1 897  ? 107.270 126.157 38.864  1.00 124.47 ? 876  GLY A O   1 
ATOM   5415 N  N   . SER A 1 898  ? 107.333 124.445 40.320  1.00 108.12 ? 877  SER A N   1 
ATOM   5416 C  CA  . SER A 1 898  ? 107.022 125.310 41.453  1.00 108.12 ? 877  SER A CA  1 
ATOM   5417 C  C   . SER A 1 898  ? 107.699 124.763 42.700  1.00 108.12 ? 877  SER A C   1 
ATOM   5418 O  O   . SER A 1 898  ? 107.285 123.728 43.226  1.00 108.12 ? 877  SER A O   1 
ATOM   5419 C  CB  . SER A 1 898  ? 105.521 125.423 41.657  1.00 108.12 ? 877  SER A CB  1 
ATOM   5420 O  OG  . SER A 1 898  ? 105.239 126.330 42.707  1.00 108.12 ? 877  SER A OG  1 
ATOM   5421 N  N   . ASP A 1 899  ? 108.726 125.460 43.169  1.00 98.76  ? 878  ASP A N   1 
ATOM   5422 C  CA  . ASP A 1 899  ? 109.387 125.142 44.427  1.00 98.76  ? 878  ASP A CA  1 
ATOM   5423 C  C   . ASP A 1 899  ? 108.879 126.121 45.475  1.00 98.76  ? 878  ASP A C   1 
ATOM   5424 O  O   . ASP A 1 899  ? 108.912 127.336 45.252  1.00 98.76  ? 878  ASP A O   1 
ATOM   5425 C  CB  . ASP A 1 899  ? 110.905 125.239 44.288  1.00 98.76  ? 878  ASP A CB  1 
ATOM   5426 C  CG  . ASP A 1 899  ? 111.646 124.641 45.470  1.00 98.76  ? 878  ASP A CG  1 
ATOM   5427 O  OD1 . ASP A 1 899  ? 111.002 124.098 46.391  1.00 98.76  ? 878  ASP A OD1 1 
ATOM   5428 O  OD2 . ASP A 1 899  ? 112.890 124.725 45.478  1.00 98.76  ? 878  ASP A OD2 1 
ATOM   5429 N  N   . ASP A 1 900  ? 108.357 125.586 46.585  1.00 84.05  ? 879  ASP A N   1 
ATOM   5430 C  CA  . ASP A 1 900  ? 107.820 126.304 47.745  1.00 84.05  ? 879  ASP A CA  1 
ATOM   5431 C  C   . ASP A 1 900  ? 106.619 127.184 47.427  1.00 84.05  ? 879  ASP A C   1 
ATOM   5432 O  O   . ASP A 1 900  ? 106.170 127.936 48.289  1.00 84.05  ? 879  ASP A O   1 
ATOM   5433 C  CB  . ASP A 1 900  ? 108.886 127.144 48.447  1.00 84.05  ? 879  ASP A CB  1 
ATOM   5434 C  CG  . ASP A 1 900  ? 109.904 126.297 49.142  1.00 84.05  ? 879  ASP A CG  1 
ATOM   5435 O  OD1 . ASP A 1 900  ? 109.550 125.166 49.531  1.00 84.05  ? 879  ASP A OD1 1 
ATOM   5436 O  OD2 . ASP A 1 900  ? 111.052 126.754 49.303  1.00 84.05  ? 879  ASP A OD2 1 
ATOM   5437 N  N   . GLY A 1 901  ? 106.082 127.117 46.220  1.00 74.23  ? 880  GLY A N   1 
ATOM   5438 C  CA  . GLY A 1 901  ? 104.753 127.599 45.945  1.00 74.23  ? 880  GLY A CA  1 
ATOM   5439 C  C   . GLY A 1 901  ? 103.739 126.503 46.123  1.00 74.23  ? 880  GLY A C   1 
ATOM   5440 O  O   . GLY A 1 901  ? 102.577 126.652 45.735  1.00 74.23  ? 880  GLY A O   1 
ATOM   5441 N  N   . VAL A 1 902  ? 104.169 125.390 46.700  1.00 69.26  ? 881  VAL A N   1 
ATOM   5442 C  CA  . VAL A 1 902  ? 103.346 124.221 46.881  1.00 69.26  ? 881  VAL A CA  1 
ATOM   5443 C  C   . VAL A 1 902  ? 102.865 124.109 48.310  1.00 69.26  ? 881  VAL A C   1 
ATOM   5444 O  O   . VAL A 1 902  ? 101.678 123.918 48.562  1.00 69.26  ? 881  VAL A O   1 
ATOM   5445 C  CB  . VAL A 1 902  ? 104.134 122.965 46.470  1.00 69.26  ? 881  VAL A CB  1 
ATOM   5446 C  CG1 . VAL A 1 902  ? 103.295 121.753 46.683  1.00 69.26  ? 881  VAL A CG1 1 
ATOM   5447 C  CG2 . VAL A 1 902  ? 104.597 123.086 45.050  1.00 69.26  ? 881  VAL A CG2 1 
ATOM   5448 N  N   . LEU A 1 903  ? 103.784 124.232 49.264  1.00 53.73  ? 882  LEU A N   1 
ATOM   5449 C  CA  . LEU A 1 903  ? 103.396 124.197 50.664  1.00 53.73  ? 882  LEU A CA  1 
ATOM   5450 C  C   . LEU A 1 903  ? 102.635 125.461 51.032  1.00 53.73  ? 882  LEU A C   1 
ATOM   5451 O  O   . LEU A 1 903  ? 101.715 125.424 51.862  1.00 53.73  ? 882  LEU A O   1 
ATOM   5452 C  CB  . LEU A 1 903  ? 104.646 124.014 51.518  1.00 53.73  ? 882  LEU A CB  1 
ATOM   5453 C  CG  . LEU A 1 903  ? 104.539 123.361 52.891  1.00 53.73  ? 882  LEU A CG  1 
ATOM   5454 C  CD1 . LEU A 1 903  ? 104.045 124.277 53.975  1.00 53.73  ? 882  LEU A CD1 1 
ATOM   5455 C  CD2 . LEU A 1 903  ? 103.630 122.173 52.754  1.00 53.73  ? 882  LEU A CD2 1 
ATOM   5456 N  N   . ALA A 1 904  ? 102.995 126.578 50.398  1.00 49.42  ? 883  ALA A N   1 
ATOM   5457 C  CA  . ALA A 1 904  ? 102.176 127.774 50.480  1.00 49.42  ? 883  ALA A CA  1 
ATOM   5458 C  C   . ALA A 1 904  ? 100.797 127.523 49.896  1.00 49.42  ? 883  ALA A C   1 
ATOM   5459 O  O   . ALA A 1 904  ? 99.801  127.996 50.437  1.00 49.42  ? 883  ALA A O   1 
ATOM   5460 C  CB  . ALA A 1 904  ? 102.862 128.930 49.764  1.00 49.42  ? 883  ALA A CB  1 
ATOM   5461 N  N   . TYR A 1 905  ? 100.713 126.742 48.821  1.00 102.40 ? 884  TYR A N   1 
ATOM   5462 C  CA  . TYR A 1 905  ? 99.413  126.436 48.236  1.00 104.68 ? 884  TYR A CA  1 
ATOM   5463 C  C   . TYR A 1 905  ? 98.594  125.487 49.096  1.00 110.90 ? 884  TYR A C   1 
ATOM   5464 O  O   . TYR A 1 905  ? 97.368  125.490 48.993  1.00 110.88 ? 884  TYR A O   1 
ATOM   5465 C  CB  . TYR A 1 905  ? 99.600  125.846 46.845  1.00 104.71 ? 884  TYR A CB  1 
ATOM   5466 C  CG  . TYR A 1 905  ? 98.334  125.524 46.091  1.00 104.71 ? 884  TYR A CG  1 
ATOM   5467 C  CD1 . TYR A 1 905  ? 97.581  126.526 45.500  1.00 104.71 ? 884  TYR A CD1 1 
ATOM   5468 C  CD2 . TYR A 1 905  ? 97.914  124.214 45.944  1.00 104.71 ? 884  TYR A CD2 1 
ATOM   5469 C  CE1 . TYR A 1 905  ? 96.436  126.228 44.795  1.00 104.71 ? 884  TYR A CE1 1 
ATOM   5470 C  CE2 . TYR A 1 905  ? 96.779  123.908 45.241  1.00 104.71 ? 884  TYR A CE2 1 
ATOM   5471 C  CZ  . TYR A 1 905  ? 96.043  124.916 44.673  1.00 104.71 ? 884  TYR A CZ  1 
ATOM   5472 O  OH  . TYR A 1 905  ? 94.908  124.604 43.973  1.00 104.71 ? 884  TYR A OH  1 
ATOM   5473 N  N   . LYS A 1 906  ? 99.225  124.675 49.938  1.00 130.46 ? 885  LYS A N   1 
ATOM   5474 C  CA  . LYS A 1 906  ? 98.423  123.897 50.873  1.00 135.31 ? 885  LYS A CA  1 
ATOM   5475 C  C   . LYS A 1 906  ? 98.008  124.712 52.084  1.00 132.97 ? 885  LYS A C   1 
ATOM   5476 O  O   . LYS A 1 906  ? 96.958  124.441 52.666  1.00 132.68 ? 885  LYS A O   1 
ATOM   5477 C  CB  . LYS A 1 906  ? 99.165  122.649 51.348  1.00 90.48  ? 885  LYS A CB  1 
ATOM   5478 C  CG  . LYS A 1 906  ? 98.956  121.392 50.521  1.00 90.48  ? 885  LYS A CG  1 
ATOM   5479 C  CD  . LYS A 1 906  ? 99.789  121.381 49.277  1.00 90.48  ? 885  LYS A CD  1 
ATOM   5480 C  CE  . LYS A 1 906  ? 99.730  120.035 48.613  1.00 90.48  ? 885  LYS A CE  1 
ATOM   5481 N  NZ  . LYS A 1 906  ? 100.473 120.014 47.338  1.00 90.48  ? 885  LYS A NZ  1 
ATOM   5482 N  N   . LEU A 1 907  ? 98.801  125.701 52.487  1.00 134.26 ? 886  LEU A N   1 
ATOM   5483 C  CA  . LEU A 1 907  ? 98.433  126.445 53.687  1.00 117.62 ? 886  LEU A CA  1 
ATOM   5484 C  C   . LEU A 1 907  ? 97.508  127.622 53.419  1.00 111.15 ? 886  LEU A C   1 
ATOM   5485 O  O   . LEU A 1 907  ? 96.765  128.022 54.320  1.00 108.00 ? 886  LEU A O   1 
ATOM   5486 C  CB  . LEU A 1 907  ? 99.676  126.955 54.406  1.00 101.06 ? 886  LEU A CB  1 
ATOM   5487 C  CG  . LEU A 1 907  ? 100.586 125.884 54.969  1.00 101.06 ? 886  LEU A CG  1 
ATOM   5488 C  CD1 . LEU A 1 907  ? 101.714 126.587 55.658  1.00 101.06 ? 886  LEU A CD1 1 
ATOM   5489 C  CD2 . LEU A 1 907  ? 99.832  125.003 55.923  1.00 101.06 ? 886  LEU A CD2 1 
ATOM   5490 N  N   . LEU A 1 908  ? 97.564  128.212 52.224  1.00 49.48  ? 887  LEU A N   1 
ATOM   5491 C  CA  . LEU A 1 908  ? 96.615  129.256 51.867  1.00 49.48  ? 887  LEU A CA  1 
ATOM   5492 C  C   . LEU A 1 908  ? 95.205  128.706 51.808  1.00 49.48  ? 887  LEU A C   1 
ATOM   5493 O  O   . LEU A 1 908  ? 94.296  129.232 52.452  1.00 49.48  ? 887  LEU A O   1 
ATOM   5494 C  CB  . LEU A 1 908  ? 96.975  129.876 50.525  1.00 49.48  ? 887  LEU A CB  1 
ATOM   5495 C  CG  . LEU A 1 908  ? 98.196  130.771 50.531  1.00 49.48  ? 887  LEU A CG  1 
ATOM   5496 C  CD1 . LEU A 1 908  ? 98.515  131.253 49.142  1.00 49.48  ? 887  LEU A CD1 1 
ATOM   5497 C  CD2 . LEU A 1 908  ? 97.937  131.907 51.444  1.00 49.48  ? 887  LEU A CD2 1 
ATOM   5498 N  N   . VAL A 1 909  ? 95.016  127.612 51.074  1.00 73.62  ? 888  VAL A N   1 
ATOM   5499 C  CA  . VAL A 1 909  ? 93.677  127.116 50.806  1.00 73.37  ? 888  VAL A CA  1 
ATOM   5500 C  C   . VAL A 1 909  ? 93.101  126.411 52.033  1.00 69.44  ? 888  VAL A C   1 
ATOM   5501 O  O   . VAL A 1 909  ? 91.882  126.232 52.133  1.00 68.59  ? 888  VAL A O   1 
ATOM   5502 C  CB  . VAL A 1 909  ? 93.777  126.255 49.535  1.00 108.00 ? 888  VAL A CB  1 
ATOM   5503 C  CG1 . VAL A 1 909  ? 92.446  125.861 49.012  1.00 108.00 ? 888  VAL A CG1 1 
ATOM   5504 C  CG2 . VAL A 1 909  ? 94.505  127.024 48.464  1.00 108.00 ? 888  VAL A CG2 1 
ATOM   5505 N  N   . GLN A 1 910  ? 93.941  126.077 53.008  1.00 60.28  ? 889  GLN A N   1 
ATOM   5506 C  CA  . GLN A 1 910  ? 93.512  125.500 54.281  1.00 58.17  ? 889  GLN A CA  1 
ATOM   5507 C  C   . GLN A 1 910  ? 92.908  126.611 55.127  1.00 55.14  ? 889  GLN A C   1 
ATOM   5508 O  O   . GLN A 1 910  ? 93.630  127.414 55.716  1.00 54.79  ? 889  GLN A O   1 
ATOM   5509 C  CB  . GLN A 1 910  ? 94.701  124.870 54.993  1.00 113.58 ? 889  GLN A CB  1 
ATOM   5510 C  CG  . GLN A 1 910  ? 94.378  124.041 56.201  1.00 113.58 ? 889  GLN A CG  1 
ATOM   5511 C  CD  . GLN A 1 910  ? 93.825  122.693 55.841  1.00 113.58 ? 889  GLN A CD  1 
ATOM   5512 O  OE1 . GLN A 1 910  ? 94.232  122.093 54.853  1.00 113.58 ? 889  GLN A OE1 1 
ATOM   5513 N  NE2 . GLN A 1 910  ? 92.931  122.184 56.663  1.00 113.58 ? 889  GLN A NE2 1 
ATOM   5514 N  N   . THR A 1 911  ? 91.580  126.655 55.218  1.00 48.84  ? 890  THR A N   1 
ATOM   5515 C  CA  . THR A 1 911  ? 90.934  127.780 55.882  1.00 46.76  ? 890  THR A CA  1 
ATOM   5516 C  C   . THR A 1 911  ? 90.960  127.697 57.401  1.00 46.15  ? 890  THR A C   1 
ATOM   5517 O  O   . THR A 1 911  ? 90.512  128.642 58.056  1.00 46.15  ? 890  THR A O   1 
ATOM   5518 C  CB  . THR A 1 911  ? 89.480  127.921 55.440  1.00 129.73 ? 890  THR A CB  1 
ATOM   5519 O  OG1 . THR A 1 911  ? 88.960  129.162 55.936  1.00 129.73 ? 890  THR A OG1 1 
ATOM   5520 C  CG2 . THR A 1 911  ? 88.649  126.791 56.003  1.00 129.73 ? 890  THR A CG2 1 
ATOM   5521 N  N   . GLY A 1 912  ? 91.445  126.604 57.978  1.00 88.65  ? 891  GLY A N   1 
ATOM   5522 C  CA  . GLY A 1 912  ? 91.667  126.542 59.406  1.00 88.65  ? 891  GLY A CA  1 
ATOM   5523 C  C   . GLY A 1 912  ? 90.510  126.035 60.232  1.00 88.65  ? 891  GLY A C   1 
ATOM   5524 O  O   . GLY A 1 912  ? 90.677  125.833 61.439  1.00 88.65  ? 891  GLY A O   1 
ATOM   5525 N  N   . SER A 1 913  ? 89.348  125.814 59.629  1.00 47.95  ? 892  SER A N   1 
ATOM   5526 C  CA  . SER A 1 913  ? 88.235  125.195 60.337  1.00 48.08  ? 892  SER A CA  1 
ATOM   5527 C  C   . SER A 1 913  ? 88.395  123.682 60.326  1.00 48.08  ? 892  SER A C   1 
ATOM   5528 O  O   . SER A 1 913  ? 89.481  123.165 60.054  1.00 27.32  ? 892  SER A O   1 
ATOM   5529 C  CB  . SER A 1 913  ? 86.895  125.597 59.718  1.00 150.95 ? 892  SER A CB  1 
ATOM   5530 O  OG  . SER A 1 913  ? 85.817  124.948 60.371  1.00 150.95 ? 892  SER A OG  1 
ATOM   5531 N  N   . ARG A 1 914  ? 87.331  122.960 60.651  1.00 120.37 ? 893  ARG A N   1 
ATOM   5532 C  CA  . ARG A 1 914  ? 87.363  121.509 60.578  1.00 120.37 ? 893  ARG A CA  1 
ATOM   5533 C  C   . ARG A 1 914  ? 86.195  120.898 59.819  1.00 120.37 ? 893  ARG A C   1 
ATOM   5534 O  O   . ARG A 1 914  ? 86.314  119.754 59.368  1.00 120.37 ? 893  ARG A O   1 
ATOM   5535 C  CB  . ARG A 1 914  ? 87.419  120.913 61.987  1.00 120.37 ? 893  ARG A CB  1 
ATOM   5536 C  CG  . ARG A 1 914  ? 86.219  121.248 62.813  1.00 120.37 ? 893  ARG A CG  1 
ATOM   5537 C  CD  . ARG A 1 914  ? 86.277  120.575 64.154  1.00 120.37 ? 893  ARG A CD  1 
ATOM   5538 N  NE  . ARG A 1 914  ? 85.068  120.846 64.918  1.00 120.37 ? 893  ARG A NE  1 
ATOM   5539 C  CZ  . ARG A 1 914  ? 83.945  120.146 64.797  1.00 120.37 ? 893  ARG A CZ  1 
ATOM   5540 N  NH1 . ARG A 1 914  ? 82.884  120.456 65.528  1.00 120.37 ? 893  ARG A NH1 1 
ATOM   5541 N  NH2 . ARG A 1 914  ? 83.876  119.138 63.939  1.00 120.37 ? 893  ARG A NH2 1 
ATOM   5542 N  N   . ASP A 1 915  ? 85.084  121.604 59.663  1.00 121.44 ? 894  ASP A N   1 
ATOM   5543 C  CA  . ASP A 1 915  ? 84.020  121.217 58.752  1.00 121.44 ? 894  ASP A CA  1 
ATOM   5544 C  C   . ASP A 1 915  ? 84.071  122.163 57.563  1.00 121.44 ? 894  ASP A C   1 
ATOM   5545 O  O   . ASP A 1 915  ? 84.255  123.373 57.742  1.00 121.44 ? 894  ASP A O   1 
ATOM   5546 C  CB  . ASP A 1 915  ? 82.653  121.283 59.433  1.00 121.44 ? 894  ASP A CB  1 
ATOM   5547 C  CG  . ASP A 1 915  ? 81.550  120.634 58.611  1.00 121.44 ? 894  ASP A CG  1 
ATOM   5548 O  OD1 . ASP A 1 915  ? 81.833  120.089 57.523  1.00 121.44 ? 894  ASP A OD1 1 
ATOM   5549 O  OD2 . ASP A 1 915  ? 80.386  120.678 59.055  1.00 121.44 ? 894  ASP A OD2 1 
ATOM   5550 N  N   . LYS A 1 916  ? 83.869  121.608 56.363  1.00 105.21 ? 895  LYS A N   1 
ATOM   5551 C  CA  . LYS A 1 916  ? 84.212  122.249 55.090  1.00 105.21 ? 895  LYS A CA  1 
ATOM   5552 C  C   . LYS A 1 916  ? 85.637  122.789 55.145  1.00 105.21 ? 895  LYS A C   1 
ATOM   5553 O  O   . LYS A 1 916  ? 85.893  123.992 55.082  1.00 105.21 ? 895  LYS A O   1 
ATOM   5554 C  CB  . LYS A 1 916  ? 83.207  123.335 54.706  1.00 105.21 ? 895  LYS A CB  1 
ATOM   5555 C  CG  . LYS A 1 916  ? 81.850  122.796 54.302  1.00 105.21 ? 895  LYS A CG  1 
ATOM   5556 C  CD  . LYS A 1 916  ? 81.959  121.953 53.046  1.00 105.21 ? 895  LYS A CD  1 
ATOM   5557 C  CE  . LYS A 1 916  ? 82.449  122.787 51.869  1.00 105.21 ? 895  LYS A CE  1 
ATOM   5558 N  NZ  . LYS A 1 916  ? 81.523  123.889 51.523  1.00 105.21 ? 895  LYS A NZ  1 
ATOM   5559 N  N   . PRO A 1 917  ? 86.558  121.839 55.282  1.00 102.02 ? 896  PRO A N   1 
ATOM   5560 C  CA  . PRO A 1 917  ? 87.911  122.139 55.725  1.00 102.02 ? 896  PRO A CA  1 
ATOM   5561 C  C   . PRO A 1 917  ? 88.689  122.921 54.682  1.00 102.02 ? 896  PRO A C   1 
ATOM   5562 O  O   . PRO A 1 917  ? 89.470  123.812 55.026  1.00 102.02 ? 896  PRO A O   1 
ATOM   5563 C  CB  . PRO A 1 917  ? 88.531  120.752 55.917  1.00 30.00  ? 896  PRO A CB  1 
ATOM   5564 C  CG  . PRO A 1 917  ? 87.835  119.886 54.926  1.00 30.00  ? 896  PRO A CG  1 
ATOM   5565 C  CD  . PRO A 1 917  ? 86.868  120.785 54.222  1.00 30.00  ? 896  PRO A CD  1 
ATOM   5566 N  N   . ILE A 1 918  ? 88.516  122.585 53.407  1.00 89.91  ? 897  ILE A N   1 
ATOM   5567 C  CA  . ILE A 1 918  ? 89.265  123.227 52.329  1.00 89.91  ? 897  ILE A CA  1 
ATOM   5568 C  C   . ILE A 1 918  ? 88.305  123.698 51.241  1.00 89.91  ? 897  ILE A C   1 
ATOM   5569 O  O   . ILE A 1 918  ? 87.860  122.895 50.408  1.00 89.91  ? 897  ILE A O   1 
ATOM   5570 C  CB  . ILE A 1 918  ? 90.339  122.281 51.766  1.00 89.91  ? 897  ILE A CB  1 
ATOM   5571 C  CG1 . ILE A 1 918  ? 91.388  121.996 52.823  1.00 89.91  ? 897  ILE A CG1 1 
ATOM   5572 C  CG2 . ILE A 1 918  ? 91.066  122.901 50.616  1.00 89.91  ? 897  ILE A CG2 1 
ATOM   5573 C  CD1 . ILE A 1 918  ? 92.292  120.927 52.452  1.00 89.91  ? 897  ILE A CD1 1 
ATOM   5574 N  N   . ASP A 1 919  ? 87.894  124.962 51.257  1.00 84.77  ? 898  ASP A N   1 
ATOM   5575 C  CA  . ASP A 1 919  ? 87.356  125.588 50.050  1.00 84.77  ? 898  ASP A CA  1 
ATOM   5576 C  C   . ASP A 1 919  ? 88.460  126.309 49.299  1.00 84.77  ? 898  ASP A C   1 
ATOM   5577 O  O   . ASP A 1 919  ? 89.440  126.776 49.880  1.00 84.77  ? 898  ASP A O   1 
ATOM   5578 C  CB  . ASP A 1 919  ? 86.227  126.559 50.401  1.00 30.00  ? 898  ASP A CB  1 
ATOM   5579 C  CG  . ASP A 1 919  ? 84.966  125.848 50.850  1.00 30.00  ? 898  ASP A CG  1 
ATOM   5580 O  OD1 . ASP A 1 919  ? 84.859  124.625 50.625  1.00 30.00  ? 898  ASP A OD1 1 
ATOM   5581 O  OD2 . ASP A 1 919  ? 84.028  126.431 51.435  1.00 30.00  ? 898  ASP A OD2 1 
ATOM   5582 N  N   . ILE A 1 920  ? 88.281  126.413 47.983  1.00 87.74  ? 899  ILE A N   1 
ATOM   5583 C  CA  . ILE A 1 920  ? 89.366  126.860 47.114  1.00 87.74  ? 899  ILE A CA  1 
ATOM   5584 C  C   . ILE A 1 920  ? 89.392  128.385 46.956  1.00 87.74  ? 899  ILE A C   1 
ATOM   5585 O  O   . ILE A 1 920  ? 90.462  128.955 46.707  1.00 87.74  ? 899  ILE A O   1 
ATOM   5586 C  CB  . ILE A 1 920  ? 89.282  126.102 45.768  1.00 87.74  ? 899  ILE A CB  1 
ATOM   5587 C  CG1 . ILE A 1 920  ? 89.406  124.589 45.987  1.00 87.74  ? 899  ILE A CG1 1 
ATOM   5588 C  CG2 . ILE A 1 920  ? 90.423  126.424 44.827  1.00 87.74  ? 899  ILE A CG2 1 
ATOM   5589 C  CD1 . ILE A 1 920  ? 88.100  123.803 45.974  1.00 87.74  ? 899  ILE A CD1 1 
ATOM   5590 N  N   . SER A 1 921  ? 88.270  129.075 47.201  1.00 103.30 ? 900  SER A N   1 
ATOM   5591 C  CA  . SER A 1 921  ? 88.255  130.540 47.149  1.00 103.30 ? 900  SER A CA  1 
ATOM   5592 C  C   . SER A 1 921  ? 89.066  131.189 48.262  1.00 103.30 ? 900  SER A C   1 
ATOM   5593 O  O   . SER A 1 921  ? 89.363  132.385 48.173  1.00 103.30 ? 900  SER A O   1 
ATOM   5594 C  CB  . SER A 1 921  ? 86.829  131.076 47.219  1.00 103.30 ? 900  SER A CB  1 
ATOM   5595 O  OG  . SER A 1 921  ? 86.840  132.491 47.273  1.00 103.30 ? 900  SER A OG  1 
ATOM   5596 N  N   . GLN A 1 922  ? 89.439  130.424 49.293  1.00 92.33  ? 901  GLN A N   1 
ATOM   5597 C  CA  . GLN A 1 922  ? 90.316  130.907 50.353  1.00 92.33  ? 901  GLN A CA  1 
ATOM   5598 C  C   . GLN A 1 922  ? 91.686  131.315 49.816  1.00 92.33  ? 901  GLN A C   1 
ATOM   5599 O  O   . GLN A 1 922  ? 92.365  132.157 50.413  1.00 92.33  ? 901  GLN A O   1 
ATOM   5600 C  CB  . GLN A 1 922  ? 90.440  129.818 51.418  1.00 92.33  ? 901  GLN A CB  1 
ATOM   5601 C  CG  . GLN A 1 922  ? 91.179  130.221 52.652  1.00 92.33  ? 901  GLN A CG  1 
ATOM   5602 C  CD  . GLN A 1 922  ? 90.521  131.382 53.347  1.00 92.33  ? 901  GLN A CD  1 
ATOM   5603 O  OE1 . GLN A 1 922  ? 90.957  132.524 53.218  1.00 92.33  ? 901  GLN A OE1 1 
ATOM   5604 N  NE2 . GLN A 1 922  ? 89.474  131.098 54.111  1.00 92.33  ? 901  GLN A NE2 1 
ATOM   5605 N  N   . LEU A 1 923  ? 92.092  130.754 48.675  1.00 27.04  ? 902  LEU A N   1 
ATOM   5606 C  CA  . LEU A 1 923  ? 93.301  131.165 47.971  1.00 27.36  ? 902  LEU A CA  1 
ATOM   5607 C  C   . LEU A 1 923  ? 93.262  132.616 47.518  1.00 27.48  ? 902  LEU A C   1 
ATOM   5608 O  O   . LEU A 1 923  ? 94.321  133.219 47.320  1.00 28.04  ? 902  LEU A O   1 
ATOM   5609 C  CB  . LEU A 1 923  ? 93.497  130.238 46.766  1.00 140.43 ? 902  LEU A CB  1 
ATOM   5610 C  CG  . LEU A 1 923  ? 94.685  130.233 45.797  1.00 140.43 ? 902  LEU A CG  1 
ATOM   5611 C  CD1 . LEU A 1 923  ? 94.557  131.248 44.646  1.00 140.43 ? 902  LEU A CD1 1 
ATOM   5612 C  CD2 . LEU A 1 923  ? 95.979  130.444 46.561  1.00 140.43 ? 902  LEU A CD2 1 
ATOM   5613 N  N   . THR A 1 924  ? 92.073  133.185 47.342  1.00 27.22  ? 903  THR A N   1 
ATOM   5614 C  CA  . THR A 1 924  ? 91.938  134.460 46.654  1.00 29.10  ? 903  THR A CA  1 
ATOM   5615 C  C   . THR A 1 924  ? 92.215  135.670 47.539  1.00 29.97  ? 903  THR A C   1 
ATOM   5616 O  O   . THR A 1 924  ? 92.488  136.752 47.011  1.00 31.73  ? 903  THR A O   1 
ATOM   5617 C  CB  . THR A 1 924  ? 90.532  134.562 46.066  1.00 149.09 ? 903  THR A CB  1 
ATOM   5618 O  OG1 . THR A 1 924  ? 89.569  134.504 47.124  1.00 149.09 ? 903  THR A OG1 1 
ATOM   5619 C  CG2 . THR A 1 924  ? 90.277  133.405 45.110  1.00 149.09 ? 903  THR A CG2 1 
ATOM   5620 N  N   . LYS A 1 925  ? 92.153  135.520 48.861  1.00 28.92  ? 904  LYS A N   1 
ATOM   5621 C  CA  . LYS A 1 925  ? 92.172  136.681 49.743  1.00 29.50  ? 904  LYS A CA  1 
ATOM   5622 C  C   . LYS A 1 925  ? 93.048  136.547 50.975  1.00 29.98  ? 904  LYS A C   1 
ATOM   5623 O  O   . LYS A 1 925  ? 93.242  137.554 51.658  1.00 31.06  ? 904  LYS A O   1 
ATOM   5624 C  CB  . LYS A 1 925  ? 90.747  137.000 50.201  1.00 133.79 ? 904  LYS A CB  1 
ATOM   5625 C  CG  . LYS A 1 925  ? 90.165  135.906 51.069  1.00 133.79 ? 904  LYS A CG  1 
ATOM   5626 C  CD  . LYS A 1 925  ? 88.730  136.183 51.417  1.00 133.79 ? 904  LYS A CD  1 
ATOM   5627 C  CE  . LYS A 1 925  ? 87.853  135.990 50.203  1.00 133.79 ? 904  LYS A CE  1 
ATOM   5628 N  NZ  . LYS A 1 925  ? 87.855  134.572 49.776  1.00 133.79 ? 904  LYS A NZ  1 
ATOM   5629 N  N   . GLN A 1 926  ? 93.556  135.367 51.305  1.00 29.62  ? 905  GLN A N   1 
ATOM   5630 C  CA  . GLN A 1 926  ? 94.297  135.168 52.541  1.00 30.05  ? 905  GLN A CA  1 
ATOM   5631 C  C   . GLN A 1 926  ? 95.793  135.270 52.292  1.00 31.77  ? 905  GLN A C   1 
ATOM   5632 O  O   . GLN A 1 926  ? 96.301  134.761 51.293  1.00 33.85  ? 905  GLN A O   1 
ATOM   5633 C  CB  . GLN A 1 926  ? 93.968  133.811 53.166  1.00 127.11 ? 905  GLN A CB  1 
ATOM   5634 C  CG  . GLN A 1 926  ? 94.634  133.569 54.508  1.00 127.11 ? 905  GLN A CG  1 
ATOM   5635 C  CD  . GLN A 1 926  ? 94.146  132.325 55.178  1.00 127.11 ? 905  GLN A CD  1 
ATOM   5636 O  OE1 . GLN A 1 926  ? 93.319  131.617 54.642  1.00 127.11 ? 905  GLN A OE1 1 
ATOM   5637 N  NE2 . GLN A 1 926  ? 94.651  132.052 56.364  1.00 127.11 ? 905  GLN A NE2 1 
ATOM   5638 N  N   . ARG A 1 927  ? 96.486  135.959 53.191  1.00 32.32  ? 906  ARG A N   1 
ATOM   5639 C  CA  . ARG A 1 927  ? 97.934  135.926 53.252  1.00 34.05  ? 906  ARG A CA  1 
ATOM   5640 C  C   . ARG A 1 927  ? 98.359  135.485 54.644  1.00 35.01  ? 906  ARG A C   1 
ATOM   5641 O  O   . ARG A 1 927  ? 97.662  135.731 55.631  1.00 36.87  ? 906  ARG A O   1 
ATOM   5642 C  CB  . ARG A 1 927  ? 98.546  137.273 52.901  1.00 113.56 ? 906  ARG A CB  1 
ATOM   5643 C  CG  . ARG A 1 927  ? 98.600  137.546 51.412  1.00 113.56 ? 906  ARG A CG  1 
ATOM   5644 C  CD  . ARG A 1 927  ? 97.365  138.243 50.897  1.00 113.56 ? 906  ARG A CD  1 
ATOM   5645 N  NE  . ARG A 1 927  ? 97.558  138.711 49.528  1.00 113.56 ? 906  ARG A NE  1 
ATOM   5646 C  CZ  . ARG A 1 927  ? 97.210  138.019 48.449  1.00 113.56 ? 906  ARG A CZ  1 
ATOM   5647 N  NH1 . ARG A 1 927  ? 97.424  138.513 47.239  1.00 113.56 ? 906  ARG A NH1 1 
ATOM   5648 N  NH2 . ARG A 1 927  ? 96.639  136.834 48.583  1.00 113.56 ? 906  ARG A NH2 1 
ATOM   5649 N  N   . LEU A 1 928  ? 99.522  134.842 54.711  1.00 57.69  ? 907  LEU A N   1 
ATOM   5650 C  CA  . LEU A 1 928  ? 99.888  134.029 55.862  1.00 57.69  ? 907  LEU A CA  1 
ATOM   5651 C  C   . LEU A 1 928  ? 100.529 134.818 56.994  1.00 57.69  ? 907  LEU A C   1 
ATOM   5652 O  O   . LEU A 1 928  ? 100.699 134.280 58.088  1.00 57.69  ? 907  LEU A O   1 
ATOM   5653 C  CB  . LEU A 1 928  ? 100.847 132.937 55.410  1.00 57.69  ? 907  LEU A CB  1 
ATOM   5654 C  CG  . LEU A 1 928  ? 100.274 131.981 54.382  1.00 57.69  ? 907  LEU A CG  1 
ATOM   5655 C  CD1 . LEU A 1 928  ? 101.365 131.085 53.851  1.00 57.69  ? 907  LEU A CD1 1 
ATOM   5656 C  CD2 . LEU A 1 928  ? 99.186  131.165 55.008  1.00 57.69  ? 907  LEU A CD2 1 
ATOM   5657 N  N   . VAL A 1 929  ? 100.969 136.036 56.746  1.00 37.04  ? 908  VAL A N   1 
ATOM   5658 C  CA  . VAL A 1 929  ? 101.575 136.843 57.793  1.00 37.48  ? 908  VAL A CA  1 
ATOM   5659 C  C   . VAL A 1 929  ? 100.908 138.217 57.709  1.00 38.96  ? 908  VAL A C   1 
ATOM   5660 O  O   . VAL A 1 929  ? 101.492 139.262 58.024  1.00 39.34  ? 908  VAL A O   1 
ATOM   5661 C  CB  . VAL A 1 929  ? 103.109 136.820 57.630  1.00 112.22 ? 908  VAL A CB  1 
ATOM   5662 C  CG1 . VAL A 1 929  ? 103.538 137.456 56.324  1.00 112.22 ? 908  VAL A CG1 1 
ATOM   5663 C  CG2 . VAL A 1 929  ? 103.855 137.359 58.849  1.00 112.22 ? 908  VAL A CG2 1 
ATOM   5664 N  N   . ASP A 1 930  ? 99.652  138.221 57.288  1.00 70.08  ? 909  ASP A N   1 
ATOM   5665 C  CA  . ASP A 1 930  ? 98.972  139.449 56.903  1.00 72.44  ? 909  ASP A CA  1 
ATOM   5666 C  C   . ASP A 1 930  ? 98.528  140.247 58.125  1.00 72.81  ? 909  ASP A C   1 
ATOM   5667 O  O   . ASP A 1 930  ? 98.955  140.005 59.257  1.00 72.09  ? 909  ASP A O   1 
ATOM   5668 C  CB  . ASP A 1 930  ? 97.766  139.135 56.015  1.00 30.00  ? 909  ASP A CB  1 
ATOM   5669 C  CG  . ASP A 1 930  ? 98.169  138.655 54.635  1.00 30.00  ? 909  ASP A CG  1 
ATOM   5670 O  OD1 . ASP A 1 930  ? 99.348  138.831 54.263  1.00 30.00  ? 909  ASP A OD1 1 
ATOM   5671 O  OD2 . ASP A 1 930  ? 97.375  138.091 53.852  1.00 30.00  ? 909  ASP A OD2 1 
ATOM   5672 N  N   . ALA A 1 931  ? 97.673  141.241 57.858  1.00 59.55  ? 910  ALA A N   1 
ATOM   5673 C  CA  . ALA A 1 931  ? 97.036  142.112 58.851  1.00 60.22  ? 910  ALA A CA  1 
ATOM   5674 C  C   . ALA A 1 931  ? 98.061  142.936 59.633  1.00 61.45  ? 910  ALA A C   1 
ATOM   5675 O  O   . ALA A 1 931  ? 98.060  142.967 60.868  1.00 60.75  ? 910  ALA A O   1 
ATOM   5676 C  CB  . ALA A 1 931  ? 96.111  141.329 59.789  1.00 172.83 ? 910  ALA A CB  1 
ATOM   5677 N  N   . ASP A 1 932  ? 98.997  143.541 58.891  1.00 102.69 ? 911  ASP A N   1 
ATOM   5678 C  CA  . ASP A 1 932  ? 99.709  144.770 59.246  1.00 104.23 ? 911  ASP A CA  1 
ATOM   5679 C  C   . ASP A 1 932  ? 100.737 144.597 60.364  1.00 102.73 ? 911  ASP A C   1 
ATOM   5680 O  O   . ASP A 1 932  ? 101.559 145.483 60.604  1.00 104.06 ? 911  ASP A O   1 
ATOM   5681 C  CB  . ASP A 1 932  ? 98.680  145.852 59.619  1.00 162.24 ? 911  ASP A CB  1 
ATOM   5682 C  CG  . ASP A 1 932  ? 99.273  147.244 59.672  1.00 162.24 ? 911  ASP A CG  1 
ATOM   5683 O  OD1 . ASP A 1 932  ? 99.545  147.816 58.599  1.00 162.24 ? 911  ASP A OD1 1 
ATOM   5684 O  OD2 . ASP A 1 932  ? 99.469  147.768 60.787  1.00 162.24 ? 911  ASP A OD2 1 
ATOM   5685 N  N   . GLY A 1 933  ? 100.750 143.446 61.013  1.00 124.46 ? 912  GLY A N   1 
ATOM   5686 C  CA  . GLY A 1 933  ? 101.597 143.249 62.161  1.00 122.77 ? 912  GLY A CA  1 
ATOM   5687 C  C   . GLY A 1 933  ? 102.210 141.873 62.144  1.00 121.69 ? 912  GLY A C   1 
ATOM   5688 O  O   . GLY A 1 933  ? 102.930 141.496 61.218  1.00 121.57 ? 912  GLY A O   1 
ATOM   5689 N  N   . ILE A 1 934  ? 101.943 141.132 63.208  1.00 79.37  ? 913  ILE A N   1 
ATOM   5690 C  CA  . ILE A 1 934  ? 102.373 139.750 63.329  1.00 80.43  ? 913  ILE A CA  1 
ATOM   5691 C  C   . ILE A 1 934  ? 101.336 138.791 62.773  1.00 83.16  ? 913  ILE A C   1 
ATOM   5692 O  O   . ILE A 1 934  ? 101.664 137.926 61.959  1.00 82.76  ? 913  ILE A O   1 
ATOM   5693 C  CB  . ILE A 1 934  ? 102.675 139.433 64.810  1.00 120.55 ? 913  ILE A CB  1 
ATOM   5694 C  CG1 . ILE A 1 934  ? 103.943 140.156 65.291  1.00 120.55 ? 913  ILE A CG1 1 
ATOM   5695 C  CG2 . ILE A 1 934  ? 102.685 137.928 65.057  1.00 120.55 ? 913  ILE A CG2 1 
ATOM   5696 C  CD1 . ILE A 1 934  ? 103.689 141.472 66.037  1.00 120.55 ? 913  ILE A CD1 1 
ATOM   5697 N  N   . ILE A 1 935  ? 100.077 139.017 63.142  1.00 100.99 ? 914  ILE A N   1 
ATOM   5698 C  CA  . ILE A 1 935  ? 99.076  137.996 63.436  1.00 103.42 ? 914  ILE A CA  1 
ATOM   5699 C  C   . ILE A 1 935  ? 98.920  136.924 62.369  1.00 104.67 ? 914  ILE A C   1 
ATOM   5700 O  O   . ILE A 1 935  ? 98.574  137.211 61.219  1.00 103.99 ? 914  ILE A O   1 
ATOM   5701 C  CB  . ILE A 1 935  ? 97.732  138.680 63.718  1.00 112.00 ? 914  ILE A CB  1 
ATOM   5702 C  CG1 . ILE A 1 935  ? 97.866  139.557 64.964  1.00 112.00 ? 914  ILE A CG1 1 
ATOM   5703 C  CG2 . ILE A 1 935  ? 96.636  137.650 63.899  1.00 112.00 ? 914  ILE A CG2 1 
ATOM   5704 C  CD1 . ILE A 1 935  ? 96.736  140.542 65.163  1.00 112.00 ? 914  ILE A CD1 1 
ATOM   5705 N  N   . ASN A 1 936  ? 99.208  135.686 62.759  1.00 152.72 ? 915  ASN A N   1 
ATOM   5706 C  CA  . ASN A 1 936  ? 98.999  134.536 61.898  1.00 156.46 ? 915  ASN A CA  1 
ATOM   5707 C  C   . ASN A 1 936  ? 97.505  134.271 61.763  1.00 154.79 ? 915  ASN A C   1 
ATOM   5708 O  O   . ASN A 1 936  ? 96.799  134.219 62.773  1.00 156.56 ? 915  ASN A O   1 
ATOM   5709 C  CB  . ASN A 1 936  ? 99.712  133.326 62.477  1.00 100.75 ? 915  ASN A CB  1 
ATOM   5710 C  CG  . ASN A 1 936  ? 101.205 133.423 62.341  1.00 100.75 ? 915  ASN A CG  1 
ATOM   5711 O  OD1 . ASN A 1 936  ? 101.716 133.767 61.284  1.00 100.75 ? 915  ASN A OD1 1 
ATOM   5712 N  ND2 . ASN A 1 936  ? 101.916 133.141 63.416  1.00 100.75 ? 915  ASN A ND2 1 
ATOM   5713 N  N   . PRO A 1 937  ? 97.031  134.105 60.651  1.00 62.99  ? 916  PRO A N   1 
ATOM   5714 C  CA  . PRO A 1 937  ? 95.576  134.209 60.406  1.00 62.99  ? 916  PRO A CA  1 
ATOM   5715 C  C   . PRO A 1 937  ? 94.696  133.034 60.834  1.00 62.99  ? 916  PRO A C   1 
ATOM   5716 O  O   . PRO A 1 937  ? 94.373  132.119 60.072  1.00 62.99  ? 916  PRO A O   1 
ATOM   5717 C  CB  . PRO A 1 937  ? 95.514  134.416 58.892  1.00 62.99  ? 916  PRO A CB  1 
ATOM   5718 C  CG  . PRO A 1 937  ? 96.717  133.738 58.382  1.00 62.99  ? 916  PRO A CG  1 
ATOM   5719 C  CD  . PRO A 1 937  ? 97.777  133.920 59.398  1.00 62.99  ? 916  PRO A CD  1 
ATOM   5720 N  N   . SER A 1 938  ? 94.314  133.053 62.112  1.00 130.62 ? 917  SER A N   1 
ATOM   5721 C  CA  . SER A 1 938  ? 93.137  132.388 62.666  1.00 126.89 ? 917  SER A CA  1 
ATOM   5722 C  C   . SER A 1 938  ? 93.143  130.873 62.594  1.00 130.43 ? 917  SER A C   1 
ATOM   5723 O  O   . SER A 1 938  ? 92.132  130.258 62.945  1.00 124.44 ? 917  SER A O   1 
ATOM   5724 C  CB  . SER A 1 938  ? 91.838  132.860 62.006  1.00 116.65 ? 917  SER A CB  1 
ATOM   5725 O  OG  . SER A 1 938  ? 90.743  132.080 62.455  1.00 116.65 ? 917  SER A OG  1 
ATOM   5726 N  N   . ALA A 1 939  ? 94.214  130.245 62.127  1.00 148.98 ? 918  ALA A N   1 
ATOM   5727 C  CA  . ALA A 1 939  ? 94.369  128.812 62.300  1.00 148.06 ? 918  ALA A CA  1 
ATOM   5728 C  C   . ALA A 1 939  ? 95.542  128.494 63.213  1.00 149.83 ? 918  ALA A C   1 
ATOM   5729 O  O   . ALA A 1 939  ? 95.361  127.846 64.246  1.00 147.46 ? 918  ALA A O   1 
ATOM   5730 C  CB  . ALA A 1 939  ? 94.565  128.126 60.946  1.00 119.96 ? 918  ALA A CB  1 
ATOM   5731 N  N   . PHE A 1 940  ? 96.756  128.873 62.808  1.00 211.57 ? 919  PHE A N   1 
ATOM   5732 C  CA  . PHE A 1 940  ? 97.986  128.880 63.593  1.00 209.54 ? 919  PHE A CA  1 
ATOM   5733 C  C   . PHE A 1 940  ? 98.449  127.494 64.045  1.00 210.86 ? 919  PHE A C   1 
ATOM   5734 O  O   . PHE A 1 940  ? 99.630  127.329 64.344  1.00 215.13 ? 919  PHE A O   1 
ATOM   5735 C  CB  . PHE A 1 940  ? 97.819  129.813 64.804  1.00 99.27  ? 919  PHE A CB  1 
ATOM   5736 C  CG  . PHE A 1 940  ? 99.032  129.912 65.691  1.00 99.27  ? 919  PHE A CG  1 
ATOM   5737 C  CD1 . PHE A 1 940  ? 100.092 130.714 65.349  1.00 99.27  ? 919  PHE A CD1 1 
ATOM   5738 C  CD2 . PHE A 1 940  ? 99.114  129.172 66.858  1.00 99.27  ? 919  PHE A CD2 1 
ATOM   5739 C  CE1 . PHE A 1 940  ? 101.198 130.795 66.165  1.00 99.27  ? 919  PHE A CE1 1 
ATOM   5740 C  CE2 . PHE A 1 940  ? 100.222 129.238 67.660  1.00 99.27  ? 919  PHE A CE2 1 
ATOM   5741 C  CZ  . PHE A 1 940  ? 101.260 130.054 67.317  1.00 99.27  ? 919  PHE A CZ  1 
ATOM   5742 N  N   . TYR A 1 941  ? 97.610  126.462 63.982  1.00 264.26 ? 920  TYR A N   1 
ATOM   5743 C  CA  . TYR A 1 941  ? 98.009  125.125 64.397  1.00 265.31 ? 920  TYR A CA  1 
ATOM   5744 C  C   . TYR A 1 941  ? 98.287  124.217 63.223  1.00 263.49 ? 920  TYR A C   1 
ATOM   5745 O  O   . TYR A 1 941  ? 99.176  123.373 63.300  1.00 265.94 ? 920  TYR A O   1 
ATOM   5746 C  CB  . TYR A 1 941  ? 96.941  124.484 65.276  1.00 88.77  ? 920  TYR A CB  1 
ATOM   5747 C  CG  . TYR A 1 941  ? 96.807  125.124 66.621  1.00 88.77  ? 920  TYR A CG  1 
ATOM   5748 C  CD1 . TYR A 1 941  ? 97.660  124.798 67.655  1.00 88.77  ? 920  TYR A CD1 1 
ATOM   5749 C  CD2 . TYR A 1 941  ? 95.822  126.053 66.856  1.00 88.77  ? 920  TYR A CD2 1 
ATOM   5750 C  CE1 . TYR A 1 941  ? 97.533  125.392 68.890  1.00 88.77  ? 920  TYR A CE1 1 
ATOM   5751 C  CE2 . TYR A 1 941  ? 95.682  126.645 68.084  1.00 88.77  ? 920  TYR A CE2 1 
ATOM   5752 C  CZ  . TYR A 1 941  ? 96.540  126.316 69.098  1.00 88.77  ? 920  TYR A CZ  1 
ATOM   5753 O  OH  . TYR A 1 941  ? 96.391  126.922 70.323  1.00 88.77  ? 920  TYR A OH  1 
ATOM   5754 N  N   . ILE A 1 942  ? 97.517  124.363 62.151  1.00 275.47 ? 921  ILE A N   1 
ATOM   5755 C  CA  . ILE A 1 942  ? 97.879  123.749 60.884  1.00 272.91 ? 921  ILE A CA  1 
ATOM   5756 C  C   . ILE A 1 942  ? 99.215  124.294 60.411  1.00 274.84 ? 921  ILE A C   1 
ATOM   5757 O  O   . ILE A 1 942  ? 100.115 123.541 60.010  1.00 275.43 ? 921  ILE A O   1 
ATOM   5758 C  CB  . ILE A 1 942  ? 96.774  124.009 59.856  1.00 84.88  ? 921  ILE A CB  1 
ATOM   5759 C  CG1 . ILE A 1 942  ? 95.449  123.434 60.356  1.00 84.88  ? 921  ILE A CG1 1 
ATOM   5760 C  CG2 . ILE A 1 942  ? 97.169  123.470 58.538  1.00 84.88  ? 921  ILE A CG2 1 
ATOM   5761 C  CD1 . ILE A 1 942  ? 95.477  121.956 60.628  1.00 84.88  ? 921  ILE A CD1 1 
ATOM   5762 N  N   . TYR A 1 943  ? 99.370  125.613 60.502  1.00 245.13 ? 922  TYR A N   1 
ATOM   5763 C  CA  . TYR A 1 943  ? 100.639 126.257 60.204  1.00 245.49 ? 922  TYR A CA  1 
ATOM   5764 C  C   . TYR A 1 943  ? 101.733 125.778 61.145  1.00 245.29 ? 922  TYR A C   1 
ATOM   5765 O  O   . TYR A 1 943  ? 102.890 125.640 60.731  1.00 245.50 ? 922  TYR A O   1 
ATOM   5766 C  CB  . TYR A 1 943  ? 100.501 127.773 60.328  1.00 86.72  ? 922  TYR A CB  1 
ATOM   5767 C  CG  . TYR A 1 943  ? 99.496  128.460 59.427  1.00 86.72  ? 922  TYR A CG  1 
ATOM   5768 C  CD1 . TYR A 1 943  ? 99.028  127.871 58.267  1.00 86.72  ? 922  TYR A CD1 1 
ATOM   5769 C  CD2 . TYR A 1 943  ? 98.992  129.698 59.774  1.00 86.72  ? 922  TYR A CD2 1 
ATOM   5770 C  CE1 . TYR A 1 943  ? 98.103  128.512 57.475  1.00 86.72  ? 922  TYR A CE1 1 
ATOM   5771 C  CE2 . TYR A 1 943  ? 98.075  130.336 58.992  1.00 86.72  ? 922  TYR A CE2 1 
ATOM   5772 C  CZ  . TYR A 1 943  ? 97.634  129.742 57.847  1.00 86.72  ? 922  TYR A CZ  1 
ATOM   5773 O  OH  . TYR A 1 943  ? 96.714  130.383 57.061  1.00 86.72  ? 922  TYR A OH  1 
ATOM   5774 N  N   . LEU A 1 944  ? 101.386 125.477 62.396  1.00 143.33 ? 923  LEU A N   1 
ATOM   5775 C  CA  . LEU A 1 944  ? 102.412 125.052 63.337  1.00 141.97 ? 923  LEU A CA  1 
ATOM   5776 C  C   . LEU A 1 944  ? 102.875 123.630 63.064  1.00 139.66 ? 923  LEU A C   1 
ATOM   5777 O  O   . LEU A 1 944  ? 104.078 123.363 63.131  1.00 142.09 ? 923  LEU A O   1 
ATOM   5778 C  CB  . LEU A 1 944  ? 101.915 125.171 64.773  1.00 85.01  ? 923  LEU A CB  1 
ATOM   5779 C  CG  . LEU A 1 944  ? 102.996 125.346 65.837  1.00 85.01  ? 923  LEU A CG  1 
ATOM   5780 C  CD1 . LEU A 1 944  ? 102.453 126.202 66.938  1.00 85.01  ? 923  LEU A CD1 1 
ATOM   5781 C  CD2 . LEU A 1 944  ? 103.464 124.052 66.426  1.00 85.01  ? 923  LEU A CD2 1 
ATOM   5782 N  N   . THR A 1 945  ? 101.953 122.697 62.780  1.00 155.73 ? 924  THR A N   1 
ATOM   5783 C  CA  . THR A 1 945  ? 102.386 121.324 62.524  1.00 154.59 ? 924  THR A CA  1 
ATOM   5784 C  C   . THR A 1 945  ? 103.126 121.225 61.208  1.00 159.01 ? 924  THR A C   1 
ATOM   5785 O  O   . THR A 1 945  ? 104.078 120.443 61.086  1.00 163.06 ? 924  THR A O   1 
ATOM   5786 C  CB  . THR A 1 945  ? 101.220 120.349 62.509  1.00 84.49  ? 924  THR A CB  1 
ATOM   5787 O  OG1 . THR A 1 945  ? 100.361 120.671 61.421  1.00 84.49  ? 924  THR A OG1 1 
ATOM   5788 C  CG2 . THR A 1 945  ? 100.456 120.416 63.795  1.00 84.49  ? 924  THR A CG2 1 
ATOM   5789 N  N   . ALA A 1 946  ? 102.719 122.026 60.222  1.00 122.45 ? 925  ALA A N   1 
ATOM   5790 C  CA  . ALA A 1 946  ? 103.507 122.122 59.003  1.00 123.08 ? 925  ALA A CA  1 
ATOM   5791 C  C   . ALA A 1 946  ? 104.882 122.705 59.274  1.00 120.25 ? 925  ALA A C   1 
ATOM   5792 O  O   . ALA A 1 946  ? 105.859 122.304 58.635  1.00 123.52 ? 925  ALA A O   1 
ATOM   5793 C  CB  . ALA A 1 946  ? 102.771 122.957 57.966  1.00 86.85  ? 925  ALA A CB  1 
ATOM   5794 N  N   . TRP A 1 947  ? 104.990 123.608 60.248  1.00 78.30  ? 926  TRP A N   1 
ATOM   5795 C  CA  . TRP A 1 947  ? 106.289 124.191 60.562  1.00 80.34  ? 926  TRP A CA  1 
ATOM   5796 C  C   . TRP A 1 947  ? 107.201 123.213 61.277  1.00 79.10  ? 926  TRP A C   1 
ATOM   5797 O  O   . TRP A 1 947  ? 108.383 123.102 60.943  1.00 80.74  ? 926  TRP A O   1 
ATOM   5798 C  CB  . TRP A 1 947  ? 106.123 125.416 61.423  1.00 74.55  ? 926  TRP A CB  1 
ATOM   5799 C  CG  . TRP A 1 947  ? 107.416 125.958 61.887  1.00 74.55  ? 926  TRP A CG  1 
ATOM   5800 C  CD1 . TRP A 1 947  ? 108.422 126.416 61.112  1.00 74.55  ? 926  TRP A CD1 1 
ATOM   5801 C  CD2 . TRP A 1 947  ? 107.846 126.118 63.241  1.00 74.55  ? 926  TRP A CD2 1 
ATOM   5802 N  NE1 . TRP A 1 947  ? 109.460 126.854 61.892  1.00 74.55  ? 926  TRP A NE1 1 
ATOM   5803 C  CE2 . TRP A 1 947  ? 109.125 126.683 63.208  1.00 74.55  ? 926  TRP A CE2 1 
ATOM   5804 C  CE3 . TRP A 1 947  ? 107.266 125.844 64.478  1.00 74.55  ? 926  TRP A CE3 1 
ATOM   5805 C  CZ2 . TRP A 1 947  ? 109.838 126.971 64.359  1.00 74.55  ? 926  TRP A CZ2 1 
ATOM   5806 C  CZ3 . TRP A 1 947  ? 107.978 126.125 65.615  1.00 74.55  ? 926  TRP A CZ3 1 
ATOM   5807 C  CH2 . TRP A 1 947  ? 109.247 126.683 65.550  1.00 74.55  ? 926  TRP A CH2 1 
ATOM   5808 N  N   . VAL A 1 948  ? 106.687 122.534 62.299  1.00 31.42  ? 927  VAL A N   1 
ATOM   5809 C  CA  . VAL A 1 948  ? 107.539 121.663 63.093  1.00 31.42  ? 927  VAL A CA  1 
ATOM   5810 C  C   . VAL A 1 948  ? 107.873 120.396 62.317  1.00 31.42  ? 927  VAL A C   1 
ATOM   5811 O  O   . VAL A 1 948  ? 108.939 119.804 62.510  1.00 31.42  ? 927  VAL A O   1 
ATOM   5812 C  CB  . VAL A 1 948  ? 106.868 121.386 64.454  1.00 31.42  ? 927  VAL A CB  1 
ATOM   5813 C  CG1 . VAL A 1 948  ? 105.602 120.636 64.278  1.00 31.42  ? 927  VAL A CG1 1 
ATOM   5814 C  CG2 . VAL A 1 948  ? 107.764 120.618 65.371  1.00 31.42  ? 927  VAL A CG2 1 
ATOM   5815 N  N   . SER A 1 949  ? 107.028 119.998 61.373  1.00 35.38  ? 928  SER A N   1 
ATOM   5816 C  CA  . SER A 1 949  ? 107.380 118.829 60.588  1.00 35.38  ? 928  SER A CA  1 
ATOM   5817 C  C   . SER A 1 949  ? 108.197 119.163 59.352  1.00 35.38  ? 928  SER A C   1 
ATOM   5818 O  O   . SER A 1 949  ? 108.994 118.331 58.913  1.00 35.38  ? 928  SER A O   1 
ATOM   5819 C  CB  . SER A 1 949  ? 106.126 118.076 60.167  1.00 35.38  ? 928  SER A CB  1 
ATOM   5820 O  OG  . SER A 1 949  ? 106.470 116.966 59.366  1.00 35.38  ? 928  SER A OG  1 
ATOM   5821 N  N   . ASN A 1 950  ? 108.034 120.357 58.787  1.00 53.20  ? 929  ASN A N   1 
ATOM   5822 C  CA  . ASN A 1 950  ? 108.655 120.692 57.516  1.00 52.39  ? 929  ASN A CA  1 
ATOM   5823 C  C   . ASN A 1 950  ? 109.831 121.648 57.614  1.00 51.77  ? 929  ASN A C   1 
ATOM   5824 O  O   . ASN A 1 950  ? 110.511 121.855 56.607  1.00 49.90  ? 929  ASN A O   1 
ATOM   5825 C  CB  . ASN A 1 950  ? 107.611 121.286 56.573  1.00 80.42  ? 929  ASN A CB  1 
ATOM   5826 C  CG  . ASN A 1 950  ? 106.580 120.284 56.172  1.00 80.42  ? 929  ASN A CG  1 
ATOM   5827 O  OD1 . ASN A 1 950  ? 105.427 120.376 56.563  1.00 80.42  ? 929  ASN A OD1 1 
ATOM   5828 N  ND2 . ASN A 1 950  ? 106.988 119.308 55.382  1.00 80.42  ? 929  ASN A ND2 1 
ATOM   5829 N  N   . ASP A 1 951  ? 110.092 122.236 58.775  1.00 45.53  ? 930  ASP A N   1 
ATOM   5830 C  CA  . ASP A 1 951  ? 111.243 123.115 58.974  1.00 45.28  ? 930  ASP A CA  1 
ATOM   5831 C  C   . ASP A 1 951  ? 112.013 122.603 60.180  1.00 42.47  ? 930  ASP A C   1 
ATOM   5832 O  O   . ASP A 1 951  ? 111.898 123.155 61.280  1.00 41.85  ? 930  ASP A O   1 
ATOM   5833 C  CB  . ASP A 1 951  ? 110.796 124.559 59.182  1.00 87.36  ? 930  ASP A CB  1 
ATOM   5834 C  CG  . ASP A 1 951  ? 111.926 125.553 59.052  1.00 87.36  ? 930  ASP A CG  1 
ATOM   5835 O  OD1 . ASP A 1 951  ? 113.061 125.141 58.747  1.00 87.36  ? 930  ASP A OD1 1 
ATOM   5836 O  OD2 . ASP A 1 951  ? 111.676 126.757 59.257  1.00 87.36  ? 930  ASP A OD2 1 
ATOM   5837 N  N   . PRO A 1 952  ? 112.814 121.550 60.013  1.00 42.17  ? 931  PRO A N   1 
ATOM   5838 C  CA  . PRO A 1 952  ? 113.396 120.888 61.186  1.00 41.10  ? 931  PRO A CA  1 
ATOM   5839 C  C   . PRO A 1 952  ? 114.586 121.607 61.787  1.00 39.05  ? 931  PRO A C   1 
ATOM   5840 O  O   . PRO A 1 952  ? 114.893 121.369 62.962  1.00 37.63  ? 931  PRO A O   1 
ATOM   5841 C  CB  . PRO A 1 952  ? 113.819 119.521 60.641  1.00 98.84  ? 931  PRO A CB  1 
ATOM   5842 C  CG  . PRO A 1 952  ? 113.100 119.377 59.342  1.00 98.84  ? 931  PRO A CG  1 
ATOM   5843 C  CD  . PRO A 1 952  ? 113.042 120.759 58.799  1.00 98.84  ? 931  PRO A CD  1 
ATOM   5844 N  N   . VAL A 1 953  ? 115.273 122.461 61.035  1.00 53.35  ? 932  VAL A N   1 
ATOM   5845 C  CA  . VAL A 1 953  ? 116.436 123.144 61.580  1.00 51.34  ? 932  VAL A CA  1 
ATOM   5846 C  C   . VAL A 1 953  ? 116.060 124.417 62.336  1.00 51.91  ? 932  VAL A C   1 
ATOM   5847 O  O   . VAL A 1 953  ? 116.788 124.833 63.240  1.00 52.86  ? 932  VAL A O   1 
ATOM   5848 C  CB  . VAL A 1 953  ? 117.443 123.428 60.460  1.00 89.43  ? 932  VAL A CB  1 
ATOM   5849 C  CG1 . VAL A 1 953  ? 117.949 122.133 59.918  1.00 89.43  ? 932  VAL A CG1 1 
ATOM   5850 C  CG2 . VAL A 1 953  ? 116.795 124.207 59.350  1.00 89.43  ? 932  VAL A CG2 1 
ATOM   5851 N  N   . ALA A 1 954  ? 114.931 125.039 62.014  1.00 72.54  ? 933  ALA A N   1 
ATOM   5852 C  CA  . ALA A 1 954  ? 114.486 126.177 62.800  1.00 72.69  ? 933  ALA A CA  1 
ATOM   5853 C  C   . ALA A 1 954  ? 113.735 125.734 64.040  1.00 72.99  ? 933  ALA A C   1 
ATOM   5854 O  O   . ALA A 1 954  ? 113.711 126.459 65.034  1.00 73.69  ? 933  ALA A O   1 
ATOM   5855 C  CB  . ALA A 1 954  ? 113.608 127.091 61.957  1.00 90.61  ? 933  ALA A CB  1 
ATOM   5856 N  N   . TYR A 1 955  ? 113.112 124.560 64.004  1.00 54.66  ? 934  TYR A N   1 
ATOM   5857 C  CA  . TYR A 1 955  ? 112.542 124.007 65.222  1.00 54.83  ? 934  TYR A CA  1 
ATOM   5858 C  C   . TYR A 1 955  ? 113.609 123.377 66.095  1.00 53.89  ? 934  TYR A C   1 
ATOM   5859 O  O   . TYR A 1 955  ? 113.475 123.359 67.320  1.00 53.65  ? 934  TYR A O   1 
ATOM   5860 C  CB  . TYR A 1 955  ? 111.478 122.969 64.892  1.00 77.36  ? 934  TYR A CB  1 
ATOM   5861 C  CG  . TYR A 1 955  ? 110.786 122.445 66.113  1.00 77.36  ? 934  TYR A CG  1 
ATOM   5862 C  CD1 . TYR A 1 955  ? 109.834 123.202 66.762  1.00 77.36  ? 934  TYR A CD1 1 
ATOM   5863 C  CD2 . TYR A 1 955  ? 111.101 121.207 66.631  1.00 77.36  ? 934  TYR A CD2 1 
ATOM   5864 C  CE1 . TYR A 1 955  ? 109.208 122.735 67.881  1.00 77.36  ? 934  TYR A CE1 1 
ATOM   5865 C  CE2 . TYR A 1 955  ? 110.481 120.731 67.753  1.00 77.36  ? 934  TYR A CE2 1 
ATOM   5866 C  CZ  . TYR A 1 955  ? 109.534 121.496 68.367  1.00 77.36  ? 934  TYR A CZ  1 
ATOM   5867 O  OH  . TYR A 1 955  ? 108.919 121.004 69.486  1.00 77.36  ? 934  TYR A OH  1 
ATOM   5868 N  N   . ALA A 1 956  ? 114.653 122.831 65.489  1.00 42.27  ? 935  ALA A N   1 
ATOM   5869 C  CA  . ALA A 1 956  ? 115.772 122.361 66.286  1.00 42.82  ? 935  ALA A CA  1 
ATOM   5870 C  C   . ALA A 1 956  ? 116.545 123.521 66.877  1.00 42.39  ? 935  ALA A C   1 
ATOM   5871 O  O   . ALA A 1 956  ? 117.031 123.420 68.004  1.00 41.30  ? 935  ALA A O   1 
ATOM   5872 C  CB  . ALA A 1 956  ? 116.693 121.495 65.436  1.00 83.61  ? 935  ALA A CB  1 
ATOM   5873 N  N   . ALA A 1 957  ? 116.652 124.631 66.147  1.00 29.82  ? 936  ALA A N   1 
ATOM   5874 C  CA  . ALA A 1 957  ? 117.469 125.750 66.604  1.00 29.23  ? 936  ALA A CA  1 
ATOM   5875 C  C   . ALA A 1 957  ? 116.779 126.521 67.715  1.00 30.18  ? 936  ALA A C   1 
ATOM   5876 O  O   . ALA A 1 957  ? 117.383 126.806 68.753  1.00 30.24  ? 936  ALA A O   1 
ATOM   5877 C  CB  . ALA A 1 957  ? 117.792 126.670 65.436  1.00 80.92  ? 936  ALA A CB  1 
ATOM   5878 N  N   . SER A 1 958  ? 115.521 126.888 67.510  1.00 31.98  ? 937  SER A N   1 
ATOM   5879 C  CA  . SER A 1 958  ? 114.710 127.438 68.587  1.00 33.99  ? 937  SER A CA  1 
ATOM   5880 C  C   . SER A 1 958  ? 114.380 126.327 69.557  1.00 32.97  ? 937  SER A C   1 
ATOM   5881 O  O   . SER A 1 958  ? 113.515 125.496 69.273  1.00 34.65  ? 937  SER A O   1 
ATOM   5882 C  CB  . SER A 1 958  ? 113.423 128.035 68.043  1.00 94.11  ? 937  SER A CB  1 
ATOM   5883 O  OG  . SER A 1 958  ? 112.601 128.464 69.107  1.00 94.11  ? 937  SER A OG  1 
ATOM   5884 N  N   . GLN A 1 959  ? 115.020 126.326 70.722  1.00 45.74  ? 938  GLN A N   1 
ATOM   5885 C  CA  . GLN A 1 959  ? 114.887 125.235 71.684  1.00 45.74  ? 938  GLN A CA  1 
ATOM   5886 C  C   . GLN A 1 959  ? 113.519 125.319 72.346  1.00 45.74  ? 938  GLN A C   1 
ATOM   5887 O  O   . GLN A 1 959  ? 113.390 125.615 73.531  1.00 45.74  ? 938  GLN A O   1 
ATOM   5888 C  CB  . GLN A 1 959  ? 115.977 125.334 72.731  1.00 45.74  ? 938  GLN A CB  1 
ATOM   5889 C  CG  . GLN A 1 959  ? 117.361 125.321 72.179  1.00 45.74  ? 938  GLN A CG  1 
ATOM   5890 C  CD  . GLN A 1 959  ? 118.369 125.620 73.251  1.00 45.74  ? 938  GLN A CD  1 
ATOM   5891 O  OE1 . GLN A 1 959  ? 118.004 125.863 74.397  1.00 45.74  ? 938  GLN A OE1 1 
ATOM   5892 N  NE2 . GLN A 1 959  ? 119.638 125.634 72.891  1.00 45.74  ? 938  GLN A NE2 1 
ATOM   5893 N  N   . ALA A 1 960  ? 112.478 125.034 71.573  1.00 31.51  ? 939  ALA A N   1 
ATOM   5894 C  CA  . ALA A 1 960  ? 111.104 125.216 72.020  1.00 31.51  ? 939  ALA A CA  1 
ATOM   5895 C  C   . ALA A 1 960  ? 110.450 123.853 71.968  1.00 31.51  ? 939  ALA A C   1 
ATOM   5896 O  O   . ALA A 1 960  ? 109.730 123.532 71.025  1.00 31.51  ? 939  ALA A O   1 
ATOM   5897 C  CB  . ALA A 1 960  ? 110.383 126.222 71.154  1.00 31.51  ? 939  ALA A CB  1 
ATOM   5898 N  N   . ASN A 1 961  ? 110.667 123.066 73.007  1.00 34.81  ? 940  ASN A N   1 
ATOM   5899 C  CA  . ASN A 1 961  ? 110.237 121.677 72.998  1.00 34.81  ? 940  ASN A CA  1 
ATOM   5900 C  C   . ASN A 1 961  ? 108.747 121.625 73.287  1.00 34.81  ? 940  ASN A C   1 
ATOM   5901 O  O   . ASN A 1 961  ? 108.308 121.460 74.418  1.00 34.81  ? 940  ASN A O   1 
ATOM   5902 C  CB  . ASN A 1 961  ? 111.077 120.861 73.969  1.00 34.81  ? 940  ASN A CB  1 
ATOM   5903 C  CG  . ASN A 1 961  ? 111.279 121.553 75.287  1.00 34.81  ? 940  ASN A CG  1 
ATOM   5904 O  OD1 . ASN A 1 961  ? 110.661 122.571 75.571  1.00 34.81  ? 940  ASN A OD1 1 
ATOM   5905 N  ND2 . ASN A 1 961  ? 112.194 121.022 76.091  1.00 34.81  ? 940  ASN A ND2 1 
ATOM   5906 N  N   . ILE A 1 962  ? 107.963 121.759 72.222  1.00 32.17  ? 941  ILE A N   1 
ATOM   5907 C  CA  . ILE A 1 962  ? 106.511 121.775 72.324  1.00 32.17  ? 941  ILE A CA  1 
ATOM   5908 C  C   . ILE A 1 962  ? 106.011 120.381 72.672  1.00 32.17  ? 941  ILE A C   1 
ATOM   5909 O  O   . ILE A 1 962  ? 106.270 119.413 71.950  1.00 32.17  ? 941  ILE A O   1 
ATOM   5910 C  CB  . ILE A 1 962  ? 105.884 122.288 71.025  1.00 32.17  ? 941  ILE A CB  1 
ATOM   5911 C  CG1 . ILE A 1 962  ? 106.235 123.754 70.835  1.00 32.17  ? 941  ILE A CG1 1 
ATOM   5912 C  CG2 . ILE A 1 962  ? 104.404 122.108 71.051  1.00 32.17  ? 941  ILE A CG2 1 
ATOM   5913 C  CD1 . ILE A 1 962  ? 105.870 124.277 69.499  1.00 32.17  ? 941  ILE A CD1 1 
ATOM   5914 N  N   . ARG A 1 963  ? 105.313 120.269 73.795  1.00 37.33  ? 942  ARG A N   1 
ATOM   5915 C  CA  . ARG A 1 963  ? 104.701 119.036 74.232  1.00 37.33  ? 942  ARG A CA  1 
ATOM   5916 C  C   . ARG A 1 963  ? 103.226 119.306 74.470  1.00 37.33  ? 942  ARG A C   1 
ATOM   5917 O  O   . ARG A 1 963  ? 102.908 120.236 75.215  1.00 37.33  ? 942  ARG A O   1 
ATOM   5918 C  CB  . ARG A 1 963  ? 105.329 118.529 75.519  1.00 37.33  ? 942  ARG A CB  1 
ATOM   5919 C  CG  . ARG A 1 963  ? 106.801 118.304 75.454  1.00 37.33  ? 942  ARG A CG  1 
ATOM   5920 C  CD  . ARG A 1 963  ? 107.149 117.128 74.603  1.00 37.33  ? 942  ARG A CD  1 
ATOM   5921 N  NE  . ARG A 1 963  ? 108.568 116.853 74.725  1.00 37.33  ? 942  ARG A NE  1 
ATOM   5922 C  CZ  . ARG A 1 963  ? 109.491 117.396 73.948  1.00 37.33  ? 942  ARG A CZ  1 
ATOM   5923 N  NH1 . ARG A 1 963  ? 109.132 118.228 72.982  1.00 37.33  ? 942  ARG A NH1 1 
ATOM   5924 N  NH2 . ARG A 1 963  ? 110.769 117.105 74.132  1.00 37.33  ? 942  ARG A NH2 1 
ATOM   5925 N  N   . PRO A 1 964  ? 102.298 118.491 73.941  1.00 38.68  ? 943  PRO A N   1 
ATOM   5926 C  CA  . PRO A 1 964  ? 102.409 117.193 73.275  1.00 38.68  ? 943  PRO A CA  1 
ATOM   5927 C  C   . PRO A 1 964  ? 102.933 117.299 71.860  1.00 38.68  ? 943  PRO A C   1 
ATOM   5928 O  O   . PRO A 1 964  ? 102.801 118.359 71.254  1.00 38.68  ? 943  PRO A O   1 
ATOM   5929 C  CB  . PRO A 1 964  ? 100.974 116.685 73.276  1.00 38.68  ? 943  PRO A CB  1 
ATOM   5930 C  CG  . PRO A 1 964  ? 100.170 117.905 73.226  1.00 38.68  ? 943  PRO A CG  1 
ATOM   5931 C  CD  . PRO A 1 964  ? 100.895 118.924 74.022  1.00 38.68  ? 943  PRO A CD  1 
ATOM   5932 N  N   . HIS A 1 965  ? 103.540 116.222 71.370  1.00 41.28  ? 944  HIS A N   1 
ATOM   5933 C  CA  . HIS A 1 965  ? 104.238 116.257 70.097  1.00 41.28  ? 944  HIS A CA  1 
ATOM   5934 C  C   . HIS A 1 965  ? 103.242 116.431 68.966  1.00 41.28  ? 944  HIS A C   1 
ATOM   5935 O  O   . HIS A 1 965  ? 102.273 115.675 68.858  1.00 41.28  ? 944  HIS A O   1 
ATOM   5936 C  CB  . HIS A 1 965  ? 105.048 114.986 69.903  1.00 41.28  ? 944  HIS A CB  1 
ATOM   5937 C  CG  . HIS A 1 965  ? 106.161 114.822 70.885  1.00 41.28  ? 944  HIS A CG  1 
ATOM   5938 N  ND1 . HIS A 1 965  ? 107.309 115.579 70.838  1.00 41.28  ? 944  HIS A ND1 1 
ATOM   5939 C  CD2 . HIS A 1 965  ? 106.315 113.967 71.921  1.00 41.28  ? 944  HIS A CD2 1 
ATOM   5940 C  CE1 . HIS A 1 965  ? 108.118 115.206 71.810  1.00 41.28  ? 944  HIS A CE1 1 
ATOM   5941 N  NE2 . HIS A 1 965  ? 107.537 114.232 72.484  1.00 41.28  ? 944  HIS A NE2 1 
ATOM   5942 N  N   . ARG A 1 966  ? 103.465 117.458 68.161  1.00 31.15  ? 945  ARG A N   1 
ATOM   5943 C  CA  . ARG A 1 966  ? 102.658 117.691 66.981  1.00 31.15  ? 945  ARG A CA  1 
ATOM   5944 C  C   . ARG A 1 966  ? 102.867 116.543 66.001  1.00 31.15  ? 945  ARG A C   1 
ATOM   5945 O  O   . ARG A 1 966  ? 104.007 116.103 65.815  1.00 31.15  ? 945  ARG A O   1 
ATOM   5946 C  CB  . ARG A 1 966  ? 103.066 119.015 66.349  1.00 31.15  ? 945  ARG A CB  1 
ATOM   5947 C  CG  . ARG A 1 966  ? 102.995 120.226 67.272  1.00 31.15  ? 945  ARG A CG  1 
ATOM   5948 C  CD  . ARG A 1 966  ? 101.623 120.891 67.296  1.00 31.15  ? 945  ARG A CD  1 
ATOM   5949 N  NE  . ARG A 1 966  ? 100.615 120.144 68.028  1.00 31.15  ? 945  ARG A NE  1 
ATOM   5950 C  CZ  . ARG A 1 966  ? 100.486 120.150 69.345  1.00 31.15  ? 945  ARG A CZ  1 
ATOM   5951 N  NH1 . ARG A 1 966  ? 101.296 120.877 70.087  1.00 31.15  ? 945  ARG A NH1 1 
ATOM   5952 N  NH2 . ARG A 1 966  ? 99.537  119.433 69.923  1.00 31.15  ? 945  ARG A NH2 1 
ATOM   5953 N  N   . PRO A 1 967  ? 101.808 115.998 65.412  1.00 34.69  ? 946  PRO A N   1 
ATOM   5954 C  CA  . PRO A 1 967  ? 101.976 114.880 64.483  1.00 34.69  ? 946  PRO A CA  1 
ATOM   5955 C  C   . PRO A 1 967  ? 102.693 115.322 63.224  1.00 34.69  ? 946  PRO A C   1 
ATOM   5956 O  O   . PRO A 1 967  ? 102.478 116.426 62.725  1.00 34.69  ? 946  PRO A O   1 
ATOM   5957 C  CB  . PRO A 1 967  ? 100.538 114.453 64.179  1.00 34.69  ? 946  PRO A CB  1 
ATOM   5958 C  CG  . PRO A 1 967  ? 99.757  114.940 65.320  1.00 34.69  ? 946  PRO A CG  1 
ATOM   5959 C  CD  . PRO A 1 967  ? 100.393 116.227 65.724  1.00 34.69  ? 946  PRO A CD  1 
ATOM   5960 N  N   . GLU A 1 968  ? 103.570 114.458 62.728  1.00 37.99  ? 947  GLU A N   1 
ATOM   5961 C  CA  . GLU A 1 968  ? 104.405 114.819 61.598  1.00 37.99  ? 947  GLU A CA  1 
ATOM   5962 C  C   . GLU A 1 968  ? 103.612 114.755 60.307  1.00 37.99  ? 947  GLU A C   1 
ATOM   5963 O  O   . GLU A 1 968  ? 102.810 113.845 60.086  1.00 37.99  ? 947  GLU A O   1 
ATOM   5964 C  CB  . GLU A 1 968  ? 105.638 113.921 61.518  1.00 37.99  ? 947  GLU A CB  1 
ATOM   5965 C  CG  . GLU A 1 968  ? 105.384 112.446 61.301  1.00 37.99  ? 947  GLU A CG  1 
ATOM   5966 C  CD  . GLU A 1 968  ? 106.669 111.663 61.185  1.00 37.99  ? 947  GLU A CD  1 
ATOM   5967 O  OE1 . GLU A 1 968  ? 107.749 112.266 61.361  1.00 37.99  ? 947  GLU A OE1 1 
ATOM   5968 O  OE2 . GLU A 1 968  ? 106.608 110.453 60.891  1.00 37.99  ? 947  GLU A OE2 1 
ATOM   5969 N  N   . TRP A 1 969  ? 103.789 115.769 59.487  1.00 36.39  ? 948  TRP A N   1 
ATOM   5970 C  CA  . TRP A 1 969  ? 103.206 115.811 58.159  1.00 36.39  ? 948  TRP A CA  1 
ATOM   5971 C  C   . TRP A 1 969  ? 104.342 116.235 57.245  1.00 36.39  ? 948  TRP A C   1 
ATOM   5972 O  O   . TRP A 1 969  ? 104.498 117.416 56.941  1.00 36.39  ? 948  TRP A O   1 
ATOM   5973 C  CB  . TRP A 1 969  ? 102.043 116.766 58.115  1.00 36.39  ? 948  TRP A CB  1 
ATOM   5974 C  CG  . TRP A 1 969  ? 101.347 116.743 56.838  1.00 36.39  ? 948  TRP A CG  1 
ATOM   5975 C  CD1 . TRP A 1 969  ? 100.556 115.751 56.363  1.00 36.39  ? 948  TRP A CD1 1 
ATOM   5976 C  CD2 . TRP A 1 969  ? 101.402 117.737 55.823  1.00 36.39  ? 948  TRP A CD2 1 
ATOM   5977 N  NE1 . TRP A 1 969  ? 100.087 116.074 55.117  1.00 36.39  ? 948  TRP A NE1 1 
ATOM   5978 C  CE2 . TRP A 1 969  ? 100.599 117.291 54.764  1.00 36.39  ? 948  TRP A CE2 1 
ATOM   5979 C  CE3 . TRP A 1 969  ? 102.040 118.967 55.712  1.00 36.39  ? 948  TRP A CE3 1 
ATOM   5980 C  CZ2 . TRP A 1 969  ? 100.426 118.028 53.608  1.00 36.39  ? 948  TRP A CZ2 1 
ATOM   5981 C  CZ3 . TRP A 1 969  ? 101.866 119.690 54.573  1.00 36.39  ? 948  TRP A CZ3 1 
ATOM   5982 C  CH2 . TRP A 1 969  ? 101.066 119.224 53.532  1.00 36.39  ? 948  TRP A CH2 1 
ATOM   5983 N  N   . VAL A 1 970  ? 105.156 115.280 56.821  1.00 31.64  ? 949  VAL A N   1 
ATOM   5984 C  CA  . VAL A 1 970  ? 106.271 115.612 55.947  1.00 31.64  ? 949  VAL A CA  1 
ATOM   5985 C  C   . VAL A 1 970  ? 105.749 115.672 54.525  1.00 31.64  ? 949  VAL A C   1 
ATOM   5986 O  O   . VAL A 1 970  ? 105.122 114.726 54.041  1.00 31.64  ? 949  VAL A O   1 
ATOM   5987 C  CB  . VAL A 1 970  ? 107.407 114.595 56.084  1.00 31.64  ? 949  VAL A CB  1 
ATOM   5988 C  CG1 . VAL A 1 970  ? 108.548 114.973 55.171  1.00 31.64  ? 949  VAL A CG1 1 
ATOM   5989 C  CG2 . VAL A 1 970  ? 107.888 114.541 57.507  1.00 31.64  ? 949  VAL A CG2 1 
ATOM   5990 N  N   . HIS A 1 971  ? 105.987 116.790 53.861  1.00 51.31  ? 950  HIS A N   1 
ATOM   5991 C  CA  . HIS A 1 971  ? 105.424 117.038 52.551  1.00 51.31  ? 950  HIS A CA  1 
ATOM   5992 C  C   . HIS A 1 971  ? 106.479 116.876 51.473  1.00 51.31  ? 950  HIS A C   1 
ATOM   5993 O  O   . HIS A 1 971  ? 107.595 117.382 51.606  1.00 51.31  ? 950  HIS A O   1 
ATOM   5994 C  CB  . HIS A 1 971  ? 104.847 118.441 52.467  1.00 51.31  ? 950  HIS A CB  1 
ATOM   5995 C  CG  . HIS A 1 971  ? 104.312 118.773 51.117  1.00 51.31  ? 950  HIS A CG  1 
ATOM   5996 N  ND1 . HIS A 1 971  ? 103.104 118.301 50.661  1.00 51.31  ? 950  HIS A ND1 1 
ATOM   5997 C  CD2 . HIS A 1 971  ? 104.845 119.489 50.101  1.00 51.31  ? 950  HIS A CD2 1 
ATOM   5998 C  CE1 . HIS A 1 971  ? 102.897 118.739 49.434  1.00 51.31  ? 950  HIS A CE1 1 
ATOM   5999 N  NE2 . HIS A 1 971  ? 103.943 119.456 49.069  1.00 51.31  ? 950  HIS A NE2 1 
ATOM   6000 N  N   . ASP A 1 972  ? 106.120 116.177 50.403  1.00 91.27  ? 951  ASP A N   1 
ATOM   6001 C  CA  . ASP A 1 972  ? 106.883 116.214 49.167  1.00 91.27  ? 951  ASP A CA  1 
ATOM   6002 C  C   . ASP A 1 972  ? 106.059 116.876 48.068  1.00 91.27  ? 951  ASP A C   1 
ATOM   6003 O  O   . ASP A 1 972  ? 104.831 116.773 48.042  1.00 91.27  ? 951  ASP A O   1 
ATOM   6004 C  CB  . ASP A 1 972  ? 107.328 114.816 48.728  1.00 91.27  ? 951  ASP A CB  1 
ATOM   6005 C  CG  . ASP A 1 972  ? 106.180 113.834 48.620  1.00 91.27  ? 951  ASP A CG  1 
ATOM   6006 O  OD1 . ASP A 1 972  ? 105.066 114.138 49.088  1.00 91.27  ? 951  ASP A OD1 1 
ATOM   6007 O  OD2 . ASP A 1 972  ? 106.390 112.749 48.045  1.00 91.27  ? 951  ASP A OD2 1 
ATOM   6008 N  N   . LYS A 1 973  ? 106.745 117.583 47.176  1.00 89.11  ? 952  LYS A N   1 
ATOM   6009 C  CA  . LYS A 1 973  ? 106.078 118.137 46.010  1.00 89.11  ? 952  LYS A CA  1 
ATOM   6010 C  C   . LYS A 1 973  ? 105.678 116.997 45.086  1.00 89.11  ? 952  LYS A C   1 
ATOM   6011 O  O   . LYS A 1 973  ? 106.389 115.990 44.985  1.00 89.11  ? 952  LYS A O   1 
ATOM   6012 C  CB  . LYS A 1 973  ? 107.004 119.138 45.304  1.00 89.11  ? 952  LYS A CB  1 
ATOM   6013 C  CG  . LYS A 1 973  ? 106.412 119.957 44.142  1.00 89.11  ? 952  LYS A CG  1 
ATOM   6014 C  CD  . LYS A 1 973  ? 106.637 119.331 42.775  1.00 89.11  ? 952  LYS A CD  1 
ATOM   6015 C  CE  . LYS A 1 973  ? 108.116 119.181 42.500  1.00 89.11  ? 952  LYS A CE  1 
ATOM   6016 N  NZ  . LYS A 1 973  ? 108.790 120.498 42.486  1.00 89.11  ? 952  LYS A NZ  1 
ATOM   6017 N  N   . ALA A 1 974  ? 104.523 117.163 44.432  1.00 102.44 ? 953  ALA A N   1 
ATOM   6018 C  CA  . ALA A 1 974  ? 103.925 116.201 43.501  1.00 102.44 ? 953  ALA A CA  1 
ATOM   6019 C  C   . ALA A 1 974  ? 103.695 114.848 44.179  1.00 102.44 ? 953  ALA A C   1 
ATOM   6020 O  O   . ALA A 1 974  ? 104.291 113.825 43.842  1.00 102.44 ? 953  ALA A O   1 
ATOM   6021 C  CB  . ALA A 1 974  ? 104.761 116.053 42.222  1.00 102.44 ? 953  ALA A CB  1 
ATOM   6022 N  N   . ASP A 1 975  ? 102.814 114.886 45.173  1.00 88.38  ? 954  ASP A N   1 
ATOM   6023 C  CA  . ASP A 1 975  ? 102.368 113.673 45.840  1.00 88.38  ? 954  ASP A CA  1 
ATOM   6024 C  C   . ASP A 1 975  ? 101.195 113.040 45.096  1.00 88.38  ? 954  ASP A C   1 
ATOM   6025 O  O   . ASP A 1 975  ? 101.280 111.881 44.678  1.00 88.38  ? 954  ASP A O   1 
ATOM   6026 C  CB  . ASP A 1 975  ? 101.997 113.991 47.285  1.00 88.38  ? 954  ASP A CB  1 
ATOM   6027 C  CG  . ASP A 1 975  ? 101.633 112.769 48.062  1.00 88.38  ? 954  ASP A CG  1 
ATOM   6028 O  OD1 . ASP A 1 975  ? 102.542 111.991 48.416  1.00 88.38  ? 954  ASP A OD1 1 
ATOM   6029 O  OD2 . ASP A 1 975  ? 100.428 112.586 48.315  1.00 88.38  ? 954  ASP A OD2 1 
ATOM   6030 N  N   . TYR A 1 976  ? 100.097 113.792 44.945  1.00 93.05  ? 955  TYR A N   1 
ATOM   6031 C  CA  . TYR A 1 976  ? 98.961  113.458 44.073  1.00 93.05  ? 955  TYR A CA  1 
ATOM   6032 C  C   . TYR A 1 976  ? 98.275  112.150 44.459  1.00 93.05  ? 955  TYR A C   1 
ATOM   6033 O  O   . TYR A 1 976  ? 98.006  111.288 43.621  1.00 93.05  ? 955  TYR A O   1 
ATOM   6034 C  CB  . TYR A 1 976  ? 99.383  113.449 42.602  1.00 93.05  ? 955  TYR A CB  1 
ATOM   6035 C  CG  . TYR A 1 976  ? 99.448  114.831 42.023  1.00 93.05  ? 955  TYR A CG  1 
ATOM   6036 C  CD1 . TYR A 1 976  ? 98.315  115.419 41.484  1.00 93.05  ? 955  TYR A CD1 1 
ATOM   6037 C  CD2 . TYR A 1 976  ? 100.616 115.573 42.067  1.00 93.05  ? 955  TYR A CD2 1 
ATOM   6038 C  CE1 . TYR A 1 976  ? 98.347  116.694 40.967  1.00 93.05  ? 955  TYR A CE1 1 
ATOM   6039 C  CE2 . TYR A 1 976  ? 100.660 116.860 41.558  1.00 93.05  ? 955  TYR A CE2 1 
ATOM   6040 C  CZ  . TYR A 1 976  ? 99.518  117.413 41.010  1.00 93.05  ? 955  TYR A CZ  1 
ATOM   6041 O  OH  . TYR A 1 976  ? 99.542  118.686 40.495  1.00 93.05  ? 955  TYR A OH  1 
ATOM   6042 N  N   . MET A 1 977  ? 97.977  112.016 45.753  1.00 89.30  ? 956  MET A N   1 
ATOM   6043 C  CA  . MET A 1 977  ? 97.162  110.929 46.271  1.00 89.30  ? 956  MET A CA  1 
ATOM   6044 C  C   . MET A 1 977  ? 96.578  111.386 47.593  1.00 89.30  ? 956  MET A C   1 
ATOM   6045 O  O   . MET A 1 977  ? 97.267  112.089 48.340  1.00 89.30  ? 956  MET A O   1 
ATOM   6046 C  CB  . MET A 1 977  ? 97.970  109.634 46.442  1.00 89.30  ? 956  MET A CB  1 
ATOM   6047 C  CG  . MET A 1 977  ? 99.283  109.730 47.228  1.00 89.30  ? 956  MET A CG  1 
ATOM   6048 S  SD  . MET A 1 977  ? 99.210  109.622 49.032  1.00 89.30  ? 956  MET A SD  1 
ATOM   6049 C  CE  . MET A 1 977  ? 98.738  107.914 49.266  1.00 89.30  ? 956  MET A CE  1 
ATOM   6050 N  N   . PRO A 1 978  ? 95.330  111.024 47.917  1.00 90.58  ? 957  PRO A N   1 
ATOM   6051 C  CA  . PRO A 1 978  ? 94.735  111.495 49.174  1.00 90.58  ? 957  PRO A CA  1 
ATOM   6052 C  C   . PRO A 1 978  ? 95.363  110.844 50.394  1.00 90.58  ? 957  PRO A C   1 
ATOM   6053 O  O   . PRO A 1 978  ? 96.267  110.017 50.250  1.00 90.58  ? 957  PRO A O   1 
ATOM   6054 C  CB  . PRO A 1 978  ? 93.257  111.116 49.028  1.00 90.58  ? 957  PRO A CB  1 
ATOM   6055 C  CG  . PRO A 1 978  ? 93.272  109.952 48.121  1.00 90.58  ? 957  PRO A CG  1 
ATOM   6056 C  CD  . PRO A 1 978  ? 94.396  110.183 47.152  1.00 90.58  ? 957  PRO A CD  1 
ATOM   6057 N  N   . GLU A 1 979  ? 94.894  111.258 51.580  1.00 48.01  ? 958  GLU A N   1 
ATOM   6058 C  CA  . GLU A 1 979  ? 95.367  110.957 52.936  1.00 50.22  ? 958  GLU A CA  1 
ATOM   6059 C  C   . GLU A 1 979  ? 96.669  111.687 53.262  1.00 51.80  ? 958  GLU A C   1 
ATOM   6060 O  O   . GLU A 1 979  ? 97.132  111.641 54.404  1.00 53.76  ? 958  GLU A O   1 
ATOM   6061 C  CB  . GLU A 1 979  ? 95.536  109.451 53.194  1.00 141.10 ? 958  GLU A CB  1 
ATOM   6062 C  CG  . GLU A 1 979  ? 94.279  108.644 52.978  1.00 141.10 ? 958  GLU A CG  1 
ATOM   6063 C  CD  . GLU A 1 979  ? 94.497  107.166 53.199  1.00 141.10 ? 958  GLU A CD  1 
ATOM   6064 O  OE1 . GLU A 1 979  ? 95.650  106.779 53.469  1.00 141.10 ? 958  GLU A OE1 1 
ATOM   6065 O  OE2 . GLU A 1 979  ? 93.528  106.389 53.085  1.00 141.10 ? 958  GLU A OE2 1 
ATOM   6066 N  N   . THR A 1 980  ? 97.284  112.341 52.280  1.00 44.73  ? 959  THR A N   1 
ATOM   6067 C  CA  . THR A 1 980  ? 98.356  113.299 52.533  1.00 46.20  ? 959  THR A CA  1 
ATOM   6068 C  C   . THR A 1 980  ? 98.233  114.577 51.704  1.00 47.06  ? 959  THR A C   1 
ATOM   6069 O  O   . THR A 1 980  ? 98.615  115.646 52.190  1.00 46.56  ? 959  THR A O   1 
ATOM   6070 C  CB  . THR A 1 980  ? 99.721  112.623 52.284  1.00 130.53 ? 959  THR A CB  1 
ATOM   6071 O  OG1 . THR A 1 980  ? 99.784  111.412 53.045  1.00 130.53 ? 959  THR A OG1 1 
ATOM   6072 C  CG2 . THR A 1 980  ? 100.903 113.492 52.711  1.00 130.53 ? 959  THR A CG2 1 
ATOM   6073 N  N   . ARG A 1 981  ? 97.612  114.498 50.538  1.00 69.27  ? 960  ARG A N   1 
ATOM   6074 C  CA  . ARG A 1 981  ? 97.425  115.708 49.779  1.00 70.56  ? 960  ARG A CA  1 
ATOM   6075 C  C   . ARG A 1 981  ? 96.364  116.523 50.507  1.00 71.20  ? 960  ARG A C   1 
ATOM   6076 O  O   . ARG A 1 981  ? 95.297  116.020 50.841  1.00 73.05  ? 960  ARG A O   1 
ATOM   6077 C  CB  . ARG A 1 981  ? 96.953  115.390 48.362  1.00 30.00  ? 960  ARG A CB  1 
ATOM   6078 C  CG  . ARG A 1 981  ? 97.856  115.942 47.272  1.00 30.00  ? 960  ARG A CG  1 
ATOM   6079 C  CD  . ARG A 1 981  ? 97.173  117.047 46.480  1.00 30.00  ? 960  ARG A CD  1 
ATOM   6080 N  NE  . ARG A 1 981  ? 95.739  116.820 46.327  1.00 30.00  ? 960  ARG A NE  1 
ATOM   6081 C  CZ  . ARG A 1 981  ? 94.999  117.350 45.360  1.00 30.00  ? 960  ARG A CZ  1 
ATOM   6082 N  NH1 . ARG A 1 981  ? 95.555  118.139 44.454  1.00 30.00  ? 960  ARG A NH1 1 
ATOM   6083 N  NH2 . ARG A 1 981  ? 93.702  117.091 45.298  1.00 30.00  ? 960  ARG A NH2 1 
ATOM   6084 N  N   . LEU A 1 982  ? 96.684  117.784 50.756  1.00 52.96  ? 961  LEU A N   1 
ATOM   6085 C  CA  . LEU A 1 982  ? 95.777  118.750 51.378  1.00 52.96  ? 961  LEU A CA  1 
ATOM   6086 C  C   . LEU A 1 982  ? 95.062  118.138 52.582  1.00 52.96  ? 961  LEU A C   1 
ATOM   6087 O  O   . LEU A 1 982  ? 93.839  118.056 52.649  1.00 52.96  ? 961  LEU A O   1 
ATOM   6088 C  CB  . LEU A 1 982  ? 94.777  119.305 50.360  1.00 52.96  ? 961  LEU A CB  1 
ATOM   6089 C  CG  . LEU A 1 982  ? 95.121  120.482 49.447  1.00 52.96  ? 961  LEU A CG  1 
ATOM   6090 C  CD1 . LEU A 1 982  ? 96.056  120.079 48.353  1.00 52.96  ? 961  LEU A CD1 1 
ATOM   6091 C  CD2 . LEU A 1 982  ? 93.860  121.060 48.846  1.00 52.96  ? 961  LEU A CD2 1 
ATOM   6092 N  N   . ARG A 1 983  ? 95.864  117.559 53.454  1.00 96.93  ? 962  ARG A N   1 
ATOM   6093 C  CA  . ARG A 1 983  ? 95.357  117.038 54.697  1.00 98.71  ? 962  ARG A CA  1 
ATOM   6094 C  C   . ARG A 1 983  ? 96.438  117.282 55.723  1.00 99.86  ? 962  ARG A C   1 
ATOM   6095 O  O   . ARG A 1 983  ? 97.599  116.940 55.524  1.00 99.89  ? 962  ARG A O   1 
ATOM   6096 C  CB  . ARG A 1 983  ? 95.001  115.556 54.609  1.00 97.48  ? 962  ARG A CB  1 
ATOM   6097 C  CG  . ARG A 1 983  ? 94.085  115.094 55.733  1.00 97.48  ? 962  ARG A CG  1 
ATOM   6098 C  CD  . ARG A 1 983  ? 93.188  113.945 55.300  1.00 97.48  ? 962  ARG A CD  1 
ATOM   6099 N  NE  . ARG A 1 983  ? 91.770  114.244 55.478  1.00 97.48  ? 962  ARG A NE  1 
ATOM   6100 C  CZ  . ARG A 1 983  ? 90.838  114.021 54.557  1.00 97.48  ? 962  ARG A CZ  1 
ATOM   6101 N  NH1 . ARG A 1 983  ? 91.171  113.498 53.387  1.00 97.48  ? 962  ARG A NH1 1 
ATOM   6102 N  NH2 . ARG A 1 983  ? 89.573  114.322 54.801  1.00 97.48  ? 962  ARG A NH2 1 
ATOM   6103 N  N   . ILE A 1 984  ? 96.044  117.881 56.824  1.00 70.09  ? 963  ILE A N   1 
ATOM   6104 C  CA  . ILE A 1 984  ? 96.935  118.152 57.941  1.00 70.99  ? 963  ILE A CA  1 
ATOM   6105 C  C   . ILE A 1 984  ? 96.282  117.545 59.172  1.00 68.43  ? 963  ILE A C   1 
ATOM   6106 O  O   . ILE A 1 984  ? 95.093  117.788 59.402  1.00 65.24  ? 963  ILE A O   1 
ATOM   6107 C  CB  . ILE A 1 984  ? 97.140  119.663 58.124  1.00 99.79  ? 963  ILE A CB  1 
ATOM   6108 C  CG1 . ILE A 1 984  ? 97.364  120.330 56.769  1.00 99.79  ? 963  ILE A CG1 1 
ATOM   6109 C  CG2 . ILE A 1 984  ? 98.314  119.926 59.000  1.00 99.79  ? 963  ILE A CG2 1 
ATOM   6110 C  CD1 . ILE A 1 984  ? 98.603  119.951 56.081  1.00 99.79  ? 963  ILE A CD1 1 
ATOM   6111 N  N   . PRO A 1 985  ? 96.987  116.728 59.956  1.00 39.74  ? 964  PRO A N   1 
ATOM   6112 C  CA  . PRO A 1 985  ? 96.324  116.028 61.062  1.00 38.63  ? 964  PRO A CA  1 
ATOM   6113 C  C   . PRO A 1 985  ? 95.956  116.997 62.173  1.00 36.80  ? 964  PRO A C   1 
ATOM   6114 O  O   . PRO A 1 985  ? 96.756  117.849 62.565  1.00 36.38  ? 964  PRO A O   1 
ATOM   6115 C  CB  . PRO A 1 985  ? 97.370  115.006 61.514  1.00 99.66  ? 964  PRO A CB  1 
ATOM   6116 C  CG  . PRO A 1 985  ? 98.652  115.611 61.134  1.00 99.66  ? 964  PRO A CG  1 
ATOM   6117 C  CD  . PRO A 1 985  ? 98.408  116.370 59.866  1.00 99.66  ? 964  PRO A CD  1 
ATOM   6118 N  N   . ALA A 1 986  ? 94.716  116.889 62.641  1.00 60.00  ? 965  ALA A N   1 
ATOM   6119 C  CA  . ALA A 1 986  ? 94.172  117.822 63.620  1.00 59.66  ? 965  ALA A CA  1 
ATOM   6120 C  C   . ALA A 1 986  ? 94.879  117.623 64.951  1.00 58.47  ? 965  ALA A C   1 
ATOM   6121 O  O   . ALA A 1 986  ? 94.652  116.624 65.641  1.00 60.93  ? 965  ALA A O   1 
ATOM   6122 C  CB  . ALA A 1 986  ? 92.668  117.621 63.760  1.00 113.20 ? 965  ALA A CB  1 
ATOM   6123 N  N   . ALA A 1 987  ? 95.743  118.564 65.304  1.00 37.74  ? 966  ALA A N   1 
ATOM   6124 C  CA  . ALA A 1 987  ? 96.599  118.443 66.470  1.00 36.17  ? 966  ALA A CA  1 
ATOM   6125 C  C   . ALA A 1 987  ? 95.985  119.133 67.678  1.00 37.40  ? 966  ALA A C   1 
ATOM   6126 O  O   . ALA A 1 987  ? 95.221  120.093 67.551  1.00 36.64  ? 966  ALA A O   1 
ATOM   6127 C  CB  . ALA A 1 987  ? 97.973  119.035 66.182  1.00 121.57 ? 966  ALA A CB  1 
ATOM   6128 N  N   . GLU A 1 988  ? 96.337  118.633 68.858  1.00 54.52  ? 967  GLU A N   1 
ATOM   6129 C  CA  . GLU A 1 988  ? 95.829  119.172 70.105  1.00 54.79  ? 967  GLU A CA  1 
ATOM   6130 C  C   . GLU A 1 988  ? 96.445  120.541 70.387  1.00 54.83  ? 967  GLU A C   1 
ATOM   6131 O  O   . GLU A 1 988  ? 97.488  120.880 69.826  1.00 53.96  ? 967  GLU A O   1 
ATOM   6132 C  CB  . GLU A 1 988  ? 96.129  118.201 71.244  1.00 128.05 ? 967  GLU A CB  1 
ATOM   6133 C  CG  . GLU A 1 988  ? 95.268  116.978 71.239  1.00 128.05 ? 967  GLU A CG  1 
ATOM   6134 C  CD  . GLU A 1 988  ? 95.559  116.086 72.410  1.00 128.05 ? 967  GLU A CD  1 
ATOM   6135 O  OE1 . GLU A 1 988  ? 96.551  116.347 73.122  1.00 128.05 ? 967  GLU A OE1 1 
ATOM   6136 O  OE2 . GLU A 1 988  ? 94.788  115.132 72.631  1.00 128.05 ? 967  GLU A OE2 1 
ATOM   6137 N  N   . PRO A 1 989  ? 95.810  121.357 71.233  1.00 54.03  ? 968  PRO A N   1 
ATOM   6138 C  CA  . PRO A 1 989  ? 96.431  122.622 71.640  1.00 55.16  ? 968  PRO A CA  1 
ATOM   6139 C  C   . PRO A 1 989  ? 97.680  122.405 72.480  1.00 53.69  ? 968  PRO A C   1 
ATOM   6140 O  O   . PRO A 1 989  ? 97.950  121.323 73.001  1.00 54.46  ? 968  PRO A O   1 
ATOM   6141 C  CB  . PRO A 1 989  ? 95.333  123.325 72.434  1.00 106.27 ? 968  PRO A CB  1 
ATOM   6142 C  CG  . PRO A 1 989  ? 94.408  122.257 72.826  1.00 106.27 ? 968  PRO A CG  1 
ATOM   6143 C  CD  . PRO A 1 989  ? 94.419  121.285 71.704  1.00 106.27 ? 968  PRO A CD  1 
ATOM   6144 N  N   . ILE A 1 990  ? 98.427  123.494 72.637  1.00 61.00  ? 969  ILE A N   1 
ATOM   6145 C  CA  . ILE A 1 990  ? 99.868  123.391 72.820  1.00 60.13  ? 969  ILE A CA  1 
ATOM   6146 C  C   . ILE A 1 990  ? 100.236 123.000 74.242  1.00 60.60  ? 969  ILE A C   1 
ATOM   6147 O  O   . ILE A 1 990  ? 101.053 122.101 74.432  1.00 59.76  ? 969  ILE A O   1 
ATOM   6148 C  CB  . ILE A 1 990  ? 100.546 124.697 72.376  1.00 92.42  ? 969  ILE A CB  1 
ATOM   6149 C  CG1 . ILE A 1 990  ? 100.458 124.798 70.862  1.00 92.42  ? 969  ILE A CG1 1 
ATOM   6150 C  CG2 . ILE A 1 990  ? 101.989 124.747 72.788  1.00 92.42  ? 969  ILE A CG2 1 
ATOM   6151 C  CD1 . ILE A 1 990  ? 100.861 126.115 70.324  1.00 92.42  ? 969  ILE A CD1 1 
ATOM   6152 N  N   . GLU A 1 991  ? 99.744  123.734 75.244  1.00 52.96  ? 970  GLU A N   1 
ATOM   6153 C  CA  . GLU A 1 991  ? 99.859  123.462 76.687  1.00 52.96  ? 970  GLU A CA  1 
ATOM   6154 C  C   . GLU A 1 991  ? 101.263 123.629 77.268  1.00 52.96  ? 970  GLU A C   1 
ATOM   6155 O  O   . GLU A 1 991  ? 101.405 123.707 78.491  1.00 52.96  ? 970  GLU A O   1 
ATOM   6156 C  CB  . GLU A 1 991  ? 99.403  122.040 77.058  1.00 52.96  ? 970  GLU A CB  1 
ATOM   6157 C  CG  . GLU A 1 991  ? 97.994  121.667 76.687  1.00 52.96  ? 970  GLU A CG  1 
ATOM   6158 C  CD  . GLU A 1 991  ? 97.670  120.243 77.076  1.00 52.96  ? 970  GLU A CD  1 
ATOM   6159 O  OE1 . GLU A 1 991  ? 98.577  119.548 77.573  1.00 52.96  ? 970  GLU A OE1 1 
ATOM   6160 O  OE2 . GLU A 1 991  ? 96.517  119.815 76.872  1.00 52.96  ? 970  GLU A OE2 1 
ATOM   6161 N  N   . TYR A 1 992  ? 102.292 123.737 76.425  1.00 36.25  ? 971  TYR A N   1 
ATOM   6162 C  CA  . TYR A 1 992  ? 103.681 123.777 76.872  1.00 36.25  ? 971  TYR A CA  1 
ATOM   6163 C  C   . TYR A 1 992  ? 104.583 124.197 75.730  1.00 36.25  ? 971  TYR A C   1 
ATOM   6164 O  O   . TYR A 1 992  ? 104.533 123.609 74.651  1.00 36.25  ? 971  TYR A O   1 
ATOM   6165 C  CB  . TYR A 1 992  ? 104.154 122.418 77.383  1.00 36.25  ? 971  TYR A CB  1 
ATOM   6166 C  CG  . TYR A 1 992  ? 105.528 122.440 78.014  1.00 36.25  ? 971  TYR A CG  1 
ATOM   6167 C  CD1 . TYR A 1 992  ? 105.690 122.765 79.341  1.00 36.25  ? 971  TYR A CD1 1 
ATOM   6168 C  CD2 . TYR A 1 992  ? 106.665 122.148 77.275  1.00 36.25  ? 971  TYR A CD2 1 
ATOM   6169 C  CE1 . TYR A 1 992  ? 106.935 122.769 79.919  1.00 36.25  ? 971  TYR A CE1 1 
ATOM   6170 C  CE2 . TYR A 1 992  ? 107.911 122.179 77.840  1.00 36.25  ? 971  TYR A CE2 1 
ATOM   6171 C  CZ  . TYR A 1 992  ? 108.041 122.501 79.158  1.00 36.25  ? 971  TYR A CZ  1 
ATOM   6172 O  OH  . TYR A 1 992  ? 109.286 122.526 79.730  1.00 36.25  ? 971  TYR A OH  1 
ATOM   6173 N  N   . ALA A 1 993  ? 105.450 125.164 75.992  1.00 26.26  ? 972  ALA A N   1 
ATOM   6174 C  CA  . ALA A 1 993  ? 106.433 125.671 75.052  1.00 25.79  ? 972  ALA A CA  1 
ATOM   6175 C  C   . ALA A 1 993  ? 107.387 126.542 75.832  1.00 26.13  ? 972  ALA A C   1 
ATOM   6176 O  O   . ALA A 1 993  ? 106.972 127.214 76.769  1.00 27.10  ? 972  ALA A O   1 
ATOM   6177 C  CB  . ALA A 1 993  ? 105.788 126.492 73.935  1.00 84.66  ? 972  ALA A CB  1 
ATOM   6178 N  N   . GLN A 1 994  ? 108.651 126.538 75.462  1.00 25.82  ? 973  GLN A N   1 
ATOM   6179 C  CA  . GLN A 1 994  ? 109.600 127.345 76.197  1.00 25.83  ? 973  GLN A CA  1 
ATOM   6180 C  C   . GLN A 1 994  ? 110.395 128.185 75.219  1.00 25.58  ? 973  GLN A C   1 
ATOM   6181 O  O   . GLN A 1 994  ? 110.355 127.966 74.009  1.00 24.91  ? 973  GLN A O   1 
ATOM   6182 C  CB  . GLN A 1 994  ? 110.534 126.480 77.032  1.00 73.66  ? 973  GLN A CB  1 
ATOM   6183 C  CG  . GLN A 1 994  ? 111.501 125.695 76.232  1.00 73.66  ? 973  GLN A CG  1 
ATOM   6184 C  CD  . GLN A 1 994  ? 112.299 124.750 77.075  1.00 73.66  ? 973  GLN A CD  1 
ATOM   6185 O  OE1 . GLN A 1 994  ? 112.124 124.689 78.282  1.00 73.66  ? 973  GLN A OE1 1 
ATOM   6186 N  NE2 . GLN A 1 994  ? 113.180 123.995 76.442  1.00 73.66  ? 973  GLN A NE2 1 
ATOM   6187 N  N   . PHE A 1 995  ? 111.112 129.167 75.751  1.00 26.30  ? 974  PHE A N   1 
ATOM   6188 C  CA  . PHE A 1 995  ? 112.077 129.831 74.926  1.00 27.48  ? 974  PHE A CA  1 
ATOM   6189 C  C   . PHE A 1 995  ? 113.285 130.231 75.753  1.00 27.74  ? 974  PHE A C   1 
ATOM   6190 O  O   . PHE A 1 995  ? 113.122 130.835 76.818  1.00 28.13  ? 974  PHE A O   1 
ATOM   6191 C  CB  . PHE A 1 995  ? 111.507 131.036 74.175  1.00 80.42  ? 974  PHE A CB  1 
ATOM   6192 C  CG  . PHE A 1 995  ? 110.639 131.934 74.985  1.00 80.42  ? 974  PHE A CG  1 
ATOM   6193 C  CD1 . PHE A 1 995  ? 109.271 131.740 74.995  1.00 80.42  ? 974  PHE A CD1 1 
ATOM   6194 C  CD2 . PHE A 1 995  ? 111.161 133.009 75.663  1.00 80.42  ? 974  PHE A CD2 1 
ATOM   6195 C  CE1 . PHE A 1 995  ? 108.449 132.568 75.697  1.00 80.42  ? 974  PHE A CE1 1 
ATOM   6196 C  CE2 . PHE A 1 995  ? 110.342 133.843 76.376  1.00 80.42  ? 974  PHE A CE2 1 
ATOM   6197 C  CZ  . PHE A 1 995  ? 108.988 133.622 76.394  1.00 80.42  ? 974  PHE A CZ  1 
ATOM   6198 N  N   . PRO A 1 996  ? 114.486 129.904 75.295  1.00 27.42  ? 975  PRO A N   1 
ATOM   6199 C  CA  . PRO A 1 996  ? 115.644 129.881 76.183  1.00 28.18  ? 975  PRO A CA  1 
ATOM   6200 C  C   . PRO A 1 996  ? 116.194 131.270 76.436  1.00 29.29  ? 975  PRO A C   1 
ATOM   6201 O  O   . PRO A 1 996  ? 115.975 132.207 75.673  1.00 30.47  ? 975  PRO A O   1 
ATOM   6202 C  CB  . PRO A 1 996  ? 116.652 129.045 75.399  1.00 89.69  ? 975  PRO A CB  1 
ATOM   6203 C  CG  . PRO A 1 996  ? 116.339 129.379 73.998  1.00 89.69  ? 975  PRO A CG  1 
ATOM   6204 C  CD  . PRO A 1 996  ? 114.857 129.559 73.918  1.00 89.69  ? 975  PRO A CD  1 
ATOM   6205 N  N   . PHE A 1 997  ? 116.930 131.377 77.535  1.00 55.37  ? 976  PHE A N   1 
ATOM   6206 C  CA  . PHE A 1 997  ? 117.727 132.549 77.846  1.00 56.71  ? 976  PHE A CA  1 
ATOM   6207 C  C   . PHE A 1 997  ? 118.936 132.111 78.645  1.00 56.91  ? 976  PHE A C   1 
ATOM   6208 O  O   . PHE A 1 997  ? 118.867 131.165 79.429  1.00 57.28  ? 976  PHE A O   1 
ATOM   6209 C  CB  . PHE A 1 997  ? 116.963 133.589 78.657  1.00 79.68  ? 976  PHE A CB  1 
ATOM   6210 C  CG  . PHE A 1 997  ? 116.039 134.439 77.861  1.00 79.68  ? 976  PHE A CG  1 
ATOM   6211 C  CD1 . PHE A 1 997  ? 116.520 135.542 77.196  1.00 79.68  ? 976  PHE A CD1 1 
ATOM   6212 C  CD2 . PHE A 1 997  ? 114.689 134.166 77.805  1.00 79.68  ? 976  PHE A CD2 1 
ATOM   6213 C  CE1 . PHE A 1 997  ? 115.675 136.345 76.470  1.00 79.68  ? 976  PHE A CE1 1 
ATOM   6214 C  CE2 . PHE A 1 997  ? 113.842 134.963 77.081  1.00 79.68  ? 976  PHE A CE2 1 
ATOM   6215 C  CZ  . PHE A 1 997  ? 114.334 136.052 76.414  1.00 79.68  ? 976  PHE A CZ  1 
ATOM   6216 N  N   . TYR A 1 998  ? 120.040 132.809 78.453  1.00 57.33  ? 977  TYR A N   1 
ATOM   6217 C  CA  . TYR A 1 998  ? 121.189 132.669 79.325  1.00 57.56  ? 977  TYR A CA  1 
ATOM   6218 C  C   . TYR A 1 998  ? 121.264 133.913 80.186  1.00 58.73  ? 977  TYR A C   1 
ATOM   6219 O  O   . TYR A 1 998  ? 120.702 134.948 79.838  1.00 59.19  ? 977  TYR A O   1 
ATOM   6220 C  CB  . TYR A 1 998  ? 122.473 132.504 78.517  1.00 88.01  ? 977  TYR A CB  1 
ATOM   6221 C  CG  . TYR A 1 998  ? 122.585 131.198 77.783  1.00 88.01  ? 977  TYR A CG  1 
ATOM   6222 C  CD1 . TYR A 1 998  ? 121.852 130.095 78.171  1.00 88.01  ? 977  TYR A CD1 1 
ATOM   6223 C  CD2 . TYR A 1 998  ? 123.412 131.078 76.684  1.00 88.01  ? 977  TYR A CD2 1 
ATOM   6224 C  CE1 . TYR A 1 998  ? 121.952 128.906 77.494  1.00 88.01  ? 977  TYR A CE1 1 
ATOM   6225 C  CE2 . TYR A 1 998  ? 123.513 129.898 75.998  1.00 88.01  ? 977  TYR A CE2 1 
ATOM   6226 C  CZ  . TYR A 1 998  ? 122.783 128.812 76.411  1.00 88.01  ? 977  TYR A CZ  1 
ATOM   6227 O  OH  . TYR A 1 998  ? 122.877 127.616 75.738  1.00 88.01  ? 977  TYR A OH  1 
ATOM   6228 N  N   . LEU A 1 999  ? 121.947 133.817 81.320  1.00 35.01  ? 978  LEU A N   1 
ATOM   6229 C  CA  . LEU A 1 999  ? 122.133 135.018 82.121  1.00 36.40  ? 978  LEU A CA  1 
ATOM   6230 C  C   . LEU A 1 999  ? 123.461 135.016 82.858  1.00 37.06  ? 978  LEU A C   1 
ATOM   6231 O  O   . LEU A 1 999  ? 123.827 134.038 83.515  1.00 36.10  ? 978  LEU A O   1 
ATOM   6232 C  CB  . LEU A 1 999  ? 120.953 135.232 83.075  1.00 89.45  ? 978  LEU A CB  1 
ATOM   6233 C  CG  . LEU A 1 999  ? 120.256 134.187 83.922  1.00 89.45  ? 978  LEU A CG  1 
ATOM   6234 C  CD1 . LEU A 1 999  ? 121.008 133.875 85.160  1.00 89.45  ? 978  LEU A CD1 1 
ATOM   6235 C  CD2 . LEU A 1 999  ? 118.959 134.793 84.310  1.00 89.45  ? 978  LEU A CD2 1 
ATOM   6236 N  N   . ASN A 1 1000 ? 124.185 136.123 82.714  1.00 60.43  ? 979  ASN A N   1 
ATOM   6237 C  CA  . ASN A 1 1000 ? 125.439 136.358 83.419  1.00 60.43  ? 979  ASN A CA  1 
ATOM   6238 C  C   . ASN A 1 1000 ? 125.497 137.850 83.709  1.00 60.43  ? 979  ASN A C   1 
ATOM   6239 O  O   . ASN A 1 1000 ? 125.714 138.654 82.797  1.00 60.43  ? 979  ASN A O   1 
ATOM   6240 C  CB  . ASN A 1 1000 ? 126.640 135.920 82.596  1.00 60.43  ? 979  ASN A CB  1 
ATOM   6241 C  CG  . ASN A 1 1000 ? 127.961 136.033 83.345  1.00 60.43  ? 979  ASN A CG  1 
ATOM   6242 O  OD1 . ASN A 1 1000 ? 128.003 136.352 84.534  1.00 60.43  ? 979  ASN A OD1 1 
ATOM   6243 N  ND2 . ASN A 1 1000 ? 129.056 135.801 82.633  1.00 60.43  ? 979  ASN A ND2 1 
ATOM   6244 N  N   . GLY A 1 1001 ? 125.246 138.208 84.957  1.00 97.77  ? 980  GLY A N   1 
ATOM   6245 C  CA  . GLY A 1 1001 ? 125.781 139.428 85.515  1.00 100.18 ? 980  GLY A CA  1 
ATOM   6246 C  C   . GLY A 1 1001 ? 126.064 139.187 86.975  1.00 102.14 ? 980  GLY A C   1 
ATOM   6247 O  O   . GLY A 1 1001 ? 126.559 140.061 87.688  1.00 104.25 ? 980  GLY A O   1 
ATOM   6248 N  N   . LEU A 1 1002 ? 125.765 137.970 87.414  1.00 109.88 ? 981  LEU A N   1 
ATOM   6249 C  CA  . LEU A 1 1002 ? 125.557 137.652 88.819  1.00 112.32 ? 981  LEU A CA  1 
ATOM   6250 C  C   . LEU A 1 1002 ? 126.741 136.909 89.418  1.00 115.11 ? 981  LEU A C   1 
ATOM   6251 O  O   . LEU A 1 1002 ? 127.235 135.938 88.840  1.00 116.93 ? 981  LEU A O   1 
ATOM   6252 C  CB  . LEU A 1 1002 ? 124.258 136.861 88.985  1.00 117.08 ? 981  LEU A CB  1 
ATOM   6253 C  CG  . LEU A 1 1002 ? 123.791 135.898 87.898  1.00 117.08 ? 981  LEU A CG  1 
ATOM   6254 C  CD1 . LEU A 1 1002 ? 124.480 134.560 87.874  1.00 117.08 ? 981  LEU A CD1 1 
ATOM   6255 C  CD2 . LEU A 1 1002 ? 122.304 135.728 88.085  1.00 117.08 ? 981  LEU A CD2 1 
ATOM   6256 N  N   . ARG A 1 1003 ? 127.215 137.398 90.562  1.00 171.63 ? 982  ARG A N   1 
ATOM   6257 C  CA  . ARG A 1 1003 ? 128.318 136.769 91.275  1.00 174.62 ? 982  ARG A CA  1 
ATOM   6258 C  C   . ARG A 1 1003 ? 128.000 136.633 92.760  1.00 177.24 ? 982  ARG A C   1 
ATOM   6259 O  O   . ARG A 1 1003 ? 128.532 135.745 93.431  1.00 178.01 ? 982  ARG A O   1 
ATOM   6260 C  CB  . ARG A 1 1003 ? 129.610 137.565 91.071  1.00 118.76 ? 982  ARG A CB  1 
ATOM   6261 C  CG  . ARG A 1 1003 ? 130.155 137.505 89.651  1.00 118.76 ? 982  ARG A CG  1 
ATOM   6262 C  CD  . ARG A 1 1003 ? 131.420 138.322 89.482  1.00 118.76 ? 982  ARG A CD  1 
ATOM   6263 N  NE  . ARG A 1 1003 ? 131.878 138.333 88.094  1.00 118.76 ? 982  ARG A NE  1 
ATOM   6264 C  CZ  . ARG A 1 1003 ? 132.712 137.441 87.575  1.00 118.76 ? 982  ARG A CZ  1 
ATOM   6265 N  NH1 . ARG A 1 1003 ? 133.073 137.529 86.304  1.00 118.76 ? 982  ARG A NH1 1 
ATOM   6266 N  NH2 . ARG A 1 1003 ? 133.189 136.463 88.330  1.00 118.76 ? 982  ARG A NH2 1 
ATOM   6267 N  N   . ASP A 1 1004 ? 127.144 137.497 93.283  1.00 142.75 ? 983  ASP A N   1 
ATOM   6268 C  CA  . ASP A 1 1004 ? 126.772 137.445 94.684  1.00 147.19 ? 983  ASP A CA  1 
ATOM   6269 C  C   . ASP A 1 1004 ? 125.410 136.785 94.823  1.00 146.64 ? 983  ASP A C   1 
ATOM   6270 O  O   . ASP A 1 1004 ? 124.842 136.272 93.857  1.00 147.21 ? 983  ASP A O   1 
ATOM   6271 C  CB  . ASP A 1 1004 ? 126.751 138.842 95.300  1.00 134.03 ? 983  ASP A CB  1 
ATOM   6272 C  CG  . ASP A 1 1004 ? 128.120 139.473 95.365  1.00 134.03 ? 983  ASP A CG  1 
ATOM   6273 O  OD1 . ASP A 1 1004 ? 129.119 138.726 95.383  1.00 134.03 ? 983  ASP A OD1 1 
ATOM   6274 O  OD2 . ASP A 1 1004 ? 128.197 140.717 95.420  1.00 134.03 ? 983  ASP A OD2 1 
ATOM   6275 N  N   . THR A 1 1005 ? 124.871 136.802 96.041  1.00 121.46 ? 984  THR A N   1 
ATOM   6276 C  CA  . THR A 1 1005 ? 123.499 136.380 96.278  1.00 122.50 ? 984  THR A CA  1 
ATOM   6277 C  C   . THR A 1 1005 ? 122.513 137.536 96.247  1.00 123.52 ? 984  THR A C   1 
ATOM   6278 O  O   . THR A 1 1005 ? 121.307 137.302 96.076  1.00 121.50 ? 984  THR A O   1 
ATOM   6279 C  CB  . THR A 1 1005 ? 123.393 135.649 97.614  1.00 118.02 ? 984  THR A CB  1 
ATOM   6280 O  OG1 . THR A 1 1005 ? 122.037 135.248 97.824  1.00 118.02 ? 984  THR A OG1 1 
ATOM   6281 C  CG2 . THR A 1 1005 ? 123.841 136.535 98.742  1.00 118.02 ? 984  THR A CG2 1 
ATOM   6282 N  N   . SER A 1 1006 ? 123.002 138.772 96.399  1.00 66.41  ? 985  SER A N   1 
ATOM   6283 C  CA  . SER A 1 1006 ? 122.176 139.947 96.147  1.00 66.41  ? 985  SER A CA  1 
ATOM   6284 C  C   . SER A 1 1006 ? 121.710 139.988 94.701  1.00 66.41  ? 985  SER A C   1 
ATOM   6285 O  O   . SER A 1 1006 ? 120.545 140.305 94.418  1.00 66.41  ? 985  SER A O   1 
ATOM   6286 C  CB  . SER A 1 1006 ? 122.966 141.207 96.482  1.00 66.41  ? 985  SER A CB  1 
ATOM   6287 O  OG  . SER A 1 1006 ? 122.250 142.363 96.100  1.00 66.41  ? 985  SER A OG  1 
ATOM   6288 N  N   . ASP A 1 1007 ? 122.613 139.646 93.777  1.00 90.78  ? 986  ASP A N   1 
ATOM   6289 C  CA  . ASP A 1 1007 ? 122.289 139.624 92.357  1.00 92.73  ? 986  ASP A CA  1 
ATOM   6290 C  C   . ASP A 1 1007 ? 121.237 138.570 92.056  1.00 88.86  ? 986  ASP A C   1 
ATOM   6291 O  O   . ASP A 1 1007 ? 120.314 138.807 91.268  1.00 88.83  ? 986  ASP A O   1 
ATOM   6292 C  CB  . ASP A 1 1007 ? 123.550 139.337 91.551  1.00 108.22 ? 986  ASP A CB  1 
ATOM   6293 C  CG  . ASP A 1 1007 ? 124.665 140.316 91.840  1.00 108.22 ? 986  ASP A CG  1 
ATOM   6294 O  OD1 . ASP A 1 1007 ? 124.376 141.466 92.233  1.00 108.22 ? 986  ASP A OD1 1 
ATOM   6295 O  OD2 . ASP A 1 1007 ? 125.838 139.929 91.676  1.00 108.22 ? 986  ASP A OD2 1 
ATOM   6296 N  N   . PHE A 1 1008 ? 121.383 137.396 92.674  1.00 67.06  ? 987  PHE A N   1 
ATOM   6297 C  CA  . PHE A 1 1008 ? 120.406 136.320 92.574  1.00 61.19  ? 987  PHE A CA  1 
ATOM   6298 C  C   . PHE A 1 1008 ? 119.032 136.763 93.033  1.00 55.93  ? 987  PHE A C   1 
ATOM   6299 O  O   . PHE A 1 1008 ? 118.037 136.546 92.331  1.00 53.75  ? 987  PHE A O   1 
ATOM   6300 C  CB  . PHE A 1 1008 ? 120.873 135.145 93.420  1.00 95.89  ? 987  PHE A CB  1 
ATOM   6301 C  CG  . PHE A 1 1008 ? 121.962 134.353 92.799  1.00 95.89  ? 987  PHE A CG  1 
ATOM   6302 C  CD1 . PHE A 1 1008 ? 122.063 134.249 91.441  1.00 95.89  ? 987  PHE A CD1 1 
ATOM   6303 C  CD2 . PHE A 1 1008 ? 122.916 133.757 93.579  1.00 95.89  ? 987  PHE A CD2 1 
ATOM   6304 C  CE1 . PHE A 1 1008 ? 123.059 133.518 90.884  1.00 95.89  ? 987  PHE A CE1 1 
ATOM   6305 C  CE2 . PHE A 1 1008 ? 123.929 133.042 93.012  1.00 95.89  ? 987  PHE A CE2 1 
ATOM   6306 C  CZ  . PHE A 1 1008 ? 123.997 132.929 91.658  1.00 95.89  ? 987  PHE A CZ  1 
ATOM   6307 N  N   . VAL A 1 1009 ? 118.962 137.399 94.207  1.00 54.14  ? 988  VAL A N   1 
ATOM   6308 C  CA  . VAL A 1 1009 ? 117.670 137.785 94.763  1.00 52.38  ? 988  VAL A CA  1 
ATOM   6309 C  C   . VAL A 1 1009 ? 117.004 138.852 93.904  1.00 52.43  ? 988  VAL A C   1 
ATOM   6310 O  O   . VAL A 1 1009 ? 115.806 138.761 93.605  1.00 51.22  ? 988  VAL A O   1 
ATOM   6311 C  CB  . VAL A 1 1009 ? 117.835 138.236 96.224  1.00 100.78 ? 988  VAL A CB  1 
ATOM   6312 C  CG1 . VAL A 1 1009 ? 116.551 138.847 96.749  1.00 100.78 ? 988  VAL A CG1 1 
ATOM   6313 C  CG2 . VAL A 1 1009 ? 118.194 137.047 97.079  1.00 100.78 ? 988  VAL A CG2 1 
ATOM   6314 N  N   . GLU A 1 1010 ? 117.778 139.827 93.422  1.00 57.18  ? 989  GLU A N   1 
ATOM   6315 C  CA  . GLU A 1 1010 ? 117.200 140.874 92.581  1.00 57.65  ? 989  GLU A CA  1 
ATOM   6316 C  C   . GLU A 1 1010 ? 116.729 140.329 91.232  1.00 57.03  ? 989  GLU A C   1 
ATOM   6317 O  O   . GLU A 1 1010 ? 115.654 140.711 90.743  1.00 56.45  ? 989  GLU A O   1 
ATOM   6318 C  CB  . GLU A 1 1010 ? 118.217 141.995 92.387  1.00 108.76 ? 989  GLU A CB  1 
ATOM   6319 C  CG  . GLU A 1 1010 ? 117.698 143.173 91.600  1.00 108.76 ? 989  GLU A CG  1 
ATOM   6320 C  CD  . GLU A 1 1010 ? 118.713 144.283 91.500  1.00 108.76 ? 989  GLU A CD  1 
ATOM   6321 O  OE1 . GLU A 1 1010 ? 119.826 144.122 92.042  1.00 108.76 ? 989  GLU A OE1 1 
ATOM   6322 O  OE2 . GLU A 1 1010 ? 118.401 145.320 90.881  1.00 108.76 ? 989  GLU A OE2 1 
ATOM   6323 N  N   . ALA A 1 1011 ? 117.503 139.410 90.642  1.00 74.16  ? 990  ALA A N   1 
ATOM   6324 C  CA  . ALA A 1 1011 ? 117.128 138.822 89.359  1.00 74.47  ? 990  ALA A CA  1 
ATOM   6325 C  C   . ALA A 1 1011 ? 115.851 138.008 89.477  1.00 71.23  ? 990  ALA A C   1 
ATOM   6326 O  O   . ALA A 1 1011 ? 114.942 138.143 88.647  1.00 70.34  ? 990  ALA A O   1 
ATOM   6327 C  CB  . ALA A 1 1011 ? 118.257 137.947 88.832  1.00 100.68 ? 990  ALA A CB  1 
ATOM   6328 N  N   . ILE A 1 1012 ? 115.751 137.183 90.523  1.00 48.07  ? 991  ILE A N   1 
ATOM   6329 C  CA  . ILE A 1 1012 ? 114.551 136.377 90.722  1.00 46.02  ? 991  ILE A CA  1 
ATOM   6330 C  C   . ILE A 1 1012 ? 113.345 137.264 91.000  1.00 45.31  ? 991  ILE A C   1 
ATOM   6331 O  O   . ILE A 1 1012 ? 112.245 136.994 90.503  1.00 44.50  ? 991  ILE A O   1 
ATOM   6332 C  CB  . ILE A 1 1012 ? 114.784 135.348 91.841  1.00 84.44  ? 991  ILE A CB  1 
ATOM   6333 C  CG1 . ILE A 1 1012 ? 115.857 134.358 91.420  1.00 84.44  ? 991  ILE A CG1 1 
ATOM   6334 C  CG2 . ILE A 1 1012 ? 113.542 134.554 92.138  1.00 84.44  ? 991  ILE A CG2 1 
ATOM   6335 C  CD1 . ILE A 1 1012 ? 116.373 133.535 92.550  1.00 84.44  ? 991  ILE A CD1 1 
ATOM   6336 N  N   . GLU A 1 1013 ? 113.544 138.377 91.722  1.00 45.94  ? 992  GLU A N   1 
ATOM   6337 C  CA  . GLU A 1 1013 ? 112.444 139.309 91.972  1.00 46.08  ? 992  GLU A CA  1 
ATOM   6338 C  C   . GLU A 1 1013 ? 111.918 139.919 90.684  1.00 46.50  ? 992  GLU A C   1 
ATOM   6339 O  O   . GLU A 1 1013 ? 110.703 139.968 90.466  1.00 45.38  ? 992  GLU A O   1 
ATOM   6340 C  CB  . GLU A 1 1013 ? 112.870 140.425 92.926  1.00 95.00  ? 992  GLU A CB  1 
ATOM   6341 C  CG  . GLU A 1 1013 ? 112.984 140.044 94.393  1.00 95.00  ? 992  GLU A CG  1 
ATOM   6342 C  CD  . GLU A 1 1013 ? 113.412 141.217 95.263  1.00 95.00  ? 992  GLU A CD  1 
ATOM   6343 O  OE1 . GLU A 1 1013 ? 113.646 142.316 94.716  1.00 95.00  ? 992  GLU A OE1 1 
ATOM   6344 O  OE2 . GLU A 1 1013 ? 113.530 141.035 96.492  1.00 95.00  ? 992  GLU A OE2 1 
ATOM   6345 N  N   . LYS A 1 1014 ? 112.818 140.356 89.801  1.00 47.72  ? 993  LYS A N   1 
ATOM   6346 C  CA  . LYS A 1 1014 ? 112.363 141.004 88.575  1.00 48.23  ? 993  LYS A CA  1 
ATOM   6347 C  C   . LYS A 1 1014 ? 111.677 140.020 87.632  1.00 47.45  ? 993  LYS A C   1 
ATOM   6348 O  O   . LYS A 1 1014 ? 110.600 140.319 87.090  1.00 47.93  ? 993  LYS A O   1 
ATOM   6349 C  CB  . LYS A 1 1014 ? 113.535 141.689 87.886  1.00 107.71 ? 993  LYS A CB  1 
ATOM   6350 C  CG  . LYS A 1 1014 ? 114.083 142.847 88.679  1.00 107.71 ? 993  LYS A CG  1 
ATOM   6351 C  CD  . LYS A 1 1014 ? 115.268 143.476 87.994  1.00 107.71 ? 993  LYS A CD  1 
ATOM   6352 C  CE  . LYS A 1 1014 ? 114.830 144.293 86.800  1.00 107.71 ? 993  LYS A CE  1 
ATOM   6353 N  NZ  . LYS A 1 1014 ? 114.094 145.516 87.215  1.00 107.71 ? 993  LYS A NZ  1 
ATOM   6354 N  N   . VAL A 1 1015 ? 112.258 138.828 87.463  1.00 46.34  ? 994  VAL A N   1 
ATOM   6355 C  CA  . VAL A 1 1015 ? 111.688 137.853 86.540  1.00 45.03  ? 994  VAL A CA  1 
ATOM   6356 C  C   . VAL A 1 1015 ? 110.338 137.349 87.048  1.00 44.12  ? 994  VAL A C   1 
ATOM   6357 O  O   . VAL A 1 1015 ? 109.398 137.153 86.263  1.00 43.65  ? 994  VAL A O   1 
ATOM   6358 C  CB  . VAL A 1 1015 ? 112.695 136.715 86.304  1.00 94.39  ? 994  VAL A CB  1 
ATOM   6359 C  CG1 . VAL A 1 1015 ? 112.133 135.683 85.391  1.00 94.39  ? 994  VAL A CG1 1 
ATOM   6360 C  CG2 . VAL A 1 1015 ? 113.957 137.267 85.695  1.00 94.39  ? 994  VAL A CG2 1 
ATOM   6361 N  N   . ARG A 1 1016 ? 110.187 137.209 88.368  1.00 44.42  ? 995  ARG A N   1 
ATOM   6362 C  CA  . ARG A 1 1016 ? 108.871 136.869 88.902  1.00 45.19  ? 995  ARG A CA  1 
ATOM   6363 C  C   . ARG A 1 1016 ? 107.887 138.030 88.793  1.00 45.39  ? 995  ARG A C   1 
ATOM   6364 O  O   . ARG A 1 1016 ? 106.675 137.793 88.744  1.00 45.10  ? 995  ARG A O   1 
ATOM   6365 C  CB  . ARG A 1 1016 ? 108.971 136.412 90.353  1.00 83.76  ? 995  ARG A CB  1 
ATOM   6366 C  CG  . ARG A 1 1016 ? 109.676 135.096 90.574  1.00 83.76  ? 995  ARG A CG  1 
ATOM   6367 C  CD  . ARG A 1 1016 ? 108.854 133.900 90.229  1.00 83.76  ? 995  ARG A CD  1 
ATOM   6368 N  NE  . ARG A 1 1016 ? 109.608 132.697 90.550  1.00 83.76  ? 995  ARG A NE  1 
ATOM   6369 C  CZ  . ARG A 1 1016 ? 109.177 131.461 90.345  1.00 83.76  ? 995  ARG A CZ  1 
ATOM   6370 N  NH1 . ARG A 1 1016 ? 107.980 131.243 89.823  1.00 83.76  ? 995  ARG A NH1 1 
ATOM   6371 N  NH2 . ARG A 1 1016 ? 109.948 130.437 90.664  1.00 83.76  ? 995  ARG A NH2 1 
ATOM   6372 N  N   . THR A 1 1017 ? 108.363 139.284 88.758  1.00 46.72  ? 996  THR A N   1 
ATOM   6373 C  CA  . THR A 1 1017 ? 107.417 140.370 88.494  1.00 47.65  ? 996  THR A CA  1 
ATOM   6374 C  C   . THR A 1 1017 ? 106.936 140.362 87.053  1.00 46.62  ? 996  THR A C   1 
ATOM   6375 O  O   . THR A 1 1017 ? 105.811 140.790 86.778  1.00 46.37  ? 996  THR A O   1 
ATOM   6376 C  CB  . THR A 1 1017 ? 107.995 141.751 88.808  1.00 98.57  ? 996  THR A CB  1 
ATOM   6377 O  OG1 . THR A 1 1017 ? 109.234 141.937 88.121  1.00 98.57  ? 996  THR A OG1 1 
ATOM   6378 C  CG2 . THR A 1 1017 ? 108.156 141.966 90.302  1.00 98.57  ? 996  THR A CG2 1 
ATOM   6379 N  N   . ILE A 1 1018 ? 107.756 139.885 86.121  1.00 56.12  ? 997  ILE A N   1 
ATOM   6380 C  CA  . ILE A 1 1018 ? 107.307 139.847 84.734  1.00 56.65  ? 997  ILE A CA  1 
ATOM   6381 C  C   . ILE A 1 1018 ? 106.374 138.667 84.491  1.00 54.40  ? 997  ILE A C   1 
ATOM   6382 O  O   . ILE A 1 1018 ? 105.313 138.813 83.869  1.00 54.31  ? 997  ILE A O   1 
ATOM   6383 C  CB  . ILE A 1 1018 ? 108.514 139.823 83.792  1.00 85.54  ? 997  ILE A CB  1 
ATOM   6384 C  CG1 . ILE A 1 1018 ? 109.309 141.101 83.979  1.00 85.54  ? 997  ILE A CG1 1 
ATOM   6385 C  CG2 . ILE A 1 1018 ? 108.059 139.744 82.376  1.00 85.54  ? 997  ILE A CG2 1 
ATOM   6386 C  CD1 . ILE A 1 1018 ? 110.602 141.083 83.294  1.00 85.54  ? 997  ILE A CD1 1 
ATOM   6387 N  N   . CYS A 1 1019 ? 106.741 137.484 84.986  1.00 42.79  ? 998  CYS A N   1 
ATOM   6388 C  CA  . CYS A 1 1019 ? 105.868 136.325 84.816  1.00 40.30  ? 998  CYS A CA  1 
ATOM   6389 C  C   . CYS A 1 1019 ? 104.565 136.490 85.596  1.00 39.37  ? 998  CYS A C   1 
ATOM   6390 O  O   . CYS A 1 1019 ? 103.491 136.101 85.119  1.00 38.44  ? 998  CYS A O   1 
ATOM   6391 C  CB  . CYS A 1 1019 ? 106.601 135.055 85.238  1.00 98.45  ? 998  CYS A CB  1 
ATOM   6392 S  SG  . CYS A 1 1019 ? 107.994 134.620 84.192  1.00 98.45  ? 998  CYS A SG  1 
ATOM   6393 N  N   . SER A 1 1020 ? 104.637 137.102 86.778  1.00 44.34  ? 999  SER A N   1 
ATOM   6394 C  CA  . SER A 1 1020 ? 103.430 137.398 87.535  1.00 45.29  ? 999  SER A CA  1 
ATOM   6395 C  C   . SER A 1 1020 ? 102.660 138.569 86.950  1.00 47.02  ? 999  SER A C   1 
ATOM   6396 O  O   . SER A 1 1020 ? 101.467 138.715 87.230  1.00 46.03  ? 999  SER A O   1 
ATOM   6397 C  CB  . SER A 1 1020 ? 103.787 137.699 88.981  1.00 107.57 ? 999  SER A CB  1 
ATOM   6398 O  OG  . SER A 1 1020 ? 104.539 138.892 89.048  1.00 107.57 ? 999  SER A OG  1 
ATOM   6399 N  N   . ASN A 1 1021 ? 103.326 139.420 86.174  1.00 43.94  ? 1000 ASN A N   1 
ATOM   6400 C  CA  . ASN A 1 1021 ? 102.628 140.459 85.429  1.00 46.20  ? 1000 ASN A CA  1 
ATOM   6401 C  C   . ASN A 1 1021 ? 101.774 139.856 84.324  1.00 45.19  ? 1000 ASN A C   1 
ATOM   6402 O  O   . ASN A 1 1021 ? 100.628 140.272 84.124  1.00 46.00  ? 1000 ASN A O   1 
ATOM   6403 C  CB  . ASN A 1 1021 ? 103.652 141.434 84.852  1.00 98.37  ? 1000 ASN A CB  1 
ATOM   6404 C  CG  . ASN A 1 1021 ? 103.033 142.653 84.218  1.00 98.37  ? 1000 ASN A CG  1 
ATOM   6405 O  OD1 . ASN A 1 1021 ? 101.828 142.886 84.297  1.00 98.37  ? 1000 ASN A OD1 1 
ATOM   6406 N  ND2 . ASN A 1 1021 ? 103.875 143.441 83.559  1.00 98.37  ? 1000 ASN A ND2 1 
ATOM   6407 N  N   . TYR A 1 1022 ? 102.307 138.876 83.592  1.00 52.53  ? 1001 TYR A N   1 
ATOM   6408 C  CA  . TYR A 1 1022 ? 101.533 138.325 82.489  1.00 52.45  ? 1001 TYR A CA  1 
ATOM   6409 C  C   . TYR A 1 1022 ? 100.646 137.159 82.877  1.00 52.16  ? 1001 TYR A C   1 
ATOM   6410 O  O   . TYR A 1 1022 ? 99.787  136.775 82.081  1.00 43.84  ? 1001 TYR A O   1 
ATOM   6411 C  CB  . TYR A 1 1022 ? 102.446 137.907 81.350  1.00 91.38  ? 1001 TYR A CB  1 
ATOM   6412 C  CG  . TYR A 1 1022 ? 103.031 139.097 80.669  1.00 91.38  ? 1001 TYR A CG  1 
ATOM   6413 C  CD1 . TYR A 1 1022 ? 102.293 139.832 79.760  1.00 91.38  ? 1001 TYR A CD1 1 
ATOM   6414 C  CD2 . TYR A 1 1022 ? 104.313 139.503 80.952  1.00 91.38  ? 1001 TYR A CD2 1 
ATOM   6415 C  CE1 . TYR A 1 1022 ? 102.829 140.929 79.149  1.00 91.38  ? 1001 TYR A CE1 1 
ATOM   6416 C  CE2 . TYR A 1 1022 ? 104.854 140.594 80.349  1.00 91.38  ? 1001 TYR A CE2 1 
ATOM   6417 C  CZ  . TYR A 1 1022 ? 104.111 141.301 79.452  1.00 91.38  ? 1001 TYR A CZ  1 
ATOM   6418 O  OH  . TYR A 1 1022 ? 104.672 142.391 78.860  1.00 91.38  ? 1001 TYR A OH  1 
ATOM   6419 N  N   . THR A 1 1023 ? 100.793 136.607 84.078  1.00 42.25  ? 1002 THR A N   1 
ATOM   6420 C  CA  . THR A 1 1023 ? 99.833  135.600 84.508  1.00 41.19  ? 1002 THR A CA  1 
ATOM   6421 C  C   . THR A 1 1023 ? 98.501  136.243 84.896  1.00 41.90  ? 1002 THR A C   1 
ATOM   6422 O  O   . THR A 1 1023 ? 97.473  135.559 84.942  1.00 42.29  ? 1002 THR A O   1 
ATOM   6423 C  CB  . THR A 1 1023 ? 100.445 134.786 85.653  1.00 98.80  ? 1002 THR A CB  1 
ATOM   6424 O  OG1 . THR A 1 1023 ? 101.785 134.432 85.301  1.00 98.80  ? 1002 THR A OG1 1 
ATOM   6425 C  CG2 . THR A 1 1023 ? 99.690  133.474 85.882  1.00 98.80  ? 1002 THR A CG2 1 
ATOM   6426 N  N   . SER A 1 1024 ? 98.486  137.556 85.127  1.00 53.32  ? 1003 SER A N   1 
ATOM   6427 C  CA  . SER A 1 1024 ? 97.255  138.316 85.288  1.00 54.73  ? 1003 SER A CA  1 
ATOM   6428 C  C   . SER A 1 1024 ? 96.805  138.978 83.992  1.00 55.68  ? 1003 SER A C   1 
ATOM   6429 O  O   . SER A 1 1024 ? 96.062  139.964 84.036  1.00 56.29  ? 1003 SER A O   1 
ATOM   6430 C  CB  . SER A 1 1024 ? 97.430  139.381 86.363  1.00 100.10 ? 1003 SER A CB  1 
ATOM   6431 O  OG  . SER A 1 1024 ? 98.303  140.389 85.895  1.00 100.10 ? 1003 SER A OG  1 
ATOM   6432 N  N   . LEU A 1 1025 ? 97.266  138.483 82.846  1.00 73.42  ? 1004 LEU A N   1 
ATOM   6433 C  CA  . LEU A 1 1025 ? 96.782  138.915 81.546  1.00 75.04  ? 1004 LEU A CA  1 
ATOM   6434 C  C   . LEU A 1 1025 ? 96.254  137.776 80.697  1.00 74.29  ? 1004 LEU A C   1 
ATOM   6435 O  O   . LEU A 1 1025 ? 95.673  138.037 79.642  1.00 75.99  ? 1004 LEU A O   1 
ATOM   6436 C  CB  . LEU A 1 1025 ? 97.884  139.635 80.756  1.00 90.90  ? 1004 LEU A CB  1 
ATOM   6437 C  CG  . LEU A 1 1025 ? 98.036  141.155 80.792  1.00 90.90  ? 1004 LEU A CG  1 
ATOM   6438 C  CD1 . LEU A 1 1025 ? 96.846  141.828 80.138  1.00 90.90  ? 1004 LEU A CD1 1 
ATOM   6439 C  CD2 . LEU A 1 1025 ? 98.235  141.664 82.197  1.00 90.90  ? 1004 LEU A CD2 1 
ATOM   6440 N  N   . GLY A 1 1026 ? 96.449  136.525 81.112  1.00 84.14  ? 1005 GLY A N   1 
ATOM   6441 C  CA  . GLY A 1 1026 ? 96.036  135.360 80.353  1.00 83.49  ? 1005 GLY A CA  1 
ATOM   6442 C  C   . GLY A 1 1026 ? 97.189  134.458 79.962  1.00 84.14  ? 1005 GLY A C   1 
ATOM   6443 O  O   . GLY A 1 1026 ? 96.997  133.250 79.797  1.00 83.53  ? 1005 GLY A O   1 
ATOM   6444 N  N   . LEU A 1 1027 ? 98.384  135.020 79.833  1.00 55.98  ? 1006 LEU A N   1 
ATOM   6445 C  CA  . LEU A 1 1027 ? 99.558  134.275 79.391  1.00 55.85  ? 1006 LEU A CA  1 
ATOM   6446 C  C   . LEU A 1 1027 ? 100.297 133.769 80.618  1.00 56.75  ? 1006 LEU A C   1 
ATOM   6447 O  O   . LEU A 1 1027 ? 101.147 134.454 81.181  1.00 56.03  ? 1006 LEU A O   1 
ATOM   6448 C  CB  . LEU A 1 1027 ? 100.451 135.165 78.547  1.00 109.45 ? 1006 LEU A CB  1 
ATOM   6449 C  CG  . LEU A 1 1027 ? 101.683 134.512 77.943  1.00 109.45 ? 1006 LEU A CG  1 
ATOM   6450 C  CD1 . LEU A 1 1027 ? 101.283 133.527 76.870  1.00 109.45 ? 1006 LEU A CD1 1 
ATOM   6451 C  CD2 . LEU A 1 1027 ? 102.585 135.583 77.414  1.00 109.45 ? 1006 LEU A CD2 1 
ATOM   6452 N  N   . SER A 1 1028 ? 99.924  132.579 81.072  1.00 68.12  ? 1007 SER A N   1 
ATOM   6453 C  CA  . SER A 1 1028 ? 100.573 132.030 82.243  1.00 69.80  ? 1007 SER A CA  1 
ATOM   6454 C  C   . SER A 1 1028 ? 102.016 131.794 81.867  1.00 69.65  ? 1007 SER A C   1 
ATOM   6455 O  O   . SER A 1 1028 ? 102.301 131.203 80.838  1.00 70.75  ? 1007 SER A O   1 
ATOM   6456 C  CB  . SER A 1 1028 ? 99.908  130.722 82.662  1.00 104.56 ? 1007 SER A CB  1 
ATOM   6457 O  OG  . SER A 1 1028 ? 100.562 129.606 82.085  1.00 104.56 ? 1007 SER A OG  1 
ATOM   6458 N  N   . SER A 1 1029 ? 102.930 132.256 82.703  1.00 64.52  ? 1008 SER A N   1 
ATOM   6459 C  CA  . SER A 1 1029 ? 104.340 132.071 82.436  1.00 63.18  ? 1008 SER A CA  1 
ATOM   6460 C  C   . SER A 1 1029 ? 105.049 131.867 83.747  1.00 60.60  ? 1008 SER A C   1 
ATOM   6461 O  O   . SER A 1 1029 ? 104.610 132.371 84.772  1.00 58.99  ? 1008 SER A O   1 
ATOM   6462 C  CB  . SER A 1 1029 ? 104.913 133.297 81.734  1.00 90.37  ? 1008 SER A CB  1 
ATOM   6463 O  OG  . SER A 1 1029 ? 104.385 133.430 80.429  1.00 90.37  ? 1008 SER A OG  1 
ATOM   6464 N  N   . TYR A 1 1030 ? 106.146 131.129 83.721  1.00 48.22  ? 1009 TYR A N   1 
ATOM   6465 C  CA  . TYR A 1 1030 ? 106.925 130.907 84.932  1.00 46.47  ? 1009 TYR A CA  1 
ATOM   6466 C  C   . TYR A 1 1030 ? 108.319 130.453 84.531  1.00 46.56  ? 1009 TYR A C   1 
ATOM   6467 O  O   . TYR A 1 1030 ? 108.466 129.751 83.535  1.00 49.69  ? 1009 TYR A O   1 
ATOM   6468 C  CB  . TYR A 1 1030 ? 106.252 129.863 85.832  1.00 78.07  ? 1009 TYR A CB  1 
ATOM   6469 C  CG  . TYR A 1 1030 ? 106.233 128.466 85.285  1.00 78.07  ? 1009 TYR A CG  1 
ATOM   6470 C  CD1 . TYR A 1 1030 ? 105.231 128.050 84.437  1.00 78.07  ? 1009 TYR A CD1 1 
ATOM   6471 C  CD2 . TYR A 1 1030 ? 107.198 127.549 85.668  1.00 78.07  ? 1009 TYR A CD2 1 
ATOM   6472 C  CE1 . TYR A 1 1030 ? 105.222 126.773 83.963  1.00 78.07  ? 1009 TYR A CE1 1 
ATOM   6473 C  CE2 . TYR A 1 1030 ? 107.205 126.292 85.197  1.00 78.07  ? 1009 TYR A CE2 1 
ATOM   6474 C  CZ  . TYR A 1 1030 ? 106.219 125.906 84.353  1.00 78.07  ? 1009 TYR A CZ  1 
ATOM   6475 O  OH  . TYR A 1 1030 ? 106.254 124.623 83.906  1.00 78.07  ? 1009 TYR A OH  1 
ATOM   6476 N  N   . PRO A 1 1031 ? 109.367 130.855 85.273  1.00 42.54  ? 1010 PRO A N   1 
ATOM   6477 C  CA  . PRO A 1 1031 ? 110.788 130.506 85.054  1.00 43.01  ? 1010 PRO A CA  1 
ATOM   6478 C  C   . PRO A 1 1031 ? 111.092 129.050 85.432  1.00 41.39  ? 1010 PRO A C   1 
ATOM   6479 O  O   . PRO A 1 1031 ? 110.307 128.468 86.151  1.00 40.75  ? 1010 PRO A O   1 
ATOM   6480 C  CB  . PRO A 1 1031 ? 111.529 131.445 86.004  1.00 78.59  ? 1010 PRO A CB  1 
ATOM   6481 C  CG  . PRO A 1 1031 ? 110.558 132.526 86.323  1.00 78.59  ? 1010 PRO A CG  1 
ATOM   6482 C  CD  . PRO A 1 1031 ? 109.220 131.861 86.328  1.00 78.59  ? 1010 PRO A CD  1 
ATOM   6483 N  N   . ASN A 1 1032 ? 112.150 128.467 84.874  1.00 37.72  ? 1011 ASN A N   1 
ATOM   6484 C  CA  . ASN A 1 1032 ? 112.682 127.112 85.182  1.00 36.47  ? 1011 ASN A CA  1 
ATOM   6485 C  C   . ASN A 1 1032 ? 114.236 127.360 85.243  1.00 37.10  ? 1011 ASN A C   1 
ATOM   6486 O  O   . ASN A 1 1032 ? 114.731 128.229 84.549  1.00 39.54  ? 1011 ASN A O   1 
ATOM   6487 C  CB  . ASN A 1 1032 ? 112.316 126.111 84.101  1.00 86.94  ? 1011 ASN A CB  1 
ATOM   6488 C  CG  . ASN A 1 1032 ? 111.410 125.013 84.616  1.00 86.94  ? 1011 ASN A CG  1 
ATOM   6489 O  OD1 . ASN A 1 1032 ? 110.216 125.224 84.825  1.00 86.94  ? 1011 ASN A OD1 1 
ATOM   6490 N  ND2 . ASN A 1 1032 ? 111.977 123.834 84.833  1.00 86.94  ? 1011 ASN A ND2 1 
ATOM   6491 N  N   . GLY A 1 1033 ? 115.027 126.674 86.069  1.00 49.31  ? 1012 GLY A N   1 
ATOM   6492 C  CA  . GLY A 1 1033 ? 116.478 126.940 86.060  1.00 49.31  ? 1012 GLY A CA  1 
ATOM   6493 C  C   . GLY A 1 1033 ? 117.256 126.675 87.349  1.00 49.31  ? 1012 GLY A C   1 
ATOM   6494 O  O   . GLY A 1 1033 ? 116.647 126.365 88.356  1.00 49.31  ? 1012 GLY A O   1 
ATOM   6495 N  N   . TYR A 1 1034 ? 118.591 126.764 87.351  1.00 62.53  ? 1013 TYR A N   1 
ATOM   6496 C  CA  . TYR A 1 1034 ? 119.295 126.605 88.626  1.00 62.53  ? 1013 TYR A CA  1 
ATOM   6497 C  C   . TYR A 1 1034 ? 119.065 127.718 89.650  1.00 62.53  ? 1013 TYR A C   1 
ATOM   6498 O  O   . TYR A 1 1034 ? 118.788 127.377 90.816  1.00 62.53  ? 1013 TYR A O   1 
ATOM   6499 C  CB  . TYR A 1 1034 ? 120.788 126.384 88.374  1.00 62.53  ? 1013 TYR A CB  1 
ATOM   6500 C  CG  . TYR A 1 1034 ? 121.147 124.965 88.023  1.00 62.53  ? 1013 TYR A CG  1 
ATOM   6501 C  CD1 . TYR A 1 1034 ? 120.279 123.918 88.300  1.00 62.53  ? 1013 TYR A CD1 1 
ATOM   6502 C  CD2 . TYR A 1 1034 ? 122.360 124.668 87.421  1.00 62.53  ? 1013 TYR A CD2 1 
ATOM   6503 C  CE1 . TYR A 1 1034 ? 120.610 122.614 87.986  1.00 62.53  ? 1013 TYR A CE1 1 
ATOM   6504 C  CE2 . TYR A 1 1034 ? 122.698 123.370 87.101  1.00 62.53  ? 1013 TYR A CE2 1 
ATOM   6505 C  CZ  . TYR A 1 1034 ? 121.820 122.350 87.384  1.00 62.53  ? 1013 TYR A CZ  1 
ATOM   6506 O  OH  . TYR A 1 1034 ? 122.163 121.059 87.063  1.00 62.53  ? 1013 TYR A OH  1 
ATOM   6507 N  N   . PRO A 1 1035 ? 119.209 129.027 89.339  1.00 59.27  ? 1014 PRO A N   1 
ATOM   6508 C  CA  . PRO A 1 1035 ? 119.163 130.016 90.434  1.00 59.27  ? 1014 PRO A CA  1 
ATOM   6509 C  C   . PRO A 1 1035 ? 117.809 130.156 91.094  1.00 59.27  ? 1014 PRO A C   1 
ATOM   6510 O  O   . PRO A 1 1035 ? 117.750 130.479 92.287  1.00 59.27  ? 1014 PRO A O   1 
ATOM   6511 C  CB  . PRO A 1 1035 ? 119.571 131.323 89.748  1.00 59.27  ? 1014 PRO A CB  1 
ATOM   6512 C  CG  . PRO A 1 1035 ? 119.198 131.151 88.370  1.00 59.27  ? 1014 PRO A CG  1 
ATOM   6513 C  CD  . PRO A 1 1035 ? 119.458 129.725 88.059  1.00 59.27  ? 1014 PRO A CD  1 
ATOM   6514 N  N   . PHE A 1 1036 ? 116.732 129.902 90.355  1.00 50.61  ? 1015 PHE A N   1 
ATOM   6515 C  CA  . PHE A 1 1036 ? 115.396 129.908 90.930  1.00 50.61  ? 1015 PHE A CA  1 
ATOM   6516 C  C   . PHE A 1 1036 ? 115.259 128.796 91.957  1.00 50.61  ? 1015 PHE A C   1 
ATOM   6517 O  O   . PHE A 1 1036 ? 114.913 129.050 93.121  1.00 50.61  ? 1015 PHE A O   1 
ATOM   6518 C  CB  . PHE A 1 1036 ? 114.374 129.760 89.804  1.00 50.61  ? 1015 PHE A CB  1 
ATOM   6519 C  CG  . PHE A 1 1036 ? 114.444 130.870 88.790  1.00 50.61  ? 1015 PHE A CG  1 
ATOM   6520 C  CD1 . PHE A 1 1036 ? 113.796 132.063 89.013  1.00 50.61  ? 1015 PHE A CD1 1 
ATOM   6521 C  CD2 . PHE A 1 1036 ? 115.188 130.732 87.637  1.00 50.61  ? 1015 PHE A CD2 1 
ATOM   6522 C  CE1 . PHE A 1 1036 ? 113.871 133.085 88.099  1.00 50.61  ? 1015 PHE A CE1 1 
ATOM   6523 C  CE2 . PHE A 1 1036 ? 115.269 131.758 86.727  1.00 50.61  ? 1015 PHE A CE2 1 
ATOM   6524 C  CZ  . PHE A 1 1036 ? 114.610 132.932 86.963  1.00 50.61  ? 1015 PHE A CZ  1 
ATOM   6525 N  N   . LEU A 1 1037 ? 115.643 127.580 91.555  1.00 59.85  ? 1016 LEU A N   1 
ATOM   6526 C  CA  . LEU A 1 1037 ? 115.589 126.386 92.395  1.00 59.85  ? 1016 LEU A CA  1 
ATOM   6527 C  C   . LEU A 1 1037 ? 116.415 126.525 93.666  1.00 59.85  ? 1016 LEU A C   1 
ATOM   6528 O  O   . LEU A 1 1037 ? 115.883 126.451 94.779  1.00 59.85  ? 1016 LEU A O   1 
ATOM   6529 C  CB  . LEU A 1 1037 ? 116.073 125.178 91.592  1.00 59.85  ? 1016 LEU A CB  1 
ATOM   6530 C  CG  . LEU A 1 1037 ? 115.058 124.272 90.901  1.00 59.85  ? 1016 LEU A CG  1 
ATOM   6531 C  CD1 . LEU A 1 1037 ? 114.288 123.531 91.967  1.00 59.85  ? 1016 LEU A CD1 1 
ATOM   6532 C  CD2 . LEU A 1 1037 ? 114.103 125.039 90.018  1.00 59.85  ? 1016 LEU A CD2 1 
ATOM   6533 N  N   . PHE A 1 1038 ? 117.723 126.722 93.524  1.00 64.65  ? 1017 PHE A N   1 
ATOM   6534 C  CA  . PHE A 1 1038 ? 118.560 126.696 94.717  1.00 64.65  ? 1017 PHE A CA  1 
ATOM   6535 C  C   . PHE A 1 1038 ? 118.476 127.998 95.496  1.00 64.65  ? 1017 PHE A C   1 
ATOM   6536 O  O   . PHE A 1 1038 ? 118.364 127.976 96.723  1.00 64.65  ? 1017 PHE A O   1 
ATOM   6537 C  CB  . PHE A 1 1038 ? 120.011 126.403 94.352  1.00 64.65  ? 1017 PHE A CB  1 
ATOM   6538 C  CG  . PHE A 1 1038 ? 120.253 125.006 93.865  1.00 64.65  ? 1017 PHE A CG  1 
ATOM   6539 C  CD1 . PHE A 1 1038 ? 119.348 123.996 94.118  1.00 64.65  ? 1017 PHE A CD1 1 
ATOM   6540 C  CD2 . PHE A 1 1038 ? 121.390 124.714 93.141  1.00 64.65  ? 1017 PHE A CD2 1 
ATOM   6541 C  CE1 . PHE A 1 1038 ? 119.573 122.731 93.666  1.00 64.65  ? 1017 PHE A CE1 1 
ATOM   6542 C  CE2 . PHE A 1 1038 ? 121.621 123.444 92.684  1.00 64.65  ? 1017 PHE A CE2 1 
ATOM   6543 C  CZ  . PHE A 1 1038 ? 120.710 122.451 92.947  1.00 64.65  ? 1017 PHE A CZ  1 
ATOM   6544 N  N   . TRP A 1 1039 ? 118.529 129.139 94.814  1.00 58.53  ? 1018 TRP A N   1 
ATOM   6545 C  CA  . TRP A 1 1039 ? 118.532 130.414 95.515  1.00 58.53  ? 1018 TRP A CA  1 
ATOM   6546 C  C   . TRP A 1 1039 ? 117.141 130.977 95.729  1.00 58.53  ? 1018 TRP A C   1 
ATOM   6547 O  O   . TRP A 1 1039 ? 117.009 132.194 95.875  1.00 58.53  ? 1018 TRP A O   1 
ATOM   6548 C  CB  . TRP A 1 1039 ? 119.401 131.416 94.762  1.00 58.53  ? 1018 TRP A CB  1 
ATOM   6549 C  CG  . TRP A 1 1039 ? 120.844 131.158 94.962  1.00 58.53  ? 1018 TRP A CG  1 
ATOM   6550 C  CD1 . TRP A 1 1039 ? 121.632 131.699 95.920  1.00 58.53  ? 1018 TRP A CD1 1 
ATOM   6551 C  CD2 . TRP A 1 1039 ? 121.670 130.252 94.227  1.00 58.53  ? 1018 TRP A CD2 1 
ATOM   6552 N  NE1 . TRP A 1 1039 ? 122.908 131.214 95.817  1.00 58.53  ? 1018 TRP A NE1 1 
ATOM   6553 C  CE2 . TRP A 1 1039 ? 122.955 130.314 94.788  1.00 58.53  ? 1018 TRP A CE2 1 
ATOM   6554 C  CE3 . TRP A 1 1039 ? 121.452 129.402 93.144  1.00 58.53  ? 1018 TRP A CE3 1 
ATOM   6555 C  CZ2 . TRP A 1 1039 ? 124.018 129.560 94.303  1.00 58.53  ? 1018 TRP A CZ2 1 
ATOM   6556 C  CZ3 . TRP A 1 1039 ? 122.504 128.651 92.668  1.00 58.53  ? 1018 TRP A CZ3 1 
ATOM   6557 C  CH2 . TRP A 1 1039 ? 123.772 128.735 93.244  1.00 58.53  ? 1018 TRP A CH2 1 
ATOM   6558 N  N   . GLU A 1 1040 ? 116.111 130.127 95.731  1.00 61.87  ? 1019 GLU A N   1 
ATOM   6559 C  CA  . GLU A 1 1040 ? 114.766 130.577 96.064  1.00 61.87  ? 1019 GLU A CA  1 
ATOM   6560 C  C   . GLU A 1 1040 ? 114.657 131.108 97.492  1.00 61.87  ? 1019 GLU A C   1 
ATOM   6561 O  O   . GLU A 1 1040 ? 114.001 132.128 97.723  1.00 61.87  ? 1019 GLU A O   1 
ATOM   6562 C  CB  . GLU A 1 1040 ? 113.786 129.429 95.857  1.00 61.87  ? 1019 GLU A CB  1 
ATOM   6563 C  CG  . GLU A 1 1040 ? 112.342 129.739 96.189  1.00 61.87  ? 1019 GLU A CG  1 
ATOM   6564 C  CD  . GLU A 1 1040 ? 111.688 130.706 95.233  1.00 61.87  ? 1019 GLU A CD  1 
ATOM   6565 O  OE1 . GLU A 1 1040 ? 112.126 130.798 94.066  1.00 61.87  ? 1019 GLU A OE1 1 
ATOM   6566 O  OE2 . GLU A 1 1040 ? 110.709 131.359 95.645  1.00 61.87  ? 1019 GLU A OE2 1 
ATOM   6567 N  N   . GLN A 1 1041 ? 115.301 130.449 98.465  1.00 52.33  ? 1020 GLN A N   1 
ATOM   6568 C  CA  . GLN A 1 1041 ? 114.901 130.651 99.857  1.00 52.33  ? 1020 GLN A CA  1 
ATOM   6569 C  C   . GLN A 1 1041 ? 115.392 131.946 100.479 1.00 52.33  ? 1020 GLN A C   1 
ATOM   6570 O  O   . GLN A 1 1041 ? 114.981 132.257 101.596 1.00 52.33  ? 1020 GLN A O   1 
ATOM   6571 C  CB  . GLN A 1 1041 ? 115.361 129.510 100.766 1.00 52.33  ? 1020 GLN A CB  1 
ATOM   6572 C  CG  . GLN A 1 1041 ? 116.819 129.539 101.184 1.00 52.33  ? 1020 GLN A CG  1 
ATOM   6573 C  CD  . GLN A 1 1041 ? 117.677 128.553 100.437 1.00 52.33  ? 1020 GLN A CD  1 
ATOM   6574 O  OE1 . GLN A 1 1041 ? 117.280 128.019 99.409  1.00 52.33  ? 1020 GLN A OE1 1 
ATOM   6575 N  NE2 . GLN A 1 1041 ? 118.856 128.279 100.973 1.00 52.33  ? 1020 GLN A NE2 1 
ATOM   6576 N  N   . TYR A 1 1042 ? 116.239 132.716 99.813  1.00 57.14  ? 1021 TYR A N   1 
ATOM   6577 C  CA  . TYR A 1 1042 ? 116.695 133.956 100.425 1.00 57.14  ? 1021 TYR A CA  1 
ATOM   6578 C  C   . TYR A 1 1042 ? 115.690 135.087 100.284 1.00 57.14  ? 1021 TYR A C   1 
ATOM   6579 O  O   . TYR A 1 1042 ? 115.932 136.176 100.813 1.00 57.14  ? 1021 TYR A O   1 
ATOM   6580 C  CB  . TYR A 1 1042 ? 118.025 134.385 99.817  1.00 57.14  ? 1021 TYR A CB  1 
ATOM   6581 C  CG  . TYR A 1 1042 ? 119.111 133.371 99.999  1.00 57.14  ? 1021 TYR A CG  1 
ATOM   6582 C  CD1 . TYR A 1 1042 ? 119.832 133.295 101.172 1.00 57.14  ? 1021 TYR A CD1 1 
ATOM   6583 C  CD2 . TYR A 1 1042 ? 119.400 132.472 98.992  1.00 57.14  ? 1021 TYR A CD2 1 
ATOM   6584 C  CE1 . TYR A 1 1042 ? 120.819 132.357 101.329 1.00 57.14  ? 1021 TYR A CE1 1 
ATOM   6585 C  CE2 . TYR A 1 1042 ? 120.381 131.532 99.141  1.00 57.14  ? 1021 TYR A CE2 1 
ATOM   6586 C  CZ  . TYR A 1 1042 ? 121.087 131.476 100.306 1.00 57.14  ? 1021 TYR A CZ  1 
ATOM   6587 O  OH  . TYR A 1 1042 ? 122.067 130.526 100.430 1.00 57.14  ? 1021 TYR A OH  1 
ATOM   6588 N  N   . ILE A 1 1043 ? 114.577 134.850 99.590  1.00 60.52  ? 1022 ILE A N   1 
ATOM   6589 C  CA  . ILE A 1 1043 ? 113.609 135.906 99.325  1.00 60.52  ? 1022 ILE A CA  1 
ATOM   6590 C  C   . ILE A 1 1043 ? 112.838 136.252 100.589 1.00 60.52  ? 1022 ILE A C   1 
ATOM   6591 O  O   . ILE A 1 1043 ? 112.632 137.428 100.912 1.00 60.52  ? 1022 ILE A O   1 
ATOM   6592 C  CB  . ILE A 1 1043 ? 112.670 135.474 98.188  1.00 60.52  ? 1022 ILE A CB  1 
ATOM   6593 C  CG1 . ILE A 1 1043 ? 113.469 135.264 96.908  1.00 60.52  ? 1022 ILE A CG1 1 
ATOM   6594 C  CG2 . ILE A 1 1043 ? 111.592 136.507 97.954  1.00 60.52  ? 1022 ILE A CG2 1 
ATOM   6595 C  CD1 . ILE A 1 1043 ? 112.678 134.600 95.822  1.00 60.52  ? 1022 ILE A CD1 1 
ATOM   6596 N  N   . GLY A 1 1044 ? 112.420 135.238 101.330 1.00 64.77  ? 1023 GLY A N   1 
ATOM   6597 C  CA  . GLY A 1 1044 ? 111.692 135.454 102.558 1.00 64.77  ? 1023 GLY A CA  1 
ATOM   6598 C  C   . GLY A 1 1044 ? 112.535 135.496 103.804 1.00 64.77  ? 1023 GLY A C   1 
ATOM   6599 O  O   . GLY A 1 1044 ? 112.011 135.798 104.878 1.00 64.77  ? 1023 GLY A O   1 
ATOM   6600 N  N   . LEU A 1 1045 ? 113.834 135.233 103.693 1.00 59.31  ? 1024 LEU A N   1 
ATOM   6601 C  CA  . LEU A 1 1045 ? 114.704 135.125 104.850 1.00 59.31  ? 1024 LEU A CA  1 
ATOM   6602 C  C   . LEU A 1 1045 ? 114.971 136.517 105.414 1.00 59.31  ? 1024 LEU A C   1 
ATOM   6603 O  O   . LEU A 1 1045 ? 114.685 137.527 104.767 1.00 59.31  ? 1024 LEU A O   1 
ATOM   6604 C  CB  . LEU A 1 1045 ? 116.000 134.424 104.456 1.00 59.31  ? 1024 LEU A CB  1 
ATOM   6605 C  CG  . LEU A 1 1045 ? 116.878 133.734 105.488 1.00 59.31  ? 1024 LEU A CG  1 
ATOM   6606 C  CD1 . LEU A 1 1045 ? 116.125 132.566 106.051 1.00 59.31  ? 1024 LEU A CD1 1 
ATOM   6607 C  CD2 . LEU A 1 1045 ? 118.109 133.258 104.800 1.00 59.31  ? 1024 LEU A CD2 1 
ATOM   6608 N  N   . ARG A 1 1046 ? 115.482 136.550 106.650 1.00 56.75  ? 1025 ARG A N   1 
ATOM   6609 C  CA  . ARG A 1 1046 ? 115.631 137.681 107.574 1.00 56.75  ? 1025 ARG A CA  1 
ATOM   6610 C  C   . ARG A 1 1046 ? 114.302 138.184 108.108 1.00 56.75  ? 1025 ARG A C   1 
ATOM   6611 O  O   . ARG A 1 1046 ? 114.295 139.115 108.914 1.00 56.75  ? 1025 ARG A O   1 
ATOM   6612 C  CB  . ARG A 1 1046 ? 116.377 138.888 106.989 1.00 56.75  ? 1025 ARG A CB  1 
ATOM   6613 C  CG  . ARG A 1 1046 ? 117.762 138.605 106.501 1.00 56.75  ? 1025 ARG A CG  1 
ATOM   6614 C  CD  . ARG A 1 1046 ? 118.743 138.463 107.628 1.00 56.75  ? 1025 ARG A CD  1 
ATOM   6615 N  NE  . ARG A 1 1046 ? 120.077 138.213 107.103 1.00 56.75  ? 1025 ARG A NE  1 
ATOM   6616 C  CZ  . ARG A 1 1046 ? 120.914 139.170 106.731 1.00 56.75  ? 1025 ARG A CZ  1 
ATOM   6617 N  NH1 . ARG A 1 1046 ? 120.551 140.438 106.820 1.00 56.75  ? 1025 ARG A NH1 1 
ATOM   6618 N  NH2 . ARG A 1 1046 ? 122.112 138.859 106.271 1.00 56.75  ? 1025 ARG A NH2 1 
ATOM   6619 N  N   . HIS A 1 1047 ? 113.180 137.625 107.673 1.00 76.45  ? 1026 HIS A N   1 
ATOM   6620 C  CA  . HIS A 1 1047 ? 111.899 137.856 108.318 1.00 76.45  ? 1026 HIS A CA  1 
ATOM   6621 C  C   . HIS A 1 1047 ? 111.513 136.696 109.210 1.00 76.45  ? 1026 HIS A C   1 
ATOM   6622 O  O   . HIS A 1 1047 ? 111.075 136.912 110.343 1.00 76.45  ? 1026 HIS A O   1 
ATOM   6623 C  CB  . HIS A 1 1047 ? 110.793 138.088 107.280 1.00 76.45  ? 1026 HIS A CB  1 
ATOM   6624 C  CG  . HIS A 1 1047 ? 110.969 139.338 106.476 1.00 76.45  ? 1026 HIS A CG  1 
ATOM   6625 N  ND1 . HIS A 1 1047 ? 111.668 139.367 105.289 1.00 76.45  ? 1026 HIS A ND1 1 
ATOM   6626 C  CD2 . HIS A 1 1047 ? 110.546 140.605 106.694 1.00 76.45  ? 1026 HIS A CD2 1 
ATOM   6627 C  CE1 . HIS A 1 1047 ? 111.664 140.597 104.808 1.00 76.45  ? 1026 HIS A CE1 1 
ATOM   6628 N  NE2 . HIS A 1 1047 ? 110.991 141.368 105.643 1.00 76.45  ? 1026 HIS A NE2 1 
ATOM   6629 N  N   . TRP A 1 1048 ? 111.702 135.466 108.731 1.00 84.58  ? 1027 TRP A N   1 
ATOM   6630 C  CA  . TRP A 1 1048 ? 111.355 134.306 109.536 1.00 84.58  ? 1027 TRP A CA  1 
ATOM   6631 C  C   . TRP A 1 1048 ? 112.338 134.117 110.676 1.00 84.58  ? 1027 TRP A C   1 
ATOM   6632 O  O   . TRP A 1 1048 ? 111.983 133.531 111.703 1.00 84.58  ? 1027 TRP A O   1 
ATOM   6633 C  CB  . TRP A 1 1048 ? 111.302 133.056 108.669 1.00 84.58  ? 1027 TRP A CB  1 
ATOM   6634 C  CG  . TRP A 1 1048 ? 110.291 133.160 107.593 1.00 84.58  ? 1027 TRP A CG  1 
ATOM   6635 C  CD1 . TRP A 1 1048 ? 110.520 133.540 106.312 1.00 84.58  ? 1027 TRP A CD1 1 
ATOM   6636 C  CD2 . TRP A 1 1048 ? 108.889 132.893 107.687 1.00 84.58  ? 1027 TRP A CD2 1 
ATOM   6637 N  NE1 . TRP A 1 1048 ? 109.352 133.532 105.595 1.00 84.58  ? 1027 TRP A NE1 1 
ATOM   6638 C  CE2 . TRP A 1 1048 ? 108.332 133.133 106.416 1.00 84.58  ? 1027 TRP A CE2 1 
ATOM   6639 C  CE3 . TRP A 1 1048 ? 108.049 132.472 108.717 1.00 84.58  ? 1027 TRP A CE3 1 
ATOM   6640 C  CZ2 . TRP A 1 1048 ? 106.972 132.966 106.146 1.00 84.58  ? 1027 TRP A CZ2 1 
ATOM   6641 C  CZ3 . TRP A 1 1048 ? 106.696 132.306 108.448 1.00 84.58  ? 1027 TRP A CZ3 1 
ATOM   6642 C  CH2 . TRP A 1 1048 ? 106.171 132.554 107.172 1.00 84.58  ? 1027 TRP A CH2 1 
ATOM   6643 N  N   . LEU A 1 1049 ? 113.565 134.611 110.518 1.00 51.76  ? 1028 LEU A N   1 
ATOM   6644 C  CA  . LEU A 1 1049 ? 114.507 134.632 111.628 1.00 51.76  ? 1028 LEU A CA  1 
ATOM   6645 C  C   . LEU A 1 1049 ? 113.971 135.474 112.776 1.00 51.76  ? 1028 LEU A C   1 
ATOM   6646 O  O   . LEU A 1 1049 ? 113.884 135.004 113.915 1.00 51.76  ? 1028 LEU A O   1 
ATOM   6647 C  CB  . LEU A 1 1049 ? 115.856 135.152 111.137 1.00 51.76  ? 1028 LEU A CB  1 
ATOM   6648 C  CG  . LEU A 1 1049 ? 117.070 135.238 112.046 1.00 51.76  ? 1028 LEU A CG  1 
ATOM   6649 C  CD1 . LEU A 1 1049 ? 118.267 134.868 111.227 1.00 51.76  ? 1028 LEU A CD1 1 
ATOM   6650 C  CD2 . LEU A 1 1049 ? 117.236 136.656 112.530 1.00 51.76  ? 1028 LEU A CD2 1 
ATOM   6651 N  N   . LEU A 1 1050 ? 113.551 136.705 112.475 1.00 62.82  ? 1029 LEU A N   1 
ATOM   6652 C  CA  . LEU A 1 1050 ? 112.977 137.581 113.490 1.00 62.82  ? 1029 LEU A CA  1 
ATOM   6653 C  C   . LEU A 1 1050 ? 111.685 137.005 114.053 1.00 62.82  ? 1029 LEU A C   1 
ATOM   6654 O  O   . LEU A 1 1050 ? 111.439 137.072 115.266 1.00 62.82  ? 1029 LEU A O   1 
ATOM   6655 C  CB  . LEU A 1 1050 ? 112.721 138.963 112.895 1.00 62.82  ? 1029 LEU A CB  1 
ATOM   6656 C  CG  . LEU A 1 1050 ? 112.147 139.972 113.879 1.00 62.82  ? 1029 LEU A CG  1 
ATOM   6657 C  CD1 . LEU A 1 1050 ? 113.164 140.256 114.952 1.00 62.82  ? 1029 LEU A CD1 1 
ATOM   6658 C  CD2 . LEU A 1 1050 ? 111.721 141.240 113.185 1.00 62.82  ? 1029 LEU A CD2 1 
ATOM   6659 N  N   . LEU A 1 1051 ? 110.879 136.390 113.188 1.00 55.61  ? 1030 LEU A N   1 
ATOM   6660 C  CA  . LEU A 1 1051 ? 109.589 135.862 113.603 1.00 55.61  ? 1030 LEU A CA  1 
ATOM   6661 C  C   . LEU A 1 1051 ? 109.746 134.702 114.571 1.00 55.61  ? 1030 LEU A C   1 
ATOM   6662 O  O   . LEU A 1 1051 ? 109.072 134.657 115.606 1.00 55.61  ? 1030 LEU A O   1 
ATOM   6663 C  CB  . LEU A 1 1051 ? 108.793 135.424 112.385 1.00 55.61  ? 1030 LEU A CB  1 
ATOM   6664 C  CG  . LEU A 1 1051 ? 107.407 134.935 112.748 1.00 55.61  ? 1030 LEU A CG  1 
ATOM   6665 C  CD1 . LEU A 1 1051 ? 106.644 136.082 113.362 1.00 55.61  ? 1030 LEU A CD1 1 
ATOM   6666 C  CD2 . LEU A 1 1051 ? 106.698 134.382 111.532 1.00 55.61  ? 1030 LEU A CD2 1 
ATOM   6667 N  N   . PHE A 1 1052 ? 110.660 133.777 114.287 1.00 54.24  ? 1031 PHE A N   1 
ATOM   6668 C  CA  . PHE A 1 1052 ? 110.751 132.630 115.172 1.00 54.24  ? 1031 PHE A CA  1 
ATOM   6669 C  C   . PHE A 1 1052 ? 111.648 132.876 116.375 1.00 54.24  ? 1031 PHE A C   1 
ATOM   6670 O  O   . PHE A 1 1052 ? 111.479 132.189 117.387 1.00 54.24  ? 1031 PHE A O   1 
ATOM   6671 C  CB  . PHE A 1 1052 ? 111.174 131.385 114.401 1.00 54.24  ? 1031 PHE A CB  1 
ATOM   6672 C  CG  . PHE A 1 1052 ? 110.136 130.926 113.421 1.00 54.24  ? 1031 PHE A CG  1 
ATOM   6673 C  CD1 . PHE A 1 1052 ? 108.900 130.490 113.869 1.00 54.24  ? 1031 PHE A CD1 1 
ATOM   6674 C  CD2 . PHE A 1 1052 ? 110.398 130.888 112.066 1.00 54.24  ? 1031 PHE A CD2 1 
ATOM   6675 C  CE1 . PHE A 1 1052 ? 107.932 130.069 112.982 1.00 54.24  ? 1031 PHE A CE1 1 
ATOM   6676 C  CE2 . PHE A 1 1052 ? 109.443 130.464 111.174 1.00 54.24  ? 1031 PHE A CE2 1 
ATOM   6677 C  CZ  . PHE A 1 1052 ? 108.207 130.052 111.632 1.00 54.24  ? 1031 PHE A CZ  1 
ATOM   6678 N  N   . ILE A 1 1053 ? 112.552 133.859 116.324 1.00 47.53  ? 1032 ILE A N   1 
ATOM   6679 C  CA  . ILE A 1 1053 ? 113.171 134.323 117.566 1.00 47.53  ? 1032 ILE A CA  1 
ATOM   6680 C  C   . ILE A 1 1053 ? 112.124 134.934 118.487 1.00 47.53  ? 1032 ILE A C   1 
ATOM   6681 O  O   . ILE A 1 1053 ? 112.099 134.650 119.694 1.00 47.53  ? 1032 ILE A O   1 
ATOM   6682 C  CB  . ILE A 1 1053 ? 114.319 135.301 117.265 1.00 47.53  ? 1032 ILE A CB  1 
ATOM   6683 C  CG1 . ILE A 1 1053 ? 115.493 134.543 116.649 1.00 47.53  ? 1032 ILE A CG1 1 
ATOM   6684 C  CG2 . ILE A 1 1053 ? 114.749 136.053 118.502 1.00 47.53  ? 1032 ILE A CG2 1 
ATOM   6685 C  CD1 . ILE A 1 1053 ? 116.018 133.439 117.512 1.00 47.53  ? 1032 ILE A CD1 1 
ATOM   6686 N  N   . SER A 1 1054 ? 111.197 135.715 117.921 1.00 55.26  ? 1033 SER A N   1 
ATOM   6687 C  CA  . SER A 1 1054 ? 110.151 136.328 118.736 1.00 55.26  ? 1033 SER A CA  1 
ATOM   6688 C  C   . SER A 1 1054 ? 109.190 135.288 119.317 1.00 55.26  ? 1033 SER A C   1 
ATOM   6689 O  O   . SER A 1 1054 ? 108.893 135.317 120.519 1.00 55.26  ? 1033 SER A O   1 
ATOM   6690 C  CB  . SER A 1 1054 ? 109.393 137.361 117.910 1.00 55.26  ? 1033 SER A CB  1 
ATOM   6691 O  OG  . SER A 1 1054 ? 108.347 137.932 118.672 1.00 55.26  ? 1033 SER A OG  1 
ATOM   6692 N  N   . VAL A 1 1055 ? 108.721 134.342 118.499 1.00 52.67  ? 1034 VAL A N   1 
ATOM   6693 C  CA  . VAL A 1 1055 ? 107.719 133.409 119.017 1.00 52.67  ? 1034 VAL A CA  1 
ATOM   6694 C  C   . VAL A 1 1055 ? 108.357 132.354 119.925 1.00 52.67  ? 1034 VAL A C   1 
ATOM   6695 O  O   . VAL A 1 1055 ? 107.706 131.869 120.863 1.00 52.67  ? 1034 VAL A O   1 
ATOM   6696 C  CB  . VAL A 1 1055 ? 106.906 132.776 117.870 1.00 52.67  ? 1034 VAL A CB  1 
ATOM   6697 C  CG1 . VAL A 1 1055 ? 107.714 131.788 117.077 1.00 52.67  ? 1034 VAL A CG1 1 
ATOM   6698 C  CG2 . VAL A 1 1055 ? 105.630 132.120 118.390 1.00 52.67  ? 1034 VAL A CG2 1 
ATOM   6699 N  N   . VAL A 1 1056 ? 109.636 132.022 119.723 1.00 45.57  ? 1035 VAL A N   1 
ATOM   6700 C  CA  . VAL A 1 1056 ? 110.274 131.100 120.656 1.00 45.57  ? 1035 VAL A CA  1 
ATOM   6701 C  C   . VAL A 1 1056 ? 110.554 131.799 121.980 1.00 45.57  ? 1035 VAL A C   1 
ATOM   6702 O  O   . VAL A 1 1056 ? 110.330 131.227 123.052 1.00 45.57  ? 1035 VAL A O   1 
ATOM   6703 C  CB  . VAL A 1 1056 ? 111.532 130.474 120.031 1.00 45.57  ? 1035 VAL A CB  1 
ATOM   6704 C  CG1 . VAL A 1 1056 ? 112.336 129.743 121.055 1.00 45.57  ? 1035 VAL A CG1 1 
ATOM   6705 C  CG2 . VAL A 1 1056 ? 111.115 129.458 119.028 1.00 45.57  ? 1035 VAL A CG2 1 
ATOM   6706 N  N   . LEU A 1 1057 ? 110.941 133.075 121.943 1.00 34.63  ? 1036 LEU A N   1 
ATOM   6707 C  CA  . LEU A 1 1057 ? 111.087 133.752 123.223 1.00 34.63  ? 1036 LEU A CA  1 
ATOM   6708 C  C   . LEU A 1 1057 ? 109.758 134.129 123.865 1.00 34.63  ? 1036 LEU A C   1 
ATOM   6709 O  O   . LEU A 1 1057 ? 109.760 134.574 125.013 1.00 34.63  ? 1036 LEU A O   1 
ATOM   6710 C  CB  . LEU A 1 1057 ? 111.964 134.984 123.085 1.00 34.63  ? 1036 LEU A CB  1 
ATOM   6711 C  CG  . LEU A 1 1057 ? 113.424 134.634 122.838 1.00 34.63  ? 1036 LEU A CG  1 
ATOM   6712 C  CD1 . LEU A 1 1057 ? 114.238 135.889 122.666 1.00 34.63  ? 1036 LEU A CD1 1 
ATOM   6713 C  CD2 . LEU A 1 1057 ? 113.952 133.810 123.977 1.00 34.63  ? 1036 LEU A CD2 1 
ATOM   6714 N  N   . ALA A 1 1058 ? 108.629 133.952 123.179 1.00 44.72  ? 1037 ALA A N   1 
ATOM   6715 C  CA  . ALA A 1 1058 ? 107.359 134.013 123.897 1.00 44.72  ? 1037 ALA A CA  1 
ATOM   6716 C  C   . ALA A 1 1058 ? 107.004 132.670 124.524 1.00 44.72  ? 1037 ALA A C   1 
ATOM   6717 O  O   . ALA A 1 1058 ? 106.532 132.621 125.672 1.00 44.72  ? 1037 ALA A O   1 
ATOM   6718 C  CB  . ALA A 1 1058 ? 106.239 134.468 122.966 1.00 44.72  ? 1037 ALA A CB  1 
ATOM   6719 N  N   . CYS A 1 1059 ? 107.235 131.567 123.803 1.00 57.02  ? 1038 CYS A N   1 
ATOM   6720 C  CA  . CYS A 1 1059 ? 106.835 130.275 124.350 1.00 57.02  ? 1038 CYS A CA  1 
ATOM   6721 C  C   . CYS A 1 1059 ? 107.764 129.812 125.466 1.00 57.02  ? 1038 CYS A C   1 
ATOM   6722 O  O   . CYS A 1 1059 ? 107.319 129.104 126.370 1.00 57.02  ? 1038 CYS A O   1 
ATOM   6723 C  CB  . CYS A 1 1059 ? 106.769 129.211 123.260 1.00 57.02  ? 1038 CYS A CB  1 
ATOM   6724 S  SG  . CYS A 1 1059 ? 108.360 128.656 122.660 1.00 57.02  ? 1038 CYS A SG  1 
ATOM   6725 N  N   . THR A 1 1060 ? 109.041 130.201 125.444 1.00 51.43  ? 1039 THR A N   1 
ATOM   6726 C  CA  . THR A 1 1060 ? 109.898 129.857 126.575 1.00 51.43  ? 1039 THR A CA  1 
ATOM   6727 C  C   . THR A 1 1060 ? 109.644 130.743 127.788 1.00 51.43  ? 1039 THR A C   1 
ATOM   6728 O  O   . THR A 1 1060 ? 109.966 130.342 128.910 1.00 51.43  ? 1039 THR A O   1 
ATOM   6729 C  CB  . THR A 1 1060 ? 111.377 129.911 126.185 1.00 51.43  ? 1039 THR A CB  1 
ATOM   6730 O  OG1 . THR A 1 1060 ? 112.160 129.361 127.243 1.00 51.43  ? 1039 THR A OG1 1 
ATOM   6731 C  CG2 . THR A 1 1060 ? 111.840 131.321 125.955 1.00 51.43  ? 1039 THR A CG2 1 
ATOM   6732 N  N   . PHE A 1 1061 ? 109.053 131.921 127.598 1.00 54.00  ? 1040 PHE A N   1 
ATOM   6733 C  CA  . PHE A 1 1061 ? 108.593 132.697 128.737 1.00 54.00  ? 1040 PHE A CA  1 
ATOM   6734 C  C   . PHE A 1 1061 ? 107.351 132.076 129.345 1.00 54.00  ? 1040 PHE A C   1 
ATOM   6735 O  O   . PHE A 1 1061 ? 107.176 132.092 130.569 1.00 54.00  ? 1040 PHE A O   1 
ATOM   6736 C  CB  . PHE A 1 1061 ? 108.307 134.129 128.316 1.00 54.00  ? 1040 PHE A CB  1 
ATOM   6737 C  CG  . PHE A 1 1061 ? 107.753 134.971 129.408 1.00 54.00  ? 1040 PHE A CG  1 
ATOM   6738 C  CD1 . PHE A 1 1061 ? 108.553 135.370 130.458 1.00 54.00  ? 1040 PHE A CD1 1 
ATOM   6739 C  CD2 . PHE A 1 1061 ? 106.435 135.380 129.377 1.00 54.00  ? 1040 PHE A CD2 1 
ATOM   6740 C  CE1 . PHE A 1 1061 ? 108.043 136.154 131.467 1.00 54.00  ? 1040 PHE A CE1 1 
ATOM   6741 C  CE2 . PHE A 1 1061 ? 105.917 136.163 130.379 1.00 54.00  ? 1040 PHE A CE2 1 
ATOM   6742 C  CZ  . PHE A 1 1061 ? 106.721 136.553 131.428 1.00 54.00  ? 1040 PHE A CZ  1 
ATOM   6743 N  N   . LEU A 1 1062 ? 106.470 131.531 128.507 1.00 61.89  ? 1041 LEU A N   1 
ATOM   6744 C  CA  . LEU A 1 1062 ? 105.303 130.843 129.046 1.00 61.89  ? 1041 LEU A CA  1 
ATOM   6745 C  C   . LEU A 1 1062 ? 105.697 129.542 129.738 1.00 61.89  ? 1041 LEU A C   1 
ATOM   6746 O  O   . LEU A 1 1062 ? 105.127 129.197 130.779 1.00 61.89  ? 1041 LEU A O   1 
ATOM   6747 C  CB  . LEU A 1 1062 ? 104.285 130.599 127.934 1.00 61.89  ? 1041 LEU A CB  1 
ATOM   6748 C  CG  . LEU A 1 1062 ? 102.895 130.069 128.291 1.00 61.89  ? 1041 LEU A CG  1 
ATOM   6749 C  CD1 . LEU A 1 1062 ? 101.873 130.730 127.392 1.00 61.89  ? 1041 LEU A CD1 1 
ATOM   6750 C  CD2 . LEU A 1 1062 ? 102.795 128.555 128.125 1.00 61.89  ? 1041 LEU A CD2 1 
ATOM   6751 N  N   . VAL A 1 1063 ? 106.672 128.816 129.186 1.00 58.47  ? 1042 VAL A N   1 
ATOM   6752 C  CA  . VAL A 1 1063 ? 107.106 127.563 129.800 1.00 58.47  ? 1042 VAL A CA  1 
ATOM   6753 C  C   . VAL A 1 1063 ? 107.840 127.826 131.110 1.00 58.47  ? 1042 VAL A C   1 
ATOM   6754 O  O   . VAL A 1 1063 ? 107.552 127.193 132.136 1.00 58.47  ? 1042 VAL A O   1 
ATOM   6755 C  CB  . VAL A 1 1063 ? 107.960 126.757 128.805 1.00 58.47  ? 1042 VAL A CB  1 
ATOM   6756 C  CG1 . VAL A 1 1063 ? 108.656 125.628 129.494 1.00 58.47  ? 1042 VAL A CG1 1 
ATOM   6757 C  CG2 . VAL A 1 1063 ? 107.075 126.172 127.735 1.00 58.47  ? 1042 VAL A CG2 1 
ATOM   6758 N  N   . CYS A 1 1064 ? 108.743 128.806 131.123 1.00 57.29  ? 1043 CYS A N   1 
ATOM   6759 C  CA  . CYS A 1 1064 ? 109.392 129.222 132.362 1.00 57.29  ? 1043 CYS A CA  1 
ATOM   6760 C  C   . CYS A 1 1064 ? 108.503 130.088 133.249 1.00 57.29  ? 1043 CYS A C   1 
ATOM   6761 O  O   . CYS A 1 1064 ? 108.993 130.616 134.249 1.00 57.29  ? 1043 CYS A O   1 
ATOM   6762 C  CB  . CYS A 1 1064 ? 110.689 129.971 132.066 1.00 57.29  ? 1043 CYS A CB  1 
ATOM   6763 S  SG  . CYS A 1 1064 ? 111.984 128.941 131.374 1.00 57.29  ? 1043 CYS A SG  1 
ATOM   6764 N  N   . ALA A 1 1065 ? 107.230 130.271 132.902 1.00 52.76  ? 1044 ALA A N   1 
ATOM   6765 C  CA  . ALA A 1 1065 ? 106.241 130.770 133.844 1.00 52.76  ? 1044 ALA A CA  1 
ATOM   6766 C  C   . ALA A 1 1065 ? 105.335 129.674 134.387 1.00 52.76  ? 1044 ALA A C   1 
ATOM   6767 O  O   . ALA A 1 1065 ? 104.792 129.830 135.482 1.00 52.76  ? 1044 ALA A O   1 
ATOM   6768 C  CB  . ALA A 1 1065 ? 105.381 131.855 133.194 1.00 52.76  ? 1044 ALA A CB  1 
ATOM   6769 N  N   . VAL A 1 1066 ? 105.156 128.576 133.654 1.00 73.21  ? 1045 VAL A N   1 
ATOM   6770 C  CA  . VAL A 1 1066 ? 104.337 127.475 134.154 1.00 73.21  ? 1045 VAL A CA  1 
ATOM   6771 C  C   . VAL A 1 1066 ? 105.145 126.575 135.077 1.00 73.21  ? 1045 VAL A C   1 
ATOM   6772 O  O   . VAL A 1 1066 ? 104.690 126.212 136.167 1.00 73.21  ? 1045 VAL A O   1 
ATOM   6773 C  CB  . VAL A 1 1066 ? 103.730 126.682 132.980 1.00 73.21  ? 1045 VAL A CB  1 
ATOM   6774 C  CG1 . VAL A 1 1066 ? 103.066 125.412 133.465 1.00 73.21  ? 1045 VAL A CG1 1 
ATOM   6775 C  CG2 . VAL A 1 1066 ? 102.708 127.527 132.259 1.00 73.21  ? 1045 VAL A CG2 1 
ATOM   6776 N  N   . PHE A 1 1067 ? 106.359 126.206 134.671 1.00 77.93  ? 1046 PHE A N   1 
ATOM   6777 C  CA  . PHE A 1 1067 ? 107.145 125.288 135.489 1.00 77.93  ? 1046 PHE A CA  1 
ATOM   6778 C  C   . PHE A 1 1067 ? 107.789 125.949 136.701 1.00 77.93  ? 1046 PHE A C   1 
ATOM   6779 O  O   . PHE A 1 1067 ? 108.295 125.238 137.574 1.00 77.93  ? 1046 PHE A O   1 
ATOM   6780 C  CB  . PHE A 1 1067 ? 108.194 124.606 134.617 1.00 77.93  ? 1046 PHE A CB  1 
ATOM   6781 C  CG  . PHE A 1 1067 ? 107.627 123.519 133.751 1.00 77.93  ? 1046 PHE A CG  1 
ATOM   6782 C  CD1 . PHE A 1 1067 ? 106.455 122.875 134.108 1.00 77.93  ? 1046 PHE A CD1 1 
ATOM   6783 C  CD2 . PHE A 1 1067 ? 108.238 123.172 132.564 1.00 77.93  ? 1046 PHE A CD2 1 
ATOM   6784 C  CE1 . PHE A 1 1067 ? 105.924 121.877 133.312 1.00 77.93  ? 1046 PHE A CE1 1 
ATOM   6785 C  CE2 . PHE A 1 1067 ? 107.716 122.182 131.762 1.00 77.93  ? 1046 PHE A CE2 1 
ATOM   6786 C  CZ  . PHE A 1 1067 ? 106.555 121.534 132.135 1.00 77.93  ? 1046 PHE A CZ  1 
ATOM   6787 N  N   . LEU A 1 1068 ? 107.785 127.273 136.778 1.00 63.38  ? 1047 LEU A N   1 
ATOM   6788 C  CA  . LEU A 1 1068 ? 108.003 127.990 138.026 1.00 63.38  ? 1047 LEU A CA  1 
ATOM   6789 C  C   . LEU A 1 1068 ? 107.251 129.305 137.902 1.00 63.38  ? 1047 LEU A C   1 
ATOM   6790 O  O   . LEU A 1 1068 ? 107.373 129.985 136.881 1.00 63.38  ? 1047 LEU A O   1 
ATOM   6791 C  CB  . LEU A 1 1068 ? 109.497 128.190 138.317 1.00 63.38  ? 1047 LEU A CB  1 
ATOM   6792 C  CG  . LEU A 1 1068 ? 110.471 128.878 137.362 1.00 63.38  ? 1047 LEU A CG  1 
ATOM   6793 C  CD1 . LEU A 1 1068 ? 110.558 130.372 137.601 1.00 63.38  ? 1047 LEU A CD1 1 
ATOM   6794 C  CD2 . LEU A 1 1068 ? 111.841 128.238 137.486 1.00 63.38  ? 1047 LEU A CD2 1 
ATOM   6795 N  N   . LEU A 1 1069 ? 106.453 129.646 138.917 1.00 62.84  ? 1048 LEU A N   1 
ATOM   6796 C  CA  . LEU A 1 1069 ? 105.391 130.621 138.688 1.00 62.84  ? 1048 LEU A CA  1 
ATOM   6797 C  C   . LEU A 1 1069 ? 105.894 132.052 138.620 1.00 62.84  ? 1048 LEU A C   1 
ATOM   6798 O  O   . LEU A 1 1069 ? 105.351 132.831 137.829 1.00 62.84  ? 1048 LEU A O   1 
ATOM   6799 C  CB  . LEU A 1 1069 ? 104.300 130.498 139.758 1.00 62.84  ? 1048 LEU A CB  1 
ATOM   6800 C  CG  . LEU A 1 1069 ? 103.013 131.321 139.543 1.00 62.84  ? 1048 LEU A CG  1 
ATOM   6801 C  CD1 . LEU A 1 1069 ? 101.818 130.514 139.915 1.00 62.84  ? 1048 LEU A CD1 1 
ATOM   6802 C  CD2 . LEU A 1 1069 ? 102.968 132.621 140.349 1.00 62.84  ? 1048 LEU A CD2 1 
ATOM   6803 N  N   . ASN A 1 1070 ? 106.910 132.404 139.399 1.00 81.52  ? 1049 ASN A N   1 
ATOM   6804 C  CA  . ASN A 1 1070 ? 107.239 133.804 139.685 1.00 81.52  ? 1049 ASN A CA  1 
ATOM   6805 C  C   . ASN A 1 1070 ? 107.688 134.535 138.425 1.00 81.52  ? 1049 ASN A C   1 
ATOM   6806 O  O   . ASN A 1 1070 ? 108.816 134.316 137.965 1.00 81.52  ? 1049 ASN A O   1 
ATOM   6807 C  CB  . ASN A 1 1070 ? 108.317 133.875 140.763 1.00 81.52  ? 1049 ASN A CB  1 
ATOM   6808 C  CG  . ASN A 1 1070 ? 108.429 135.253 141.395 1.00 81.52  ? 1049 ASN A CG  1 
ATOM   6809 O  OD1 . ASN A 1 1070 ? 107.752 136.198 140.997 1.00 81.52  ? 1049 ASN A OD1 1 
ATOM   6810 N  ND2 . ASN A 1 1070 ? 109.272 135.361 142.405 1.00 81.52  ? 1049 ASN A ND2 1 
ATOM   6811 N  N   . PRO A 1 1071 ? 106.854 135.409 137.851 1.00 81.08  ? 1050 PRO A N   1 
ATOM   6812 C  CA  . PRO A 1 1071 ? 107.065 135.833 136.463 1.00 81.08  ? 1050 PRO A CA  1 
ATOM   6813 C  C   . PRO A 1 1071 ? 108.175 136.846 136.282 1.00 81.08  ? 1050 PRO A C   1 
ATOM   6814 O  O   . PRO A 1 1071 ? 108.721 136.935 135.175 1.00 81.08  ? 1050 PRO A O   1 
ATOM   6815 C  CB  . PRO A 1 1071 ? 105.710 136.433 136.082 1.00 81.08  ? 1050 PRO A CB  1 
ATOM   6816 C  CG  . PRO A 1 1071 ? 105.181 136.951 137.363 1.00 81.08  ? 1050 PRO A CG  1 
ATOM   6817 C  CD  . PRO A 1 1071 ? 105.646 136.017 138.433 1.00 81.08  ? 1050 PRO A CD  1 
ATOM   6818 N  N   . TRP A 1 1072 ? 108.526 137.609 137.319 1.00 69.40  ? 1051 TRP A N   1 
ATOM   6819 C  CA  . TRP A 1 1072 ? 109.674 138.505 137.241 1.00 69.40  ? 1051 TRP A CA  1 
ATOM   6820 C  C   . TRP A 1 1072 ? 110.987 137.740 137.157 1.00 69.40  ? 1051 TRP A C   1 
ATOM   6821 O  O   . TRP A 1 1072 ? 111.975 138.272 136.641 1.00 69.40  ? 1051 TRP A O   1 
ATOM   6822 C  CB  . TRP A 1 1072 ? 109.674 139.434 138.448 1.00 69.40  ? 1051 TRP A CB  1 
ATOM   6823 C  CG  . TRP A 1 1072 ? 110.767 140.439 138.474 1.00 69.40  ? 1051 TRP A CG  1 
ATOM   6824 C  CD1 . TRP A 1 1072 ? 111.934 140.343 139.157 1.00 69.40  ? 1051 TRP A CD1 1 
ATOM   6825 C  CD2 . TRP A 1 1072 ? 110.784 141.715 137.828 1.00 69.40  ? 1051 TRP A CD2 1 
ATOM   6826 N  NE1 . TRP A 1 1072 ? 112.690 141.471 138.972 1.00 69.40  ? 1051 TRP A NE1 1 
ATOM   6827 C  CE2 . TRP A 1 1072 ? 112.004 142.332 138.158 1.00 69.40  ? 1051 TRP A CE2 1 
ATOM   6828 C  CE3 . TRP A 1 1072 ? 109.889 142.394 136.999 1.00 69.40  ? 1051 TRP A CE3 1 
ATOM   6829 C  CZ2 . TRP A 1 1072 ? 112.356 143.594 137.685 1.00 69.40  ? 1051 TRP A CZ2 1 
ATOM   6830 C  CZ3 . TRP A 1 1072 ? 110.243 143.654 136.530 1.00 69.40  ? 1051 TRP A CZ3 1 
ATOM   6831 C  CH2 . TRP A 1 1072 ? 111.465 144.237 136.875 1.00 69.40  ? 1051 TRP A CH2 1 
ATOM   6832 N  N   . THR A 1 1073 ? 111.010 136.497 137.634 1.00 69.74  ? 1052 THR A N   1 
ATOM   6833 C  CA  . THR A 1 1073 ? 112.182 135.645 137.507 1.00 69.74  ? 1052 THR A CA  1 
ATOM   6834 C  C   . THR A 1 1073 ? 112.248 134.937 136.164 1.00 69.74  ? 1052 THR A C   1 
ATOM   6835 O  O   . THR A 1 1073 ? 113.312 134.429 135.801 1.00 69.74  ? 1052 THR A O   1 
ATOM   6836 C  CB  . THR A 1 1073 ? 112.186 134.606 138.617 1.00 69.74  ? 1052 THR A CB  1 
ATOM   6837 O  OG1 . THR A 1 1073 ? 111.061 133.736 138.448 1.00 69.74  ? 1052 THR A OG1 1 
ATOM   6838 C  CG2 . THR A 1 1073 ? 112.061 135.301 139.948 1.00 69.74  ? 1052 THR A CG2 1 
ATOM   6839 N  N   . ALA A 1 1074 ? 111.140 134.876 135.431 1.00 53.26  ? 1053 ALA A N   1 
ATOM   6840 C  CA  . ALA A 1 1074 ? 111.177 134.290 134.099 1.00 53.26  ? 1053 ALA A CA  1 
ATOM   6841 C  C   . ALA A 1 1074 ? 111.689 135.288 133.073 1.00 53.26  ? 1053 ALA A C   1 
ATOM   6842 O  O   . ALA A 1 1074 ? 112.432 134.920 132.159 1.00 53.26  ? 1053 ALA A O   1 
ATOM   6843 C  CB  . ALA A 1 1074 ? 109.792 133.782 133.708 1.00 53.26  ? 1053 ALA A CB  1 
ATOM   6844 N  N   . GLY A 1 1075 ? 111.317 136.561 133.225 1.00 58.93  ? 1054 GLY A N   1 
ATOM   6845 C  CA  . GLY A 1 1075 ? 111.731 137.589 132.290 1.00 58.93  ? 1054 GLY A CA  1 
ATOM   6846 C  C   . GLY A 1 1075 ? 113.214 137.874 132.303 1.00 58.93  ? 1054 GLY A C   1 
ATOM   6847 O  O   . GLY A 1 1075 ? 113.724 138.477 131.355 1.00 58.93  ? 1054 GLY A O   1 
ATOM   6848 N  N   . ILE A 1 1076 ? 113.920 137.452 133.350 1.00 57.47  ? 1055 ILE A N   1 
ATOM   6849 C  CA  . ILE A 1 1076 ? 115.369 137.588 133.348 1.00 57.47  ? 1055 ILE A CA  1 
ATOM   6850 C  C   . ILE A 1 1076 ? 116.011 136.427 132.590 1.00 57.47  ? 1055 ILE A C   1 
ATOM   6851 O  O   . ILE A 1 1076 ? 117.040 136.608 131.925 1.00 57.47  ? 1055 ILE A O   1 
ATOM   6852 C  CB  . ILE A 1 1076 ? 115.886 137.698 134.789 1.00 57.47  ? 1055 ILE A CB  1 
ATOM   6853 C  CG1 . ILE A 1 1076 ? 115.124 138.788 135.537 1.00 57.47  ? 1055 ILE A CG1 1 
ATOM   6854 C  CG2 . ILE A 1 1076 ? 117.334 138.068 134.789 1.00 57.47  ? 1055 ILE A CG2 1 
ATOM   6855 C  CD1 . ILE A 1 1076 ? 115.277 140.165 134.943 1.00 57.47  ? 1055 ILE A CD1 1 
ATOM   6856 N  N   . ILE A 1 1077 ? 115.405 135.234 132.654 1.00 54.56  ? 1056 ILE A N   1 
ATOM   6857 C  CA  . ILE A 1 1077 ? 115.787 134.140 131.760 1.00 54.56  ? 1056 ILE A CA  1 
ATOM   6858 C  C   . ILE A 1 1077 ? 115.557 134.537 130.308 1.00 54.56  ? 1056 ILE A C   1 
ATOM   6859 O  O   . ILE A 1 1077 ? 116.403 134.294 129.438 1.00 54.56  ? 1056 ILE A O   1 
ATOM   6860 C  CB  . ILE A 1 1077 ? 115.020 132.854 132.127 1.00 54.56  ? 1056 ILE A CB  1 
ATOM   6861 C  CG1 . ILE A 1 1077 ? 115.538 132.266 133.436 1.00 54.56  ? 1056 ILE A CG1 1 
ATOM   6862 C  CG2 . ILE A 1 1077 ? 115.055 131.824 131.013 1.00 54.56  ? 1056 ILE A CG2 1 
ATOM   6863 C  CD1 . ILE A 1 1077 ? 114.699 131.115 133.957 1.00 54.56  ? 1056 ILE A CD1 1 
ATOM   6864 N  N   . VAL A 1 1078 ? 114.437 135.201 130.032 1.00 43.97  ? 1057 VAL A N   1 
ATOM   6865 C  CA  . VAL A 1 1078 ? 114.164 135.669 128.682 1.00 43.97  ? 1057 VAL A CA  1 
ATOM   6866 C  C   . VAL A 1 1078 ? 115.106 136.800 128.293 1.00 43.97  ? 1057 VAL A C   1 
ATOM   6867 O  O   . VAL A 1 1078 ? 115.493 136.915 127.126 1.00 43.97  ? 1057 VAL A O   1 
ATOM   6868 C  CB  . VAL A 1 1078 ? 112.683 136.064 128.600 1.00 43.97  ? 1057 VAL A CB  1 
ATOM   6869 C  CG1 . VAL A 1 1078 ? 112.330 136.727 127.291 1.00 43.97  ? 1057 VAL A CG1 1 
ATOM   6870 C  CG2 . VAL A 1 1078 ? 111.853 134.824 128.776 1.00 43.97  ? 1057 VAL A CG2 1 
ATOM   6871 N  N   . MET A 1 1079 ? 115.539 137.612 129.252 1.00 50.00  ? 1058 MET A N   1 
ATOM   6872 C  CA  . MET A 1 1079 ? 116.460 138.696 128.926 1.00 50.00  ? 1058 MET A CA  1 
ATOM   6873 C  C   . MET A 1 1079 ? 117.848 138.164 128.585 1.00 50.00  ? 1058 MET A C   1 
ATOM   6874 O  O   . MET A 1 1079 ? 118.461 138.605 127.605 1.00 50.00  ? 1058 MET A O   1 
ATOM   6875 C  CB  . MET A 1 1079 ? 116.520 139.687 130.085 1.00 50.00  ? 1058 MET A CB  1 
ATOM   6876 C  CG  . MET A 1 1079 ? 117.350 140.919 129.825 1.00 50.00  ? 1058 MET A CG  1 
ATOM   6877 S  SD  . MET A 1 1079 ? 117.225 142.084 131.191 1.00 50.00  ? 1058 MET A SD  1 
ATOM   6878 C  CE  . MET A 1 1079 ? 118.379 143.348 130.678 1.00 50.00  ? 1058 MET A CE  1 
ATOM   6879 N  N   . VAL A 1 1080 ? 118.344 137.194 129.354 1.00 42.18  ? 1059 VAL A N   1 
ATOM   6880 C  CA  . VAL A 1 1080 ? 119.665 136.638 129.071 1.00 42.18  ? 1059 VAL A CA  1 
ATOM   6881 C  C   . VAL A 1 1080 ? 119.624 135.735 127.837 1.00 42.18  ? 1059 VAL A C   1 
ATOM   6882 O  O   . VAL A 1 1080 ? 120.608 135.638 127.094 1.00 42.18  ? 1059 VAL A O   1 
ATOM   6883 C  CB  . VAL A 1 1080 ? 120.183 135.927 130.332 1.00 42.18  ? 1059 VAL A CB  1 
ATOM   6884 C  CG1 . VAL A 1 1080 ? 121.542 135.308 130.123 1.00 42.18  ? 1059 VAL A CG1 1 
ATOM   6885 C  CG2 . VAL A 1 1080 ? 120.277 136.927 131.428 1.00 42.18  ? 1059 VAL A CG2 1 
ATOM   6886 N  N   . LEU A 1 1081 ? 118.480 135.098 127.570 1.00 40.00  ? 1060 LEU A N   1 
ATOM   6887 C  CA  . LEU A 1 1081 ? 118.278 134.438 126.282 1.00 40.00  ? 1060 LEU A CA  1 
ATOM   6888 C  C   . LEU A 1 1081 ? 118.305 135.422 125.124 1.00 40.00  ? 1060 LEU A C   1 
ATOM   6889 O  O   . LEU A 1 1081 ? 118.902 135.139 124.081 1.00 40.00  ? 1060 LEU A O   1 
ATOM   6890 C  CB  . LEU A 1 1081 ? 116.949 133.696 126.265 1.00 40.00  ? 1060 LEU A CB  1 
ATOM   6891 C  CG  . LEU A 1 1081 ? 116.844 132.307 126.842 1.00 40.00  ? 1060 LEU A CG  1 
ATOM   6892 C  CD1 . LEU A 1 1081 ? 115.395 131.929 126.946 1.00 40.00  ? 1060 LEU A CD1 1 
ATOM   6893 C  CD2 . LEU A 1 1081 ? 117.513 131.436 125.851 1.00 40.00  ? 1060 LEU A CD2 1 
ATOM   6894 N  N   . ALA A 1 1082 ? 117.631 136.562 125.275 1.00 46.21  ? 1061 ALA A N   1 
ATOM   6895 C  CA  . ALA A 1 1082 ? 117.498 137.508 124.175 1.00 46.21  ? 1061 ALA A CA  1 
ATOM   6896 C  C   . ALA A 1 1082 ? 118.842 138.122 123.824 1.00 46.21  ? 1061 ALA A C   1 
ATOM   6897 O  O   . ALA A 1 1082 ? 119.271 138.078 122.663 1.00 46.21  ? 1061 ALA A O   1 
ATOM   6898 C  CB  . ALA A 1 1082 ? 116.488 138.593 124.535 1.00 46.21  ? 1061 ALA A CB  1 
ATOM   6899 N  N   . LEU A 1 1083 ? 119.546 138.648 124.828 1.00 56.30  ? 1062 LEU A N   1 
ATOM   6900 C  CA  . LEU A 1 1083 ? 120.867 139.205 124.571 1.00 56.30  ? 1062 LEU A CA  1 
ATOM   6901 C  C   . LEU A 1 1083 ? 121.860 138.111 124.203 1.00 56.30  ? 1062 LEU A C   1 
ATOM   6902 O  O   . LEU A 1 1083 ? 122.811 138.366 123.458 1.00 56.30  ? 1062 LEU A O   1 
ATOM   6903 C  CB  . LEU A 1 1083 ? 121.361 139.995 125.785 1.00 56.30  ? 1062 LEU A CB  1 
ATOM   6904 C  CG  . LEU A 1 1083 ? 120.840 141.427 125.982 1.00 56.30  ? 1062 LEU A CG  1 
ATOM   6905 C  CD1 . LEU A 1 1083 ? 121.052 142.235 124.723 1.00 56.30  ? 1062 LEU A CD1 1 
ATOM   6906 C  CD2 . LEU A 1 1083 ? 119.395 141.545 126.445 1.00 56.30  ? 1062 LEU A CD2 1 
ATOM   6907 N  N   . MET A 1 1084 ? 121.617 136.889 124.677 1.00 68.89  ? 1063 MET A N   1 
ATOM   6908 C  CA  . MET A 1 1084 ? 122.442 135.739 124.325 1.00 68.89  ? 1063 MET A CA  1 
ATOM   6909 C  C   . MET A 1 1084 ? 122.391 135.440 122.832 1.00 68.89  ? 1063 MET A C   1 
ATOM   6910 O  O   . MET A 1 1084 ? 123.432 135.297 122.176 1.00 68.89  ? 1063 MET A O   1 
ATOM   6911 C  CB  . MET A 1 1084 ? 121.970 134.533 125.132 1.00 68.89  ? 1063 MET A CB  1 
ATOM   6912 C  CG  . MET A 1 1084 ? 122.739 133.285 124.876 1.00 68.89  ? 1063 MET A CG  1 
ATOM   6913 S  SD  . MET A 1 1084 ? 124.429 133.420 125.435 1.00 68.89  ? 1063 MET A SD  1 
ATOM   6914 C  CE  . MET A 1 1084 ? 125.156 132.288 124.269 1.00 68.89  ? 1063 MET A CE  1 
ATOM   6915 N  N   . THR A 1 1085 ? 121.184 135.365 122.266 1.00 58.42  ? 1064 THR A N   1 
ATOM   6916 C  CA  . THR A 1 1085 ? 121.062 135.046 120.848 1.00 58.42  ? 1064 THR A CA  1 
ATOM   6917 C  C   . THR A 1 1085 ? 121.370 136.230 119.950 1.00 58.42  ? 1064 THR A C   1 
ATOM   6918 O  O   . THR A 1 1085 ? 121.772 136.025 118.800 1.00 58.42  ? 1064 THR A O   1 
ATOM   6919 C  CB  . THR A 1 1085 ? 119.666 134.540 120.530 1.00 58.42  ? 1064 THR A CB  1 
ATOM   6920 O  OG1 . THR A 1 1085 ? 118.713 135.572 120.803 1.00 58.42  ? 1064 THR A OG1 1 
ATOM   6921 C  CG2 . THR A 1 1085 ? 119.374 133.350 121.382 1.00 58.42  ? 1064 THR A CG2 1 
ATOM   6922 N  N   . VAL A 1 1086 ? 121.167 137.460 120.433 1.00 53.86  ? 1065 VAL A N   1 
ATOM   6923 C  CA  . VAL A 1 1086 ? 121.625 138.620 119.672 1.00 53.86  ? 1065 VAL A CA  1 
ATOM   6924 C  C   . VAL A 1 1086 ? 123.145 138.620 119.568 1.00 53.86  ? 1065 VAL A C   1 
ATOM   6925 O  O   . VAL A 1 1086 ? 123.710 138.872 118.494 1.00 53.86  ? 1065 VAL A O   1 
ATOM   6926 C  CB  . VAL A 1 1086 ? 121.080 139.912 120.300 1.00 53.86  ? 1065 VAL A CB  1 
ATOM   6927 C  CG1 . VAL A 1 1086 ? 121.750 141.124 119.714 1.00 53.86  ? 1065 VAL A CG1 1 
ATOM   6928 C  CG2 . VAL A 1 1086 ? 119.599 140.001 120.028 1.00 53.86  ? 1065 VAL A CG2 1 
ATOM   6929 N  N   . GLU A 1 1087 ? 123.828 138.264 120.654 1.00 66.32  ? 1066 GLU A N   1 
ATOM   6930 C  CA  . GLU A 1 1087 ? 125.279 138.162 120.589 1.00 66.32  ? 1066 GLU A CA  1 
ATOM   6931 C  C   . GLU A 1 1087 ? 125.735 136.986 119.735 1.00 66.32  ? 1066 GLU A C   1 
ATOM   6932 O  O   . GLU A 1 1087 ? 126.779 137.076 119.078 1.00 66.32  ? 1066 GLU A O   1 
ATOM   6933 C  CB  . GLU A 1 1087 ? 125.850 138.087 122.001 1.00 66.32  ? 1066 GLU A CB  1 
ATOM   6934 C  CG  . GLU A 1 1087 ? 125.749 139.426 122.720 1.00 66.32  ? 1066 GLU A CG  1 
ATOM   6935 C  CD  . GLU A 1 1087 ? 125.966 139.341 124.216 1.00 66.32  ? 1066 GLU A CD  1 
ATOM   6936 O  OE1 . GLU A 1 1087 ? 126.096 138.219 124.749 1.00 66.32  ? 1066 GLU A OE1 1 
ATOM   6937 O  OE2 . GLU A 1 1087 ? 125.985 140.407 124.864 1.00 66.32  ? 1066 GLU A OE2 1 
ATOM   6938 N  N   . LEU A 1 1088 ? 124.957 135.900 119.689 1.00 49.87  ? 1067 LEU A N   1 
ATOM   6939 C  CA  . LEU A 1 1088 ? 125.355 134.762 118.861 1.00 49.87  ? 1067 LEU A CA  1 
ATOM   6940 C  C   . LEU A 1 1088 ? 125.159 135.064 117.382 1.00 49.87  ? 1067 LEU A C   1 
ATOM   6941 O  O   . LEU A 1 1088 ? 125.996 134.694 116.553 1.00 49.87  ? 1067 LEU A O   1 
ATOM   6942 C  CB  . LEU A 1 1088 ? 124.573 133.513 119.274 1.00 49.87  ? 1067 LEU A CB  1 
ATOM   6943 C  CG  . LEU A 1 1088 ? 125.030 132.106 118.858 1.00 49.87  ? 1067 LEU A CG  1 
ATOM   6944 C  CD1 . LEU A 1 1088 ? 124.579 131.649 117.490 1.00 49.87  ? 1067 LEU A CD1 1 
ATOM   6945 C  CD2 . LEU A 1 1088 ? 126.529 132.043 118.933 1.00 49.87  ? 1067 LEU A CD2 1 
ATOM   6946 N  N   . PHE A 1 1089 ? 124.061 135.734 117.037 1.00 55.49  ? 1068 PHE A N   1 
ATOM   6947 C  CA  . PHE A 1 1089 ? 123.804 136.110 115.651 1.00 55.49  ? 1068 PHE A CA  1 
ATOM   6948 C  C   . PHE A 1 1089 ? 124.798 137.151 115.158 1.00 55.49  ? 1068 PHE A C   1 
ATOM   6949 O  O   . PHE A 1 1089 ? 125.277 137.069 114.021 1.00 55.49  ? 1068 PHE A O   1 
ATOM   6950 C  CB  . PHE A 1 1089 ? 122.367 136.611 115.541 1.00 55.49  ? 1068 PHE A CB  1 
ATOM   6951 C  CG  . PHE A 1 1089 ? 122.033 137.238 114.234 1.00 55.49  ? 1068 PHE A CG  1 
ATOM   6952 C  CD1 . PHE A 1 1089 ? 121.975 136.486 113.082 1.00 55.49  ? 1068 PHE A CD1 1 
ATOM   6953 C  CD2 . PHE A 1 1089 ? 121.707 138.578 114.171 1.00 55.49  ? 1068 PHE A CD2 1 
ATOM   6954 C  CE1 . PHE A 1 1089 ? 121.648 137.069 111.883 1.00 55.49  ? 1068 PHE A CE1 1 
ATOM   6955 C  CE2 . PHE A 1 1089 ? 121.373 139.166 112.973 1.00 55.49  ? 1068 PHE A CE2 1 
ATOM   6956 C  CZ  . PHE A 1 1089 ? 121.346 138.408 111.828 1.00 55.49  ? 1068 PHE A CZ  1 
ATOM   6957 N  N   . GLY A 1 1090 ? 125.145 138.121 116.004 1.00 65.18  ? 1069 GLY A N   1 
ATOM   6958 C  CA  . GLY A 1 1090 ? 126.085 139.146 115.579 1.00 65.18  ? 1069 GLY A CA  1 
ATOM   6959 C  C   . GLY A 1 1090 ? 127.514 138.647 115.478 1.00 65.18  ? 1069 GLY A C   1 
ATOM   6960 O  O   . GLY A 1 1090 ? 128.214 138.943 114.508 1.00 65.18  ? 1069 GLY A O   1 
ATOM   6961 N  N   . MET A 1 1091 ? 127.964 137.879 116.469 1.00 76.03  ? 1070 MET A N   1 
ATOM   6962 C  CA  . MET A 1 1091 ? 129.315 137.334 116.406 1.00 76.03  ? 1070 MET A CA  1 
ATOM   6963 C  C   . MET A 1 1091 ? 129.427 136.255 115.333 1.00 76.03  ? 1070 MET A C   1 
ATOM   6964 O  O   . MET A 1 1091 ? 130.502 136.073 114.745 1.00 76.03  ? 1070 MET A O   1 
ATOM   6965 C  CB  . MET A 1 1091 ? 129.702 136.845 117.797 1.00 76.03  ? 1070 MET A CB  1 
ATOM   6966 C  CG  . MET A 1 1091 ? 131.040 136.176 117.973 1.00 76.03  ? 1070 MET A CG  1 
ATOM   6967 S  SD  . MET A 1 1091 ? 130.786 134.407 117.826 1.00 76.03  ? 1070 MET A SD  1 
ATOM   6968 C  CE  . MET A 1 1091 ? 129.592 134.228 119.144 1.00 76.03  ? 1070 MET A CE  1 
ATOM   6969 N  N   . MET A 1 1092 ? 128.318 135.571 115.033 1.00 77.67  ? 1071 MET A N   1 
ATOM   6970 C  CA  . MET A 1 1092 ? 128.190 134.852 113.766 1.00 77.67  ? 1071 MET A CA  1 
ATOM   6971 C  C   . MET A 1 1092 ? 128.390 135.790 112.583 1.00 77.67  ? 1071 MET A C   1 
ATOM   6972 O  O   . MET A 1 1092 ? 128.921 135.386 111.541 1.00 77.67  ? 1071 MET A O   1 
ATOM   6973 C  CB  . MET A 1 1092 ? 126.815 134.190 113.687 1.00 77.67  ? 1071 MET A CB  1 
ATOM   6974 C  CG  . MET A 1 1092 ? 126.567 133.370 112.444 1.00 77.67  ? 1071 MET A CG  1 
ATOM   6975 S  SD  . MET A 1 1092 ? 124.869 132.802 112.413 1.00 77.67  ? 1071 MET A SD  1 
ATOM   6976 C  CE  . MET A 1 1092 ? 124.907 131.576 113.707 1.00 77.67  ? 1071 MET A CE  1 
ATOM   6977 N  N   . GLY A 1 1093 ? 127.967 137.047 112.728 1.00 78.66  ? 1072 GLY A N   1 
ATOM   6978 C  CA  . GLY A 1 1093 ? 128.334 138.060 111.755 1.00 78.66  ? 1072 GLY A CA  1 
ATOM   6979 C  C   . GLY A 1 1093 ? 129.833 138.268 111.638 1.00 78.66  ? 1072 GLY A C   1 
ATOM   6980 O  O   . GLY A 1 1093 ? 130.385 138.231 110.536 1.00 78.66  ? 1072 GLY A O   1 
ATOM   6981 N  N   . LEU A 1 1094 ? 130.519 138.476 112.770 1.00 65.14  ? 1073 LEU A N   1 
ATOM   6982 C  CA  . LEU A 1 1094 ? 131.920 138.891 112.699 1.00 65.14  ? 1073 LEU A CA  1 
ATOM   6983 C  C   . LEU A 1 1094 ? 132.846 137.769 112.260 1.00 65.14  ? 1073 LEU A C   1 
ATOM   6984 O  O   . LEU A 1 1094 ? 133.855 138.038 111.606 1.00 65.14  ? 1073 LEU A O   1 
ATOM   6985 C  CB  . LEU A 1 1094 ? 132.402 139.448 114.032 1.00 65.14  ? 1073 LEU A CB  1 
ATOM   6986 C  CG  . LEU A 1 1094 ? 131.849 140.818 114.391 1.00 65.14  ? 1073 LEU A CG  1 
ATOM   6987 C  CD1 . LEU A 1 1094 ? 132.347 141.256 115.739 1.00 65.14  ? 1073 LEU A CD1 1 
ATOM   6988 C  CD2 . LEU A 1 1094 ? 132.216 141.834 113.347 1.00 65.14  ? 1073 LEU A CD2 1 
ATOM   6989 N  N   . ILE A 1 1095 ? 132.549 136.519 112.609 1.00 70.42  ? 1074 ILE A N   1 
ATOM   6990 C  CA  . ILE A 1 1095 ? 133.332 135.433 112.025 1.00 70.42  ? 1074 ILE A CA  1 
ATOM   6991 C  C   . ILE A 1 1095 ? 132.988 135.272 110.542 1.00 70.42  ? 1074 ILE A C   1 
ATOM   6992 O  O   . ILE A 1 1095 ? 133.870 135.031 109.709 1.00 70.42  ? 1074 ILE A O   1 
ATOM   6993 C  CB  . ILE A 1 1095 ? 133.155 134.137 112.849 1.00 70.42  ? 1074 ILE A CB  1 
ATOM   6994 C  CG1 . ILE A 1 1095 ? 134.076 134.163 114.075 1.00 70.42  ? 1074 ILE A CG1 1 
ATOM   6995 C  CG2 . ILE A 1 1095 ? 133.411 132.874 112.040 1.00 70.42  ? 1074 ILE A CG2 1 
ATOM   6996 C  CD1 . ILE A 1 1095 ? 133.496 134.783 115.325 1.00 70.42  ? 1074 ILE A CD1 1 
ATOM   6997 N  N   . GLY A 1 1096 ? 131.728 135.486 110.177 1.00 71.15  ? 1075 GLY A N   1 
ATOM   6998 C  CA  . GLY A 1 1096 ? 131.327 135.482 108.786 1.00 71.15  ? 1075 GLY A CA  1 
ATOM   6999 C  C   . GLY A 1 1096 ? 130.462 134.321 108.348 1.00 71.15  ? 1075 GLY A C   1 
ATOM   7000 O  O   . GLY A 1 1096 ? 130.190 134.197 107.149 1.00 71.15  ? 1075 GLY A O   1 
ATOM   7001 N  N   . ILE A 1 1097 ? 130.038 133.459 109.269 1.00 88.39  ? 1076 ILE A N   1 
ATOM   7002 C  CA  . ILE A 1 1097 ? 129.123 132.376 108.938 1.00 88.39  ? 1076 ILE A CA  1 
ATOM   7003 C  C   . ILE A 1 1097 ? 127.770 132.981 108.596 1.00 88.39  ? 1076 ILE A C   1 
ATOM   7004 O  O   . ILE A 1 1097 ? 127.344 133.960 109.220 1.00 88.39  ? 1076 ILE A O   1 
ATOM   7005 C  CB  . ILE A 1 1097 ? 129.036 131.405 110.126 1.00 88.39  ? 1076 ILE A CB  1 
ATOM   7006 C  CG1 . ILE A 1 1097 ? 130.438 131.000 110.561 1.00 88.39  ? 1076 ILE A CG1 1 
ATOM   7007 C  CG2 . ILE A 1 1097 ? 128.248 130.165 109.768 1.00 88.39  ? 1076 ILE A CG2 1 
ATOM   7008 C  CD1 . ILE A 1 1097 ? 131.226 130.328 109.471 1.00 88.39  ? 1076 ILE A CD1 1 
ATOM   7009 N  N   . LYS A 1 1098 ? 127.210 132.527 107.483 1.00 68.59  ? 1077 LYS A N   1 
ATOM   7010 C  CA  . LYS A 1 1098 ? 125.996 133.110 106.924 1.00 68.59  ? 1077 LYS A CA  1 
ATOM   7011 C  C   . LYS A 1 1098 ? 124.735 132.292 107.027 1.00 68.59  ? 1077 LYS A C   1 
ATOM   7012 O  O   . LYS A 1 1098 ? 124.776 131.079 107.204 1.00 68.59  ? 1077 LYS A O   1 
ATOM   7013 C  CB  . LYS A 1 1098 ? 126.231 133.468 105.456 1.00 68.59  ? 1077 LYS A CB  1 
ATOM   7014 C  CG  . LYS A 1 1098 ? 127.591 133.047 104.925 1.00 68.59  ? 1077 LYS A CG  1 
ATOM   7015 C  CD  . LYS A 1 1098 ? 128.601 134.170 105.069 1.00 68.59  ? 1077 LYS A CD  1 
ATOM   7016 C  CE  . LYS A 1 1098 ? 128.984 134.729 103.712 1.00 68.59  ? 1077 LYS A CE  1 
ATOM   7017 N  NZ  . LYS A 1 1098 ? 128.712 133.738 102.637 1.00 68.59  ? 1077 LYS A NZ  1 
ATOM   7018 N  N   . LEU A 1 1099 ? 123.606 132.974 106.887 1.00 75.36  ? 1078 LEU A N   1 
ATOM   7019 C  CA  . LEU A 1 1099 ? 122.326 132.309 106.982 1.00 75.36  ? 1078 LEU A CA  1 
ATOM   7020 C  C   . LEU A 1 1099 ? 121.989 131.693 105.640 1.00 75.36  ? 1078 LEU A C   1 
ATOM   7021 O  O   . LEU A 1 1099 ? 121.498 132.351 104.729 1.00 75.36  ? 1078 LEU A O   1 
ATOM   7022 C  CB  . LEU A 1 1099 ? 121.242 133.307 107.381 1.00 75.36  ? 1078 LEU A CB  1 
ATOM   7023 C  CG  . LEU A 1 1099 ? 121.739 134.712 107.711 1.00 75.36  ? 1078 LEU A CG  1 
ATOM   7024 C  CD1 . LEU A 1 1099 ? 122.742 134.661 108.850 1.00 75.36  ? 1078 LEU A CD1 1 
ATOM   7025 C  CD2 . LEU A 1 1099 ? 122.354 135.363 106.485 1.00 75.36  ? 1078 LEU A CD2 1 
ATOM   7026 N  N   . SER A 1 1100 ? 122.274 130.405 105.545 1.00 65.77  ? 1079 SER A N   1 
ATOM   7027 C  CA  . SER A 1 1100 ? 122.018 129.611 104.358 1.00 65.77  ? 1079 SER A CA  1 
ATOM   7028 C  C   . SER A 1 1100 ? 121.006 128.530 104.700 1.00 65.77  ? 1079 SER A C   1 
ATOM   7029 O  O   . SER A 1 1100 ? 121.051 127.446 104.117 1.00 65.77  ? 1079 SER A O   1 
ATOM   7030 C  CB  . SER A 1 1100 ? 123.313 128.975 103.855 1.00 65.77  ? 1079 SER A CB  1 
ATOM   7031 O  OG  . SER A 1 1100 ? 124.200 128.710 104.928 1.00 65.77  ? 1079 SER A OG  1 
ATOM   7032 N  N   . ALA A 1 1101 ? 120.176 128.827 105.705 1.00 57.72  ? 1080 ALA A N   1 
ATOM   7033 C  CA  . ALA A 1 1101 ? 119.133 127.969 106.285 1.00 57.72  ? 1080 ALA A CA  1 
ATOM   7034 C  C   . ALA A 1 1101 ? 119.732 126.842 107.116 1.00 57.72  ? 1080 ALA A C   1 
ATOM   7035 O  O   . ALA A 1 1101 ? 119.068 125.859 107.428 1.00 57.72  ? 1080 ALA A O   1 
ATOM   7036 C  CB  . ALA A 1 1101 ? 118.080 127.483 105.288 1.00 57.72  ? 1080 ALA A CB  1 
ATOM   7037 N  N   . VAL A 1 1102 ? 121.010 127.001 107.448 1.00 55.67  ? 1081 VAL A N   1 
ATOM   7038 C  CA  . VAL A 1 1102 ? 121.720 126.090 108.328 1.00 55.67  ? 1081 VAL A CA  1 
ATOM   7039 C  C   . VAL A 1 1102 ? 122.090 126.837 109.612 1.00 55.67  ? 1081 VAL A C   1 
ATOM   7040 O  O   . VAL A 1 1102 ? 121.906 126.262 110.693 1.00 55.67  ? 1081 VAL A O   1 
ATOM   7041 C  CB  . VAL A 1 1102 ? 122.914 125.447 107.610 1.00 55.67  ? 1081 VAL A CB  1 
ATOM   7042 C  CG1 . VAL A 1 1102 ? 123.643 124.531 108.535 1.00 55.67  ? 1081 VAL A CG1 1 
ATOM   7043 C  CG2 . VAL A 1 1102 ? 122.417 124.701 106.404 1.00 55.67  ? 1081 VAL A CG2 1 
ATOM   7044 N  N   . PRO A 1 1103 ? 122.563 128.101 109.600 1.00 66.74  ? 1082 PRO A N   1 
ATOM   7045 C  CA  . PRO A 1 1103 ? 122.655 128.811 110.880 1.00 66.74  ? 1082 PRO A CA  1 
ATOM   7046 C  C   . PRO A 1 1103 ? 121.321 129.222 111.464 1.00 66.74  ? 1082 PRO A C   1 
ATOM   7047 O  O   . PRO A 1 1103 ? 121.288 129.556 112.650 1.00 66.74  ? 1082 PRO A O   1 
ATOM   7048 C  CB  . PRO A 1 1103 ? 123.503 130.041 110.546 1.00 66.74  ? 1082 PRO A CB  1 
ATOM   7049 C  CG  . PRO A 1 1103 ? 124.260 129.674 109.406 1.00 66.74  ? 1082 PRO A CG  1 
ATOM   7050 C  CD  . PRO A 1 1103 ? 123.335 128.861 108.590 1.00 66.74  ? 1082 PRO A CD  1 
ATOM   7051 N  N   . VAL A 1 1104 ? 120.229 129.220 110.704 1.00 46.09  ? 1083 VAL A N   1 
ATOM   7052 C  CA  . VAL A 1 1104 ? 118.954 129.635 111.282 1.00 46.09  ? 1083 VAL A CA  1 
ATOM   7053 C  C   . VAL A 1 1104 ? 118.424 128.567 112.234 1.00 46.09  ? 1083 VAL A C   1 
ATOM   7054 O  O   . VAL A 1 1104 ? 117.969 128.875 113.349 1.00 46.09  ? 1083 VAL A O   1 
ATOM   7055 C  CB  . VAL A 1 1104 ? 117.955 129.973 110.165 1.00 46.09  ? 1083 VAL A CB  1 
ATOM   7056 C  CG1 . VAL A 1 1104 ? 116.583 130.217 110.730 1.00 46.09  ? 1083 VAL A CG1 1 
ATOM   7057 C  CG2 . VAL A 1 1104 ? 118.423 131.202 109.434 1.00 46.09  ? 1083 VAL A CG2 1 
ATOM   7058 N  N   . VAL A 1 1105 ? 118.524 127.296 111.829 1.00 54.82  ? 1084 VAL A N   1 
ATOM   7059 C  CA  . VAL A 1 1105 ? 118.112 126.180 112.677 1.00 54.82  ? 1084 VAL A CA  1 
ATOM   7060 C  C   . VAL A 1 1105 ? 118.952 126.137 113.946 1.00 54.82  ? 1084 VAL A C   1 
ATOM   7061 O  O   . VAL A 1 1105 ? 118.442 125.885 115.043 1.00 54.82  ? 1084 VAL A O   1 
ATOM   7062 C  CB  . VAL A 1 1105 ? 118.204 124.864 111.883 1.00 54.82  ? 1084 VAL A CB  1 
ATOM   7063 C  CG1 . VAL A 1 1105 ? 117.846 123.674 112.745 1.00 54.82  ? 1084 VAL A CG1 1 
ATOM   7064 C  CG2 . VAL A 1 1105 ? 117.291 124.925 110.691 1.00 54.82  ? 1084 VAL A CG2 1 
ATOM   7065 N  N   . ILE A 1 1106 ? 120.236 126.465 113.828 1.00 50.77  ? 1085 ILE A N   1 
ATOM   7066 C  CA  . ILE A 1 1106 ? 121.100 126.494 114.997 1.00 50.77  ? 1085 ILE A CA  1 
ATOM   7067 C  C   . ILE A 1 1106 ? 120.910 127.778 115.811 1.00 50.77  ? 1085 ILE A C   1 
ATOM   7068 O  O   . ILE A 1 1106 ? 121.276 127.823 116.988 1.00 50.77  ? 1085 ILE A O   1 
ATOM   7069 C  CB  . ILE A 1 1106 ? 122.537 126.251 114.509 1.00 50.77  ? 1085 ILE A CB  1 
ATOM   7070 C  CG1 . ILE A 1 1106 ? 122.571 124.969 113.685 1.00 50.77  ? 1085 ILE A CG1 1 
ATOM   7071 C  CG2 . ILE A 1 1106 ? 123.478 126.020 115.640 1.00 50.77  ? 1085 ILE A CG2 1 
ATOM   7072 C  CD1 . ILE A 1 1106 ? 122.151 123.734 114.459 1.00 50.77  ? 1085 ILE A CD1 1 
ATOM   7073 N  N   . LEU A 1 1107 ? 120.301 128.816 115.246 1.00 41.13  ? 1086 LEU A N   1 
ATOM   7074 C  CA  . LEU A 1 1107 ? 119.893 129.932 116.091 1.00 41.13  ? 1086 LEU A CA  1 
ATOM   7075 C  C   . LEU A 1 1107 ? 118.674 129.579 116.933 1.00 41.13  ? 1086 LEU A C   1 
ATOM   7076 O  O   . LEU A 1 1107 ? 118.589 129.973 118.102 1.00 41.13  ? 1086 LEU A O   1 
ATOM   7077 C  CB  . LEU A 1 1107 ? 119.618 131.167 115.243 1.00 41.13  ? 1086 LEU A CB  1 
ATOM   7078 C  CG  . LEU A 1 1107 ? 120.838 131.953 114.781 1.00 41.13  ? 1086 LEU A CG  1 
ATOM   7079 C  CD1 . LEU A 1 1107 ? 120.482 132.896 113.667 1.00 41.13  ? 1086 LEU A CD1 1 
ATOM   7080 C  CD2 . LEU A 1 1107 ? 121.339 132.740 115.950 1.00 41.13  ? 1086 LEU A CD2 1 
ATOM   7081 N  N   . ILE A 1 1108 ? 117.722 128.837 116.364 1.00 47.25  ? 1087 ILE A N   1 
ATOM   7082 C  CA  . ILE A 1 1108 ? 116.534 128.482 117.138 1.00 47.25  ? 1087 ILE A CA  1 
ATOM   7083 C  C   . ILE A 1 1108 ? 116.876 127.432 118.189 1.00 47.25  ? 1087 ILE A C   1 
ATOM   7084 O  O   . ILE A 1 1108 ? 116.481 127.538 119.365 1.00 47.25  ? 1087 ILE A O   1 
ATOM   7085 C  CB  . ILE A 1 1108 ? 115.424 128.004 116.194 1.00 47.25  ? 1087 ILE A CB  1 
ATOM   7086 C  CG1 . ILE A 1 1108 ? 115.215 129.023 115.074 1.00 47.25  ? 1087 ILE A CG1 1 
ATOM   7087 C  CG2 . ILE A 1 1108 ? 114.143 127.820 116.958 1.00 47.25  ? 1087 ILE A CG2 1 
ATOM   7088 C  CD1 . ILE A 1 1108 ? 114.820 130.391 115.543 1.00 47.25  ? 1087 ILE A CD1 1 
ATOM   7089 N  N   . ALA A 1 1109 ? 117.656 126.426 117.793 1.00 41.12  ? 1088 ALA A N   1 
ATOM   7090 C  CA  . ALA A 1 1109 ? 118.215 125.484 118.754 1.00 41.12  ? 1088 ALA A CA  1 
ATOM   7091 C  C   . ALA A 1 1109 ? 119.152 126.170 119.736 1.00 41.12  ? 1088 ALA A C   1 
ATOM   7092 O  O   . ALA A 1 1109 ? 119.313 125.704 120.864 1.00 41.12  ? 1088 ALA A O   1 
ATOM   7093 C  CB  . ALA A 1 1109 ? 118.953 124.376 118.010 1.00 41.12  ? 1088 ALA A CB  1 
ATOM   7094 N  N   . SER A 1 1110 ? 119.772 127.276 119.324 1.00 44.64  ? 1089 SER A N   1 
ATOM   7095 C  CA  . SER A 1 1110 ? 120.612 128.064 120.215 1.00 44.64  ? 1089 SER A CA  1 
ATOM   7096 C  C   . SER A 1 1110 ? 119.804 128.744 121.304 1.00 44.64  ? 1089 SER A C   1 
ATOM   7097 O  O   . SER A 1 1110 ? 120.305 128.910 122.424 1.00 44.64  ? 1089 SER A O   1 
ATOM   7098 C  CB  . SER A 1 1110 ? 121.383 129.105 119.413 1.00 44.64  ? 1089 SER A CB  1 
ATOM   7099 O  OG  . SER A 1 1110 ? 121.977 130.066 120.257 1.00 44.64  ? 1089 SER A OG  1 
ATOM   7100 N  N   . VAL A 1 1111 ? 118.573 129.165 120.998 1.00 43.96  ? 1090 VAL A N   1 
ATOM   7101 C  CA  . VAL A 1 1111 ? 117.672 129.596 122.065 1.00 43.96  ? 1090 VAL A CA  1 
ATOM   7102 C  C   . VAL A 1 1111 ? 117.392 128.433 123.001 1.00 43.96  ? 1090 VAL A C   1 
ATOM   7103 O  O   . VAL A 1 1111 ? 117.527 128.553 124.229 1.00 43.96  ? 1090 VAL A O   1 
ATOM   7104 C  CB  . VAL A 1 1111 ? 116.354 130.146 121.498 1.00 43.96  ? 1090 VAL A CB  1 
ATOM   7105 C  CG1 . VAL A 1 1111 ? 115.508 130.653 122.631 1.00 43.96  ? 1090 VAL A CG1 1 
ATOM   7106 C  CG2 . VAL A 1 1111 ? 116.576 131.218 120.473 1.00 43.96  ? 1090 VAL A CG2 1 
ATOM   7107 N  N   . GLY A 1 1112 ? 117.040 127.277 122.417 1.00 45.42  ? 1091 GLY A N   1 
ATOM   7108 C  CA  . GLY A 1 1112 ? 116.631 126.130 123.221 1.00 45.42  ? 1091 GLY A CA  1 
ATOM   7109 C  C   . GLY A 1 1112 ? 117.705 125.618 124.166 1.00 45.42  ? 1091 GLY A C   1 
ATOM   7110 O  O   . GLY A 1 1112 ? 117.425 125.308 125.324 1.00 45.42  ? 1091 GLY A O   1 
ATOM   7111 N  N   . ILE A 1 1113 ? 118.950 125.567 123.703 1.00 36.89  ? 1092 ILE A N   1 
ATOM   7112 C  CA  . ILE A 1 1113 ? 120.048 125.212 124.592 1.00 36.89  ? 1092 ILE A CA  1 
ATOM   7113 C  C   . ILE A 1 1113 ? 120.385 126.385 125.507 1.00 36.89  ? 1092 ILE A C   1 
ATOM   7114 O  O   . ILE A 1 1113 ? 120.874 126.192 126.626 1.00 36.89  ? 1092 ILE A O   1 
ATOM   7115 C  CB  . ILE A 1 1113 ? 121.253 124.747 123.757 1.00 36.89  ? 1092 ILE A CB  1 
ATOM   7116 C  CG1 . ILE A 1 1113 ? 120.825 123.613 122.839 1.00 36.89  ? 1092 ILE A CG1 1 
ATOM   7117 C  CG2 . ILE A 1 1113 ? 122.384 124.225 124.616 1.00 36.89  ? 1092 ILE A CG2 1 
ATOM   7118 C  CD1 . ILE A 1 1113 ? 120.245 122.437 123.572 1.00 36.89  ? 1092 ILE A CD1 1 
ATOM   7119 N  N   . GLY A 1 1114 ? 120.084 127.613 125.085 1.00 43.86  ? 1093 GLY A N   1 
ATOM   7120 C  CA  . GLY A 1 1114 ? 120.362 128.753 125.937 1.00 43.86  ? 1093 GLY A CA  1 
ATOM   7121 C  C   . GLY A 1 1114 ? 119.471 128.867 127.154 1.00 43.86  ? 1093 GLY A C   1 
ATOM   7122 O  O   . GLY A 1 1114 ? 119.815 129.601 128.082 1.00 43.86  ? 1093 GLY A O   1 
ATOM   7123 N  N   . VAL A 1 1115 ? 118.325 128.175 127.163 1.00 48.90  ? 1094 VAL A N   1 
ATOM   7124 C  CA  . VAL A 1 1115 ? 117.402 128.264 128.304 1.00 48.90  ? 1094 VAL A CA  1 
ATOM   7125 C  C   . VAL A 1 1115 ? 118.010 127.649 129.566 1.00 48.90  ? 1094 VAL A C   1 
ATOM   7126 O  O   . VAL A 1 1115 ? 117.773 128.132 130.681 1.00 48.90  ? 1094 VAL A O   1 
ATOM   7127 C  CB  . VAL A 1 1115 ? 116.056 127.591 127.946 1.00 48.90  ? 1094 VAL A CB  1 
ATOM   7128 C  CG1 . VAL A 1 1115 ? 115.041 127.751 129.042 1.00 48.90  ? 1094 VAL A CG1 1 
ATOM   7129 C  CG2 . VAL A 1 1115 ? 115.477 128.167 126.692 1.00 48.90  ? 1094 VAL A CG2 1 
ATOM   7130 N  N   . GLU A 1 1116 ? 118.879 126.651 129.398 1.00 59.14  ? 1095 GLU A N   1 
ATOM   7131 C  CA  . GLU A 1 1116 ? 119.195 125.684 130.447 1.00 59.14  ? 1095 GLU A CA  1 
ATOM   7132 C  C   . GLU A 1 1116 ? 119.980 126.310 131.604 1.00 59.14  ? 1095 GLU A C   1 
ATOM   7133 O  O   . GLU A 1 1116 ? 119.594 126.164 132.777 1.00 59.14  ? 1095 GLU A O   1 
ATOM   7134 C  CB  . GLU A 1 1116 ? 119.956 124.538 129.791 1.00 59.14  ? 1095 GLU A CB  1 
ATOM   7135 C  CG  . GLU A 1 1116 ? 120.092 123.273 130.565 1.00 59.14  ? 1095 GLU A CG  1 
ATOM   7136 C  CD  . GLU A 1 1116 ? 121.384 123.206 131.321 1.00 59.14  ? 1095 GLU A CD  1 
ATOM   7137 O  OE1 . GLU A 1 1116 ? 122.290 123.969 130.976 1.00 59.14  ? 1095 GLU A OE1 1 
ATOM   7138 O  OE2 . GLU A 1 1116 ? 121.530 122.327 132.192 1.00 59.14  ? 1095 GLU A OE2 1 
ATOM   7139 N  N   . PHE A 1 1117 ? 121.053 127.048 131.279 1.00 58.17  ? 1096 PHE A N   1 
ATOM   7140 C  CA  . PHE A 1 1117 ? 121.926 127.703 132.262 1.00 58.17  ? 1096 PHE A CA  1 
ATOM   7141 C  C   . PHE A 1 1117 ? 121.136 128.638 133.171 1.00 58.17  ? 1096 PHE A C   1 
ATOM   7142 O  O   . PHE A 1 1117 ? 121.161 128.527 134.414 1.00 58.17  ? 1096 PHE A O   1 
ATOM   7143 C  CB  . PHE A 1 1117 ? 122.975 128.521 131.507 1.00 58.17  ? 1096 PHE A CB  1 
ATOM   7144 C  CG  . PHE A 1 1117 ? 123.772 127.734 130.510 1.00 58.17  ? 1096 PHE A CG  1 
ATOM   7145 C  CD1 . PHE A 1 1117 ? 124.116 126.420 130.739 1.00 58.17  ? 1096 PHE A CD1 1 
ATOM   7146 C  CD2 . PHE A 1 1117 ? 124.100 128.293 129.289 1.00 58.17  ? 1096 PHE A CD2 1 
ATOM   7147 C  CE1 . PHE A 1 1117 ? 124.823 125.686 129.790 1.00 58.17  ? 1096 PHE A CE1 1 
ATOM   7148 C  CE2 . PHE A 1 1117 ? 124.799 127.567 128.337 1.00 58.17  ? 1096 PHE A CE2 1 
ATOM   7149 C  CZ  . PHE A 1 1117 ? 125.163 126.267 128.588 1.00 58.17  ? 1096 PHE A CZ  1 
ATOM   7150 N  N   . THR A 1 1118 ? 120.391 129.539 132.538 1.00 59.16  ? 1097 THR A N   1 
ATOM   7151 C  CA  . THR A 1 1118 ? 119.570 130.518 133.224 1.00 59.16  ? 1097 THR A CA  1 
ATOM   7152 C  C   . THR A 1 1118 ? 118.461 129.866 134.040 1.00 59.16  ? 1097 THR A C   1 
ATOM   7153 O  O   . THR A 1 1118 ? 118.081 130.392 135.097 1.00 59.16  ? 1097 THR A O   1 
ATOM   7154 C  CB  . THR A 1 1118 ? 118.989 131.471 132.185 1.00 59.16  ? 1097 THR A CB  1 
ATOM   7155 O  OG1 . THR A 1 1118 ? 118.122 130.740 131.316 1.00 59.16  ? 1097 THR A OG1 1 
ATOM   7156 C  CG2 . THR A 1 1118 ? 120.100 132.044 131.341 1.00 59.16  ? 1097 THR A CG2 1 
ATOM   7157 N  N   . VAL A 1 1119 ? 117.936 128.731 133.564 1.00 47.84  ? 1098 VAL A N   1 
ATOM   7158 C  CA  . VAL A 1 1119 ? 116.949 127.971 134.324 1.00 47.84  ? 1098 VAL A CA  1 
ATOM   7159 C  C   . VAL A 1 1119 ? 117.527 127.514 135.653 1.00 47.84  ? 1098 VAL A C   1 
ATOM   7160 O  O   . VAL A 1 1119 ? 116.909 127.703 136.711 1.00 47.84  ? 1098 VAL A O   1 
ATOM   7161 C  CB  . VAL A 1 1119 ? 116.429 126.787 133.492 1.00 47.84  ? 1098 VAL A CB  1 
ATOM   7162 C  CG1 . VAL A 1 1119 ? 115.878 125.698 134.368 1.00 47.84  ? 1098 VAL A CG1 1 
ATOM   7163 C  CG2 . VAL A 1 1119 ? 115.307 127.255 132.648 1.00 47.84  ? 1098 VAL A CG2 1 
ATOM   7164 N  N   . HIS A 1 1120 ? 118.739 126.955 135.629 1.00 50.63  ? 1099 HIS A N   1 
ATOM   7165 C  CA  . HIS A 1 1120 ? 119.266 126.384 136.865 1.00 50.63  ? 1099 HIS A CA  1 
ATOM   7166 C  C   . HIS A 1 1120 ? 119.633 127.459 137.884 1.00 50.63  ? 1099 HIS A C   1 
ATOM   7167 O  O   . HIS A 1 1120 ? 119.176 127.404 139.036 1.00 50.63  ? 1099 HIS A O   1 
ATOM   7168 C  CB  . HIS A 1 1120 ? 120.456 125.485 136.575 1.00 50.63  ? 1099 HIS A CB  1 
ATOM   7169 C  CG  . HIS A 1 1120 ? 120.091 124.266 135.799 1.00 50.63  ? 1099 HIS A CG  1 
ATOM   7170 N  ND1 . HIS A 1 1120 ? 119.269 123.283 136.302 1.00 50.63  ? 1099 HIS A ND1 1 
ATOM   7171 C  CD2 . HIS A 1 1120 ? 120.456 123.857 134.566 1.00 50.63  ? 1099 HIS A CD2 1 
ATOM   7172 C  CE1 . HIS A 1 1120 ? 119.127 122.329 135.399 1.00 50.63  ? 1099 HIS A CE1 1 
ATOM   7173 N  NE2 . HIS A 1 1120 ? 119.839 122.653 134.336 1.00 50.63  ? 1099 HIS A NE2 1 
ATOM   7174 N  N   . VAL A 1 1121 ? 120.416 128.467 137.481 1.00 55.87  ? 1100 VAL A N   1 
ATOM   7175 C  CA  . VAL A 1 1121 ? 120.801 129.438 138.507 1.00 55.87  ? 1100 VAL A CA  1 
ATOM   7176 C  C   . VAL A 1 1121 ? 119.663 130.376 138.890 1.00 55.87  ? 1100 VAL A C   1 
ATOM   7177 O  O   . VAL A 1 1121 ? 119.655 130.896 140.012 1.00 55.87  ? 1100 VAL A O   1 
ATOM   7178 C  CB  . VAL A 1 1121 ? 122.036 130.249 138.097 1.00 55.87  ? 1100 VAL A CB  1 
ATOM   7179 C  CG1 . VAL A 1 1121 ? 123.254 129.365 138.116 1.00 55.87  ? 1100 VAL A CG1 1 
ATOM   7180 C  CG2 . VAL A 1 1121 ? 121.839 130.827 136.726 1.00 55.87  ? 1100 VAL A CG2 1 
ATOM   7181 N  N   . ALA A 1 1122 ? 118.675 130.581 138.017 1.00 54.76  ? 1101 ALA A N   1 
ATOM   7182 C  CA  . ALA A 1 1122 ? 117.507 131.340 138.445 1.00 54.76  ? 1101 ALA A CA  1 
ATOM   7183 C  C   . ALA A 1 1122 ? 116.655 130.546 139.425 1.00 54.76  ? 1101 ALA A C   1 
ATOM   7184 O  O   . ALA A 1 1122 ? 116.040 131.134 140.323 1.00 54.76  ? 1101 ALA A O   1 
ATOM   7185 C  CB  . ALA A 1 1122 ? 116.672 131.762 137.242 1.00 54.76  ? 1101 ALA A CB  1 
ATOM   7186 N  N   . LEU A 1 1123 ? 116.612 129.218 139.274 1.00 59.61  ? 1102 LEU A N   1 
ATOM   7187 C  CA  . LEU A 1 1123 ? 115.865 128.393 140.219 1.00 59.61  ? 1102 LEU A CA  1 
ATOM   7188 C  C   . LEU A 1 1123 ? 116.535 128.396 141.585 1.00 59.61  ? 1102 LEU A C   1 
ATOM   7189 O  O   . LEU A 1 1123 ? 115.857 128.505 142.620 1.00 59.61  ? 1102 LEU A O   1 
ATOM   7190 C  CB  . LEU A 1 1123 ? 115.729 126.972 139.670 1.00 59.61  ? 1102 LEU A CB  1 
ATOM   7191 C  CG  . LEU A 1 1123 ? 114.761 125.936 140.260 1.00 59.61  ? 1102 LEU A CG  1 
ATOM   7192 C  CD1 . LEU A 1 1123 ? 115.304 125.183 141.471 1.00 59.61  ? 1102 LEU A CD1 1 
ATOM   7193 C  CD2 . LEU A 1 1123 ? 113.435 126.597 140.595 1.00 59.61  ? 1102 LEU A CD2 1 
ATOM   7194 N  N   . ALA A 1 1124 ? 117.865 128.301 141.600 1.00 54.18  ? 1103 ALA A N   1 
ATOM   7195 C  CA  . ALA A 1 1124 ? 118.581 128.395 142.865 1.00 54.18  ? 1103 ALA A CA  1 
ATOM   7196 C  C   . ALA A 1 1124 ? 118.434 129.770 143.502 1.00 54.18  ? 1103 ALA A C   1 
ATOM   7197 O  O   . ALA A 1 1124 ? 118.386 129.869 144.731 1.00 54.18  ? 1103 ALA A O   1 
ATOM   7198 C  CB  . ALA A 1 1124 ? 120.057 128.070 142.668 1.00 54.18  ? 1103 ALA A CB  1 
ATOM   7199 N  N   . PHE A 1 1125 ? 118.342 130.835 142.700 1.00 53.27  ? 1104 PHE A N   1 
ATOM   7200 C  CA  . PHE A 1 1125 ? 118.181 132.149 143.309 1.00 53.27  ? 1104 PHE A CA  1 
ATOM   7201 C  C   . PHE A 1 1125 ? 116.778 132.345 143.837 1.00 53.27  ? 1104 PHE A C   1 
ATOM   7202 O  O   . PHE A 1 1125 ? 116.579 133.081 144.805 1.00 53.27  ? 1104 PHE A O   1 
ATOM   7203 C  CB  . PHE A 1 1125 ? 118.515 133.257 142.321 1.00 53.27  ? 1104 PHE A CB  1 
ATOM   7204 C  CG  . PHE A 1 1125 ? 118.583 134.614 142.945 1.00 53.27  ? 1104 PHE A CG  1 
ATOM   7205 C  CD1 . PHE A 1 1125 ? 119.719 135.012 143.621 1.00 53.27  ? 1104 PHE A CD1 1 
ATOM   7206 C  CD2 . PHE A 1 1125 ? 117.501 135.480 142.891 1.00 53.27  ? 1104 PHE A CD2 1 
ATOM   7207 C  CE1 . PHE A 1 1125 ? 119.787 136.255 144.203 1.00 53.27  ? 1104 PHE A CE1 1 
ATOM   7208 C  CE2 . PHE A 1 1125 ? 117.562 136.723 143.480 1.00 53.27  ? 1104 PHE A CE2 1 
ATOM   7209 C  CZ  . PHE A 1 1125 ? 118.704 137.110 144.132 1.00 53.27  ? 1104 PHE A CZ  1 
ATOM   7210 N  N   . LEU A 1 1126 ? 115.797 131.705 143.229 1.00 53.15  ? 1105 LEU A N   1 
ATOM   7211 C  CA  . LEU A 1 1126 ? 114.450 131.907 143.726 1.00 53.15  ? 1105 LEU A CA  1 
ATOM   7212 C  C   . LEU A 1 1126 ? 114.191 131.090 144.986 1.00 53.15  ? 1105 LEU A C   1 
ATOM   7213 O  O   . LEU A 1 1126 ? 113.435 131.535 145.855 1.00 53.15  ? 1105 LEU A O   1 
ATOM   7214 C  CB  . LEU A 1 1126 ? 113.452 131.583 142.613 1.00 53.15  ? 1105 LEU A CB  1 
ATOM   7215 C  CG  . LEU A 1 1126 ? 112.021 132.114 142.680 1.00 53.15  ? 1105 LEU A CG  1 
ATOM   7216 C  CD1 . LEU A 1 1126 ? 111.062 131.248 143.501 1.00 53.15  ? 1105 LEU A CD1 1 
ATOM   7217 C  CD2 . LEU A 1 1126 ? 112.065 133.530 143.222 1.00 53.15  ? 1105 LEU A CD2 1 
ATOM   7218 N  N   . THR A 1 1127 ? 114.821 129.917 145.131 1.00 57.88  ? 1106 THR A N   1 
ATOM   7219 C  CA  . THR A 1 1127 ? 114.517 129.116 146.317 1.00 57.88  ? 1106 THR A CA  1 
ATOM   7220 C  C   . THR A 1 1127 ? 115.225 129.600 147.584 1.00 57.88  ? 1106 THR A C   1 
ATOM   7221 O  O   . THR A 1 1127 ? 114.703 129.380 148.684 1.00 57.88  ? 1106 THR A O   1 
ATOM   7222 C  CB  . THR A 1 1127 ? 114.857 127.644 146.077 1.00 57.88  ? 1106 THR A CB  1 
ATOM   7223 O  OG1 . THR A 1 1127 ? 116.243 127.513 145.753 1.00 57.88  ? 1106 THR A OG1 1 
ATOM   7224 C  CG2 . THR A 1 1127 ? 114.014 127.081 144.960 1.00 57.88  ? 1106 THR A CG2 1 
ATOM   7225 N  N   . ALA A 1 1128 ? 116.381 130.259 147.464 1.00 59.71  ? 1107 ALA A N   1 
ATOM   7226 C  CA  . ALA A 1 1128 ? 117.262 130.511 148.604 1.00 59.71  ? 1107 ALA A CA  1 
ATOM   7227 C  C   . ALA A 1 1128 ? 116.679 131.572 149.546 1.00 59.71  ? 1107 ALA A C   1 
ATOM   7228 O  O   . ALA A 1 1128 ? 115.775 132.331 149.193 1.00 59.71  ? 1107 ALA A O   1 
ATOM   7229 C  CB  . ALA A 1 1128 ? 118.650 130.926 148.124 1.00 59.71  ? 1107 ALA A CB  1 
ATOM   7230 N  N   . ILE A 1 1129 ? 117.231 131.628 150.761 1.00 68.98  ? 1108 ILE A N   1 
ATOM   7231 C  CA  . ILE A 1 1129 ? 116.534 132.217 151.894 1.00 68.98  ? 1108 ILE A CA  1 
ATOM   7232 C  C   . ILE A 1 1129 ? 117.102 133.569 152.341 1.00 68.98  ? 1108 ILE A C   1 
ATOM   7233 O  O   . ILE A 1 1129 ? 116.322 134.432 152.764 1.00 68.98  ? 1108 ILE A O   1 
ATOM   7234 C  CB  . ILE A 1 1129 ? 116.492 131.210 153.069 1.00 68.98  ? 1108 ILE A CB  1 
ATOM   7235 C  CG1 . ILE A 1 1129 ? 115.531 131.662 154.168 1.00 68.98  ? 1108 ILE A CG1 1 
ATOM   7236 C  CG2 . ILE A 1 1129 ? 117.882 130.886 153.614 1.00 68.98  ? 1108 ILE A CG2 1 
ATOM   7237 C  CD1 . ILE A 1 1129 ? 114.093 131.701 153.726 1.00 68.98  ? 1108 ILE A CD1 1 
ATOM   7238 N  N   . GLY A 1 1130 ? 118.417 133.795 152.238 1.00 84.79  ? 1109 GLY A N   1 
ATOM   7239 C  CA  . GLY A 1 1130 ? 118.989 135.073 152.642 1.00 84.79  ? 1109 GLY A CA  1 
ATOM   7240 C  C   . GLY A 1 1130 ? 118.530 136.203 151.741 1.00 84.79  ? 1109 GLY A C   1 
ATOM   7241 O  O   . GLY A 1 1130 ? 118.156 135.992 150.592 1.00 84.79  ? 1109 GLY A O   1 
ATOM   7242 N  N   . ASP A 1 1131 ? 118.510 137.419 152.277 1.00 73.67  ? 1110 ASP A N   1 
ATOM   7243 C  CA  . ASP A 1 1131 ? 117.752 138.466 151.601 1.00 73.67  ? 1110 ASP A CA  1 
ATOM   7244 C  C   . ASP A 1 1131 ? 118.584 139.363 150.697 1.00 73.67  ? 1110 ASP A C   1 
ATOM   7245 O  O   . ASP A 1 1131 ? 118.050 139.906 149.725 1.00 73.67  ? 1110 ASP A O   1 
ATOM   7246 C  CB  . ASP A 1 1131 ? 116.999 139.323 152.622 1.00 73.67  ? 1110 ASP A CB  1 
ATOM   7247 C  CG  . ASP A 1 1131 ? 115.882 138.561 153.298 1.00 73.67  ? 1110 ASP A CG  1 
ATOM   7248 O  OD1 . ASP A 1 1131 ? 115.396 137.581 152.702 1.00 73.67  ? 1110 ASP A OD1 1 
ATOM   7249 O  OD2 . ASP A 1 1131 ? 115.484 138.948 154.412 1.00 73.67  ? 1110 ASP A OD2 1 
ATOM   7250 N  N   . LYS A 1 1132 ? 119.865 139.527 150.975 1.00 79.37  ? 1111 LYS A N   1 
ATOM   7251 C  CA  . LYS A 1 1132 ? 120.725 140.401 150.192 1.00 79.37  ? 1111 LYS A CA  1 
ATOM   7252 C  C   . LYS A 1 1132 ? 121.391 139.596 149.074 1.00 79.37  ? 1111 LYS A C   1 
ATOM   7253 O  O   . LYS A 1 1132 ? 120.898 138.543 148.666 1.00 79.37  ? 1111 LYS A O   1 
ATOM   7254 C  CB  . LYS A 1 1132 ? 121.715 141.110 151.119 1.00 79.37  ? 1111 LYS A CB  1 
ATOM   7255 C  CG  . LYS A 1 1132 ? 121.078 142.079 152.126 1.00 79.37  ? 1111 LYS A CG  1 
ATOM   7256 C  CD  . LYS A 1 1132 ? 120.646 143.409 151.497 1.00 79.37  ? 1111 LYS A CD  1 
ATOM   7257 C  CE  . LYS A 1 1132 ? 119.148 143.499 151.224 1.00 79.37  ? 1111 LYS A CE  1 
ATOM   7258 N  NZ  . LYS A 1 1132 ? 118.756 144.837 150.706 1.00 79.37  ? 1111 LYS A NZ  1 
ATOM   7259 N  N   . ASN A 1 1133 ? 122.498 140.113 148.530 1.00 80.51  ? 1112 ASN A N   1 
ATOM   7260 C  CA  . ASN A 1 1133 ? 123.353 139.365 147.610 1.00 80.51  ? 1112 ASN A CA  1 
ATOM   7261 C  C   . ASN A 1 1133 ? 123.995 138.125 148.232 1.00 80.51  ? 1112 ASN A C   1 
ATOM   7262 O  O   . ASN A 1 1133 ? 124.652 137.368 147.513 1.00 80.51  ? 1112 ASN A O   1 
ATOM   7263 C  CB  . ASN A 1 1133 ? 124.435 140.290 147.052 1.00 80.51  ? 1112 ASN A CB  1 
ATOM   7264 C  CG  . ASN A 1 1133 ? 125.265 140.958 148.135 1.00 80.51  ? 1112 ASN A CG  1 
ATOM   7265 O  OD1 . ASN A 1 1133 ? 125.106 140.696 149.327 1.00 80.51  ? 1112 ASN A OD1 1 
ATOM   7266 N  ND2 . ASN A 1 1133 ? 126.157 141.840 147.717 1.00 80.51  ? 1112 ASN A ND2 1 
ATOM   7267 N  N   . ARG A 1 1134 ? 123.846 137.918 149.542 1.00 80.66  ? 1113 ARG A N   1 
ATOM   7268 C  CA  . ARG A 1 1134 ? 124.109 136.623 150.158 1.00 80.66  ? 1113 ARG A CA  1 
ATOM   7269 C  C   . ARG A 1 1134 ? 123.236 135.515 149.562 1.00 80.66  ? 1113 ARG A C   1 
ATOM   7270 O  O   . ARG A 1 1134 ? 123.628 134.342 149.579 1.00 80.66  ? 1113 ARG A O   1 
ATOM   7271 C  CB  . ARG A 1 1134 ? 123.905 136.757 151.676 1.00 80.66  ? 1113 ARG A CB  1 
ATOM   7272 C  CG  . ARG A 1 1134 ? 124.118 135.503 152.508 1.00 80.66  ? 1113 ARG A CG  1 
ATOM   7273 C  CD  . ARG A 1 1134 ? 125.527 134.977 152.383 1.00 80.66  ? 1113 ARG A CD  1 
ATOM   7274 N  NE  . ARG A 1 1134 ? 125.693 133.743 153.138 1.00 80.66  ? 1113 ARG A NE  1 
ATOM   7275 C  CZ  . ARG A 1 1134 ? 126.734 132.931 153.012 1.00 80.66  ? 1113 ARG A CZ  1 
ATOM   7276 N  NH1 . ARG A 1 1134 ? 126.806 131.826 153.740 1.00 80.66  ? 1113 ARG A NH1 1 
ATOM   7277 N  NH2 . ARG A 1 1134 ? 127.699 133.217 152.152 1.00 80.66  ? 1113 ARG A NH2 1 
ATOM   7278 N  N   . ARG A 1 1135 ? 122.066 135.863 149.016 1.00 72.71  ? 1114 ARG A N   1 
ATOM   7279 C  CA  . ARG A 1 1135 ? 121.222 134.880 148.341 1.00 72.71  ? 1114 ARG A CA  1 
ATOM   7280 C  C   . ARG A 1 1135 ? 121.901 134.307 147.108 1.00 72.71  ? 1114 ARG A C   1 
ATOM   7281 O  O   . ARG A 1 1135 ? 121.936 133.088 146.919 1.00 72.71  ? 1114 ARG A O   1 
ATOM   7282 C  CB  . ARG A 1 1135 ? 119.899 135.507 147.939 1.00 72.71  ? 1114 ARG A CB  1 
ATOM   7283 C  CG  . ARG A 1 1135 ? 118.954 134.525 147.321 1.00 72.71  ? 1114 ARG A CG  1 
ATOM   7284 C  CD  . ARG A 1 1135 ? 117.674 135.209 147.008 1.00 72.71  ? 1114 ARG A CD  1 
ATOM   7285 N  NE  . ARG A 1 1135 ? 117.094 135.708 148.231 1.00 72.71  ? 1114 ARG A NE  1 
ATOM   7286 C  CZ  . ARG A 1 1135 ? 116.092 136.565 148.279 1.00 72.71  ? 1114 ARG A CZ  1 
ATOM   7287 N  NH1 . ARG A 1 1135 ? 115.656 136.968 149.455 1.00 72.71  ? 1114 ARG A NH1 1 
ATOM   7288 N  NH2 . ARG A 1 1135 ? 115.546 137.029 147.164 1.00 72.71  ? 1114 ARG A NH2 1 
ATOM   7289 N  N   . ALA A 1 1136 ? 122.453 135.174 146.256 1.00 71.61  ? 1115 ALA A N   1 
ATOM   7290 C  CA  . ALA A 1 1136 ? 123.131 134.720 145.049 1.00 71.61  ? 1115 ALA A CA  1 
ATOM   7291 C  C   . ALA A 1 1136 ? 124.431 133.986 145.342 1.00 71.61  ? 1115 ALA A C   1 
ATOM   7292 O  O   . ALA A 1 1136 ? 124.960 133.329 144.442 1.00 71.61  ? 1115 ALA A O   1 
ATOM   7293 C  CB  . ALA A 1 1136 ? 123.407 135.902 144.119 1.00 71.61  ? 1115 ALA A CB  1 
ATOM   7294 N  N   . VAL A 1 1137 ? 124.954 134.088 146.564 1.00 66.29  ? 1116 VAL A N   1 
ATOM   7295 C  CA  . VAL A 1 1137 ? 126.118 133.304 146.951 1.00 66.29  ? 1116 VAL A CA  1 
ATOM   7296 C  C   . VAL A 1 1137 ? 125.763 131.828 147.011 1.00 66.29  ? 1116 VAL A C   1 
ATOM   7297 O  O   . VAL A 1 1137 ? 126.368 130.998 146.325 1.00 66.29  ? 1116 VAL A O   1 
ATOM   7298 C  CB  . VAL A 1 1137 ? 126.664 133.792 148.300 1.00 66.29  ? 1116 VAL A CB  1 
ATOM   7299 C  CG1 . VAL A 1 1137 ? 127.819 132.928 148.723 1.00 66.29  ? 1116 VAL A CG1 1 
ATOM   7300 C  CG2 . VAL A 1 1137 ? 127.074 135.239 148.212 1.00 66.29  ? 1116 VAL A CG2 1 
ATOM   7301 N  N   . LEU A 1 1138 ? 124.771 131.482 147.831 1.00 69.66  ? 1117 LEU A N   1 
ATOM   7302 C  CA  . LEU A 1 1138 ? 124.374 130.086 147.964 1.00 69.66  ? 1117 LEU A CA  1 
ATOM   7303 C  C   . LEU A 1 1138 ? 123.619 129.594 146.736 1.00 69.66  ? 1117 LEU A C   1 
ATOM   7304 O  O   . LEU A 1 1138 ? 123.621 128.390 146.462 1.00 69.66  ? 1117 LEU A O   1 
ATOM   7305 C  CB  . LEU A 1 1138 ? 123.546 129.907 149.242 1.00 69.66  ? 1117 LEU A CB  1 
ATOM   7306 C  CG  . LEU A 1 1138 ? 123.309 128.528 149.877 1.00 69.66  ? 1117 LEU A CG  1 
ATOM   7307 C  CD1 . LEU A 1 1138 ? 122.146 127.741 149.292 1.00 69.66  ? 1117 LEU A CD1 1 
ATOM   7308 C  CD2 . LEU A 1 1138 ? 124.579 127.704 149.804 1.00 69.66  ? 1117 LEU A CD2 1 
ATOM   7309 N  N   . ALA A 1 1139 ? 122.987 130.500 145.987 1.00 58.19  ? 1118 ALA A N   1 
ATOM   7310 C  CA  . ALA A 1 1139 ? 122.422 130.132 144.695 1.00 58.19  ? 1118 ALA A CA  1 
ATOM   7311 C  C   . ALA A 1 1139 ? 123.512 129.771 143.705 1.00 58.19  ? 1118 ALA A C   1 
ATOM   7312 O  O   . ALA A 1 1139 ? 123.379 128.807 142.945 1.00 58.19  ? 1118 ALA A O   1 
ATOM   7313 C  CB  . ALA A 1 1139 ? 121.602 131.283 144.138 1.00 58.19  ? 1118 ALA A CB  1 
ATOM   7314 N  N   . LEU A 1 1140 ? 124.581 130.558 143.685 1.00 59.35  ? 1119 LEU A N   1 
ATOM   7315 C  CA  . LEU A 1 1140 ? 125.705 130.288 142.804 1.00 59.35  ? 1119 LEU A CA  1 
ATOM   7316 C  C   . LEU A 1 1140 ? 126.454 129.035 143.233 1.00 59.35  ? 1119 LEU A C   1 
ATOM   7317 O  O   . LEU A 1 1140 ? 127.065 128.366 142.397 1.00 59.35  ? 1119 LEU A O   1 
ATOM   7318 C  CB  . LEU A 1 1140 ? 126.608 131.522 142.780 1.00 59.35  ? 1119 LEU A CB  1 
ATOM   7319 C  CG  . LEU A 1 1140 ? 127.867 131.743 141.938 1.00 59.35  ? 1119 LEU A CG  1 
ATOM   7320 C  CD1 . LEU A 1 1140 ? 129.077 131.156 142.625 1.00 59.35  ? 1119 LEU A CD1 1 
ATOM   7321 C  CD2 . LEU A 1 1140 ? 127.714 131.156 140.563 1.00 59.35  ? 1119 LEU A CD2 1 
ATOM   7322 N  N   . GLU A 1 1141 ? 126.415 128.700 144.518 1.00 72.69  ? 1120 GLU A N   1 
ATOM   7323 C  CA  . GLU A 1 1141 ? 127.087 127.505 145.008 1.00 72.69  ? 1120 GLU A CA  1 
ATOM   7324 C  C   . GLU A 1 1141 ? 126.259 126.250 144.803 1.00 72.69  ? 1120 GLU A C   1 
ATOM   7325 O  O   . GLU A 1 1141 ? 126.821 125.172 144.586 1.00 72.69  ? 1120 GLU A O   1 
ATOM   7326 C  CB  . GLU A 1 1141 ? 127.413 127.677 146.494 1.00 72.69  ? 1120 GLU A CB  1 
ATOM   7327 C  CG  . GLU A 1 1141 ? 128.363 126.652 147.091 1.00 72.69  ? 1120 GLU A CG  1 
ATOM   7328 C  CD  . GLU A 1 1141 ? 127.654 125.418 147.611 1.00 72.69  ? 1120 GLU A CD  1 
ATOM   7329 O  OE1 . GLU A 1 1141 ? 126.478 125.537 148.007 1.00 72.69  ? 1120 GLU A OE1 1 
ATOM   7330 O  OE2 . GLU A 1 1141 ? 128.267 124.330 147.605 1.00 72.69  ? 1120 GLU A OE2 1 
ATOM   7331 N  N   . HIS A 1 1142 ? 124.940 126.372 144.858 1.00 76.58  ? 1121 HIS A N   1 
ATOM   7332 C  CA  . HIS A 1 1142 ? 124.052 125.224 144.975 1.00 76.58  ? 1121 HIS A CA  1 
ATOM   7333 C  C   . HIS A 1 1142 ? 123.899 124.454 143.664 1.00 76.58  ? 1121 HIS A C   1 
ATOM   7334 O  O   . HIS A 1 1142 ? 123.457 123.300 143.689 1.00 76.58  ? 1121 HIS A O   1 
ATOM   7335 C  CB  . HIS A 1 1142 ? 122.695 125.725 145.472 1.00 76.58  ? 1121 HIS A CB  1 
ATOM   7336 C  CG  . HIS A 1 1142 ? 121.826 124.672 146.081 1.00 76.58  ? 1121 HIS A CG  1 
ATOM   7337 N  ND1 . HIS A 1 1142 ? 120.480 124.870 146.311 1.00 76.58  ? 1121 HIS A ND1 1 
ATOM   7338 C  CD2 . HIS A 1 1142 ? 122.109 123.437 146.552 1.00 76.58  ? 1121 HIS A CD2 1 
ATOM   7339 C  CE1 . HIS A 1 1142 ? 119.967 123.793 146.873 1.00 76.58  ? 1121 HIS A CE1 1 
ATOM   7340 N  NE2 . HIS A 1 1142 ? 120.934 122.907 147.030 1.00 76.58  ? 1121 HIS A NE2 1 
ATOM   7341 N  N   . MET A 1 1143 ? 124.270 125.056 142.525 1.00 60.43  ? 1122 MET A N   1 
ATOM   7342 C  CA  . MET A 1 1143 ? 124.022 124.487 141.205 1.00 60.43  ? 1122 MET A CA  1 
ATOM   7343 C  C   . MET A 1 1143 ? 125.239 124.526 140.293 1.00 60.43  ? 1122 MET A C   1 
ATOM   7344 O  O   . MET A 1 1143 ? 125.093 124.273 139.098 1.00 60.43  ? 1122 MET A O   1 
ATOM   7345 C  CB  . MET A 1 1143 ? 122.885 125.231 140.497 1.00 60.43  ? 1122 MET A CB  1 
ATOM   7346 C  CG  . MET A 1 1143 ? 121.510 125.052 141.071 1.00 60.43  ? 1122 MET A CG  1 
ATOM   7347 S  SD  . MET A 1 1143 ? 120.837 123.415 140.807 1.00 60.43  ? 1122 MET A SD  1 
ATOM   7348 C  CE  . MET A 1 1143 ? 119.348 123.532 141.790 1.00 60.43  ? 1122 MET A CE  1 
ATOM   7349 N  N   . PHE A 1 1144 ? 126.422 124.830 140.821 1.00 45.01  ? 1123 PHE A N   1 
ATOM   7350 C  CA  . PHE A 1 1144 ? 127.549 125.243 139.987 1.00 45.01  ? 1123 PHE A CA  1 
ATOM   7351 C  C   . PHE A 1 1144 ? 128.099 124.091 139.154 1.00 45.01  ? 1123 PHE A C   1 
ATOM   7352 O  O   . PHE A 1 1144 ? 128.157 124.175 137.919 1.00 45.01  ? 1123 PHE A O   1 
ATOM   7353 C  CB  . PHE A 1 1144 ? 128.633 125.837 140.883 1.00 45.01  ? 1123 PHE A CB  1 
ATOM   7354 C  CG  . PHE A 1 1144 ? 129.849 126.288 140.156 1.00 45.01  ? 1123 PHE A CG  1 
ATOM   7355 C  CD1 . PHE A 1 1144 ? 129.832 127.445 139.411 1.00 45.01  ? 1123 PHE A CD1 1 
ATOM   7356 C  CD2 . PHE A 1 1144 ? 131.023 125.567 140.244 1.00 45.01  ? 1123 PHE A CD2 1 
ATOM   7357 C  CE1 . PHE A 1 1144 ? 130.960 127.865 138.752 1.00 45.01  ? 1123 PHE A CE1 1 
ATOM   7358 C  CE2 . PHE A 1 1144 ? 132.155 125.983 139.584 1.00 45.01  ? 1123 PHE A CE2 1 
ATOM   7359 C  CZ  . PHE A 1 1144 ? 132.123 127.133 138.840 1.00 45.01  ? 1123 PHE A CZ  1 
ATOM   7360 N  N   . ALA A 1 1145 ? 128.499 123.008 139.815 1.00 51.32  ? 1124 ALA A N   1 
ATOM   7361 C  CA  . ALA A 1 1145 ? 129.113 121.879 139.117 1.00 51.32  ? 1124 ALA A CA  1 
ATOM   7362 C  C   . ALA A 1 1145 ? 128.229 121.171 138.084 1.00 51.32  ? 1124 ALA A C   1 
ATOM   7363 O  O   . ALA A 1 1145 ? 128.785 120.739 137.058 1.00 51.32  ? 1124 ALA A O   1 
ATOM   7364 C  CB  . ALA A 1 1145 ? 129.647 120.873 140.144 1.00 51.32  ? 1124 ALA A CB  1 
ATOM   7365 N  N   . PRO A 1 1146 ? 126.903 121.002 138.253 1.00 54.68  ? 1125 PRO A N   1 
ATOM   7366 C  CA  . PRO A 1 1146 ? 126.126 120.484 137.115 1.00 54.68  ? 1125 PRO A CA  1 
ATOM   7367 C  C   . PRO A 1 1146 ? 126.010 121.442 135.940 1.00 54.68  ? 1125 PRO A C   1 
ATOM   7368 O  O   . PRO A 1 1146 ? 125.850 120.974 134.808 1.00 54.68  ? 1125 PRO A O   1 
ATOM   7369 C  CB  . PRO A 1 1146 ? 124.756 120.172 137.731 1.00 54.68  ? 1125 PRO A CB  1 
ATOM   7370 C  CG  . PRO A 1 1146 ? 124.698 120.939 138.954 1.00 54.68  ? 1125 PRO A CG  1 
ATOM   7371 C  CD  . PRO A 1 1146 ? 126.080 120.948 139.478 1.00 54.68  ? 1125 PRO A CD  1 
ATOM   7372 N  N   . VAL A 1 1147 ? 126.089 122.756 136.154 1.00 50.22  ? 1126 VAL A N   1 
ATOM   7373 C  CA  . VAL A 1 1147 ? 126.076 123.672 135.016 1.00 50.22  ? 1126 VAL A CA  1 
ATOM   7374 C  C   . VAL A 1 1147 ? 127.423 123.637 134.300 1.00 50.22  ? 1126 VAL A C   1 
ATOM   7375 O  O   . VAL A 1 1147 ? 127.489 123.702 133.063 1.00 50.22  ? 1126 VAL A O   1 
ATOM   7376 C  CB  . VAL A 1 1147 ? 125.682 125.088 135.478 1.00 50.22  ? 1126 VAL A CB  1 
ATOM   7377 C  CG1 . VAL A 1 1147 ? 125.771 126.094 134.352 1.00 50.22  ? 1126 VAL A CG1 1 
ATOM   7378 C  CG2 . VAL A 1 1147 ? 124.266 125.078 136.011 1.00 50.22  ? 1126 VAL A CG2 1 
ATOM   7379 N  N   . LEU A 1 1148 ? 128.512 123.475 135.056 1.00 50.52  ? 1127 LEU A N   1 
ATOM   7380 C  CA  . LEU A 1 1148 ? 129.815 123.267 134.431 1.00 50.52  ? 1127 LEU A CA  1 
ATOM   7381 C  C   . LEU A 1 1148 ? 129.857 121.944 133.669 1.00 50.52  ? 1127 LEU A C   1 
ATOM   7382 O  O   . LEU A 1 1148 ? 130.517 121.843 132.625 1.00 50.52  ? 1127 LEU A O   1 
ATOM   7383 C  CB  . LEU A 1 1148 ? 130.903 123.326 135.502 1.00 50.52  ? 1127 LEU A CB  1 
ATOM   7384 C  CG  . LEU A 1 1148 ? 132.380 123.579 135.182 1.00 50.52  ? 1127 LEU A CG  1 
ATOM   7385 C  CD1 . LEU A 1 1148 ? 133.145 122.358 134.668 1.00 50.52  ? 1127 LEU A CD1 1 
ATOM   7386 C  CD2 . LEU A 1 1148 ? 132.479 124.734 134.208 1.00 50.52  ? 1127 LEU A CD2 1 
ATOM   7387 N  N   . ASP A 1 1149 ? 129.141 120.932 134.159 1.00 60.51  ? 1128 ASP A N   1 
ATOM   7388 C  CA  . ASP A 1 1149 ? 128.945 119.724 133.368 1.00 60.51  ? 1128 ASP A CA  1 
ATOM   7389 C  C   . ASP A 1 1149 ? 128.094 120.002 132.137 1.00 60.51  ? 1128 ASP A C   1 
ATOM   7390 O  O   . ASP A 1 1149 ? 128.295 119.377 131.089 1.00 60.51  ? 1128 ASP A O   1 
ATOM   7391 C  CB  . ASP A 1 1149 ? 128.315 118.641 134.233 1.00 60.51  ? 1128 ASP A CB  1 
ATOM   7392 C  CG  . ASP A 1 1149 ? 129.286 118.071 135.244 1.00 60.51  ? 1128 ASP A CG  1 
ATOM   7393 O  OD1 . ASP A 1 1149 ? 130.497 118.030 134.949 1.00 60.51  ? 1128 ASP A OD1 1 
ATOM   7394 O  OD2 . ASP A 1 1149 ? 128.845 117.671 136.337 1.00 60.51  ? 1128 ASP A OD2 1 
ATOM   7395 N  N   . GLY A 1 1150 ? 127.177 120.961 132.233 1.00 47.77  ? 1129 GLY A N   1 
ATOM   7396 C  CA  . GLY A 1 1150 ? 126.472 121.489 131.083 1.00 47.77  ? 1129 GLY A CA  1 
ATOM   7397 C  C   . GLY A 1 1150 ? 127.311 122.342 130.158 1.00 47.77  ? 1129 GLY A C   1 
ATOM   7398 O  O   . GLY A 1 1150 ? 126.809 122.786 129.124 1.00 47.77  ? 1129 GLY A O   1 
ATOM   7399 N  N   . ALA A 1 1151 ? 128.563 122.616 130.521 1.00 53.17  ? 1130 ALA A N   1 
ATOM   7400 C  CA  . ALA A 1 1151 ? 129.541 123.125 129.569 1.00 53.17  ? 1130 ALA A CA  1 
ATOM   7401 C  C   . ALA A 1 1151 ? 130.321 121.994 128.915 1.00 53.17  ? 1130 ALA A C   1 
ATOM   7402 O  O   . ALA A 1 1151 ? 130.298 121.846 127.690 1.00 53.17  ? 1130 ALA A O   1 
ATOM   7403 C  CB  . ALA A 1 1151 ? 130.523 124.077 130.251 1.00 53.17  ? 1130 ALA A CB  1 
ATOM   7404 N  N   . VAL A 1 1152 ? 131.016 121.190 129.722 1.00 57.88  ? 1131 VAL A N   1 
ATOM   7405 C  CA  . VAL A 1 1152 ? 132.001 120.271 129.161 1.00 57.88  ? 1131 VAL A CA  1 
ATOM   7406 C  C   . VAL A 1 1152 ? 131.336 119.070 128.490 1.00 57.88  ? 1131 VAL A C   1 
ATOM   7407 O  O   . VAL A 1 1152 ? 131.944 118.438 127.616 1.00 57.88  ? 1131 VAL A O   1 
ATOM   7408 C  CB  . VAL A 1 1152 ? 132.989 119.880 130.275 1.00 57.88  ? 1131 VAL A CB  1 
ATOM   7409 C  CG1 . VAL A 1 1152 ? 134.190 119.107 129.745 1.00 57.88  ? 1131 VAL A CG1 1 
ATOM   7410 C  CG2 . VAL A 1 1152 ? 133.461 121.119 130.994 1.00 57.88  ? 1131 VAL A CG2 1 
ATOM   7411 N  N   . SER A 1 1153 ? 130.080 118.770 128.826 1.00 67.21  ? 1132 SER A N   1 
ATOM   7412 C  CA  . SER A 1 1153 ? 129.364 117.706 128.128 1.00 67.21  ? 1132 SER A CA  1 
ATOM   7413 C  C   . SER A 1 1153 ? 129.104 118.082 126.674 1.00 67.21  ? 1132 SER A C   1 
ATOM   7414 O  O   . SER A 1 1153 ? 129.587 117.412 125.750 1.00 67.21  ? 1132 SER A O   1 
ATOM   7415 C  CB  . SER A 1 1153 ? 128.050 117.411 128.842 1.00 67.21  ? 1132 SER A CB  1 
ATOM   7416 O  OG  . SER A 1 1153 ? 127.178 118.519 128.748 1.00 67.21  ? 1132 SER A OG  1 
ATOM   7417 N  N   . THR A 1 1154 ? 128.367 119.179 126.461 1.00 57.78  ? 1133 THR A N   1 
ATOM   7418 C  CA  . THR A 1 1154 ? 128.023 119.629 125.115 1.00 57.78  ? 1133 THR A CA  1 
ATOM   7419 C  C   . THR A 1 1154 ? 129.258 120.058 124.335 1.00 57.78  ? 1133 THR A C   1 
ATOM   7420 O  O   . THR A 1 1154 ? 129.452 119.640 123.184 1.00 57.78  ? 1133 THR A O   1 
ATOM   7421 C  CB  . THR A 1 1154 ? 127.034 120.785 125.200 1.00 57.78  ? 1133 THR A CB  1 
ATOM   7422 O  OG1 . THR A 1 1154 ? 125.879 120.372 125.935 1.00 57.78  ? 1133 THR A OG1 1 
ATOM   7423 C  CG2 . THR A 1 1154 ? 126.606 121.209 123.817 1.00 57.78  ? 1133 THR A CG2 1 
ATOM   7424 N  N   . LEU A 1 1155 ? 130.120 120.856 124.968 1.00 54.48  ? 1134 LEU A N   1 
ATOM   7425 C  CA  . LEU A 1 1155 ? 131.358 121.308 124.343 1.00 54.48  ? 1134 LEU A CA  1 
ATOM   7426 C  C   . LEU A 1 1155 ? 132.303 120.154 124.050 1.00 54.48  ? 1134 LEU A C   1 
ATOM   7427 O  O   . LEU A 1 1155 ? 133.142 120.265 123.153 1.00 54.48  ? 1134 LEU A O   1 
ATOM   7428 C  CB  . LEU A 1 1155 ? 132.030 122.342 125.252 1.00 54.48  ? 1134 LEU A CB  1 
ATOM   7429 C  CG  . LEU A 1 1155 ? 133.268 123.175 124.902 1.00 54.48  ? 1134 LEU A CG  1 
ATOM   7430 C  CD1 . LEU A 1 1155 ? 134.587 122.473 125.182 1.00 54.48  ? 1134 LEU A CD1 1 
ATOM   7431 C  CD2 . LEU A 1 1155 ? 133.199 123.592 123.457 1.00 54.48  ? 1134 LEU A CD2 1 
ATOM   7432 N  N   . LEU A 1 1156 ? 132.194 119.046 124.785 1.00 61.81  ? 1135 LEU A N   1 
ATOM   7433 C  CA  . LEU A 1 1156 ? 133.101 117.933 124.542 1.00 61.81  ? 1135 LEU A CA  1 
ATOM   7434 C  C   . LEU A 1 1156 ? 132.586 117.035 123.429 1.00 61.81  ? 1135 LEU A C   1 
ATOM   7435 O  O   . LEU A 1 1156 ? 133.379 116.543 122.614 1.00 61.81  ? 1135 LEU A O   1 
ATOM   7436 C  CB  . LEU A 1 1156 ? 133.318 117.138 125.823 1.00 61.81  ? 1135 LEU A CB  1 
ATOM   7437 C  CG  . LEU A 1 1156 ? 134.436 116.107 125.737 1.00 61.81  ? 1135 LEU A CG  1 
ATOM   7438 C  CD1 . LEU A 1 1156 ? 135.733 116.805 125.412 1.00 61.81  ? 1135 LEU A CD1 1 
ATOM   7439 C  CD2 . LEU A 1 1156 ? 134.566 115.354 127.040 1.00 61.81  ? 1135 LEU A CD2 1 
ATOM   7440 N  N   . GLY A 1 1157 ? 131.268 116.824 123.367 1.00 72.23  ? 1136 GLY A N   1 
ATOM   7441 C  CA  . GLY A 1 1157 ? 130.705 116.066 122.260 1.00 72.23  ? 1136 GLY A CA  1 
ATOM   7442 C  C   . GLY A 1 1157 ? 130.850 116.784 120.932 1.00 72.23  ? 1136 GLY A C   1 
ATOM   7443 O  O   . GLY A 1 1157 ? 131.264 116.190 119.928 1.00 72.23  ? 1136 GLY A O   1 
ATOM   7444 N  N   . VAL A 1 1158 ? 130.544 118.083 120.911 1.00 73.37  ? 1137 VAL A N   1 
ATOM   7445 C  CA  . VAL A 1 1158 ? 130.782 118.859 119.707 1.00 73.37  ? 1137 VAL A CA  1 
ATOM   7446 C  C   . VAL A 1 1158 ? 132.279 119.069 119.488 1.00 73.37  ? 1137 VAL A C   1 
ATOM   7447 O  O   . VAL A 1 1158 ? 132.728 119.192 118.342 1.00 73.37  ? 1137 VAL A O   1 
ATOM   7448 C  CB  . VAL A 1 1158 ? 129.975 120.167 119.798 1.00 73.37  ? 1137 VAL A CB  1 
ATOM   7449 C  CG1 . VAL A 1 1158 ? 130.130 121.025 118.562 1.00 73.37  ? 1137 VAL A CG1 1 
ATOM   7450 C  CG2 . VAL A 1 1158 ? 128.515 119.846 119.997 1.00 73.37  ? 1137 VAL A CG2 1 
ATOM   7451 N  N   . LEU A 1 1159 ? 133.082 119.031 120.553 1.00 86.56  ? 1138 LEU A N   1 
ATOM   7452 C  CA  . LEU A 1 1159 ? 134.533 119.073 120.397 1.00 86.56  ? 1138 LEU A CA  1 
ATOM   7453 C  C   . LEU A 1 1159 ? 135.078 117.807 119.747 1.00 86.56  ? 1138 LEU A C   1 
ATOM   7454 O  O   . LEU A 1 1159 ? 136.162 117.850 119.159 1.00 86.56  ? 1138 LEU A O   1 
ATOM   7455 C  CB  . LEU A 1 1159 ? 135.198 119.323 121.757 1.00 86.56  ? 1138 LEU A CB  1 
ATOM   7456 C  CG  . LEU A 1 1159 ? 136.702 119.577 121.900 1.00 86.56  ? 1138 LEU A CG  1 
ATOM   7457 C  CD1 . LEU A 1 1159 ? 136.961 120.594 122.996 1.00 86.56  ? 1138 LEU A CD1 1 
ATOM   7458 C  CD2 . LEU A 1 1159 ? 137.455 118.282 122.226 1.00 86.56  ? 1138 LEU A CD2 1 
ATOM   7459 N  N   . MET A 1 1160 ? 134.360 116.685 119.828 1.00 82.23  ? 1139 MET A N   1 
ATOM   7460 C  CA  . MET A 1 1160 ? 134.696 115.564 118.958 1.00 82.23  ? 1139 MET A CA  1 
ATOM   7461 C  C   . MET A 1 1160 ? 134.070 115.719 117.576 1.00 82.23  ? 1139 MET A C   1 
ATOM   7462 O  O   . MET A 1 1160 ? 134.637 115.241 116.586 1.00 82.23  ? 1139 MET A O   1 
ATOM   7463 C  CB  . MET A 1 1160 ? 134.288 114.243 119.615 1.00 82.23  ? 1139 MET A CB  1 
ATOM   7464 C  CG  . MET A 1 1160 ? 134.615 112.989 118.805 1.00 82.23  ? 1139 MET A CG  1 
ATOM   7465 S  SD  . MET A 1 1160 ? 136.344 112.809 118.320 1.00 82.23  ? 1139 MET A SD  1 
ATOM   7466 C  CE  . MET A 1 1160 ? 137.096 112.319 119.860 1.00 82.23  ? 1139 MET A CE  1 
ATOM   7467 N  N   . LEU A 1 1161 ? 132.947 116.437 117.473 1.00 73.99  ? 1140 LEU A N   1 
ATOM   7468 C  CA  . LEU A 1 1161 ? 132.316 116.653 116.168 1.00 73.99  ? 1140 LEU A CA  1 
ATOM   7469 C  C   . LEU A 1 1161 ? 133.163 117.508 115.227 1.00 73.99  ? 1140 LEU A C   1 
ATOM   7470 O  O   . LEU A 1 1161 ? 132.947 117.464 114.013 1.00 73.99  ? 1140 LEU A O   1 
ATOM   7471 C  CB  . LEU A 1 1161 ? 130.920 117.264 116.369 1.00 73.99  ? 1140 LEU A CB  1 
ATOM   7472 C  CG  . LEU A 1 1161 ? 129.861 117.538 115.291 1.00 73.99  ? 1140 LEU A CG  1 
ATOM   7473 C  CD1 . LEU A 1 1161 ? 130.027 118.884 114.615 1.00 73.99  ? 1140 LEU A CD1 1 
ATOM   7474 C  CD2 . LEU A 1 1161 ? 129.874 116.440 114.269 1.00 73.99  ? 1140 LEU A CD2 1 
ATOM   7475 N  N   . ALA A 1 1162 ? 134.137 118.253 115.735 1.00 88.79  ? 1141 ALA A N   1 
ATOM   7476 C  CA  . ALA A 1 1162 ? 135.057 118.939 114.846 1.00 88.79  ? 1141 ALA A CA  1 
ATOM   7477 C  C   . ALA A 1 1162 ? 136.011 117.943 114.193 1.00 88.79  ? 1141 ALA A C   1 
ATOM   7478 O  O   . ALA A 1 1162 ? 136.036 116.752 114.513 1.00 88.79  ? 1141 ALA A O   1 
ATOM   7479 C  CB  . ALA A 1 1162 ? 135.858 119.991 115.604 1.00 88.79  ? 1141 ALA A CB  1 
ATOM   7480 N  N   . GLY A 1 1163 ? 136.818 118.448 113.269 1.00 99.22  ? 1142 GLY A N   1 
ATOM   7481 C  CA  . GLY A 1 1163 ? 137.807 117.619 112.620 1.00 99.22  ? 1142 GLY A CA  1 
ATOM   7482 C  C   . GLY A 1 1163 ? 137.288 116.789 111.471 1.00 99.22  ? 1142 GLY A C   1 
ATOM   7483 O  O   . GLY A 1 1163 ? 138.035 115.957 110.943 1.00 99.22  ? 1142 GLY A O   1 
ATOM   7484 N  N   . SER A 1 1164 ? 136.028 116.962 111.090 1.00 98.70  ? 1143 SER A N   1 
ATOM   7485 C  CA  . SER A 1 1164 ? 135.567 116.427 109.823 1.00 98.70  ? 1143 SER A CA  1 
ATOM   7486 C  C   . SER A 1 1164 ? 136.186 117.232 108.692 1.00 98.70  ? 1143 SER A C   1 
ATOM   7487 O  O   . SER A 1 1164 ? 136.526 118.405 108.852 1.00 98.70  ? 1143 SER A O   1 
ATOM   7488 C  CB  . SER A 1 1164 ? 134.044 116.474 109.745 1.00 98.70  ? 1143 SER A CB  1 
ATOM   7489 O  OG  . SER A 1 1164 ? 133.586 117.810 109.767 1.00 98.70  ? 1143 SER A OG  1 
ATOM   7490 N  N   . GLU A 1 1165 ? 136.342 116.591 107.541 1.00 109.73 ? 1144 GLU A N   1 
ATOM   7491 C  CA  . GLU A 1 1165 ? 137.068 117.233 106.456 1.00 109.73 ? 1144 GLU A CA  1 
ATOM   7492 C  C   . GLU A 1 1165 ? 136.211 118.267 105.723 1.00 109.73 ? 1144 GLU A C   1 
ATOM   7493 O  O   . GLU A 1 1165 ? 136.755 119.130 105.022 1.00 109.73 ? 1144 GLU A O   1 
ATOM   7494 C  CB  . GLU A 1 1165 ? 137.610 116.149 105.512 1.00 109.73 ? 1144 GLU A CB  1 
ATOM   7495 C  CG  . GLU A 1 1165 ? 138.670 116.612 104.517 1.00 109.73 ? 1144 GLU A CG  1 
ATOM   7496 C  CD  . GLU A 1 1165 ? 139.299 115.470 103.749 1.00 109.73 ? 1144 GLU A CD  1 
ATOM   7497 O  OE1 . GLU A 1 1165 ? 138.954 114.306 104.039 1.00 109.73 ? 1144 GLU A OE1 1 
ATOM   7498 O  OE2 . GLU A 1 1165 ? 140.128 115.731 102.851 1.00 109.73 ? 1144 GLU A OE2 1 
ATOM   7499 N  N   . PHE A 1 1166 ? 134.896 118.245 105.915 1.00 92.87  ? 1145 PHE A N   1 
ATOM   7500 C  CA  . PHE A 1 1166 ? 134.025 119.190 105.237 1.00 92.87  ? 1145 PHE A CA  1 
ATOM   7501 C  C   . PHE A 1 1166 ? 134.130 120.575 105.871 1.00 92.87  ? 1145 PHE A C   1 
ATOM   7502 O  O   . PHE A 1 1166 ? 134.593 120.738 107.001 1.00 92.87  ? 1145 PHE A O   1 
ATOM   7503 C  CB  . PHE A 1 1166 ? 132.581 118.696 105.279 1.00 92.87  ? 1145 PHE A CB  1 
ATOM   7504 C  CG  . PHE A 1 1166 ? 132.399 117.350 104.662 1.00 92.87  ? 1145 PHE A CG  1 
ATOM   7505 C  CD1 . PHE A 1 1166 ? 132.363 117.198 103.287 1.00 92.87  ? 1145 PHE A CD1 1 
ATOM   7506 C  CD2 . PHE A 1 1166 ? 132.291 116.227 105.456 1.00 92.87  ? 1145 PHE A CD2 1 
ATOM   7507 C  CE1 . PHE A 1 1166 ? 132.218 115.943 102.715 1.00 92.87  ? 1145 PHE A CE1 1 
ATOM   7508 C  CE2 . PHE A 1 1166 ? 132.139 114.973 104.895 1.00 92.87  ? 1145 PHE A CE2 1 
ATOM   7509 C  CZ  . PHE A 1 1166 ? 132.102 114.832 103.522 1.00 92.87  ? 1145 PHE A CZ  1 
ATOM   7510 N  N   . ASP A 1 1167 ? 133.708 121.587 105.112 1.00 93.89  ? 1146 ASP A N   1 
ATOM   7511 C  CA  . ASP A 1 1167 ? 133.587 122.954 105.610 1.00 93.89  ? 1146 ASP A CA  1 
ATOM   7512 C  C   . ASP A 1 1167 ? 132.204 123.244 106.164 1.00 93.89  ? 1146 ASP A C   1 
ATOM   7513 O  O   . ASP A 1 1167 ? 132.050 124.134 107.009 1.00 93.89  ? 1146 ASP A O   1 
ATOM   7514 C  CB  . ASP A 1 1167 ? 133.878 123.958 104.493 1.00 93.89  ? 1146 ASP A CB  1 
ATOM   7515 C  CG  . ASP A 1 1167 ? 135.333 124.000 104.105 1.00 93.89  ? 1146 ASP A CG  1 
ATOM   7516 O  OD1 . ASP A 1 1167 ? 136.183 123.752 104.983 1.00 93.89  ? 1146 ASP A OD1 1 
ATOM   7517 O  OD2 . ASP A 1 1167 ? 135.627 124.288 102.925 1.00 93.89  ? 1146 ASP A OD2 1 
ATOM   7518 N  N   . PHE A 1 1168 ? 131.203 122.527 105.658 1.00 82.68  ? 1147 PHE A N   1 
ATOM   7519 C  CA  . PHE A 1 1168 ? 129.824 122.683 106.098 1.00 82.68  ? 1147 PHE A CA  1 
ATOM   7520 C  C   . PHE A 1 1168 ? 129.674 122.365 107.578 1.00 82.68  ? 1147 PHE A C   1 
ATOM   7521 O  O   . PHE A 1 1168 ? 129.051 123.124 108.329 1.00 82.68  ? 1147 PHE A O   1 
ATOM   7522 C  CB  . PHE A 1 1168 ? 128.950 121.767 105.253 1.00 82.68  ? 1147 PHE A CB  1 
ATOM   7523 C  CG  . PHE A 1 1168 ? 127.516 121.748 105.644 1.00 82.68  ? 1147 PHE A CG  1 
ATOM   7524 C  CD1 . PHE A 1 1168 ? 126.698 122.815 105.356 1.00 82.68  ? 1147 PHE A CD1 1 
ATOM   7525 C  CD2 . PHE A 1 1168 ? 126.974 120.632 106.256 1.00 82.68  ? 1147 PHE A CD2 1 
ATOM   7526 C  CE1 . PHE A 1 1168 ? 125.371 122.784 105.693 1.00 82.68  ? 1147 PHE A CE1 1 
ATOM   7527 C  CE2 . PHE A 1 1168 ? 125.647 120.595 106.597 1.00 82.68  ? 1147 PHE A CE2 1 
ATOM   7528 C  CZ  . PHE A 1 1168 ? 124.844 121.673 106.317 1.00 82.68  ? 1147 PHE A CZ  1 
ATOM   7529 N  N   . ILE A 1 1169 ? 130.261 121.255 108.018 1.00 82.07  ? 1148 ILE A N   1 
ATOM   7530 C  CA  . ILE A 1 1169 ? 130.176 120.868 109.419 1.00 82.07  ? 1148 ILE A CA  1 
ATOM   7531 C  C   . ILE A 1 1169 ? 131.012 121.801 110.284 1.00 82.07  ? 1148 ILE A C   1 
ATOM   7532 O  O   . ILE A 1 1169 ? 130.520 122.358 111.271 1.00 82.07  ? 1148 ILE A O   1 
ATOM   7533 C  CB  . ILE A 1 1169 ? 130.602 119.403 109.590 1.00 82.07  ? 1148 ILE A CB  1 
ATOM   7534 C  CG1 . ILE A 1 1169 ? 129.565 118.473 108.963 1.00 82.07  ? 1148 ILE A CG1 1 
ATOM   7535 C  CG2 . ILE A 1 1169 ? 130.811 119.071 111.031 1.00 82.07  ? 1148 ILE A CG2 1 
ATOM   7536 C  CD1 . ILE A 1 1169 ? 130.005 117.028 108.900 1.00 82.07  ? 1148 ILE A CD1 1 
ATOM   7537 N  N   . VAL A 1 1170 ? 132.278 122.010 109.916 1.00 83.36  ? 1149 VAL A N   1 
ATOM   7538 C  CA  . VAL A 1 1170 ? 133.200 122.724 110.791 1.00 83.36  ? 1149 VAL A CA  1 
ATOM   7539 C  C   . VAL A 1 1170 ? 132.939 124.222 110.822 1.00 83.36  ? 1149 VAL A C   1 
ATOM   7540 O  O   . VAL A 1 1170 ? 133.440 124.913 111.712 1.00 83.36  ? 1149 VAL A O   1 
ATOM   7541 C  CB  . VAL A 1 1170 ? 134.653 122.428 110.363 1.00 83.36  ? 1149 VAL A CB  1 
ATOM   7542 C  CG1 . VAL A 1 1170 ? 135.054 123.256 109.154 1.00 83.36  ? 1149 VAL A CG1 1 
ATOM   7543 C  CG2 . VAL A 1 1170 ? 135.633 122.580 111.520 1.00 83.36  ? 1149 VAL A CG2 1 
ATOM   7544 N  N   . ARG A 1 1171 ? 132.143 124.750 109.892 1.00 83.58  ? 1150 ARG A N   1 
ATOM   7545 C  CA  . ARG A 1 1171 ? 131.777 126.153 109.955 1.00 83.58  ? 1150 ARG A CA  1 
ATOM   7546 C  C   . ARG A 1 1171 ? 130.326 126.388 110.324 1.00 83.58  ? 1150 ARG A C   1 
ATOM   7547 O  O   . ARG A 1 1171 ? 130.004 127.471 110.817 1.00 83.58  ? 1150 ARG A O   1 
ATOM   7548 C  CB  . ARG A 1 1171 ? 132.067 126.853 108.621 1.00 83.58  ? 1150 ARG A CB  1 
ATOM   7549 C  CG  . ARG A 1 1171 ? 133.543 126.966 108.313 1.00 83.58  ? 1150 ARG A CG  1 
ATOM   7550 C  CD  . ARG A 1 1171 ? 133.796 127.744 107.042 1.00 83.58  ? 1150 ARG A CD  1 
ATOM   7551 N  NE  . ARG A 1 1171 ? 135.198 127.657 106.640 1.00 83.58  ? 1150 ARG A NE  1 
ATOM   7552 C  CZ  . ARG A 1 1171 ? 136.157 128.463 107.081 1.00 83.58  ? 1150 ARG A CZ  1 
ATOM   7553 N  NH1 . ARG A 1 1171 ? 137.404 128.308 106.654 1.00 83.58  ? 1150 ARG A NH1 1 
ATOM   7554 N  NH2 . ARG A 1 1171 ? 135.872 129.422 107.952 1.00 83.58  ? 1150 ARG A NH2 1 
ATOM   7555 N  N   . TYR A 1 1172 ? 129.446 125.413 110.116 1.00 84.63  ? 1151 TYR A N   1 
ATOM   7556 C  CA  . TYR A 1 1172 ? 128.038 125.626 110.390 1.00 84.63  ? 1151 TYR A CA  1 
ATOM   7557 C  C   . TYR A 1 1172 ? 127.526 124.913 111.630 1.00 84.63  ? 1151 TYR A C   1 
ATOM   7558 O  O   . TYR A 1 1172 ? 126.515 125.347 112.188 1.00 84.63  ? 1151 TYR A O   1 
ATOM   7559 C  CB  . TYR A 1 1172 ? 127.194 125.195 109.186 1.00 84.63  ? 1151 TYR A CB  1 
ATOM   7560 C  CG  . TYR A 1 1172 ? 127.298 126.126 108.005 1.00 84.63  ? 1151 TYR A CG  1 
ATOM   7561 C  CD1 . TYR A 1 1172 ? 126.552 127.292 107.951 1.00 84.63  ? 1151 TYR A CD1 1 
ATOM   7562 C  CD2 . TYR A 1 1172 ? 128.137 125.838 106.941 1.00 84.63  ? 1151 TYR A CD2 1 
ATOM   7563 C  CE1 . TYR A 1 1172 ? 126.640 128.148 106.868 1.00 84.63  ? 1151 TYR A CE1 1 
ATOM   7564 C  CE2 . TYR A 1 1172 ? 128.232 126.685 105.858 1.00 84.63  ? 1151 TYR A CE2 1 
ATOM   7565 C  CZ  . TYR A 1 1172 ? 127.484 127.835 105.827 1.00 84.63  ? 1151 TYR A CZ  1 
ATOM   7566 O  OH  . TYR A 1 1172 ? 127.588 128.674 104.747 1.00 84.63  ? 1151 TYR A OH  1 
ATOM   7567 N  N   . PHE A 1 1173 ? 128.177 123.852 112.077 1.00 72.45  ? 1152 PHE A N   1 
ATOM   7568 C  CA  . PHE A 1 1173 ? 127.700 123.132 113.250 1.00 72.45  ? 1152 PHE A CA  1 
ATOM   7569 C  C   . PHE A 1 1173 ? 128.711 123.071 114.379 1.00 72.45  ? 1152 PHE A C   1 
ATOM   7570 O  O   . PHE A 1 1173 ? 128.325 123.169 115.540 1.00 72.45  ? 1152 PHE A O   1 
ATOM   7571 C  CB  . PHE A 1 1173 ? 127.282 121.713 112.873 1.00 72.45  ? 1152 PHE A CB  1 
ATOM   7572 C  CG  . PHE A 1 1173 ? 126.036 121.652 112.049 1.00 72.45  ? 1152 PHE A CG  1 
ATOM   7573 C  CD1 . PHE A 1 1173 ? 124.793 121.748 112.644 1.00 72.45  ? 1152 PHE A CD1 1 
ATOM   7574 C  CD2 . PHE A 1 1173 ? 126.104 121.493 110.680 1.00 72.45  ? 1152 PHE A CD2 1 
ATOM   7575 C  CE1 . PHE A 1 1173 ? 123.637 121.682 111.885 1.00 72.45  ? 1152 PHE A CE1 1 
ATOM   7576 C  CE2 . PHE A 1 1173 ? 124.951 121.430 109.920 1.00 72.45  ? 1152 PHE A CE2 1 
ATOM   7577 C  CZ  . PHE A 1 1173 ? 123.718 121.526 110.525 1.00 72.45  ? 1152 PHE A CZ  1 
ATOM   7578 N  N   . PHE A 1 1174 ? 129.996 122.903 114.086 1.00 88.29  ? 1153 PHE A N   1 
ATOM   7579 C  CA  . PHE A 1 1174 ? 130.968 122.947 115.169 1.00 88.29  ? 1153 PHE A CA  1 
ATOM   7580 C  C   . PHE A 1 1174 ? 131.230 124.369 115.630 1.00 88.29  ? 1153 PHE A C   1 
ATOM   7581 O  O   . PHE A 1 1174 ? 131.126 124.668 116.821 1.00 88.29  ? 1153 PHE A O   1 
ATOM   7582 C  CB  . PHE A 1 1174 ? 132.282 122.297 114.768 1.00 88.29  ? 1153 PHE A CB  1 
ATOM   7583 C  CG  . PHE A 1 1174 ? 133.385 122.584 115.735 1.00 88.29  ? 1153 PHE A CG  1 
ATOM   7584 C  CD1 . PHE A 1 1174 ? 133.342 122.075 117.021 1.00 88.29  ? 1153 PHE A CD1 1 
ATOM   7585 C  CD2 . PHE A 1 1174 ? 134.456 123.380 115.369 1.00 88.29  ? 1153 PHE A CD2 1 
ATOM   7586 C  CE1 . PHE A 1 1174 ? 134.350 122.345 117.917 1.00 88.29  ? 1153 PHE A CE1 1 
ATOM   7587 C  CE2 . PHE A 1 1174 ? 135.464 123.652 116.261 1.00 88.29  ? 1153 PHE A CE2 1 
ATOM   7588 C  CZ  . PHE A 1 1174 ? 135.411 123.134 117.536 1.00 88.29  ? 1153 PHE A CZ  1 
ATOM   7589 N  N   . ALA A 1 1175 ? 131.569 125.265 114.713 1.00 77.14  ? 1154 ALA A N   1 
ATOM   7590 C  CA  . ALA A 1 1175 ? 131.933 126.617 115.109 1.00 77.14  ? 1154 ALA A CA  1 
ATOM   7591 C  C   . ALA A 1 1175 ? 130.745 127.469 115.523 1.00 77.14  ? 1154 ALA A C   1 
ATOM   7592 O  O   . ALA A 1 1175 ? 130.935 128.656 115.802 1.00 77.14  ? 1154 ALA A O   1 
ATOM   7593 C  CB  . ALA A 1 1175 ? 132.683 127.316 113.978 1.00 77.14  ? 1154 ALA A CB  1 
ATOM   7594 N  N   . VAL A 1 1176 ? 129.535 126.919 115.564 1.00 69.59  ? 1155 VAL A N   1 
ATOM   7595 C  CA  . VAL A 1 1176 ? 128.383 127.615 116.098 1.00 69.59  ? 1155 VAL A CA  1 
ATOM   7596 C  C   . VAL A 1 1176 ? 127.932 127.015 117.424 1.00 69.59  ? 1155 VAL A C   1 
ATOM   7597 O  O   . VAL A 1 1176 ? 127.586 127.752 118.349 1.00 69.59  ? 1155 VAL A O   1 
ATOM   7598 C  CB  . VAL A 1 1176 ? 127.229 127.629 115.075 1.00 69.59  ? 1155 VAL A CB  1 
ATOM   7599 C  CG1 . VAL A 1 1176 ? 126.124 128.536 115.547 1.00 69.59  ? 1155 VAL A CG1 1 
ATOM   7600 C  CG2 . VAL A 1 1176 ? 127.731 128.079 113.733 1.00 69.59  ? 1155 VAL A CG2 1 
ATOM   7601 N  N   . LEU A 1 1177 ? 127.957 125.685 117.555 1.00 67.11  ? 1156 LEU A N   1 
ATOM   7602 C  CA  . LEU A 1 1177 ? 127.647 125.081 118.847 1.00 67.11  ? 1156 LEU A CA  1 
ATOM   7603 C  C   . LEU A 1 1177 ? 128.756 125.319 119.861 1.00 67.11  ? 1156 LEU A C   1 
ATOM   7604 O  O   . LEU A 1 1177 ? 128.481 125.640 121.020 1.00 67.11  ? 1156 LEU A O   1 
ATOM   7605 C  CB  . LEU A 1 1177 ? 127.399 123.581 118.719 1.00 67.11  ? 1156 LEU A CB  1 
ATOM   7606 C  CG  . LEU A 1 1177 ? 125.985 123.046 118.481 1.00 67.11  ? 1156 LEU A CG  1 
ATOM   7607 C  CD1 . LEU A 1 1177 ? 125.031 123.569 119.539 1.00 67.11  ? 1156 LEU A CD1 1 
ATOM   7608 C  CD2 . LEU A 1 1177 ? 125.464 123.320 117.105 1.00 67.11  ? 1156 LEU A CD2 1 
ATOM   7609 N  N   . ALA A 1 1178 ? 130.012 125.161 119.459 1.00 58.05  ? 1157 ALA A N   1 
ATOM   7610 C  CA  . ALA A 1 1178 ? 131.103 125.320 120.409 1.00 58.05  ? 1157 ALA A CA  1 
ATOM   7611 C  C   . ALA A 1 1178 ? 131.381 126.774 120.759 1.00 58.05  ? 1157 ALA A C   1 
ATOM   7612 O  O   . ALA A 1 1178 ? 132.114 127.032 121.718 1.00 58.05  ? 1157 ALA A O   1 
ATOM   7613 C  CB  . ALA A 1 1178 ? 132.375 124.665 119.874 1.00 58.05  ? 1157 ALA A CB  1 
ATOM   7614 N  N   . ILE A 1 1179 ? 130.833 127.729 120.006 1.00 58.92  ? 1158 ILE A N   1 
ATOM   7615 C  CA  . ILE A 1 1179 ? 130.839 129.123 120.428 1.00 58.92  ? 1158 ILE A CA  1 
ATOM   7616 C  C   . ILE A 1 1179 ? 129.541 129.478 121.142 1.00 58.92  ? 1158 ILE A C   1 
ATOM   7617 O  O   . ILE A 1 1179 ? 129.439 130.565 121.732 1.00 58.92  ? 1158 ILE A O   1 
ATOM   7618 C  CB  . ILE A 1 1179 ? 131.101 130.058 119.222 1.00 58.92  ? 1158 ILE A CB  1 
ATOM   7619 C  CG1 . ILE A 1 1179 ? 131.752 131.368 119.662 1.00 58.92  ? 1158 ILE A CG1 1 
ATOM   7620 C  CG2 . ILE A 1 1179 ? 129.822 130.348 118.467 1.00 58.92  ? 1158 ILE A CG2 1 
ATOM   7621 C  CD1 . ILE A 1 1179 ? 133.147 131.221 120.218 1.00 58.92  ? 1158 ILE A CD1 1 
ATOM   7622 N  N   . LEU A 1 1180 ? 128.563 128.575 121.150 1.00 51.69  ? 1159 LEU A N   1 
ATOM   7623 C  CA  . LEU A 1 1180 ? 127.353 128.787 121.932 1.00 51.69  ? 1159 LEU A CA  1 
ATOM   7624 C  C   . LEU A 1 1180 ? 127.562 128.433 123.397 1.00 51.69  ? 1159 LEU A C   1 
ATOM   7625 O  O   . LEU A 1 1180 ? 127.027 129.118 124.276 1.00 51.69  ? 1159 LEU A O   1 
ATOM   7626 C  CB  . LEU A 1 1180 ? 126.200 127.976 121.333 1.00 51.69  ? 1159 LEU A CB  1 
ATOM   7627 C  CG  . LEU A 1 1180 ? 124.752 127.948 121.839 1.00 51.69  ? 1159 LEU A CG  1 
ATOM   7628 C  CD1 . LEU A 1 1180 ? 124.504 126.924 122.943 1.00 51.69  ? 1159 LEU A CD1 1 
ATOM   7629 C  CD2 . LEU A 1 1180 ? 124.356 129.304 122.318 1.00 51.69  ? 1159 LEU A CD2 1 
ATOM   7630 N  N   . THR A 1 1181 ? 128.309 127.362 123.681 1.00 58.12  ? 1160 THR A N   1 
ATOM   7631 C  CA  . THR A 1 1181 ? 128.405 126.894 125.058 1.00 58.12  ? 1160 THR A CA  1 
ATOM   7632 C  C   . THR A 1 1181 ? 129.256 127.828 125.895 1.00 58.12  ? 1160 THR A C   1 
ATOM   7633 O  O   . THR A 1 1181 ? 128.965 128.043 127.072 1.00 58.12  ? 1160 THR A O   1 
ATOM   7634 C  CB  . THR A 1 1181 ? 128.981 125.486 125.117 1.00 58.12  ? 1160 THR A CB  1 
ATOM   7635 O  OG1 . THR A 1 1181 ? 130.359 125.529 124.746 1.00 58.12  ? 1160 THR A OG1 1 
ATOM   7636 C  CG2 . THR A 1 1181 ? 128.254 124.589 124.159 1.00 58.12  ? 1160 THR A CG2 1 
ATOM   7637 N  N   . ILE A 1 1182 ? 130.297 128.408 125.296 1.00 68.17  ? 1161 ILE A N   1 
ATOM   7638 C  CA  . ILE A 1 1182 ? 131.187 129.301 126.033 1.00 68.17  ? 1161 ILE A CA  1 
ATOM   7639 C  C   . ILE A 1 1182 ? 130.463 130.580 126.420 1.00 68.17  ? 1161 ILE A C   1 
ATOM   7640 O  O   . ILE A 1 1182 ? 130.408 130.948 127.604 1.00 68.17  ? 1161 ILE A O   1 
ATOM   7641 C  CB  . ILE A 1 1182 ? 132.443 129.597 125.203 1.00 68.17  ? 1161 ILE A CB  1 
ATOM   7642 C  CG1 . ILE A 1 1182 ? 133.194 128.297 124.923 1.00 68.17  ? 1161 ILE A CG1 1 
ATOM   7643 C  CG2 . ILE A 1 1182 ? 133.312 130.603 125.916 1.00 68.17  ? 1161 ILE A CG2 1 
ATOM   7644 C  CD1 . ILE A 1 1182 ? 133.633 127.567 126.174 1.00 68.17  ? 1161 ILE A CD1 1 
ATOM   7645 N  N   . LEU A 1 1183 ? 129.863 131.249 125.431 1.00 67.92  ? 1162 LEU A N   1 
ATOM   7646 C  CA  . LEU A 1 1183 ? 129.102 132.463 125.690 1.00 67.92  ? 1162 LEU A CA  1 
ATOM   7647 C  C   . LEU A 1 1183 ? 127.879 132.192 126.546 1.00 67.92  ? 1162 LEU A C   1 
ATOM   7648 O  O   . LEU A 1 1183 ? 127.445 133.072 127.295 1.00 67.92  ? 1162 LEU A O   1 
ATOM   7649 C  CB  . LEU A 1 1183 ? 128.690 133.131 124.384 1.00 67.92  ? 1162 LEU A CB  1 
ATOM   7650 C  CG  . LEU A 1 1183 ? 129.667 134.085 123.701 1.00 67.92  ? 1162 LEU A CG  1 
ATOM   7651 C  CD1 . LEU A 1 1183 ? 130.812 133.368 122.997 1.00 67.92  ? 1162 LEU A CD1 1 
ATOM   7652 C  CD2 . LEU A 1 1183 ? 128.904 134.965 122.734 1.00 67.92  ? 1162 LEU A CD2 1 
ATOM   7653 N  N   . GLY A 1 1184 ? 127.338 130.978 126.486 1.00 57.85  ? 1163 GLY A N   1 
ATOM   7654 C  CA  . GLY A 1 1184 ? 126.265 130.630 127.395 1.00 57.85  ? 1163 GLY A CA  1 
ATOM   7655 C  C   . GLY A 1 1184 ? 126.741 130.476 128.826 1.00 57.85  ? 1163 GLY A C   1 
ATOM   7656 O  O   . GLY A 1 1184 ? 126.028 130.835 129.766 1.00 57.85  ? 1163 GLY A O   1 
ATOM   7657 N  N   . VAL A 1 1185 ? 127.958 129.961 129.013 1.00 54.50  ? 1164 VAL A N   1 
ATOM   7658 C  CA  . VAL A 1 1185 ? 128.454 129.711 130.362 1.00 54.50  ? 1164 VAL A CA  1 
ATOM   7659 C  C   . VAL A 1 1185 ? 128.853 131.009 131.044 1.00 54.50  ? 1164 VAL A C   1 
ATOM   7660 O  O   . VAL A 1 1185 ? 128.452 131.260 132.188 1.00 54.50  ? 1164 VAL A O   1 
ATOM   7661 C  CB  . VAL A 1 1185 ? 129.596 128.686 130.339 1.00 54.50  ? 1164 VAL A CB  1 
ATOM   7662 C  CG1 . VAL A 1 1185 ? 130.400 128.729 131.610 1.00 54.50  ? 1164 VAL A CG1 1 
ATOM   7663 C  CG2 . VAL A 1 1185 ? 128.977 127.343 130.248 1.00 54.50  ? 1164 VAL A CG2 1 
ATOM   7664 N  N   . LEU A 1 1186 ? 129.632 131.863 130.371 1.00 67.16  ? 1165 LEU A N   1 
ATOM   7665 C  CA  . LEU A 1 1186 ? 129.947 133.100 131.077 1.00 67.16  ? 1165 LEU A CA  1 
ATOM   7666 C  C   . LEU A 1 1186 ? 128.758 134.046 131.092 1.00 67.16  ? 1165 LEU A C   1 
ATOM   7667 O  O   . LEU A 1 1186 ? 128.616 134.830 132.040 1.00 67.16  ? 1165 LEU A O   1 
ATOM   7668 C  CB  . LEU A 1 1186 ? 131.171 133.820 130.506 1.00 67.16  ? 1165 LEU A CB  1 
ATOM   7669 C  CG  . LEU A 1 1186 ? 131.125 134.780 129.329 1.00 67.16  ? 1165 LEU A CG  1 
ATOM   7670 C  CD1 . LEU A 1 1186 ? 132.248 135.748 129.509 1.00 67.16  ? 1165 LEU A CD1 1 
ATOM   7671 C  CD2 . LEU A 1 1186 ? 131.379 134.045 128.083 1.00 67.16  ? 1165 LEU A CD2 1 
ATOM   7672 N  N   . ASN A 1 1187 ? 127.874 133.933 130.099 1.00 68.41  ? 1166 ASN A N   1 
ATOM   7673 C  CA  . ASN A 1 1187 ? 126.688 134.776 130.051 1.00 68.41  ? 1166 ASN A CA  1 
ATOM   7674 C  C   . ASN A 1 1187 ? 125.751 134.455 131.206 1.00 68.41  ? 1166 ASN A C   1 
ATOM   7675 O  O   . ASN A 1 1187 ? 125.450 135.323 132.033 1.00 68.41  ? 1166 ASN A O   1 
ATOM   7676 C  CB  . ASN A 1 1187 ? 125.981 134.593 128.711 1.00 68.41  ? 1166 ASN A CB  1 
ATOM   7677 C  CG  . ASN A 1 1187 ? 125.035 135.714 128.396 1.00 68.41  ? 1166 ASN A CG  1 
ATOM   7678 O  OD1 . ASN A 1 1187 ? 124.860 136.636 129.189 1.00 68.41  ? 1166 ASN A OD1 1 
ATOM   7679 N  ND2 . ASN A 1 1187 ? 124.431 135.659 127.217 1.00 68.41  ? 1166 ASN A ND2 1 
ATOM   7680 N  N   . GLY A 1 1188 ? 125.321 133.202 131.311 1.00 60.54  ? 1167 GLY A N   1 
ATOM   7681 C  CA  . GLY A 1 1188 ? 124.426 132.822 132.385 1.00 60.54  ? 1167 GLY A CA  1 
ATOM   7682 C  C   . GLY A 1 1188 ? 125.101 132.716 133.737 1.00 60.54  ? 1167 GLY A C   1 
ATOM   7683 O  O   . GLY A 1 1188 ? 124.679 133.361 134.706 1.00 60.54  ? 1167 GLY A O   1 
ATOM   7684 N  N   . LEU A 1 1189 ? 126.160 131.905 133.799 1.00 62.33  ? 1168 LEU A N   1 
ATOM   7685 C  CA  . LEU A 1 1189 ? 126.830 131.623 135.064 1.00 62.33  ? 1168 LEU A CA  1 
ATOM   7686 C  C   . LEU A 1 1189 ? 127.568 132.839 135.608 1.00 62.33  ? 1168 LEU A C   1 
ATOM   7687 O  O   . LEU A 1 1189 ? 127.727 132.961 136.828 1.00 62.33  ? 1168 LEU A O   1 
ATOM   7688 C  CB  . LEU A 1 1189 ? 127.789 130.436 134.895 1.00 62.33  ? 1168 LEU A CB  1 
ATOM   7689 C  CG  . LEU A 1 1189 ? 128.547 129.843 136.092 1.00 62.33  ? 1168 LEU A CG  1 
ATOM   7690 C  CD1 . LEU A 1 1189 ? 128.651 128.354 135.947 1.00 62.33  ? 1168 LEU A CD1 1 
ATOM   7691 C  CD2 . LEU A 1 1189 ? 129.948 130.410 136.197 1.00 62.33  ? 1168 LEU A CD2 1 
ATOM   7692 N  N   . VAL A 1 1190 ? 128.043 133.733 134.748 1.00 57.42  ? 1169 VAL A N   1 
ATOM   7693 C  CA  . VAL A 1 1190 ? 128.708 134.915 135.276 1.00 57.42  ? 1169 VAL A CA  1 
ATOM   7694 C  C   . VAL A 1 1190 ? 127.736 136.075 135.415 1.00 57.42  ? 1169 VAL A C   1 
ATOM   7695 O  O   . VAL A 1 1190 ? 127.714 136.745 136.447 1.00 57.42  ? 1169 VAL A O   1 
ATOM   7696 C  CB  . VAL A 1 1190 ? 129.930 135.273 134.411 1.00 57.42  ? 1169 VAL A CB  1 
ATOM   7697 C  CG1 . VAL A 1 1190 ? 130.531 136.577 134.851 1.00 57.42  ? 1169 VAL A CG1 1 
ATOM   7698 C  CG2 . VAL A 1 1190 ? 130.975 134.190 134.542 1.00 57.42  ? 1169 VAL A CG2 1 
ATOM   7699 N  N   . LEU A 1 1191 ? 126.868 136.292 134.429 1.00 65.67  ? 1170 LEU A N   1 
ATOM   7700 C  CA  . LEU A 1 1191 ? 126.021 137.479 134.468 1.00 65.67  ? 1170 LEU A CA  1 
ATOM   7701 C  C   . LEU A 1 1191 ? 124.895 137.342 135.485 1.00 65.67  ? 1170 LEU A C   1 
ATOM   7702 O  O   . LEU A 1 1191 ? 124.615 138.294 136.222 1.00 65.67  ? 1170 LEU A O   1 
ATOM   7703 C  CB  . LEU A 1 1191 ? 125.478 137.775 133.069 1.00 65.67  ? 1170 LEU A CB  1 
ATOM   7704 C  CG  . LEU A 1 1191 ? 124.729 139.067 132.718 1.00 65.67  ? 1170 LEU A CG  1 
ATOM   7705 C  CD1 . LEU A 1 1191 ? 123.236 138.935 132.900 1.00 65.67  ? 1170 LEU A CD1 1 
ATOM   7706 C  CD2 . LEU A 1 1191 ? 125.245 140.234 133.552 1.00 65.67  ? 1170 LEU A CD2 1 
ATOM   7707 N  N   . LEU A 1 1192 ? 124.240 136.181 135.552 1.00 48.26  ? 1171 LEU A N   1 
ATOM   7708 C  CA  . LEU A 1 1192 ? 123.052 136.094 136.401 1.00 48.26  ? 1171 LEU A CA  1 
ATOM   7709 C  C   . LEU A 1 1192 ? 123.244 136.172 137.919 1.00 48.26  ? 1171 LEU A C   1 
ATOM   7710 O  O   . LEU A 1 1192 ? 122.355 136.707 138.594 1.00 48.26  ? 1171 LEU A O   1 
ATOM   7711 C  CB  . LEU A 1 1192 ? 122.263 134.831 136.091 1.00 48.26  ? 1171 LEU A CB  1 
ATOM   7712 C  CG  . LEU A 1 1192 ? 121.464 134.958 134.825 1.00 48.26  ? 1171 LEU A CG  1 
ATOM   7713 C  CD1 . LEU A 1 1192 ? 120.736 133.691 134.661 1.00 48.26  ? 1171 LEU A CD1 1 
ATOM   7714 C  CD2 . LEU A 1 1192 ? 120.497 136.070 135.007 1.00 48.26  ? 1171 LEU A CD2 1 
ATOM   7715 N  N   . PRO A 1 1193 ? 124.322 135.653 138.517 1.00 65.63  ? 1172 PRO A N   1 
ATOM   7716 C  CA  . PRO A 1 1193 ? 124.557 136.025 139.916 1.00 65.63  ? 1172 PRO A CA  1 
ATOM   7717 C  C   . PRO A 1 1193 ? 124.889 137.495 140.081 1.00 65.63  ? 1172 PRO A C   1 
ATOM   7718 O  O   . PRO A 1 1193 ? 124.471 138.107 141.071 1.00 65.63  ? 1172 PRO A O   1 
ATOM   7719 C  CB  . PRO A 1 1193 ? 125.726 135.123 140.326 1.00 65.63  ? 1172 PRO A CB  1 
ATOM   7720 C  CG  . PRO A 1 1193 ? 125.637 133.984 139.433 1.00 65.63  ? 1172 PRO A CG  1 
ATOM   7721 C  CD  . PRO A 1 1193 ? 125.191 134.526 138.137 1.00 65.63  ? 1172 PRO A CD  1 
ATOM   7722 N  N   . VAL A 1 1194 ? 125.619 138.079 139.129 1.00 55.26  ? 1173 VAL A N   1 
ATOM   7723 C  CA  . VAL A 1 1194 ? 125.977 139.490 139.221 1.00 55.26  ? 1173 VAL A CA  1 
ATOM   7724 C  C   . VAL A 1 1194 ? 124.745 140.366 139.045 1.00 55.26  ? 1173 VAL A C   1 
ATOM   7725 O  O   . VAL A 1 1194 ? 124.509 141.293 139.829 1.00 55.26  ? 1173 VAL A O   1 
ATOM   7726 C  CB  . VAL A 1 1194 ? 127.065 139.831 138.191 1.00 55.26  ? 1173 VAL A CB  1 
ATOM   7727 C  CG1 . VAL A 1 1194 ? 127.291 141.322 138.130 1.00 55.26  ? 1173 VAL A CG1 1 
ATOM   7728 C  CG2 . VAL A 1 1194 ? 128.349 139.152 138.562 1.00 55.26  ? 1173 VAL A CG2 1 
ATOM   7729 N  N   . LEU A 1 1195 ? 123.935 140.077 138.027 1.00 46.76  ? 1174 LEU A N   1 
ATOM   7730 C  CA  . LEU A 1 1195 ? 122.737 140.872 137.794 1.00 46.76  ? 1174 LEU A CA  1 
ATOM   7731 C  C   . LEU A 1 1195 ? 121.721 140.651 138.900 1.00 46.76  ? 1174 LEU A C   1 
ATOM   7732 O  O   . LEU A 1 1195 ? 121.191 141.611 139.466 1.00 46.76  ? 1174 LEU A O   1 
ATOM   7733 C  CB  . LEU A 1 1195 ? 122.139 140.542 136.423 1.00 46.76  ? 1174 LEU A CB  1 
ATOM   7734 C  CG  . LEU A 1 1195 ? 120.959 141.362 135.884 1.00 46.76  ? 1174 LEU A CG  1 
ATOM   7735 C  CD1 . LEU A 1 1195 ? 121.090 141.523 134.401 1.00 46.76  ? 1174 LEU A CD1 1 
ATOM   7736 C  CD2 . LEU A 1 1195 ? 119.661 140.668 136.136 1.00 46.76  ? 1174 LEU A CD2 1 
ATOM   7737 N  N   . LEU A 1 1196 ? 121.466 139.393 139.249 1.00 43.72  ? 1175 LEU A N   1 
ATOM   7738 C  CA  . LEU A 1 1196 ? 120.493 139.095 140.289 1.00 43.72  ? 1175 LEU A CA  1 
ATOM   7739 C  C   . LEU A 1 1196 ? 120.976 139.468 141.679 1.00 43.72  ? 1175 LEU A C   1 
ATOM   7740 O  O   . LEU A 1 1196 ? 120.172 139.455 142.614 1.00 43.72  ? 1175 LEU A O   1 
ATOM   7741 C  CB  . LEU A 1 1196 ? 120.103 137.616 140.244 1.00 43.72  ? 1175 LEU A CB  1 
ATOM   7742 C  CG  . LEU A 1 1196 ? 118.848 137.196 139.479 1.00 43.72  ? 1175 LEU A CG  1 
ATOM   7743 C  CD1 . LEU A 1 1196 ? 118.918 137.591 138.064 1.00 43.72  ? 1175 LEU A CD1 1 
ATOM   7744 C  CD2 . LEU A 1 1196 ? 118.740 135.702 139.531 1.00 43.72  ? 1175 LEU A CD2 1 
ATOM   7745 N  N   . SER A 1 1197 ? 122.254 139.802 141.847 1.00 62.43  ? 1176 SER A N   1 
ATOM   7746 C  CA  . SER A 1 1197 ? 122.665 140.430 143.091 1.00 62.43  ? 1176 SER A CA  1 
ATOM   7747 C  C   . SER A 1 1197 ? 122.227 141.881 143.155 1.00 62.43  ? 1176 SER A C   1 
ATOM   7748 O  O   . SER A 1 1197 ? 122.158 142.444 144.251 1.00 62.43  ? 1176 SER A O   1 
ATOM   7749 C  CB  . SER A 1 1197 ? 124.175 140.334 143.275 1.00 62.43  ? 1176 SER A CB  1 
ATOM   7750 O  OG  . SER A 1 1197 ? 124.568 138.986 143.451 1.00 62.43  ? 1176 SER A OG  1 
ATOM   7751 N  N   . PHE A 1 1198 ? 121.918 142.497 142.013 1.00 58.90  ? 1177 PHE A N   1 
ATOM   7752 C  CA  . PHE A 1 1198 ? 121.468 143.880 142.054 1.00 58.90  ? 1177 PHE A CA  1 
ATOM   7753 C  C   . PHE A 1 1198 ? 119.977 143.959 142.353 1.00 58.90  ? 1177 PHE A C   1 
ATOM   7754 O  O   . PHE A 1 1198 ? 119.552 144.769 143.183 1.00 58.90  ? 1177 PHE A O   1 
ATOM   7755 C  CB  . PHE A 1 1198 ? 121.787 144.586 140.740 1.00 58.90  ? 1177 PHE A CB  1 
ATOM   7756 C  CG  . PHE A 1 1198 ? 121.634 146.077 140.807 1.00 58.90  ? 1177 PHE A CG  1 
ATOM   7757 C  CD1 . PHE A 1 1198 ? 122.626 146.859 141.381 1.00 58.90  ? 1177 PHE A CD1 1 
ATOM   7758 C  CD2 . PHE A 1 1198 ? 120.503 146.697 140.314 1.00 58.90  ? 1177 PHE A CD2 1 
ATOM   7759 C  CE1 . PHE A 1 1198 ? 122.499 148.242 141.449 1.00 58.90  ? 1177 PHE A CE1 1 
ATOM   7760 C  CE2 . PHE A 1 1198 ? 120.368 148.076 140.382 1.00 58.90  ? 1177 PHE A CE2 1 
ATOM   7761 C  CZ  . PHE A 1 1198 ? 121.371 148.848 140.949 1.00 58.90  ? 1177 PHE A CZ  1 
ATOM   7762 N  N   . PHE A 1 1199 ? 119.174 143.119 141.707 1.00 63.27  ? 1178 PHE A N   1 
ATOM   7763 C  CA  . PHE A 1 1199 ? 117.727 143.151 141.881 1.00 63.27  ? 1178 PHE A CA  1 
ATOM   7764 C  C   . PHE A 1 1199 ? 117.178 141.745 141.665 1.00 63.27  ? 1178 PHE A C   1 
ATOM   7765 O  O   . PHE A 1 1199 ? 117.931 140.778 141.527 1.00 63.27  ? 1178 PHE A O   1 
ATOM   7766 C  CB  . PHE A 1 1199 ? 117.094 144.186 140.942 1.00 63.27  ? 1178 PHE A CB  1 
ATOM   7767 C  CG  . PHE A 1 1199 ? 117.187 143.838 139.487 1.00 63.27  ? 1178 PHE A CG  1 
ATOM   7768 C  CD1 . PHE A 1 1199 ? 118.318 144.149 138.758 1.00 63.27  ? 1178 PHE A CD1 1 
ATOM   7769 C  CD2 . PHE A 1 1199 ? 116.117 143.258 138.834 1.00 63.27  ? 1178 PHE A CD2 1 
ATOM   7770 C  CE1 . PHE A 1 1199 ? 118.398 143.843 137.419 1.00 63.27  ? 1178 PHE A CE1 1 
ATOM   7771 C  CE2 . PHE A 1 1199 ? 116.188 142.950 137.501 1.00 63.27  ? 1178 PHE A CE2 1 
ATOM   7772 C  CZ  . PHE A 1 1199 ? 117.325 143.254 136.789 1.00 63.27  ? 1178 PHE A CZ  1 
ATOM   7773 N  N   . GLY A 1 1200 ? 115.863 141.589 141.582 1.00 79.26  ? 1179 GLY A N   1 
ATOM   7774 C  CA  . GLY A 1 1200 ? 115.393 140.247 141.307 1.00 79.26  ? 1179 GLY A CA  1 
ATOM   7775 C  C   . GLY A 1 1200 ? 114.074 139.641 141.734 1.00 79.26  ? 1179 GLY A C   1 
ATOM   7776 O  O   . GLY A 1 1200 ? 113.024 140.277 141.704 1.00 79.26  ? 1179 GLY A O   1 
ATOM   7777 N  N   . PRO A 1 1201 ? 114.156 138.376 142.155 1.00 88.92  ? 1180 PRO A N   1 
ATOM   7778 C  CA  . PRO A 1 1201 ? 113.163 137.379 142.564 1.00 88.92  ? 1180 PRO A CA  1 
ATOM   7779 C  C   . PRO A 1 1201 ? 112.246 137.639 143.755 1.00 88.92  ? 1180 PRO A C   1 
ATOM   7780 O  O   . PRO A 1 1201 ? 111.104 137.210 143.608 1.00 88.92  ? 1180 PRO A O   1 
ATOM   7781 C  CB  . PRO A 1 1201 ? 114.010 136.125 142.826 1.00 88.92  ? 1180 PRO A CB  1 
ATOM   7782 C  CG  . PRO A 1 1201 ? 115.399 136.620 143.014 1.00 88.92  ? 1180 PRO A CG  1 
ATOM   7783 C  CD  . PRO A 1 1201 ? 115.505 137.795 142.098 1.00 88.92  ? 1180 PRO A CD  1 
ATOM   7784 N  N   . TYR A 1 1202 ? 112.681 138.263 144.854 1.00 93.76  ? 1181 TYR A N   1 
ATOM   7785 C  CA  . TYR A 1 1202 ? 111.791 138.463 146.014 1.00 93.76  ? 1181 TYR A CA  1 
ATOM   7786 C  C   . TYR A 1 1202 ? 111.194 137.104 146.439 1.00 93.76  ? 1181 TYR A C   1 
ATOM   7787 O  O   . TYR A 1 1202 ? 109.978 136.895 146.408 1.00 93.76  ? 1181 TYR A O   1 
ATOM   7788 C  CB  . TYR A 1 1202 ? 110.746 139.567 145.750 1.00 93.76  ? 1181 TYR A CB  1 
ATOM   7789 C  CG  . TYR A 1 1202 ? 109.509 139.544 146.624 1.00 93.76  ? 1181 TYR A CG  1 
ATOM   7790 C  CD1 . TYR A 1 1202 ? 109.555 139.086 147.932 1.00 93.76  ? 1181 TYR A CD1 1 
ATOM   7791 C  CD2 . TYR A 1 1202 ? 108.291 139.994 146.133 1.00 93.76  ? 1181 TYR A CD2 1 
ATOM   7792 C  CE1 . TYR A 1 1202 ? 108.420 139.070 148.721 1.00 93.76  ? 1181 TYR A CE1 1 
ATOM   7793 C  CE2 . TYR A 1 1202 ? 107.154 139.983 146.915 1.00 93.76  ? 1181 TYR A CE2 1 
ATOM   7794 C  CZ  . TYR A 1 1202 ? 107.225 139.522 148.206 1.00 93.76  ? 1181 TYR A CZ  1 
ATOM   7795 O  OH  . TYR A 1 1202 ? 106.092 139.516 148.980 1.00 93.76  ? 1181 TYR A OH  1 
ATOM   7796 N  N   . PRO A 1 1203 ? 112.093 136.260 146.986 1.00 89.32  ? 1182 PRO A N   1 
ATOM   7797 C  CA  . PRO A 1 1203 ? 112.243 134.911 147.560 1.00 89.32  ? 1182 PRO A CA  1 
ATOM   7798 C  C   . PRO A 1 1203 ? 111.047 134.264 148.246 1.00 89.32  ? 1182 PRO A C   1 
ATOM   7799 O  O   . PRO A 1 1203 ? 110.354 134.875 149.053 1.00 89.32  ? 1182 PRO A O   1 
ATOM   7800 C  CB  . PRO A 1 1203 ? 113.371 135.090 148.591 1.00 89.32  ? 1182 PRO A CB  1 
ATOM   7801 C  CG  . PRO A 1 1203 ? 113.816 136.515 148.491 1.00 89.32  ? 1182 PRO A CG  1 
ATOM   7802 C  CD  . PRO A 1 1203 ? 113.341 137.012 147.166 1.00 89.32  ? 1182 PRO A CD  1 
ATOM   7803 N  N   . GLU A 1 1204 ? 110.859 132.990 147.919 1.00 101.35 ? 1183 GLU A N   1 
ATOM   7804 C  CA  . GLU A 1 1204 ? 109.781 132.152 148.429 1.00 101.35 ? 1183 GLU A CA  1 
ATOM   7805 C  C   . GLU A 1 1204 ? 109.785 131.867 149.936 1.00 101.35 ? 1183 GLU A C   1 
ATOM   7806 O  O   . GLU A 1 1204 ? 108.728 131.867 150.565 1.00 101.35 ? 1183 GLU A O   1 
ATOM   7807 C  CB  . GLU A 1 1204 ? 109.742 130.837 147.631 1.00 101.35 ? 1183 GLU A CB  1 
ATOM   7808 C  CG  . GLU A 1 1204 ? 109.537 129.567 148.448 1.00 101.35 ? 1183 GLU A CG  1 
ATOM   7809 C  CD  . GLU A 1 1204 ? 110.639 128.543 148.235 1.00 101.35 ? 1183 GLU A CD  1 
ATOM   7810 O  OE1 . GLU A 1 1204 ? 111.781 128.947 147.929 1.00 101.35 ? 1183 GLU A OE1 1 
ATOM   7811 O  OE2 . GLU A 1 1204 ? 110.365 127.331 148.376 1.00 101.35 ? 1183 GLU A OE2 1 
ATOM   7812 N  N   . VAL A 1 1205 ? 110.958 131.625 150.514 1.00 95.93  ? 1184 VAL A N   1 
ATOM   7813 C  CA  . VAL A 1 1205 ? 111.049 131.292 151.938 1.00 95.93  ? 1184 VAL A CA  1 
ATOM   7814 C  C   . VAL A 1 1205 ? 110.580 132.391 152.887 1.00 95.93  ? 1184 VAL A C   1 
ATOM   7815 O  O   . VAL A 1 1205 ? 109.910 132.111 153.878 1.00 95.93  ? 1184 VAL A O   1 
ATOM   7816 C  CB  . VAL A 1 1205 ? 112.475 130.863 152.332 1.00 30.00  ? 1184 VAL A CB  1 
ATOM   7817 N  N   . SER A 1 1206 ? 110.935 133.635 152.583 1.00 74.80  ? 1185 SER A N   1 
ATOM   7818 C  CA  . SER A 1 1206 ? 110.549 134.771 153.414 1.00 74.80  ? 1185 SER A CA  1 
ATOM   7819 C  C   . SER A 1 1206 ? 110.661 136.074 152.630 1.00 74.80  ? 1185 SER A C   1 
ATOM   7820 O  O   . SER A 1 1206 ? 110.200 137.123 153.079 1.00 74.80  ? 1185 SER A O   1 
ATOM   7821 C  CB  . SER A 1 1206 ? 111.416 134.842 154.672 1.00 30.00  ? 1185 SER A CB  1 
ATOM   7822 N  N   . LEU B 2 19   ? 104.480 85.746  64.660  1.00 39.95  ? 39   LEU B N   1 
ATOM   7823 C  CA  . LEU B 2 19   ? 105.145 86.761  63.850  1.00 41.43  ? 39   LEU B CA  1 
ATOM   7824 C  C   . LEU B 2 19   ? 105.405 88.020  64.665  1.00 39.18  ? 39   LEU B C   1 
ATOM   7825 O  O   . LEU B 2 19   ? 104.531 88.492  65.379  1.00 44.23  ? 39   LEU B O   1 
ATOM   7826 C  CB  . LEU B 2 19   ? 104.309 87.106  62.612  1.00 41.37  ? 39   LEU B CB  1 
ATOM   7827 C  CG  . LEU B 2 19   ? 104.065 86.001  61.576  1.00 42.24  ? 39   LEU B CG  1 
ATOM   7828 C  CD1 . LEU B 2 19   ? 103.233 86.513  60.407  1.00 38.95  ? 39   LEU B CD1 1 
ATOM   7829 C  CD2 . LEU B 2 19   ? 105.364 85.396  61.086  1.00 45.21  ? 39   LEU B CD2 1 
ATOM   7830 N  N   . THR B 2 20   ? 106.603 88.575  64.539  1.00 37.72  ? 40   THR B N   1 
ATOM   7831 C  CA  . THR B 2 20   ? 107.009 89.732  65.315  1.00 37.29  ? 40   THR B CA  1 
ATOM   7832 C  C   . THR B 2 20   ? 107.672 90.752  64.398  1.00 30.47  ? 40   THR B C   1 
ATOM   7833 O  O   . THR B 2 20   ? 108.243 90.382  63.368  1.00 25.13  ? 40   THR B O   1 
ATOM   7834 C  CB  . THR B 2 20   ? 107.953 89.298  66.452  1.00 50.79  ? 40   THR B CB  1 
ATOM   7835 O  OG1 . THR B 2 20   ? 108.199 90.389  67.345  1.00 56.35  ? 40   THR B OG1 1 
ATOM   7836 C  CG2 . THR B 2 20   ? 109.276 88.756  65.928  1.00 47.35  ? 40   THR B CG2 1 
ATOM   7837 N  N   . PRO B 2 21   ? 107.551 92.046  64.699  1.00 29.37  ? 41   PRO B N   1 
ATOM   7838 C  CA  . PRO B 2 21   ? 108.149 93.052  63.815  1.00 26.77  ? 41   PRO B CA  1 
ATOM   7839 C  C   . PRO B 2 21   ? 109.659 93.122  63.958  1.00 26.74  ? 41   PRO B C   1 
ATOM   7840 O  O   . PRO B 2 21   ? 110.213 92.898  65.034  1.00 26.21  ? 41   PRO B O   1 
ATOM   7841 C  CB  . PRO B 2 21   ? 107.493 94.356  64.271  1.00 26.77  ? 41   PRO B CB  1 
ATOM   7842 C  CG  . PRO B 2 21   ? 107.078 94.097  65.668  1.00 31.95  ? 41   PRO B CG  1 
ATOM   7843 C  CD  . PRO B 2 21   ? 106.670 92.669  65.701  1.00 29.54  ? 41   PRO B CD  1 
ATOM   7844 N  N   . LEU B 2 22   ? 110.324 93.444  62.846  1.00 17.18  ? 42   LEU B N   1 
ATOM   7845 C  CA  . LEU B 2 22   ? 111.776 93.555  62.804  1.00 12.90  ? 42   LEU B CA  1 
ATOM   7846 C  C   . LEU B 2 22   ? 112.275 94.729  63.635  1.00 15.79  ? 42   LEU B C   1 
ATOM   7847 O  O   . LEU B 2 22   ? 111.527 95.630  64.013  1.00 16.29  ? 42   LEU B O   1 
ATOM   7848 C  CB  . LEU B 2 22   ? 112.283 93.751  61.378  1.00 13.99  ? 42   LEU B CB  1 
ATOM   7849 C  CG  . LEU B 2 22   ? 112.585 92.617  60.418  1.00 17.25  ? 42   LEU B CG  1 
ATOM   7850 C  CD1 . LEU B 2 22   ? 111.334 91.949  59.968  1.00 16.18  ? 42   LEU B CD1 1 
ATOM   7851 C  CD2 . LEU B 2 22   ? 113.284 93.219  59.238  1.00 18.88  ? 42   LEU B CD2 1 
ATOM   7852 N  N   . ALA B 2 23   ? 113.569 94.711  63.904  1.00 14.01  ? 43   ALA B N   1 
ATOM   7853 C  CA  . ALA B 2 23   ? 114.236 95.853  64.497  1.00 15.23  ? 43   ALA B CA  1 
ATOM   7854 C  C   . ALA B 2 23   ? 114.777 96.739  63.393  1.00 15.13  ? 43   ALA B C   1 
ATOM   7855 O  O   . ALA B 2 23   ? 114.923 96.316  62.249  1.00 14.83  ? 43   ALA B O   1 
ATOM   7856 C  CB  . ALA B 2 23   ? 115.373 95.413  65.416  1.00 14.71  ? 43   ALA B CB  1 
ATOM   7857 N  N   . TYR B 2 24   ? 115.052 97.986  63.749  1.00 16.28  ? 44   TYR B N   1 
ATOM   7858 C  CA  . TYR B 2 24   ? 115.748 98.892  62.852  1.00 18.84  ? 44   TYR B CA  1 
ATOM   7859 C  C   . TYR B 2 24   ? 117.133 98.344  62.526  1.00 17.57  ? 44   TYR B C   1 
ATOM   7860 O  O   . TYR B 2 24   ? 117.819 97.814  63.402  1.00 15.96  ? 44   TYR B O   1 
ATOM   7861 C  CB  . TYR B 2 24   ? 115.831 100.262 63.515  1.00 19.18  ? 44   TYR B CB  1 
ATOM   7862 C  CG  . TYR B 2 24   ? 116.615 101.311 62.783  1.00 17.18  ? 44   TYR B CG  1 
ATOM   7863 C  CD1 . TYR B 2 24   ? 116.123 101.907 61.638  1.00 13.27  ? 44   TYR B CD1 1 
ATOM   7864 C  CD2 . TYR B 2 24   ? 117.822 101.749 63.279  1.00 21.37  ? 44   TYR B CD2 1 
ATOM   7865 C  CE1 . TYR B 2 24   ? 116.833 102.867 60.987  1.00 14.70  ? 44   TYR B CE1 1 
ATOM   7866 C  CE2 . TYR B 2 24   ? 118.532 102.726 62.642  1.00 20.48  ? 44   TYR B CE2 1 
ATOM   7867 C  CZ  . TYR B 2 24   ? 118.034 103.277 61.495  1.00 21.78  ? 44   TYR B CZ  1 
ATOM   7868 O  OH  . TYR B 2 24   ? 118.754 104.247 60.865  1.00 20.04  ? 44   TYR B OH  1 
ATOM   7869 N  N   . LYS B 2 25   ? 117.506 98.429  61.242  1.00 11.69  ? 45   LYS B N   1 
ATOM   7870 C  CA  . LYS B 2 25   ? 118.743 97.873  60.676  1.00 12.04  ? 45   LYS B CA  1 
ATOM   7871 C  C   . LYS B 2 25   ? 118.842 96.364  60.901  1.00 10.67  ? 45   LYS B C   1 
ATOM   7872 O  O   . LYS B 2 25   ? 119.764 95.873  61.546  1.00 15.53  ? 45   LYS B O   1 
ATOM   7873 C  CB  . LYS B 2 25   ? 119.989 98.562  61.234  1.00 18.26  ? 45   LYS B CB  1 
ATOM   7874 C  CG  . LYS B 2 25   ? 120.087 100.024 60.989  1.00 16.01  ? 45   LYS B CG  1 
ATOM   7875 C  CD  . LYS B 2 25   ? 120.342 100.353 59.549  1.00 18.41  ? 45   LYS B CD  1 
ATOM   7876 C  CE  . LYS B 2 25   ? 120.647 101.829 59.431  1.00 19.38  ? 45   LYS B CE  1 
ATOM   7877 N  NZ  . LYS B 2 25   ? 120.846 102.293 58.034  1.00 16.64  ? 45   LYS B NZ  1 
ATOM   7878 N  N   . GLN B 2 26   ? 117.893 95.625  60.337  1.00 11.89  ? 46   GLN B N   1 
ATOM   7879 C  CA  . GLN B 2 26   ? 117.906 94.173  60.441  1.00 10.46  ? 46   GLN B CA  1 
ATOM   7880 C  C   . GLN B 2 26   ? 117.601 93.566  59.087  1.00 18.19  ? 46   GLN B C   1 
ATOM   7881 O  O   . GLN B 2 26   ? 116.728 94.057  58.371  1.00 12.46  ? 46   GLN B O   1 
ATOM   7882 C  CB  . GLN B 2 26   ? 116.878 93.674  61.451  1.00 12.68  ? 46   GLN B CB  1 
ATOM   7883 C  CG  . GLN B 2 26   ? 116.971 92.195  61.735  1.00 15.26  ? 46   GLN B CG  1 
ATOM   7884 C  CD  . GLN B 2 26   ? 115.922 91.730  62.701  1.00 18.73  ? 46   GLN B CD  1 
ATOM   7885 O  OE1 . GLN B 2 26   ? 115.052 92.499  63.097  1.00 18.43  ? 46   GLN B OE1 1 
ATOM   7886 N  NE2 . GLN B 2 26   ? 115.999 90.470  63.100  1.00 20.23  ? 46   GLN B NE2 1 
ATOM   7887 N  N   . PHE B 2 27   ? 118.306 92.494  58.742  1.00 15.47  ? 47   PHE B N   1 
ATOM   7888 C  CA  . PHE B 2 27   ? 118.055 91.771  57.505  1.00 12.07  ? 47   PHE B CA  1 
ATOM   7889 C  C   . PHE B 2 27   ? 117.852 90.295  57.794  1.00 15.18  ? 47   PHE B C   1 
ATOM   7890 O  O   . PHE B 2 27   ? 118.628 89.685  58.530  1.00 17.86  ? 47   PHE B O   1 
ATOM   7891 C  CB  . PHE B 2 27   ? 119.177 91.997  56.480  1.00 11.08  ? 47   PHE B CB  1 
ATOM   7892 C  CG  . PHE B 2 27   ? 120.559 91.803  57.013  1.00 16.38  ? 47   PHE B CG  1 
ATOM   7893 C  CD1 . PHE B 2 27   ? 121.243 92.870  57.571  1.00 19.18  ? 47   PHE B CD1 1 
ATOM   7894 C  CD2 . PHE B 2 27   ? 121.197 90.588  56.914  1.00 16.65  ? 47   PHE B CD2 1 
ATOM   7895 C  CE1 . PHE B 2 27   ? 122.509 92.722  58.052  1.00 23.21  ? 47   PHE B CE1 1 
ATOM   7896 C  CE2 . PHE B 2 27   ? 122.478 90.429  57.397  1.00 19.52  ? 47   PHE B CE2 1 
ATOM   7897 C  CZ  . PHE B 2 27   ? 123.133 91.502  57.967  1.00 20.22  ? 47   PHE B CZ  1 
ATOM   7898 N  N   . ILE B 2 28   ? 116.791 89.737  57.229  1.00 12.51  ? 48   ILE B N   1 
ATOM   7899 C  CA  . ILE B 2 28   ? 116.410 88.351  57.447  1.00 10.22  ? 48   ILE B CA  1 
ATOM   7900 C  C   . ILE B 2 28   ? 116.439 87.656  56.093  1.00 17.03  ? 48   ILE B C   1 
ATOM   7901 O  O   . ILE B 2 28   ? 115.736 88.077  55.174  1.00 15.91  ? 48   ILE B O   1 
ATOM   7902 C  CB  . ILE B 2 28   ? 115.024 88.224  58.099  1.00 11.11  ? 48   ILE B CB  1 
ATOM   7903 C  CG1 . ILE B 2 28   ? 115.024 88.889  59.474  1.00 16.78  ? 48   ILE B CG1 1 
ATOM   7904 C  CG2 . ILE B 2 28   ? 114.638 86.768  58.234  1.00 15.77  ? 48   ILE B CG2 1 
ATOM   7905 C  CD1 . ILE B 2 28   ? 113.665 88.978  60.112  1.00 20.02  ? 48   ILE B CD1 1 
ATOM   7906 N  N   . PRO B 2 29   ? 117.234 86.590  55.912  1.00 14.37  ? 49   PRO B N   1 
ATOM   7907 C  CA  . PRO B 2 29   ? 118.100 85.905  56.878  1.00 17.95  ? 49   PRO B CA  1 
ATOM   7908 C  C   . PRO B 2 29   ? 119.397 86.662  57.140  1.00 20.15  ? 49   PRO B C   1 
ATOM   7909 O  O   . PRO B 2 29   ? 119.711 87.582  56.397  1.00 14.78  ? 49   PRO B O   1 
ATOM   7910 C  CB  . PRO B 2 29   ? 118.382 84.572  56.194  1.00 17.75  ? 49   PRO B CB  1 
ATOM   7911 C  CG  . PRO B 2 29   ? 118.332 84.897  54.754  1.00 14.10  ? 49   PRO B CG  1 
ATOM   7912 C  CD  . PRO B 2 29   ? 117.277 85.941  54.592  1.00 13.36  ? 49   PRO B CD  1 
ATOM   7913 N  N   . ASN B 2 30   ? 120.146 86.274  58.172  1.00 17.54  ? 50   ASN B N   1 
ATOM   7914 C  CA  . ASN B 2 30   ? 121.257 87.084  58.672  1.00 16.39  ? 50   ASN B CA  1 
ATOM   7915 C  C   . ASN B 2 30   ? 122.543 86.865  57.868  1.00 25.51  ? 50   ASN B C   1 
ATOM   7916 O  O   . ASN B 2 30   ? 123.604 86.553  58.406  1.00 27.52  ? 50   ASN B O   1 
ATOM   7917 C  CB  . ASN B 2 30   ? 121.487 86.787  60.146  1.00 21.19  ? 50   ASN B CB  1 
ATOM   7918 C  CG  . ASN B 2 30   ? 120.382 87.313  61.021  1.00 25.50  ? 50   ASN B CG  1 
ATOM   7919 O  OD1 . ASN B 2 30   ? 119.923 88.435  60.849  1.00 27.42  ? 50   ASN B OD1 1 
ATOM   7920 N  ND2 . ASN B 2 30   ? 119.936 86.498  61.962  1.00 25.62  ? 50   ASN B ND2 1 
ATOM   7921 N  N   . VAL B 2 31   ? 122.441 87.047  56.553  1.00 18.94  ? 51   VAL B N   1 
ATOM   7922 C  CA  . VAL B 2 31   ? 123.579 86.969  55.648  1.00 19.92  ? 51   VAL B CA  1 
ATOM   7923 C  C   . VAL B 2 31   ? 123.502 88.147  54.686  1.00 21.12  ? 51   VAL B C   1 
ATOM   7924 O  O   . VAL B 2 31   ? 122.491 88.842  54.602  1.00 18.15  ? 51   VAL B O   1 
ATOM   7925 C  CB  . VAL B 2 31   ? 123.632 85.639  54.865  1.00 20.39  ? 51   VAL B CB  1 
ATOM   7926 C  CG1 . VAL B 2 31   ? 123.940 84.467  55.775  1.00 23.44  ? 51   VAL B CG1 1 
ATOM   7927 C  CG2 . VAL B 2 31   ? 122.325 85.404  54.187  1.00 19.76  ? 51   VAL B CG2 1 
ATOM   7928 N  N   . ALA B 2 32   ? 124.585 88.356  53.943  1.00 18.96  ? 52   ALA B N   1 
ATOM   7929 C  CA  . ALA B 2 32   ? 124.652 89.472  53.014  1.00 19.66  ? 52   ALA B CA  1 
ATOM   7930 C  C   . ALA B 2 32   ? 123.793 89.205  51.784  1.00 15.56  ? 52   ALA B C   1 
ATOM   7931 O  O   . ALA B 2 32   ? 123.471 88.064  51.462  1.00 19.94  ? 52   ALA B O   1 
ATOM   7932 C  CB  . ALA B 2 32   ? 126.094 89.739  52.595  1.00 19.28  ? 52   ALA B CB  1 
ATOM   7933 N  N   . GLU B 2 33   ? 123.471 90.289  51.073  1.00 14.61  ? 53   GLU B N   1 
ATOM   7934 C  CA  . GLU B 2 33   ? 122.400 90.288  50.079  1.00 10.74  ? 53   GLU B CA  1 
ATOM   7935 C  C   . GLU B 2 33   ? 122.715 89.419  48.870  1.00 10.38  ? 53   GLU B C   1 
ATOM   7936 O  O   . GLU B 2 33   ? 121.811 88.805  48.298  1.00 12.10  ? 53   GLU B O   1 
ATOM   7937 C  CB  . GLU B 2 33   ? 122.125 91.726  49.643  1.00 9.72   ? 53   GLU B CB  1 
ATOM   7938 C  CG  . GLU B 2 33   ? 120.964 91.928  48.683  1.00 9.82   ? 53   GLU B CG  1 
ATOM   7939 C  CD  . GLU B 2 33   ? 120.677 93.399  48.452  1.00 16.42  ? 53   GLU B CD  1 
ATOM   7940 O  OE1 . GLU B 2 33   ? 121.471 94.229  48.935  1.00 16.27  ? 53   GLU B OE1 1 
ATOM   7941 O  OE2 . GLU B 2 33   ? 119.645 93.735  47.839  1.00 11.72  ? 53   GLU B OE2 1 
ATOM   7942 N  N   . LYS B 2 34   ? 123.978 89.331  48.479  1.00 11.90  ? 54   LYS B N   1 
ATOM   7943 C  CA  . LYS B 2 34   ? 124.327 88.658  47.239  1.00 16.23  ? 54   LYS B CA  1 
ATOM   7944 C  C   . LYS B 2 34   ? 124.856 87.240  47.435  1.00 18.06  ? 54   LYS B C   1 
ATOM   7945 O  O   . LYS B 2 34   ? 125.362 86.650  46.476  1.00 21.45  ? 54   LYS B O   1 
ATOM   7946 C  CB  . LYS B 2 34   ? 125.347 89.481  46.449  1.00 21.41  ? 54   LYS B CB  1 
ATOM   7947 C  CG  . LYS B 2 34   ? 124.744 90.543  45.535  1.00 26.16  ? 54   LYS B CG  1 
ATOM   7948 C  CD  . LYS B 2 34   ? 124.409 91.835  46.256  1.00 33.78  ? 54   LYS B CD  1 
ATOM   7949 C  CE  . LYS B 2 34   ? 125.667 92.618  46.581  1.00 34.26  ? 54   LYS B CE  1 
ATOM   7950 N  NZ  . LYS B 2 34   ? 125.377 93.944  47.185  1.00 35.43  ? 54   LYS B NZ  1 
ATOM   7951 N  N   . THR B 2 35   ? 124.746 86.671  48.635  1.00 21.18  ? 55   THR B N   1 
ATOM   7952 C  CA  . THR B 2 35   ? 125.285 85.334  48.841  1.00 24.14  ? 55   THR B CA  1 
ATOM   7953 C  C   . THR B 2 35   ? 124.316 84.280  48.313  1.00 25.24  ? 55   THR B C   1 
ATOM   7954 O  O   . THR B 2 35   ? 123.163 84.564  47.979  1.00 24.12  ? 55   THR B O   1 
ATOM   7955 C  CB  . THR B 2 35   ? 125.588 85.083  50.315  1.00 26.57  ? 55   THR B CB  1 
ATOM   7956 O  OG1 . THR B 2 35   ? 124.375 85.158  51.066  1.00 26.21  ? 55   THR B OG1 1 
ATOM   7957 C  CG2 . THR B 2 35   ? 126.554 86.120  50.840  1.00 26.66  ? 55   THR B CG2 1 
ATOM   7958 N  N   . LEU B 2 36   ? 124.802 83.039  48.255  1.00 26.57  ? 56   LEU B N   1 
ATOM   7959 C  CA  . LEU B 2 36   ? 124.098 81.947  47.592  1.00 25.65  ? 56   LEU B CA  1 
ATOM   7960 C  C   . LEU B 2 36   ? 122.994 81.331  48.442  1.00 21.71  ? 56   LEU B C   1 
ATOM   7961 O  O   . LEU B 2 36   ? 122.330 80.399  47.979  1.00 30.94  ? 56   LEU B O   1 
ATOM   7962 C  CB  . LEU B 2 36   ? 125.091 80.858  47.187  1.00 35.47  ? 56   LEU B CB  1 
ATOM   7963 C  CG  . LEU B 2 36   ? 126.205 81.293  46.230  1.00 45.16  ? 56   LEU B CG  1 
ATOM   7964 C  CD1 . LEU B 2 36   ? 127.166 80.144  45.958  1.00 50.04  ? 56   LEU B CD1 1 
ATOM   7965 C  CD2 . LEU B 2 36   ? 125.649 81.848  44.935  1.00 43.87  ? 56   LEU B CD2 1 
ATOM   7966 N  N   . GLY B 2 37   ? 122.797 81.804  49.669  1.00 23.58  ? 57   GLY B N   1 
ATOM   7967 C  CA  . GLY B 2 37   ? 121.664 81.397  50.471  1.00 24.75  ? 57   GLY B CA  1 
ATOM   7968 C  C   . GLY B 2 37   ? 120.646 82.512  50.514  1.00 29.22  ? 57   GLY B C   1 
ATOM   7969 O  O   . GLY B 2 37   ? 119.466 82.294  50.788  1.00 29.12  ? 57   GLY B O   1 
ATOM   7970 N  N   . ALA B 2 38   ? 121.123 83.722  50.271  1.00 21.01  ? 58   ALA B N   1 
ATOM   7971 C  CA  . ALA B 2 38   ? 120.296 84.910  50.131  1.00 16.87  ? 58   ALA B CA  1 
ATOM   7972 C  C   . ALA B 2 38   ? 119.998 85.166  48.652  1.00 14.98  ? 58   ALA B C   1 
ATOM   7973 O  O   . ALA B 2 38   ? 120.101 84.266  47.814  1.00 17.02  ? 58   ALA B O   1 
ATOM   7974 C  CB  . ALA B 2 38   ? 120.970 86.101  50.800  1.00 17.75  ? 58   ALA B CB  1 
ATOM   7975 N  N   . SER B 2 39   ? 119.619 86.407  48.326  1.00 17.09  ? 59   SER B N   1 
ATOM   7976 C  CA  . SER B 2 39   ? 119.144 86.853  47.017  1.00 13.07  ? 59   SER B CA  1 
ATOM   7977 C  C   . SER B 2 39   ? 120.115 86.722  45.841  1.00 13.52  ? 59   SER B C   1 
ATOM   7978 O  O   . SER B 2 39   ? 119.773 87.110  44.720  1.00 14.53  ? 59   SER B O   1 
ATOM   7979 C  CB  . SER B 2 39   ? 118.728 88.314  47.124  1.00 11.62  ? 59   SER B CB  1 
ATOM   7980 O  OG  . SER B 2 39   ? 117.702 88.453  48.081  1.00 12.99  ? 59   SER B OG  1 
ATOM   7981 N  N   . GLY B 2 40   ? 121.321 86.223  46.069  1.00 16.75  ? 60   GLY B N   1 
ATOM   7982 C  CA  . GLY B 2 40   ? 122.183 85.828  44.978  1.00 17.04  ? 60   GLY B CA  1 
ATOM   7983 C  C   . GLY B 2 40   ? 122.946 86.991  44.370  1.00 17.38  ? 60   GLY B C   1 
ATOM   7984 O  O   . GLY B 2 40   ? 122.599 88.160  44.524  1.00 15.87  ? 60   GLY B O   1 
ATOM   7985 N  N   . ARG B 2 41   ? 123.988 86.632  43.622  1.00 14.50  ? 61   ARG B N   1 
ATOM   7986 C  CA  . ARG B 2 41   ? 124.997 87.552  43.121  1.00 14.44  ? 61   ARG B CA  1 
ATOM   7987 C  C   . ARG B 2 41   ? 124.418 88.547  42.116  1.00 16.61  ? 61   ARG B C   1 
ATOM   7988 O  O   . ARG B 2 41   ? 123.284 88.425  41.645  1.00 17.75  ? 61   ARG B O   1 
ATOM   7989 C  CB  . ARG B 2 41   ? 126.135 86.778  42.463  1.00 19.45  ? 61   ARG B CB  1 
ATOM   7990 C  CG  . ARG B 2 41   ? 125.657 85.923  41.311  1.00 25.25  ? 61   ARG B CG  1 
ATOM   7991 C  CD  . ARG B 2 41   ? 126.803 85.279  40.566  1.00 35.38  ? 61   ARG B CD  1 
ATOM   7992 N  NE  . ARG B 2 41   ? 127.565 86.278  39.827  1.00 44.00  ? 61   ARG B NE  1 
ATOM   7993 C  CZ  . ARG B 2 41   ? 127.242 86.729  38.617  1.00 46.11  ? 61   ARG B CZ  1 
ATOM   7994 N  NH1 . ARG B 2 41   ? 126.169 86.267  37.989  1.00 44.11  ? 61   ARG B NH1 1 
ATOM   7995 N  NH2 . ARG B 2 41   ? 128.000 87.642  38.031  1.00 44.89  ? 61   ARG B NH2 1 
ATOM   7996 N  N   . TYR B 2 42   ? 125.240 89.532  41.780  1.00 15.78  ? 62   TYR B N   1 
ATOM   7997 C  CA  . TYR B 2 42   ? 124.870 90.644  40.923  1.00 15.08  ? 62   TYR B CA  1 
ATOM   7998 C  C   . TYR B 2 42   ? 125.449 90.441  39.530  1.00 20.24  ? 62   TYR B C   1 
ATOM   7999 O  O   . TYR B 2 42   ? 126.477 89.784  39.359  1.00 20.72  ? 62   TYR B O   1 
ATOM   8000 C  CB  . TYR B 2 42   ? 125.381 91.951  41.528  1.00 18.05  ? 62   TYR B CB  1 
ATOM   8001 C  CG  . TYR B 2 42   ? 125.014 93.188  40.759  1.00 16.24  ? 62   TYR B CG  1 
ATOM   8002 C  CD1 . TYR B 2 42   ? 123.750 93.744  40.862  1.00 14.07  ? 62   TYR B CD1 1 
ATOM   8003 C  CD2 . TYR B 2 42   ? 125.934 93.794  39.915  1.00 16.47  ? 62   TYR B CD2 1 
ATOM   8004 C  CE1 . TYR B 2 42   ? 123.417 94.878  40.155  1.00 16.02  ? 62   TYR B CE1 1 
ATOM   8005 C  CE2 . TYR B 2 42   ? 125.611 94.924  39.207  1.00 18.11  ? 62   TYR B CE2 1 
ATOM   8006 C  CZ  . TYR B 2 42   ? 124.354 95.461  39.326  1.00 17.44  ? 62   TYR B CZ  1 
ATOM   8007 O  OH  . TYR B 2 42   ? 124.040 96.591  38.610  1.00 17.60  ? 62   TYR B OH  1 
ATOM   8008 N  N   . GLU B 2 43   ? 124.777 91.001  38.525  1.00 15.68  ? 63   GLU B N   1 
ATOM   8009 C  CA  . GLU B 2 43   ? 125.225 90.857  37.148  1.00 16.34  ? 63   GLU B CA  1 
ATOM   8010 C  C   . GLU B 2 43   ? 125.649 92.171  36.501  1.00 18.86  ? 63   GLU B C   1 
ATOM   8011 O  O   . GLU B 2 43   ? 126.787 92.280  36.039  1.00 21.88  ? 63   GLU B O   1 
ATOM   8012 C  CB  . GLU B 2 43   ? 124.137 90.196  36.304  1.00 16.89  ? 63   GLU B CB  1 
ATOM   8013 C  CG  . GLU B 2 43   ? 124.573 89.989  34.875  1.00 18.09  ? 63   GLU B CG  1 
ATOM   8014 C  CD  . GLU B 2 43   ? 125.693 88.973  34.741  1.00 22.06  ? 63   GLU B CD  1 
ATOM   8015 O  OE1 . GLU B 2 43   ? 125.765 88.034  35.567  1.00 22.77  ? 63   GLU B OE1 1 
ATOM   8016 O  OE2 . GLU B 2 43   ? 126.515 89.125  33.811  1.00 15.12  ? 63   GLU B OE2 1 
ATOM   8017 N  N   . GLY B 2 44   ? 124.776 93.168  36.438  1.00 14.29  ? 64   GLY B N   1 
ATOM   8018 C  CA  . GLY B 2 44   ? 125.124 94.394  35.741  1.00 13.36  ? 64   GLY B CA  1 
ATOM   8019 C  C   . GLY B 2 44   ? 123.911 95.269  35.547  1.00 16.09  ? 64   GLY B C   1 
ATOM   8020 O  O   . GLY B 2 44   ? 122.769 94.833  35.687  1.00 16.01  ? 64   GLY B O   1 
ATOM   8021 N  N   . LYS B 2 45   ? 124.181 96.527  35.195  1.00 12.80  ? 65   LYS B N   1 
ATOM   8022 C  CA  . LYS B 2 45   ? 123.133 97.533  35.072  1.00 12.11  ? 65   LYS B CA  1 
ATOM   8023 C  C   . LYS B 2 45   ? 122.354 97.319  33.783  1.00 14.38  ? 65   LYS B C   1 
ATOM   8024 O  O   . LYS B 2 45   ? 122.942 97.092  32.721  1.00 14.09  ? 65   LYS B O   1 
ATOM   8025 C  CB  . LYS B 2 45   ? 123.720 98.944  35.101  1.00 14.07  ? 65   LYS B CB  1 
ATOM   8026 C  CG  . LYS B 2 45   ? 124.270 99.357  36.456  1.00 20.09  ? 65   LYS B CG  1 
ATOM   8027 C  CD  . LYS B 2 45   ? 125.768 99.130  36.543  1.00 21.86  ? 65   LYS B CD  1 
ATOM   8028 C  CE  . LYS B 2 45   ? 126.329 99.632  37.855  1.00 26.64  ? 65   LYS B CE  1 
ATOM   8029 N  NZ  . LYS B 2 45   ? 125.896 98.772  38.987  1.00 29.38  ? 65   LYS B NZ  1 
ATOM   8030 N  N   . ILE B 2 46   ? 121.035 97.388  33.874  1.00 9.18   ? 66   ILE B N   1 
ATOM   8031 C  CA  . ILE B 2 46   ? 120.153 96.998  32.779  1.00 8.80   ? 66   ILE B CA  1 
ATOM   8032 C  C   . ILE B 2 46   ? 119.389 98.252  32.364  1.00 11.66  ? 66   ILE B C   1 
ATOM   8033 O  O   . ILE B 2 46   ? 118.317 98.550  32.893  1.00 11.43  ? 66   ILE B O   1 
ATOM   8034 C  CB  . ILE B 2 46   ? 119.198 95.870  33.176  1.00 8.76   ? 66   ILE B CB  1 
ATOM   8035 C  CG1 . ILE B 2 46   ? 119.959 94.725  33.846  1.00 9.32   ? 66   ILE B CG1 1 
ATOM   8036 C  CG2 . ILE B 2 46   ? 118.494 95.329  31.956  1.00 10.32  ? 66   ILE B CG2 1 
ATOM   8037 C  CD1 . ILE B 2 46   ? 121.000 94.087  32.973  1.00 8.62   ? 66   ILE B CD1 1 
ATOM   8038 N  N   . SER B 2 47   ? 119.935 98.993  31.406  1.00 14.45  ? 67   SER B N   1 
ATOM   8039 C  CA  . SER B 2 47   ? 119.259 100.158 30.855  1.00 12.69  ? 67   SER B CA  1 
ATOM   8040 C  C   . SER B 2 47   ? 118.456 99.743  29.627  1.00 12.03  ? 67   SER B C   1 
ATOM   8041 O  O   . SER B 2 47   ? 118.276 98.556  29.346  1.00 13.80  ? 67   SER B O   1 
ATOM   8042 C  CB  . SER B 2 47   ? 120.259 101.261 30.518  1.00 160.20 ? 67   SER B CB  1 
ATOM   8043 O  OG  . SER B 2 47   ? 120.869 101.776 31.687  1.00 160.20 ? 67   SER B OG  1 
ATOM   8044 N  N   . ARG B 2 48   ? 117.975 100.726 28.872  1.00 14.35  ? 68   ARG B N   1 
ATOM   8045 C  CA  . ARG B 2 48   ? 117.143 100.473 27.702  1.00 13.62  ? 68   ARG B CA  1 
ATOM   8046 C  C   . ARG B 2 48   ? 117.951 100.178 26.441  1.00 16.87  ? 68   ARG B C   1 
ATOM   8047 O  O   . ARG B 2 48   ? 117.362 100.076 25.359  1.00 19.06  ? 68   ARG B O   1 
ATOM   8048 C  CB  . ARG B 2 48   ? 116.210 101.663 27.456  1.00 15.34  ? 68   ARG B CB  1 
ATOM   8049 C  CG  . ARG B 2 48   ? 115.123 101.829 28.511  1.00 22.54  ? 68   ARG B CG  1 
ATOM   8050 C  CD  . ARG B 2 48   ? 114.054 102.826 28.083  1.00 27.53  ? 68   ARG B CD  1 
ATOM   8051 N  NE  . ARG B 2 48   ? 114.543 104.200 28.042  1.00 25.07  ? 68   ARG B NE  1 
ATOM   8052 C  CZ  . ARG B 2 48   ? 114.481 105.041 29.069  1.00 24.40  ? 68   ARG B CZ  1 
ATOM   8053 N  NH1 . ARG B 2 48   ? 113.944 104.651 30.215  1.00 22.92  ? 68   ARG B NH1 1 
ATOM   8054 N  NH2 . ARG B 2 48   ? 114.947 106.274 28.949  1.00 24.38  ? 68   ARG B NH2 1 
ATOM   8055 N  N   . ASN B 2 49   ? 119.274 100.036 26.548  1.00 18.06  ? 69   ASN B N   1 
ATOM   8056 C  CA  . ASN B 2 49   ? 120.136 99.734  25.412  1.00 26.34  ? 69   ASN B CA  1 
ATOM   8057 C  C   . ASN B 2 49   ? 120.610 98.285  25.412  1.00 28.33  ? 69   ASN B C   1 
ATOM   8058 O  O   . ASN B 2 49   ? 121.752 98.010  25.033  1.00 30.83  ? 69   ASN B O   1 
ATOM   8059 C  CB  . ASN B 2 49   ? 121.342 100.672 25.395  1.00 30.02  ? 69   ASN B CB  1 
ATOM   8060 C  CG  . ASN B 2 49   ? 120.963 102.111 25.119  1.00 40.41  ? 69   ASN B CG  1 
ATOM   8061 O  OD1 . ASN B 2 49   ? 120.112 102.393 24.274  1.00 44.75  ? 69   ASN B OD1 1 
ATOM   8062 N  ND2 . ASN B 2 49   ? 121.599 103.036 25.829  1.00 39.07  ? 69   ASN B ND2 1 
ATOM   8063 N  N   . SER B 2 50   ? 119.762 97.352  25.836  1.00 22.80  ? 70   SER B N   1 
ATOM   8064 C  CA  . SER B 2 50   ? 120.162 95.960  25.979  1.00 16.61  ? 70   SER B CA  1 
ATOM   8065 C  C   . SER B 2 50   ? 119.034 95.033  25.544  1.00 17.94  ? 70   SER B C   1 
ATOM   8066 O  O   . SER B 2 50   ? 117.857 95.404  25.529  1.00 14.54  ? 70   SER B O   1 
ATOM   8067 C  CB  . SER B 2 50   ? 120.568 95.636  27.424  1.00 23.86  ? 70   SER B CB  1 
ATOM   8068 O  OG  . SER B 2 50   ? 119.457 95.707  28.303  1.00 21.12  ? 70   SER B OG  1 
ATOM   8069 N  N   . GLU B 2 51   ? 119.426 93.807  25.189  1.00 17.79  ? 71   GLU B N   1 
ATOM   8070 C  CA  . GLU B 2 51   ? 118.457 92.768  24.861  1.00 21.26  ? 71   GLU B CA  1 
ATOM   8071 C  C   . GLU B 2 51   ? 117.787 92.231  26.118  1.00 19.74  ? 71   GLU B C   1 
ATOM   8072 O  O   . GLU B 2 51   ? 116.590 91.921  26.111  1.00 22.15  ? 71   GLU B O   1 
ATOM   8073 C  CB  . GLU B 2 51   ? 119.150 91.640  24.100  1.00 30.08  ? 71   GLU B CB  1 
ATOM   8074 C  CG  . GLU B 2 51   ? 118.241 90.513  23.655  1.00 35.79  ? 71   GLU B CG  1 
ATOM   8075 C  CD  . GLU B 2 51   ? 117.272 90.935  22.573  1.00 37.66  ? 71   GLU B CD  1 
ATOM   8076 O  OE1 . GLU B 2 51   ? 117.598 91.857  21.795  1.00 35.76  ? 71   GLU B OE1 1 
ATOM   8077 O  OE2 . GLU B 2 51   ? 116.178 90.339  22.499  1.00 38.42  ? 71   GLU B OE2 1 
ATOM   8078 N  N   . ARG B 2 52   ? 118.539 92.145  27.216  1.00 12.58  ? 72   ARG B N   1 
ATOM   8079 C  CA  . ARG B 2 52   ? 118.051 91.679  28.507  1.00 10.01  ? 72   ARG B CA  1 
ATOM   8080 C  C   . ARG B 2 52   ? 117.292 92.753  29.281  1.00 10.73  ? 72   ARG B C   1 
ATOM   8081 O  O   . ARG B 2 52   ? 117.064 92.589  30.484  1.00 12.23  ? 72   ARG B O   1 
ATOM   8082 C  CB  . ARG B 2 52   ? 119.224 91.157  29.337  1.00 12.57  ? 72   ARG B CB  1 
ATOM   8083 C  CG  . ARG B 2 52   ? 120.266 92.213  29.656  1.00 13.83  ? 72   ARG B CG  1 
ATOM   8084 C  CD  . ARG B 2 52   ? 121.497 91.592  30.293  1.00 11.88  ? 72   ARG B CD  1 
ATOM   8085 N  NE  . ARG B 2 52   ? 121.194 90.991  31.583  1.00 14.35  ? 72   ARG B NE  1 
ATOM   8086 C  CZ  . ARG B 2 52   ? 121.998 90.144  32.213  1.00 16.52  ? 72   ARG B CZ  1 
ATOM   8087 N  NH1 . ARG B 2 52   ? 123.154 89.799  31.670  1.00 16.83  ? 72   ARG B NH1 1 
ATOM   8088 N  NH2 . ARG B 2 52   ? 121.638 89.636  33.381  1.00 19.58  ? 72   ARG B NH2 1 
ATOM   8089 N  N   . PHE B 2 53   ? 116.918 93.848  28.620  1.00 9.83   ? 73   PHE B N   1 
ATOM   8090 C  CA  . PHE B 2 53   ? 116.002 94.824  29.191  1.00 10.41  ? 73   PHE B CA  1 
ATOM   8091 C  C   . PHE B 2 53   ? 114.558 94.346  29.158  1.00 12.13  ? 73   PHE B C   1 
ATOM   8092 O  O   . PHE B 2 53   ? 113.781 94.685  30.055  1.00 12.55  ? 73   PHE B O   1 
ATOM   8093 C  CB  . PHE B 2 53   ? 116.136 96.154  28.440  1.00 12.02  ? 73   PHE B CB  1 
ATOM   8094 C  CG  . PHE B 2 53   ? 115.099 97.171  28.813  1.00 14.86  ? 73   PHE B CG  1 
ATOM   8095 C  CD1 . PHE B 2 53   ? 115.110 97.764  30.060  1.00 16.45  ? 73   PHE B CD1 1 
ATOM   8096 C  CD2 . PHE B 2 53   ? 114.118 97.540  27.908  1.00 17.10  ? 73   PHE B CD2 1 
ATOM   8097 C  CE1 . PHE B 2 53   ? 114.149 98.692  30.410  1.00 19.92  ? 73   PHE B CE1 1 
ATOM   8098 C  CE2 . PHE B 2 53   ? 113.158 98.475  28.248  1.00 20.18  ? 73   PHE B CE2 1 
ATOM   8099 C  CZ  . PHE B 2 53   ? 113.173 99.047  29.504  1.00 15.24  ? 73   PHE B CZ  1 
ATOM   8100 N  N   . LYS B 2 54   ? 114.198 93.515  28.179  1.00 13.02  ? 74   LYS B N   1 
ATOM   8101 C  CA  . LYS B 2 54   ? 112.802 93.347  27.784  1.00 16.20  ? 74   LYS B CA  1 
ATOM   8102 C  C   . LYS B 2 54   ? 111.952 92.553  28.773  1.00 16.68  ? 74   LYS B C   1 
ATOM   8103 O  O   . LYS B 2 54   ? 110.783 92.298  28.464  1.00 19.04  ? 74   LYS B O   1 
ATOM   8104 C  CB  . LYS B 2 54   ? 112.731 92.697  26.402  1.00 19.42  ? 74   LYS B CB  1 
ATOM   8105 C  CG  . LYS B 2 54   ? 113.272 91.287  26.324  1.00 22.90  ? 74   LYS B CG  1 
ATOM   8106 C  CD  . LYS B 2 54   ? 113.186 90.776  24.894  1.00 26.15  ? 74   LYS B CD  1 
ATOM   8107 C  CE  . LYS B 2 54   ? 113.683 89.346  24.768  1.00 36.34  ? 74   LYS B CE  1 
ATOM   8108 N  NZ  . LYS B 2 54   ? 113.594 88.850  23.365  1.00 39.79  ? 74   LYS B NZ  1 
ATOM   8109 N  N   . GLU B 2 55   ? 112.476 92.165  29.934  1.00 11.72  ? 75   GLU B N   1 
ATOM   8110 C  CA  . GLU B 2 55   ? 111.630 91.656  31.003  1.00 12.36  ? 75   GLU B CA  1 
ATOM   8111 C  C   . GLU B 2 55   ? 111.128 92.756  31.924  1.00 15.53  ? 75   GLU B C   1 
ATOM   8112 O  O   . GLU B 2 55   ? 110.291 92.485  32.792  1.00 16.76  ? 75   GLU B O   1 
ATOM   8113 C  CB  . GLU B 2 55   ? 112.372 90.614  31.833  1.00 20.51  ? 75   GLU B CB  1 
ATOM   8114 C  CG  . GLU B 2 55   ? 112.646 89.332  31.099  1.00 22.92  ? 75   GLU B CG  1 
ATOM   8115 C  CD  . GLU B 2 55   ? 113.348 88.334  31.971  1.00 25.89  ? 75   GLU B CD  1 
ATOM   8116 O  OE1 . GLU B 2 55   ? 113.701 88.699  33.109  1.00 23.41  ? 75   GLU B OE1 1 
ATOM   8117 O  OE2 . GLU B 2 55   ? 113.546 87.187  31.526  1.00 22.30  ? 75   GLU B OE2 1 
ATOM   8118 N  N   . LEU B 2 56   ? 111.614 93.978  31.756  1.00 12.96  ? 76   LEU B N   1 
ATOM   8119 C  CA  . LEU B 2 56   ? 111.193 95.096  32.584  1.00 10.05  ? 76   LEU B CA  1 
ATOM   8120 C  C   . LEU B 2 56   ? 109.921 95.691  31.990  1.00 15.71  ? 76   LEU B C   1 
ATOM   8121 O  O   . LEU B 2 56   ? 109.915 96.156  30.846  1.00 19.08  ? 76   LEU B O   1 
ATOM   8122 C  CB  . LEU B 2 56   ? 112.309 96.134  32.688  1.00 9.11   ? 76   LEU B CB  1 
ATOM   8123 C  CG  . LEU B 2 56   ? 113.562 95.587  33.379  1.00 11.80  ? 76   LEU B CG  1 
ATOM   8124 C  CD1 . LEU B 2 56   ? 114.682 96.608  33.419  1.00 14.14  ? 76   LEU B CD1 1 
ATOM   8125 C  CD2 . LEU B 2 56   ? 113.220 95.115  34.775  1.00 16.05  ? 76   LEU B CD2 1 
ATOM   8126 N  N   . THR B 2 57   ? 108.850 95.663  32.772  1.00 12.11  ? 77   THR B N   1 
ATOM   8127 C  CA  . THR B 2 57   ? 107.503 96.012  32.355  1.00 15.54  ? 77   THR B CA  1 
ATOM   8128 C  C   . THR B 2 57   ? 106.825 96.719  33.518  1.00 19.60  ? 77   THR B C   1 
ATOM   8129 O  O   . THR B 2 57   ? 107.186 96.477  34.676  1.00 14.01  ? 77   THR B O   1 
ATOM   8130 C  CB  . THR B 2 57   ? 106.724 94.752  31.935  1.00 26.04  ? 77   THR B CB  1 
ATOM   8131 O  OG1 . THR B 2 57   ? 105.387 95.087  31.555  1.00 31.78  ? 77   THR B OG1 1 
ATOM   8132 C  CG2 . THR B 2 57   ? 106.706 93.716  33.042  1.00 26.92  ? 77   THR B CG2 1 
ATOM   8133 N  N   . PRO B 2 58   ? 105.901 97.641  33.250  1.00 15.23  ? 78   PRO B N   1 
ATOM   8134 C  CA  . PRO B 2 58   ? 105.171 98.272  34.353  1.00 16.35  ? 78   PRO B CA  1 
ATOM   8135 C  C   . PRO B 2 58   ? 104.223 97.293  35.018  1.00 14.76  ? 78   PRO B C   1 
ATOM   8136 O  O   . PRO B 2 58   ? 103.684 96.384  34.383  1.00 17.11  ? 78   PRO B O   1 
ATOM   8137 C  CB  . PRO B 2 58   ? 104.408 99.413  33.676  1.00 20.93  ? 78   PRO B CB  1 
ATOM   8138 C  CG  . PRO B 2 58   ? 104.309 99.016  32.262  1.00 20.43  ? 78   PRO B CG  1 
ATOM   8139 C  CD  . PRO B 2 58   ? 105.582 98.281  31.963  1.00 24.17  ? 78   PRO B CD  1 
ATOM   8140 N  N   . ASN B 2 59   ? 104.028 97.482  36.321  1.00 10.69  ? 79   ASN B N   1 
ATOM   8141 C  CA  . ASN B 2 59   ? 103.229 96.521  37.067  1.00 12.07  ? 79   ASN B CA  1 
ATOM   8142 C  C   . ASN B 2 59   ? 101.740 96.836  36.960  1.00 15.40  ? 79   ASN B C   1 
ATOM   8143 O  O   . ASN B 2 59   ? 100.933 95.921  36.767  1.00 16.17  ? 79   ASN B O   1 
ATOM   8144 C  CB  . ASN B 2 59   ? 103.685 96.486  38.527  1.00 12.69  ? 79   ASN B CB  1 
ATOM   8145 C  CG  . ASN B 2 59   ? 103.247 95.226  39.250  1.00 18.92  ? 79   ASN B CG  1 
ATOM   8146 O  OD1 . ASN B 2 59   ? 102.590 94.362  38.673  1.00 21.02  ? 79   ASN B OD1 1 
ATOM   8147 N  ND2 . ASN B 2 59   ? 103.623 95.108  40.518  1.00 14.36  ? 79   ASN B ND2 1 
ATOM   8148 N  N   . TYR B 2 60   ? 101.374 98.119  37.091  1.00 15.79  ? 80   TYR B N   1 
ATOM   8149 C  CA  . TYR B 2 60   ? 100.011 98.637  36.889  1.00 15.60  ? 80   TYR B CA  1 
ATOM   8150 C  C   . TYR B 2 60   ? 98.977  98.015  37.826  1.00 20.22  ? 80   TYR B C   1 
ATOM   8151 O  O   . TYR B 2 60   ? 97.793  97.952  37.492  1.00 21.09  ? 80   TYR B O   1 
ATOM   8152 C  CB  . TYR B 2 60   ? 99.536  98.475  35.439  1.00 13.51  ? 80   TYR B CB  1 
ATOM   8153 C  CG  . TYR B 2 60   ? 100.168 99.411  34.445  1.00 17.92  ? 80   TYR B CG  1 
ATOM   8154 C  CD1 . TYR B 2 60   ? 100.838 100.551 34.861  1.00 17.44  ? 80   TYR B CD1 1 
ATOM   8155 C  CD2 . TYR B 2 60   ? 100.092 99.151  33.084  1.00 21.29  ? 80   TYR B CD2 1 
ATOM   8156 C  CE1 . TYR B 2 60   ? 101.419 101.409 33.948  1.00 17.58  ? 80   TYR B CE1 1 
ATOM   8157 C  CE2 . TYR B 2 60   ? 100.672 99.999  32.163  1.00 22.54  ? 80   TYR B CE2 1 
ATOM   8158 C  CZ  . TYR B 2 60   ? 101.336 101.126 32.601  1.00 22.32  ? 80   TYR B CZ  1 
ATOM   8159 O  OH  . TYR B 2 60   ? 101.916 101.978 31.691  1.00 30.95  ? 80   TYR B OH  1 
ATOM   8160 N  N   . ASN B 2 61   ? 99.390  97.542  38.998  1.00 15.87  ? 81   ASN B N   1 
ATOM   8161 C  CA  . ASN B 2 61   ? 98.435  97.073  39.990  1.00 14.80  ? 81   ASN B CA  1 
ATOM   8162 C  C   . ASN B 2 61   ? 97.925  98.304  40.722  1.00 17.67  ? 81   ASN B C   1 
ATOM   8163 O  O   . ASN B 2 61   ? 98.694  98.916  41.479  1.00 18.43  ? 81   ASN B O   1 
ATOM   8164 C  CB  . ASN B 2 61   ? 99.090  96.097  40.955  1.00 18.08  ? 81   ASN B CB  1 
ATOM   8165 C  CG  . ASN B 2 61   ? 98.089  95.358  41.831  1.00 21.11  ? 81   ASN B CG  1 
ATOM   8166 O  OD1 . ASN B 2 61   ? 96.886  95.592  41.763  1.00 19.54  ? 81   ASN B OD1 1 
ATOM   8167 N  ND2 . ASN B 2 61   ? 98.590  94.446  42.651  1.00 19.51  ? 81   ASN B ND2 1 
ATOM   8168 N  N   . PRO B 2 62   ? 96.660  98.702  40.541  1.00 18.29  ? 82   PRO B N   1 
ATOM   8169 C  CA  . PRO B 2 62   ? 96.215  100.027 41.013  1.00 15.98  ? 82   PRO B CA  1 
ATOM   8170 C  C   . PRO B 2 62   ? 96.144  100.165 42.523  1.00 23.03  ? 82   PRO B C   1 
ATOM   8171 O  O   . PRO B 2 62   ? 95.997  101.292 43.014  1.00 23.85  ? 82   PRO B O   1 
ATOM   8172 C  CB  . PRO B 2 62   ? 94.824  100.170 40.388  1.00 21.90  ? 82   PRO B CB  1 
ATOM   8173 C  CG  . PRO B 2 62   ? 94.353  98.776  40.234  1.00 22.15  ? 82   PRO B CG  1 
ATOM   8174 C  CD  . PRO B 2 62   ? 95.564  97.953  39.907  1.00 20.87  ? 82   PRO B CD  1 
ATOM   8175 N  N   . ASP B 2 63   ? 96.253  99.069  43.272  1.00 17.97  ? 83   ASP B N   1 
ATOM   8176 C  CA  . ASP B 2 63   ? 96.360  99.169  44.717  1.00 17.45  ? 83   ASP B CA  1 
ATOM   8177 C  C   . ASP B 2 63   ? 97.710  99.719  45.150  1.00 16.46  ? 83   ASP B C   1 
ATOM   8178 O  O   . ASP B 2 63   ? 97.813  100.260 46.252  1.00 17.19  ? 83   ASP B O   1 
ATOM   8179 C  CB  . ASP B 2 63   ? 96.122  97.797  45.343  1.00 21.48  ? 83   ASP B CB  1 
ATOM   8180 C  CG  . ASP B 2 63   ? 94.714  97.298  45.124  1.00 32.82  ? 83   ASP B CG  1 
ATOM   8181 O  OD1 . ASP B 2 63   ? 93.792  98.132  45.069  1.00 33.43  ? 83   ASP B OD1 1 
ATOM   8182 O  OD2 . ASP B 2 63   ? 94.530  96.075  44.978  1.00 34.79  ? 83   ASP B OD2 1 
ATOM   8183 N  N   . ILE B 2 64   ? 98.735  99.603  44.309  1.00 14.38  ? 84   ILE B N   1 
ATOM   8184 C  CA  . ILE B 2 64   ? 100.081 100.064 44.636  1.00 13.68  ? 84   ILE B CA  1 
ATOM   8185 C  C   . ILE B 2 64   ? 100.188 101.545 44.299  1.00 14.72  ? 84   ILE B C   1 
ATOM   8186 O  O   . ILE B 2 64   ? 99.727  101.981 43.239  1.00 14.61  ? 84   ILE B O   1 
ATOM   8187 C  CB  . ILE B 2 64   ? 101.136 99.256  43.867  1.00 14.33  ? 84   ILE B CB  1 
ATOM   8188 C  CG1 . ILE B 2 64   ? 100.998 97.776  44.159  1.00 15.77  ? 84   ILE B CG1 1 
ATOM   8189 C  CG2 . ILE B 2 64   ? 102.515 99.662  44.269  1.00 13.70  ? 84   ILE B CG2 1 
ATOM   8190 C  CD1 . ILE B 2 64   ? 101.860 96.941  43.265  1.00 15.44  ? 84   ILE B CD1 1 
ATOM   8191 N  N   . ILE B 2 65   ? 100.786 102.323 45.196  1.00 10.78  ? 85   ILE B N   1 
ATOM   8192 C  CA  . ILE B 2 65   ? 101.005 103.746 44.980  1.00 14.95  ? 85   ILE B CA  1 
ATOM   8193 C  C   . ILE B 2 65   ? 102.469 103.920 44.597  1.00 17.47  ? 85   ILE B C   1 
ATOM   8194 O  O   . ILE B 2 65   ? 103.361 103.897 45.446  1.00 18.69  ? 85   ILE B O   1 
ATOM   8195 C  CB  . ILE B 2 65   ? 100.619 104.577 46.206  1.00 16.40  ? 85   ILE B CB  1 
ATOM   8196 C  CG1 . ILE B 2 65   ? 99.134  104.413 46.496  1.00 24.52  ? 85   ILE B CG1 1 
ATOM   8197 C  CG2 . ILE B 2 65   ? 100.909 106.046 45.987  1.00 19.78  ? 85   ILE B CG2 1 
ATOM   8198 C  CD1 . ILE B 2 65   ? 98.246  104.895 45.374  1.00 30.27  ? 85   ILE B CD1 1 
ATOM   8199 N  N   . PHE B 2 66   ? 102.719 104.072 43.305  1.00 12.75  ? 86   PHE B N   1 
ATOM   8200 C  CA  . PHE B 2 66   ? 104.030 104.456 42.814  1.00 15.21  ? 86   PHE B CA  1 
ATOM   8201 C  C   . PHE B 2 66   ? 104.231 105.946 43.028  1.00 19.61  ? 86   PHE B C   1 
ATOM   8202 O  O   . PHE B 2 66   ? 103.383 106.747 42.632  1.00 22.16  ? 86   PHE B O   1 
ATOM   8203 C  CB  . PHE B 2 66   ? 104.135 104.115 41.336  1.00 13.53  ? 86   PHE B CB  1 
ATOM   8204 C  CG  . PHE B 2 66   ? 104.225 102.655 41.068  1.00 12.90  ? 86   PHE B CG  1 
ATOM   8205 C  CD1 . PHE B 2 66   ? 104.874 101.822 41.949  1.00 14.18  ? 86   PHE B CD1 1 
ATOM   8206 C  CD2 . PHE B 2 66   ? 103.569 102.102 39.992  1.00 11.50  ? 86   PHE B CD2 1 
ATOM   8207 C  CE1 . PHE B 2 66   ? 104.943 100.473 41.710  1.00 17.26  ? 86   PHE B CE1 1 
ATOM   8208 C  CE2 . PHE B 2 66   ? 103.621 100.752 39.752  1.00 13.48  ? 86   PHE B CE2 1 
ATOM   8209 C  CZ  . PHE B 2 66   ? 104.306 99.937  40.615  1.00 14.29  ? 86   PHE B CZ  1 
ATOM   8210 N  N   . LYS B 2 67   ? 105.340 106.312 43.669  1.00 12.72  ? 87   LYS B N   1 
ATOM   8211 C  CA  . LYS B 2 67   ? 105.670 107.721 43.859  1.00 14.81  ? 87   LYS B CA  1 
ATOM   8212 C  C   . LYS B 2 67   ? 105.931 108.414 42.527  1.00 20.90  ? 87   LYS B C   1 
ATOM   8213 O  O   . LYS B 2 67   ? 105.298 109.428 42.212  1.00 20.34  ? 87   LYS B O   1 
ATOM   8214 C  CB  . LYS B 2 67   ? 106.887 107.856 44.768  1.00 18.68  ? 87   LYS B CB  1 
ATOM   8215 C  CG  . LYS B 2 67   ? 107.321 109.284 45.006  1.00 23.24  ? 87   LYS B CG  1 
ATOM   8216 C  CD  . LYS B 2 67   ? 108.565 109.328 45.857  1.00 21.60  ? 87   LYS B CD  1 
ATOM   8217 C  CE  . LYS B 2 67   ? 109.048 110.739 46.057  1.00 30.23  ? 87   LYS B CE  1 
ATOM   8218 N  NZ  . LYS B 2 67   ? 110.318 110.773 46.823  1.00 33.42  ? 87   LYS B NZ  1 
ATOM   8219 N  N   . ASP B 2 68   ? 106.868 107.868 41.741  1.00 14.42  ? 88   ASP B N   1 
ATOM   8220 C  CA  . ASP B 2 68   ? 107.283 108.373 40.427  1.00 15.72  ? 88   ASP B CA  1 
ATOM   8221 C  C   . ASP B 2 68   ? 107.784 109.817 40.525  1.00 21.47  ? 88   ASP B C   1 
ATOM   8222 O  O   . ASP B 2 68   ? 107.214 110.749 39.957  1.00 19.50  ? 88   ASP B O   1 
ATOM   8223 C  CB  . ASP B 2 68   ? 106.158 108.229 39.393  1.00 20.76  ? 88   ASP B CB  1 
ATOM   8224 C  CG  . ASP B 2 68   ? 106.651 108.352 37.963  1.00 31.77  ? 88   ASP B CG  1 
ATOM   8225 O  OD1 . ASP B 2 68   ? 107.868 108.530 37.748  1.00 27.75  ? 88   ASP B OD1 1 
ATOM   8226 O  OD2 . ASP B 2 68   ? 105.809 108.270 37.043  1.00 36.33  ? 88   ASP B OD2 1 
ATOM   8227 N  N   . GLU B 2 69   ? 108.879 109.982 41.269  1.00 18.50  ? 89   GLU B N   1 
ATOM   8228 C  CA  . GLU B 2 69   ? 109.452 111.303 41.484  1.00 17.57  ? 89   GLU B CA  1 
ATOM   8229 C  C   . GLU B 2 69   ? 110.167 111.837 40.252  1.00 20.28  ? 89   GLU B C   1 
ATOM   8230 O  O   . GLU B 2 69   ? 110.354 113.050 40.143  1.00 22.15  ? 89   GLU B O   1 
ATOM   8231 C  CB  . GLU B 2 69   ? 110.419 111.266 42.667  1.00 21.06  ? 89   GLU B CB  1 
ATOM   8232 C  CG  . GLU B 2 69   ? 111.722 110.517 42.410  1.00 17.42  ? 89   GLU B CG  1 
ATOM   8233 C  CD  . GLU B 2 69   ? 111.646 109.019 42.676  1.00 20.41  ? 89   GLU B CD  1 
ATOM   8234 O  OE1 . GLU B 2 69   ? 110.536 108.461 42.776  1.00 19.24  ? 89   GLU B OE1 1 
ATOM   8235 O  OE2 . GLU B 2 69   ? 112.724 108.406 42.788  1.00 19.84  ? 89   GLU B OE2 1 
ATOM   8236 N  N   . GLU B 2 70   ? 110.567 110.972 39.325  1.00 14.94  ? 90   GLU B N   1 
ATOM   8237 C  CA  . GLU B 2 70   ? 111.256 111.431 38.130  1.00 17.04  ? 90   GLU B CA  1 
ATOM   8238 C  C   . GLU B 2 70   ? 110.306 111.801 37.004  1.00 17.27  ? 90   GLU B C   1 
ATOM   8239 O  O   . GLU B 2 70   ? 110.756 112.410 36.026  1.00 19.40  ? 90   GLU B O   1 
ATOM   8240 C  CB  . GLU B 2 70   ? 112.229 110.363 37.615  1.00 13.37  ? 90   GLU B CB  1 
ATOM   8241 C  CG  . GLU B 2 70   ? 113.447 110.086 38.485  1.00 16.41  ? 90   GLU B CG  1 
ATOM   8242 C  CD  . GLU B 2 70   ? 113.199 109.019 39.534  1.00 17.58  ? 90   GLU B CD  1 
ATOM   8243 O  OE1 . GLU B 2 70   ? 112.074 108.481 39.591  1.00 14.48  ? 90   GLU B OE1 1 
ATOM   8244 O  OE2 . GLU B 2 70   ? 114.144 108.702 40.286  1.00 15.61  ? 90   GLU B OE2 1 
ATOM   8245 N  N   . ASN B 2 71   ? 109.019 111.446 37.131  1.00 15.24  ? 91   ASN B N   1 
ATOM   8246 C  CA  . ASN B 2 71   ? 108.009 111.554 36.068  1.00 16.42  ? 91   ASN B CA  1 
ATOM   8247 C  C   . ASN B 2 71   ? 108.442 110.820 34.801  1.00 18.64  ? 91   ASN B C   1 
ATOM   8248 O  O   . ASN B 2 71   ? 108.201 111.278 33.683  1.00 21.52  ? 91   ASN B O   1 
ATOM   8249 C  CB  . ASN B 2 71   ? 107.654 113.013 35.759  1.00 23.29  ? 91   ASN B CB  1 
ATOM   8250 C  CG  . ASN B 2 71   ? 106.848 113.661 36.858  1.00 26.28  ? 91   ASN B CG  1 
ATOM   8251 O  OD1 . ASN B 2 71   ? 105.918 113.061 37.394  1.00 31.32  ? 91   ASN B OD1 1 
ATOM   8252 N  ND2 . ASN B 2 71   ? 107.202 114.892 37.206  1.00 25.85  ? 91   ASN B ND2 1 
ATOM   8253 N  N   . THR B 2 72   ? 109.095 109.669 34.977  1.00 16.14  ? 92   THR B N   1 
ATOM   8254 C  CA  . THR B 2 72   ? 109.551 108.850 33.864  1.00 17.02  ? 92   THR B CA  1 
ATOM   8255 C  C   . THR B 2 72   ? 108.968 107.448 33.878  1.00 17.20  ? 92   THR B C   1 
ATOM   8256 O  O   . THR B 2 72   ? 109.282 106.659 32.981  1.00 21.41  ? 92   THR B O   1 
ATOM   8257 C  CB  . THR B 2 72   ? 111.082 108.731 33.858  1.00 21.85  ? 92   THR B CB  1 
ATOM   8258 O  OG1 . THR B 2 72   ? 111.514 108.080 35.056  1.00 16.82  ? 92   THR B OG1 1 
ATOM   8259 C  CG2 . THR B 2 72   ? 111.743 110.096 33.763  1.00 22.00  ? 92   THR B CG2 1 
ATOM   8260 N  N   . GLY B 2 73   ? 108.155 107.107 34.873  1.00 16.04  ? 93   GLY B N   1 
ATOM   8261 C  CA  . GLY B 2 73   ? 107.649 105.754 34.984  1.00 16.97  ? 93   GLY B CA  1 
ATOM   8262 C  C   . GLY B 2 73   ? 108.679 104.734 35.402  1.00 15.69  ? 93   GLY B C   1 
ATOM   8263 O  O   . GLY B 2 73   ? 108.432 103.533 35.281  1.00 14.48  ? 93   GLY B O   1 
ATOM   8264 N  N   . ALA B 2 74   ? 109.831 105.181 35.910  1.00 12.32  ? 94   ALA B N   1 
ATOM   8265 C  CA  . ALA B 2 74   ? 110.930 104.295 36.263  1.00 8.99   ? 94   ALA B CA  1 
ATOM   8266 C  C   . ALA B 2 74   ? 110.668 103.495 37.527  1.00 11.49  ? 94   ALA B C   1 
ATOM   8267 O  O   . ALA B 2 74   ? 111.403 102.543 37.800  1.00 12.08  ? 94   ALA B O   1 
ATOM   8268 C  CB  . ALA B 2 74   ? 112.220 105.099 36.428  1.00 14.20  ? 94   ALA B CB  1 
ATOM   8269 N  N   . ASP B 2 75   ? 109.652 103.854 38.302  1.00 10.65  ? 95   ASP B N   1 
ATOM   8270 C  CA  . ASP B 2 75   ? 109.263 103.086 39.471  1.00 8.12   ? 95   ASP B CA  1 
ATOM   8271 C  C   . ASP B 2 75   ? 108.214 102.042 39.144  1.00 12.50  ? 95   ASP B C   1 
ATOM   8272 O  O   . ASP B 2 75   ? 107.457 101.630 40.029  1.00 12.93  ? 95   ASP B O   1 
ATOM   8273 C  CB  . ASP B 2 75   ? 108.765 104.030 40.557  1.00 9.01   ? 95   ASP B CB  1 
ATOM   8274 C  CG  . ASP B 2 75   ? 109.844 104.960 41.019  1.00 12.13  ? 95   ASP B CG  1 
ATOM   8275 O  OD1 . ASP B 2 75   ? 111.019 104.549 40.968  1.00 10.84  ? 95   ASP B OD1 1 
ATOM   8276 O  OD2 . ASP B 2 75   ? 109.531 106.105 41.398  1.00 13.59  ? 95   ASP B OD2 1 
ATOM   8277 N  N   . ARG B 2 76   ? 108.144 101.623 37.891  1.00 9.69   ? 96   ARG B N   1 
ATOM   8278 C  CA  . ARG B 2 76   ? 107.212 100.611 37.441  1.00 8.42   ? 96   ARG B CA  1 
ATOM   8279 C  C   . ARG B 2 76   ? 107.893 99.410  36.824  1.00 9.53   ? 96   ARG B C   1 
ATOM   8280 O  O   . ARG B 2 76   ? 107.354 98.307  36.911  1.00 9.62   ? 96   ARG B O   1 
ATOM   8281 C  CB  . ARG B 2 76   ? 106.250 101.207 36.408  1.00 13.04  ? 96   ARG B CB  1 
ATOM   8282 C  CG  . ARG B 2 76   ? 105.394 102.312 36.962  1.00 18.11  ? 96   ARG B CG  1 
ATOM   8283 C  CD  . ARG B 2 76   ? 104.432 102.853 35.937  1.00 20.76  ? 96   ARG B CD  1 
ATOM   8284 N  NE  . ARG B 2 76   ? 103.665 103.956 36.494  1.00 22.29  ? 96   ARG B NE  1 
ATOM   8285 C  CZ  . ARG B 2 76   ? 102.499 103.818 37.109  1.00 26.96  ? 96   ARG B CZ  1 
ATOM   8286 N  NH1 . ARG B 2 76   ? 101.945 102.622 37.229  1.00 19.75  ? 96   ARG B NH1 1 
ATOM   8287 N  NH2 . ARG B 2 76   ? 101.881 104.885 37.589  1.00 27.98  ? 96   ARG B NH2 1 
ATOM   8288 N  N   . LEU B 2 77   ? 109.058 99.597  36.211  1.00 8.75   ? 97   LEU B N   1 
ATOM   8289 C  CA  . LEU B 2 77   ? 109.768 98.510  35.552  1.00 8.19   ? 97   LEU B CA  1 
ATOM   8290 C  C   . LEU B 2 77   ? 110.384 97.586  36.593  1.00 12.93  ? 97   LEU B C   1 
ATOM   8291 O  O   . LEU B 2 77   ? 111.183 98.028  37.424  1.00 12.96  ? 97   LEU B O   1 
ATOM   8292 C  CB  . LEU B 2 77   ? 110.849 99.079  34.643  1.00 7.38   ? 97   LEU B CB  1 
ATOM   8293 C  CG  . LEU B 2 77   ? 110.328 99.971  33.523  1.00 14.12  ? 97   LEU B CG  1 
ATOM   8294 C  CD1 . LEU B 2 77   ? 111.477 100.571 32.749  1.00 12.69  ? 97   LEU B CD1 1 
ATOM   8295 C  CD2 . LEU B 2 77   ? 109.427 99.189  32.605  1.00 15.47  ? 97   LEU B CD2 1 
ATOM   8296 N  N   . MET B 2 78   ? 110.027 96.306  36.538  1.00 9.30   ? 98   MET B N   1 
ATOM   8297 C  CA  . MET B 2 78   ? 110.543 95.335  37.490  1.00 6.34   ? 98   MET B CA  1 
ATOM   8298 C  C   . MET B 2 78   ? 110.400 93.935  36.913  1.00 10.32  ? 98   MET B C   1 
ATOM   8299 O  O   . MET B 2 78   ? 109.508 93.676  36.104  1.00 11.83  ? 98   MET B O   1 
ATOM   8300 C  CB  . MET B 2 78   ? 109.828 95.452  38.835  1.00 8.98   ? 98   MET B CB  1 
ATOM   8301 C  CG  . MET B 2 78   ? 108.329 95.373  38.734  1.00 7.73   ? 98   MET B CG  1 
ATOM   8302 S  SD  . MET B 2 78   ? 107.520 95.613  40.325  1.00 12.86  ? 98   MET B SD  1 
ATOM   8303 C  CE  . MET B 2 78   ? 107.806 97.355  40.597  1.00 13.16  ? 98   MET B CE  1 
ATOM   8304 N  N   . THR B 2 79   ? 111.293 93.038  37.339  1.00 8.76   ? 99   THR B N   1 
ATOM   8305 C  CA  . THR B 2 79   ? 111.350 91.687  36.798  1.00 8.06   ? 99   THR B CA  1 
ATOM   8306 C  C   . THR B 2 79   ? 110.235 90.821  37.372  1.00 11.70  ? 99   THR B C   1 
ATOM   8307 O  O   . THR B 2 79   ? 109.520 91.211  38.297  1.00 10.82  ? 99   THR B O   1 
ATOM   8308 C  CB  . THR B 2 79   ? 112.699 91.039  37.084  1.00 8.59   ? 99   THR B CB  1 
ATOM   8309 O  OG1 . THR B 2 79   ? 112.891 90.943  38.499  1.00 8.49   ? 99   THR B OG1 1 
ATOM   8310 C  CG2 . THR B 2 79   ? 113.820 91.857  36.473  1.00 10.14  ? 99   THR B CG2 1 
ATOM   8311 N  N   . GLN B 2 80   ? 110.128 89.610  36.816  1.00 12.40  ? 100  GLN B N   1 
ATOM   8312 C  CA  . GLN B 2 80   ? 108.941 88.779  36.999  1.00 12.49  ? 100  GLN B CA  1 
ATOM   8313 C  C   . GLN B 2 80   ? 108.795 88.298  38.433  1.00 13.59  ? 100  GLN B C   1 
ATOM   8314 O  O   . GLN B 2 80   ? 107.678 88.247  38.975  1.00 14.53  ? 100  GLN B O   1 
ATOM   8315 C  CB  . GLN B 2 80   ? 108.998 87.586  36.053  1.00 17.07  ? 100  GLN B CB  1 
ATOM   8316 C  CG  . GLN B 2 80   ? 108.880 87.950  34.600  1.00 20.95  ? 100  GLN B CG  1 
ATOM   8317 C  CD  . GLN B 2 80   ? 108.958 86.741  33.704  1.00 25.42  ? 100  GLN B CD  1 
ATOM   8318 O  OE1 . GLN B 2 80   ? 109.194 85.626  34.167  1.00 26.61  ? 100  GLN B OE1 1 
ATOM   8319 N  NE2 . GLN B 2 80   ? 108.750 86.950  32.411  1.00 26.92  ? 100  GLN B NE2 1 
ATOM   8320 N  N   . ARG B 2 81   ? 109.913 87.945  39.058  1.00 10.62  ? 101  ARG B N   1 
ATOM   8321 C  CA  . ARG B 2 81   ? 109.884 87.526  40.448  1.00 9.35   ? 101  ARG B CA  1 
ATOM   8322 C  C   . ARG B 2 81   ? 109.518 88.695  41.356  1.00 7.26   ? 101  ARG B C   1 
ATOM   8323 O  O   . ARG B 2 81   ? 108.735 88.532  42.299  1.00 11.50  ? 101  ARG B O   1 
ATOM   8324 C  CB  . ARG B 2 81   ? 111.239 86.927  40.806  1.00 10.72  ? 101  ARG B CB  1 
ATOM   8325 C  CG  . ARG B 2 81   ? 111.305 86.222  42.123  1.00 13.47  ? 101  ARG B CG  1 
ATOM   8326 C  CD  . ARG B 2 81   ? 112.630 85.496  42.243  1.00 17.20  ? 101  ARG B CD  1 
ATOM   8327 N  NE  . ARG B 2 81   ? 112.755 84.819  43.523  1.00 17.57  ? 101  ARG B NE  1 
ATOM   8328 C  CZ  . ARG B 2 81   ? 112.289 83.603  43.764  1.00 22.93  ? 101  ARG B CZ  1 
ATOM   8329 N  NH1 . ARG B 2 81   ? 111.668 82.926  42.812  1.00 22.24  ? 101  ARG B NH1 1 
ATOM   8330 N  NH2 . ARG B 2 81   ? 112.446 83.064  44.961  1.00 20.09  ? 101  ARG B NH2 1 
ATOM   8331 N  N   . CYS B 2 82   ? 110.025 89.894  41.042  1.00 9.10   ? 102  CYS B N   1 
ATOM   8332 C  CA  . CYS B 2 82   ? 109.676 91.081  41.817  1.00 8.79   ? 102  CYS B CA  1 
ATOM   8333 C  C   . CYS B 2 82   ? 108.221 91.469  41.618  1.00 9.73   ? 102  CYS B C   1 
ATOM   8334 O  O   . CYS B 2 82   ? 107.571 91.940  42.558  1.00 11.55  ? 102  CYS B O   1 
ATOM   8335 C  CB  . CYS B 2 82   ? 110.579 92.248  41.439  1.00 7.25   ? 102  CYS B CB  1 
ATOM   8336 S  SG  . CYS B 2 82   ? 110.259 93.730  42.403  1.00 13.17  ? 102  CYS B SG  1 
ATOM   8337 N  N   . LYS B 2 83   ? 107.702 91.291  40.397  1.00 9.82   ? 103  LYS B N   1 
ATOM   8338 C  CA  . LYS B 2 83   ? 106.281 91.521  40.152  1.00 10.81  ? 103  LYS B CA  1 
ATOM   8339 C  C   . LYS B 2 83   ? 105.428 90.581  40.983  1.00 14.83  ? 103  LYS B C   1 
ATOM   8340 O  O   . LYS B 2 83   ? 104.437 91.004  41.595  1.00 13.20  ? 103  LYS B O   1 
ATOM   8341 C  CB  . LYS B 2 83   ? 105.941 91.336  38.673  1.00 11.64  ? 103  LYS B CB  1 
ATOM   8342 C  CG  . LYS B 2 83   ? 106.488 92.373  37.720  1.00 24.37  ? 103  LYS B CG  1 
ATOM   8343 C  CD  . LYS B 2 83   ? 105.826 92.224  36.358  1.00 31.11  ? 103  LYS B CD  1 
ATOM   8344 C  CE  . LYS B 2 83   ? 106.285 90.955  35.665  1.00 37.61  ? 103  LYS B CE  1 
ATOM   8345 N  NZ  . LYS B 2 83   ? 105.722 90.753  34.307  1.00 38.89  ? 103  LYS B NZ  1 
ATOM   8346 N  N   . ASP B 2 84   ? 105.818 89.308  41.042  1.00 13.42  ? 104  ASP B N   1 
ATOM   8347 C  CA  . ASP B 2 84   ? 104.989 88.320  41.718  1.00 14.58  ? 104  ASP B CA  1 
ATOM   8348 C  C   . ASP B 2 84   ? 105.009 88.532  43.229  1.00 12.50  ? 104  ASP B C   1 
ATOM   8349 O  O   . ASP B 2 84   ? 103.949 88.617  43.870  1.00 15.40  ? 104  ASP B O   1 
ATOM   8350 C  CB  . ASP B 2 84   ? 105.460 86.916  41.345  1.00 20.30  ? 104  ASP B CB  1 
ATOM   8351 C  CG  . ASP B 2 84   ? 104.465 85.845  41.728  1.00 30.56  ? 104  ASP B CG  1 
ATOM   8352 O  OD1 . ASP B 2 84   ? 103.419 85.743  41.057  1.00 33.64  ? 104  ASP B OD1 1 
ATOM   8353 O  OD2 . ASP B 2 84   ? 104.730 85.093  42.683  1.00 29.87  ? 104  ASP B OD2 1 
ATOM   8354 N  N   . LYS B 2 85   ? 106.206 88.678  43.806  1.00 12.84  ? 105  LYS B N   1 
ATOM   8355 C  CA  . LYS B 2 85   ? 106.293 88.848  45.251  1.00 11.21  ? 105  LYS B CA  1 
ATOM   8356 C  C   . LYS B 2 85   ? 105.765 90.204  45.690  1.00 13.11  ? 105  LYS B C   1 
ATOM   8357 O  O   . LYS B 2 85   ? 105.207 90.320  46.787  1.00 12.97  ? 105  LYS B O   1 
ATOM   8358 C  CB  . LYS B 2 85   ? 107.732 88.676  45.729  1.00 13.45  ? 105  LYS B CB  1 
ATOM   8359 C  CG  . LYS B 2 85   ? 108.455 87.393  45.311  1.00 15.85  ? 105  LYS B CG  1 
ATOM   8360 C  CD  . LYS B 2 85   ? 107.897 86.116  45.902  1.00 17.33  ? 105  LYS B CD  1 
ATOM   8361 C  CE  . LYS B 2 85   ? 107.119 85.328  44.868  1.00 21.16  ? 105  LYS B CE  1 
ATOM   8362 N  NZ  . LYS B 2 85   ? 106.624 84.035  45.384  1.00 25.73  ? 105  LYS B NZ  1 
ATOM   8363 N  N   . LEU B 2 86   ? 105.908 91.228  44.847  1.00 10.21  ? 106  LEU B N   1 
ATOM   8364 C  CA  . LEU B 2 86   ? 105.352 92.533  45.189  1.00 6.56   ? 106  LEU B CA  1 
ATOM   8365 C  C   . LEU B 2 86   ? 103.831 92.503  45.157  1.00 11.66  ? 106  LEU B C   1 
ATOM   8366 O  O   . LEU B 2 86   ? 103.179 93.137  45.996  1.00 10.92  ? 106  LEU B O   1 
ATOM   8367 C  CB  . LEU B 2 86   ? 105.884 93.606  44.245  1.00 9.89   ? 106  LEU B CB  1 
ATOM   8368 C  CG  . LEU B 2 86   ? 105.436 95.018  44.618  1.00 10.45  ? 106  LEU B CG  1 
ATOM   8369 C  CD1 . LEU B 2 86   ? 105.989 95.402  45.974  1.00 10.51  ? 106  LEU B CD1 1 
ATOM   8370 C  CD2 . LEU B 2 86   ? 105.816 96.028  43.568  1.00 6.01   ? 106  LEU B CD2 1 
ATOM   8371 N  N   . ASN B 2 87   ? 103.252 91.761  44.206  1.00 14.65  ? 107  ASN B N   1 
ATOM   8372 C  CA  . ASN B 2 87   ? 101.803 91.578  44.191  1.00 14.07  ? 107  ASN B CA  1 
ATOM   8373 C  C   . ASN B 2 87   ? 101.317 90.877  45.453  1.00 16.43  ? 107  ASN B C   1 
ATOM   8374 O  O   . ASN B 2 87   ? 100.330 91.314  46.071  1.00 14.33  ? 107  ASN B O   1 
ATOM   8375 C  CB  . ASN B 2 87   ? 101.387 90.799  42.949  1.00 12.76  ? 107  ASN B CB  1 
ATOM   8376 C  CG  . ASN B 2 87   ? 101.383 91.657  41.709  1.00 15.76  ? 107  ASN B CG  1 
ATOM   8377 O  OD1 . ASN B 2 87   ? 100.904 92.787  41.729  1.00 17.24  ? 107  ASN B OD1 1 
ATOM   8378 N  ND2 . ASN B 2 87   ? 101.924 91.130  40.620  1.00 19.95  ? 107  ASN B ND2 1 
ATOM   8379 N  N   . ALA B 2 88   ? 102.022 89.816  45.873  1.00 16.65  ? 108  ALA B N   1 
ATOM   8380 C  CA  . ALA B 2 88   ? 101.657 89.121  47.108  1.00 18.05  ? 108  ALA B CA  1 
ATOM   8381 C  C   . ALA B 2 88   ? 101.782 90.036  48.323  1.00 14.21  ? 108  ALA B C   1 
ATOM   8382 O  O   . ALA B 2 88   ? 100.948 89.989  49.239  1.00 17.43  ? 108  ALA B O   1 
ATOM   8383 C  CB  . ALA B 2 88   ? 102.521 87.871  47.282  1.00 13.50  ? 108  ALA B CB  1 
ATOM   8384 N  N   . LEU B 2 89   ? 102.787 90.912  48.320  1.00 8.44   ? 109  LEU B N   1 
ATOM   8385 C  CA  . LEU B 2 89   ? 102.968 91.816  49.446  1.00 10.39  ? 109  LEU B CA  1 
ATOM   8386 C  C   . LEU B 2 89   ? 101.876 92.870  49.493  1.00 11.20  ? 109  LEU B C   1 
ATOM   8387 O  O   . LEU B 2 89   ? 101.391 93.198  50.577  1.00 13.35  ? 109  LEU B O   1 
ATOM   8388 C  CB  . LEU B 2 89   ? 104.340 92.474  49.385  1.00 10.22  ? 109  LEU B CB  1 
ATOM   8389 C  CG  . LEU B 2 89   ? 104.655 93.358  50.586  1.00 12.80  ? 109  LEU B CG  1 
ATOM   8390 C  CD1 . LEU B 2 89   ? 104.588 92.571  51.871  1.00 12.76  ? 109  LEU B CD1 1 
ATOM   8391 C  CD2 . LEU B 2 89   ? 106.011 93.977  50.425  1.00 11.44  ? 109  LEU B CD2 1 
ATOM   8392 N  N   . ALA B 2 90   ? 101.458 93.390  48.334  1.00 11.06  ? 110  ALA B N   1 
ATOM   8393 C  CA  . ALA B 2 90   ? 100.363 94.358  48.305  1.00 10.47  ? 110  ALA B CA  1 
ATOM   8394 C  C   . ALA B 2 90   ? 99.066  93.739  48.811  1.00 13.88  ? 110  ALA B C   1 
ATOM   8395 O  O   . ALA B 2 90   ? 98.327  94.367  49.592  1.00 13.39  ? 110  ALA B O   1 
ATOM   8396 C  CB  . ALA B 2 90   ? 100.185 94.906  46.891  1.00 11.92  ? 110  ALA B CB  1 
ATOM   8397 N  N   . ILE B 2 91   ? 98.810  92.483  48.415  1.00 12.05  ? 111  ILE B N   1 
ATOM   8398 C  CA  . ILE B 2 91   ? 97.649  91.740  48.907  1.00 14.10  ? 111  ILE B CA  1 
ATOM   8399 C  C   . ILE B 2 91   ? 97.691  91.605  50.425  1.00 15.60  ? 111  ILE B C   1 
ATOM   8400 O  O   . ILE B 2 91   ? 96.694  91.857  51.114  1.00 19.04  ? 111  ILE B O   1 
ATOM   8401 C  CB  . ILE B 2 91   ? 97.572  90.369  48.210  1.00 21.71  ? 111  ILE B CB  1 
ATOM   8402 C  CG1 . ILE B 2 91   ? 97.228  90.547  46.734  1.00 21.97  ? 111  ILE B CG1 1 
ATOM   8403 C  CG2 . ILE B 2 91   ? 96.571  89.447  48.886  1.00 22.27  ? 111  ILE B CG2 1 
ATOM   8404 C  CD1 . ILE B 2 91   ? 97.339  89.286  45.938  1.00 24.60  ? 111  ILE B CD1 1 
ATOM   8405 N  N   . SER B 2 92   ? 98.860  91.275  50.973  1.00 16.00  ? 112  SER B N   1 
ATOM   8406 C  CA  . SER B 2 92   ? 98.936  91.070  52.415  1.00 17.59  ? 112  SER B CA  1 
ATOM   8407 C  C   . SER B 2 92   ? 98.866  92.384  53.186  1.00 17.23  ? 112  SER B C   1 
ATOM   8408 O  O   . SER B 2 92   ? 98.312  92.419  54.292  1.00 18.75  ? 112  SER B O   1 
ATOM   8409 C  CB  . SER B 2 92   ? 100.211 90.308  52.766  1.00 20.97  ? 112  SER B CB  1 
ATOM   8410 O  OG  . SER B 2 92   ? 100.272 90.026  54.150  1.00 30.64  ? 112  SER B OG  1 
ATOM   8411 N  N   . VAL B 2 93   ? 99.404  93.469  52.625  1.00 15.21  ? 113  VAL B N   1 
ATOM   8412 C  CA  . VAL B 2 93   ? 99.390  94.744  53.335  1.00 13.14  ? 113  VAL B CA  1 
ATOM   8413 C  C   . VAL B 2 93   ? 97.977  95.288  53.416  1.00 18.25  ? 113  VAL B C   1 
ATOM   8414 O  O   . VAL B 2 93   ? 97.541  95.740  54.481  1.00 15.43  ? 113  VAL B O   1 
ATOM   8415 C  CB  . VAL B 2 93   ? 100.362 95.742  52.684  1.00 16.00  ? 113  VAL B CB  1 
ATOM   8416 C  CG1 . VAL B 2 93   ? 100.166 97.136  53.235  1.00 14.12  ? 113  VAL B CG1 1 
ATOM   8417 C  CG2 . VAL B 2 93   ? 101.771 95.312  52.970  1.00 16.03  ? 113  VAL B CG2 1 
ATOM   8418 N  N   . MET B 2 94   ? 97.204  95.182  52.328  1.00 18.16  ? 114  MET B N   1 
ATOM   8419 C  CA  . MET B 2 94   ? 95.791  95.535  52.463  1.00 18.74  ? 114  MET B CA  1 
ATOM   8420 C  C   . MET B 2 94   ? 95.014  94.509  53.289  1.00 22.02  ? 114  MET B C   1 
ATOM   8421 O  O   . MET B 2 94   ? 93.944  94.837  53.813  1.00 21.71  ? 114  MET B O   1 
ATOM   8422 C  CB  . MET B 2 94   ? 95.149  95.707  51.092  1.00 20.47  ? 114  MET B CB  1 
ATOM   8423 C  CG  . MET B 2 94   ? 95.739  96.834  50.280  1.00 21.72  ? 114  MET B CG  1 
ATOM   8424 S  SD  . MET B 2 94   ? 94.842  96.926  48.735  1.00 27.68  ? 114  MET B SD  1 
ATOM   8425 C  CE  . MET B 2 94   ? 95.294  95.337  48.061  1.00 35.51  ? 114  MET B CE  1 
ATOM   8426 N  N   . ASN B 2 95   ? 95.541  93.288  53.441  1.00 20.30  ? 115  ASN B N   1 
ATOM   8427 C  CA  . ASN B 2 95   ? 95.030  92.354  54.438  1.00 23.79  ? 115  ASN B CA  1 
ATOM   8428 C  C   . ASN B 2 95   ? 95.517  92.660  55.846  1.00 24.84  ? 115  ASN B C   1 
ATOM   8429 O  O   . ASN B 2 95   ? 95.182  91.910  56.769  1.00 23.37  ? 115  ASN B O   1 
ATOM   8430 C  CB  . ASN B 2 95   ? 95.416  90.913  54.092  1.00 21.68  ? 115  ASN B CB  1 
ATOM   8431 C  CG  . ASN B 2 95   ? 94.619  90.350  52.944  1.00 29.38  ? 115  ASN B CG  1 
ATOM   8432 O  OD1 . ASN B 2 95   ? 93.409  90.546  52.863  1.00 30.28  ? 115  ASN B OD1 1 
ATOM   8433 N  ND2 . ASN B 2 95   ? 95.292  89.635  52.051  1.00 26.35  ? 115  ASN B ND2 1 
ATOM   8434 N  N   . GLN B 2 96   ? 96.312  93.710  56.043  1.00 18.26  ? 116  GLN B N   1 
ATOM   8435 C  CA  . GLN B 2 96   ? 96.713  94.109  57.387  1.00 17.49  ? 116  GLN B CA  1 
ATOM   8436 C  C   . GLN B 2 96   ? 95.943  95.329  57.886  1.00 24.20  ? 116  GLN B C   1 
ATOM   8437 O  O   . GLN B 2 96   ? 95.328  95.271  58.954  1.00 21.67  ? 116  GLN B O   1 
ATOM   8438 C  CB  . GLN B 2 96   ? 98.218  94.371  57.442  1.00 20.07  ? 116  GLN B CB  1 
ATOM   8439 C  CG  . GLN B 2 96   ? 98.687  94.732  58.827  1.00 19.06  ? 116  GLN B CG  1 
ATOM   8440 C  CD  . GLN B 2 96   ? 98.517  93.604  59.802  1.00 23.95  ? 116  GLN B CD  1 
ATOM   8441 O  OE1 . GLN B 2 96   ? 98.813  92.454  59.489  1.00 28.48  ? 116  GLN B OE1 1 
ATOM   8442 N  NE2 . GLN B 2 96   ? 98.029  93.921  60.996  1.00 26.72  ? 116  GLN B NE2 1 
ATOM   8443 N  N   . TRP B 2 97   ? 95.962  96.452  57.128  1.00 23.04  ? 117  TRP B N   1 
ATOM   8444 C  CA  . TRP B 2 97   ? 95.273  97.669  57.557  1.00 24.57  ? 117  TRP B CA  1 
ATOM   8445 C  C   . TRP B 2 97   ? 94.090  97.974  56.653  1.00 27.30  ? 117  TRP B C   1 
ATOM   8446 O  O   . TRP B 2 97   ? 94.189  97.828  55.430  1.00 23.24  ? 117  TRP B O   1 
ATOM   8447 C  CB  . TRP B 2 97   ? 96.198  98.890  57.553  1.00 26.34  ? 117  TRP B CB  1 
ATOM   8448 C  CG  . TRP B 2 97   ? 97.288  98.841  58.553  1.00 18.80  ? 117  TRP B CG  1 
ATOM   8449 C  CD1 . TRP B 2 97   ? 97.226  99.253  59.840  1.00 19.67  ? 117  TRP B CD1 1 
ATOM   8450 C  CD2 . TRP B 2 97   ? 98.620  98.360  58.346  1.00 17.40  ? 117  TRP B CD2 1 
ATOM   8451 N  NE1 . TRP B 2 97   ? 98.432  99.051  60.461  1.00 19.38  ? 117  TRP B NE1 1 
ATOM   8452 C  CE2 . TRP B 2 97   ? 99.304  98.500  59.562  1.00 18.68  ? 117  TRP B CE2 1 
ATOM   8453 C  CE3 . TRP B 2 97   ? 99.300  97.825  57.248  1.00 19.62  ? 117  TRP B CE3 1 
ATOM   8454 C  CZ2 . TRP B 2 97   ? 100.631 98.126  59.713  1.00 21.83  ? 117  TRP B CZ2 1 
ATOM   8455 C  CZ3 . TRP B 2 97   ? 100.611 97.446  57.401  1.00 22.71  ? 117  TRP B CZ3 1 
ATOM   8456 C  CH2 . TRP B 2 97   ? 101.266 97.601  58.622  1.00 20.77  ? 117  TRP B CH2 1 
ATOM   8457 N  N   . PRO B 2 98   ? 92.961  98.400  57.220  1.00 37.13  ? 118  PRO B N   1 
ATOM   8458 C  CA  . PRO B 2 98   ? 91.854  98.883  56.384  1.00 36.81  ? 118  PRO B CA  1 
ATOM   8459 C  C   . PRO B 2 98   ? 92.123  100.266 55.810  1.00 28.10  ? 118  PRO B C   1 
ATOM   8460 O  O   . PRO B 2 98   ? 92.081  101.267 56.534  1.00 31.66  ? 118  PRO B O   1 
ATOM   8461 C  CB  . PRO B 2 98   ? 90.665  98.906  57.353  1.00 44.72  ? 118  PRO B CB  1 
ATOM   8462 C  CG  . PRO B 2 98   ? 91.048  97.984  58.450  1.00 48.73  ? 118  PRO B CG  1 
ATOM   8463 C  CD  . PRO B 2 98   ? 92.526  98.155  58.602  1.00 43.47  ? 118  PRO B CD  1 
ATOM   8464 N  N   . GLY B 2 99   ? 92.400  100.330 54.511  1.00 24.76  ? 119  GLY B N   1 
ATOM   8465 C  CA  . GLY B 2 99   ? 92.592  101.599 53.843  1.00 26.10  ? 119  GLY B CA  1 
ATOM   8466 C  C   . GLY B 2 99   ? 94.017  102.095 53.780  1.00 27.61  ? 119  GLY B C   1 
ATOM   8467 O  O   . GLY B 2 99   ? 94.241  103.309 53.857  1.00 29.92  ? 119  GLY B O   1 
ATOM   8468 N  N   . VAL B 2 100  ? 94.994  101.200 53.649  1.00 22.19  ? 120  VAL B N   1 
ATOM   8469 C  CA  . VAL B 2 100  ? 96.405  101.564 53.578  1.00 18.12  ? 120  VAL B CA  1 
ATOM   8470 C  C   . VAL B 2 100  ? 97.026  100.820 52.409  1.00 18.66  ? 120  VAL B C   1 
ATOM   8471 O  O   . VAL B 2 100  ? 96.963  99.587  52.351  1.00 18.03  ? 120  VAL B O   1 
ATOM   8472 C  CB  . VAL B 2 100  ? 97.147  101.243 54.883  1.00 21.16  ? 120  VAL B CB  1 
ATOM   8473 C  CG1 . VAL B 2 100  ? 98.625  101.348 54.676  1.00 20.95  ? 120  VAL B CG1 1 
ATOM   8474 C  CG2 . VAL B 2 100  ? 96.738  102.206 55.971  1.00 22.90  ? 120  VAL B CG2 1 
ATOM   8475 N  N   . LYS B 2 101  ? 97.636  101.562 51.489  1.00 15.50  ? 121  LYS B N   1 
ATOM   8476 C  CA  . LYS B 2 101  ? 98.140  101.021 50.238  1.00 13.11  ? 121  LYS B CA  1 
ATOM   8477 C  C   . LYS B 2 101  ? 99.662  100.982 50.234  1.00 13.06  ? 121  LYS B C   1 
ATOM   8478 O  O   . LYS B 2 101  ? 100.322 101.903 50.717  1.00 14.62  ? 121  LYS B O   1 
ATOM   8479 C  CB  . LYS B 2 101  ? 97.619  101.842 49.063  1.00 12.30  ? 121  LYS B CB  1 
ATOM   8480 C  CG  . LYS B 2 101  ? 96.117  101.680 48.892  1.00 17.17  ? 121  LYS B CG  1 
ATOM   8481 C  CD  . LYS B 2 101  ? 95.543  102.465 47.725  1.00 19.83  ? 121  LYS B CD  1 
ATOM   8482 C  CE  . LYS B 2 101  ? 94.030  102.278 47.652  1.00 30.61  ? 121  LYS B CE  1 
ATOM   8483 N  NZ  . LYS B 2 101  ? 93.402  103.020 46.530  1.00 33.52  ? 121  LYS B NZ  1 
ATOM   8484 N  N   . LEU B 2 102  ? 100.203 99.904  49.678  1.00 11.59  ? 122  LEU B N   1 
ATOM   8485 C  CA  . LEU B 2 102  ? 101.634 99.630  49.699  1.00 9.07   ? 122  LEU B CA  1 
ATOM   8486 C  C   . LEU B 2 102  ? 102.345 100.536 48.714  1.00 12.13  ? 122  LEU B C   1 
ATOM   8487 O  O   . LEU B 2 102  ? 102.202 100.371 47.500  1.00 15.70  ? 122  LEU B O   1 
ATOM   8488 C  CB  . LEU B 2 102  ? 101.878 98.175  49.346  1.00 9.57   ? 122  LEU B CB  1 
ATOM   8489 C  CG  . LEU B 2 102  ? 103.339 97.787  49.362  1.00 10.69  ? 122  LEU B CG  1 
ATOM   8490 C  CD1 . LEU B 2 102  ? 103.852 97.877  50.767  1.00 11.62  ? 122  LEU B CD1 1 
ATOM   8491 C  CD2 . LEU B 2 102  ? 103.474 96.395  48.822  1.00 12.60  ? 122  LEU B CD2 1 
ATOM   8492 N  N   . ARG B 2 103  ? 103.134 101.471 49.222  1.00 8.42   ? 123  ARG B N   1 
ATOM   8493 C  CA  . ARG B 2 103  ? 103.705 102.538 48.411  1.00 8.61   ? 123  ARG B CA  1 
ATOM   8494 C  C   . ARG B 2 103  ? 105.145 102.208 48.046  1.00 10.52  ? 123  ARG B C   1 
ATOM   8495 O  O   . ARG B 2 103  ? 106.033 102.249 48.899  1.00 12.43  ? 123  ARG B O   1 
ATOM   8496 C  CB  . ARG B 2 103  ? 103.611 103.861 49.154  1.00 10.89  ? 123  ARG B CB  1 
ATOM   8497 C  CG  . ARG B 2 103  ? 104.230 105.021 48.447  1.00 14.62  ? 123  ARG B CG  1 
ATOM   8498 C  CD  . ARG B 2 103  ? 103.957 106.281 49.227  1.00 14.30  ? 123  ARG B CD  1 
ATOM   8499 N  NE  . ARG B 2 103  ? 104.633 107.422 48.636  1.00 20.44  ? 123  ARG B NE  1 
ATOM   8500 C  CZ  . ARG B 2 103  ? 105.821 107.857 49.030  1.00 19.94  ? 123  ARG B CZ  1 
ATOM   8501 N  NH1 . ARG B 2 103  ? 106.446 107.260 50.029  1.00 16.08  ? 123  ARG B NH1 1 
ATOM   8502 N  NH2 . ARG B 2 103  ? 106.379 108.893 48.433  1.00 21.18  ? 123  ARG B NH2 1 
ATOM   8503 N  N   . VAL B 2 104  ? 105.368 101.889 46.775  1.00 7.85   ? 124  VAL B N   1 
ATOM   8504 C  CA  . VAL B 2 104  ? 106.697 101.619 46.238  1.00 5.71   ? 124  VAL B CA  1 
ATOM   8505 C  C   . VAL B 2 104  ? 107.322 102.952 45.849  1.00 9.07   ? 124  VAL B C   1 
ATOM   8506 O  O   . VAL B 2 104  ? 106.849 103.623 44.932  1.00 11.94  ? 124  VAL B O   1 
ATOM   8507 C  CB  . VAL B 2 104  ? 106.631 100.673 45.035  1.00 9.58   ? 124  VAL B CB  1 
ATOM   8508 C  CG1 . VAL B 2 104  ? 107.957 100.595 44.351  1.00 10.70  ? 124  VAL B CG1 1 
ATOM   8509 C  CG2 . VAL B 2 104  ? 106.210 99.296  45.474  1.00 10.09  ? 124  VAL B CG2 1 
ATOM   8510 N  N   . THR B 2 105  ? 108.390 103.342 46.537  1.00 8.83   ? 125  THR B N   1 
ATOM   8511 C  CA  . THR B 2 105  ? 108.963 104.645 46.244  1.00 8.97   ? 125  THR B CA  1 
ATOM   8512 C  C   . THR B 2 105  ? 109.910 104.576 45.065  1.00 10.08  ? 125  THR B C   1 
ATOM   8513 O  O   . THR B 2 105  ? 109.820 105.393 44.148  1.00 11.89  ? 125  THR B O   1 
ATOM   8514 C  CB  . THR B 2 105  ? 109.704 105.202 47.450  1.00 10.70  ? 125  THR B CB  1 
ATOM   8515 O  OG1 . THR B 2 105  ? 110.810 104.356 47.752  1.00 13.43  ? 125  THR B OG1 1 
ATOM   8516 C  CG2 . THR B 2 105  ? 108.805 105.256 48.636  1.00 14.76  ? 125  THR B CG2 1 
ATOM   8517 N  N   . GLU B 2 106  ? 110.849 103.633 45.085  1.00 8.34   ? 126  GLU B N   1 
ATOM   8518 C  CA  . GLU B 2 106  ? 111.944 103.587 44.122  1.00 9.94   ? 126  GLU B CA  1 
ATOM   8519 C  C   . GLU B 2 106  ? 112.079 102.167 43.606  1.00 12.46  ? 126  GLU B C   1 
ATOM   8520 O  O   . GLU B 2 106  ? 112.238 101.234 44.394  1.00 10.08  ? 126  GLU B O   1 
ATOM   8521 C  CB  . GLU B 2 106  ? 113.247 104.061 44.770  1.00 13.90  ? 126  GLU B CB  1 
ATOM   8522 C  CG  . GLU B 2 106  ? 113.205 105.528 45.177  1.00 20.08  ? 126  GLU B CG  1 
ATOM   8523 C  CD  . GLU B 2 106  ? 114.378 105.973 46.015  1.00 20.35  ? 126  GLU B CD  1 
ATOM   8524 O  OE1 . GLU B 2 106  ? 115.230 105.138 46.362  1.00 19.70  ? 126  GLU B OE1 1 
ATOM   8525 O  OE2 . GLU B 2 106  ? 114.432 107.168 46.358  1.00 18.09  ? 126  GLU B OE2 1 
ATOM   8526 N  N   . GLY B 2 107  ? 112.001 102.004 42.293  1.00 7.72   ? 127  GLY B N   1 
ATOM   8527 C  CA  . GLY B 2 107  ? 112.076 100.688 41.694  1.00 9.00   ? 127  GLY B CA  1 
ATOM   8528 C  C   . GLY B 2 107  ? 113.345 100.479 40.898  1.00 9.79   ? 127  GLY B C   1 
ATOM   8529 O  O   . GLY B 2 107  ? 114.399 100.159 41.453  1.00 9.70   ? 127  GLY B O   1 
ATOM   8530 N  N   . TRP B 2 108  ? 113.247 100.628 39.585  1.00 10.20  ? 128  TRP B N   1 
ATOM   8531 C  CA  . TRP B 2 108  ? 114.408 100.595 38.703  1.00 9.04   ? 128  TRP B CA  1 
ATOM   8532 C  C   . TRP B 2 108  ? 114.877 102.024 38.502  1.00 11.66  ? 128  TRP B C   1 
ATOM   8533 O  O   . TRP B 2 108  ? 114.312 102.762 37.696  1.00 12.02  ? 128  TRP B O   1 
ATOM   8534 C  CB  . TRP B 2 108  ? 114.052 99.946  37.374  1.00 9.23   ? 128  TRP B CB  1 
ATOM   8535 C  CG  . TRP B 2 108  ? 115.139 100.025 36.366  1.00 7.68   ? 128  TRP B CG  1 
ATOM   8536 C  CD1 . TRP B 2 108  ? 116.318 99.347  36.374  1.00 7.83   ? 128  TRP B CD1 1 
ATOM   8537 C  CD2 . TRP B 2 108  ? 115.166 100.868 35.214  1.00 8.38   ? 128  TRP B CD2 1 
ATOM   8538 N  NE1 . TRP B 2 108  ? 117.069 99.698  35.279  1.00 7.11   ? 128  TRP B NE1 1 
ATOM   8539 C  CE2 . TRP B 2 108  ? 116.383 100.633 34.554  1.00 10.75  ? 128  TRP B CE2 1 
ATOM   8540 C  CE3 . TRP B 2 108  ? 114.271 101.791 34.667  1.00 11.43  ? 128  TRP B CE3 1 
ATOM   8541 C  CZ2 . TRP B 2 108  ? 116.730 101.288 33.381  1.00 11.56  ? 128  TRP B CZ2 1 
ATOM   8542 C  CZ3 . TRP B 2 108  ? 114.616 102.438 33.505  1.00 15.98  ? 128  TRP B CZ3 1 
ATOM   8543 C  CH2 . TRP B 2 108  ? 115.832 102.185 32.872  1.00 17.21  ? 128  TRP B CH2 1 
ATOM   8544 N  N   . ASP B 2 109  ? 115.890 102.425 39.263  1.00 10.08  ? 129  ASP B N   1 
ATOM   8545 C  CA  . ASP B 2 109  ? 116.468 103.757 39.130  1.00 10.75  ? 129  ASP B CA  1 
ATOM   8546 C  C   . ASP B 2 109  ? 117.429 103.731 37.947  1.00 12.78  ? 129  ASP B C   1 
ATOM   8547 O  O   . ASP B 2 109  ? 118.181 102.771 37.784  1.00 12.97  ? 129  ASP B O   1 
ATOM   8548 C  CB  . ASP B 2 109  ? 117.205 104.157 40.407  1.00 8.97   ? 129  ASP B CB  1 
ATOM   8549 C  CG  . ASP B 2 109  ? 118.607 104.667 40.136  1.00 11.72  ? 129  ASP B CG  1 
ATOM   8550 O  OD1 . ASP B 2 109  ? 118.804 105.900 40.143  1.00 16.03  ? 129  ASP B OD1 1 
ATOM   8551 O  OD2 . ASP B 2 109  ? 119.511 103.834 39.914  1.00 15.56  ? 129  ASP B OD2 1 
ATOM   8552 N  N   . GLU B 2 110  ? 117.415 104.772 37.120  1.00 13.97  ? 130  GLU B N   1 
ATOM   8553 C  CA  . GLU B 2 110  ? 118.303 104.794 35.969  1.00 15.56  ? 130  GLU B CA  1 
ATOM   8554 C  C   . GLU B 2 110  ? 119.352 105.893 36.009  1.00 20.82  ? 130  GLU B C   1 
ATOM   8555 O  O   . GLU B 2 110  ? 120.284 105.857 35.200  1.00 27.96  ? 130  GLU B O   1 
ATOM   8556 C  CB  . GLU B 2 110  ? 117.499 104.940 34.672  1.00 20.22  ? 130  GLU B CB  1 
ATOM   8557 C  CG  . GLU B 2 110  ? 116.811 106.284 34.524  1.00 22.15  ? 130  GLU B CG  1 
ATOM   8558 C  CD  . GLU B 2 110  ? 116.054 106.412 33.216  1.00 27.46  ? 130  GLU B CD  1 
ATOM   8559 O  OE1 . GLU B 2 110  ? 116.028 105.435 32.436  1.00 26.16  ? 130  GLU B OE1 1 
ATOM   8560 O  OE2 . GLU B 2 110  ? 115.497 107.498 32.963  1.00 22.76  ? 130  GLU B OE2 1 
ATOM   8561 N  N   . ASP B 2 111  ? 119.224 106.879 36.898  1.00 20.29  ? 131  ASP B N   1 
ATOM   8562 C  CA  . ASP B 2 111  ? 120.294 107.860 37.033  1.00 26.15  ? 131  ASP B CA  1 
ATOM   8563 C  C   . ASP B 2 111  ? 121.493 107.280 37.757  1.00 28.30  ? 131  ASP B C   1 
ATOM   8564 O  O   . ASP B 2 111  ? 122.626 107.713 37.524  1.00 30.45  ? 131  ASP B O   1 
ATOM   8565 C  CB  . ASP B 2 111  ? 119.807 109.101 37.771  1.00 30.06  ? 131  ASP B CB  1 
ATOM   8566 C  CG  . ASP B 2 111  ? 118.932 109.974 36.919  1.00 40.35  ? 131  ASP B CG  1 
ATOM   8567 O  OD1 . ASP B 2 111  ? 119.094 109.950 35.685  1.00 39.54  ? 131  ASP B OD1 1 
ATOM   8568 O  OD2 . ASP B 2 111  ? 118.089 110.700 37.481  1.00 41.87  ? 131  ASP B OD2 1 
ATOM   8569 N  N   . GLY B 2 112  ? 121.270 106.311 38.630  1.00 22.66  ? 132  GLY B N   1 
ATOM   8570 C  CA  . GLY B 2 112  ? 122.361 105.739 39.378  1.00 20.67  ? 132  GLY B CA  1 
ATOM   8571 C  C   . GLY B 2 112  ? 122.628 106.509 40.648  1.00 26.41  ? 132  GLY B C   1 
ATOM   8572 O  O   . GLY B 2 112  ? 123.783 106.800 40.970  1.00 31.33  ? 132  GLY B O   1 
ATOM   8573 N  N   . HIS B 2 113  ? 121.560 106.866 41.367  1.00 16.00  ? 133  HIS B N   1 
ATOM   8574 C  CA  . HIS B 2 113  ? 121.717 107.518 42.662  1.00 13.91  ? 133  HIS B CA  1 
ATOM   8575 C  C   . HIS B 2 113  ? 122.350 106.591 43.680  1.00 16.30  ? 133  HIS B C   1 
ATOM   8576 O  O   . HIS B 2 113  ? 123.111 107.041 44.541  1.00 19.20  ? 133  HIS B O   1 
ATOM   8577 C  CB  . HIS B 2 113  ? 120.370 107.958 43.217  1.00 21.65  ? 133  HIS B CB  1 
ATOM   8578 C  CG  . HIS B 2 113  ? 119.668 108.981 42.393  1.00 30.55  ? 133  HIS B CG  1 
ATOM   8579 N  ND1 . HIS B 2 113  ? 118.804 108.648 41.375  1.00 37.25  ? 133  HIS B ND1 1 
ATOM   8580 C  CD2 . HIS B 2 113  ? 119.675 110.331 42.456  1.00 35.23  ? 133  HIS B CD2 1 
ATOM   8581 C  CE1 . HIS B 2 113  ? 118.317 109.751 40.839  1.00 42.17  ? 133  HIS B CE1 1 
ATOM   8582 N  NE2 . HIS B 2 113  ? 118.836 110.786 41.471  1.00 38.38  ? 133  HIS B NE2 1 
ATOM   8583 N  N   . HIS B 2 114  ? 122.049 105.302 43.594  1.00 10.60  ? 134  HIS B N   1 
ATOM   8584 C  CA  . HIS B 2 114  ? 122.249 104.395 44.705  1.00 12.19  ? 134  HIS B CA  1 
ATOM   8585 C  C   . HIS B 2 114  ? 123.685 103.887 44.716  1.00 13.33  ? 134  HIS B C   1 
ATOM   8586 O  O   . HIS B 2 114  ? 124.520 104.287 43.902  1.00 16.96  ? 134  HIS B O   1 
ATOM   8587 C  CB  . HIS B 2 114  ? 121.234 103.265 44.610  1.00 9.64   ? 134  HIS B CB  1 
ATOM   8588 C  CG  . HIS B 2 114  ? 119.841 103.756 44.384  1.00 11.49  ? 134  HIS B CG  1 
ATOM   8589 N  ND1 . HIS B 2 114  ? 119.129 104.441 45.342  1.00 15.17  ? 134  HIS B ND1 1 
ATOM   8590 C  CD2 . HIS B 2 114  ? 119.039 103.687 43.298  1.00 12.05  ? 134  HIS B CD2 1 
ATOM   8591 C  CE1 . HIS B 2 114  ? 117.945 104.765 44.859  1.00 10.74  ? 134  HIS B CE1 1 
ATOM   8592 N  NE2 . HIS B 2 114  ? 117.863 104.316 43.622  1.00 15.43  ? 134  HIS B NE2 1 
ATOM   8593 N  N   . SER B 2 115  ? 123.973 102.995 45.657  1.00 14.44  ? 135  SER B N   1 
ATOM   8594 C  CA  . SER B 2 115  ? 125.321 102.498 45.866  1.00 21.03  ? 135  SER B CA  1 
ATOM   8595 C  C   . SER B 2 115  ? 125.768 101.629 44.693  1.00 23.84  ? 135  SER B C   1 
ATOM   8596 O  O   . SER B 2 115  ? 124.973 101.215 43.846  1.00 19.18  ? 135  SER B O   1 
ATOM   8597 C  CB  . SER B 2 115  ? 125.398 101.701 47.165  1.00 29.74  ? 135  SER B CB  1 
ATOM   8598 O  OG  . SER B 2 115  ? 124.619 100.523 47.076  1.00 32.57  ? 135  SER B OG  1 
ATOM   8599 N  N   . GLU B 2 116  ? 127.066 101.352 44.657  1.00 22.24  ? 136  GLU B N   1 
ATOM   8600 C  CA  . GLU B 2 116  ? 127.651 100.645 43.527  1.00 27.14  ? 136  GLU B CA  1 
ATOM   8601 C  C   . GLU B 2 116  ? 127.267 99.177  43.548  1.00 21.89  ? 136  GLU B C   1 
ATOM   8602 O  O   . GLU B 2 116  ? 127.340 98.519  44.591  1.00 28.95  ? 136  GLU B O   1 
ATOM   8603 C  CB  . GLU B 2 116  ? 129.165 100.824 43.531  1.00 35.45  ? 136  GLU B CB  1 
ATOM   8604 C  CG  . GLU B 2 116  ? 129.585 102.194 43.001  1.00 42.62  ? 136  GLU B CG  1 
ATOM   8605 C  CD  . GLU B 2 116  ? 129.448 103.321 44.014  1.00 49.60  ? 136  GLU B CD  1 
ATOM   8606 O  OE1 . GLU B 2 116  ? 129.152 103.043 45.195  1.00 48.47  ? 136  GLU B OE1 1 
ATOM   8607 O  OE2 . GLU B 2 116  ? 129.613 104.494 43.617  1.00 51.92  ? 136  GLU B OE2 1 
ATOM   8608 N  N   . GLU B 2 117  ? 126.855 98.682  42.381  1.00 17.26  ? 137  GLU B N   1 
ATOM   8609 C  CA  . GLU B 2 117  ? 126.223 97.379  42.187  1.00 13.55  ? 137  GLU B CA  1 
ATOM   8610 C  C   . GLU B 2 117  ? 125.021 97.215  43.112  1.00 18.21  ? 137  GLU B C   1 
ATOM   8611 O  O   . GLU B 2 117  ? 124.989 96.367  44.002  1.00 21.61  ? 137  GLU B O   1 
ATOM   8612 C  CB  . GLU B 2 117  ? 127.223 96.231  42.348  1.00 23.59  ? 137  GLU B CB  1 
ATOM   8613 C  CG  . GLU B 2 117  ? 128.260 96.181  41.237  1.00 29.44  ? 137  GLU B CG  1 
ATOM   8614 C  CD  . GLU B 2 117  ? 129.112 94.937  41.286  1.00 37.72  ? 137  GLU B CD  1 
ATOM   8615 O  OE1 . GLU B 2 117  ? 129.022 94.189  42.280  1.00 41.74  ? 137  GLU B OE1 1 
ATOM   8616 O  OE2 . GLU B 2 117  ? 129.851 94.695  40.313  1.00 42.95  ? 137  GLU B OE2 1 
ATOM   8617 N  N   . SER B 2 118  ? 124.031 98.073  42.894  1.00 12.79  ? 138  SER B N   1 
ATOM   8618 C  CA  . SER B 2 118  ? 122.768 97.993  43.611  1.00 10.06  ? 138  SER B CA  1 
ATOM   8619 C  C   . SER B 2 118  ? 121.779 97.146  42.828  1.00 7.53   ? 138  SER B C   1 
ATOM   8620 O  O   . SER B 2 118  ? 121.726 97.212  41.600  1.00 9.37   ? 138  SER B O   1 
ATOM   8621 C  CB  . SER B 2 118  ? 122.181 99.385  43.834  1.00 10.66  ? 138  SER B CB  1 
ATOM   8622 O  OG  . SER B 2 118  ? 120.909 99.300  44.449  1.00 8.93   ? 138  SER B OG  1 
ATOM   8623 N  N   . LEU B 2 119  ? 120.971 96.367  43.545  1.00 7.39   ? 139  LEU B N   1 
ATOM   8624 C  CA  . LEU B 2 119  ? 119.969 95.567  42.853  1.00 6.10   ? 139  LEU B CA  1 
ATOM   8625 C  C   . LEU B 2 119  ? 118.809 96.397  42.331  1.00 7.64   ? 139  LEU B C   1 
ATOM   8626 O  O   . LEU B 2 119  ? 118.010 95.877  41.548  1.00 8.82   ? 139  LEU B O   1 
ATOM   8627 C  CB  . LEU B 2 119  ? 119.452 94.454  43.759  1.00 6.70   ? 139  LEU B CB  1 
ATOM   8628 C  CG  . LEU B 2 119  ? 120.439 93.320  43.998  1.00 9.49   ? 139  LEU B CG  1 
ATOM   8629 C  CD1 . LEU B 2 119  ? 119.868 92.306  44.935  1.00 8.86   ? 139  LEU B CD1 1 
ATOM   8630 C  CD2 . LEU B 2 119  ? 120.761 92.668  42.685  1.00 19.17  ? 139  LEU B CD2 1 
ATOM   8631 N  N   . HIS B 2 120  ? 118.714 97.672  42.720  1.00 5.26   ? 140  HIS B N   1 
ATOM   8632 C  CA  . HIS B 2 120  ? 117.813 98.603  42.052  1.00 5.44   ? 140  HIS B CA  1 
ATOM   8633 C  C   . HIS B 2 120  ? 118.205 98.858  40.602  1.00 9.64   ? 140  HIS B C   1 
ATOM   8634 O  O   . HIS B 2 120  ? 117.390 99.384  39.838  1.00 7.48   ? 140  HIS B O   1 
ATOM   8635 C  CB  . HIS B 2 120  ? 117.774 99.947  42.780  1.00 3.88   ? 140  HIS B CB  1 
ATOM   8636 C  CG  . HIS B 2 120  ? 117.114 99.908  44.119  1.00 4.99   ? 140  HIS B CG  1 
ATOM   8637 N  ND1 . HIS B 2 120  ? 115.756 99.753  44.270  1.00 6.87   ? 140  HIS B ND1 1 
ATOM   8638 C  CD2 . HIS B 2 120  ? 117.616 100.067 45.364  1.00 7.91   ? 140  HIS B CD2 1 
ATOM   8639 C  CE1 . HIS B 2 120  ? 115.454 99.785  45.554  1.00 8.59   ? 140  HIS B CE1 1 
ATOM   8640 N  NE2 . HIS B 2 120  ? 116.563 99.982  46.239  1.00 4.67   ? 140  HIS B NE2 1 
ATOM   8641 N  N   . TYR B 2 121  ? 119.433 98.526  40.210  1.00 11.58  ? 141  TYR B N   1 
ATOM   8642 C  CA  . TYR B 2 121  ? 119.896 98.677  38.842  1.00 8.76   ? 141  TYR B CA  1 
ATOM   8643 C  C   . TYR B 2 121  ? 119.555 97.473  37.979  1.00 9.10   ? 141  TYR B C   1 
ATOM   8644 O  O   . TYR B 2 121  ? 120.146 97.311  36.908  1.00 10.44  ? 141  TYR B O   1 
ATOM   8645 C  CB  . TYR B 2 121  ? 121.407 98.893  38.820  1.00 6.25   ? 141  TYR B CB  1 
ATOM   8646 C  CG  . TYR B 2 121  ? 121.898 100.137 39.520  1.00 10.33  ? 141  TYR B CG  1 
ATOM   8647 C  CD1 . TYR B 2 121  ? 121.089 101.250 39.677  1.00 15.61  ? 141  TYR B CD1 1 
ATOM   8648 C  CD2 . TYR B 2 121  ? 123.169 100.168 40.076  1.00 12.81  ? 141  TYR B CD2 1 
ATOM   8649 C  CE1 . TYR B 2 121  ? 121.554 102.374 40.339  1.00 18.54  ? 141  TYR B CE1 1 
ATOM   8650 C  CE2 . TYR B 2 121  ? 123.642 101.278 40.729  1.00 16.36  ? 141  TYR B CE2 1 
ATOM   8651 C  CZ  . TYR B 2 121  ? 122.836 102.380 40.863  1.00 19.57  ? 141  TYR B CZ  1 
ATOM   8652 O  OH  . TYR B 2 121  ? 123.322 103.482 41.530  1.00 18.01  ? 141  TYR B OH  1 
ATOM   8653 N  N   . GLU B 2 122  ? 118.649 96.607  38.431  1.00 9.35   ? 142  GLU B N   1 
ATOM   8654 C  CA  . GLU B 2 122  ? 118.202 95.489  37.615  1.00 10.62  ? 142  GLU B CA  1 
ATOM   8655 C  C   . GLU B 2 122  ? 116.697 95.268  37.622  1.00 10.35  ? 142  GLU B C   1 
ATOM   8656 O  O   . GLU B 2 122  ? 116.235 94.327  36.972  1.00 11.39  ? 142  GLU B O   1 
ATOM   8657 C  CB  . GLU B 2 122  ? 118.879 94.188  38.056  1.00 14.35  ? 142  GLU B CB  1 
ATOM   8658 C  CG  . GLU B 2 122  ? 120.323 94.076  37.661  1.00 19.96  ? 142  GLU B CG  1 
ATOM   8659 C  CD  . GLU B 2 122  ? 120.940 92.764  38.078  1.00 22.15  ? 142  GLU B CD  1 
ATOM   8660 O  OE1 . GLU B 2 122  ? 120.279 92.000  38.810  1.00 31.20  ? 142  GLU B OE1 1 
ATOM   8661 O  OE2 . GLU B 2 122  ? 122.087 92.492  37.667  1.00 27.39  ? 142  GLU B OE2 1 
ATOM   8662 N  N   . GLY B 2 123  ? 115.919 96.082  38.330  1.00 5.56   ? 143  GLY B N   1 
ATOM   8663 C  CA  . GLY B 2 123  ? 114.501 95.810  38.438  1.00 8.66   ? 143  GLY B CA  1 
ATOM   8664 C  C   . GLY B 2 123  ? 114.160 94.648  39.337  1.00 10.36  ? 143  GLY B C   1 
ATOM   8665 O  O   . GLY B 2 123  ? 113.062 94.101  39.241  1.00 10.60  ? 143  GLY B O   1 
ATOM   8666 N  N   . ARG B 2 124  ? 115.082 94.251  40.210  1.00 7.53   ? 144  ARG B N   1 
ATOM   8667 C  CA  . ARG B 2 124  ? 114.873 93.175  41.165  1.00 7.48   ? 144  ARG B CA  1 
ATOM   8668 C  C   . ARG B 2 124  ? 114.715 93.677  42.586  1.00 8.91   ? 144  ARG B C   1 
ATOM   8669 O  O   . ARG B 2 124  ? 114.692 92.867  43.515  1.00 8.95   ? 144  ARG B O   1 
ATOM   8670 C  CB  . ARG B 2 124  ? 116.043 92.210  41.118  1.00 12.28  ? 144  ARG B CB  1 
ATOM   8671 C  CG  . ARG B 2 124  ? 116.082 91.310  39.937  1.00 14.45  ? 144  ARG B CG  1 
ATOM   8672 C  CD  . ARG B 2 124  ? 117.464 90.729  39.897  1.00 14.86  ? 144  ARG B CD  1 
ATOM   8673 N  NE  . ARG B 2 124  ? 117.798 90.065  41.149  1.00 22.42  ? 144  ARG B NE  1 
ATOM   8674 C  CZ  . ARG B 2 124  ? 119.033 89.736  41.503  1.00 15.05  ? 144  ARG B CZ  1 
ATOM   8675 N  NH1 . ARG B 2 124  ? 120.045 90.007  40.690  1.00 16.18  ? 144  ARG B NH1 1 
ATOM   8676 N  NH2 . ARG B 2 124  ? 119.250 89.127  42.658  1.00 25.24  ? 144  ARG B NH2 1 
ATOM   8677 N  N   . ALA B 2 125  ? 114.630 94.982  42.787  1.00 6.41   ? 145  ALA B N   1 
ATOM   8678 C  CA  . ALA B 2 125  ? 114.629 95.506  44.140  1.00 6.75   ? 145  ALA B CA  1 
ATOM   8679 C  C   . ALA B 2 125  ? 113.781 96.759  44.194  1.00 7.00   ? 145  ALA B C   1 
ATOM   8680 O  O   . ALA B 2 125  ? 113.957 97.657  43.370  1.00 7.46   ? 145  ALA B O   1 
ATOM   8681 C  CB  . ALA B 2 125  ? 116.048 95.815  44.602  1.00 6.29   ? 145  ALA B CB  1 
ATOM   8682 N  N   . VAL B 2 126  ? 112.877 96.818  45.165  1.00 6.27   ? 146  VAL B N   1 
ATOM   8683 C  CA  . VAL B 2 126  ? 111.989 97.954  45.346  1.00 4.46   ? 146  VAL B CA  1 
ATOM   8684 C  C   . VAL B 2 126  ? 112.025 98.402  46.797  1.00 8.18   ? 146  VAL B C   1 
ATOM   8685 O  O   . VAL B 2 126  ? 112.138 97.576  47.706  1.00 8.16   ? 146  VAL B O   1 
ATOM   8686 C  CB  . VAL B 2 126  ? 110.553 97.613  44.918  1.00 8.41   ? 146  VAL B CB  1 
ATOM   8687 C  CG1 . VAL B 2 126  ? 110.465 97.499  43.416  1.00 8.87   ? 146  VAL B CG1 1 
ATOM   8688 C  CG2 . VAL B 2 126  ? 110.133 96.303  45.527  1.00 10.18  ? 146  VAL B CG2 1 
ATOM   8689 N  N   . ASP B 2 127  ? 111.948 99.710  47.011  1.00 5.01   ? 147  ASP B N   1 
ATOM   8690 C  CA  . ASP B 2 127  ? 111.831 100.287 48.339  1.00 5.13   ? 147  ASP B CA  1 
ATOM   8691 C  C   . ASP B 2 127  ? 110.371 100.634 48.600  1.00 8.32   ? 147  ASP B C   1 
ATOM   8692 O  O   . ASP B 2 127  ? 109.697 101.192 47.733  1.00 8.26   ? 147  ASP B O   1 
ATOM   8693 C  CB  . ASP B 2 127  ? 112.689 101.539 48.471  1.00 5.15   ? 147  ASP B CB  1 
ATOM   8694 C  CG  . ASP B 2 127  ? 114.163 101.254 48.328  1.00 9.43   ? 147  ASP B CG  1 
ATOM   8695 O  OD1 . ASP B 2 127  ? 114.589 100.112 48.560  1.00 5.15   ? 147  ASP B OD1 1 
ATOM   8696 O  OD2 . ASP B 2 127  ? 114.915 102.192 48.015  1.00 9.56   ? 147  ASP B OD2 1 
ATOM   8697 N  N   . ILE B 2 128  ? 109.875 100.300 49.790  1.00 8.29   ? 148  ILE B N   1 
ATOM   8698 C  CA  . ILE B 2 128  ? 108.448 100.382 50.074  1.00 9.33   ? 148  ILE B CA  1 
ATOM   8699 C  C   . ILE B 2 128  ? 108.185 101.246 51.298  1.00 8.96   ? 148  ILE B C   1 
ATOM   8700 O  O   . ILE B 2 128  ? 109.027 101.368 52.192  1.00 9.42   ? 148  ILE B O   1 
ATOM   8701 C  CB  . ILE B 2 128  ? 107.830 98.982  50.270  1.00 8.71   ? 148  ILE B CB  1 
ATOM   8702 C  CG1 . ILE B 2 128  ? 108.553 98.223  51.367  1.00 11.33  ? 148  ILE B CG1 1 
ATOM   8703 C  CG2 . ILE B 2 128  ? 107.868 98.191  48.994  1.00 7.42   ? 148  ILE B CG2 1 
ATOM   8704 C  CD1 . ILE B 2 128  ? 107.898 96.940  51.712  1.00 13.29  ? 148  ILE B CD1 1 
ATOM   8705 N  N   . THR B 2 129  ? 107.011 101.885 51.305  1.00 7.54   ? 149  THR B N   1 
ATOM   8706 C  CA  . THR B 2 129  ? 106.394 102.498 52.480  1.00 9.11   ? 149  THR B CA  1 
ATOM   8707 C  C   . THR B 2 129  ? 104.902 102.201 52.445  1.00 8.88   ? 149  THR B C   1 
ATOM   8708 O  O   . THR B 2 129  ? 104.405 101.539 51.534  1.00 10.44  ? 149  THR B O   1 
ATOM   8709 C  CB  . THR B 2 129  ? 106.551 104.016 52.529  1.00 15.74  ? 149  THR B CB  1 
ATOM   8710 O  OG1 . THR B 2 129  ? 105.904 104.590 51.392  1.00 17.86  ? 149  THR B OG1 1 
ATOM   8711 C  CG2 . THR B 2 129  ? 107.979 104.442 52.549  1.00 13.62  ? 149  THR B CG2 1 
ATOM   8712 N  N   . THR B 2 130  ? 104.170 102.741 53.413  1.00 12.46  ? 150  THR B N   1 
ATOM   8713 C  CA  . THR B 2 130  ? 102.720 102.674 53.363  1.00 12.63  ? 150  THR B CA  1 
ATOM   8714 C  C   . THR B 2 130  ? 102.159 103.898 52.647  1.00 12.17  ? 150  THR B C   1 
ATOM   8715 O  O   . THR B 2 130  ? 102.894 104.781 52.203  1.00 15.96  ? 150  THR B O   1 
ATOM   8716 C  CB  . THR B 2 130  ? 102.126 102.562 54.759  1.00 17.26  ? 150  THR B CB  1 
ATOM   8717 O  OG1 . THR B 2 130  ? 102.503 103.700 55.535  1.00 19.01  ? 150  THR B OG1 1 
ATOM   8718 C  CG2 . THR B 2 130  ? 102.596 101.310 55.426  1.00 16.33  ? 150  THR B CG2 1 
ATOM   8719 N  N   . SER B 2 131  ? 100.829 103.959 52.547  1.00 13.69  ? 151  SER B N   1 
ATOM   8720 C  CA  . SER B 2 131  ? 100.187 105.053 51.824  1.00 13.54  ? 151  SER B CA  1 
ATOM   8721 C  C   . SER B 2 131  ? 100.234 106.343 52.618  1.00 19.18  ? 151  SER B C   1 
ATOM   8722 O  O   . SER B 2 131  ? 100.442 107.420 52.053  1.00 21.22  ? 151  SER B O   1 
ATOM   8723 C  CB  . SER B 2 131  ? 98.739  104.705 51.515  1.00 19.87  ? 151  SER B CB  1 
ATOM   8724 O  OG  . SER B 2 131  ? 97.995  104.639 52.715  1.00 20.84  ? 151  SER B OG  1 
ATOM   8725 N  N   . ASP B 2 132  ? 100.030 106.258 53.921  1.00 19.84  ? 152  ASP B N   1 
ATOM   8726 C  CA  . ASP B 2 132  ? 100.027 107.432 54.776  1.00 21.23  ? 152  ASP B CA  1 
ATOM   8727 C  C   . ASP B 2 132  ? 101.416 107.852 55.241  1.00 19.84  ? 152  ASP B C   1 
ATOM   8728 O  O   . ASP B 2 132  ? 101.514 108.801 56.027  1.00 19.79  ? 152  ASP B O   1 
ATOM   8729 C  CB  . ASP B 2 132  ? 99.126  107.169 55.975  1.00 24.25  ? 152  ASP B CB  1 
ATOM   8730 C  CG  . ASP B 2 132  ? 99.421  105.841 56.627  1.00 25.06  ? 152  ASP B CG  1 
ATOM   8731 O  OD1 . ASP B 2 132  ? 100.257 105.092 56.079  1.00 19.87  ? 152  ASP B OD1 1 
ATOM   8732 O  OD2 . ASP B 2 132  ? 98.818  105.537 57.677  1.00 23.41  ? 152  ASP B OD2 1 
ATOM   8733 N  N   . ARG B 2 133  ? 102.471 107.152 54.789  1.00 15.66  ? 153  ARG B N   1 
ATOM   8734 C  CA  . ARG B 2 133  ? 103.879 107.465 55.070  1.00 18.11  ? 153  ARG B CA  1 
ATOM   8735 C  C   . ARG B 2 133  ? 104.191 107.453 56.561  1.00 21.49  ? 153  ARG B C   1 
ATOM   8736 O  O   . ARG B 2 133  ? 105.079 108.174 57.018  1.00 20.50  ? 153  ARG B O   1 
ATOM   8737 C  CB  . ARG B 2 133  ? 104.286 108.810 54.469  1.00 22.63  ? 153  ARG B CB  1 
ATOM   8738 C  CG  . ARG B 2 133  ? 104.293 108.875 52.963  1.00 31.33  ? 153  ARG B CG  1 
ATOM   8739 C  CD  . ARG B 2 133  ? 104.401 110.332 52.530  1.00 44.57  ? 153  ARG B CD  1 
ATOM   8740 N  NE  . ARG B 2 133  ? 105.642 110.959 52.969  1.00 55.37  ? 153  ARG B NE  1 
ATOM   8741 C  CZ  . ARG B 2 133  ? 106.736 111.019 52.225  1.00 58.82  ? 153  ARG B CZ  1 
ATOM   8742 N  NH1 . ARG B 2 133  ? 107.840 111.596 52.677  1.00 59.53  ? 153  ARG B NH1 1 
ATOM   8743 N  NH2 . ARG B 2 133  ? 106.707 110.511 51.009  1.00 55.77  ? 153  ARG B NH2 1 
ATOM   8744 N  N   . ASP B 2 134  ? 103.467 106.651 57.336  1.00 19.37  ? 154  ASP B N   1 
ATOM   8745 C  CA  . ASP B 2 134  ? 103.620 106.667 58.782  1.00 19.43  ? 154  ASP B CA  1 
ATOM   8746 C  C   . ASP B 2 134  ? 104.809 105.802 59.171  1.00 16.32  ? 154  ASP B C   1 
ATOM   8747 O  O   . ASP B 2 134  ? 104.940 104.673 58.695  1.00 17.38  ? 154  ASP B O   1 
ATOM   8748 C  CB  . ASP B 2 134  ? 102.348 106.166 59.452  1.00 20.24  ? 154  ASP B CB  1 
ATOM   8749 C  CG  . ASP B 2 134  ? 102.278 106.538 60.910  1.00 26.42  ? 154  ASP B CG  1 
ATOM   8750 O  OD1 . ASP B 2 134  ? 103.224 107.173 61.416  1.00 23.22  ? 154  ASP B OD1 1 
ATOM   8751 O  OD2 . ASP B 2 134  ? 101.264 106.215 61.557  1.00 25.56  ? 154  ASP B OD2 1 
ATOM   8752 N  N   . ARG B 2 135  ? 105.675 106.320 60.041  1.00 14.73  ? 155  ARG B N   1 
ATOM   8753 C  CA  . ARG B 2 135  ? 106.931 105.626 60.289  1.00 15.39  ? 155  ARG B CA  1 
ATOM   8754 C  C   . ARG B 2 135  ? 106.814 104.467 61.263  1.00 17.38  ? 155  ARG B C   1 
ATOM   8755 O  O   . ARG B 2 135  ? 107.739 103.656 61.335  1.00 18.43  ? 155  ARG B O   1 
ATOM   8756 C  CB  . ARG B 2 135  ? 108.000 106.594 60.790  1.00 15.18  ? 155  ARG B CB  1 
ATOM   8757 C  CG  . ARG B 2 135  ? 108.591 107.451 59.699  1.00 18.68  ? 155  ARG B CG  1 
ATOM   8758 C  CD  . ARG B 2 135  ? 109.780 108.246 60.192  1.00 22.83  ? 155  ARG B CD  1 
ATOM   8759 N  NE  . ARG B 2 135  ? 109.390 109.350 61.057  1.00 21.67  ? 155  ARG B NE  1 
ATOM   8760 C  CZ  . ARG B 2 135  ? 109.652 109.405 62.355  1.00 32.85  ? 155  ARG B CZ  1 
ATOM   8761 N  NH1 . ARG B 2 135  ? 110.293 108.406 62.940  1.00 34.37  ? 155  ARG B NH1 1 
ATOM   8762 N  NH2 . ARG B 2 135  ? 109.264 110.448 63.069  1.00 34.09  ? 155  ARG B NH2 1 
ATOM   8763 N  N   . SER B 2 136  ? 105.715 104.346 62.000  1.00 16.47  ? 156  SER B N   1 
ATOM   8764 C  CA  . SER B 2 136  ? 105.651 103.291 63.003  1.00 19.76  ? 156  SER B CA  1 
ATOM   8765 C  C   . SER B 2 136  ? 105.345 101.931 62.390  1.00 19.22  ? 156  SER B C   1 
ATOM   8766 O  O   . SER B 2 136  ? 105.827 100.910 62.890  1.00 21.55  ? 156  SER B O   1 
ATOM   8767 C  CB  . SER B 2 136  ? 104.611 103.646 64.062  1.00 23.19  ? 156  SER B CB  1 
ATOM   8768 O  OG  . SER B 2 136  ? 103.320 103.705 63.496  1.00 23.66  ? 156  SER B OG  1 
ATOM   8769 N  N   . LYS B 2 137  ? 104.591 101.899 61.299  1.00 16.32  ? 157  LYS B N   1 
ATOM   8770 C  CA  . LYS B 2 137  ? 104.051 100.660 60.757  1.00 15.08  ? 157  LYS B CA  1 
ATOM   8771 C  C   . LYS B 2 137  ? 105.050 99.882  59.918  1.00 16.69  ? 157  LYS B C   1 
ATOM   8772 O  O   . LYS B 2 137  ? 104.704 98.823  59.378  1.00 14.67  ? 157  LYS B O   1 
ATOM   8773 C  CB  . LYS B 2 137  ? 102.809 100.982 59.935  1.00 15.31  ? 157  LYS B CB  1 
ATOM   8774 C  CG  . LYS B 2 137  ? 101.728 101.610 60.784  1.00 16.70  ? 157  LYS B CG  1 
ATOM   8775 C  CD  . LYS B 2 137  ? 100.426 101.792 60.047  1.00 16.47  ? 157  LYS B CD  1 
ATOM   8776 C  CE  . LYS B 2 137  ? 100.486 102.960 59.103  1.00 22.69  ? 157  LYS B CE  1 
ATOM   8777 N  NZ  . LYS B 2 137  ? 99.158  103.214 58.492  1.00 24.32  ? 157  LYS B NZ  1 
ATOM   8778 N  N   . TYR B 2 138  ? 106.287 100.363 59.823  1.00 14.21  ? 158  TYR B N   1 
ATOM   8779 C  CA  . TYR B 2 138  ? 107.250 99.799  58.893  1.00 15.17  ? 158  TYR B CA  1 
ATOM   8780 C  C   . TYR B 2 138  ? 107.886 98.510  59.391  1.00 14.24  ? 158  TYR B C   1 
ATOM   8781 O  O   . TYR B 2 138  ? 108.347 97.715  58.570  1.00 12.21  ? 158  TYR B O   1 
ATOM   8782 C  CB  . TYR B 2 138  ? 108.322 100.838 58.597  1.00 12.13  ? 158  TYR B CB  1 
ATOM   8783 C  CG  . TYR B 2 138  ? 107.813 101.989 57.777  1.00 13.40  ? 158  TYR B CG  1 
ATOM   8784 C  CD1 . TYR B 2 138  ? 106.693 101.856 56.983  1.00 14.74  ? 158  TYR B CD1 1 
ATOM   8785 C  CD2 . TYR B 2 138  ? 108.433 103.215 57.824  1.00 16.57  ? 158  TYR B CD2 1 
ATOM   8786 C  CE1 . TYR B 2 138  ? 106.225 102.905 56.238  1.00 14.75  ? 158  TYR B CE1 1 
ATOM   8787 C  CE2 . TYR B 2 138  ? 107.970 104.266 57.085  1.00 15.69  ? 158  TYR B CE2 1 
ATOM   8788 C  CZ  . TYR B 2 138  ? 106.868 104.106 56.297  1.00 15.90  ? 158  TYR B CZ  1 
ATOM   8789 O  OH  . TYR B 2 138  ? 106.415 105.172 55.573  1.00 14.92  ? 158  TYR B OH  1 
ATOM   8790 N  N   . GLY B 2 139  ? 107.934 98.289  60.703  1.00 13.58  ? 159  GLY B N   1 
ATOM   8791 C  CA  . GLY B 2 139  ? 108.450 97.031  61.208  1.00 12.58  ? 159  GLY B CA  1 
ATOM   8792 C  C   . GLY B 2 139  ? 107.544 95.876  60.849  1.00 14.06  ? 159  GLY B C   1 
ATOM   8793 O  O   . GLY B 2 139  ? 107.995 94.856  60.321  1.00 13.33  ? 159  GLY B O   1 
ATOM   8794 N  N   . MET B 2 140  ? 106.247 96.039  61.097  1.00 14.32  ? 160  MET B N   1 
ATOM   8795 C  CA  . MET B 2 140  ? 105.275 95.043  60.672  1.00 14.41  ? 160  MET B CA  1 
ATOM   8796 C  C   . MET B 2 140  ? 105.223 94.948  59.160  1.00 14.90  ? 160  MET B C   1 
ATOM   8797 O  O   . MET B 2 140  ? 104.984 93.865  58.615  1.00 15.01  ? 160  MET B O   1 
ATOM   8798 C  CB  . MET B 2 140  ? 103.897 95.388  61.237  1.00 16.61  ? 160  MET B CB  1 
ATOM   8799 C  CG  . MET B 2 140  ? 102.825 94.328  61.052  1.00 24.17  ? 160  MET B CG  1 
ATOM   8800 S  SD  . MET B 2 140  ? 103.084 92.855  62.043  1.00 36.82  ? 160  MET B SD  1 
ATOM   8801 C  CE  . MET B 2 140  ? 102.131 91.665  61.106  1.00 31.26  ? 160  MET B CE  1 
ATOM   8802 N  N   . LEU B 2 141  ? 105.481 96.064  58.472  1.00 12.29  ? 161  LEU B N   1 
ATOM   8803 C  CA  . LEU B 2 141  ? 105.578 96.028  57.018  1.00 10.34  ? 161  LEU B CA  1 
ATOM   8804 C  C   . LEU B 2 141  ? 106.730 95.146  56.553  1.00 12.05  ? 161  LEU B C   1 
ATOM   8805 O  O   . LEU B 2 141  ? 106.583 94.389  55.590  1.00 11.72  ? 161  LEU B O   1 
ATOM   8806 C  CB  . LEU B 2 141  ? 105.724 97.445  56.485  1.00 10.73  ? 161  LEU B CB  1 
ATOM   8807 C  CG  . LEU B 2 141  ? 105.872 97.635  54.993  1.00 9.95   ? 161  LEU B CG  1 
ATOM   8808 C  CD1 . LEU B 2 141  ? 104.731 97.014  54.303  1.00 11.42  ? 161  LEU B CD1 1 
ATOM   8809 C  CD2 . LEU B 2 141  ? 105.851 99.100  54.740  1.00 12.29  ? 161  LEU B CD2 1 
ATOM   8810 N  N   . ALA B 2 142  ? 107.866 95.191  57.252  1.00 12.21  ? 162  ALA B N   1 
ATOM   8811 C  CA  . ALA B 2 142  ? 109.023 94.400  56.842  1.00 13.30  ? 162  ALA B CA  1 
ATOM   8812 C  C   . ALA B 2 142  ? 108.880 92.932  57.219  1.00 12.35  ? 162  ALA B C   1 
ATOM   8813 O  O   . ALA B 2 142  ? 109.376 92.065  56.490  1.00 10.23  ? 162  ALA B O   1 
ATOM   8814 C  CB  . ALA B 2 142  ? 110.300 94.968  57.452  1.00 9.65   ? 162  ALA B CB  1 
ATOM   8815 N  N   . ARG B 2 143  ? 108.236 92.639  58.355  1.00 16.94  ? 163  ARG B N   1 
ATOM   8816 C  CA  . ARG B 2 143  ? 107.899 91.256  58.686  1.00 14.88  ? 163  ARG B CA  1 
ATOM   8817 C  C   . ARG B 2 143  ? 106.926 90.676  57.670  1.00 12.86  ? 163  ARG B C   1 
ATOM   8818 O  O   . ARG B 2 143  ? 107.041 89.503  57.291  1.00 13.75  ? 163  ARG B O   1 
ATOM   8819 C  CB  . ARG B 2 143  ? 107.334 91.187  60.105  1.00 14.14  ? 163  ARG B CB  1 
ATOM   8820 C  CG  . ARG B 2 143  ? 106.684 89.890  60.492  1.00 19.25  ? 163  ARG B CG  1 
ATOM   8821 C  CD  . ARG B 2 143  ? 107.622 88.712  60.538  1.00 22.80  ? 163  ARG B CD  1 
ATOM   8822 N  NE  . ARG B 2 143  ? 108.642 88.843  61.570  1.00 26.45  ? 163  ARG B NE  1 
ATOM   8823 C  CZ  . ARG B 2 143  ? 109.592 87.941  61.799  1.00 28.87  ? 163  ARG B CZ  1 
ATOM   8824 N  NH1 . ARG B 2 143  ? 109.629 86.816  61.097  1.00 29.34  ? 163  ARG B NH1 1 
ATOM   8825 N  NH2 . ARG B 2 143  ? 110.487 88.145  62.757  1.00 28.39  ? 163  ARG B NH2 1 
ATOM   8826 N  N   . LEU B 2 144  ? 105.987 91.494  57.188  1.00 13.23  ? 164  LEU B N   1 
ATOM   8827 C  CA  . LEU B 2 144  ? 105.159 91.075  56.064  1.00 11.82  ? 164  LEU B CA  1 
ATOM   8828 C  C   . LEU B 2 144  ? 105.969 90.925  54.786  1.00 12.22  ? 164  LEU B C   1 
ATOM   8829 O  O   . LEU B 2 144  ? 105.612 90.119  53.925  1.00 14.19  ? 164  LEU B O   1 
ATOM   8830 C  CB  . LEU B 2 144  ? 104.026 92.067  55.845  1.00 13.65  ? 164  LEU B CB  1 
ATOM   8831 C  CG  . LEU B 2 144  ? 102.925 91.972  56.881  1.00 17.61  ? 164  LEU B CG  1 
ATOM   8832 C  CD1 . LEU B 2 144  ? 101.946 93.086  56.675  1.00 20.96  ? 164  LEU B CD1 1 
ATOM   8833 C  CD2 . LEU B 2 144  ? 102.247 90.640  56.740  1.00 18.61  ? 164  LEU B CD2 1 
ATOM   8834 N  N   . ALA B 2 145  ? 107.051 91.684  54.639  1.00 9.81   ? 165  ALA B N   1 
ATOM   8835 C  CA  . ALA B 2 145  ? 107.867 91.530  53.447  1.00 9.33   ? 165  ALA B CA  1 
ATOM   8836 C  C   . ALA B 2 145  ? 108.691 90.251  53.493  1.00 10.58  ? 165  ALA B C   1 
ATOM   8837 O  O   . ALA B 2 145  ? 108.976 89.664  52.446  1.00 12.61  ? 165  ALA B O   1 
ATOM   8838 C  CB  . ALA B 2 145  ? 108.762 92.749  53.270  1.00 10.93  ? 165  ALA B CB  1 
ATOM   8839 N  N   . VAL B 2 146  ? 109.080 89.798  54.684  1.00 12.89  ? 166  VAL B N   1 
ATOM   8840 C  CA  . VAL B 2 146  ? 109.732 88.496  54.782  1.00 10.98  ? 166  VAL B CA  1 
ATOM   8841 C  C   . VAL B 2 146  ? 108.719 87.378  54.596  1.00 12.01  ? 166  VAL B C   1 
ATOM   8842 O  O   . VAL B 2 146  ? 108.950 86.430  53.836  1.00 16.41  ? 166  VAL B O   1 
ATOM   8843 C  CB  . VAL B 2 146  ? 110.475 88.371  56.120  1.00 13.31  ? 166  VAL B CB  1 
ATOM   8844 C  CG1 . VAL B 2 146  ? 111.010 86.972  56.301  1.00 20.59  ? 166  VAL B CG1 1 
ATOM   8845 C  CG2 . VAL B 2 146  ? 111.607 89.357  56.169  1.00 14.01  ? 166  VAL B CG2 1 
ATOM   8846 N  N   . GLU B 2 147  ? 107.563 87.491  55.250  1.00 15.01  ? 167  GLU B N   1 
ATOM   8847 C  CA  . GLU B 2 147  ? 106.511 86.489  55.152  1.00 15.74  ? 167  GLU B CA  1 
ATOM   8848 C  C   . GLU B 2 147  ? 105.554 86.749  53.999  1.00 20.54  ? 167  GLU B C   1 
ATOM   8849 O  O   . GLU B 2 147  ? 104.385 86.351  54.060  1.00 21.32  ? 167  GLU B O   1 
ATOM   8850 C  CB  . GLU B 2 147  ? 105.753 86.390  56.475  1.00 24.65  ? 167  GLU B CB  1 
ATOM   8851 C  CG  . GLU B 2 147  ? 106.570 85.763  57.591  1.00 31.87  ? 167  GLU B CG  1 
ATOM   8852 C  CD  . GLU B 2 147  ? 106.900 84.296  57.332  1.00 42.14  ? 167  GLU B CD  1 
ATOM   8853 O  OE1 . GLU B 2 147  ? 106.089 83.586  56.703  1.00 45.02  ? 167  GLU B OE1 1 
ATOM   8854 O  OE2 . GLU B 2 147  ? 107.980 83.850  57.765  1.00 35.62  ? 167  GLU B OE2 1 
ATOM   8855 N  N   . ALA B 2 148  ? 106.010 87.432  52.961  1.00 15.69  ? 168  ALA B N   1 
ATOM   8856 C  CA  . ALA B 2 148  ? 105.293 87.472  51.704  1.00 15.46  ? 168  ALA B CA  1 
ATOM   8857 C  C   . ALA B 2 148  ? 106.021 86.745  50.595  1.00 19.21  ? 168  ALA B C   1 
ATOM   8858 O  O   . ALA B 2 148  ? 105.374 86.186  49.714  1.00 20.21  ? 168  ALA B O   1 
ATOM   8859 C  CB  . ALA B 2 148  ? 105.044 88.918  51.273  1.00 17.62  ? 168  ALA B CB  1 
ATOM   8860 N  N   . GLY B 2 149  ? 107.346 86.722  50.628  1.00 15.39  ? 169  GLY B N   1 
ATOM   8861 C  CA  . GLY B 2 149  ? 108.082 85.986  49.626  1.00 17.22  ? 169  GLY B CA  1 
ATOM   8862 C  C   . GLY B 2 149  ? 109.353 86.662  49.170  1.00 15.93  ? 169  GLY B C   1 
ATOM   8863 O  O   . GLY B 2 149  ? 110.088 86.098  48.355  1.00 16.73  ? 169  GLY B O   1 
ATOM   8864 N  N   . PHE B 2 150  ? 109.628 87.861  49.679  1.00 12.52  ? 170  PHE B N   1 
ATOM   8865 C  CA  . PHE B 2 150  ? 110.859 88.543  49.316  1.00 8.71   ? 170  PHE B CA  1 
ATOM   8866 C  C   . PHE B 2 150  ? 112.073 87.842  49.897  1.00 9.03   ? 170  PHE B C   1 
ATOM   8867 O  O   . PHE B 2 150  ? 111.999 87.162  50.922  1.00 14.51  ? 170  PHE B O   1 
ATOM   8868 C  CB  . PHE B 2 150  ? 110.843 89.998  49.760  1.00 9.86   ? 170  PHE B CB  1 
ATOM   8869 C  CG  . PHE B 2 150  ? 110.110 90.889  48.829  1.00 7.10   ? 170  PHE B CG  1 
ATOM   8870 C  CD1 . PHE B 2 150  ? 110.700 91.287  47.647  1.00 8.71   ? 170  PHE B CD1 1 
ATOM   8871 C  CD2 . PHE B 2 150  ? 108.841 91.329  49.123  1.00 8.58   ? 170  PHE B CD2 1 
ATOM   8872 C  CE1 . PHE B 2 150  ? 110.039 92.106  46.774  1.00 11.25  ? 170  PHE B CE1 1 
ATOM   8873 C  CE2 . PHE B 2 150  ? 108.168 92.147  48.253  1.00 10.84  ? 170  PHE B CE2 1 
ATOM   8874 C  CZ  . PHE B 2 150  ? 108.767 92.540  47.078  1.00 10.45  ? 170  PHE B CZ  1 
ATOM   8875 N  N   . ASP B 2 151  ? 113.201 88.020  49.220  1.00 9.24   ? 171  ASP B N   1 
ATOM   8876 C  CA  . ASP B 2 151  ? 114.378 87.214  49.461  1.00 10.44  ? 171  ASP B CA  1 
ATOM   8877 C  C   . ASP B 2 151  ? 115.447 87.932  50.267  1.00 9.08   ? 171  ASP B C   1 
ATOM   8878 O  O   . ASP B 2 151  ? 116.416 87.286  50.673  1.00 13.92  ? 171  ASP B O   1 
ATOM   8879 C  CB  . ASP B 2 151  ? 114.950 86.744  48.123  1.00 11.53  ? 171  ASP B CB  1 
ATOM   8880 C  CG  . ASP B 2 151  ? 113.985 85.857  47.363  1.00 16.56  ? 171  ASP B CG  1 
ATOM   8881 O  OD1 . ASP B 2 151  ? 113.162 85.183  48.011  1.00 19.22  ? 171  ASP B OD1 1 
ATOM   8882 O  OD2 . ASP B 2 151  ? 114.042 85.837  46.119  1.00 16.57  ? 171  ASP B OD2 1 
ATOM   8883 N  N   . TRP B 2 152  ? 115.297 89.235  50.508  1.00 9.07   ? 172  TRP B N   1 
ATOM   8884 C  CA  . TRP B 2 152  ? 116.171 89.956  51.433  1.00 11.51  ? 172  TRP B CA  1 
ATOM   8885 C  C   . TRP B 2 152  ? 115.445 91.232  51.818  1.00 12.17  ? 172  TRP B C   1 
ATOM   8886 O  O   . TRP B 2 152  ? 115.138 92.046  50.947  1.00 11.62  ? 172  TRP B O   1 
ATOM   8887 C  CB  . TRP B 2 152  ? 117.508 90.282  50.784  1.00 10.38  ? 172  TRP B CB  1 
ATOM   8888 C  CG  . TRP B 2 152  ? 118.629 90.510  51.731  1.00 11.25  ? 172  TRP B CG  1 
ATOM   8889 C  CD1 . TRP B 2 152  ? 119.219 89.581  52.529  1.00 12.99  ? 172  TRP B CD1 1 
ATOM   8890 C  CD2 . TRP B 2 152  ? 119.322 91.734  51.967  1.00 8.74   ? 172  TRP B CD2 1 
ATOM   8891 N  NE1 . TRP B 2 152  ? 120.234 90.150  53.249  1.00 12.40  ? 172  TRP B NE1 1 
ATOM   8892 C  CE2 . TRP B 2 152  ? 120.314 91.476  52.924  1.00 10.37  ? 172  TRP B CE2 1 
ATOM   8893 C  CE3 . TRP B 2 152  ? 119.184 93.031  51.481  1.00 9.82   ? 172  TRP B CE3 1 
ATOM   8894 C  CZ2 . TRP B 2 152  ? 121.170 92.459  53.392  1.00 11.07  ? 172  TRP B CZ2 1 
ATOM   8895 C  CZ3 . TRP B 2 152  ? 120.046 93.998  51.932  1.00 9.43   ? 172  TRP B CZ3 1 
ATOM   8896 C  CH2 . TRP B 2 152  ? 121.021 93.712  52.882  1.00 11.93  ? 172  TRP B CH2 1 
ATOM   8897 N  N   . VAL B 2 153  ? 115.146 91.405  53.101  1.00 9.26   ? 173  VAL B N   1 
ATOM   8898 C  CA  . VAL B 2 153  ? 114.378 92.550  53.570  1.00 8.74   ? 173  VAL B CA  1 
ATOM   8899 C  C   . VAL B 2 153  ? 115.179 93.251  54.650  1.00 12.88  ? 173  VAL B C   1 
ATOM   8900 O  O   . VAL B 2 153  ? 115.261 92.772  55.785  1.00 10.63  ? 173  VAL B O   1 
ATOM   8901 C  CB  . VAL B 2 153  ? 113.005 92.140  54.099  1.00 11.44  ? 173  VAL B CB  1 
ATOM   8902 C  CG1 . VAL B 2 153  ? 112.249 93.351  54.603  1.00 10.43  ? 173  VAL B CG1 1 
ATOM   8903 C  CG2 . VAL B 2 153  ? 112.209 91.431  53.028  1.00 10.11  ? 173  VAL B CG2 1 
ATOM   8904 N  N   . TYR B 2 154  ? 115.751 94.390  54.310  1.00 9.41   ? 174  TYR B N   1 
ATOM   8905 C  CA  . TYR B 2 154  ? 116.659 95.116  55.181  1.00 10.77  ? 174  TYR B CA  1 
ATOM   8906 C  C   . TYR B 2 154  ? 115.990 96.414  55.593  1.00 8.09   ? 174  TYR B C   1 
ATOM   8907 O  O   . TYR B 2 154  ? 115.690 97.251  54.739  1.00 10.16  ? 174  TYR B O   1 
ATOM   8908 C  CB  . TYR B 2 154  ? 117.976 95.364  54.449  1.00 7.03   ? 174  TYR B CB  1 
ATOM   8909 C  CG  . TYR B 2 154  ? 119.020 96.194  55.152  1.00 10.47  ? 174  TYR B CG  1 
ATOM   8910 C  CD1 . TYR B 2 154  ? 119.662 95.737  56.288  1.00 12.24  ? 174  TYR B CD1 1 
ATOM   8911 C  CD2 . TYR B 2 154  ? 119.429 97.402  54.619  1.00 10.79  ? 174  TYR B CD2 1 
ATOM   8912 C  CE1 . TYR B 2 154  ? 120.638 96.498  56.911  1.00 16.93  ? 174  TYR B CE1 1 
ATOM   8913 C  CE2 . TYR B 2 154  ? 120.403 98.164  55.230  1.00 11.71  ? 174  TYR B CE2 1 
ATOM   8914 C  CZ  . TYR B 2 154  ? 121.001 97.708  56.371  1.00 18.04  ? 174  TYR B CZ  1 
ATOM   8915 O  OH  . TYR B 2 154  ? 121.969 98.468  56.971  1.00 18.66  ? 174  TYR B OH  1 
ATOM   8916 N  N   . TYR B 2 155  ? 115.769 96.591  56.893  1.00 8.24   ? 175  TYR B N   1 
ATOM   8917 C  CA  . TYR B 2 155  ? 115.147 97.806  57.418  1.00 8.02   ? 175  TYR B CA  1 
ATOM   8918 C  C   . TYR B 2 155  ? 116.193 98.905  57.260  1.00 11.58  ? 175  TYR B C   1 
ATOM   8919 O  O   . TYR B 2 155  ? 116.939 99.230  58.185  1.00 11.89  ? 175  TYR B O   1 
ATOM   8920 C  CB  . TYR B 2 155  ? 114.778 97.620  58.882  1.00 9.48   ? 175  TYR B CB  1 
ATOM   8921 C  CG  . TYR B 2 155  ? 113.754 98.559  59.472  1.00 10.69  ? 175  TYR B CG  1 
ATOM   8922 C  CD1 . TYR B 2 155  ? 112.460 98.140  59.708  1.00 8.68   ? 175  TYR B CD1 1 
ATOM   8923 C  CD2 . TYR B 2 155  ? 114.071 99.865  59.757  1.00 11.92  ? 175  TYR B CD2 1 
ATOM   8924 C  CE1 . TYR B 2 155  ? 111.527 98.990  60.260  1.00 10.08  ? 175  TYR B CE1 1 
ATOM   8925 C  CE2 . TYR B 2 155  ? 113.139 100.727 60.295  1.00 16.94  ? 175  TYR B CE2 1 
ATOM   8926 C  CZ  . TYR B 2 155  ? 111.877 100.285 60.539  1.00 18.53  ? 175  TYR B CZ  1 
ATOM   8927 O  OH  . TYR B 2 155  ? 110.956 101.147 61.078  1.00 17.85  ? 175  TYR B OH  1 
ATOM   8928 N  N   . GLU B 2 156  ? 116.256 99.477  56.054  1.00 8.80   ? 176  GLU B N   1 
ATOM   8929 C  CA  . GLU B 2 156  ? 117.430 100.240 55.643  1.00 7.05   ? 176  GLU B CA  1 
ATOM   8930 C  C   . GLU B 2 156  ? 117.473 101.610 56.293  1.00 11.22  ? 176  GLU B C   1 
ATOM   8931 O  O   . GLU B 2 156  ? 118.422 101.942 57.008  1.00 12.32  ? 176  GLU B O   1 
ATOM   8932 C  CB  . GLU B 2 156  ? 117.459 100.381 54.124  1.00 9.97   ? 176  GLU B CB  1 
ATOM   8933 C  CG  . GLU B 2 156  ? 118.642 101.181 53.611  1.00 13.28  ? 176  GLU B CG  1 
ATOM   8934 C  CD  . GLU B 2 156  ? 118.668 101.289 52.101  1.00 18.41  ? 176  GLU B CD  1 
ATOM   8935 O  OE1 . GLU B 2 156  ? 117.757 100.740 51.448  1.00 15.48  ? 176  GLU B OE1 1 
ATOM   8936 O  OE2 . GLU B 2 156  ? 119.596 101.931 51.566  1.00 24.57  ? 176  GLU B OE2 1 
ATOM   8937 N  N   . SER B 2 157  ? 116.476 102.434 56.031  1.00 11.87  ? 177  SER B N   1 
ATOM   8938 C  CA  . SER B 2 157  ? 116.439 103.765 56.603  1.00 12.22  ? 177  SER B CA  1 
ATOM   8939 C  C   . SER B 2 157  ? 115.231 103.885 57.512  1.00 10.51  ? 177  SER B C   1 
ATOM   8940 O  O   . SER B 2 157  ? 114.395 102.985 57.592  1.00 12.30  ? 177  SER B O   1 
ATOM   8941 C  CB  . SER B 2 157  ? 116.396 104.834 55.507  1.00 13.13  ? 177  SER B CB  1 
ATOM   8942 O  OG  . SER B 2 157  ? 116.360 106.139 56.054  1.00 16.82  ? 177  SER B OG  1 
ATOM   8943 N  N   . LYS B 2 158  ? 115.139 105.024 58.195  1.00 11.96  ? 178  LYS B N   1 
ATOM   8944 C  CA  . LYS B 2 158  ? 113.958 105.327 58.991  1.00 10.61  ? 178  LYS B CA  1 
ATOM   8945 C  C   . LYS B 2 158  ? 112.735 105.591 58.132  1.00 14.73  ? 178  LYS B C   1 
ATOM   8946 O  O   . LYS B 2 158  ? 111.616 105.563 58.647  1.00 19.00  ? 178  LYS B O   1 
ATOM   8947 C  CB  . LYS B 2 158  ? 114.216 106.544 59.876  1.00 15.55  ? 178  LYS B CB  1 
ATOM   8948 C  CG  . LYS B 2 158  ? 115.230 106.327 60.971  1.00 17.18  ? 178  LYS B CG  1 
ATOM   8949 C  CD  . LYS B 2 158  ? 114.684 105.414 62.051  1.00 25.62  ? 178  LYS B CD  1 
ATOM   8950 C  CE  . LYS B 2 158  ? 113.640 106.096 62.891  1.00 32.85  ? 178  LYS B CE  1 
ATOM   8951 N  NZ  . LYS B 2 158  ? 114.263 107.179 63.675  1.00 37.38  ? 178  LYS B NZ  1 
ATOM   8952 N  N   . ALA B 2 159  ? 112.919 105.853 56.843  1.00 12.03  ? 179  ALA B N   1 
ATOM   8953 C  CA  . ALA B 2 159  ? 111.845 106.351 56.009  1.00 13.73  ? 179  ALA B CA  1 
ATOM   8954 C  C   . ALA B 2 159  ? 111.354 105.370 54.958  1.00 11.27  ? 179  ALA B C   1 
ATOM   8955 O  O   . ALA B 2 159  ? 110.385 105.693 54.272  1.00 12.61  ? 179  ALA B O   1 
ATOM   8956 C  CB  . ALA B 2 159  ? 112.275 107.646 55.312  1.00 18.92  ? 179  ALA B CB  1 
ATOM   8957 N  N   . HIS B 2 160  ? 111.985 104.207 54.800  1.00 9.12   ? 180  HIS B N   1 
ATOM   8958 C  CA  . HIS B 2 160  ? 111.504 103.199 53.859  1.00 6.94   ? 180  HIS B CA  1 
ATOM   8959 C  C   . HIS B 2 160  ? 112.060 101.840 54.254  1.00 8.90   ? 180  HIS B C   1 
ATOM   8960 O  O   . HIS B 2 160  ? 112.900 101.727 55.144  1.00 8.45   ? 180  HIS B O   1 
ATOM   8961 C  CB  . HIS B 2 160  ? 111.892 103.534 52.420  1.00 10.00  ? 180  HIS B CB  1 
ATOM   8962 C  CG  . HIS B 2 160  ? 113.364 103.517 52.167  1.00 11.37  ? 180  HIS B CG  1 
ATOM   8963 N  ND1 . HIS B 2 160  ? 114.195 104.538 52.565  1.00 13.34  ? 180  HIS B ND1 1 
ATOM   8964 C  CD2 . HIS B 2 160  ? 114.148 102.626 51.518  1.00 12.38  ? 180  HIS B CD2 1 
ATOM   8965 C  CE1 . HIS B 2 160  ? 115.432 104.268 52.192  1.00 13.68  ? 180  HIS B CE1 1 
ATOM   8966 N  NE2 . HIS B 2 160  ? 115.431 103.113 51.554  1.00 12.94  ? 180  HIS B NE2 1 
ATOM   8967 N  N   . ILE B 2 161  ? 111.573 100.803 53.576  1.00 8.20   ? 181  ILE B N   1 
ATOM   8968 C  CA  . ILE B 2 161  ? 111.988 99.425  53.810  1.00 7.85   ? 181  ILE B CA  1 
ATOM   8969 C  C   . ILE B 2 161  ? 112.514 98.861  52.505  1.00 5.71   ? 181  ILE B C   1 
ATOM   8970 O  O   . ILE B 2 161  ? 111.832 98.928  51.481  1.00 9.56   ? 181  ILE B O   1 
ATOM   8971 C  CB  . ILE B 2 161  ? 110.823 98.562  54.316  1.00 6.08   ? 181  ILE B CB  1 
ATOM   8972 C  CG1 . ILE B 2 161  ? 110.207 99.171  55.558  1.00 8.01   ? 181  ILE B CG1 1 
ATOM   8973 C  CG2 . ILE B 2 161  ? 111.299 97.182  54.626  1.00 9.81   ? 181  ILE B CG2 1 
ATOM   8974 C  CD1 . ILE B 2 161  ? 111.173 99.337  56.641  1.00 6.56   ? 181  ILE B CD1 1 
ATOM   8975 N  N   . HIS B 2 162  ? 113.707 98.295  52.535  1.00 5.67   ? 182  HIS B N   1 
ATOM   8976 C  CA  . HIS B 2 162  ? 114.290 97.742  51.327  1.00 7.06   ? 182  HIS B CA  1 
ATOM   8977 C  C   . HIS B 2 162  ? 113.796 96.319  51.116  1.00 6.38   ? 182  HIS B C   1 
ATOM   8978 O  O   . HIS B 2 162  ? 113.549 95.585  52.072  1.00 8.77   ? 182  HIS B O   1 
ATOM   8979 C  CB  . HIS B 2 162  ? 115.812 97.747  51.413  1.00 6.69   ? 182  HIS B CB  1 
ATOM   8980 C  CG  . HIS B 2 162  ? 116.490 97.350  50.143  1.00 6.61   ? 182  HIS B CG  1 
ATOM   8981 N  ND1 . HIS B 2 162  ? 116.734 98.240  49.124  1.00 6.59   ? 182  HIS B ND1 1 
ATOM   8982 C  CD2 . HIS B 2 162  ? 116.929 96.148  49.706  1.00 8.70   ? 182  HIS B CD2 1 
ATOM   8983 C  CE1 . HIS B 2 162  ? 117.332 97.612  48.129  1.00 8.44   ? 182  HIS B CE1 1 
ATOM   8984 N  NE2 . HIS B 2 162  ? 117.457 96.341  48.454  1.00 9.09   ? 182  HIS B NE2 1 
ATOM   8985 N  N   . CYS B 2 163  ? 113.651 95.929  49.852  1.00 5.82   ? 183  CYS B N   1 
ATOM   8986 C  CA  . CYS B 2 163  ? 113.353 94.551  49.489  1.00 4.47   ? 183  CYS B CA  1 
ATOM   8987 C  C   . CYS B 2 163  ? 114.105 94.210  48.216  1.00 9.08   ? 183  CYS B C   1 
ATOM   8988 O  O   . CYS B 2 163  ? 114.470 95.095  47.442  1.00 9.11   ? 183  CYS B O   1 
ATOM   8989 C  CB  . CYS B 2 163  ? 111.860 94.318  49.271  1.00 8.42   ? 183  CYS B CB  1 
ATOM   8990 S  SG  . CYS B 2 163  ? 110.839 94.473  50.727  1.00 15.20  ? 183  CYS B SG  1 
ATOM   8991 N  N   . SER B 2 164  ? 114.331 92.914  48.000  1.00 6.90   ? 184  SER B N   1 
ATOM   8992 C  CA  . SER B 2 164  ? 114.978 92.439  46.782  1.00 6.70   ? 184  SER B CA  1 
ATOM   8993 C  C   . SER B 2 164  ? 114.721 90.954  46.618  1.00 10.62  ? 184  SER B C   1 
ATOM   8994 O  O   . SER B 2 164  ? 114.570 90.225  47.600  1.00 8.66   ? 184  SER B O   1 
ATOM   8995 C  CB  . SER B 2 164  ? 116.486 92.685  46.795  1.00 9.10   ? 184  SER B CB  1 
ATOM   8996 O  OG  . SER B 2 164  ? 117.111 91.916  47.802  1.00 8.60   ? 184  SER B OG  1 
ATOM   8997 N  N   . VAL B 2 165  ? 114.713 90.506  45.367  1.00 8.52   ? 185  VAL B N   1 
ATOM   8998 C  CA  . VAL B 2 165  ? 114.437 89.118  45.042  1.00 7.48   ? 185  VAL B CA  1 
ATOM   8999 C  C   . VAL B 2 165  ? 115.681 88.494  44.432  1.00 11.39  ? 185  VAL B C   1 
ATOM   9000 O  O   . VAL B 2 165  ? 116.656 89.171  44.113  1.00 9.31   ? 185  VAL B O   1 
ATOM   9001 C  CB  . VAL B 2 165  ? 113.244 88.971  44.088  1.00 7.77   ? 185  VAL B CB  1 
ATOM   9002 C  CG1 . VAL B 2 165  ? 112.005 89.547  44.718  1.00 10.81  ? 185  VAL B CG1 1 
ATOM   9003 C  CG2 . VAL B 2 165  ? 113.540 89.658  42.777  1.00 7.48   ? 185  VAL B CG2 1 
ATOM   9004 N  N   . LYS B 2 166  ? 115.631 87.176  44.278  1.00 11.83  ? 186  LYS B N   1 
ATOM   9005 C  CA  . LYS B 2 166  ? 116.705 86.447  43.625  1.00 16.55  ? 186  LYS B CA  1 
ATOM   9006 C  C   . LYS B 2 166  ? 116.670 86.740  42.131  1.00 16.83  ? 186  LYS B C   1 
ATOM   9007 O  O   . LYS B 2 166  ? 115.618 87.045  41.568  1.00 15.69  ? 186  LYS B O   1 
ATOM   9008 C  CB  . LYS B 2 166  ? 116.547 84.943  43.883  1.00 15.89  ? 186  LYS B CB  1 
ATOM   9009 C  CG  . LYS B 2 166  ? 117.730 84.063  43.495  1.00 19.63  ? 186  LYS B CG  1 
ATOM   9010 C  CD  . LYS B 2 166  ? 117.488 82.596  43.823  1.00 24.17  ? 186  LYS B CD  1 
ATOM   9011 C  CE  . LYS B 2 166  ? 116.589 81.950  42.787  1.00 32.72  ? 186  LYS B CE  1 
ATOM   9012 N  NZ  . LYS B 2 166  ? 116.420 80.486  42.992  1.00 38.73  ? 186  LYS B NZ  1 
ATOM   9013 N  N   . ALA B 2 167  ? 117.829 86.657  41.487  1.00 12.69  ? 187  ALA B N   1 
ATOM   9014 C  CA  . ALA B 2 167  ? 117.865 86.771  40.039  1.00 12.27  ? 187  ALA B CA  1 
ATOM   9015 C  C   . ALA B 2 167  ? 117.151 85.599  39.376  1.00 15.47  ? 187  ALA B C   1 
ATOM   9016 O  O   . ALA B 2 167  ? 116.971 84.529  39.960  1.00 17.66  ? 187  ALA B O   1 
ATOM   9017 C  CB  . ALA B 2 167  ? 119.305 86.848  39.538  1.00 19.42  ? 187  ALA B CB  1 
ATOM   9018 N  N   . GLU B 2 168  ? 116.591 85.918  38.213  1.00 16.38  ? 188  GLU B N   1 
ATOM   9019 C  CA  . GLU B 2 168  ? 115.784 85.010  37.405  1.00 22.40  ? 188  GLU B CA  1 
ATOM   9020 C  C   . GLU B 2 168  ? 115.687 83.572  37.893  1.00 21.12  ? 188  GLU B C   1 
ATOM   9021 O  O   . GLU B 2 168  ? 115.013 83.290  38.883  1.00 18.43  ? 188  GLU B O   1 
ATOM   9022 C  CB  . GLU B 2 168  ? 116.194 85.066  35.933  1.00 33.46  ? 188  GLU B CB  1 
ATOM   9023 C  CG  . GLU B 2 168  ? 115.209 85.834  35.063  1.00 41.21  ? 188  GLU B CG  1 
ATOM   9024 C  CD  . GLU B 2 168  ? 114.027 86.383  35.846  1.00 51.26  ? 188  GLU B CD  1 
ATOM   9025 O  OE1 . GLU B 2 168  ? 112.875 86.059  35.492  1.00 54.35  ? 188  GLU B OE1 1 
ATOM   9026 O  OE2 . GLU B 2 168  ? 114.244 87.148  36.809  1.00 44.62  ? 188  GLU B OE2 1 
ATOM   9027 N  N   . ASN B 2 169  ? 116.341 82.663  37.183  1.00 16.96  ? 189  ASN B N   1 
ATOM   9028 C  CA  . ASN B 2 169  ? 116.288 81.260  37.552  1.00 20.04  ? 189  ASN B CA  1 
ATOM   9029 C  C   . ASN B 2 169  ? 117.650 80.696  37.915  1.00 21.73  ? 189  ASN B C   1 
ATOM   9030 O  O   . ASN B 2 169  ? 118.619 80.843  37.173  1.00 21.25  ? 189  ASN B O   1 
ATOM   9031 C  CB  . ASN B 2 169  ? 115.643 80.454  36.429  1.00 19.86  ? 189  ASN B CB  1 
ATOM   9032 C  CG  . ASN B 2 169  ? 114.416 81.139  35.863  1.00 30.99  ? 189  ASN B CG  1 
ATOM   9033 O  OD1 . ASN B 2 169  ? 113.525 81.551  36.607  1.00 33.81  ? 189  ASN B OD1 1 
ATOM   9034 N  ND2 . ASN B 2 169  ? 114.368 81.275  34.542  1.00 34.15  ? 189  ASN B ND2 1 
HETATM 9035 C  C1  . NAG C 3 .    ? 103.453 144.648 82.895  1.00 23.03  ? 1    NAG C C1  1 
HETATM 9036 C  C2  . NAG C 3 .    ? 104.612 145.380 82.236  1.00 23.03  ? 1    NAG C C2  1 
HETATM 9037 C  C3  . NAG C 3 .    ? 104.143 146.740 81.716  1.00 23.03  ? 1    NAG C C3  1 
HETATM 9038 C  C4  . NAG C 3 .    ? 102.881 146.614 80.867  1.00 23.03  ? 1    NAG C C4  1 
HETATM 9039 C  C5  . NAG C 3 .    ? 101.832 145.721 81.536  1.00 23.03  ? 1    NAG C C5  1 
HETATM 9040 C  C6  . NAG C 3 .    ? 100.690 145.377 80.620  1.00 23.03  ? 1    NAG C C6  1 
HETATM 9041 C  C7  . NAG C 3 .    ? 106.983 145.677 82.763  1.00 23.03  ? 1    NAG C C7  1 
HETATM 9042 C  C8  . NAG C 3 .    ? 108.008 145.831 83.847  1.00 23.03  ? 1    NAG C C8  1 
HETATM 9043 N  N2  . NAG C 3 .    ? 105.717 145.538 83.165  1.00 23.03  ? 1    NAG C N2  1 
HETATM 9044 O  O3  . NAG C 3 .    ? 105.175 147.351 80.951  1.00 23.03  ? 1    NAG C O3  1 
HETATM 9045 O  O4  . NAG C 3 .    ? 102.297 147.906 80.760  1.00 23.03  ? 1    NAG C O4  1 
HETATM 9046 O  O5  . NAG C 3 .    ? 102.408 144.475 81.952  1.00 23.03  ? 1    NAG C O5  1 
HETATM 9047 O  O6  . NAG C 3 .    ? 101.142 144.594 79.524  1.00 23.03  ? 1    NAG C O6  1 
HETATM 9048 O  O7  . NAG C 3 .    ? 107.286 145.695 81.574  1.00 23.03  ? 1    NAG C O7  1 
HETATM 9049 C  C1  . NAG C 3 .    ? 102.412 148.550 79.492  1.00 33.86  ? 2    NAG C C1  1 
HETATM 9050 C  C2  . NAG C 3 .    ? 101.329 149.633 79.533  1.00 33.86  ? 2    NAG C C2  1 
HETATM 9051 C  C3  . NAG C 3 .    ? 101.395 150.508 78.282  1.00 33.86  ? 2    NAG C C3  1 
HETATM 9052 C  C4  . NAG C 3 .    ? 102.803 151.048 78.077  1.00 33.86  ? 2    NAG C C4  1 
HETATM 9053 C  C5  . NAG C 3 .    ? 103.762 149.871 78.007  1.00 33.86  ? 2    NAG C C5  1 
HETATM 9054 C  C6  . NAG C 3 .    ? 105.202 150.272 77.795  1.00 33.86  ? 2    NAG C C6  1 
HETATM 9055 C  C7  . NAG C 3 .    ? 99.266  149.030 80.767  1.00 33.86  ? 2    NAG C C7  1 
HETATM 9056 C  C8  . NAG C 3 .    ? 99.829  149.766 81.955  1.00 33.86  ? 2    NAG C C8  1 
HETATM 9057 N  N2  . NAG C 3 .    ? 100.018 149.013 79.655  1.00 33.86  ? 2    NAG C N2  1 
HETATM 9058 O  O3  . NAG C 3 .    ? 100.476 151.585 78.397  1.00 33.86  ? 2    NAG C O3  1 
HETATM 9059 O  O4  . NAG C 3 .    ? 102.879 151.819 76.884  1.00 33.86  ? 2    NAG C O4  1 
HETATM 9060 O  O5  . NAG C 3 .    ? 103.692 149.146 79.244  1.00 33.86  ? 2    NAG C O5  1 
HETATM 9061 O  O6  . NAG C 3 .    ? 105.636 149.949 76.479  1.00 33.86  ? 2    NAG C O6  1 
HETATM 9062 O  O7  . NAG C 3 .    ? 98.168  148.486 80.810  1.00 33.86  ? 2    NAG C O7  1 
HETATM 9063 C  C1  . NAG D 4 .    ? 152.929 124.511 51.730  1.00 46.57  ? 1801 NAG A C1  1 
HETATM 9064 C  C2  . NAG D 4 .    ? 152.339 124.096 50.353  1.00 46.57  ? 1801 NAG A C2  1 
HETATM 9065 C  C3  . NAG D 4 .    ? 153.112 122.932 49.715  1.00 46.57  ? 1801 NAG A C3  1 
HETATM 9066 C  C4  . NAG D 4 .    ? 154.603 123.238 49.686  1.00 46.57  ? 1801 NAG A C4  1 
HETATM 9067 C  C5  . NAG D 4 .    ? 155.100 123.603 51.084  1.00 46.57  ? 1801 NAG A C5  1 
HETATM 9068 C  C6  . NAG D 4 .    ? 156.547 124.035 51.097  1.00 46.57  ? 1801 NAG A C6  1 
HETATM 9069 C  C7  . NAG D 4 .    ? 149.979 123.100 50.854  1.00 46.57  ? 1801 NAG A C7  1 
HETATM 9070 C  C8  . NAG D 4 .    ? 150.464 122.050 51.838  1.00 46.57  ? 1801 NAG A C8  1 
HETATM 9071 N  N2  . NAG D 4 .    ? 150.876 123.944 50.271  1.00 46.57  ? 1801 NAG A N2  1 
HETATM 9072 O  O3  . NAG D 4 .    ? 152.637 122.717 48.391  1.00 46.57  ? 1801 NAG A O3  1 
HETATM 9073 O  O4  . NAG D 4 .    ? 155.317 122.100 49.219  1.00 46.57  ? 1801 NAG A O4  1 
HETATM 9074 O  O5  . NAG D 4 .    ? 154.348 124.707 51.609  1.00 46.57  ? 1801 NAG A O5  1 
HETATM 9075 O  O6  . NAG D 4 .    ? 156.716 125.291 50.454  1.00 46.57  ? 1801 NAG A O6  1 
HETATM 9076 O  O7  . NAG D 4 .    ? 148.786 123.194 50.585  1.00 46.57  ? 1801 NAG A O7  1 
HETATM 9077 C  C1  . NAG E 4 .    ? 143.398 147.049 70.957  1.00 23.03  ? 1802 NAG A C1  1 
HETATM 9078 C  C2  . NAG E 4 .    ? 144.009 147.544 69.644  1.00 23.03  ? 1802 NAG A C2  1 
HETATM 9079 C  C3  . NAG E 4 .    ? 144.018 146.426 68.607  1.00 23.03  ? 1802 NAG A C3  1 
HETATM 9080 C  C4  . NAG E 4 .    ? 144.727 145.196 69.154  1.00 23.03  ? 1802 NAG A C4  1 
HETATM 9081 C  C5  . NAG E 4 .    ? 144.076 144.768 70.464  1.00 23.03  ? 1802 NAG A C5  1 
HETATM 9082 C  C6  . NAG E 4 .    ? 144.789 143.607 71.116  1.00 23.03  ? 1802 NAG A C6  1 
HETATM 9083 C  C7  . NAG E 4 .    ? 143.784 149.954 69.245  1.00 23.03  ? 1802 NAG A C7  1 
HETATM 9084 C  C8  . NAG E 4 .    ? 142.933 151.037 68.656  1.00 23.03  ? 1802 NAG A C8  1 
HETATM 9085 N  N2  . NAG E 4 .    ? 143.307 148.710 69.135  1.00 23.03  ? 1802 NAG A N2  1 
HETATM 9086 O  O3  . NAG E 4 .    ? 144.668 146.875 67.424  1.00 23.03  ? 1802 NAG A O3  1 
HETATM 9087 O  O4  . NAG E 4 .    ? 144.641 144.126 68.221  1.00 23.03  ? 1802 NAG A O4  1 
HETATM 9088 O  O5  . NAG E 4 .    ? 144.098 145.858 71.400  1.00 23.03  ? 1802 NAG A O5  1 
HETATM 9089 O  O6  . NAG E 4 .    ? 144.724 142.444 70.302  1.00 23.03  ? 1802 NAG A O6  1 
HETATM 9090 O  O7  . NAG E 4 .    ? 144.850 150.194 69.801  1.00 23.03  ? 1802 NAG A O7  1 
HETATM 9091 C  C1  . NAG F 4 .    ? 158.162 115.694 81.440  1.00 0.03   ? 1803 NAG A C1  1 
HETATM 9092 C  C2  . NAG F 4 .    ? 158.248 114.217 81.028  1.00 0.03   ? 1803 NAG A C2  1 
HETATM 9093 C  C3  . NAG F 4 .    ? 159.684 113.660 81.139  1.00 0.03   ? 1803 NAG A C3  1 
HETATM 9094 C  C4  . NAG F 4 .    ? 160.563 114.405 82.144  1.00 0.03   ? 1803 NAG A C4  1 
HETATM 9095 C  C5  . NAG F 4 .    ? 160.407 115.929 82.085  1.00 0.03   ? 1803 NAG A C5  1 
HETATM 9096 C  C6  . NAG F 4 .    ? 161.673 116.635 81.654  1.00 0.03   ? 1803 NAG A C6  1 
HETATM 9097 C  C7  . NAG F 4 .    ? 157.162 113.128 83.014  1.00 0.03   ? 1803 NAG A C7  1 
HETATM 9098 C  C8  . NAG F 4 .    ? 156.054 112.205 83.414  1.00 0.03   ? 1803 NAG A C8  1 
HETATM 9099 N  N2  . NAG F 4 .    ? 157.273 113.359 81.695  1.00 0.03   ? 1803 NAG A N2  1 
HETATM 9100 O  O3  . NAG F 4 .    ? 160.293 113.675 79.853  1.00 0.03   ? 1803 NAG A O3  1 
HETATM 9101 O  O4  . NAG F 4 .    ? 160.243 113.965 83.458  1.00 0.03   ? 1803 NAG A O4  1 
HETATM 9102 O  O5  . NAG F 4 .    ? 159.376 116.321 81.167  1.00 0.03   ? 1803 NAG A O5  1 
HETATM 9103 O  O6  . NAG F 4 .    ? 161.400 117.898 81.060  1.00 0.03   ? 1803 NAG A O6  1 
HETATM 9104 O  O7  . NAG F 4 .    ? 157.910 113.631 83.849  1.00 0.03   ? 1803 NAG A O7  1 
HETATM 9105 C  C1  . NAG G 4 .    ? 104.896 123.690 31.626  1.00 72.29  ? 1804 NAG A C1  1 
HETATM 9106 C  C2  . NAG G 4 .    ? 103.880 124.589 30.917  1.00 72.29  ? 1804 NAG A C2  1 
HETATM 9107 C  C3  . NAG G 4 .    ? 104.435 125.066 29.578  1.00 72.29  ? 1804 NAG A C3  1 
HETATM 9108 C  C4  . NAG G 4 .    ? 105.786 125.739 29.769  1.00 72.29  ? 1804 NAG A C4  1 
HETATM 9109 C  C5  . NAG G 4 .    ? 106.740 124.791 30.492  1.00 72.29  ? 1804 NAG A C5  1 
HETATM 9110 C  C6  . NAG G 4 .    ? 108.071 125.425 30.818  1.00 72.29  ? 1804 NAG A C6  1 
HETATM 9111 C  C7  . NAG G 4 .    ? 101.579 124.035 31.568  1.00 72.29  ? 1804 NAG A C7  1 
HETATM 9112 C  C8  . NAG G 4 .    ? 100.346 123.258 31.219  1.00 72.29  ? 1804 NAG A C8  1 
HETATM 9113 N  N2  . NAG G 4 .    ? 102.612 123.904 30.730  1.00 72.29  ? 1804 NAG A N2  1 
HETATM 9114 O  O3  . NAG G 4 .    ? 103.518 125.977 28.986  1.00 72.29  ? 1804 NAG A O3  1 
HETATM 9115 O  O4  . NAG G 4 .    ? 106.334 126.101 28.506  1.00 72.29  ? 1804 NAG A O4  1 
HETATM 9116 O  O5  . NAG G 4 .    ? 106.161 124.383 31.741  1.00 72.29  ? 1804 NAG A O5  1 
HETATM 9117 O  O6  . NAG G 4 .    ? 108.638 124.849 31.987  1.00 72.29  ? 1804 NAG A O6  1 
HETATM 9118 O  O7  . NAG G 4 .    ? 101.642 124.742 32.569  1.00 72.29  ? 1804 NAG A O7  1 
HETATM 9119 C  C1  . NAG H 4 .    ? 101.910 116.141 90.034  1.00 32.32  ? 1807 NAG A C1  1 
HETATM 9120 C  C2  . NAG H 4 .    ? 101.448 115.630 91.375  1.00 32.32  ? 1807 NAG A C2  1 
HETATM 9121 C  C3  . NAG H 4 .    ? 101.122 114.150 91.263  1.00 32.32  ? 1807 NAG A C3  1 
HETATM 9122 C  C4  . NAG H 4 .    ? 100.056 113.935 90.194  1.00 32.32  ? 1807 NAG A C4  1 
HETATM 9123 C  C5  . NAG H 4 .    ? 100.448 114.599 88.868  1.00 32.32  ? 1807 NAG A C5  1 
HETATM 9124 C  C6  . NAG H 4 .    ? 99.309  114.615 87.878  1.00 32.32  ? 1807 NAG A C6  1 
HETATM 9125 C  C7  . NAG H 4 .    ? 102.105 116.272 93.640  1.00 32.32  ? 1807 NAG A C7  1 
HETATM 9126 C  C8  . NAG H 4 .    ? 103.242 116.482 94.592  1.00 32.32  ? 1807 NAG A C8  1 
HETATM 9127 N  N2  . NAG H 4 .    ? 102.438 115.870 92.410  1.00 32.32  ? 1807 NAG A N2  1 
HETATM 9128 O  O3  . NAG H 4 .    ? 100.673 113.665 92.523  1.00 32.32  ? 1807 NAG A O3  1 
HETATM 9129 O  O4  . NAG H 4 .    ? 99.865  112.544 89.970  1.00 32.32  ? 1807 NAG A O4  1 
HETATM 9130 O  O5  . NAG H 4 .    ? 100.848 115.971 89.063  1.00 32.32  ? 1807 NAG A O5  1 
HETATM 9131 O  O6  . NAG H 4 .    ? 98.177  113.926 88.392  1.00 32.32  ? 1807 NAG A O6  1 
HETATM 9132 O  O7  . NAG H 4 .    ? 100.939 116.455 93.969  1.00 32.32  ? 1807 NAG A O7  1 
HETATM 9133 C  CAA . Y01 I 5 .    ? 124.648 116.894 51.743  1.00 42.30  ? 1808 Y01 A CAA 1 
HETATM 9134 C  CBA . Y01 I 5 .    ? 123.749 117.667 52.692  1.00 42.30  ? 1808 Y01 A CBA 1 
HETATM 9135 C  CAB . Y01 I 5 .    ? 122.517 116.854 53.029  1.00 42.30  ? 1808 Y01 A CAB 1 
HETATM 9136 C  CAN . Y01 I 5 .    ? 124.510 118.004 53.955  1.00 42.30  ? 1808 Y01 A CAN 1 
HETATM 9137 C  CAJ . Y01 I 5 .    ? 123.616 118.758 54.921  1.00 42.30  ? 1808 Y01 A CAJ 1 
HETATM 9138 C  CAO . Y01 I 5 .    ? 124.437 119.123 56.138  1.00 42.30  ? 1808 Y01 A CAO 1 
HETATM 9139 C  CBB . Y01 I 5 .    ? 123.708 118.786 57.427  1.00 42.30  ? 1808 Y01 A CBB 1 
HETATM 9140 C  CAC . Y01 I 5 .    ? 124.476 117.594 57.984  1.00 42.30  ? 1808 Y01 A CAC 1 
HETATM 9141 C  CBE . Y01 I 5 .    ? 123.650 119.992 58.373  1.00 42.30  ? 1808 Y01 A CBE 1 
HETATM 9142 C  CAP . Y01 I 5 .    ? 123.514 121.325 57.626  1.00 42.30  ? 1808 Y01 A CAP 1 
HETATM 9143 C  CAQ . Y01 I 5 .    ? 122.610 122.246 58.432  1.00 42.30  ? 1808 Y01 A CAQ 1 
HETATM 9144 C  CBG . Y01 I 5 .    ? 122.627 121.520 59.752  1.00 42.30  ? 1808 Y01 A CBG 1 
HETATM 9145 C  CBI . Y01 I 5 .    ? 122.519 120.060 59.384  1.00 42.30  ? 1808 Y01 A CBI 1 
HETATM 9146 C  CAE . Y01 I 5 .    ? 121.203 119.705 58.727  1.00 42.30  ? 1808 Y01 A CAE 1 
HETATM 9147 C  CAU . Y01 I 5 .    ? 122.696 119.231 60.640  1.00 42.30  ? 1808 Y01 A CAU 1 
HETATM 9148 C  CAS . Y01 I 5 .    ? 121.792 119.693 61.771  1.00 42.30  ? 1808 Y01 A CAS 1 
HETATM 9149 C  CBF . Y01 I 5 .    ? 121.971 121.181 62.047  1.00 42.30  ? 1808 Y01 A CBF 1 
HETATM 9150 C  CBD . Y01 I 5 .    ? 121.659 121.992 60.810  1.00 42.30  ? 1808 Y01 A CBD 1 
HETATM 9151 C  CAK . Y01 I 5 .    ? 121.955 123.453 61.070  1.00 42.30  ? 1808 Y01 A CAK 1 
HETATM 9152 C  CAI . Y01 I 5 .    ? 121.305 123.925 62.342  1.00 42.30  ? 1808 Y01 A CAI 1 
HETATM 9153 C  CAZ . Y01 I 5 .    ? 121.063 123.112 63.373  1.00 42.30  ? 1808 Y01 A CAZ 1 
HETATM 9154 C  CAV . Y01 I 5 .    ? 120.606 123.724 64.670  1.00 42.30  ? 1808 Y01 A CAV 1 
HETATM 9155 C  CBH . Y01 I 5 .    ? 121.154 121.621 63.248  1.00 42.30  ? 1808 Y01 A CBH 1 
HETATM 9156 C  CAD . Y01 I 5 .    ? 119.721 121.117 63.142  1.00 42.30  ? 1808 Y01 A CAD 1 
HETATM 9157 C  CAT . Y01 I 5 .    ? 121.842 121.074 64.479  1.00 42.30  ? 1808 Y01 A CAT 1 
HETATM 9158 C  CAR . Y01 I 5 .    ? 121.145 121.536 65.739  1.00 42.30  ? 1808 Y01 A CAR 1 
HETATM 9159 C  CBC . Y01 I 5 .    ? 121.167 123.043 65.908  1.00 42.30  ? 1808 Y01 A CBC 1 
HETATM 9160 O  OAW . Y01 I 5 .    ? 120.256 123.302 66.963  1.00 42.30  ? 1808 Y01 A OAW 1 
HETATM 9161 C  CAY . Y01 I 5 .    ? 120.691 124.319 67.893  1.00 42.30  ? 1808 Y01 A CAY 1 
HETATM 9162 O  OAG . Y01 I 5 .    ? 121.663 124.999 67.648  1.00 42.30  ? 1808 Y01 A OAG 1 
HETATM 9163 C  CAM . Y01 I 5 .    ? 119.921 124.510 69.164  1.00 42.30  ? 1808 Y01 A CAM 1 
HETATM 9164 C  CAL . Y01 I 5 .    ? 120.549 123.659 70.244  1.00 42.30  ? 1808 Y01 A CAL 1 
HETATM 9165 C  CAX . Y01 I 5 .    ? 121.704 124.441 70.804  1.00 42.30  ? 1808 Y01 A CAX 1 
HETATM 9166 O  OAH . Y01 I 5 .    ? 121.904 125.704 70.442  1.00 42.30  ? 1808 Y01 A OAH 1 
HETATM 9167 O  OAF . Y01 I 5 .    ? 122.451 123.926 71.615  1.00 42.30  ? 1808 Y01 A OAF 1 
HETATM 9168 C  CAA . Y01 J 5 .    ? 123.924 103.440 118.747 1.00 100.92 ? 1809 Y01 A CAA 1 
HETATM 9169 C  CBA . Y01 J 5 .    ? 123.869 104.959 118.804 1.00 100.92 ? 1809 Y01 A CBA 1 
HETATM 9170 C  CAB . Y01 J 5 .    ? 124.402 105.412 120.148 1.00 100.92 ? 1809 Y01 A CAB 1 
HETATM 9171 C  CAN . Y01 J 5 .    ? 124.679 105.597 117.689 1.00 100.92 ? 1809 Y01 A CAN 1 
HETATM 9172 C  CAJ . Y01 J 5 .    ? 123.908 105.609 116.383 1.00 100.92 ? 1809 Y01 A CAJ 1 
HETATM 9173 C  CAO . Y01 J 5 .    ? 124.600 104.701 115.385 1.00 100.92 ? 1809 Y01 A CAO 1 
HETATM 9174 C  CBB . Y01 J 5 .    ? 124.569 105.301 113.993 1.00 100.92 ? 1809 Y01 A CBB 1 
HETATM 9175 C  CAC . Y01 J 5 .    ? 125.993 105.778 113.732 1.00 100.92 ? 1809 Y01 A CAC 1 
HETATM 9176 C  CBE . Y01 J 5 .    ? 124.012 104.284 112.985 1.00 100.92 ? 1809 Y01 A CBE 1 
HETATM 9177 C  CAP . Y01 J 5 .    ? 122.779 103.558 113.546 1.00 100.92 ? 1809 Y01 A CAP 1 
HETATM 9178 C  CAQ . Y01 J 5 .    ? 121.798 103.328 112.405 1.00 100.92 ? 1809 Y01 A CAQ 1 
HETATM 9179 C  CBG . Y01 J 5 .    ? 122.664 103.630 111.203 1.00 100.92 ? 1809 Y01 A CBG 1 
HETATM 9180 C  CBI . Y01 J 5 .    ? 123.523 104.795 111.636 1.00 100.92 ? 1809 Y01 A CBI 1 
HETATM 9181 C  CAE . Y01 J 5 .    ? 122.720 106.068 111.847 1.00 100.92 ? 1809 Y01 A CAE 1 
HETATM 9182 C  CAU . Y01 J 5 .    ? 124.571 104.988 110.538 1.00 100.92 ? 1809 Y01 A CAU 1 
HETATM 9183 C  CAS . Y01 J 5 .    ? 123.936 105.222 109.169 1.00 100.92 ? 1809 Y01 A CAS 1 
HETATM 9184 C  CBF . Y01 J 5 .    ? 123.031 104.048 108.808 1.00 100.92 ? 1809 Y01 A CBF 1 
HETATM 9185 C  CBD . Y01 J 5 .    ? 121.953 103.868 109.885 1.00 100.92 ? 1809 Y01 A CBD 1 
HETATM 9186 C  CAK . Y01 J 5 .    ? 121.005 102.710 109.594 1.00 100.92 ? 1809 Y01 A CAK 1 
HETATM 9187 C  CAI . Y01 J 5 .    ? 120.570 102.823 108.155 1.00 100.92 ? 1809 Y01 A CAI 1 
HETATM 9188 C  CAZ . Y01 J 5 .    ? 121.541 102.988 107.251 1.00 100.92 ? 1809 Y01 A CAZ 1 
HETATM 9189 C  CAV . Y01 J 5 .    ? 121.706 101.933 106.186 1.00 100.92 ? 1809 Y01 A CAV 1 
HETATM 9190 C  CBH . Y01 J 5 .    ? 122.430 104.194 107.417 1.00 100.92 ? 1809 Y01 A CBH 1 
HETATM 9191 C  CAD . Y01 J 5 .    ? 121.606 105.471 107.308 1.00 100.92 ? 1809 Y01 A CAD 1 
HETATM 9192 C  CAT . Y01 J 5 .    ? 123.533 104.255 106.367 1.00 100.92 ? 1809 Y01 A CAT 1 
HETATM 9193 C  CAR . Y01 J 5 .    ? 124.005 102.878 105.953 1.00 100.92 ? 1809 Y01 A CAR 1 
HETATM 9194 C  CBC . Y01 J 5 .    ? 122.873 102.166 105.235 1.00 100.92 ? 1809 Y01 A CBC 1 
HETATM 9195 O  OAW . Y01 J 5 .    ? 122.428 102.925 104.115 1.00 100.92 ? 1809 Y01 A OAW 1 
HETATM 9196 C  CAY . Y01 J 5 .    ? 121.560 102.128 103.258 1.00 100.92 ? 1809 Y01 A CAY 1 
HETATM 9197 O  OAG . Y01 J 5 .    ? 120.358 102.344 103.252 1.00 100.92 ? 1809 Y01 A OAG 1 
HETATM 9198 C  CAM . Y01 J 5 .    ? 122.143 101.049 102.373 1.00 100.92 ? 1809 Y01 A CAM 1 
HETATM 9199 C  CAL . Y01 J 5 .    ? 121.624 99.669  102.766 1.00 100.92 ? 1809 Y01 A CAL 1 
HETATM 9200 C  CAX . Y01 J 5 .    ? 122.776 98.825  103.262 1.00 100.92 ? 1809 Y01 A CAX 1 
HETATM 9201 O  OAH . Y01 J 5 .    ? 122.842 98.435  104.531 1.00 100.92 ? 1809 Y01 A OAH 1 
HETATM 9202 O  OAF . Y01 J 5 .    ? 123.666 98.496  102.501 1.00 100.92 ? 1809 Y01 A OAF 1 
HETATM 9203 N  N   . SER K 6 .    ? 117.708 80.062  39.079  1.00 30.00  ? 201  SER B N   1 
HETATM 9204 C  CA  . SER K 6 .    ? 118.936 79.473  39.585  1.00 30.00  ? 201  SER B CA  1 
HETATM 9205 C  C   . SER K 6 .    ? 118.630 78.196  40.361  1.00 30.00  ? 201  SER B C   1 
HETATM 9206 O  O   . SER K 6 .    ? 117.467 77.868  40.603  1.00 30.00  ? 201  SER B O   1 
HETATM 9207 C  CB  . SER K 6 .    ? 119.689 80.469  40.475  1.00 30.00  ? 201  SER B CB  1 
HETATM 9208 O  OG  . SER K 6 .    ? 118.834 81.475  40.998  1.00 30.00  ? 201  SER B OG  1 
HETATM 9209 ZN ZN  . ZN  L 7 .    ? 116.632 101.020 48.156  1.00 7.85   ? 202  ZN  B ZN  1 
HETATM 9210 CA CA  . CA  M 8 .    ? 115.213 106.221 40.718  1.00 18.68  ? 203  CA  B CA  1 
HETATM 9211 CA CA  . CA  N 8 .    ? 111.696 106.206 42.715  1.00 12.03  ? 204  CA  B CA  1 
# 
loop_
_atom_site_anisotrop.id 
_atom_site_anisotrop.type_symbol 
_atom_site_anisotrop.pdbx_label_atom_id 
_atom_site_anisotrop.pdbx_label_alt_id 
_atom_site_anisotrop.pdbx_label_comp_id 
_atom_site_anisotrop.pdbx_label_asym_id 
_atom_site_anisotrop.pdbx_label_seq_id 
_atom_site_anisotrop.pdbx_PDB_ins_code 
_atom_site_anisotrop.U[1][1] 
_atom_site_anisotrop.U[2][2] 
_atom_site_anisotrop.U[3][3] 
_atom_site_anisotrop.U[1][2] 
_atom_site_anisotrop.U[1][3] 
_atom_site_anisotrop.U[2][3] 
_atom_site_anisotrop.pdbx_auth_seq_id 
_atom_site_anisotrop.pdbx_auth_comp_id 
_atom_site_anisotrop.pdbx_auth_asym_id 
_atom_site_anisotrop.pdbx_auth_atom_id 
805  N  N   . LEU A 196  ? 0.5157 0.5157 0.5157 0.0000 0.0000 0.0000 175  LEU A N   
806  C  CA  . LEU A 196  ? 0.5157 0.5157 0.5157 0.0000 0.0000 0.0000 175  LEU A CA  
807  C  C   . LEU A 196  ? 0.5157 0.5157 0.5157 0.0000 0.0000 0.0000 175  LEU A C   
808  O  O   . LEU A 196  ? 0.5157 0.5157 0.5157 0.0000 0.0000 0.0000 175  LEU A O   
813  N  N   . LEU A 197  ? 0.5035 0.5035 0.5035 0.0000 0.0000 0.0000 176  LEU A N   
814  C  CA  . LEU A 197  ? 0.5035 0.5035 0.5035 0.0000 0.0000 0.0000 176  LEU A CA  
815  C  C   . LEU A 197  ? 0.5035 0.5035 0.5035 0.0000 0.0000 0.0000 176  LEU A C   
816  O  O   . LEU A 197  ? 0.5035 0.5035 0.5035 0.0000 0.0000 0.0000 176  LEU A O   
821  N  N   . GLN A 198  ? 0.6829 0.6829 0.6829 0.0000 0.0000 0.0000 177  GLN A N   
822  C  CA  . GLN A 198  ? 0.6829 0.6829 0.6829 0.0000 0.0000 0.0000 177  GLN A CA  
823  C  C   . GLN A 198  ? 0.6829 0.6829 0.6829 0.0000 0.0000 0.0000 177  GLN A C   
824  O  O   . GLN A 198  ? 0.6829 0.6829 0.6829 0.0000 0.0000 0.0000 177  GLN A O   
830  N  N   . HIS A 199  ? 0.3841 0.3841 0.3841 0.0000 0.0000 0.0000 178  HIS A N   
831  C  CA  . HIS A 199  ? 0.3841 0.3841 0.3841 0.0000 0.0000 0.0000 178  HIS A CA  
832  C  C   . HIS A 199  ? 0.3841 0.3841 0.3841 0.0000 0.0000 0.0000 178  HIS A C   
833  O  O   . HIS A 199  ? 0.3841 0.3841 0.3841 0.0000 0.0000 0.0000 178  HIS A O   
840  N  N   . LEU A 200  ? 0.4278 0.4278 0.4278 0.0000 0.0000 0.0000 179  LEU A N   
841  C  CA  . LEU A 200  ? 0.4278 0.4278 0.4278 0.0000 0.0000 0.0000 179  LEU A CA  
842  C  C   . LEU A 200  ? 0.4278 0.4278 0.4278 0.0000 0.0000 0.0000 179  LEU A C   
843  O  O   . LEU A 200  ? 0.4278 0.4278 0.4278 0.0000 0.0000 0.0000 179  LEU A O   
848  N  N   . ASP A 201  ? 0.5845 0.5845 0.5845 0.0000 0.0000 0.0000 180  ASP A N   
849  C  CA  . ASP A 201  ? 0.5845 0.5845 0.5845 0.0000 0.0000 0.0000 180  ASP A CA  
850  C  C   . ASP A 201  ? 0.5845 0.5845 0.5845 0.0000 0.0000 0.0000 180  ASP A C   
851  O  O   . ASP A 201  ? 0.5845 0.5845 0.5845 0.0000 0.0000 0.0000 180  ASP A O   
856  N  N   . SER A 202  ? 0.6222 0.6222 0.6222 0.0000 0.0000 0.0000 181  SER A N   
857  C  CA  . SER A 202  ? 0.6222 0.6222 0.6222 0.0000 0.0000 0.0000 181  SER A CA  
858  C  C   . SER A 202  ? 0.6222 0.6222 0.6222 0.0000 0.0000 0.0000 181  SER A C   
859  O  O   . SER A 202  ? 0.6222 0.6222 0.6222 0.0000 0.0000 0.0000 181  SER A O   
862  N  N   . ALA A 203  ? 0.6115 0.6115 0.6115 0.0000 0.0000 0.0000 182  ALA A N   
863  C  CA  . ALA A 203  ? 0.6115 0.6115 0.6115 0.0000 0.0000 0.0000 182  ALA A CA  
864  C  C   . ALA A 203  ? 0.6115 0.6115 0.6115 0.0000 0.0000 0.0000 182  ALA A C   
865  O  O   . ALA A 203  ? 0.6115 0.6115 0.6115 0.0000 0.0000 0.0000 182  ALA A O   
867  N  N   . LEU A 204  ? 0.5633 0.5633 0.5633 0.0000 0.0000 0.0000 183  LEU A N   
868  C  CA  . LEU A 204  ? 0.5633 0.5633 0.5633 0.0000 0.0000 0.0000 183  LEU A CA  
869  C  C   . LEU A 204  ? 0.5633 0.5633 0.5633 0.0000 0.0000 0.0000 183  LEU A C   
870  O  O   . LEU A 204  ? 0.5633 0.5633 0.5633 0.0000 0.0000 0.0000 183  LEU A O   
875  N  N   . GLN A 205  ? 0.5395 0.5395 0.5395 0.0000 0.0000 0.0000 184  GLN A N   
876  C  CA  . GLN A 205  ? 0.5395 0.5395 0.5395 0.0000 0.0000 0.0000 184  GLN A CA  
877  C  C   . GLN A 205  ? 0.5395 0.5395 0.5395 0.0000 0.0000 0.0000 184  GLN A C   
878  O  O   . GLN A 205  ? 0.5395 0.5395 0.5395 0.0000 0.0000 0.0000 184  GLN A O   
884  N  N   . ALA A 206  ? 0.4807 0.4807 0.4807 0.0000 0.0000 0.0000 185  ALA A N   
885  C  CA  . ALA A 206  ? 0.4807 0.4807 0.4807 0.0000 0.0000 0.0000 185  ALA A CA  
886  C  C   . ALA A 206  ? 0.4807 0.4807 0.4807 0.0000 0.0000 0.0000 185  ALA A C   
887  O  O   . ALA A 206  ? 0.4807 0.4807 0.4807 0.0000 0.0000 0.0000 185  ALA A O   
889  N  N   . SER A 207  ? 0.4568 0.4568 0.4568 0.0000 0.0000 0.0000 186  SER A N   
890  C  CA  . SER A 207  ? 0.4568 0.4568 0.4568 0.0000 0.0000 0.0000 186  SER A CA  
891  C  C   . SER A 207  ? 0.4568 0.4568 0.4568 0.0000 0.0000 0.0000 186  SER A C   
892  O  O   . SER A 207  ? 0.4568 0.4568 0.4568 0.0000 0.0000 0.0000 186  SER A O   
895  N  N   . ARG A 208  ? 0.5082 0.5082 0.5082 0.0000 0.0000 0.0000 187  ARG A N   
896  C  CA  . ARG A 208  ? 0.5082 0.5082 0.5082 0.0000 0.0000 0.0000 187  ARG A CA  
897  C  C   . ARG A 208  ? 0.5082 0.5082 0.5082 0.0000 0.0000 0.0000 187  ARG A C   
898  O  O   . ARG A 208  ? 0.5082 0.5082 0.5082 0.0000 0.0000 0.0000 187  ARG A O   
913  N  N   . HIS A 210  ? 0.6225 0.6225 0.6225 0.0000 0.0000 0.0000 189  HIS A N   
914  C  CA  . HIS A 210  ? 0.6225 0.6225 0.6225 0.0000 0.0000 0.0000 189  HIS A CA  
915  C  C   . HIS A 210  ? 0.6225 0.6225 0.6225 0.0000 0.0000 0.0000 189  HIS A C   
916  O  O   . HIS A 210  ? 0.6225 0.6225 0.6225 0.0000 0.0000 0.0000 189  HIS A O   
923  N  N   . VAL A 211  ? 0.7864 0.7864 0.7864 0.0000 0.0000 0.0000 190  VAL A N   
924  C  CA  . VAL A 211  ? 0.7864 0.7864 0.7864 0.0000 0.0000 0.0000 190  VAL A CA  
925  C  C   . VAL A 211  ? 0.7864 0.7864 0.7864 0.0000 0.0000 0.0000 190  VAL A C   
926  O  O   . VAL A 211  ? 0.7864 0.7864 0.7864 0.0000 0.0000 0.0000 190  VAL A O   
981  N  N   . GLN A 217  ? 0.6727 0.6727 0.6727 0.0000 0.0000 0.0000 196  GLN A N   
982  C  CA  . GLN A 217  ? 0.6727 0.6727 0.6727 0.0000 0.0000 0.0000 196  GLN A CA  
983  C  C   . GLN A 217  ? 0.6727 0.6727 0.6727 0.0000 0.0000 0.0000 196  GLN A C   
984  O  O   . GLN A 217  ? 0.6727 0.6727 0.6727 0.0000 0.0000 0.0000 196  GLN A O   
990  N  N   . TRP A 218  ? 0.5343 0.5343 0.5343 0.0000 0.0000 0.0000 197  TRP A N   
991  C  CA  . TRP A 218  ? 0.5343 0.5343 0.5343 0.0000 0.0000 0.0000 197  TRP A CA  
992  C  C   . TRP A 218  ? 0.5343 0.5343 0.5343 0.0000 0.0000 0.0000 197  TRP A C   
993  O  O   . TRP A 218  ? 0.5343 0.5343 0.5343 0.0000 0.0000 0.0000 197  TRP A O   
1004 N  N   . LYS A 219  ? 0.4489 0.4489 0.4489 0.0000 0.0000 0.0000 198  LYS A N   
1005 C  CA  . LYS A 219  ? 0.4489 0.4489 0.4489 0.0000 0.0000 0.0000 198  LYS A CA  
1006 C  C   . LYS A 219  ? 0.4489 0.4489 0.4489 0.0000 0.0000 0.0000 198  LYS A C   
1007 O  O   . LYS A 219  ? 0.4489 0.4489 0.4489 0.0000 0.0000 0.0000 198  LYS A O   
1013 N  N   . LEU A 220  ? 0.3753 0.3753 0.3753 0.0000 0.0000 0.0000 199  LEU A N   
1014 C  CA  . LEU A 220  ? 0.3753 0.3753 0.3753 0.0000 0.0000 0.0000 199  LEU A CA  
1015 C  C   . LEU A 220  ? 0.3753 0.3753 0.3753 0.0000 0.0000 0.0000 199  LEU A C   
1016 O  O   . LEU A 220  ? 0.3753 0.3753 0.3753 0.0000 0.0000 0.0000 199  LEU A O   
1662 N  N   . TRP A 299  ? 0.5639 0.5639 0.5639 0.0000 0.0000 0.0000 278  TRP A N   
1663 C  CA  . TRP A 299  ? 0.5639 0.5639 0.5639 0.0000 0.0000 0.0000 278  TRP A CA  
1664 C  C   . TRP A 299  ? 0.5639 0.5639 0.5639 0.0000 0.0000 0.0000 278  TRP A C   
1665 O  O   . TRP A 299  ? 0.5639 0.5639 0.5639 0.0000 0.0000 0.0000 278  TRP A O   
1676 N  N   . GLU A 300  ? 0.7588 0.7588 0.7588 0.0000 0.0000 0.0000 279  GLU A N   
1677 C  CA  . GLU A 300  ? 0.7588 0.7588 0.7588 0.0000 0.0000 0.0000 279  GLU A CA  
1678 C  C   . GLU A 300  ? 0.7588 0.7588 0.7588 0.0000 0.0000 0.0000 279  GLU A C   
1679 O  O   . GLU A 300  ? 0.7588 0.7588 0.7588 0.0000 0.0000 0.0000 279  GLU A O   
1685 N  N   . GLU A 301  ? 0.6694 0.6694 0.6694 0.0000 0.0000 0.0000 280  GLU A N   
1686 C  CA  . GLU A 301  ? 0.6694 0.6694 0.6694 0.0000 0.0000 0.0000 280  GLU A CA  
1687 C  C   . GLU A 301  ? 0.6694 0.6694 0.6694 0.0000 0.0000 0.0000 280  GLU A C   
1688 O  O   . GLU A 301  ? 0.6694 0.6694 0.6694 0.0000 0.0000 0.0000 280  GLU A O   
1694 N  N   . MET A 302  ? 0.6756 0.6756 0.6756 0.0000 0.0000 0.0000 281  MET A N   
1695 C  CA  . MET A 302  ? 0.6756 0.6756 0.6756 0.0000 0.0000 0.0000 281  MET A CA  
1696 C  C   . MET A 302  ? 0.6756 0.6756 0.6756 0.0000 0.0000 0.0000 281  MET A C   
1697 O  O   . MET A 302  ? 0.6756 0.6756 0.6756 0.0000 0.0000 0.0000 281  MET A O   
1702 N  N   . LEU A 303  ? 0.6107 0.6107 0.6107 0.0000 0.0000 0.0000 282  LEU A N   
1703 C  CA  . LEU A 303  ? 0.6107 0.6107 0.6107 0.0000 0.0000 0.0000 282  LEU A CA  
1704 C  C   . LEU A 303  ? 0.6107 0.6107 0.6107 0.0000 0.0000 0.0000 282  LEU A C   
1705 O  O   . LEU A 303  ? 0.6107 0.6107 0.6107 0.0000 0.0000 0.0000 282  LEU A O   
1710 N  N   . ASN A 304  ? 0.7010 0.7010 0.7010 0.0000 0.0000 0.0000 283  ASN A N   
1711 C  CA  . ASN A 304  ? 0.7010 0.7010 0.7010 0.0000 0.0000 0.0000 283  ASN A CA  
1712 C  C   . ASN A 304  ? 0.7010 0.7010 0.7010 0.0000 0.0000 0.0000 283  ASN A C   
1713 O  O   . ASN A 304  ? 0.7010 0.7010 0.7010 0.0000 0.0000 0.0000 283  ASN A O   
1727 N  N   . ALA A 306  ? 0.8347 0.8347 0.8347 0.0000 0.0000 0.0000 285  ALA A N   
1728 C  CA  . ALA A 306  ? 0.8347 0.8347 0.8347 0.0000 0.0000 0.0000 285  ALA A CA  
1729 C  C   . ALA A 306  ? 0.8347 0.8347 0.8347 0.0000 0.0000 0.0000 285  ALA A C   
1730 O  O   . ALA A 306  ? 0.8347 0.8347 0.8347 0.0000 0.0000 0.0000 285  ALA A O   
1741 N  N   . VAL A 308  ? 0.7290 0.7290 0.7290 0.0000 0.0000 0.0000 287  VAL A N   
1742 C  CA  . VAL A 308  ? 0.7290 0.7290 0.7290 0.0000 0.0000 0.0000 287  VAL A CA  
1743 C  C   . VAL A 308  ? 0.7290 0.7290 0.7290 0.0000 0.0000 0.0000 287  VAL A C   
1744 O  O   . VAL A 308  ? 0.7290 0.7290 0.7290 0.0000 0.0000 0.0000 287  VAL A O   
1748 N  N   . GLY A 309  ? 0.7789 0.7789 0.7789 0.0000 0.0000 0.0000 288  GLY A N   
1749 C  CA  . GLY A 309  ? 0.7789 0.7789 0.7789 0.0000 0.0000 0.0000 288  GLY A CA  
1750 C  C   . GLY A 309  ? 0.7789 0.7789 0.7789 0.0000 0.0000 0.0000 288  GLY A C   
1751 O  O   . GLY A 309  ? 0.7789 0.7789 0.7789 0.0000 0.0000 0.0000 288  GLY A O   
1752 N  N   . HIS A 310  ? 0.7303 0.7303 0.7303 0.0000 0.0000 0.0000 289  HIS A N   
1753 C  CA  . HIS A 310  ? 0.7303 0.7303 0.7303 0.0000 0.0000 0.0000 289  HIS A CA  
1754 C  C   . HIS A 310  ? 0.7303 0.7303 0.7303 0.0000 0.0000 0.0000 289  HIS A C   
1755 O  O   . HIS A 310  ? 0.7303 0.7303 0.7303 0.0000 0.0000 0.0000 289  HIS A O   
1762 N  N   . GLY A 311  ? 0.7221 0.7221 0.7221 0.0000 0.0000 0.0000 290  GLY A N   
1763 C  CA  . GLY A 311  ? 0.7221 0.7221 0.7221 0.0000 0.0000 0.0000 290  GLY A CA  
1764 C  C   . GLY A 311  ? 0.7221 0.7221 0.7221 0.0000 0.0000 0.0000 290  GLY A C   
1765 O  O   . GLY A 311  ? 0.7221 0.7221 0.7221 0.0000 0.0000 0.0000 290  GLY A O   
1766 N  N   . TYR A 312  ? 0.4983 0.4983 0.4983 0.0000 0.0000 0.0000 291  TYR A N   
1767 C  CA  . TYR A 312  ? 0.4983 0.4983 0.4983 0.0000 0.0000 0.0000 291  TYR A CA  
1768 C  C   . TYR A 312  ? 0.4983 0.4983 0.4983 0.0000 0.0000 0.0000 291  TYR A C   
1769 O  O   . TYR A 312  ? 0.4983 0.4983 0.4983 0.0000 0.0000 0.0000 291  TYR A O   
2056 N  N   . SER A 352  ? 0.5228 0.5228 0.5228 0.0000 0.0000 0.0000 331  SER A N   
2057 C  CA  . SER A 352  ? 0.5228 0.5228 0.5228 0.0000 0.0000 0.0000 331  SER A CA  
2058 C  C   . SER A 352  ? 0.5228 0.5228 0.5228 0.0000 0.0000 0.0000 331  SER A C   
2059 O  O   . SER A 352  ? 0.5228 0.5228 0.5228 0.0000 0.0000 0.0000 331  SER A O   
2062 N  N   . ARG A 353  ? 0.5029 0.5029 0.5029 0.0000 0.0000 0.0000 332  ARG A N   
2063 C  CA  . ARG A 353  ? 0.5029 0.5029 0.5029 0.0000 0.0000 0.0000 332  ARG A CA  
2064 C  C   . ARG A 353  ? 0.5029 0.5029 0.5029 0.0000 0.0000 0.0000 332  ARG A C   
2065 O  O   . ARG A 353  ? 0.5029 0.5029 0.5029 0.0000 0.0000 0.0000 332  ARG A O   
2073 N  N   . LYS A 354  ? 0.4516 0.4516 0.4516 0.0000 0.0000 0.0000 333  LYS A N   
2074 C  CA  . LYS A 354  ? 0.4516 0.4516 0.4516 0.0000 0.0000 0.0000 333  LYS A CA  
2075 C  C   . LYS A 354  ? 0.4516 0.4516 0.4516 0.0000 0.0000 0.0000 333  LYS A C   
2076 O  O   . LYS A 354  ? 0.4516 0.4516 0.4516 0.0000 0.0000 0.0000 333  LYS A O   
2082 N  N   . TYR A 355  ? 0.3969 0.3969 0.3969 0.0000 0.0000 0.0000 334  TYR A N   
2083 C  CA  . TYR A 355  ? 0.3969 0.3969 0.3969 0.0000 0.0000 0.0000 334  TYR A CA  
2084 C  C   . TYR A 355  ? 0.3969 0.3969 0.3969 0.0000 0.0000 0.0000 334  TYR A C   
2085 O  O   . TYR A 355  ? 0.3969 0.3969 0.3969 0.0000 0.0000 0.0000 334  TYR A O   
2102 N  N   . HIS A 357  ? 0.3702 0.3702 0.3702 0.0000 0.0000 0.0000 336  HIS A N   
2103 C  CA  . HIS A 357  ? 0.3702 0.3702 0.3702 0.0000 0.0000 0.0000 336  HIS A CA  
2104 C  C   . HIS A 357  ? 0.3702 0.3702 0.3702 0.0000 0.0000 0.0000 336  HIS A C   
2105 O  O   . HIS A 357  ? 0.3702 0.3702 0.3702 0.0000 0.0000 0.0000 336  HIS A O   
2112 N  N   . TRP A 358  ? 0.4938 0.4938 0.4938 0.0000 0.0000 0.0000 337  TRP A N   
2113 C  CA  . TRP A 358  ? 0.4938 0.4938 0.4938 0.0000 0.0000 0.0000 337  TRP A CA  
2114 C  C   . TRP A 358  ? 0.4938 0.4938 0.4938 0.0000 0.0000 0.0000 337  TRP A C   
2115 O  O   . TRP A 358  ? 0.4938 0.4938 0.4938 0.0000 0.0000 0.0000 337  TRP A O   
2126 N  N   . GLN A 359  ? 0.4618 0.4618 0.4618 0.0000 0.0000 0.0000 338  GLN A N   
2127 C  CA  . GLN A 359  ? 0.4618 0.4618 0.4618 0.0000 0.0000 0.0000 338  GLN A CA  
2128 C  C   . GLN A 359  ? 0.4618 0.4618 0.4618 0.0000 0.0000 0.0000 338  GLN A C   
2129 O  O   . GLN A 359  ? 0.4618 0.4618 0.4618 0.0000 0.0000 0.0000 338  GLN A O   
2135 N  N   . GLU A 360  ? 0.4504 0.4504 0.4504 0.0000 0.0000 0.0000 339  GLU A N   
2136 C  CA  . GLU A 360  ? 0.4504 0.4504 0.4504 0.0000 0.0000 0.0000 339  GLU A CA  
2137 C  C   . GLU A 360  ? 0.4504 0.4504 0.4504 0.0000 0.0000 0.0000 339  GLU A C   
2138 O  O   . GLU A 360  ? 0.4504 0.4504 0.4504 0.0000 0.0000 0.0000 339  GLU A O   
2144 N  N   . GLU A 361  ? 0.3788 0.3788 0.3788 0.0000 0.0000 0.0000 340  GLU A N   
2145 C  CA  . GLU A 361  ? 0.3788 0.3788 0.3788 0.0000 0.0000 0.0000 340  GLU A CA  
2146 C  C   . GLU A 361  ? 0.3788 0.3788 0.3788 0.0000 0.0000 0.0000 340  GLU A C   
2147 O  O   . GLU A 361  ? 0.3788 0.3788 0.3788 0.0000 0.0000 0.0000 340  GLU A O   
2153 N  N   . LEU A 362  ? 0.3065 0.3065 0.3065 0.0000 0.0000 0.0000 341  LEU A N   
2154 C  CA  . LEU A 362  ? 0.3065 0.3065 0.3065 0.0000 0.0000 0.0000 341  LEU A CA  
2155 C  C   . LEU A 362  ? 0.3065 0.3065 0.3065 0.0000 0.0000 0.0000 341  LEU A C   
2156 O  O   . LEU A 362  ? 0.3065 0.3065 0.3065 0.0000 0.0000 0.0000 341  LEU A O   
2267 N  N   . HIS A 379  ? 0.5036 0.5036 0.5036 0.0000 0.0000 0.0000 358  HIS A N   
2268 C  CA  . HIS A 379  ? 0.5036 0.5036 0.5036 0.0000 0.0000 0.0000 358  HIS A CA  
2269 C  C   . HIS A 379  ? 0.5036 0.5036 0.5036 0.0000 0.0000 0.0000 358  HIS A C   
2270 O  O   . HIS A 379  ? 0.5036 0.5036 0.5036 0.0000 0.0000 0.0000 358  HIS A O   
2277 N  N   . ALA A 380  ? 0.5674 0.5674 0.5674 0.0000 0.0000 0.0000 359  ALA A N   
2278 C  CA  . ALA A 380  ? 0.5674 0.5674 0.5674 0.0000 0.0000 0.0000 359  ALA A CA  
2279 C  C   . ALA A 380  ? 0.5674 0.5674 0.5674 0.0000 0.0000 0.0000 359  ALA A C   
2280 O  O   . ALA A 380  ? 0.5674 0.5674 0.5674 0.0000 0.0000 0.0000 359  ALA A O   
2282 N  N   . LEU A 381  ? 0.4145 0.4145 0.4145 0.0000 0.0000 0.0000 360  LEU A N   
2283 C  CA  . LEU A 381  ? 0.4145 0.4145 0.4145 0.0000 0.0000 0.0000 360  LEU A CA  
2284 C  C   . LEU A 381  ? 0.4145 0.4145 0.4145 0.0000 0.0000 0.0000 360  LEU A C   
2285 O  O   . LEU A 381  ? 0.4145 0.4145 0.4145 0.0000 0.0000 0.0000 360  LEU A O   
2290 N  N   . GLN A 382  ? 0.3141 0.3141 0.3141 0.0000 0.0000 0.0000 361  GLN A N   
2291 C  CA  . GLN A 382  ? 0.3141 0.3141 0.3141 0.0000 0.0000 0.0000 361  GLN A CA  
2292 C  C   . GLN A 382  ? 0.3141 0.3141 0.3141 0.0000 0.0000 0.0000 361  GLN A C   
2293 O  O   . GLN A 382  ? 0.3141 0.3141 0.3141 0.0000 0.0000 0.0000 361  GLN A O   
2299 N  N   . THR A 383  ? 0.2804 0.2804 0.2804 0.0000 0.0000 0.0000 362  THR A N   
2300 C  CA  . THR A 383  ? 0.2804 0.2804 0.2804 0.0000 0.0000 0.0000 362  THR A CA  
2301 C  C   . THR A 383  ? 0.2804 0.2804 0.2804 0.0000 0.0000 0.0000 362  THR A C   
2302 O  O   . THR A 383  ? 0.2804 0.2804 0.2804 0.0000 0.0000 0.0000 362  THR A O   
2306 N  N   . MET A 384  ? 0.1908 0.1908 0.1908 0.0000 0.0000 0.0000 363  MET A N   
2307 C  CA  . MET A 384  ? 0.1908 0.1908 0.1908 0.0000 0.0000 0.0000 363  MET A CA  
2308 C  C   . MET A 384  ? 0.1908 0.1908 0.1908 0.0000 0.0000 0.0000 363  MET A C   
2309 O  O   . MET A 384  ? 0.1908 0.1908 0.1908 0.0000 0.0000 0.0000 363  MET A O   
2314 N  N   . PHE A 385  ? 0.1947 0.1947 0.1947 0.0000 0.0000 0.0000 364  PHE A N   
2315 C  CA  . PHE A 385  ? 0.1947 0.1947 0.1947 0.0000 0.0000 0.0000 364  PHE A CA  
2316 C  C   . PHE A 385  ? 0.1947 0.1947 0.1947 0.0000 0.0000 0.0000 364  PHE A C   
2317 O  O   . PHE A 385  ? 0.1947 0.1947 0.1947 0.0000 0.0000 0.0000 364  PHE A O   
2565 N  N   . ALA A 413  ? 0.7885 0.7885 0.7885 0.0000 0.0000 0.0000 392  ALA A N   
2566 C  CA  . ALA A 413  ? 0.7885 0.7885 0.7885 0.0000 0.0000 0.0000 392  ALA A CA  
2567 C  C   . ALA A 413  ? 0.7885 0.7885 0.7885 0.0000 0.0000 0.0000 392  ALA A C   
2568 O  O   . ALA A 413  ? 0.7885 0.7885 0.7885 0.0000 0.0000 0.0000 392  ALA A O   
2570 N  N   . ALA A 414  ? 0.7511 0.7511 0.7511 0.0000 0.0000 0.0000 393  ALA A N   
2571 C  CA  . ALA A 414  ? 0.7511 0.7511 0.7511 0.0000 0.0000 0.0000 393  ALA A CA  
2572 C  C   . ALA A 414  ? 0.7511 0.7511 0.7511 0.0000 0.0000 0.0000 393  ALA A C   
2573 O  O   . ALA A 414  ? 0.7511 0.7511 0.7511 0.0000 0.0000 0.0000 393  ALA A O   
2575 N  N   . ALA A 415  ? 0.8669 0.8669 0.8669 0.0000 0.0000 0.0000 394  ALA A N   
2576 C  CA  . ALA A 415  ? 0.8669 0.8669 0.8669 0.0000 0.0000 0.0000 394  ALA A CA  
2577 C  C   . ALA A 415  ? 0.8669 0.8669 0.8669 0.0000 0.0000 0.0000 394  ALA A C   
2578 O  O   . ALA A 415  ? 0.8669 0.8669 0.8669 0.0000 0.0000 0.0000 394  ALA A O   
2580 N  N   . ILE A 416  ? 0.6263 0.6263 0.6263 0.0000 0.0000 0.0000 395  ILE A N   
2581 C  CA  . ILE A 416  ? 0.6263 0.6263 0.6263 0.0000 0.0000 0.0000 395  ILE A CA  
2582 C  C   . ILE A 416  ? 0.6263 0.6263 0.6263 0.0000 0.0000 0.0000 395  ILE A C   
2583 O  O   . ILE A 416  ? 0.6263 0.6263 0.6263 0.0000 0.0000 0.0000 395  ILE A O   
2588 N  N   . LEU A 417  ? 0.6662 0.6662 0.6662 0.0000 0.0000 0.0000 396  LEU A N   
2589 C  CA  . LEU A 417  ? 0.6662 0.6662 0.6662 0.0000 0.0000 0.0000 396  LEU A CA  
2590 C  C   . LEU A 417  ? 0.6662 0.6662 0.6662 0.0000 0.0000 0.0000 396  LEU A C   
2591 O  O   . LEU A 417  ? 0.6662 0.6662 0.6662 0.0000 0.0000 0.0000 396  LEU A O   
2596 N  N   . GLU A 418  ? 0.6914 0.6914 0.6914 0.0000 0.0000 0.0000 397  GLU A N   
2597 C  CA  . GLU A 418  ? 0.6914 0.6914 0.6914 0.0000 0.0000 0.0000 397  GLU A CA  
2598 C  C   . GLU A 418  ? 0.6914 0.6914 0.6914 0.0000 0.0000 0.0000 397  GLU A C   
2599 O  O   . GLU A 418  ? 0.6914 0.6914 0.6914 0.0000 0.0000 0.0000 397  GLU A O   
2605 N  N   . ALA A 419  ? 0.4879 0.4879 0.4879 0.0000 0.0000 0.0000 398  ALA A N   
2606 C  CA  . ALA A 419  ? 0.4879 0.4879 0.4879 0.0000 0.0000 0.0000 398  ALA A CA  
2607 C  C   . ALA A 419  ? 0.4879 0.4879 0.4879 0.0000 0.0000 0.0000 398  ALA A C   
2608 O  O   . ALA A 419  ? 0.4879 0.4879 0.4879 0.0000 0.0000 0.0000 398  ALA A O   
2610 N  N   . TRP A 420  ? 0.3469 0.3469 0.3469 0.0000 0.0000 0.0000 399  TRP A N   
2611 C  CA  . TRP A 420  ? 0.3469 0.3469 0.3469 0.0000 0.0000 0.0000 399  TRP A CA  
2612 C  C   . TRP A 420  ? 0.3469 0.3469 0.3469 0.0000 0.0000 0.0000 399  TRP A C   
2613 O  O   . TRP A 420  ? 0.3469 0.3469 0.3469 0.0000 0.0000 0.0000 399  TRP A O   
2624 N  N   . GLN A 421  ? 0.4024 0.4024 0.4024 0.0000 0.0000 0.0000 400  GLN A N   
2625 C  CA  . GLN A 421  ? 0.4024 0.4024 0.4024 0.0000 0.0000 0.0000 400  GLN A CA  
2626 C  C   . GLN A 421  ? 0.4024 0.4024 0.4024 0.0000 0.0000 0.0000 400  GLN A C   
2627 O  O   . GLN A 421  ? 0.4024 0.4024 0.4024 0.0000 0.0000 0.0000 400  GLN A O   
2633 N  N   . ARG A 422  ? 0.5072 0.5072 0.5072 0.0000 0.0000 0.0000 401  ARG A N   
2634 C  CA  . ARG A 422  ? 0.5072 0.5072 0.5072 0.0000 0.0000 0.0000 401  ARG A CA  
2635 C  C   . ARG A 422  ? 0.5072 0.5072 0.5072 0.0000 0.0000 0.0000 401  ARG A C   
2636 O  O   . ARG A 422  ? 0.5072 0.5072 0.5072 0.0000 0.0000 0.0000 401  ARG A O   
2644 N  N   . THR A 423  ? 0.3589 0.3589 0.3589 0.0000 0.0000 0.0000 402  THR A N   
2645 C  CA  . THR A 423  ? 0.3589 0.3589 0.3589 0.0000 0.0000 0.0000 402  THR A CA  
2646 C  C   . THR A 423  ? 0.3589 0.3589 0.3589 0.0000 0.0000 0.0000 402  THR A C   
2647 O  O   . THR A 423  ? 0.3589 0.3589 0.3589 0.0000 0.0000 0.0000 402  THR A O   
2651 N  N   . TYR A 424  ? 0.3982 0.3982 0.3982 0.0000 0.0000 0.0000 403  TYR A N   
2652 C  CA  . TYR A 424  ? 0.3982 0.3982 0.3982 0.0000 0.0000 0.0000 403  TYR A CA  
2653 C  C   . TYR A 424  ? 0.3982 0.3982 0.3982 0.0000 0.0000 0.0000 403  TYR A C   
2654 O  O   . TYR A 424  ? 0.3982 0.3982 0.3982 0.0000 0.0000 0.0000 403  TYR A O   
2663 N  N   . VAL A 425  ? 0.4265 0.4265 0.4265 0.0000 0.0000 0.0000 404  VAL A N   
2664 C  CA  . VAL A 425  ? 0.4265 0.4265 0.4265 0.0000 0.0000 0.0000 404  VAL A CA  
2665 C  C   . VAL A 425  ? 0.4265 0.4265 0.4265 0.0000 0.0000 0.0000 404  VAL A C   
2666 O  O   . VAL A 425  ? 0.4265 0.4265 0.4265 0.0000 0.0000 0.0000 404  VAL A O   
2670 N  N   . GLU A 426  ? 0.6565 0.6565 0.6565 0.0000 0.0000 0.0000 405  GLU A N   
2671 C  CA  . GLU A 426  ? 0.6565 0.6565 0.6565 0.0000 0.0000 0.0000 405  GLU A CA  
2672 C  C   . GLU A 426  ? 0.6565 0.6565 0.6565 0.0000 0.0000 0.0000 405  GLU A C   
2673 O  O   . GLU A 426  ? 0.6565 0.6565 0.6565 0.0000 0.0000 0.0000 405  GLU A O   
2679 N  N   . VAL A 427  ? 0.5598 0.5598 0.5598 0.0000 0.0000 0.0000 406  VAL A N   
2680 C  CA  . VAL A 427  ? 0.5598 0.5598 0.5598 0.0000 0.0000 0.0000 406  VAL A CA  
2681 C  C   . VAL A 427  ? 0.5598 0.5598 0.5598 0.0000 0.0000 0.0000 406  VAL A C   
2682 O  O   . VAL A 427  ? 0.5598 0.5598 0.5598 0.0000 0.0000 0.0000 406  VAL A O   
2686 N  N   . VAL A 428  ? 0.5754 0.5754 0.5754 0.0000 0.0000 0.0000 407  VAL A N   
2687 C  CA  . VAL A 428  ? 0.5754 0.5754 0.5754 0.0000 0.0000 0.0000 407  VAL A CA  
2688 C  C   . VAL A 428  ? 0.5754 0.5754 0.5754 0.0000 0.0000 0.0000 407  VAL A C   
2689 O  O   . VAL A 428  ? 0.5754 0.5754 0.5754 0.0000 0.0000 0.0000 407  VAL A O   
2693 N  N   . HIS A 429  ? 0.6335 0.6335 0.6335 0.0000 0.0000 0.0000 408  HIS A N   
2694 C  CA  . HIS A 429  ? 0.6335 0.6335 0.6335 0.0000 0.0000 0.0000 408  HIS A CA  
2695 C  C   . HIS A 429  ? 0.6335 0.6335 0.6335 0.0000 0.0000 0.0000 408  HIS A C   
2696 O  O   . HIS A 429  ? 0.6335 0.6335 0.6335 0.0000 0.0000 0.0000 408  HIS A O   
2703 N  N   . GLN A 430  ? 0.6432 0.6432 0.6432 0.0000 0.0000 0.0000 409  GLN A N   
2704 C  CA  . GLN A 430  ? 0.6432 0.6432 0.6432 0.0000 0.0000 0.0000 409  GLN A CA  
2705 C  C   . GLN A 430  ? 0.6432 0.6432 0.6432 0.0000 0.0000 0.0000 409  GLN A C   
2706 O  O   . GLN A 430  ? 0.6432 0.6432 0.6432 0.0000 0.0000 0.0000 409  GLN A O   
2712 N  N   . SER A 431  ? 0.7705 0.7705 0.7705 0.0000 0.0000 0.0000 410  SER A N   
2713 C  CA  . SER A 431  ? 0.7705 0.7705 0.7705 0.0000 0.0000 0.0000 410  SER A CA  
2714 C  C   . SER A 431  ? 0.7705 0.7705 0.7705 0.0000 0.0000 0.0000 410  SER A C   
2715 O  O   . SER A 431  ? 0.7705 0.7705 0.7705 0.0000 0.0000 0.0000 410  SER A O   
2718 N  N   . VAL A 432  ? 0.9121 0.9121 0.9121 0.0000 0.0000 0.0000 411  VAL A N   
2719 C  CA  . VAL A 432  ? 0.9121 0.9121 0.9121 0.0000 0.0000 0.0000 411  VAL A CA  
2720 C  C   . VAL A 432  ? 0.9121 0.9121 0.9121 0.0000 0.0000 0.0000 411  VAL A C   
2721 O  O   . VAL A 432  ? 0.9121 0.9121 0.9121 0.0000 0.0000 0.0000 411  VAL A O   
2739 N  N   . ASN A 435  ? 1.0297 1.0297 1.0297 0.0000 0.0000 0.0000 414  ASN A N   
2740 C  CA  . ASN A 435  ? 1.0297 1.0297 1.0297 0.0000 0.0000 0.0000 414  ASN A CA  
2741 C  C   . ASN A 435  ? 1.0297 1.0297 1.0297 0.0000 0.0000 0.0000 414  ASN A C   
2742 O  O   . ASN A 435  ? 1.0297 1.0297 1.0297 0.0000 0.0000 0.0000 414  ASN A O   
2747 N  N   . SER A 436  ? 0.9783 0.9783 0.9783 0.0000 0.0000 0.0000 415  SER A N   
2748 C  CA  . SER A 436  ? 0.9783 0.9783 0.9783 0.0000 0.0000 0.0000 415  SER A CA  
2749 C  C   . SER A 436  ? 0.9783 0.9783 0.9783 0.0000 0.0000 0.0000 415  SER A C   
2750 O  O   . SER A 436  ? 0.9783 0.9783 0.9783 0.0000 0.0000 0.0000 415  SER A O   
2778 N  N   . VAL A 440  ? 0.7000 0.7000 0.7000 0.0000 0.0000 0.0000 419  VAL A N   
2779 C  CA  . VAL A 440  ? 0.7000 0.7000 0.7000 0.0000 0.0000 0.0000 419  VAL A CA  
2780 C  C   . VAL A 440  ? 0.7000 0.7000 0.7000 0.0000 0.0000 0.0000 419  VAL A C   
2781 O  O   . VAL A 440  ? 0.7000 0.7000 0.7000 0.0000 0.0000 0.0000 419  VAL A O   
2785 N  N   . LEU A 441  ? 0.4742 0.4742 0.4742 0.0000 0.0000 0.0000 420  LEU A N   
2786 C  CA  . LEU A 441  ? 0.4742 0.4742 0.4742 0.0000 0.0000 0.0000 420  LEU A CA  
2787 C  C   . LEU A 441  ? 0.4742 0.4742 0.4742 0.0000 0.0000 0.0000 420  LEU A C   
2788 O  O   . LEU A 441  ? 0.4742 0.4742 0.4742 0.0000 0.0000 0.0000 420  LEU A O   
2793 N  N   . SER A 442  ? 0.3724 0.3724 0.3724 0.0000 0.0000 0.0000 421  SER A N   
2794 C  CA  . SER A 442  ? 0.3724 0.3724 0.3724 0.0000 0.0000 0.0000 421  SER A CA  
2795 C  C   . SER A 442  ? 0.3724 0.3724 0.3724 0.0000 0.0000 0.0000 421  SER A C   
2796 O  O   . SER A 442  ? 0.3724 0.3724 0.3724 0.0000 0.0000 0.0000 421  SER A O   
2799 N  N   . PHE A 443  ? 0.3736 0.3736 0.3736 0.0000 0.0000 0.0000 422  PHE A N   
2800 C  CA  . PHE A 443  ? 0.3736 0.3736 0.3736 0.0000 0.0000 0.0000 422  PHE A CA  
2801 C  C   . PHE A 443  ? 0.3736 0.3736 0.3736 0.0000 0.0000 0.0000 422  PHE A C   
2802 O  O   . PHE A 443  ? 0.3736 0.3736 0.3736 0.0000 0.0000 0.0000 422  PHE A O   
2810 N  N   . THR A 444  ? 0.5349 0.5349 0.5349 0.0000 0.0000 0.0000 423  THR A N   
2811 C  CA  . THR A 444  ? 0.5349 0.5349 0.5349 0.0000 0.0000 0.0000 423  THR A CA  
2812 C  C   . THR A 444  ? 0.5349 0.5349 0.5349 0.0000 0.0000 0.0000 423  THR A C   
2813 O  O   . THR A 444  ? 0.5349 0.5349 0.5349 0.0000 0.0000 0.0000 423  THR A O   
4741 N  N   . SER A 820  ? 0.6260 0.6260 0.6260 0.0000 0.0000 0.0000 799  SER A N   
4742 C  CA  . SER A 820  ? 0.6260 0.6260 0.6260 0.0000 0.0000 0.0000 799  SER A CA  
4743 C  C   . SER A 820  ? 0.6260 0.6260 0.6260 0.0000 0.0000 0.0000 799  SER A C   
4744 O  O   . SER A 820  ? 0.6260 0.6260 0.6260 0.0000 0.0000 0.0000 799  SER A O   
4747 N  N   . PHE A 821  ? 0.5064 0.5064 0.5064 0.0000 0.0000 0.0000 800  PHE A N   
4748 C  CA  . PHE A 821  ? 0.5064 0.5064 0.5064 0.0000 0.0000 0.0000 800  PHE A CA  
4749 C  C   . PHE A 821  ? 0.5064 0.5064 0.5064 0.0000 0.0000 0.0000 800  PHE A C   
4750 O  O   . PHE A 821  ? 0.5064 0.5064 0.5064 0.0000 0.0000 0.0000 800  PHE A O   
4758 N  N   . TYR A 822  ? 0.3334 0.3334 0.3334 0.0000 0.0000 0.0000 801  TYR A N   
4759 C  CA  . TYR A 822  ? 0.3334 0.3334 0.3334 0.0000 0.0000 0.0000 801  TYR A CA  
4760 C  C   . TYR A 822  ? 0.3334 0.3334 0.3334 0.0000 0.0000 0.0000 801  TYR A C   
4761 O  O   . TYR A 822  ? 0.3334 0.3334 0.3334 0.0000 0.0000 0.0000 801  TYR A O   
4770 N  N   . ASN A 823  ? 0.2439 0.2439 0.2439 0.0000 0.0000 0.0000 802  ASN A N   
4771 C  CA  . ASN A 823  ? 0.2439 0.2439 0.2439 0.0000 0.0000 0.0000 802  ASN A CA  
4772 C  C   . ASN A 823  ? 0.2439 0.2439 0.2439 0.0000 0.0000 0.0000 802  ASN A C   
4773 O  O   . ASN A 823  ? 0.2439 0.2439 0.2439 0.0000 0.0000 0.0000 802  ASN A O   
4778 N  N   . MET A 824  ? 0.2366 0.2366 0.2366 0.0000 0.0000 0.0000 803  MET A N   
4779 C  CA  . MET A 824  ? 0.2366 0.2366 0.2366 0.0000 0.0000 0.0000 803  MET A CA  
4780 C  C   . MET A 824  ? 0.2366 0.2366 0.2366 0.0000 0.0000 0.0000 803  MET A C   
4781 O  O   . MET A 824  ? 0.2366 0.2366 0.2366 0.0000 0.0000 0.0000 803  MET A O   
4786 N  N   . TYR A 825  ? 0.2779 0.2779 0.2779 0.0000 0.0000 0.0000 804  TYR A N   
4787 C  CA  . TYR A 825  ? 0.2779 0.2779 0.2779 0.0000 0.0000 0.0000 804  TYR A CA  
4788 C  C   . TYR A 825  ? 0.2779 0.2779 0.2779 0.0000 0.0000 0.0000 804  TYR A C   
4789 O  O   . TYR A 825  ? 0.2779 0.2779 0.2779 0.0000 0.0000 0.0000 804  TYR A O   
4798 N  N   . ILE A 826  ? 0.1819 0.1819 0.1819 0.0000 0.0000 0.0000 805  ILE A N   
4799 C  CA  . ILE A 826  ? 0.1819 0.1819 0.1819 0.0000 0.0000 0.0000 805  ILE A CA  
4800 C  C   . ILE A 826  ? 0.1819 0.1819 0.1819 0.0000 0.0000 0.0000 805  ILE A C   
4801 O  O   . ILE A 826  ? 0.1819 0.1819 0.1819 0.0000 0.0000 0.0000 805  ILE A O   
4806 N  N   . VAL A 827  ? 0.1693 0.1693 0.1693 0.0000 0.0000 0.0000 806  VAL A N   
4807 C  CA  . VAL A 827  ? 0.1693 0.1693 0.1693 0.0000 0.0000 0.0000 806  VAL A CA  
4808 C  C   . VAL A 827  ? 0.1693 0.1693 0.1693 0.0000 0.0000 0.0000 806  VAL A C   
4809 O  O   . VAL A 827  ? 0.1693 0.1693 0.1693 0.0000 0.0000 0.0000 806  VAL A O   
4813 N  N   . THR A 828  ? 0.3493 0.3493 0.3493 0.0000 0.0000 0.0000 807  THR A N   
4814 C  CA  . THR A 828  ? 0.3493 0.3493 0.3493 0.0000 0.0000 0.0000 807  THR A CA  
4815 C  C   . THR A 828  ? 0.3493 0.3493 0.3493 0.0000 0.0000 0.0000 807  THR A C   
4816 O  O   . THR A 828  ? 0.3493 0.3493 0.3493 0.0000 0.0000 0.0000 807  THR A O   
4820 N  N   . GLN A 829  ? 0.6157 0.6157 0.6157 0.0000 0.0000 0.0000 808  GLN A N   
4821 C  CA  . GLN A 829  ? 0.6157 0.6157 0.6157 0.0000 0.0000 0.0000 808  GLN A CA  
4822 C  C   . GLN A 829  ? 0.6157 0.6157 0.6157 0.0000 0.0000 0.0000 808  GLN A C   
4823 O  O   . GLN A 829  ? 0.6157 0.6157 0.6157 0.0000 0.0000 0.0000 808  GLN A O   
4829 N  N   . LYS A 830  ? 0.5095 0.5095 0.5095 0.0000 0.0000 0.0000 809  LYS A N   
4830 C  CA  . LYS A 830  ? 0.5095 0.5095 0.5095 0.0000 0.0000 0.0000 809  LYS A CA  
4831 C  C   . LYS A 830  ? 0.5095 0.5095 0.5095 0.0000 0.0000 0.0000 809  LYS A C   
4832 O  O   . LYS A 830  ? 0.5095 0.5095 0.5095 0.0000 0.0000 0.0000 809  LYS A O   
5111 N  N   . LYS A 863  ? 0.4442 0.4442 0.4442 0.0000 0.0000 0.0000 842  LYS A N   
5112 C  CA  . LYS A 863  ? 0.4442 0.4442 0.4442 0.0000 0.0000 0.0000 842  LYS A CA  
5113 C  C   . LYS A 863  ? 0.4442 0.4442 0.4442 0.0000 0.0000 0.0000 842  LYS A C   
5114 O  O   . LYS A 863  ? 0.4442 0.4442 0.4442 0.0000 0.0000 0.0000 842  LYS A O   
5120 N  N   . MET A 864  ? 0.4510 0.4510 0.4510 0.0000 0.0000 0.0000 843  MET A N   
5121 C  CA  . MET A 864  ? 0.4510 0.4510 0.4510 0.0000 0.0000 0.0000 843  MET A CA  
5122 C  C   . MET A 864  ? 0.4510 0.4510 0.4510 0.0000 0.0000 0.0000 843  MET A C   
5123 O  O   . MET A 864  ? 0.4510 0.4510 0.4510 0.0000 0.0000 0.0000 843  MET A O   
5128 N  N   . TRP A 865  ? 0.3216 0.3216 0.3216 0.0000 0.0000 0.0000 844  TRP A N   
5129 C  CA  . TRP A 865  ? 0.3216 0.3216 0.3216 0.0000 0.0000 0.0000 844  TRP A CA  
5130 C  C   . TRP A 865  ? 0.3216 0.3216 0.3216 0.0000 0.0000 0.0000 844  TRP A C   
5131 O  O   . TRP A 865  ? 0.3216 0.3216 0.3216 0.0000 0.0000 0.0000 844  TRP A O   
5142 N  N   . LEU A 866  ? 0.3994 0.3994 0.3994 0.0000 0.0000 0.0000 845  LEU A N   
5143 C  CA  . LEU A 866  ? 0.3994 0.3994 0.3994 0.0000 0.0000 0.0000 845  LEU A CA  
5144 C  C   . LEU A 866  ? 0.3994 0.3994 0.3994 0.0000 0.0000 0.0000 845  LEU A C   
5145 O  O   . LEU A 866  ? 0.3994 0.3994 0.3994 0.0000 0.0000 0.0000 845  LEU A O   
5150 N  N   . HIS A 867  ? 0.2582 0.2582 0.2582 0.0000 0.0000 0.0000 846  HIS A N   
5151 C  CA  . HIS A 867  ? 0.2582 0.2582 0.2582 0.0000 0.0000 0.0000 846  HIS A CA  
5152 C  C   . HIS A 867  ? 0.2582 0.2582 0.2582 0.0000 0.0000 0.0000 846  HIS A C   
5153 O  O   . HIS A 867  ? 0.2582 0.2582 0.2582 0.0000 0.0000 0.0000 846  HIS A O   
5160 N  N   . TYR A 868  ? 0.2045 0.2045 0.2045 0.0000 0.0000 0.0000 847  TYR A N   
5161 C  CA  . TYR A 868  ? 0.2045 0.2045 0.2045 0.0000 0.0000 0.0000 847  TYR A CA  
5162 C  C   . TYR A 868  ? 0.2045 0.2045 0.2045 0.0000 0.0000 0.0000 847  TYR A C   
5163 O  O   . TYR A 868  ? 0.2045 0.2045 0.2045 0.0000 0.0000 0.0000 847  TYR A O   
5172 N  N   . PHE A 869  ? 0.2397 0.2397 0.2397 0.0000 0.0000 0.0000 848  PHE A N   
5173 C  CA  . PHE A 869  ? 0.2397 0.2397 0.2397 0.0000 0.0000 0.0000 848  PHE A CA  
5174 C  C   . PHE A 869  ? 0.2397 0.2397 0.2397 0.0000 0.0000 0.0000 848  PHE A C   
5175 O  O   . PHE A 869  ? 0.2397 0.2397 0.2397 0.0000 0.0000 0.0000 848  PHE A O   
5183 N  N   . ARG A 870  ? 0.3306 0.3306 0.3306 0.0000 0.0000 0.0000 849  ARG A N   
5184 C  CA  . ARG A 870  ? 0.3306 0.3306 0.3306 0.0000 0.0000 0.0000 849  ARG A CA  
5185 C  C   . ARG A 870  ? 0.3306 0.3306 0.3306 0.0000 0.0000 0.0000 849  ARG A C   
5186 O  O   . ARG A 870  ? 0.3306 0.3306 0.3306 0.0000 0.0000 0.0000 849  ARG A O   
5194 N  N   . ASP A 871  ? 0.4515 0.4515 0.4515 0.0000 0.0000 0.0000 850  ASP A N   
5195 C  CA  . ASP A 871  ? 0.4515 0.4515 0.4515 0.0000 0.0000 0.0000 850  ASP A CA  
5196 C  C   . ASP A 871  ? 0.4515 0.4515 0.4515 0.0000 0.0000 0.0000 850  ASP A C   
5197 O  O   . ASP A 871  ? 0.4515 0.4515 0.4515 0.0000 0.0000 0.0000 850  ASP A O   
5202 N  N   . TRP A 872  ? 0.2482 0.2482 0.2482 0.0000 0.0000 0.0000 851  TRP A N   
5203 C  CA  . TRP A 872  ? 0.2482 0.2482 0.2482 0.0000 0.0000 0.0000 851  TRP A CA  
5204 C  C   . TRP A 872  ? 0.2482 0.2482 0.2482 0.0000 0.0000 0.0000 851  TRP A C   
5205 O  O   . TRP A 872  ? 0.2482 0.2482 0.2482 0.0000 0.0000 0.0000 851  TRP A O   
5216 N  N   . LEU A 873  ? 0.2540 0.2540 0.2540 0.0000 0.0000 0.0000 852  LEU A N   
5217 C  CA  . LEU A 873  ? 0.2540 0.2540 0.2540 0.0000 0.0000 0.0000 852  LEU A CA  
5218 C  C   . LEU A 873  ? 0.2540 0.2540 0.2540 0.0000 0.0000 0.0000 852  LEU A C   
5219 O  O   . LEU A 873  ? 0.2540 0.2540 0.2540 0.0000 0.0000 0.0000 852  LEU A O   
5224 N  N   . GLN A 874  ? 0.4378 0.4378 0.4378 0.0000 0.0000 0.0000 853  GLN A N   
5225 C  CA  . GLN A 874  ? 0.4378 0.4378 0.4378 0.0000 0.0000 0.0000 853  GLN A CA  
5226 C  C   . GLN A 874  ? 0.4378 0.4378 0.4378 0.0000 0.0000 0.0000 853  GLN A C   
5227 O  O   . GLN A 874  ? 0.4378 0.4378 0.4378 0.0000 0.0000 0.0000 853  GLN A O   
5233 N  N   . GLY A 875  ? 0.5303 0.5303 0.5303 0.0000 0.0000 0.0000 854  GLY A N   
5234 C  CA  . GLY A 875  ? 0.5303 0.5303 0.5303 0.0000 0.0000 0.0000 854  GLY A CA  
5235 C  C   . GLY A 875  ? 0.5303 0.5303 0.5303 0.0000 0.0000 0.0000 854  GLY A C   
5236 O  O   . GLY A 875  ? 0.5303 0.5303 0.5303 0.0000 0.0000 0.0000 854  GLY A O   
5237 N  N   . LEU A 876  ? 0.4709 0.4709 0.4709 0.0000 0.0000 0.0000 855  LEU A N   
5238 C  CA  . LEU A 876  ? 0.4709 0.4709 0.4709 0.0000 0.0000 0.0000 855  LEU A CA  
5239 C  C   . LEU A 876  ? 0.4709 0.4709 0.4709 0.0000 0.0000 0.0000 855  LEU A C   
5240 O  O   . LEU A 876  ? 0.4709 0.4709 0.4709 0.0000 0.0000 0.0000 855  LEU A O   
5245 N  N   . GLN A 877  ? 0.5748 0.5748 0.5748 0.0000 0.0000 0.0000 856  GLN A N   
5246 C  CA  . GLN A 877  ? 0.5748 0.5748 0.5748 0.0000 0.0000 0.0000 856  GLN A CA  
5247 C  C   . GLN A 877  ? 0.5748 0.5748 0.5748 0.0000 0.0000 0.0000 856  GLN A C   
5248 O  O   . GLN A 877  ? 0.5748 0.5748 0.5748 0.0000 0.0000 0.0000 856  GLN A O   
5254 N  N   . ASP A 878  ? 0.7185 0.7185 0.7185 0.0000 0.0000 0.0000 857  ASP A N   
5255 C  CA  . ASP A 878  ? 0.7185 0.7185 0.7185 0.0000 0.0000 0.0000 857  ASP A CA  
5256 C  C   . ASP A 878  ? 0.7185 0.7185 0.7185 0.0000 0.0000 0.0000 857  ASP A C   
5257 O  O   . ASP A 878  ? 0.7185 0.7185 0.7185 0.0000 0.0000 0.0000 857  ASP A O   
5262 N  N   . ALA A 879  ? 0.6744 0.6744 0.6744 0.0000 0.0000 0.0000 858  ALA A N   
5263 C  CA  . ALA A 879  ? 0.6744 0.6744 0.6744 0.0000 0.0000 0.0000 858  ALA A CA  
5264 C  C   . ALA A 879  ? 0.6744 0.6744 0.6744 0.0000 0.0000 0.0000 858  ALA A C   
5265 O  O   . ALA A 879  ? 0.6744 0.6744 0.6744 0.0000 0.0000 0.0000 858  ALA A O   
5267 N  N   . PHE A 880  ? 0.5664 0.5664 0.5664 0.0000 0.0000 0.0000 859  PHE A N   
5268 C  CA  . PHE A 880  ? 0.5664 0.5664 0.5664 0.0000 0.0000 0.0000 859  PHE A CA  
5269 C  C   . PHE A 880  ? 0.5664 0.5664 0.5664 0.0000 0.0000 0.0000 859  PHE A C   
5270 O  O   . PHE A 880  ? 0.5664 0.5664 0.5664 0.0000 0.0000 0.0000 859  PHE A O   
5278 N  N   . ASP A 881  ? 0.8821 0.8821 0.8821 0.0000 0.0000 0.0000 860  ASP A N   
5279 C  CA  . ASP A 881  ? 0.8821 0.8821 0.8821 0.0000 0.0000 0.0000 860  ASP A CA  
5280 C  C   . ASP A 881  ? 0.8821 0.8821 0.8821 0.0000 0.0000 0.0000 860  ASP A C   
5281 O  O   . ASP A 881  ? 0.8821 0.8821 0.8821 0.0000 0.0000 0.0000 860  ASP A O   
5286 N  N   . SER A 882  ? 0.9966 0.9966 0.9966 0.0000 0.0000 0.0000 861  SER A N   
5287 C  CA  . SER A 882  ? 0.9966 0.9966 0.9966 0.0000 0.0000 0.0000 861  SER A CA  
5288 C  C   . SER A 882  ? 0.9966 0.9966 0.9966 0.0000 0.0000 0.0000 861  SER A C   
5289 O  O   . SER A 882  ? 0.9966 0.9966 0.9966 0.0000 0.0000 0.0000 861  SER A O   
5292 N  N   . ASP A 883  ? 1.1571 1.1571 1.1571 0.0000 0.0000 0.0000 862  ASP A N   
5293 C  CA  . ASP A 883  ? 1.1571 1.1571 1.1571 0.0000 0.0000 0.0000 862  ASP A CA  
5294 C  C   . ASP A 883  ? 1.1571 1.1571 1.1571 0.0000 0.0000 0.0000 862  ASP A C   
5295 O  O   . ASP A 883  ? 1.1571 1.1571 1.1571 0.0000 0.0000 0.0000 862  ASP A O   
5300 N  N   . TRP A 884  ? 0.9755 0.9755 0.9755 0.0000 0.0000 0.0000 863  TRP A N   
5301 C  CA  . TRP A 884  ? 0.9755 0.9755 0.9755 0.0000 0.0000 0.0000 863  TRP A CA  
5302 C  C   . TRP A 884  ? 0.9755 0.9755 0.9755 0.0000 0.0000 0.0000 863  TRP A C   
5303 O  O   . TRP A 884  ? 0.9755 0.9755 0.9755 0.0000 0.0000 0.0000 863  TRP A O   
5461 N  N   . TYR A 905  ? 0.5844 0.5844 0.5844 0.0000 0.0000 0.0000 884  TYR A N   
5462 C  CA  . TYR A 905  ? 0.5844 0.5844 0.5844 0.0000 0.0000 0.0000 884  TYR A CA  
5463 C  C   . TYR A 905  ? 0.5844 0.5844 0.5844 0.0000 0.0000 0.0000 884  TYR A C   
5464 O  O   . TYR A 905  ? 0.5844 0.5844 0.5844 0.0000 0.0000 0.0000 884  TYR A O   
5473 N  N   . LYS A 906  ? 0.4041 0.4041 0.4041 0.0000 0.0000 0.0000 885  LYS A N   
5474 C  CA  . LYS A 906  ? 0.4041 0.4041 0.4041 0.0000 0.0000 0.0000 885  LYS A CA  
5475 C  C   . LYS A 906  ? 0.4041 0.4041 0.4041 0.0000 0.0000 0.0000 885  LYS A C   
5476 O  O   . LYS A 906  ? 0.4041 0.4041 0.4041 0.0000 0.0000 0.0000 885  LYS A O   
5482 N  N   . LEU A 907  ? 0.5381 0.5381 0.5381 0.0000 0.0000 0.0000 886  LEU A N   
5483 C  CA  . LEU A 907  ? 0.5381 0.5381 0.5381 0.0000 0.0000 0.0000 886  LEU A CA  
5484 C  C   . LEU A 907  ? 0.5381 0.5381 0.5381 0.0000 0.0000 0.0000 886  LEU A C   
5485 O  O   . LEU A 907  ? 0.5381 0.5381 0.5381 0.0000 0.0000 0.0000 886  LEU A O   
5498 N  N   . VAL A 909  ? 0.6261 0.6261 0.6261 0.0000 0.0000 0.0000 888  VAL A N   
5499 C  CA  . VAL A 909  ? 0.6261 0.6261 0.6261 0.0000 0.0000 0.0000 888  VAL A CA  
5500 C  C   . VAL A 909  ? 0.6261 0.6261 0.6261 0.0000 0.0000 0.0000 888  VAL A C   
5501 O  O   . VAL A 909  ? 0.6261 0.6261 0.6261 0.0000 0.0000 0.0000 888  VAL A O   
5505 N  N   . GLN A 910  ? 0.6967 0.6967 0.6967 0.0000 0.0000 0.0000 889  GLN A N   
5506 C  CA  . GLN A 910  ? 0.6967 0.6967 0.6967 0.0000 0.0000 0.0000 889  GLN A CA  
5507 C  C   . GLN A 910  ? 0.6967 0.6967 0.6967 0.0000 0.0000 0.0000 889  GLN A C   
5508 O  O   . GLN A 910  ? 0.6967 0.6967 0.6967 0.0000 0.0000 0.0000 889  GLN A O   
5514 N  N   . THR A 911  ? 0.9012 0.9012 0.9012 0.0000 0.0000 0.0000 890  THR A N   
5515 C  CA  . THR A 911  ? 0.9012 0.9012 0.9012 0.0000 0.0000 0.0000 890  THR A CA  
5516 C  C   . THR A 911  ? 0.9012 0.9012 0.9012 0.0000 0.0000 0.0000 890  THR A C   
5517 O  O   . THR A 911  ? 0.9012 0.9012 0.9012 0.0000 0.0000 0.0000 890  THR A O   
5525 N  N   . SER A 913  ? 1.1700 1.1700 1.1700 0.0000 0.0000 0.0000 892  SER A N   
5526 C  CA  . SER A 913  ? 1.1700 1.1700 1.1700 0.0000 0.0000 0.0000 892  SER A CA  
5527 C  C   . SER A 913  ? 1.1700 1.1700 1.1700 0.0000 0.0000 0.0000 892  SER A C   
5528 O  O   . SER A 913  ? 1.1700 1.1700 1.1700 0.0000 0.0000 0.0000 892  SER A O   
5605 N  N   . LEU A 923  ? 1.0367 1.0367 1.0367 0.0000 0.0000 0.0000 902  LEU A N   
5606 C  CA  . LEU A 923  ? 1.0367 1.0367 1.0367 0.0000 0.0000 0.0000 902  LEU A CA  
5607 C  C   . LEU A 923  ? 1.0367 1.0367 1.0367 0.0000 0.0000 0.0000 902  LEU A C   
5608 O  O   . LEU A 923  ? 1.0367 1.0367 1.0367 0.0000 0.0000 0.0000 902  LEU A O   
5613 N  N   . THR A 924  ? 1.1464 1.1464 1.1464 0.0000 0.0000 0.0000 903  THR A N   
5614 C  CA  . THR A 924  ? 1.1464 1.1464 1.1464 0.0000 0.0000 0.0000 903  THR A CA  
5615 C  C   . THR A 924  ? 1.1464 1.1464 1.1464 0.0000 0.0000 0.0000 903  THR A C   
5616 O  O   . THR A 924  ? 1.1464 1.1464 1.1464 0.0000 0.0000 0.0000 903  THR A O   
5620 N  N   . LYS A 925  ? 0.9527 0.9527 0.9527 0.0000 0.0000 0.0000 904  LYS A N   
5621 C  CA  . LYS A 925  ? 0.9527 0.9527 0.9527 0.0000 0.0000 0.0000 904  LYS A CA  
5622 C  C   . LYS A 925  ? 0.9527 0.9527 0.9527 0.0000 0.0000 0.0000 904  LYS A C   
5623 O  O   . LYS A 925  ? 0.9527 0.9527 0.9527 0.0000 0.0000 0.0000 904  LYS A O   
5629 N  N   . GLN A 926  ? 0.8681 0.8681 0.8681 0.0000 0.0000 0.0000 905  GLN A N   
5630 C  CA  . GLN A 926  ? 0.8681 0.8681 0.8681 0.0000 0.0000 0.0000 905  GLN A CA  
5631 C  C   . GLN A 926  ? 0.8681 0.8681 0.8681 0.0000 0.0000 0.0000 905  GLN A C   
5632 O  O   . GLN A 926  ? 0.8681 0.8681 0.8681 0.0000 0.0000 0.0000 905  GLN A O   
5638 N  N   . ARG A 927  ? 0.6965 0.6965 0.6965 0.0000 0.0000 0.0000 906  ARG A N   
5639 C  CA  . ARG A 927  ? 0.6965 0.6965 0.6965 0.0000 0.0000 0.0000 906  ARG A CA  
5640 C  C   . ARG A 927  ? 0.6965 0.6965 0.6965 0.0000 0.0000 0.0000 906  ARG A C   
5641 O  O   . ARG A 927  ? 0.6965 0.6965 0.6965 0.0000 0.0000 0.0000 906  ARG A O   
5657 N  N   . VAL A 929  ? 0.6794 0.6794 0.6794 0.0000 0.0000 0.0000 908  VAL A N   
5658 C  CA  . VAL A 929  ? 0.6794 0.6794 0.6794 0.0000 0.0000 0.0000 908  VAL A CA  
5659 C  C   . VAL A 929  ? 0.6794 0.6794 0.6794 0.0000 0.0000 0.0000 908  VAL A C   
5660 O  O   . VAL A 929  ? 0.6794 0.6794 0.6794 0.0000 0.0000 0.0000 908  VAL A O   
5664 N  N   . ASP A 930  ? 0.9819 0.9819 0.9819 0.0000 0.0000 0.0000 909  ASP A N   
5665 C  CA  . ASP A 930  ? 0.9819 0.9819 0.9819 0.0000 0.0000 0.0000 909  ASP A CA  
5666 C  C   . ASP A 930  ? 0.9819 0.9819 0.9819 0.0000 0.0000 0.0000 909  ASP A C   
5667 O  O   . ASP A 930  ? 0.9819 0.9819 0.9819 0.0000 0.0000 0.0000 909  ASP A O   
5672 N  N   . ALA A 931  ? 1.4471 1.4471 1.4471 0.0000 0.0000 0.0000 910  ALA A N   
5673 C  CA  . ALA A 931  ? 1.4471 1.4471 1.4471 0.0000 0.0000 0.0000 910  ALA A CA  
5674 C  C   . ALA A 931  ? 1.4471 1.4471 1.4471 0.0000 0.0000 0.0000 910  ALA A C   
5675 O  O   . ALA A 931  ? 1.4471 1.4471 1.4471 0.0000 0.0000 0.0000 910  ALA A O   
5677 N  N   . ASP A 932  ? 1.3130 1.3130 1.3130 0.0000 0.0000 0.0000 911  ASP A N   
5678 C  CA  . ASP A 932  ? 1.3130 1.3130 1.3130 0.0000 0.0000 0.0000 911  ASP A CA  
5679 C  C   . ASP A 932  ? 1.3130 1.3130 1.3130 0.0000 0.0000 0.0000 911  ASP A C   
5680 O  O   . ASP A 932  ? 1.3130 1.3130 1.3130 0.0000 0.0000 0.0000 911  ASP A O   
5685 N  N   . GLY A 933  ? 1.0428 1.0428 1.0428 0.0000 0.0000 0.0000 912  GLY A N   
5686 C  CA  . GLY A 933  ? 1.0428 1.0428 1.0428 0.0000 0.0000 0.0000 912  GLY A CA  
5687 C  C   . GLY A 933  ? 1.0428 1.0428 1.0428 0.0000 0.0000 0.0000 912  GLY A C   
5688 O  O   . GLY A 933  ? 1.0428 1.0428 1.0428 0.0000 0.0000 0.0000 912  GLY A O   
5689 N  N   . ILE A 934  ? 0.7849 0.7849 0.7849 0.0000 0.0000 0.0000 913  ILE A N   
5690 C  CA  . ILE A 934  ? 0.7849 0.7849 0.7849 0.0000 0.0000 0.0000 913  ILE A CA  
5691 C  C   . ILE A 934  ? 0.7849 0.7849 0.7849 0.0000 0.0000 0.0000 913  ILE A C   
5692 O  O   . ILE A 934  ? 0.7849 0.7849 0.7849 0.0000 0.0000 0.0000 913  ILE A O   
5697 N  N   . ILE A 935  ? 0.6766 0.6766 0.6766 0.0000 0.0000 0.0000 914  ILE A N   
5698 C  CA  . ILE A 935  ? 0.6766 0.6766 0.6766 0.0000 0.0000 0.0000 914  ILE A CA  
5699 C  C   . ILE A 935  ? 0.6766 0.6766 0.6766 0.0000 0.0000 0.0000 914  ILE A C   
5700 O  O   . ILE A 935  ? 0.6766 0.6766 0.6766 0.0000 0.0000 0.0000 914  ILE A O   
5705 N  N   . ASN A 936  ? 0.5341 0.5341 0.5341 0.0000 0.0000 0.0000 915  ASN A N   
5706 C  CA  . ASN A 936  ? 0.5341 0.5341 0.5341 0.0000 0.0000 0.0000 915  ASN A CA  
5707 C  C   . ASN A 936  ? 0.5341 0.5341 0.5341 0.0000 0.0000 0.0000 915  ASN A C   
5708 O  O   . ASN A 936  ? 0.5341 0.5341 0.5341 0.0000 0.0000 0.0000 915  ASN A O   
5720 N  N   . SER A 938  ? 0.7355 0.7355 0.7355 0.0000 0.0000 0.0000 917  SER A N   
5721 C  CA  . SER A 938  ? 0.7355 0.7355 0.7355 0.0000 0.0000 0.0000 917  SER A CA  
5722 C  C   . SER A 938  ? 0.7355 0.7355 0.7355 0.0000 0.0000 0.0000 917  SER A C   
5723 O  O   . SER A 938  ? 0.7355 0.7355 0.7355 0.0000 0.0000 0.0000 917  SER A O   
5726 N  N   . ALA A 939  ? 0.7775 0.7775 0.7775 0.0000 0.0000 0.0000 918  ALA A N   
5727 C  CA  . ALA A 939  ? 0.7775 0.7775 0.7775 0.0000 0.0000 0.0000 918  ALA A CA  
5728 C  C   . ALA A 939  ? 0.7775 0.7775 0.7775 0.0000 0.0000 0.0000 918  ALA A C   
5729 O  O   . ALA A 939  ? 0.7775 0.7775 0.7775 0.0000 0.0000 0.0000 918  ALA A O   
5731 N  N   . PHE A 940  ? 0.5154 0.5154 0.5154 0.0000 0.0000 0.0000 919  PHE A N   
5732 C  CA  . PHE A 940  ? 0.5154 0.5154 0.5154 0.0000 0.0000 0.0000 919  PHE A CA  
5733 C  C   . PHE A 940  ? 0.5154 0.5154 0.5154 0.0000 0.0000 0.0000 919  PHE A C   
5734 O  O   . PHE A 940  ? 0.5154 0.5154 0.5154 0.0000 0.0000 0.0000 919  PHE A O   
5742 N  N   . TYR A 941  ? 0.3824 0.3824 0.3824 0.0000 0.0000 0.0000 920  TYR A N   
5743 C  CA  . TYR A 941  ? 0.3824 0.3824 0.3824 0.0000 0.0000 0.0000 920  TYR A CA  
5744 C  C   . TYR A 941  ? 0.3824 0.3824 0.3824 0.0000 0.0000 0.0000 920  TYR A C   
5745 O  O   . TYR A 941  ? 0.3824 0.3824 0.3824 0.0000 0.0000 0.0000 920  TYR A O   
5754 N  N   . ILE A 942  ? 0.3332 0.3332 0.3332 0.0000 0.0000 0.0000 921  ILE A N   
5755 C  CA  . ILE A 942  ? 0.3332 0.3332 0.3332 0.0000 0.0000 0.0000 921  ILE A CA  
5756 C  C   . ILE A 942  ? 0.3332 0.3332 0.3332 0.0000 0.0000 0.0000 921  ILE A C   
5757 O  O   . ILE A 942  ? 0.3332 0.3332 0.3332 0.0000 0.0000 0.0000 921  ILE A O   
5762 N  N   . TYR A 943  ? 0.3565 0.3565 0.3565 0.0000 0.0000 0.0000 922  TYR A N   
5763 C  CA  . TYR A 943  ? 0.3565 0.3565 0.3565 0.0000 0.0000 0.0000 922  TYR A CA  
5764 C  C   . TYR A 943  ? 0.3565 0.3565 0.3565 0.0000 0.0000 0.0000 922  TYR A C   
5765 O  O   . TYR A 943  ? 0.3565 0.3565 0.3565 0.0000 0.0000 0.0000 922  TYR A O   
5774 N  N   . LEU A 944  ? 0.3349 0.3349 0.3349 0.0000 0.0000 0.0000 923  LEU A N   
5775 C  CA  . LEU A 944  ? 0.3349 0.3349 0.3349 0.0000 0.0000 0.0000 923  LEU A CA  
5776 C  C   . LEU A 944  ? 0.3349 0.3349 0.3349 0.0000 0.0000 0.0000 923  LEU A C   
5777 O  O   . LEU A 944  ? 0.3349 0.3349 0.3349 0.0000 0.0000 0.0000 923  LEU A O   
5782 N  N   . THR A 945  ? 0.3282 0.3282 0.3282 0.0000 0.0000 0.0000 924  THR A N   
5783 C  CA  . THR A 945  ? 0.3282 0.3282 0.3282 0.0000 0.0000 0.0000 924  THR A CA  
5784 C  C   . THR A 945  ? 0.3282 0.3282 0.3282 0.0000 0.0000 0.0000 924  THR A C   
5785 O  O   . THR A 945  ? 0.3282 0.3282 0.3282 0.0000 0.0000 0.0000 924  THR A O   
5789 N  N   . ALA A 946  ? 0.3582 0.3582 0.3582 0.0000 0.0000 0.0000 925  ALA A N   
5790 C  CA  . ALA A 946  ? 0.3582 0.3582 0.3582 0.0000 0.0000 0.0000 925  ALA A CA  
5791 C  C   . ALA A 946  ? 0.3582 0.3582 0.3582 0.0000 0.0000 0.0000 925  ALA A C   
5792 O  O   . ALA A 946  ? 0.3582 0.3582 0.3582 0.0000 0.0000 0.0000 925  ALA A O   
5794 N  N   . TRP A 947  ? 0.2023 0.2023 0.2023 0.0000 0.0000 0.0000 926  TRP A N   
5795 C  CA  . TRP A 947  ? 0.2023 0.2023 0.2023 0.0000 0.0000 0.0000 926  TRP A CA  
5796 C  C   . TRP A 947  ? 0.2023 0.2023 0.2023 0.0000 0.0000 0.0000 926  TRP A C   
5797 O  O   . TRP A 947  ? 0.2023 0.2023 0.2023 0.0000 0.0000 0.0000 926  TRP A O   
5821 N  N   . ASN A 950  ? 0.2766 0.2766 0.2766 0.0000 0.0000 0.0000 929  ASN A N   
5822 C  CA  . ASN A 950  ? 0.2766 0.2766 0.2766 0.0000 0.0000 0.0000 929  ASN A CA  
5823 C  C   . ASN A 950  ? 0.2766 0.2766 0.2766 0.0000 0.0000 0.0000 929  ASN A C   
5824 O  O   . ASN A 950  ? 0.2766 0.2766 0.2766 0.0000 0.0000 0.0000 929  ASN A O   
5829 N  N   . ASP A 951  ? 0.3646 0.3646 0.3646 0.0000 0.0000 0.0000 930  ASP A N   
5830 C  CA  . ASP A 951  ? 0.3646 0.3646 0.3646 0.0000 0.0000 0.0000 930  ASP A CA  
5831 C  C   . ASP A 951  ? 0.3646 0.3646 0.3646 0.0000 0.0000 0.0000 930  ASP A C   
5832 O  O   . ASP A 951  ? 0.3646 0.3646 0.3646 0.0000 0.0000 0.0000 930  ASP A O   
5837 N  N   . PRO A 952  ? 0.5100 0.5100 0.5100 0.0000 0.0000 0.0000 931  PRO A N   
5838 C  CA  . PRO A 952  ? 0.5100 0.5100 0.5100 0.0000 0.0000 0.0000 931  PRO A CA  
5839 C  C   . PRO A 952  ? 0.5100 0.5100 0.5100 0.0000 0.0000 0.0000 931  PRO A C   
5840 O  O   . PRO A 952  ? 0.5100 0.5100 0.5100 0.0000 0.0000 0.0000 931  PRO A O   
5844 N  N   . VAL A 953  ? 0.3908 0.3908 0.3908 0.0000 0.0000 0.0000 932  VAL A N   
5845 C  CA  . VAL A 953  ? 0.3908 0.3908 0.3908 0.0000 0.0000 0.0000 932  VAL A CA  
5846 C  C   . VAL A 953  ? 0.3908 0.3908 0.3908 0.0000 0.0000 0.0000 932  VAL A C   
5847 O  O   . VAL A 953  ? 0.3908 0.3908 0.3908 0.0000 0.0000 0.0000 932  VAL A O   
5851 N  N   . ALA A 954  ? 0.4057 0.4057 0.4057 0.0000 0.0000 0.0000 933  ALA A N   
5852 C  CA  . ALA A 954  ? 0.4057 0.4057 0.4057 0.0000 0.0000 0.0000 933  ALA A CA  
5853 C  C   . ALA A 954  ? 0.4057 0.4057 0.4057 0.0000 0.0000 0.0000 933  ALA A C   
5854 O  O   . ALA A 954  ? 0.4057 0.4057 0.4057 0.0000 0.0000 0.0000 933  ALA A O   
5856 N  N   . TYR A 955  ? 0.2379 0.2379 0.2379 0.0000 0.0000 0.0000 934  TYR A N   
5857 C  CA  . TYR A 955  ? 0.2379 0.2379 0.2379 0.0000 0.0000 0.0000 934  TYR A CA  
5858 C  C   . TYR A 955  ? 0.2379 0.2379 0.2379 0.0000 0.0000 0.0000 934  TYR A C   
5859 O  O   . TYR A 955  ? 0.2379 0.2379 0.2379 0.0000 0.0000 0.0000 934  TYR A O   
5868 N  N   . ALA A 956  ? 0.3171 0.3171 0.3171 0.0000 0.0000 0.0000 935  ALA A N   
5869 C  CA  . ALA A 956  ? 0.3171 0.3171 0.3171 0.0000 0.0000 0.0000 935  ALA A CA  
5870 C  C   . ALA A 956  ? 0.3171 0.3171 0.3171 0.0000 0.0000 0.0000 935  ALA A C   
5871 O  O   . ALA A 956  ? 0.3171 0.3171 0.3171 0.0000 0.0000 0.0000 935  ALA A O   
5873 N  N   . ALA A 957  ? 0.2830 0.2830 0.2830 0.0000 0.0000 0.0000 936  ALA A N   
5874 C  CA  . ALA A 957  ? 0.2830 0.2830 0.2830 0.0000 0.0000 0.0000 936  ALA A CA  
5875 C  C   . ALA A 957  ? 0.2830 0.2830 0.2830 0.0000 0.0000 0.0000 936  ALA A C   
5876 O  O   . ALA A 957  ? 0.2830 0.2830 0.2830 0.0000 0.0000 0.0000 936  ALA A O   
5878 N  N   . SER A 958  ? 0.4500 0.4500 0.4500 0.0000 0.0000 0.0000 937  SER A N   
5879 C  CA  . SER A 958  ? 0.4500 0.4500 0.4500 0.0000 0.0000 0.0000 937  SER A CA  
5880 C  C   . SER A 958  ? 0.4500 0.4500 0.4500 0.0000 0.0000 0.0000 937  SER A C   
5881 O  O   . SER A 958  ? 0.4500 0.4500 0.4500 0.0000 0.0000 0.0000 937  SER A O   
6057 N  N   . GLU A 979  ? 1.0452 1.0452 1.0452 0.0000 0.0000 0.0000 958  GLU A N   
6058 C  CA  . GLU A 979  ? 1.0452 1.0452 1.0452 0.0000 0.0000 0.0000 958  GLU A CA  
6059 C  C   . GLU A 979  ? 1.0452 1.0452 1.0452 0.0000 0.0000 0.0000 958  GLU A C   
6060 O  O   . GLU A 979  ? 1.0452 1.0452 1.0452 0.0000 0.0000 0.0000 958  GLU A O   
6066 N  N   . THR A 980  ? 0.9113 0.9113 0.9113 0.0000 0.0000 0.0000 959  THR A N   
6067 C  CA  . THR A 980  ? 0.9113 0.9113 0.9113 0.0000 0.0000 0.0000 959  THR A CA  
6068 C  C   . THR A 980  ? 0.9113 0.9113 0.9113 0.0000 0.0000 0.0000 959  THR A C   
6069 O  O   . THR A 980  ? 0.9113 0.9113 0.9113 0.0000 0.0000 0.0000 959  THR A O   
6073 N  N   . ARG A 981  ? 0.7257 0.7257 0.7257 0.0000 0.0000 0.0000 960  ARG A N   
6074 C  CA  . ARG A 981  ? 0.7257 0.7257 0.7257 0.0000 0.0000 0.0000 960  ARG A CA  
6075 C  C   . ARG A 981  ? 0.7257 0.7257 0.7257 0.0000 0.0000 0.0000 960  ARG A C   
6076 O  O   . ARG A 981  ? 0.7257 0.7257 0.7257 0.0000 0.0000 0.0000 960  ARG A O   
6092 N  N   . ARG A 983  ? 0.4928 0.4928 0.4928 0.0000 0.0000 0.0000 962  ARG A N   
6093 C  CA  . ARG A 983  ? 0.4928 0.4928 0.4928 0.0000 0.0000 0.0000 962  ARG A CA  
6094 C  C   . ARG A 983  ? 0.4928 0.4928 0.4928 0.0000 0.0000 0.0000 962  ARG A C   
6095 O  O   . ARG A 983  ? 0.4928 0.4928 0.4928 0.0000 0.0000 0.0000 962  ARG A O   
6103 N  N   . ILE A 984  ? 0.5220 0.5220 0.5220 0.0000 0.0000 0.0000 963  ILE A N   
6104 C  CA  . ILE A 984  ? 0.5220 0.5220 0.5220 0.0000 0.0000 0.0000 963  ILE A CA  
6105 C  C   . ILE A 984  ? 0.5220 0.5220 0.5220 0.0000 0.0000 0.0000 963  ILE A C   
6106 O  O   . ILE A 984  ? 0.5220 0.5220 0.5220 0.0000 0.0000 0.0000 963  ILE A O   
6111 N  N   . PRO A 985  ? 0.5204 0.5204 0.5204 0.0000 0.0000 0.0000 964  PRO A N   
6112 C  CA  . PRO A 985  ? 0.5204 0.5204 0.5204 0.0000 0.0000 0.0000 964  PRO A CA  
6113 C  C   . PRO A 985  ? 0.5204 0.5204 0.5204 0.0000 0.0000 0.0000 964  PRO A C   
6114 O  O   . PRO A 985  ? 0.5204 0.5204 0.5204 0.0000 0.0000 0.0000 964  PRO A O   
6118 N  N   . ALA A 986  ? 0.6919 0.6919 0.6919 0.0000 0.0000 0.0000 965  ALA A N   
6119 C  CA  . ALA A 986  ? 0.6919 0.6919 0.6919 0.0000 0.0000 0.0000 965  ALA A CA  
6120 C  C   . ALA A 986  ? 0.6919 0.6919 0.6919 0.0000 0.0000 0.0000 965  ALA A C   
6121 O  O   . ALA A 986  ? 0.6919 0.6919 0.6919 0.0000 0.0000 0.0000 965  ALA A O   
6123 N  N   . ALA A 987  ? 0.7979 0.7979 0.7979 0.0000 0.0000 0.0000 966  ALA A N   
6124 C  CA  . ALA A 987  ? 0.7979 0.7979 0.7979 0.0000 0.0000 0.0000 966  ALA A CA  
6125 C  C   . ALA A 987  ? 0.7979 0.7979 0.7979 0.0000 0.0000 0.0000 966  ALA A C   
6126 O  O   . ALA A 987  ? 0.7979 0.7979 0.7979 0.0000 0.0000 0.0000 966  ALA A O   
6128 N  N   . GLU A 988  ? 0.8799 0.8799 0.8799 0.0000 0.0000 0.0000 967  GLU A N   
6129 C  CA  . GLU A 988  ? 0.8799 0.8799 0.8799 0.0000 0.0000 0.0000 967  GLU A CA  
6130 C  C   . GLU A 988  ? 0.8799 0.8799 0.8799 0.0000 0.0000 0.0000 967  GLU A C   
6131 O  O   . GLU A 988  ? 0.8799 0.8799 0.8799 0.0000 0.0000 0.0000 967  GLU A O   
6137 N  N   . PRO A 989  ? 0.6041 0.6041 0.6041 0.0000 0.0000 0.0000 968  PRO A N   
6138 C  CA  . PRO A 989  ? 0.6041 0.6041 0.6041 0.0000 0.0000 0.0000 968  PRO A CA  
6139 C  C   . PRO A 989  ? 0.6041 0.6041 0.6041 0.0000 0.0000 0.0000 968  PRO A C   
6140 O  O   . PRO A 989  ? 0.6041 0.6041 0.6041 0.0000 0.0000 0.0000 968  PRO A O   
6144 N  N   . ILE A 990  ? 0.4287 0.4287 0.4287 0.0000 0.0000 0.0000 969  ILE A N   
6145 C  CA  . ILE A 990  ? 0.4287 0.4287 0.4287 0.0000 0.0000 0.0000 969  ILE A CA  
6146 C  C   . ILE A 990  ? 0.4287 0.4287 0.4287 0.0000 0.0000 0.0000 969  ILE A C   
6147 O  O   . ILE A 990  ? 0.4287 0.4287 0.4287 0.0000 0.0000 0.0000 969  ILE A O   
6173 N  N   . ALA A 993  ? 0.3304 0.3304 0.3304 0.0000 0.0000 0.0000 972  ALA A N   
6174 C  CA  . ALA A 993  ? 0.3304 0.3304 0.3304 0.0000 0.0000 0.0000 972  ALA A CA  
6175 C  C   . ALA A 993  ? 0.3304 0.3304 0.3304 0.0000 0.0000 0.0000 972  ALA A C   
6176 O  O   . ALA A 993  ? 0.3304 0.3304 0.3304 0.0000 0.0000 0.0000 972  ALA A O   
6178 N  N   . GLN A 994  ? 0.1911 0.1911 0.1911 0.0000 0.0000 0.0000 973  GLN A N   
6179 C  CA  . GLN A 994  ? 0.1911 0.1911 0.1911 0.0000 0.0000 0.0000 973  GLN A CA  
6180 C  C   . GLN A 994  ? 0.1911 0.1911 0.1911 0.0000 0.0000 0.0000 973  GLN A C   
6181 O  O   . GLN A 994  ? 0.1911 0.1911 0.1911 0.0000 0.0000 0.0000 973  GLN A O   
6187 N  N   . PHE A 995  ? 0.2767 0.2767 0.2767 0.0000 0.0000 0.0000 974  PHE A N   
6188 C  CA  . PHE A 995  ? 0.2767 0.2767 0.2767 0.0000 0.0000 0.0000 974  PHE A CA  
6189 C  C   . PHE A 995  ? 0.2767 0.2767 0.2767 0.0000 0.0000 0.0000 974  PHE A C   
6190 O  O   . PHE A 995  ? 0.2767 0.2767 0.2767 0.0000 0.0000 0.0000 974  PHE A O   
6198 N  N   . PRO A 996  ? 0.3941 0.3941 0.3941 0.0000 0.0000 0.0000 975  PRO A N   
6199 C  CA  . PRO A 996  ? 0.3941 0.3941 0.3941 0.0000 0.0000 0.0000 975  PRO A CA  
6200 C  C   . PRO A 996  ? 0.3941 0.3941 0.3941 0.0000 0.0000 0.0000 975  PRO A C   
6201 O  O   . PRO A 996  ? 0.3941 0.3941 0.3941 0.0000 0.0000 0.0000 975  PRO A O   
6205 N  N   . PHE A 997  ? 0.2673 0.2673 0.2673 0.0000 0.0000 0.0000 976  PHE A N   
6206 C  CA  . PHE A 997  ? 0.2673 0.2673 0.2673 0.0000 0.0000 0.0000 976  PHE A CA  
6207 C  C   . PHE A 997  ? 0.2673 0.2673 0.2673 0.0000 0.0000 0.0000 976  PHE A C   
6208 O  O   . PHE A 997  ? 0.2673 0.2673 0.2673 0.0000 0.0000 0.0000 976  PHE A O   
6216 N  N   . TYR A 998  ? 0.3728 0.3728 0.3728 0.0000 0.0000 0.0000 977  TYR A N   
6217 C  CA  . TYR A 998  ? 0.3728 0.3728 0.3728 0.0000 0.0000 0.0000 977  TYR A CA  
6218 C  C   . TYR A 998  ? 0.3728 0.3728 0.3728 0.0000 0.0000 0.0000 977  TYR A C   
6219 O  O   . TYR A 998  ? 0.3728 0.3728 0.3728 0.0000 0.0000 0.0000 977  TYR A O   
6228 N  N   . LEU A 999  ? 0.3910 0.3910 0.3910 0.0000 0.0000 0.0000 978  LEU A N   
6229 C  CA  . LEU A 999  ? 0.3910 0.3910 0.3910 0.0000 0.0000 0.0000 978  LEU A CA  
6230 C  C   . LEU A 999  ? 0.3910 0.3910 0.3910 0.0000 0.0000 0.0000 978  LEU A C   
6231 O  O   . LEU A 999  ? 0.3910 0.3910 0.3910 0.0000 0.0000 0.0000 978  LEU A O   
6244 N  N   . GLY A 1001 ? 0.9276 0.9276 0.9276 0.0000 0.0000 0.0000 980  GLY A N   
6245 C  CA  . GLY A 1001 ? 0.9276 0.9276 0.9276 0.0000 0.0000 0.0000 980  GLY A CA  
6246 C  C   . GLY A 1001 ? 0.9276 0.9276 0.9276 0.0000 0.0000 0.0000 980  GLY A C   
6247 O  O   . GLY A 1001 ? 0.9276 0.9276 0.9276 0.0000 0.0000 0.0000 980  GLY A O   
6248 N  N   . LEU A 1002 ? 0.7410 0.7410 0.7410 0.0000 0.0000 0.0000 981  LEU A N   
6249 C  CA  . LEU A 1002 ? 0.7410 0.7410 0.7410 0.0000 0.0000 0.0000 981  LEU A CA  
6250 C  C   . LEU A 1002 ? 0.7410 0.7410 0.7410 0.0000 0.0000 0.0000 981  LEU A C   
6251 O  O   . LEU A 1002 ? 0.7410 0.7410 0.7410 0.0000 0.0000 0.0000 981  LEU A O   
6256 N  N   . ARG A 1003 ? 0.7622 0.7622 0.7622 0.0000 0.0000 0.0000 982  ARG A N   
6257 C  CA  . ARG A 1003 ? 0.7622 0.7622 0.7622 0.0000 0.0000 0.0000 982  ARG A CA  
6258 C  C   . ARG A 1003 ? 0.7622 0.7622 0.7622 0.0000 0.0000 0.0000 982  ARG A C   
6259 O  O   . ARG A 1003 ? 0.7622 0.7622 0.7622 0.0000 0.0000 0.0000 982  ARG A O   
6267 N  N   . ASP A 1004 ? 0.9557 0.9557 0.9557 0.0000 0.0000 0.0000 983  ASP A N   
6268 C  CA  . ASP A 1004 ? 0.9557 0.9557 0.9557 0.0000 0.0000 0.0000 983  ASP A CA  
6269 C  C   . ASP A 1004 ? 0.9557 0.9557 0.9557 0.0000 0.0000 0.0000 983  ASP A C   
6270 O  O   . ASP A 1004 ? 0.9557 0.9557 0.9557 0.0000 0.0000 0.0000 983  ASP A O   
6275 N  N   . THR A 1005 ? 0.7529 0.7529 0.7529 0.0000 0.0000 0.0000 984  THR A N   
6276 C  CA  . THR A 1005 ? 0.7529 0.7529 0.7529 0.0000 0.0000 0.0000 984  THR A CA  
6277 C  C   . THR A 1005 ? 0.7529 0.7529 0.7529 0.0000 0.0000 0.0000 984  THR A C   
6278 O  O   . THR A 1005 ? 0.7529 0.7529 0.7529 0.0000 0.0000 0.0000 984  THR A O   
6288 N  N   . ASP A 1007 ? 0.6288 0.6288 0.6288 0.0000 0.0000 0.0000 986  ASP A N   
6289 C  CA  . ASP A 1007 ? 0.6288 0.6288 0.6288 0.0000 0.0000 0.0000 986  ASP A CA  
6290 C  C   . ASP A 1007 ? 0.6288 0.6288 0.6288 0.0000 0.0000 0.0000 986  ASP A C   
6291 O  O   . ASP A 1007 ? 0.6288 0.6288 0.6288 0.0000 0.0000 0.0000 986  ASP A O   
6296 N  N   . PHE A 1008 ? 0.4727 0.4727 0.4727 0.0000 0.0000 0.0000 987  PHE A N   
6297 C  CA  . PHE A 1008 ? 0.4727 0.4727 0.4727 0.0000 0.0000 0.0000 987  PHE A CA  
6298 C  C   . PHE A 1008 ? 0.4727 0.4727 0.4727 0.0000 0.0000 0.0000 987  PHE A C   
6299 O  O   . PHE A 1008 ? 0.4727 0.4727 0.4727 0.0000 0.0000 0.0000 987  PHE A O   
6307 N  N   . VAL A 1009 ? 0.5346 0.5346 0.5346 0.0000 0.0000 0.0000 988  VAL A N   
6308 C  CA  . VAL A 1009 ? 0.5346 0.5346 0.5346 0.0000 0.0000 0.0000 988  VAL A CA  
6309 C  C   . VAL A 1009 ? 0.5346 0.5346 0.5346 0.0000 0.0000 0.0000 988  VAL A C   
6310 O  O   . VAL A 1009 ? 0.5346 0.5346 0.5346 0.0000 0.0000 0.0000 988  VAL A O   
6314 N  N   . GLU A 1010 ? 0.6356 0.6356 0.6356 0.0000 0.0000 0.0000 989  GLU A N   
6315 C  CA  . GLU A 1010 ? 0.6356 0.6356 0.6356 0.0000 0.0000 0.0000 989  GLU A CA  
6316 C  C   . GLU A 1010 ? 0.6356 0.6356 0.6356 0.0000 0.0000 0.0000 989  GLU A C   
6317 O  O   . GLU A 1010 ? 0.6356 0.6356 0.6356 0.0000 0.0000 0.0000 989  GLU A O   
6323 N  N   . ALA A 1011 ? 0.5332 0.5332 0.5332 0.0000 0.0000 0.0000 990  ALA A N   
6324 C  CA  . ALA A 1011 ? 0.5332 0.5332 0.5332 0.0000 0.0000 0.0000 990  ALA A CA  
6325 C  C   . ALA A 1011 ? 0.5332 0.5332 0.5332 0.0000 0.0000 0.0000 990  ALA A C   
6326 O  O   . ALA A 1011 ? 0.5332 0.5332 0.5332 0.0000 0.0000 0.0000 990  ALA A O   
6328 N  N   . ILE A 1012 ? 0.3276 0.3276 0.3276 0.0000 0.0000 0.0000 991  ILE A N   
6329 C  CA  . ILE A 1012 ? 0.3276 0.3276 0.3276 0.0000 0.0000 0.0000 991  ILE A CA  
6330 C  C   . ILE A 1012 ? 0.3276 0.3276 0.3276 0.0000 0.0000 0.0000 991  ILE A C   
6331 O  O   . ILE A 1012 ? 0.3276 0.3276 0.3276 0.0000 0.0000 0.0000 991  ILE A O   
6336 N  N   . GLU A 1013 ? 0.4613 0.4613 0.4613 0.0000 0.0000 0.0000 992  GLU A N   
6337 C  CA  . GLU A 1013 ? 0.4613 0.4613 0.4613 0.0000 0.0000 0.0000 992  GLU A CA  
6338 C  C   . GLU A 1013 ? 0.4613 0.4613 0.4613 0.0000 0.0000 0.0000 992  GLU A C   
6339 O  O   . GLU A 1013 ? 0.4613 0.4613 0.4613 0.0000 0.0000 0.0000 992  GLU A O   
6345 N  N   . LYS A 1014 ? 0.6223 0.6223 0.6223 0.0000 0.0000 0.0000 993  LYS A N   
6346 C  CA  . LYS A 1014 ? 0.6223 0.6223 0.6223 0.0000 0.0000 0.0000 993  LYS A CA  
6347 C  C   . LYS A 1014 ? 0.6223 0.6223 0.6223 0.0000 0.0000 0.0000 993  LYS A C   
6348 O  O   . LYS A 1014 ? 0.6223 0.6223 0.6223 0.0000 0.0000 0.0000 993  LYS A O   
6354 N  N   . VAL A 1015 ? 0.4537 0.4537 0.4537 0.0000 0.0000 0.0000 994  VAL A N   
6355 C  CA  . VAL A 1015 ? 0.4537 0.4537 0.4537 0.0000 0.0000 0.0000 994  VAL A CA  
6356 C  C   . VAL A 1015 ? 0.4537 0.4537 0.4537 0.0000 0.0000 0.0000 994  VAL A C   
6357 O  O   . VAL A 1015 ? 0.4537 0.4537 0.4537 0.0000 0.0000 0.0000 994  VAL A O   
6361 N  N   . ARG A 1016 ? 0.3190 0.3190 0.3190 0.0000 0.0000 0.0000 995  ARG A N   
6362 C  CA  . ARG A 1016 ? 0.3190 0.3190 0.3190 0.0000 0.0000 0.0000 995  ARG A CA  
6363 C  C   . ARG A 1016 ? 0.3190 0.3190 0.3190 0.0000 0.0000 0.0000 995  ARG A C   
6364 O  O   . ARG A 1016 ? 0.3190 0.3190 0.3190 0.0000 0.0000 0.0000 995  ARG A O   
6372 N  N   . THR A 1017 ? 0.5065 0.5065 0.5065 0.0000 0.0000 0.0000 996  THR A N   
6373 C  CA  . THR A 1017 ? 0.5065 0.5065 0.5065 0.0000 0.0000 0.0000 996  THR A CA  
6374 C  C   . THR A 1017 ? 0.5065 0.5065 0.5065 0.0000 0.0000 0.0000 996  THR A C   
6375 O  O   . THR A 1017 ? 0.5065 0.5065 0.5065 0.0000 0.0000 0.0000 996  THR A O   
6379 N  N   . ILE A 1018 ? 0.3416 0.3416 0.3416 0.0000 0.0000 0.0000 997  ILE A N   
6380 C  CA  . ILE A 1018 ? 0.3416 0.3416 0.3416 0.0000 0.0000 0.0000 997  ILE A CA  
6381 C  C   . ILE A 1018 ? 0.3416 0.3416 0.3416 0.0000 0.0000 0.0000 997  ILE A C   
6382 O  O   . ILE A 1018 ? 0.3416 0.3416 0.3416 0.0000 0.0000 0.0000 997  ILE A O   
6387 N  N   . CYS A 1019 ? 0.5050 0.5050 0.5050 0.0000 0.0000 0.0000 998  CYS A N   
6388 C  CA  . CYS A 1019 ? 0.5050 0.5050 0.5050 0.0000 0.0000 0.0000 998  CYS A CA  
6389 C  C   . CYS A 1019 ? 0.5050 0.5050 0.5050 0.0000 0.0000 0.0000 998  CYS A C   
6390 O  O   . CYS A 1019 ? 0.5050 0.5050 0.5050 0.0000 0.0000 0.0000 998  CYS A O   
6393 N  N   . SER A 1020 ? 0.6206 0.6206 0.6206 0.0000 0.0000 0.0000 999  SER A N   
6394 C  CA  . SER A 1020 ? 0.6206 0.6206 0.6206 0.0000 0.0000 0.0000 999  SER A CA  
6395 C  C   . SER A 1020 ? 0.6206 0.6206 0.6206 0.0000 0.0000 0.0000 999  SER A C   
6396 O  O   . SER A 1020 ? 0.6206 0.6206 0.6206 0.0000 0.0000 0.0000 999  SER A O   
6399 N  N   . ASN A 1021 ? 0.5041 0.5041 0.5041 0.0000 0.0000 0.0000 1000 ASN A N   
6400 C  CA  . ASN A 1021 ? 0.5041 0.5041 0.5041 0.0000 0.0000 0.0000 1000 ASN A CA  
6401 C  C   . ASN A 1021 ? 0.5041 0.5041 0.5041 0.0000 0.0000 0.0000 1000 ASN A C   
6402 O  O   . ASN A 1021 ? 0.5041 0.5041 0.5041 0.0000 0.0000 0.0000 1000 ASN A O   
6407 N  N   . TYR A 1022 ? 0.4155 0.4155 0.4155 0.0000 0.0000 0.0000 1001 TYR A N   
6408 C  CA  . TYR A 1022 ? 0.4155 0.4155 0.4155 0.0000 0.0000 0.0000 1001 TYR A CA  
6409 C  C   . TYR A 1022 ? 0.4155 0.4155 0.4155 0.0000 0.0000 0.0000 1001 TYR A C   
6410 O  O   . TYR A 1022 ? 0.4155 0.4155 0.4155 0.0000 0.0000 0.0000 1001 TYR A O   
6419 N  N   . THR A 1023 ? 0.5095 0.5095 0.5095 0.0000 0.0000 0.0000 1002 THR A N   
6420 C  CA  . THR A 1023 ? 0.5095 0.5095 0.5095 0.0000 0.0000 0.0000 1002 THR A CA  
6421 C  C   . THR A 1023 ? 0.5095 0.5095 0.5095 0.0000 0.0000 0.0000 1002 THR A C   
6422 O  O   . THR A 1023 ? 0.5095 0.5095 0.5095 0.0000 0.0000 0.0000 1002 THR A O   
6426 N  N   . SER A 1024 ? 0.5259 0.5259 0.5259 0.0000 0.0000 0.0000 1003 SER A N   
6427 C  CA  . SER A 1024 ? 0.5259 0.5259 0.5259 0.0000 0.0000 0.0000 1003 SER A CA  
6428 C  C   . SER A 1024 ? 0.5259 0.5259 0.5259 0.0000 0.0000 0.0000 1003 SER A C   
6429 O  O   . SER A 1024 ? 0.5259 0.5259 0.5259 0.0000 0.0000 0.0000 1003 SER A O   
6432 N  N   . LEU A 1025 ? 0.4094 0.4094 0.4094 0.0000 0.0000 0.0000 1004 LEU A N   
6433 C  CA  . LEU A 1025 ? 0.4094 0.4094 0.4094 0.0000 0.0000 0.0000 1004 LEU A CA  
6434 C  C   . LEU A 1025 ? 0.4094 0.4094 0.4094 0.0000 0.0000 0.0000 1004 LEU A C   
6435 O  O   . LEU A 1025 ? 0.4094 0.4094 0.4094 0.0000 0.0000 0.0000 1004 LEU A O   
6440 N  N   . GLY A 1026 ? 0.6174 0.6174 0.6174 0.0000 0.0000 0.0000 1005 GLY A N   
6441 C  CA  . GLY A 1026 ? 0.6174 0.6174 0.6174 0.0000 0.0000 0.0000 1005 GLY A CA  
6442 C  C   . GLY A 1026 ? 0.6174 0.6174 0.6174 0.0000 0.0000 0.0000 1005 GLY A C   
6443 O  O   . GLY A 1026 ? 0.6174 0.6174 0.6174 0.0000 0.0000 0.0000 1005 GLY A O   
6444 N  N   . LEU A 1027 ? 0.6443 0.6443 0.6443 0.0000 0.0000 0.0000 1006 LEU A N   
6445 C  CA  . LEU A 1027 ? 0.6443 0.6443 0.6443 0.0000 0.0000 0.0000 1006 LEU A CA  
6446 C  C   . LEU A 1027 ? 0.6443 0.6443 0.6443 0.0000 0.0000 0.0000 1006 LEU A C   
6447 O  O   . LEU A 1027 ? 0.6443 0.6443 0.6443 0.0000 0.0000 0.0000 1006 LEU A O   
6452 N  N   . SER A 1028 ? 0.5824 0.5824 0.5824 0.0000 0.0000 0.0000 1007 SER A N   
6453 C  CA  . SER A 1028 ? 0.5824 0.5824 0.5824 0.0000 0.0000 0.0000 1007 SER A CA  
6454 C  C   . SER A 1028 ? 0.5824 0.5824 0.5824 0.0000 0.0000 0.0000 1007 SER A C   
6455 O  O   . SER A 1028 ? 0.5824 0.5824 0.5824 0.0000 0.0000 0.0000 1007 SER A O   
6458 N  N   . SER A 1029 ? 0.4027 0.4027 0.4027 0.0000 0.0000 0.0000 1008 SER A N   
6459 C  CA  . SER A 1029 ? 0.4027 0.4027 0.4027 0.0000 0.0000 0.0000 1008 SER A CA  
6460 C  C   . SER A 1029 ? 0.4027 0.4027 0.4027 0.0000 0.0000 0.0000 1008 SER A C   
6461 O  O   . SER A 1029 ? 0.4027 0.4027 0.4027 0.0000 0.0000 0.0000 1008 SER A O   
6464 N  N   . TYR A 1030 ? 0.2469 0.2469 0.2469 0.0000 0.0000 0.0000 1009 TYR A N   
6465 C  CA  . TYR A 1030 ? 0.2469 0.2469 0.2469 0.0000 0.0000 0.0000 1009 TYR A CA  
6466 C  C   . TYR A 1030 ? 0.2469 0.2469 0.2469 0.0000 0.0000 0.0000 1009 TYR A C   
6467 O  O   . TYR A 1030 ? 0.2469 0.2469 0.2469 0.0000 0.0000 0.0000 1009 TYR A O   
6476 N  N   . PRO A 1031 ? 0.2535 0.2535 0.2535 0.0000 0.0000 0.0000 1010 PRO A N   
6477 C  CA  . PRO A 1031 ? 0.2535 0.2535 0.2535 0.0000 0.0000 0.0000 1010 PRO A CA  
6478 C  C   . PRO A 1031 ? 0.2535 0.2535 0.2535 0.0000 0.0000 0.0000 1010 PRO A C   
6479 O  O   . PRO A 1031 ? 0.2535 0.2535 0.2535 0.0000 0.0000 0.0000 1010 PRO A O   
6483 N  N   . ASN A 1032 ? 0.3593 0.3593 0.3593 0.0000 0.0000 0.0000 1011 ASN A N   
6484 C  CA  . ASN A 1032 ? 0.3593 0.3593 0.3593 0.0000 0.0000 0.0000 1011 ASN A CA  
6485 C  C   . ASN A 1032 ? 0.3593 0.3593 0.3593 0.0000 0.0000 0.0000 1011 ASN A C   
6486 O  O   . ASN A 1032 ? 0.3593 0.3593 0.3593 0.0000 0.0000 0.0000 1011 ASN A O   
7822 N  N   . LEU B 19   ? 0.8081 0.8081 0.8081 0.0000 0.0000 0.0000 39   LEU B N   
7823 C  CA  . LEU B 19   ? 0.8081 0.8081 0.8081 0.0000 0.0000 0.0000 39   LEU B CA  
7824 C  C   . LEU B 19   ? 0.8081 0.8081 0.8081 0.0000 0.0000 0.0000 39   LEU B C   
7825 O  O   . LEU B 19   ? 0.8081 0.8081 0.8081 0.0000 0.0000 0.0000 39   LEU B O   
7826 C  CB  . LEU B 19   ? 0.8081 0.8081 0.8081 0.0000 0.0000 0.0000 39   LEU B CB  
7827 C  CG  . LEU B 19   ? 0.8081 0.8081 0.8081 0.0000 0.0000 0.0000 39   LEU B CG  
7828 C  CD1 . LEU B 19   ? 0.8081 0.8081 0.8081 0.0000 0.0000 0.0000 39   LEU B CD1 
7829 C  CD2 . LEU B 19   ? 0.8081 0.8081 0.8081 0.0000 0.0000 0.0000 39   LEU B CD2 
7830 N  N   . THR B 20   ? 0.8081 0.8081 0.8081 0.0000 0.0000 0.0000 40   THR B N   
7831 C  CA  . THR B 20   ? 0.8081 0.8081 0.8081 0.0000 0.0000 0.0000 40   THR B CA  
7832 C  C   . THR B 20   ? 0.8081 0.8081 0.8081 0.0000 0.0000 0.0000 40   THR B C   
7833 O  O   . THR B 20   ? 0.8081 0.8081 0.8081 0.0000 0.0000 0.0000 40   THR B O   
7834 C  CB  . THR B 20   ? 0.8081 0.8081 0.8081 0.0000 0.0000 0.0000 40   THR B CB  
7835 O  OG1 . THR B 20   ? 0.8081 0.8081 0.8081 0.0000 0.0000 0.0000 40   THR B OG1 
7836 C  CG2 . THR B 20   ? 0.8081 0.8081 0.8081 0.0000 0.0000 0.0000 40   THR B CG2 
7837 N  N   . PRO B 21   ? 0.8081 0.8081 0.8081 0.0000 0.0000 0.0000 41   PRO B N   
7838 C  CA  . PRO B 21   ? 0.8081 0.8081 0.8081 0.0000 0.0000 0.0000 41   PRO B CA  
7839 C  C   . PRO B 21   ? 0.8081 0.8081 0.8081 0.0000 0.0000 0.0000 41   PRO B C   
7840 O  O   . PRO B 21   ? 0.8081 0.8081 0.8081 0.0000 0.0000 0.0000 41   PRO B O   
7841 C  CB  . PRO B 21   ? 0.8081 0.8081 0.8081 0.0000 0.0000 0.0000 41   PRO B CB  
7842 C  CG  . PRO B 21   ? 0.8081 0.8081 0.8081 0.0000 0.0000 0.0000 41   PRO B CG  
7843 C  CD  . PRO B 21   ? 0.8081 0.8081 0.8081 0.0000 0.0000 0.0000 41   PRO B CD  
7844 N  N   . LEU B 22   ? 0.8081 0.8081 0.8081 0.0000 0.0000 0.0000 42   LEU B N   
7845 C  CA  . LEU B 22   ? 0.8081 0.8081 0.8081 0.0000 0.0000 0.0000 42   LEU B CA  
7846 C  C   . LEU B 22   ? 0.8081 0.8081 0.8081 0.0000 0.0000 0.0000 42   LEU B C   
7847 O  O   . LEU B 22   ? 0.8081 0.8081 0.8081 0.0000 0.0000 0.0000 42   LEU B O   
7848 C  CB  . LEU B 22   ? 0.8081 0.8081 0.8081 0.0000 0.0000 0.0000 42   LEU B CB  
7849 C  CG  . LEU B 22   ? 0.8081 0.8081 0.8081 0.0000 0.0000 0.0000 42   LEU B CG  
7850 C  CD1 . LEU B 22   ? 0.8081 0.8081 0.8081 0.0000 0.0000 0.0000 42   LEU B CD1 
7851 C  CD2 . LEU B 22   ? 0.8081 0.8081 0.8081 0.0000 0.0000 0.0000 42   LEU B CD2 
7852 N  N   . ALA B 23   ? 0.8081 0.8081 0.8081 0.0000 0.0000 0.0000 43   ALA B N   
7853 C  CA  . ALA B 23   ? 0.8081 0.8081 0.8081 0.0000 0.0000 0.0000 43   ALA B CA  
7854 C  C   . ALA B 23   ? 0.8081 0.8081 0.8081 0.0000 0.0000 0.0000 43   ALA B C   
7855 O  O   . ALA B 23   ? 0.8081 0.8081 0.8081 0.0000 0.0000 0.0000 43   ALA B O   
7856 C  CB  . ALA B 23   ? 0.8081 0.8081 0.8081 0.0000 0.0000 0.0000 43   ALA B CB  
7857 N  N   . TYR B 24   ? 0.8081 0.8081 0.8081 0.0000 0.0000 0.0000 44   TYR B N   
7858 C  CA  . TYR B 24   ? 0.8081 0.8081 0.8081 0.0000 0.0000 0.0000 44   TYR B CA  
7859 C  C   . TYR B 24   ? 0.8081 0.8081 0.8081 0.0000 0.0000 0.0000 44   TYR B C   
7860 O  O   . TYR B 24   ? 0.8081 0.8081 0.8081 0.0000 0.0000 0.0000 44   TYR B O   
7861 C  CB  . TYR B 24   ? 0.8081 0.8081 0.8081 0.0000 0.0000 0.0000 44   TYR B CB  
7862 C  CG  . TYR B 24   ? 0.8081 0.8081 0.8081 0.0000 0.0000 0.0000 44   TYR B CG  
7863 C  CD1 . TYR B 24   ? 0.8081 0.8081 0.8081 0.0000 0.0000 0.0000 44   TYR B CD1 
7864 C  CD2 . TYR B 24   ? 0.8081 0.8081 0.8081 0.0000 0.0000 0.0000 44   TYR B CD2 
7865 C  CE1 . TYR B 24   ? 0.8081 0.8081 0.8081 0.0000 0.0000 0.0000 44   TYR B CE1 
7866 C  CE2 . TYR B 24   ? 0.8081 0.8081 0.8081 0.0000 0.0000 0.0000 44   TYR B CE2 
7867 C  CZ  . TYR B 24   ? 0.8081 0.8081 0.8081 0.0000 0.0000 0.0000 44   TYR B CZ  
7868 O  OH  . TYR B 24   ? 0.8081 0.8081 0.8081 0.0000 0.0000 0.0000 44   TYR B OH  
7869 N  N   . LYS B 25   ? 0.8081 0.8081 0.8081 0.0000 0.0000 0.0000 45   LYS B N   
7870 C  CA  . LYS B 25   ? 0.8081 0.8081 0.8081 0.0000 0.0000 0.0000 45   LYS B CA  
7871 C  C   . LYS B 25   ? 0.8081 0.8081 0.8081 0.0000 0.0000 0.0000 45   LYS B C   
7872 O  O   . LYS B 25   ? 0.8081 0.8081 0.8081 0.0000 0.0000 0.0000 45   LYS B O   
7873 C  CB  . LYS B 25   ? 0.8081 0.8081 0.8081 0.0000 0.0000 0.0000 45   LYS B CB  
7874 C  CG  . LYS B 25   ? 0.8081 0.8081 0.8081 0.0000 0.0000 0.0000 45   LYS B CG  
7875 C  CD  . LYS B 25   ? 0.8081 0.8081 0.8081 0.0000 0.0000 0.0000 45   LYS B CD  
7876 C  CE  . LYS B 25   ? 0.8081 0.8081 0.8081 0.0000 0.0000 0.0000 45   LYS B CE  
7877 N  NZ  . LYS B 25   ? 0.8081 0.8081 0.8081 0.0000 0.0000 0.0000 45   LYS B NZ  
7878 N  N   . GLN B 26   ? 0.8081 0.8081 0.8081 0.0000 0.0000 0.0000 46   GLN B N   
7879 C  CA  . GLN B 26   ? 0.8081 0.8081 0.8081 0.0000 0.0000 0.0000 46   GLN B CA  
7880 C  C   . GLN B 26   ? 0.8081 0.8081 0.8081 0.0000 0.0000 0.0000 46   GLN B C   
7881 O  O   . GLN B 26   ? 0.8081 0.8081 0.8081 0.0000 0.0000 0.0000 46   GLN B O   
7882 C  CB  . GLN B 26   ? 0.8081 0.8081 0.8081 0.0000 0.0000 0.0000 46   GLN B CB  
7883 C  CG  . GLN B 26   ? 0.8081 0.8081 0.8081 0.0000 0.0000 0.0000 46   GLN B CG  
7884 C  CD  . GLN B 26   ? 0.8081 0.8081 0.8081 0.0000 0.0000 0.0000 46   GLN B CD  
7885 O  OE1 . GLN B 26   ? 0.8081 0.8081 0.8081 0.0000 0.0000 0.0000 46   GLN B OE1 
7886 N  NE2 . GLN B 26   ? 0.8081 0.8081 0.8081 0.0000 0.0000 0.0000 46   GLN B NE2 
7887 N  N   . PHE B 27   ? 0.8081 0.8081 0.8081 0.0000 0.0000 0.0000 47   PHE B N   
7888 C  CA  . PHE B 27   ? 0.8081 0.8081 0.8081 0.0000 0.0000 0.0000 47   PHE B CA  
7889 C  C   . PHE B 27   ? 0.8081 0.8081 0.8081 0.0000 0.0000 0.0000 47   PHE B C   
7890 O  O   . PHE B 27   ? 0.8081 0.8081 0.8081 0.0000 0.0000 0.0000 47   PHE B O   
7891 C  CB  . PHE B 27   ? 0.8081 0.8081 0.8081 0.0000 0.0000 0.0000 47   PHE B CB  
7892 C  CG  . PHE B 27   ? 0.8081 0.8081 0.8081 0.0000 0.0000 0.0000 47   PHE B CG  
7893 C  CD1 . PHE B 27   ? 0.8081 0.8081 0.8081 0.0000 0.0000 0.0000 47   PHE B CD1 
7894 C  CD2 . PHE B 27   ? 0.8081 0.8081 0.8081 0.0000 0.0000 0.0000 47   PHE B CD2 
7895 C  CE1 . PHE B 27   ? 0.8081 0.8081 0.8081 0.0000 0.0000 0.0000 47   PHE B CE1 
7896 C  CE2 . PHE B 27   ? 0.8081 0.8081 0.8081 0.0000 0.0000 0.0000 47   PHE B CE2 
7897 C  CZ  . PHE B 27   ? 0.8081 0.8081 0.8081 0.0000 0.0000 0.0000 47   PHE B CZ  
7898 N  N   . ILE B 28   ? 0.8081 0.8081 0.8081 0.0000 0.0000 0.0000 48   ILE B N   
7899 C  CA  . ILE B 28   ? 0.8081 0.8081 0.8081 0.0000 0.0000 0.0000 48   ILE B CA  
7900 C  C   . ILE B 28   ? 0.8081 0.8081 0.8081 0.0000 0.0000 0.0000 48   ILE B C   
7901 O  O   . ILE B 28   ? 0.8081 0.8081 0.8081 0.0000 0.0000 0.0000 48   ILE B O   
7902 C  CB  . ILE B 28   ? 0.8081 0.8081 0.8081 0.0000 0.0000 0.0000 48   ILE B CB  
7903 C  CG1 . ILE B 28   ? 0.8081 0.8081 0.8081 0.0000 0.0000 0.0000 48   ILE B CG1 
7904 C  CG2 . ILE B 28   ? 0.8081 0.8081 0.8081 0.0000 0.0000 0.0000 48   ILE B CG2 
7905 C  CD1 . ILE B 28   ? 0.8081 0.8081 0.8081 0.0000 0.0000 0.0000 48   ILE B CD1 
7906 N  N   . PRO B 29   ? 0.8081 0.8081 0.8081 0.0000 0.0000 0.0000 49   PRO B N   
7907 C  CA  . PRO B 29   ? 0.8081 0.8081 0.8081 0.0000 0.0000 0.0000 49   PRO B CA  
7908 C  C   . PRO B 29   ? 0.8081 0.8081 0.8081 0.0000 0.0000 0.0000 49   PRO B C   
7909 O  O   . PRO B 29   ? 0.8081 0.8081 0.8081 0.0000 0.0000 0.0000 49   PRO B O   
7910 C  CB  . PRO B 29   ? 0.8081 0.8081 0.8081 0.0000 0.0000 0.0000 49   PRO B CB  
7911 C  CG  . PRO B 29   ? 0.8081 0.8081 0.8081 0.0000 0.0000 0.0000 49   PRO B CG  
7912 C  CD  . PRO B 29   ? 0.8081 0.8081 0.8081 0.0000 0.0000 0.0000 49   PRO B CD  
7913 N  N   . ASN B 30   ? 0.8081 0.8081 0.8081 0.0000 0.0000 0.0000 50   ASN B N   
7914 C  CA  . ASN B 30   ? 0.8081 0.8081 0.8081 0.0000 0.0000 0.0000 50   ASN B CA  
7915 C  C   . ASN B 30   ? 0.8081 0.8081 0.8081 0.0000 0.0000 0.0000 50   ASN B C   
7916 O  O   . ASN B 30   ? 0.8081 0.8081 0.8081 0.0000 0.0000 0.0000 50   ASN B O   
7917 C  CB  . ASN B 30   ? 0.8081 0.8081 0.8081 0.0000 0.0000 0.0000 50   ASN B CB  
7918 C  CG  . ASN B 30   ? 0.8081 0.8081 0.8081 0.0000 0.0000 0.0000 50   ASN B CG  
7919 O  OD1 . ASN B 30   ? 0.8081 0.8081 0.8081 0.0000 0.0000 0.0000 50   ASN B OD1 
7920 N  ND2 . ASN B 30   ? 0.8081 0.8081 0.8081 0.0000 0.0000 0.0000 50   ASN B ND2 
7921 N  N   . VAL B 31   ? 0.8081 0.8081 0.8081 0.0000 0.0000 0.0000 51   VAL B N   
7922 C  CA  . VAL B 31   ? 0.8081 0.8081 0.8081 0.0000 0.0000 0.0000 51   VAL B CA  
7923 C  C   . VAL B 31   ? 0.8081 0.8081 0.8081 0.0000 0.0000 0.0000 51   VAL B C   
7924 O  O   . VAL B 31   ? 0.8081 0.8081 0.8081 0.0000 0.0000 0.0000 51   VAL B O   
7925 C  CB  . VAL B 31   ? 0.8081 0.8081 0.8081 0.0000 0.0000 0.0000 51   VAL B CB  
7926 C  CG1 . VAL B 31   ? 0.8081 0.8081 0.8081 0.0000 0.0000 0.0000 51   VAL B CG1 
7927 C  CG2 . VAL B 31   ? 0.8081 0.8081 0.8081 0.0000 0.0000 0.0000 51   VAL B CG2 
7928 N  N   . ALA B 32   ? 0.8081 0.8081 0.8081 0.0000 0.0000 0.0000 52   ALA B N   
7929 C  CA  . ALA B 32   ? 0.8081 0.8081 0.8081 0.0000 0.0000 0.0000 52   ALA B CA  
7930 C  C   . ALA B 32   ? 0.8081 0.8081 0.8081 0.0000 0.0000 0.0000 52   ALA B C   
7931 O  O   . ALA B 32   ? 0.8081 0.8081 0.8081 0.0000 0.0000 0.0000 52   ALA B O   
7932 C  CB  . ALA B 32   ? 0.8081 0.8081 0.8081 0.0000 0.0000 0.0000 52   ALA B CB  
7933 N  N   . GLU B 33   ? 0.8081 0.8081 0.8081 0.0000 0.0000 0.0000 53   GLU B N   
7934 C  CA  . GLU B 33   ? 0.8081 0.8081 0.8081 0.0000 0.0000 0.0000 53   GLU B CA  
7935 C  C   . GLU B 33   ? 0.8081 0.8081 0.8081 0.0000 0.0000 0.0000 53   GLU B C   
7936 O  O   . GLU B 33   ? 0.8081 0.8081 0.8081 0.0000 0.0000 0.0000 53   GLU B O   
7937 C  CB  . GLU B 33   ? 0.8081 0.8081 0.8081 0.0000 0.0000 0.0000 53   GLU B CB  
7938 C  CG  . GLU B 33   ? 0.8081 0.8081 0.8081 0.0000 0.0000 0.0000 53   GLU B CG  
7939 C  CD  . GLU B 33   ? 0.8081 0.8081 0.8081 0.0000 0.0000 0.0000 53   GLU B CD  
7940 O  OE1 . GLU B 33   ? 0.8081 0.8081 0.8081 0.0000 0.0000 0.0000 53   GLU B OE1 
7941 O  OE2 . GLU B 33   ? 0.8081 0.8081 0.8081 0.0000 0.0000 0.0000 53   GLU B OE2 
7942 N  N   . LYS B 34   ? 0.8395 0.8395 0.8395 0.0000 0.0000 0.0000 54   LYS B N   
7943 C  CA  . LYS B 34   ? 0.8395 0.8395 0.8395 0.0000 0.0000 0.0000 54   LYS B CA  
7944 C  C   . LYS B 34   ? 0.8395 0.8395 0.8395 0.0000 0.0000 0.0000 54   LYS B C   
7945 O  O   . LYS B 34   ? 0.8395 0.8395 0.8395 0.0000 0.0000 0.0000 54   LYS B O   
7946 C  CB  . LYS B 34   ? 0.8395 0.8395 0.8395 0.0000 0.0000 0.0000 54   LYS B CB  
7947 C  CG  . LYS B 34   ? 0.8395 0.8395 0.8395 0.0000 0.0000 0.0000 54   LYS B CG  
7948 C  CD  . LYS B 34   ? 0.8395 0.8395 0.8395 0.0000 0.0000 0.0000 54   LYS B CD  
7949 C  CE  . LYS B 34   ? 0.8395 0.8395 0.8395 0.0000 0.0000 0.0000 54   LYS B CE  
7950 N  NZ  . LYS B 34   ? 0.8395 0.8395 0.8395 0.0000 0.0000 0.0000 54   LYS B NZ  
7951 N  N   . THR B 35   ? 0.8118 0.8118 0.8118 0.0000 0.0000 0.0000 55   THR B N   
7952 C  CA  . THR B 35   ? 0.8118 0.8118 0.8118 0.0000 0.0000 0.0000 55   THR B CA  
7953 C  C   . THR B 35   ? 0.8118 0.8118 0.8118 0.0000 0.0000 0.0000 55   THR B C   
7954 O  O   . THR B 35   ? 0.8118 0.8118 0.8118 0.0000 0.0000 0.0000 55   THR B O   
7955 C  CB  . THR B 35   ? 0.8118 0.8118 0.8118 0.0000 0.0000 0.0000 55   THR B CB  
7956 O  OG1 . THR B 35   ? 0.8118 0.8118 0.8118 0.0000 0.0000 0.0000 55   THR B OG1 
7957 C  CG2 . THR B 35   ? 0.8118 0.8118 0.8118 0.0000 0.0000 0.0000 55   THR B CG2 
7958 N  N   . LEU B 36   ? 0.8235 0.8235 0.8235 0.0000 0.0000 0.0000 56   LEU B N   
7959 C  CA  . LEU B 36   ? 0.8235 0.8235 0.8235 0.0000 0.0000 0.0000 56   LEU B CA  
7960 C  C   . LEU B 36   ? 0.8235 0.8235 0.8235 0.0000 0.0000 0.0000 56   LEU B C   
7961 O  O   . LEU B 36   ? 0.8235 0.8235 0.8235 0.0000 0.0000 0.0000 56   LEU B O   
7962 C  CB  . LEU B 36   ? 0.8235 0.8235 0.8235 0.0000 0.0000 0.0000 56   LEU B CB  
7963 C  CG  . LEU B 36   ? 0.8235 0.8235 0.8235 0.0000 0.0000 0.0000 56   LEU B CG  
7964 C  CD1 . LEU B 36   ? 0.8235 0.8235 0.8235 0.0000 0.0000 0.0000 56   LEU B CD1 
7965 C  CD2 . LEU B 36   ? 0.8235 0.8235 0.8235 0.0000 0.0000 0.0000 56   LEU B CD2 
7966 N  N   . GLY B 37   ? 0.8276 0.8276 0.8276 0.0000 0.0000 0.0000 57   GLY B N   
7967 C  CA  . GLY B 37   ? 0.8276 0.8276 0.8276 0.0000 0.0000 0.0000 57   GLY B CA  
7968 C  C   . GLY B 37   ? 0.8276 0.8276 0.8276 0.0000 0.0000 0.0000 57   GLY B C   
7969 O  O   . GLY B 37   ? 0.8276 0.8276 0.8276 0.0000 0.0000 0.0000 57   GLY B O   
7970 N  N   . ALA B 38   ? 0.8302 0.8302 0.8302 0.0000 0.0000 0.0000 58   ALA B N   
7971 C  CA  . ALA B 38   ? 0.8302 0.8302 0.8302 0.0000 0.0000 0.0000 58   ALA B CA  
7972 C  C   . ALA B 38   ? 0.8302 0.8302 0.8302 0.0000 0.0000 0.0000 58   ALA B C   
7973 O  O   . ALA B 38   ? 0.8302 0.8302 0.8302 0.0000 0.0000 0.0000 58   ALA B O   
7974 C  CB  . ALA B 38   ? 0.8302 0.8302 0.8302 0.0000 0.0000 0.0000 58   ALA B CB  
7975 N  N   . SER B 39   ? 0.8367 0.8367 0.8367 0.0000 0.0000 0.0000 59   SER B N   
7976 C  CA  . SER B 39   ? 0.8367 0.8367 0.8367 0.0000 0.0000 0.0000 59   SER B CA  
7977 C  C   . SER B 39   ? 0.8367 0.8367 0.8367 0.0000 0.0000 0.0000 59   SER B C   
7978 O  O   . SER B 39   ? 0.8367 0.8367 0.8367 0.0000 0.0000 0.0000 59   SER B O   
7979 C  CB  . SER B 39   ? 0.8367 0.8367 0.8367 0.0000 0.0000 0.0000 59   SER B CB  
7980 O  OG  . SER B 39   ? 0.8367 0.8367 0.8367 0.0000 0.0000 0.0000 59   SER B OG  
7981 N  N   . GLY B 40   ? 0.8776 0.8776 0.8776 0.0000 0.0000 0.0000 60   GLY B N   
7982 C  CA  . GLY B 40   ? 0.8776 0.8776 0.8776 0.0000 0.0000 0.0000 60   GLY B CA  
7983 C  C   . GLY B 40   ? 0.8776 0.8776 0.8776 0.0000 0.0000 0.0000 60   GLY B C   
7984 O  O   . GLY B 40   ? 0.8776 0.8776 0.8776 0.0000 0.0000 0.0000 60   GLY B O   
7985 N  N   . ARG B 41   ? 0.9936 0.9936 0.9936 0.0000 0.0000 0.0000 61   ARG B N   
7986 C  CA  . ARG B 41   ? 0.9936 0.9936 0.9936 0.0000 0.0000 0.0000 61   ARG B CA  
7987 C  C   . ARG B 41   ? 0.9936 0.9936 0.9936 0.0000 0.0000 0.0000 61   ARG B C   
7988 O  O   . ARG B 41   ? 0.9936 0.9936 0.9936 0.0000 0.0000 0.0000 61   ARG B O   
7989 C  CB  . ARG B 41   ? 0.9936 0.9936 0.9936 0.0000 0.0000 0.0000 61   ARG B CB  
7990 C  CG  . ARG B 41   ? 0.9936 0.9936 0.9936 0.0000 0.0000 0.0000 61   ARG B CG  
7991 C  CD  . ARG B 41   ? 0.9936 0.9936 0.9936 0.0000 0.0000 0.0000 61   ARG B CD  
7992 N  NE  . ARG B 41   ? 0.9936 0.9936 0.9936 0.0000 0.0000 0.0000 61   ARG B NE  
7993 C  CZ  . ARG B 41   ? 0.9936 0.9936 0.9936 0.0000 0.0000 0.0000 61   ARG B CZ  
7994 N  NH1 . ARG B 41   ? 0.9936 0.9936 0.9936 0.0000 0.0000 0.0000 61   ARG B NH1 
7995 N  NH2 . ARG B 41   ? 0.9936 0.9936 0.9936 0.0000 0.0000 0.0000 61   ARG B NH2 
7996 N  N   . TYR B 42   ? 1.0213 1.0213 1.0213 0.0000 0.0000 0.0000 62   TYR B N   
7997 C  CA  . TYR B 42   ? 1.0213 1.0213 1.0213 0.0000 0.0000 0.0000 62   TYR B CA  
7998 C  C   . TYR B 42   ? 1.0213 1.0213 1.0213 0.0000 0.0000 0.0000 62   TYR B C   
7999 O  O   . TYR B 42   ? 1.0213 1.0213 1.0213 0.0000 0.0000 0.0000 62   TYR B O   
8000 C  CB  . TYR B 42   ? 1.0213 1.0213 1.0213 0.0000 0.0000 0.0000 62   TYR B CB  
8001 C  CG  . TYR B 42   ? 1.0213 1.0213 1.0213 0.0000 0.0000 0.0000 62   TYR B CG  
8002 C  CD1 . TYR B 42   ? 1.0213 1.0213 1.0213 0.0000 0.0000 0.0000 62   TYR B CD1 
8003 C  CD2 . TYR B 42   ? 1.0213 1.0213 1.0213 0.0000 0.0000 0.0000 62   TYR B CD2 
8004 C  CE1 . TYR B 42   ? 1.0213 1.0213 1.0213 0.0000 0.0000 0.0000 62   TYR B CE1 
8005 C  CE2 . TYR B 42   ? 1.0213 1.0213 1.0213 0.0000 0.0000 0.0000 62   TYR B CE2 
8006 C  CZ  . TYR B 42   ? 1.0213 1.0213 1.0213 0.0000 0.0000 0.0000 62   TYR B CZ  
8007 O  OH  . TYR B 42   ? 1.0213 1.0213 1.0213 0.0000 0.0000 0.0000 62   TYR B OH  
8008 N  N   . GLU B 43   ? 1.0965 1.0965 1.0965 0.0000 0.0000 0.0000 63   GLU B N   
8009 C  CA  . GLU B 43   ? 1.0965 1.0965 1.0965 0.0000 0.0000 0.0000 63   GLU B CA  
8010 C  C   . GLU B 43   ? 1.0965 1.0965 1.0965 0.0000 0.0000 0.0000 63   GLU B C   
8011 O  O   . GLU B 43   ? 1.0965 1.0965 1.0965 0.0000 0.0000 0.0000 63   GLU B O   
8012 C  CB  . GLU B 43   ? 1.0965 1.0965 1.0965 0.0000 0.0000 0.0000 63   GLU B CB  
8013 C  CG  . GLU B 43   ? 1.0965 1.0965 1.0965 0.0000 0.0000 0.0000 63   GLU B CG  
8014 C  CD  . GLU B 43   ? 1.0965 1.0965 1.0965 0.0000 0.0000 0.0000 63   GLU B CD  
8015 O  OE1 . GLU B 43   ? 1.0965 1.0965 1.0965 0.0000 0.0000 0.0000 63   GLU B OE1 
8016 O  OE2 . GLU B 43   ? 1.0965 1.0965 1.0965 0.0000 0.0000 0.0000 63   GLU B OE2 
8017 N  N   . GLY B 44   ? 1.0860 1.0860 1.0860 0.0000 0.0000 0.0000 64   GLY B N   
8018 C  CA  . GLY B 44   ? 1.0860 1.0860 1.0860 0.0000 0.0000 0.0000 64   GLY B CA  
8019 C  C   . GLY B 44   ? 1.0860 1.0860 1.0860 0.0000 0.0000 0.0000 64   GLY B C   
8020 O  O   . GLY B 44   ? 1.0860 1.0860 1.0860 0.0000 0.0000 0.0000 64   GLY B O   
8021 N  N   . LYS B 45   ? 1.0932 1.0932 1.0932 0.0000 0.0000 0.0000 65   LYS B N   
8022 C  CA  . LYS B 45   ? 1.0932 1.0932 1.0932 0.0000 0.0000 0.0000 65   LYS B CA  
8023 C  C   . LYS B 45   ? 1.0932 1.0932 1.0932 0.0000 0.0000 0.0000 65   LYS B C   
8024 O  O   . LYS B 45   ? 1.0932 1.0932 1.0932 0.0000 0.0000 0.0000 65   LYS B O   
8025 C  CB  . LYS B 45   ? 1.0932 1.0932 1.0932 0.0000 0.0000 0.0000 65   LYS B CB  
8026 C  CG  . LYS B 45   ? 1.0932 1.0932 1.0932 0.0000 0.0000 0.0000 65   LYS B CG  
8027 C  CD  . LYS B 45   ? 1.0932 1.0932 1.0932 0.0000 0.0000 0.0000 65   LYS B CD  
8028 C  CE  . LYS B 45   ? 1.0932 1.0932 1.0932 0.0000 0.0000 0.0000 65   LYS B CE  
8029 N  NZ  . LYS B 45   ? 1.0932 1.0932 1.0932 0.0000 0.0000 0.0000 65   LYS B NZ  
8030 N  N   . ILE B 46   ? 1.1399 1.1399 1.1399 0.0000 0.0000 0.0000 66   ILE B N   
8031 C  CA  . ILE B 46   ? 1.1399 1.1399 1.1399 0.0000 0.0000 0.0000 66   ILE B CA  
8032 C  C   . ILE B 46   ? 1.1399 1.1399 1.1399 0.0000 0.0000 0.0000 66   ILE B C   
8033 O  O   . ILE B 46   ? 1.1399 1.1399 1.1399 0.0000 0.0000 0.0000 66   ILE B O   
8034 C  CB  . ILE B 46   ? 1.1399 1.1399 1.1399 0.0000 0.0000 0.0000 66   ILE B CB  
8035 C  CG1 . ILE B 46   ? 1.1399 1.1399 1.1399 0.0000 0.0000 0.0000 66   ILE B CG1 
8036 C  CG2 . ILE B 46   ? 1.1399 1.1399 1.1399 0.0000 0.0000 0.0000 66   ILE B CG2 
8037 C  CD1 . ILE B 46   ? 1.1399 1.1399 1.1399 0.0000 0.0000 0.0000 66   ILE B CD1 
8038 N  N   . SER B 47   ? 1.1673 1.1673 1.1673 0.0000 0.0000 0.0000 67   SER B N   
8039 C  CA  . SER B 47   ? 1.1673 1.1673 1.1673 0.0000 0.0000 0.0000 67   SER B CA  
8040 C  C   . SER B 47   ? 1.1673 1.1673 1.1673 0.0000 0.0000 0.0000 67   SER B C   
8041 O  O   . SER B 47   ? 1.1673 1.1673 1.1673 0.0000 0.0000 0.0000 67   SER B O   
8044 N  N   . ARG B 48   ? 1.2484 1.2484 1.2484 0.0000 0.0000 0.0000 68   ARG B N   
8045 C  CA  . ARG B 48   ? 1.2484 1.2484 1.2484 0.0000 0.0000 0.0000 68   ARG B CA  
8046 C  C   . ARG B 48   ? 1.2484 1.2484 1.2484 0.0000 0.0000 0.0000 68   ARG B C   
8047 O  O   . ARG B 48   ? 1.2484 1.2484 1.2484 0.0000 0.0000 0.0000 68   ARG B O   
8048 C  CB  . ARG B 48   ? 1.2484 1.2484 1.2484 0.0000 0.0000 0.0000 68   ARG B CB  
8049 C  CG  . ARG B 48   ? 1.2484 1.2484 1.2484 0.0000 0.0000 0.0000 68   ARG B CG  
8050 C  CD  . ARG B 48   ? 1.2484 1.2484 1.2484 0.0000 0.0000 0.0000 68   ARG B CD  
8051 N  NE  . ARG B 48   ? 1.2484 1.2484 1.2484 0.0000 0.0000 0.0000 68   ARG B NE  
8052 C  CZ  . ARG B 48   ? 1.2484 1.2484 1.2484 0.0000 0.0000 0.0000 68   ARG B CZ  
8053 N  NH1 . ARG B 48   ? 1.2484 1.2484 1.2484 0.0000 0.0000 0.0000 68   ARG B NH1 
8054 N  NH2 . ARG B 48   ? 1.2484 1.2484 1.2484 0.0000 0.0000 0.0000 68   ARG B NH2 
8055 N  N   . ASN B 49   ? 1.2879 1.2879 1.2879 0.0000 0.0000 0.0000 69   ASN B N   
8056 C  CA  . ASN B 49   ? 1.2879 1.2879 1.2879 0.0000 0.0000 0.0000 69   ASN B CA  
8057 C  C   . ASN B 49   ? 1.2879 1.2879 1.2879 0.0000 0.0000 0.0000 69   ASN B C   
8058 O  O   . ASN B 49   ? 1.2879 1.2879 1.2879 0.0000 0.0000 0.0000 69   ASN B O   
8059 C  CB  . ASN B 49   ? 1.2879 1.2879 1.2879 0.0000 0.0000 0.0000 69   ASN B CB  
8060 C  CG  . ASN B 49   ? 1.2879 1.2879 1.2879 0.0000 0.0000 0.0000 69   ASN B CG  
8061 O  OD1 . ASN B 49   ? 1.2879 1.2879 1.2879 0.0000 0.0000 0.0000 69   ASN B OD1 
8062 N  ND2 . ASN B 49   ? 1.2879 1.2879 1.2879 0.0000 0.0000 0.0000 69   ASN B ND2 
8063 N  N   . SER B 50   ? 1.2613 1.2613 1.2613 0.0000 0.0000 0.0000 70   SER B N   
8064 C  CA  . SER B 50   ? 1.2613 1.2613 1.2613 0.0000 0.0000 0.0000 70   SER B CA  
8065 C  C   . SER B 50   ? 1.2613 1.2613 1.2613 0.0000 0.0000 0.0000 70   SER B C   
8066 O  O   . SER B 50   ? 1.2613 1.2613 1.2613 0.0000 0.0000 0.0000 70   SER B O   
8067 C  CB  . SER B 50   ? 1.2613 1.2613 1.2613 0.0000 0.0000 0.0000 70   SER B CB  
8068 O  OG  . SER B 50   ? 1.2613 1.2613 1.2613 0.0000 0.0000 0.0000 70   SER B OG  
8069 N  N   . GLU B 51   ? 1.2763 1.2763 1.2763 0.0000 0.0000 0.0000 71   GLU B N   
8070 C  CA  . GLU B 51   ? 1.2763 1.2763 1.2763 0.0000 0.0000 0.0000 71   GLU B CA  
8071 C  C   . GLU B 51   ? 1.2763 1.2763 1.2763 0.0000 0.0000 0.0000 71   GLU B C   
8072 O  O   . GLU B 51   ? 1.2763 1.2763 1.2763 0.0000 0.0000 0.0000 71   GLU B O   
8073 C  CB  . GLU B 51   ? 1.2763 1.2763 1.2763 0.0000 0.0000 0.0000 71   GLU B CB  
8074 C  CG  . GLU B 51   ? 1.2763 1.2763 1.2763 0.0000 0.0000 0.0000 71   GLU B CG  
8075 C  CD  . GLU B 51   ? 1.2763 1.2763 1.2763 0.0000 0.0000 0.0000 71   GLU B CD  
8076 O  OE1 . GLU B 51   ? 1.2763 1.2763 1.2763 0.0000 0.0000 0.0000 71   GLU B OE1 
8077 O  OE2 . GLU B 51   ? 1.2763 1.2763 1.2763 0.0000 0.0000 0.0000 71   GLU B OE2 
8078 N  N   . ARG B 52   ? 1.2461 1.2461 1.2461 0.0000 0.0000 0.0000 72   ARG B N   
8079 C  CA  . ARG B 52   ? 1.2461 1.2461 1.2461 0.0000 0.0000 0.0000 72   ARG B CA  
8080 C  C   . ARG B 52   ? 1.2461 1.2461 1.2461 0.0000 0.0000 0.0000 72   ARG B C   
8081 O  O   . ARG B 52   ? 1.2461 1.2461 1.2461 0.0000 0.0000 0.0000 72   ARG B O   
8082 C  CB  . ARG B 52   ? 1.2461 1.2461 1.2461 0.0000 0.0000 0.0000 72   ARG B CB  
8083 C  CG  . ARG B 52   ? 1.2461 1.2461 1.2461 0.0000 0.0000 0.0000 72   ARG B CG  
8084 C  CD  . ARG B 52   ? 1.2461 1.2461 1.2461 0.0000 0.0000 0.0000 72   ARG B CD  
8085 N  NE  . ARG B 52   ? 1.2461 1.2461 1.2461 0.0000 0.0000 0.0000 72   ARG B NE  
8086 C  CZ  . ARG B 52   ? 1.2461 1.2461 1.2461 0.0000 0.0000 0.0000 72   ARG B CZ  
8087 N  NH1 . ARG B 52   ? 1.2461 1.2461 1.2461 0.0000 0.0000 0.0000 72   ARG B NH1 
8088 N  NH2 . ARG B 52   ? 1.2461 1.2461 1.2461 0.0000 0.0000 0.0000 72   ARG B NH2 
8089 N  N   . PHE B 53   ? 1.2240 1.2240 1.2240 0.0000 0.0000 0.0000 73   PHE B N   
8090 C  CA  . PHE B 53   ? 1.2240 1.2240 1.2240 0.0000 0.0000 0.0000 73   PHE B CA  
8091 C  C   . PHE B 53   ? 1.2240 1.2240 1.2240 0.0000 0.0000 0.0000 73   PHE B C   
8092 O  O   . PHE B 53   ? 1.2240 1.2240 1.2240 0.0000 0.0000 0.0000 73   PHE B O   
8093 C  CB  . PHE B 53   ? 1.2240 1.2240 1.2240 0.0000 0.0000 0.0000 73   PHE B CB  
8094 C  CG  . PHE B 53   ? 1.2240 1.2240 1.2240 0.0000 0.0000 0.0000 73   PHE B CG  
8095 C  CD1 . PHE B 53   ? 1.2240 1.2240 1.2240 0.0000 0.0000 0.0000 73   PHE B CD1 
8096 C  CD2 . PHE B 53   ? 1.2240 1.2240 1.2240 0.0000 0.0000 0.0000 73   PHE B CD2 
8097 C  CE1 . PHE B 53   ? 1.2240 1.2240 1.2240 0.0000 0.0000 0.0000 73   PHE B CE1 
8098 C  CE2 . PHE B 53   ? 1.2240 1.2240 1.2240 0.0000 0.0000 0.0000 73   PHE B CE2 
8099 C  CZ  . PHE B 53   ? 1.2240 1.2240 1.2240 0.0000 0.0000 0.0000 73   PHE B CZ  
8100 N  N   . LYS B 54   ? 1.2279 1.2279 1.2279 0.0000 0.0000 0.0000 74   LYS B N   
8101 C  CA  . LYS B 54   ? 1.2279 1.2279 1.2279 0.0000 0.0000 0.0000 74   LYS B CA  
8102 C  C   . LYS B 54   ? 1.2279 1.2279 1.2279 0.0000 0.0000 0.0000 74   LYS B C   
8103 O  O   . LYS B 54   ? 1.2279 1.2279 1.2279 0.0000 0.0000 0.0000 74   LYS B O   
8104 C  CB  . LYS B 54   ? 1.2279 1.2279 1.2279 0.0000 0.0000 0.0000 74   LYS B CB  
8105 C  CG  . LYS B 54   ? 1.2279 1.2279 1.2279 0.0000 0.0000 0.0000 74   LYS B CG  
8106 C  CD  . LYS B 54   ? 1.2279 1.2279 1.2279 0.0000 0.0000 0.0000 74   LYS B CD  
8107 C  CE  . LYS B 54   ? 1.2279 1.2279 1.2279 0.0000 0.0000 0.0000 74   LYS B CE  
8108 N  NZ  . LYS B 54   ? 1.2279 1.2279 1.2279 0.0000 0.0000 0.0000 74   LYS B NZ  
8109 N  N   . GLU B 55   ? 1.1727 1.1727 1.1727 0.0000 0.0000 0.0000 75   GLU B N   
8110 C  CA  . GLU B 55   ? 1.1727 1.1727 1.1727 0.0000 0.0000 0.0000 75   GLU B CA  
8111 C  C   . GLU B 55   ? 1.1727 1.1727 1.1727 0.0000 0.0000 0.0000 75   GLU B C   
8112 O  O   . GLU B 55   ? 1.1727 1.1727 1.1727 0.0000 0.0000 0.0000 75   GLU B O   
8113 C  CB  . GLU B 55   ? 1.1727 1.1727 1.1727 0.0000 0.0000 0.0000 75   GLU B CB  
8114 C  CG  . GLU B 55   ? 1.1727 1.1727 1.1727 0.0000 0.0000 0.0000 75   GLU B CG  
8115 C  CD  . GLU B 55   ? 1.1727 1.1727 1.1727 0.0000 0.0000 0.0000 75   GLU B CD  
8116 O  OE1 . GLU B 55   ? 1.1727 1.1727 1.1727 0.0000 0.0000 0.0000 75   GLU B OE1 
8117 O  OE2 . GLU B 55   ? 1.1727 1.1727 1.1727 0.0000 0.0000 0.0000 75   GLU B OE2 
8118 N  N   . LEU B 56   ? 1.1174 1.1174 1.1174 0.0000 0.0000 0.0000 76   LEU B N   
8119 C  CA  . LEU B 56   ? 1.1174 1.1174 1.1174 0.0000 0.0000 0.0000 76   LEU B CA  
8120 C  C   . LEU B 56   ? 1.1174 1.1174 1.1174 0.0000 0.0000 0.0000 76   LEU B C   
8121 O  O   . LEU B 56   ? 1.1174 1.1174 1.1174 0.0000 0.0000 0.0000 76   LEU B O   
8122 C  CB  . LEU B 56   ? 1.1174 1.1174 1.1174 0.0000 0.0000 0.0000 76   LEU B CB  
8123 C  CG  . LEU B 56   ? 1.1174 1.1174 1.1174 0.0000 0.0000 0.0000 76   LEU B CG  
8124 C  CD1 . LEU B 56   ? 1.1174 1.1174 1.1174 0.0000 0.0000 0.0000 76   LEU B CD1 
8125 C  CD2 . LEU B 56   ? 1.1174 1.1174 1.1174 0.0000 0.0000 0.0000 76   LEU B CD2 
8126 N  N   . THR B 57   ? 1.0458 1.0458 1.0458 0.0000 0.0000 0.0000 77   THR B N   
8127 C  CA  . THR B 57   ? 1.0458 1.0458 1.0458 0.0000 0.0000 0.0000 77   THR B CA  
8128 C  C   . THR B 57   ? 1.0458 1.0458 1.0458 0.0000 0.0000 0.0000 77   THR B C   
8129 O  O   . THR B 57   ? 1.0458 1.0458 1.0458 0.0000 0.0000 0.0000 77   THR B O   
8130 C  CB  . THR B 57   ? 1.0458 1.0458 1.0458 0.0000 0.0000 0.0000 77   THR B CB  
8131 O  OG1 . THR B 57   ? 1.0458 1.0458 1.0458 0.0000 0.0000 0.0000 77   THR B OG1 
8132 C  CG2 . THR B 57   ? 1.0458 1.0458 1.0458 0.0000 0.0000 0.0000 77   THR B CG2 
8133 N  N   . PRO B 58   ? 1.0142 1.0142 1.0142 0.0000 0.0000 0.0000 78   PRO B N   
8134 C  CA  . PRO B 58   ? 1.0142 1.0142 1.0142 0.0000 0.0000 0.0000 78   PRO B CA  
8135 C  C   . PRO B 58   ? 1.0142 1.0142 1.0142 0.0000 0.0000 0.0000 78   PRO B C   
8136 O  O   . PRO B 58   ? 1.0142 1.0142 1.0142 0.0000 0.0000 0.0000 78   PRO B O   
8137 C  CB  . PRO B 58   ? 1.0142 1.0142 1.0142 0.0000 0.0000 0.0000 78   PRO B CB  
8138 C  CG  . PRO B 58   ? 1.0142 1.0142 1.0142 0.0000 0.0000 0.0000 78   PRO B CG  
8139 C  CD  . PRO B 58   ? 1.0142 1.0142 1.0142 0.0000 0.0000 0.0000 78   PRO B CD  
8140 N  N   . ASN B 59   ? 0.9728 0.9728 0.9728 0.0000 0.0000 0.0000 79   ASN B N   
8141 C  CA  . ASN B 59   ? 0.9728 0.9728 0.9728 0.0000 0.0000 0.0000 79   ASN B CA  
8142 C  C   . ASN B 59   ? 0.9728 0.9728 0.9728 0.0000 0.0000 0.0000 79   ASN B C   
8143 O  O   . ASN B 59   ? 0.9728 0.9728 0.9728 0.0000 0.0000 0.0000 79   ASN B O   
8144 C  CB  . ASN B 59   ? 0.9728 0.9728 0.9728 0.0000 0.0000 0.0000 79   ASN B CB  
8145 C  CG  . ASN B 59   ? 0.9728 0.9728 0.9728 0.0000 0.0000 0.0000 79   ASN B CG  
8146 O  OD1 . ASN B 59   ? 0.9728 0.9728 0.9728 0.0000 0.0000 0.0000 79   ASN B OD1 
8147 N  ND2 . ASN B 59   ? 0.9728 0.9728 0.9728 0.0000 0.0000 0.0000 79   ASN B ND2 
8148 N  N   . TYR B 60   ? 0.9913 0.9913 0.9913 0.0000 0.0000 0.0000 80   TYR B N   
8149 C  CA  . TYR B 60   ? 0.9913 0.9913 0.9913 0.0000 0.0000 0.0000 80   TYR B CA  
8150 C  C   . TYR B 60   ? 0.9913 0.9913 0.9913 0.0000 0.0000 0.0000 80   TYR B C   
8151 O  O   . TYR B 60   ? 0.9913 0.9913 0.9913 0.0000 0.0000 0.0000 80   TYR B O   
8152 C  CB  . TYR B 60   ? 0.9913 0.9913 0.9913 0.0000 0.0000 0.0000 80   TYR B CB  
8153 C  CG  . TYR B 60   ? 0.9913 0.9913 0.9913 0.0000 0.0000 0.0000 80   TYR B CG  
8154 C  CD1 . TYR B 60   ? 0.9913 0.9913 0.9913 0.0000 0.0000 0.0000 80   TYR B CD1 
8155 C  CD2 . TYR B 60   ? 0.9913 0.9913 0.9913 0.0000 0.0000 0.0000 80   TYR B CD2 
8156 C  CE1 . TYR B 60   ? 0.9913 0.9913 0.9913 0.0000 0.0000 0.0000 80   TYR B CE1 
8157 C  CE2 . TYR B 60   ? 0.9913 0.9913 0.9913 0.0000 0.0000 0.0000 80   TYR B CE2 
8158 C  CZ  . TYR B 60   ? 0.9913 0.9913 0.9913 0.0000 0.0000 0.0000 80   TYR B CZ  
8159 O  OH  . TYR B 60   ? 0.9913 0.9913 0.9913 0.0000 0.0000 0.0000 80   TYR B OH  
8160 N  N   . ASN B 61   ? 0.9275 0.9275 0.9275 0.0000 0.0000 0.0000 81   ASN B N   
8161 C  CA  . ASN B 61   ? 0.9275 0.9275 0.9275 0.0000 0.0000 0.0000 81   ASN B CA  
8162 C  C   . ASN B 61   ? 0.9275 0.9275 0.9275 0.0000 0.0000 0.0000 81   ASN B C   
8163 O  O   . ASN B 61   ? 0.9275 0.9275 0.9275 0.0000 0.0000 0.0000 81   ASN B O   
8164 C  CB  . ASN B 61   ? 0.9275 0.9275 0.9275 0.0000 0.0000 0.0000 81   ASN B CB  
8165 C  CG  . ASN B 61   ? 0.9275 0.9275 0.9275 0.0000 0.0000 0.0000 81   ASN B CG  
8166 O  OD1 . ASN B 61   ? 0.9275 0.9275 0.9275 0.0000 0.0000 0.0000 81   ASN B OD1 
8167 N  ND2 . ASN B 61   ? 0.9275 0.9275 0.9275 0.0000 0.0000 0.0000 81   ASN B ND2 
8168 N  N   . PRO B 62   ? 0.9157 0.9157 0.9157 0.0000 0.0000 0.0000 82   PRO B N   
8169 C  CA  . PRO B 62   ? 0.9157 0.9157 0.9157 0.0000 0.0000 0.0000 82   PRO B CA  
8170 C  C   . PRO B 62   ? 0.9157 0.9157 0.9157 0.0000 0.0000 0.0000 82   PRO B C   
8171 O  O   . PRO B 62   ? 0.9157 0.9157 0.9157 0.0000 0.0000 0.0000 82   PRO B O   
8172 C  CB  . PRO B 62   ? 0.9157 0.9157 0.9157 0.0000 0.0000 0.0000 82   PRO B CB  
8173 C  CG  . PRO B 62   ? 0.9157 0.9157 0.9157 0.0000 0.0000 0.0000 82   PRO B CG  
8174 C  CD  . PRO B 62   ? 0.9157 0.9157 0.9157 0.0000 0.0000 0.0000 82   PRO B CD  
8175 N  N   . ASP B 63   ? 0.9062 0.9062 0.9062 0.0000 0.0000 0.0000 83   ASP B N   
8176 C  CA  . ASP B 63   ? 0.9062 0.9062 0.9062 0.0000 0.0000 0.0000 83   ASP B CA  
8177 C  C   . ASP B 63   ? 0.9062 0.9062 0.9062 0.0000 0.0000 0.0000 83   ASP B C   
8178 O  O   . ASP B 63   ? 0.9062 0.9062 0.9062 0.0000 0.0000 0.0000 83   ASP B O   
8179 C  CB  . ASP B 63   ? 0.9062 0.9062 0.9062 0.0000 0.0000 0.0000 83   ASP B CB  
8180 C  CG  . ASP B 63   ? 0.9062 0.9062 0.9062 0.0000 0.0000 0.0000 83   ASP B CG  
8181 O  OD1 . ASP B 63   ? 0.9062 0.9062 0.9062 0.0000 0.0000 0.0000 83   ASP B OD1 
8182 O  OD2 . ASP B 63   ? 0.9062 0.9062 0.9062 0.0000 0.0000 0.0000 83   ASP B OD2 
8183 N  N   . ILE B 64   ? 0.8909 0.8909 0.8909 0.0000 0.0000 0.0000 84   ILE B N   
8184 C  CA  . ILE B 64   ? 0.8909 0.8909 0.8909 0.0000 0.0000 0.0000 84   ILE B CA  
8185 C  C   . ILE B 64   ? 0.8909 0.8909 0.8909 0.0000 0.0000 0.0000 84   ILE B C   
8186 O  O   . ILE B 64   ? 0.8909 0.8909 0.8909 0.0000 0.0000 0.0000 84   ILE B O   
8187 C  CB  . ILE B 64   ? 0.8909 0.8909 0.8909 0.0000 0.0000 0.0000 84   ILE B CB  
8188 C  CG1 . ILE B 64   ? 0.8909 0.8909 0.8909 0.0000 0.0000 0.0000 84   ILE B CG1 
8189 C  CG2 . ILE B 64   ? 0.8909 0.8909 0.8909 0.0000 0.0000 0.0000 84   ILE B CG2 
8190 C  CD1 . ILE B 64   ? 0.8909 0.8909 0.8909 0.0000 0.0000 0.0000 84   ILE B CD1 
8191 N  N   . ILE B 65   ? 0.8471 0.8471 0.8471 0.0000 0.0000 0.0000 85   ILE B N   
8192 C  CA  . ILE B 65   ? 0.8471 0.8471 0.8471 0.0000 0.0000 0.0000 85   ILE B CA  
8193 C  C   . ILE B 65   ? 0.8471 0.8471 0.8471 0.0000 0.0000 0.0000 85   ILE B C   
8194 O  O   . ILE B 65   ? 0.8471 0.8471 0.8471 0.0000 0.0000 0.0000 85   ILE B O   
8195 C  CB  . ILE B 65   ? 0.8471 0.8471 0.8471 0.0000 0.0000 0.0000 85   ILE B CB  
8196 C  CG1 . ILE B 65   ? 0.8471 0.8471 0.8471 0.0000 0.0000 0.0000 85   ILE B CG1 
8197 C  CG2 . ILE B 65   ? 0.8471 0.8471 0.8471 0.0000 0.0000 0.0000 85   ILE B CG2 
8198 C  CD1 . ILE B 65   ? 0.8471 0.8471 0.8471 0.0000 0.0000 0.0000 85   ILE B CD1 
8199 N  N   . PHE B 66   ? 0.8788 0.8788 0.8788 0.0000 0.0000 0.0000 86   PHE B N   
8200 C  CA  . PHE B 66   ? 0.8788 0.8788 0.8788 0.0000 0.0000 0.0000 86   PHE B CA  
8201 C  C   . PHE B 66   ? 0.8788 0.8788 0.8788 0.0000 0.0000 0.0000 86   PHE B C   
8202 O  O   . PHE B 66   ? 0.8788 0.8788 0.8788 0.0000 0.0000 0.0000 86   PHE B O   
8203 C  CB  . PHE B 66   ? 0.8788 0.8788 0.8788 0.0000 0.0000 0.0000 86   PHE B CB  
8204 C  CG  . PHE B 66   ? 0.8788 0.8788 0.8788 0.0000 0.0000 0.0000 86   PHE B CG  
8205 C  CD1 . PHE B 66   ? 0.8788 0.8788 0.8788 0.0000 0.0000 0.0000 86   PHE B CD1 
8206 C  CD2 . PHE B 66   ? 0.8788 0.8788 0.8788 0.0000 0.0000 0.0000 86   PHE B CD2 
8207 C  CE1 . PHE B 66   ? 0.8788 0.8788 0.8788 0.0000 0.0000 0.0000 86   PHE B CE1 
8208 C  CE2 . PHE B 66   ? 0.8788 0.8788 0.8788 0.0000 0.0000 0.0000 86   PHE B CE2 
8209 C  CZ  . PHE B 66   ? 0.8788 0.8788 0.8788 0.0000 0.0000 0.0000 86   PHE B CZ  
8210 N  N   . LYS B 67   ? 0.8465 0.8465 0.8465 0.0000 0.0000 0.0000 87   LYS B N   
8211 C  CA  . LYS B 67   ? 0.8465 0.8465 0.8465 0.0000 0.0000 0.0000 87   LYS B CA  
8212 C  C   . LYS B 67   ? 0.8465 0.8465 0.8465 0.0000 0.0000 0.0000 87   LYS B C   
8213 O  O   . LYS B 67   ? 0.8465 0.8465 0.8465 0.0000 0.0000 0.0000 87   LYS B O   
8214 C  CB  . LYS B 67   ? 0.8465 0.8465 0.8465 0.0000 0.0000 0.0000 87   LYS B CB  
8215 C  CG  . LYS B 67   ? 0.8465 0.8465 0.8465 0.0000 0.0000 0.0000 87   LYS B CG  
8216 C  CD  . LYS B 67   ? 0.8465 0.8465 0.8465 0.0000 0.0000 0.0000 87   LYS B CD  
8217 C  CE  . LYS B 67   ? 0.8465 0.8465 0.8465 0.0000 0.0000 0.0000 87   LYS B CE  
8218 N  NZ  . LYS B 67   ? 0.8465 0.8465 0.8465 0.0000 0.0000 0.0000 87   LYS B NZ  
8219 N  N   . ASP B 68   ? 0.9404 0.9404 0.9404 0.0000 0.0000 0.0000 88   ASP B N   
8220 C  CA  . ASP B 68   ? 0.9404 0.9404 0.9404 0.0000 0.0000 0.0000 88   ASP B CA  
8221 C  C   . ASP B 68   ? 0.9404 0.9404 0.9404 0.0000 0.0000 0.0000 88   ASP B C   
8222 O  O   . ASP B 68   ? 0.9404 0.9404 0.9404 0.0000 0.0000 0.0000 88   ASP B O   
8223 C  CB  . ASP B 68   ? 0.9404 0.9404 0.9404 0.0000 0.0000 0.0000 88   ASP B CB  
8224 C  CG  . ASP B 68   ? 0.9404 0.9404 0.9404 0.0000 0.0000 0.0000 88   ASP B CG  
8225 O  OD1 . ASP B 68   ? 0.9404 0.9404 0.9404 0.0000 0.0000 0.0000 88   ASP B OD1 
8226 O  OD2 . ASP B 68   ? 0.9404 0.9404 0.9404 0.0000 0.0000 0.0000 88   ASP B OD2 
8227 N  N   . GLU B 69   ? 0.9212 0.9212 0.9212 0.0000 0.0000 0.0000 89   GLU B N   
8228 C  CA  . GLU B 69   ? 0.9212 0.9212 0.9212 0.0000 0.0000 0.0000 89   GLU B CA  
8229 C  C   . GLU B 69   ? 0.9212 0.9212 0.9212 0.0000 0.0000 0.0000 89   GLU B C   
8230 O  O   . GLU B 69   ? 0.9212 0.9212 0.9212 0.0000 0.0000 0.0000 89   GLU B O   
8231 C  CB  . GLU B 69   ? 0.9212 0.9212 0.9212 0.0000 0.0000 0.0000 89   GLU B CB  
8232 C  CG  . GLU B 69   ? 0.9212 0.9212 0.9212 0.0000 0.0000 0.0000 89   GLU B CG  
8233 C  CD  . GLU B 69   ? 0.9212 0.9212 0.9212 0.0000 0.0000 0.0000 89   GLU B CD  
8234 O  OE1 . GLU B 69   ? 0.9212 0.9212 0.9212 0.0000 0.0000 0.0000 89   GLU B OE1 
8235 O  OE2 . GLU B 69   ? 0.9212 0.9212 0.9212 0.0000 0.0000 0.0000 89   GLU B OE2 
8236 N  N   . GLU B 70   ? 0.9820 0.9820 0.9820 0.0000 0.0000 0.0000 90   GLU B N   
8237 C  CA  . GLU B 70   ? 0.9820 0.9820 0.9820 0.0000 0.0000 0.0000 90   GLU B CA  
8238 C  C   . GLU B 70   ? 0.9820 0.9820 0.9820 0.0000 0.0000 0.0000 90   GLU B C   
8239 O  O   . GLU B 70   ? 0.9820 0.9820 0.9820 0.0000 0.0000 0.0000 90   GLU B O   
8240 C  CB  . GLU B 70   ? 0.9820 0.9820 0.9820 0.0000 0.0000 0.0000 90   GLU B CB  
8241 C  CG  . GLU B 70   ? 0.9820 0.9820 0.9820 0.0000 0.0000 0.0000 90   GLU B CG  
8242 C  CD  . GLU B 70   ? 0.9820 0.9820 0.9820 0.0000 0.0000 0.0000 90   GLU B CD  
8243 O  OE1 . GLU B 70   ? 0.9820 0.9820 0.9820 0.0000 0.0000 0.0000 90   GLU B OE1 
8244 O  OE2 . GLU B 70   ? 0.9820 0.9820 0.9820 0.0000 0.0000 0.0000 90   GLU B OE2 
8245 N  N   . ASN B 71   ? 0.9645 0.9645 0.9645 0.0000 0.0000 0.0000 91   ASN B N   
8246 C  CA  . ASN B 71   ? 0.9645 0.9645 0.9645 0.0000 0.0000 0.0000 91   ASN B CA  
8247 C  C   . ASN B 71   ? 0.9645 0.9645 0.9645 0.0000 0.0000 0.0000 91   ASN B C   
8248 O  O   . ASN B 71   ? 0.9645 0.9645 0.9645 0.0000 0.0000 0.0000 91   ASN B O   
8249 C  CB  . ASN B 71   ? 0.9645 0.9645 0.9645 0.0000 0.0000 0.0000 91   ASN B CB  
8250 C  CG  . ASN B 71   ? 0.9645 0.9645 0.9645 0.0000 0.0000 0.0000 91   ASN B CG  
8251 O  OD1 . ASN B 71   ? 0.9645 0.9645 0.9645 0.0000 0.0000 0.0000 91   ASN B OD1 
8252 N  ND2 . ASN B 71   ? 0.9645 0.9645 0.9645 0.0000 0.0000 0.0000 91   ASN B ND2 
8253 N  N   . THR B 72   ? 0.9705 0.9705 0.9705 0.0000 0.0000 0.0000 92   THR B N   
8254 C  CA  . THR B 72   ? 0.9705 0.9705 0.9705 0.0000 0.0000 0.0000 92   THR B CA  
8255 C  C   . THR B 72   ? 0.9705 0.9705 0.9705 0.0000 0.0000 0.0000 92   THR B C   
8256 O  O   . THR B 72   ? 0.9705 0.9705 0.9705 0.0000 0.0000 0.0000 92   THR B O   
8257 C  CB  . THR B 72   ? 0.9705 0.9705 0.9705 0.0000 0.0000 0.0000 92   THR B CB  
8258 O  OG1 . THR B 72   ? 0.9705 0.9705 0.9705 0.0000 0.0000 0.0000 92   THR B OG1 
8259 C  CG2 . THR B 72   ? 0.9705 0.9705 0.9705 0.0000 0.0000 0.0000 92   THR B CG2 
8260 N  N   . GLY B 73   ? 0.9532 0.9532 0.9532 0.0000 0.0000 0.0000 93   GLY B N   
8261 C  CA  . GLY B 73   ? 0.9532 0.9532 0.9532 0.0000 0.0000 0.0000 93   GLY B CA  
8262 C  C   . GLY B 73   ? 0.9532 0.9532 0.9532 0.0000 0.0000 0.0000 93   GLY B C   
8263 O  O   . GLY B 73   ? 0.9532 0.9532 0.9532 0.0000 0.0000 0.0000 93   GLY B O   
8264 N  N   . ALA B 74   ? 0.9575 0.9575 0.9575 0.0000 0.0000 0.0000 94   ALA B N   
8265 C  CA  . ALA B 74   ? 0.9575 0.9575 0.9575 0.0000 0.0000 0.0000 94   ALA B CA  
8266 C  C   . ALA B 74   ? 0.9575 0.9575 0.9575 0.0000 0.0000 0.0000 94   ALA B C   
8267 O  O   . ALA B 74   ? 0.9575 0.9575 0.9575 0.0000 0.0000 0.0000 94   ALA B O   
8268 C  CB  . ALA B 74   ? 0.9575 0.9575 0.9575 0.0000 0.0000 0.0000 94   ALA B CB  
8269 N  N   . ASP B 75   ? 0.9146 0.9146 0.9146 0.0000 0.0000 0.0000 95   ASP B N   
8270 C  CA  . ASP B 75   ? 0.9146 0.9146 0.9146 0.0000 0.0000 0.0000 95   ASP B CA  
8271 C  C   . ASP B 75   ? 0.9146 0.9146 0.9146 0.0000 0.0000 0.0000 95   ASP B C   
8272 O  O   . ASP B 75   ? 0.9146 0.9146 0.9146 0.0000 0.0000 0.0000 95   ASP B O   
8273 C  CB  . ASP B 75   ? 0.9146 0.9146 0.9146 0.0000 0.0000 0.0000 95   ASP B CB  
8274 C  CG  . ASP B 75   ? 0.9146 0.9146 0.9146 0.0000 0.0000 0.0000 95   ASP B CG  
8275 O  OD1 . ASP B 75   ? 0.9146 0.9146 0.9146 0.0000 0.0000 0.0000 95   ASP B OD1 
8276 O  OD2 . ASP B 75   ? 0.9146 0.9146 0.9146 0.0000 0.0000 0.0000 95   ASP B OD2 
8277 N  N   . ARG B 76   ? 0.9705 0.9705 0.9705 0.0000 0.0000 0.0000 96   ARG B N   
8278 C  CA  . ARG B 76   ? 0.9705 0.9705 0.9705 0.0000 0.0000 0.0000 96   ARG B CA  
8279 C  C   . ARG B 76   ? 0.9705 0.9705 0.9705 0.0000 0.0000 0.0000 96   ARG B C   
8280 O  O   . ARG B 76   ? 0.9705 0.9705 0.9705 0.0000 0.0000 0.0000 96   ARG B O   
8281 C  CB  . ARG B 76   ? 0.9705 0.9705 0.9705 0.0000 0.0000 0.0000 96   ARG B CB  
8282 C  CG  . ARG B 76   ? 0.9705 0.9705 0.9705 0.0000 0.0000 0.0000 96   ARG B CG  
8283 C  CD  . ARG B 76   ? 0.9705 0.9705 0.9705 0.0000 0.0000 0.0000 96   ARG B CD  
8284 N  NE  . ARG B 76   ? 0.9705 0.9705 0.9705 0.0000 0.0000 0.0000 96   ARG B NE  
8285 C  CZ  . ARG B 76   ? 0.9705 0.9705 0.9705 0.0000 0.0000 0.0000 96   ARG B CZ  
8286 N  NH1 . ARG B 76   ? 0.9705 0.9705 0.9705 0.0000 0.0000 0.0000 96   ARG B NH1 
8287 N  NH2 . ARG B 76   ? 0.9705 0.9705 0.9705 0.0000 0.0000 0.0000 96   ARG B NH2 
8288 N  N   . LEU B 77   ? 1.0094 1.0094 1.0094 0.0000 0.0000 0.0000 97   LEU B N   
8289 C  CA  . LEU B 77   ? 1.0094 1.0094 1.0094 0.0000 0.0000 0.0000 97   LEU B CA  
8290 C  C   . LEU B 77   ? 1.0094 1.0094 1.0094 0.0000 0.0000 0.0000 97   LEU B C   
8291 O  O   . LEU B 77   ? 1.0094 1.0094 1.0094 0.0000 0.0000 0.0000 97   LEU B O   
8292 C  CB  . LEU B 77   ? 1.0094 1.0094 1.0094 0.0000 0.0000 0.0000 97   LEU B CB  
8293 C  CG  . LEU B 77   ? 1.0094 1.0094 1.0094 0.0000 0.0000 0.0000 97   LEU B CG  
8294 C  CD1 . LEU B 77   ? 1.0094 1.0094 1.0094 0.0000 0.0000 0.0000 97   LEU B CD1 
8295 C  CD2 . LEU B 77   ? 1.0094 1.0094 1.0094 0.0000 0.0000 0.0000 97   LEU B CD2 
8296 N  N   . MET B 78   ? 1.0074 1.0074 1.0074 0.0000 0.0000 0.0000 98   MET B N   
8297 C  CA  . MET B 78   ? 1.0074 1.0074 1.0074 0.0000 0.0000 0.0000 98   MET B CA  
8298 C  C   . MET B 78   ? 1.0074 1.0074 1.0074 0.0000 0.0000 0.0000 98   MET B C   
8299 O  O   . MET B 78   ? 1.0074 1.0074 1.0074 0.0000 0.0000 0.0000 98   MET B O   
8300 C  CB  . MET B 78   ? 1.0074 1.0074 1.0074 0.0000 0.0000 0.0000 98   MET B CB  
8301 C  CG  . MET B 78   ? 1.0074 1.0074 1.0074 0.0000 0.0000 0.0000 98   MET B CG  
8302 S  SD  . MET B 78   ? 1.0074 1.0074 1.0074 0.0000 0.0000 0.0000 98   MET B SD  
8303 C  CE  . MET B 78   ? 1.0074 1.0074 1.0074 0.0000 0.0000 0.0000 98   MET B CE  
8304 N  N   . THR B 79   ? 0.9613 0.9613 0.9613 0.0000 0.0000 0.0000 99   THR B N   
8305 C  CA  . THR B 79   ? 0.9613 0.9613 0.9613 0.0000 0.0000 0.0000 99   THR B CA  
8306 C  C   . THR B 79   ? 0.9613 0.9613 0.9613 0.0000 0.0000 0.0000 99   THR B C   
8307 O  O   . THR B 79   ? 0.9613 0.9613 0.9613 0.0000 0.0000 0.0000 99   THR B O   
8308 C  CB  . THR B 79   ? 0.9613 0.9613 0.9613 0.0000 0.0000 0.0000 99   THR B CB  
8309 O  OG1 . THR B 79   ? 0.9613 0.9613 0.9613 0.0000 0.0000 0.0000 99   THR B OG1 
8310 C  CG2 . THR B 79   ? 0.9613 0.9613 0.9613 0.0000 0.0000 0.0000 99   THR B CG2 
8311 N  N   . GLN B 80   ? 0.9683 0.9683 0.9683 0.0000 0.0000 0.0000 100  GLN B N   
8312 C  CA  . GLN B 80   ? 0.9683 0.9683 0.9683 0.0000 0.0000 0.0000 100  GLN B CA  
8313 C  C   . GLN B 80   ? 0.9683 0.9683 0.9683 0.0000 0.0000 0.0000 100  GLN B C   
8314 O  O   . GLN B 80   ? 0.9683 0.9683 0.9683 0.0000 0.0000 0.0000 100  GLN B O   
8315 C  CB  . GLN B 80   ? 0.9683 0.9683 0.9683 0.0000 0.0000 0.0000 100  GLN B CB  
8316 C  CG  . GLN B 80   ? 0.9683 0.9683 0.9683 0.0000 0.0000 0.0000 100  GLN B CG  
8317 C  CD  . GLN B 80   ? 0.9683 0.9683 0.9683 0.0000 0.0000 0.0000 100  GLN B CD  
8318 O  OE1 . GLN B 80   ? 0.9683 0.9683 0.9683 0.0000 0.0000 0.0000 100  GLN B OE1 
8319 N  NE2 . GLN B 80   ? 0.9683 0.9683 0.9683 0.0000 0.0000 0.0000 100  GLN B NE2 
8320 N  N   . ARG B 81   ? 0.9139 0.9139 0.9139 0.0000 0.0000 0.0000 101  ARG B N   
8321 C  CA  . ARG B 81   ? 0.9139 0.9139 0.9139 0.0000 0.0000 0.0000 101  ARG B CA  
8322 C  C   . ARG B 81   ? 0.9139 0.9139 0.9139 0.0000 0.0000 0.0000 101  ARG B C   
8323 O  O   . ARG B 81   ? 0.9139 0.9139 0.9139 0.0000 0.0000 0.0000 101  ARG B O   
8324 C  CB  . ARG B 81   ? 0.9139 0.9139 0.9139 0.0000 0.0000 0.0000 101  ARG B CB  
8325 C  CG  . ARG B 81   ? 0.9139 0.9139 0.9139 0.0000 0.0000 0.0000 101  ARG B CG  
8326 C  CD  . ARG B 81   ? 0.9139 0.9139 0.9139 0.0000 0.0000 0.0000 101  ARG B CD  
8327 N  NE  . ARG B 81   ? 0.9139 0.9139 0.9139 0.0000 0.0000 0.0000 101  ARG B NE  
8328 C  CZ  . ARG B 81   ? 0.9139 0.9139 0.9139 0.0000 0.0000 0.0000 101  ARG B CZ  
8329 N  NH1 . ARG B 81   ? 0.9139 0.9139 0.9139 0.0000 0.0000 0.0000 101  ARG B NH1 
8330 N  NH2 . ARG B 81   ? 0.9139 0.9139 0.9139 0.0000 0.0000 0.0000 101  ARG B NH2 
8331 N  N   . CYS B 82   ? 0.8983 0.8983 0.8983 0.0000 0.0000 0.0000 102  CYS B N   
8332 C  CA  . CYS B 82   ? 0.8983 0.8983 0.8983 0.0000 0.0000 0.0000 102  CYS B CA  
8333 C  C   . CYS B 82   ? 0.8983 0.8983 0.8983 0.0000 0.0000 0.0000 102  CYS B C   
8334 O  O   . CYS B 82   ? 0.8983 0.8983 0.8983 0.0000 0.0000 0.0000 102  CYS B O   
8335 C  CB  . CYS B 82   ? 0.8983 0.8983 0.8983 0.0000 0.0000 0.0000 102  CYS B CB  
8336 S  SG  . CYS B 82   ? 0.8983 0.8983 0.8983 0.0000 0.0000 0.0000 102  CYS B SG  
8337 N  N   . LYS B 83   ? 0.9180 0.9180 0.9180 0.0000 0.0000 0.0000 103  LYS B N   
8338 C  CA  . LYS B 83   ? 0.9180 0.9180 0.9180 0.0000 0.0000 0.0000 103  LYS B CA  
8339 C  C   . LYS B 83   ? 0.9180 0.9180 0.9180 0.0000 0.0000 0.0000 103  LYS B C   
8340 O  O   . LYS B 83   ? 0.9180 0.9180 0.9180 0.0000 0.0000 0.0000 103  LYS B O   
8341 C  CB  . LYS B 83   ? 0.9180 0.9180 0.9180 0.0000 0.0000 0.0000 103  LYS B CB  
8342 C  CG  . LYS B 83   ? 0.9180 0.9180 0.9180 0.0000 0.0000 0.0000 103  LYS B CG  
8343 C  CD  . LYS B 83   ? 0.9180 0.9180 0.9180 0.0000 0.0000 0.0000 103  LYS B CD  
8344 C  CE  . LYS B 83   ? 0.9180 0.9180 0.9180 0.0000 0.0000 0.0000 103  LYS B CE  
8345 N  NZ  . LYS B 83   ? 0.9180 0.9180 0.9180 0.0000 0.0000 0.0000 103  LYS B NZ  
8346 N  N   . ASP B 84   ? 0.8996 0.8996 0.8996 0.0000 0.0000 0.0000 104  ASP B N   
8347 C  CA  . ASP B 84   ? 0.8996 0.8996 0.8996 0.0000 0.0000 0.0000 104  ASP B CA  
8348 C  C   . ASP B 84   ? 0.8996 0.8996 0.8996 0.0000 0.0000 0.0000 104  ASP B C   
8349 O  O   . ASP B 84   ? 0.8996 0.8996 0.8996 0.0000 0.0000 0.0000 104  ASP B O   
8350 C  CB  . ASP B 84   ? 0.8996 0.8996 0.8996 0.0000 0.0000 0.0000 104  ASP B CB  
8351 C  CG  . ASP B 84   ? 0.8996 0.8996 0.8996 0.0000 0.0000 0.0000 104  ASP B CG  
8352 O  OD1 . ASP B 84   ? 0.8996 0.8996 0.8996 0.0000 0.0000 0.0000 104  ASP B OD1 
8353 O  OD2 . ASP B 84   ? 0.8996 0.8996 0.8996 0.0000 0.0000 0.0000 104  ASP B OD2 
8354 N  N   . LYS B 85   ? 0.8409 0.8409 0.8409 0.0000 0.0000 0.0000 105  LYS B N   
8355 C  CA  . LYS B 85   ? 0.8409 0.8409 0.8409 0.0000 0.0000 0.0000 105  LYS B CA  
8356 C  C   . LYS B 85   ? 0.8409 0.8409 0.8409 0.0000 0.0000 0.0000 105  LYS B C   
8357 O  O   . LYS B 85   ? 0.8409 0.8409 0.8409 0.0000 0.0000 0.0000 105  LYS B O   
8358 C  CB  . LYS B 85   ? 0.8409 0.8409 0.8409 0.0000 0.0000 0.0000 105  LYS B CB  
8359 C  CG  . LYS B 85   ? 0.8409 0.8409 0.8409 0.0000 0.0000 0.0000 105  LYS B CG  
8360 C  CD  . LYS B 85   ? 0.8409 0.8409 0.8409 0.0000 0.0000 0.0000 105  LYS B CD  
8361 C  CE  . LYS B 85   ? 0.8409 0.8409 0.8409 0.0000 0.0000 0.0000 105  LYS B CE  
8362 N  NZ  . LYS B 85   ? 0.8409 0.8409 0.8409 0.0000 0.0000 0.0000 105  LYS B NZ  
8363 N  N   . LEU B 86   ? 0.8267 0.8267 0.8267 0.0000 0.0000 0.0000 106  LEU B N   
8364 C  CA  . LEU B 86   ? 0.8267 0.8267 0.8267 0.0000 0.0000 0.0000 106  LEU B CA  
8365 C  C   . LEU B 86   ? 0.8267 0.8267 0.8267 0.0000 0.0000 0.0000 106  LEU B C   
8366 O  O   . LEU B 86   ? 0.8267 0.8267 0.8267 0.0000 0.0000 0.0000 106  LEU B O   
8367 C  CB  . LEU B 86   ? 0.8267 0.8267 0.8267 0.0000 0.0000 0.0000 106  LEU B CB  
8368 C  CG  . LEU B 86   ? 0.8267 0.8267 0.8267 0.0000 0.0000 0.0000 106  LEU B CG  
8369 C  CD1 . LEU B 86   ? 0.8267 0.8267 0.8267 0.0000 0.0000 0.0000 106  LEU B CD1 
8370 C  CD2 . LEU B 86   ? 0.8267 0.8267 0.8267 0.0000 0.0000 0.0000 106  LEU B CD2 
8371 N  N   . ASN B 87   ? 0.8526 0.8526 0.8526 0.0000 0.0000 0.0000 107  ASN B N   
8372 C  CA  . ASN B 87   ? 0.8526 0.8526 0.8526 0.0000 0.0000 0.0000 107  ASN B CA  
8373 C  C   . ASN B 87   ? 0.8526 0.8526 0.8526 0.0000 0.0000 0.0000 107  ASN B C   
8374 O  O   . ASN B 87   ? 0.8526 0.8526 0.8526 0.0000 0.0000 0.0000 107  ASN B O   
8375 C  CB  . ASN B 87   ? 0.8526 0.8526 0.8526 0.0000 0.0000 0.0000 107  ASN B CB  
8376 C  CG  . ASN B 87   ? 0.8526 0.8526 0.8526 0.0000 0.0000 0.0000 107  ASN B CG  
8377 O  OD1 . ASN B 87   ? 0.8526 0.8526 0.8526 0.0000 0.0000 0.0000 107  ASN B OD1 
8378 N  ND2 . ASN B 87   ? 0.8526 0.8526 0.8526 0.0000 0.0000 0.0000 107  ASN B ND2 
8379 N  N   . ALA B 88   ? 0.8470 0.8470 0.8470 0.0000 0.0000 0.0000 108  ALA B N   
8380 C  CA  . ALA B 88   ? 0.8470 0.8470 0.8470 0.0000 0.0000 0.0000 108  ALA B CA  
8381 C  C   . ALA B 88   ? 0.8470 0.8470 0.8470 0.0000 0.0000 0.0000 108  ALA B C   
8382 O  O   . ALA B 88   ? 0.8470 0.8470 0.8470 0.0000 0.0000 0.0000 108  ALA B O   
8383 C  CB  . ALA B 88   ? 0.8470 0.8470 0.8470 0.0000 0.0000 0.0000 108  ALA B CB  
8384 N  N   . LEU B 89   ? 0.8217 0.8217 0.8217 0.0000 0.0000 0.0000 109  LEU B N   
8385 C  CA  . LEU B 89   ? 0.8217 0.8217 0.8217 0.0000 0.0000 0.0000 109  LEU B CA  
8386 C  C   . LEU B 89   ? 0.8217 0.8217 0.8217 0.0000 0.0000 0.0000 109  LEU B C   
8387 O  O   . LEU B 89   ? 0.8217 0.8217 0.8217 0.0000 0.0000 0.0000 109  LEU B O   
8388 C  CB  . LEU B 89   ? 0.8217 0.8217 0.8217 0.0000 0.0000 0.0000 109  LEU B CB  
8389 C  CG  . LEU B 89   ? 0.8217 0.8217 0.8217 0.0000 0.0000 0.0000 109  LEU B CG  
8390 C  CD1 . LEU B 89   ? 0.8217 0.8217 0.8217 0.0000 0.0000 0.0000 109  LEU B CD1 
8391 C  CD2 . LEU B 89   ? 0.8217 0.8217 0.8217 0.0000 0.0000 0.0000 109  LEU B CD2 
8392 N  N   . ALA B 90   ? 0.8083 0.8083 0.8083 0.0000 0.0000 0.0000 110  ALA B N   
8393 C  CA  . ALA B 90   ? 0.8083 0.8083 0.8083 0.0000 0.0000 0.0000 110  ALA B CA  
8394 C  C   . ALA B 90   ? 0.8083 0.8083 0.8083 0.0000 0.0000 0.0000 110  ALA B C   
8395 O  O   . ALA B 90   ? 0.8083 0.8083 0.8083 0.0000 0.0000 0.0000 110  ALA B O   
8396 C  CB  . ALA B 90   ? 0.8083 0.8083 0.8083 0.0000 0.0000 0.0000 110  ALA B CB  
8397 N  N   . ILE B 91   ? 0.8154 0.8154 0.8154 0.0000 0.0000 0.0000 111  ILE B N   
8398 C  CA  . ILE B 91   ? 0.8154 0.8154 0.8154 0.0000 0.0000 0.0000 111  ILE B CA  
8399 C  C   . ILE B 91   ? 0.8154 0.8154 0.8154 0.0000 0.0000 0.0000 111  ILE B C   
8400 O  O   . ILE B 91   ? 0.8154 0.8154 0.8154 0.0000 0.0000 0.0000 111  ILE B O   
8401 C  CB  . ILE B 91   ? 0.8154 0.8154 0.8154 0.0000 0.0000 0.0000 111  ILE B CB  
8402 C  CG1 . ILE B 91   ? 0.8154 0.8154 0.8154 0.0000 0.0000 0.0000 111  ILE B CG1 
8403 C  CG2 . ILE B 91   ? 0.8154 0.8154 0.8154 0.0000 0.0000 0.0000 111  ILE B CG2 
8404 C  CD1 . ILE B 91   ? 0.8154 0.8154 0.8154 0.0000 0.0000 0.0000 111  ILE B CD1 
8405 N  N   . SER B 92   ? 0.8081 0.8081 0.8081 0.0000 0.0000 0.0000 112  SER B N   
8406 C  CA  . SER B 92   ? 0.8081 0.8081 0.8081 0.0000 0.0000 0.0000 112  SER B CA  
8407 C  C   . SER B 92   ? 0.8081 0.8081 0.8081 0.0000 0.0000 0.0000 112  SER B C   
8408 O  O   . SER B 92   ? 0.8081 0.8081 0.8081 0.0000 0.0000 0.0000 112  SER B O   
8409 C  CB  . SER B 92   ? 0.8081 0.8081 0.8081 0.0000 0.0000 0.0000 112  SER B CB  
8410 O  OG  . SER B 92   ? 0.8081 0.8081 0.8081 0.0000 0.0000 0.0000 112  SER B OG  
8411 N  N   . VAL B 93   ? 0.8081 0.8081 0.8081 0.0000 0.0000 0.0000 113  VAL B N   
8412 C  CA  . VAL B 93   ? 0.8081 0.8081 0.8081 0.0000 0.0000 0.0000 113  VAL B CA  
8413 C  C   . VAL B 93   ? 0.8081 0.8081 0.8081 0.0000 0.0000 0.0000 113  VAL B C   
8414 O  O   . VAL B 93   ? 0.8081 0.8081 0.8081 0.0000 0.0000 0.0000 113  VAL B O   
8415 C  CB  . VAL B 93   ? 0.8081 0.8081 0.8081 0.0000 0.0000 0.0000 113  VAL B CB  
8416 C  CG1 . VAL B 93   ? 0.8081 0.8081 0.8081 0.0000 0.0000 0.0000 113  VAL B CG1 
8417 C  CG2 . VAL B 93   ? 0.8081 0.8081 0.8081 0.0000 0.0000 0.0000 113  VAL B CG2 
8418 N  N   . MET B 94   ? 0.8536 0.8536 0.8536 0.0000 0.0000 0.0000 114  MET B N   
8419 C  CA  . MET B 94   ? 0.8536 0.8536 0.8536 0.0000 0.0000 0.0000 114  MET B CA  
8420 C  C   . MET B 94   ? 0.8536 0.8536 0.8536 0.0000 0.0000 0.0000 114  MET B C   
8421 O  O   . MET B 94   ? 0.8536 0.8536 0.8536 0.0000 0.0000 0.0000 114  MET B O   
8422 C  CB  . MET B 94   ? 0.8536 0.8536 0.8536 0.0000 0.0000 0.0000 114  MET B CB  
8423 C  CG  . MET B 94   ? 0.8536 0.8536 0.8536 0.0000 0.0000 0.0000 114  MET B CG  
8424 S  SD  . MET B 94   ? 0.8536 0.8536 0.8536 0.0000 0.0000 0.0000 114  MET B SD  
8425 C  CE  . MET B 94   ? 0.8536 0.8536 0.8536 0.0000 0.0000 0.0000 114  MET B CE  
8426 N  N   . ASN B 95   ? 0.8319 0.8319 0.8319 0.0000 0.0000 0.0000 115  ASN B N   
8427 C  CA  . ASN B 95   ? 0.8319 0.8319 0.8319 0.0000 0.0000 0.0000 115  ASN B CA  
8428 C  C   . ASN B 95   ? 0.8319 0.8319 0.8319 0.0000 0.0000 0.0000 115  ASN B C   
8429 O  O   . ASN B 95   ? 0.8319 0.8319 0.8319 0.0000 0.0000 0.0000 115  ASN B O   
8430 C  CB  . ASN B 95   ? 0.8319 0.8319 0.8319 0.0000 0.0000 0.0000 115  ASN B CB  
8431 C  CG  . ASN B 95   ? 0.8319 0.8319 0.8319 0.0000 0.0000 0.0000 115  ASN B CG  
8432 O  OD1 . ASN B 95   ? 0.8319 0.8319 0.8319 0.0000 0.0000 0.0000 115  ASN B OD1 
8433 N  ND2 . ASN B 95   ? 0.8319 0.8319 0.8319 0.0000 0.0000 0.0000 115  ASN B ND2 
8434 N  N   . GLN B 96   ? 0.8081 0.8081 0.8081 0.0000 0.0000 0.0000 116  GLN B N   
8435 C  CA  . GLN B 96   ? 0.8081 0.8081 0.8081 0.0000 0.0000 0.0000 116  GLN B CA  
8436 C  C   . GLN B 96   ? 0.8081 0.8081 0.8081 0.0000 0.0000 0.0000 116  GLN B C   
8437 O  O   . GLN B 96   ? 0.8081 0.8081 0.8081 0.0000 0.0000 0.0000 116  GLN B O   
8438 C  CB  . GLN B 96   ? 0.8081 0.8081 0.8081 0.0000 0.0000 0.0000 116  GLN B CB  
8439 C  CG  . GLN B 96   ? 0.8081 0.8081 0.8081 0.0000 0.0000 0.0000 116  GLN B CG  
8440 C  CD  . GLN B 96   ? 0.8081 0.8081 0.8081 0.0000 0.0000 0.0000 116  GLN B CD  
8441 O  OE1 . GLN B 96   ? 0.8081 0.8081 0.8081 0.0000 0.0000 0.0000 116  GLN B OE1 
8442 N  NE2 . GLN B 96   ? 0.8081 0.8081 0.8081 0.0000 0.0000 0.0000 116  GLN B NE2 
8443 N  N   . TRP B 97   ? 0.8081 0.8081 0.8081 0.0000 0.0000 0.0000 117  TRP B N   
8444 C  CA  . TRP B 97   ? 0.8081 0.8081 0.8081 0.0000 0.0000 0.0000 117  TRP B CA  
8445 C  C   . TRP B 97   ? 0.8081 0.8081 0.8081 0.0000 0.0000 0.0000 117  TRP B C   
8446 O  O   . TRP B 97   ? 0.8081 0.8081 0.8081 0.0000 0.0000 0.0000 117  TRP B O   
8447 C  CB  . TRP B 97   ? 0.8081 0.8081 0.8081 0.0000 0.0000 0.0000 117  TRP B CB  
8448 C  CG  . TRP B 97   ? 0.8081 0.8081 0.8081 0.0000 0.0000 0.0000 117  TRP B CG  
8449 C  CD1 . TRP B 97   ? 0.8081 0.8081 0.8081 0.0000 0.0000 0.0000 117  TRP B CD1 
8450 C  CD2 . TRP B 97   ? 0.8081 0.8081 0.8081 0.0000 0.0000 0.0000 117  TRP B CD2 
8451 N  NE1 . TRP B 97   ? 0.8081 0.8081 0.8081 0.0000 0.0000 0.0000 117  TRP B NE1 
8452 C  CE2 . TRP B 97   ? 0.8081 0.8081 0.8081 0.0000 0.0000 0.0000 117  TRP B CE2 
8453 C  CE3 . TRP B 97   ? 0.8081 0.8081 0.8081 0.0000 0.0000 0.0000 117  TRP B CE3 
8454 C  CZ2 . TRP B 97   ? 0.8081 0.8081 0.8081 0.0000 0.0000 0.0000 117  TRP B CZ2 
8455 C  CZ3 . TRP B 97   ? 0.8081 0.8081 0.8081 0.0000 0.0000 0.0000 117  TRP B CZ3 
8456 C  CH2 . TRP B 97   ? 0.8081 0.8081 0.8081 0.0000 0.0000 0.0000 117  TRP B CH2 
8457 N  N   . PRO B 98   ? 0.8289 0.8289 0.8289 0.0000 0.0000 0.0000 118  PRO B N   
8458 C  CA  . PRO B 98   ? 0.8289 0.8289 0.8289 0.0000 0.0000 0.0000 118  PRO B CA  
8459 C  C   . PRO B 98   ? 0.8289 0.8289 0.8289 0.0000 0.0000 0.0000 118  PRO B C   
8460 O  O   . PRO B 98   ? 0.8289 0.8289 0.8289 0.0000 0.0000 0.0000 118  PRO B O   
8461 C  CB  . PRO B 98   ? 0.8289 0.8289 0.8289 0.0000 0.0000 0.0000 118  PRO B CB  
8462 C  CG  . PRO B 98   ? 0.8289 0.8289 0.8289 0.0000 0.0000 0.0000 118  PRO B CG  
8463 C  CD  . PRO B 98   ? 0.8289 0.8289 0.8289 0.0000 0.0000 0.0000 118  PRO B CD  
8464 N  N   . GLY B 99   ? 0.8640 0.8640 0.8640 0.0000 0.0000 0.0000 119  GLY B N   
8465 C  CA  . GLY B 99   ? 0.8640 0.8640 0.8640 0.0000 0.0000 0.0000 119  GLY B CA  
8466 C  C   . GLY B 99   ? 0.8640 0.8640 0.8640 0.0000 0.0000 0.0000 119  GLY B C   
8467 O  O   . GLY B 99   ? 0.8640 0.8640 0.8640 0.0000 0.0000 0.0000 119  GLY B O   
8468 N  N   . VAL B 100  ? 0.8319 0.8319 0.8319 0.0000 0.0000 0.0000 120  VAL B N   
8469 C  CA  . VAL B 100  ? 0.8319 0.8319 0.8319 0.0000 0.0000 0.0000 120  VAL B CA  
8470 C  C   . VAL B 100  ? 0.8319 0.8319 0.8319 0.0000 0.0000 0.0000 120  VAL B C   
8471 O  O   . VAL B 100  ? 0.8319 0.8319 0.8319 0.0000 0.0000 0.0000 120  VAL B O   
8472 C  CB  . VAL B 100  ? 0.8319 0.8319 0.8319 0.0000 0.0000 0.0000 120  VAL B CB  
8473 C  CG1 . VAL B 100  ? 0.8319 0.8319 0.8319 0.0000 0.0000 0.0000 120  VAL B CG1 
8474 C  CG2 . VAL B 100  ? 0.8319 0.8319 0.8319 0.0000 0.0000 0.0000 120  VAL B CG2 
8475 N  N   . LYS B 101  ? 0.8166 0.8166 0.8166 0.0000 0.0000 0.0000 121  LYS B N   
8476 C  CA  . LYS B 101  ? 0.8166 0.8166 0.8166 0.0000 0.0000 0.0000 121  LYS B CA  
8477 C  C   . LYS B 101  ? 0.8166 0.8166 0.8166 0.0000 0.0000 0.0000 121  LYS B C   
8478 O  O   . LYS B 101  ? 0.8166 0.8166 0.8166 0.0000 0.0000 0.0000 121  LYS B O   
8479 C  CB  . LYS B 101  ? 0.8166 0.8166 0.8166 0.0000 0.0000 0.0000 121  LYS B CB  
8480 C  CG  . LYS B 101  ? 0.8166 0.8166 0.8166 0.0000 0.0000 0.0000 121  LYS B CG  
8481 C  CD  . LYS B 101  ? 0.8166 0.8166 0.8166 0.0000 0.0000 0.0000 121  LYS B CD  
8482 C  CE  . LYS B 101  ? 0.8166 0.8166 0.8166 0.0000 0.0000 0.0000 121  LYS B CE  
8483 N  NZ  . LYS B 101  ? 0.8166 0.8166 0.8166 0.0000 0.0000 0.0000 121  LYS B NZ  
8484 N  N   . LEU B 102  ? 0.8081 0.8081 0.8081 0.0000 0.0000 0.0000 122  LEU B N   
8485 C  CA  . LEU B 102  ? 0.8081 0.8081 0.8081 0.0000 0.0000 0.0000 122  LEU B CA  
8486 C  C   . LEU B 102  ? 0.8081 0.8081 0.8081 0.0000 0.0000 0.0000 122  LEU B C   
8487 O  O   . LEU B 102  ? 0.8081 0.8081 0.8081 0.0000 0.0000 0.0000 122  LEU B O   
8488 C  CB  . LEU B 102  ? 0.8081 0.8081 0.8081 0.0000 0.0000 0.0000 122  LEU B CB  
8489 C  CG  . LEU B 102  ? 0.8081 0.8081 0.8081 0.0000 0.0000 0.0000 122  LEU B CG  
8490 C  CD1 . LEU B 102  ? 0.8081 0.8081 0.8081 0.0000 0.0000 0.0000 122  LEU B CD1 
8491 C  CD2 . LEU B 102  ? 0.8081 0.8081 0.8081 0.0000 0.0000 0.0000 122  LEU B CD2 
8492 N  N   . ARG B 103  ? 0.8081 0.8081 0.8081 0.0000 0.0000 0.0000 123  ARG B N   
8493 C  CA  . ARG B 103  ? 0.8081 0.8081 0.8081 0.0000 0.0000 0.0000 123  ARG B CA  
8494 C  C   . ARG B 103  ? 0.8081 0.8081 0.8081 0.0000 0.0000 0.0000 123  ARG B C   
8495 O  O   . ARG B 103  ? 0.8081 0.8081 0.8081 0.0000 0.0000 0.0000 123  ARG B O   
8496 C  CB  . ARG B 103  ? 0.8081 0.8081 0.8081 0.0000 0.0000 0.0000 123  ARG B CB  
8497 C  CG  . ARG B 103  ? 0.8081 0.8081 0.8081 0.0000 0.0000 0.0000 123  ARG B CG  
8498 C  CD  . ARG B 103  ? 0.8081 0.8081 0.8081 0.0000 0.0000 0.0000 123  ARG B CD  
8499 N  NE  . ARG B 103  ? 0.8081 0.8081 0.8081 0.0000 0.0000 0.0000 123  ARG B NE  
8500 C  CZ  . ARG B 103  ? 0.8081 0.8081 0.8081 0.0000 0.0000 0.0000 123  ARG B CZ  
8501 N  NH1 . ARG B 103  ? 0.8081 0.8081 0.8081 0.0000 0.0000 0.0000 123  ARG B NH1 
8502 N  NH2 . ARG B 103  ? 0.8081 0.8081 0.8081 0.0000 0.0000 0.0000 123  ARG B NH2 
8503 N  N   . VAL B 104  ? 0.8081 0.8081 0.8081 0.0000 0.0000 0.0000 124  VAL B N   
8504 C  CA  . VAL B 104  ? 0.8081 0.8081 0.8081 0.0000 0.0000 0.0000 124  VAL B CA  
8505 C  C   . VAL B 104  ? 0.8081 0.8081 0.8081 0.0000 0.0000 0.0000 124  VAL B C   
8506 O  O   . VAL B 104  ? 0.8081 0.8081 0.8081 0.0000 0.0000 0.0000 124  VAL B O   
8507 C  CB  . VAL B 104  ? 0.8081 0.8081 0.8081 0.0000 0.0000 0.0000 124  VAL B CB  
8508 C  CG1 . VAL B 104  ? 0.8081 0.8081 0.8081 0.0000 0.0000 0.0000 124  VAL B CG1 
8509 C  CG2 . VAL B 104  ? 0.8081 0.8081 0.8081 0.0000 0.0000 0.0000 124  VAL B CG2 
8510 N  N   . THR B 105  ? 0.8081 0.8081 0.8081 0.0000 0.0000 0.0000 125  THR B N   
8511 C  CA  . THR B 105  ? 0.8081 0.8081 0.8081 0.0000 0.0000 0.0000 125  THR B CA  
8512 C  C   . THR B 105  ? 0.8081 0.8081 0.8081 0.0000 0.0000 0.0000 125  THR B C   
8513 O  O   . THR B 105  ? 0.8081 0.8081 0.8081 0.0000 0.0000 0.0000 125  THR B O   
8514 C  CB  . THR B 105  ? 0.8081 0.8081 0.8081 0.0000 0.0000 0.0000 125  THR B CB  
8515 O  OG1 . THR B 105  ? 0.8081 0.8081 0.8081 0.0000 0.0000 0.0000 125  THR B OG1 
8516 C  CG2 . THR B 105  ? 0.8081 0.8081 0.8081 0.0000 0.0000 0.0000 125  THR B CG2 
8517 N  N   . GLU B 106  ? 0.8081 0.8081 0.8081 0.0000 0.0000 0.0000 126  GLU B N   
8518 C  CA  . GLU B 106  ? 0.8081 0.8081 0.8081 0.0000 0.0000 0.0000 126  GLU B CA  
8519 C  C   . GLU B 106  ? 0.8081 0.8081 0.8081 0.0000 0.0000 0.0000 126  GLU B C   
8520 O  O   . GLU B 106  ? 0.8081 0.8081 0.8081 0.0000 0.0000 0.0000 126  GLU B O   
8521 C  CB  . GLU B 106  ? 0.8081 0.8081 0.8081 0.0000 0.0000 0.0000 126  GLU B CB  
8522 C  CG  . GLU B 106  ? 0.8081 0.8081 0.8081 0.0000 0.0000 0.0000 126  GLU B CG  
8523 C  CD  . GLU B 106  ? 0.8081 0.8081 0.8081 0.0000 0.0000 0.0000 126  GLU B CD  
8524 O  OE1 . GLU B 106  ? 0.8081 0.8081 0.8081 0.0000 0.0000 0.0000 126  GLU B OE1 
8525 O  OE2 . GLU B 106  ? 0.8081 0.8081 0.8081 0.0000 0.0000 0.0000 126  GLU B OE2 
8526 N  N   . GLY B 107  ? 0.8787 0.8787 0.8787 0.0000 0.0000 0.0000 127  GLY B N   
8527 C  CA  . GLY B 107  ? 0.8787 0.8787 0.8787 0.0000 0.0000 0.0000 127  GLY B CA  
8528 C  C   . GLY B 107  ? 0.8787 0.8787 0.8787 0.0000 0.0000 0.0000 127  GLY B C   
8529 O  O   . GLY B 107  ? 0.8787 0.8787 0.8787 0.0000 0.0000 0.0000 127  GLY B O   
8530 N  N   . TRP B 108  ? 0.9892 0.9892 0.9892 0.0000 0.0000 0.0000 128  TRP B N   
8531 C  CA  . TRP B 108  ? 0.9892 0.9892 0.9892 0.0000 0.0000 0.0000 128  TRP B CA  
8532 C  C   . TRP B 108  ? 0.9892 0.9892 0.9892 0.0000 0.0000 0.0000 128  TRP B C   
8533 O  O   . TRP B 108  ? 0.9892 0.9892 0.9892 0.0000 0.0000 0.0000 128  TRP B O   
8534 C  CB  . TRP B 108  ? 0.9892 0.9892 0.9892 0.0000 0.0000 0.0000 128  TRP B CB  
8535 C  CG  . TRP B 108  ? 0.9892 0.9892 0.9892 0.0000 0.0000 0.0000 128  TRP B CG  
8536 C  CD1 . TRP B 108  ? 0.9892 0.9892 0.9892 0.0000 0.0000 0.0000 128  TRP B CD1 
8537 C  CD2 . TRP B 108  ? 0.9892 0.9892 0.9892 0.0000 0.0000 0.0000 128  TRP B CD2 
8538 N  NE1 . TRP B 108  ? 0.9892 0.9892 0.9892 0.0000 0.0000 0.0000 128  TRP B NE1 
8539 C  CE2 . TRP B 108  ? 0.9892 0.9892 0.9892 0.0000 0.0000 0.0000 128  TRP B CE2 
8540 C  CE3 . TRP B 108  ? 0.9892 0.9892 0.9892 0.0000 0.0000 0.0000 128  TRP B CE3 
8541 C  CZ2 . TRP B 108  ? 0.9892 0.9892 0.9892 0.0000 0.0000 0.0000 128  TRP B CZ2 
8542 C  CZ3 . TRP B 108  ? 0.9892 0.9892 0.9892 0.0000 0.0000 0.0000 128  TRP B CZ3 
8543 C  CH2 . TRP B 108  ? 0.9892 0.9892 0.9892 0.0000 0.0000 0.0000 128  TRP B CH2 
8544 N  N   . ASP B 109  ? 1.0015 1.0015 1.0015 0.0000 0.0000 0.0000 129  ASP B N   
8545 C  CA  . ASP B 109  ? 1.0015 1.0015 1.0015 0.0000 0.0000 0.0000 129  ASP B CA  
8546 C  C   . ASP B 109  ? 1.0015 1.0015 1.0015 0.0000 0.0000 0.0000 129  ASP B C   
8547 O  O   . ASP B 109  ? 1.0015 1.0015 1.0015 0.0000 0.0000 0.0000 129  ASP B O   
8548 C  CB  . ASP B 109  ? 1.0015 1.0015 1.0015 0.0000 0.0000 0.0000 129  ASP B CB  
8549 C  CG  . ASP B 109  ? 1.0015 1.0015 1.0015 0.0000 0.0000 0.0000 129  ASP B CG  
8550 O  OD1 . ASP B 109  ? 1.0015 1.0015 1.0015 0.0000 0.0000 0.0000 129  ASP B OD1 
8551 O  OD2 . ASP B 109  ? 1.0015 1.0015 1.0015 0.0000 0.0000 0.0000 129  ASP B OD2 
8552 N  N   . GLU B 110  ? 1.0623 1.0623 1.0623 0.0000 0.0000 0.0000 130  GLU B N   
8553 C  CA  . GLU B 110  ? 1.0623 1.0623 1.0623 0.0000 0.0000 0.0000 130  GLU B CA  
8554 C  C   . GLU B 110  ? 1.0623 1.0623 1.0623 0.0000 0.0000 0.0000 130  GLU B C   
8555 O  O   . GLU B 110  ? 1.0623 1.0623 1.0623 0.0000 0.0000 0.0000 130  GLU B O   
8556 C  CB  . GLU B 110  ? 1.0623 1.0623 1.0623 0.0000 0.0000 0.0000 130  GLU B CB  
8557 C  CG  . GLU B 110  ? 1.0623 1.0623 1.0623 0.0000 0.0000 0.0000 130  GLU B CG  
8558 C  CD  . GLU B 110  ? 1.0623 1.0623 1.0623 0.0000 0.0000 0.0000 130  GLU B CD  
8559 O  OE1 . GLU B 110  ? 1.0623 1.0623 1.0623 0.0000 0.0000 0.0000 130  GLU B OE1 
8560 O  OE2 . GLU B 110  ? 1.0623 1.0623 1.0623 0.0000 0.0000 0.0000 130  GLU B OE2 
8561 N  N   . ASP B 111  ? 1.0356 1.0356 1.0356 0.0000 0.0000 0.0000 131  ASP B N   
8562 C  CA  . ASP B 111  ? 1.0356 1.0356 1.0356 0.0000 0.0000 0.0000 131  ASP B CA  
8563 C  C   . ASP B 111  ? 1.0356 1.0356 1.0356 0.0000 0.0000 0.0000 131  ASP B C   
8564 O  O   . ASP B 111  ? 1.0356 1.0356 1.0356 0.0000 0.0000 0.0000 131  ASP B O   
8565 C  CB  . ASP B 111  ? 1.0356 1.0356 1.0356 0.0000 0.0000 0.0000 131  ASP B CB  
8566 C  CG  . ASP B 111  ? 1.0356 1.0356 1.0356 0.0000 0.0000 0.0000 131  ASP B CG  
8567 O  OD1 . ASP B 111  ? 1.0356 1.0356 1.0356 0.0000 0.0000 0.0000 131  ASP B OD1 
8568 O  OD2 . ASP B 111  ? 1.0356 1.0356 1.0356 0.0000 0.0000 0.0000 131  ASP B OD2 
8569 N  N   . GLY B 112  ? 0.9980 0.9980 0.9980 0.0000 0.0000 0.0000 132  GLY B N   
8570 C  CA  . GLY B 112  ? 0.9980 0.9980 0.9980 0.0000 0.0000 0.0000 132  GLY B CA  
8571 C  C   . GLY B 112  ? 0.9980 0.9980 0.9980 0.0000 0.0000 0.0000 132  GLY B C   
8572 O  O   . GLY B 112  ? 0.9980 0.9980 0.9980 0.0000 0.0000 0.0000 132  GLY B O   
8573 N  N   . HIS B 113  ? 0.9893 0.9893 0.9893 0.0000 0.0000 0.0000 133  HIS B N   
8574 C  CA  . HIS B 113  ? 0.9893 0.9893 0.9893 0.0000 0.0000 0.0000 133  HIS B CA  
8575 C  C   . HIS B 113  ? 0.9893 0.9893 0.9893 0.0000 0.0000 0.0000 133  HIS B C   
8576 O  O   . HIS B 113  ? 0.9893 0.9893 0.9893 0.0000 0.0000 0.0000 133  HIS B O   
8577 C  CB  . HIS B 113  ? 0.9893 0.9893 0.9893 0.0000 0.0000 0.0000 133  HIS B CB  
8578 C  CG  . HIS B 113  ? 0.9893 0.9893 0.9893 0.0000 0.0000 0.0000 133  HIS B CG  
8579 N  ND1 . HIS B 113  ? 0.9893 0.9893 0.9893 0.0000 0.0000 0.0000 133  HIS B ND1 
8580 C  CD2 . HIS B 113  ? 0.9893 0.9893 0.9893 0.0000 0.0000 0.0000 133  HIS B CD2 
8581 C  CE1 . HIS B 113  ? 0.9893 0.9893 0.9893 0.0000 0.0000 0.0000 133  HIS B CE1 
8582 N  NE2 . HIS B 113  ? 0.9893 0.9893 0.9893 0.0000 0.0000 0.0000 133  HIS B NE2 
8583 N  N   . HIS B 114  ? 0.9711 0.9711 0.9711 0.0000 0.0000 0.0000 134  HIS B N   
8584 C  CA  . HIS B 114  ? 0.9711 0.9711 0.9711 0.0000 0.0000 0.0000 134  HIS B CA  
8585 C  C   . HIS B 114  ? 0.9711 0.9711 0.9711 0.0000 0.0000 0.0000 134  HIS B C   
8586 O  O   . HIS B 114  ? 0.9711 0.9711 0.9711 0.0000 0.0000 0.0000 134  HIS B O   
8587 C  CB  . HIS B 114  ? 0.9711 0.9711 0.9711 0.0000 0.0000 0.0000 134  HIS B CB  
8588 C  CG  . HIS B 114  ? 0.9711 0.9711 0.9711 0.0000 0.0000 0.0000 134  HIS B CG  
8589 N  ND1 . HIS B 114  ? 0.9711 0.9711 0.9711 0.0000 0.0000 0.0000 134  HIS B ND1 
8590 C  CD2 . HIS B 114  ? 0.9711 0.9711 0.9711 0.0000 0.0000 0.0000 134  HIS B CD2 
8591 C  CE1 . HIS B 114  ? 0.9711 0.9711 0.9711 0.0000 0.0000 0.0000 134  HIS B CE1 
8592 N  NE2 . HIS B 114  ? 0.9711 0.9711 0.9711 0.0000 0.0000 0.0000 134  HIS B NE2 
8593 N  N   . SER B 115  ? 1.0253 1.0253 1.0253 0.0000 0.0000 0.0000 135  SER B N   
8594 C  CA  . SER B 115  ? 1.0253 1.0253 1.0253 0.0000 0.0000 0.0000 135  SER B CA  
8595 C  C   . SER B 115  ? 1.0253 1.0253 1.0253 0.0000 0.0000 0.0000 135  SER B C   
8596 O  O   . SER B 115  ? 1.0253 1.0253 1.0253 0.0000 0.0000 0.0000 135  SER B O   
8597 C  CB  . SER B 115  ? 1.0253 1.0253 1.0253 0.0000 0.0000 0.0000 135  SER B CB  
8598 O  OG  . SER B 115  ? 1.0253 1.0253 1.0253 0.0000 0.0000 0.0000 135  SER B OG  
8599 N  N   . GLU B 116  ? 1.0462 1.0462 1.0462 0.0000 0.0000 0.0000 136  GLU B N   
8600 C  CA  . GLU B 116  ? 1.0462 1.0462 1.0462 0.0000 0.0000 0.0000 136  GLU B CA  
8601 C  C   . GLU B 116  ? 1.0462 1.0462 1.0462 0.0000 0.0000 0.0000 136  GLU B C   
8602 O  O   . GLU B 116  ? 1.0462 1.0462 1.0462 0.0000 0.0000 0.0000 136  GLU B O   
8603 C  CB  . GLU B 116  ? 1.0462 1.0462 1.0462 0.0000 0.0000 0.0000 136  GLU B CB  
8604 C  CG  . GLU B 116  ? 1.0462 1.0462 1.0462 0.0000 0.0000 0.0000 136  GLU B CG  
8605 C  CD  . GLU B 116  ? 1.0462 1.0462 1.0462 0.0000 0.0000 0.0000 136  GLU B CD  
8606 O  OE1 . GLU B 116  ? 1.0462 1.0462 1.0462 0.0000 0.0000 0.0000 136  GLU B OE1 
8607 O  OE2 . GLU B 116  ? 1.0462 1.0462 1.0462 0.0000 0.0000 0.0000 136  GLU B OE2 
8608 N  N   . GLU B 117  ? 1.0162 1.0162 1.0162 0.0000 0.0000 0.0000 137  GLU B N   
8609 C  CA  . GLU B 117  ? 1.0162 1.0162 1.0162 0.0000 0.0000 0.0000 137  GLU B CA  
8610 C  C   . GLU B 117  ? 1.0162 1.0162 1.0162 0.0000 0.0000 0.0000 137  GLU B C   
8611 O  O   . GLU B 117  ? 1.0162 1.0162 1.0162 0.0000 0.0000 0.0000 137  GLU B O   
8612 C  CB  . GLU B 117  ? 1.0162 1.0162 1.0162 0.0000 0.0000 0.0000 137  GLU B CB  
8613 C  CG  . GLU B 117  ? 1.0162 1.0162 1.0162 0.0000 0.0000 0.0000 137  GLU B CG  
8614 C  CD  . GLU B 117  ? 1.0162 1.0162 1.0162 0.0000 0.0000 0.0000 137  GLU B CD  
8615 O  OE1 . GLU B 117  ? 1.0162 1.0162 1.0162 0.0000 0.0000 0.0000 137  GLU B OE1 
8616 O  OE2 . GLU B 117  ? 1.0162 1.0162 1.0162 0.0000 0.0000 0.0000 137  GLU B OE2 
8617 N  N   . SER B 118  ? 0.9671 0.9671 0.9671 0.0000 0.0000 0.0000 138  SER B N   
8618 C  CA  . SER B 118  ? 0.9671 0.9671 0.9671 0.0000 0.0000 0.0000 138  SER B CA  
8619 C  C   . SER B 118  ? 0.9671 0.9671 0.9671 0.0000 0.0000 0.0000 138  SER B C   
8620 O  O   . SER B 118  ? 0.9671 0.9671 0.9671 0.0000 0.0000 0.0000 138  SER B O   
8621 C  CB  . SER B 118  ? 0.9671 0.9671 0.9671 0.0000 0.0000 0.0000 138  SER B CB  
8622 O  OG  . SER B 118  ? 0.9671 0.9671 0.9671 0.0000 0.0000 0.0000 138  SER B OG  
8623 N  N   . LEU B 119  ? 0.8827 0.8827 0.8827 0.0000 0.0000 0.0000 139  LEU B N   
8624 C  CA  . LEU B 119  ? 0.8827 0.8827 0.8827 0.0000 0.0000 0.0000 139  LEU B CA  
8625 C  C   . LEU B 119  ? 0.8827 0.8827 0.8827 0.0000 0.0000 0.0000 139  LEU B C   
8626 O  O   . LEU B 119  ? 0.8827 0.8827 0.8827 0.0000 0.0000 0.0000 139  LEU B O   
8627 C  CB  . LEU B 119  ? 0.8827 0.8827 0.8827 0.0000 0.0000 0.0000 139  LEU B CB  
8628 C  CG  . LEU B 119  ? 0.8827 0.8827 0.8827 0.0000 0.0000 0.0000 139  LEU B CG  
8629 C  CD1 . LEU B 119  ? 0.8827 0.8827 0.8827 0.0000 0.0000 0.0000 139  LEU B CD1 
8630 C  CD2 . LEU B 119  ? 0.8827 0.8827 0.8827 0.0000 0.0000 0.0000 139  LEU B CD2 
8631 N  N   . HIS B 120  ? 0.8619 0.8619 0.8619 0.0000 0.0000 0.0000 140  HIS B N   
8632 C  CA  . HIS B 120  ? 0.8619 0.8619 0.8619 0.0000 0.0000 0.0000 140  HIS B CA  
8633 C  C   . HIS B 120  ? 0.8619 0.8619 0.8619 0.0000 0.0000 0.0000 140  HIS B C   
8634 O  O   . HIS B 120  ? 0.8619 0.8619 0.8619 0.0000 0.0000 0.0000 140  HIS B O   
8635 C  CB  . HIS B 120  ? 0.8619 0.8619 0.8619 0.0000 0.0000 0.0000 140  HIS B CB  
8636 C  CG  . HIS B 120  ? 0.8619 0.8619 0.8619 0.0000 0.0000 0.0000 140  HIS B CG  
8637 N  ND1 . HIS B 120  ? 0.8619 0.8619 0.8619 0.0000 0.0000 0.0000 140  HIS B ND1 
8638 C  CD2 . HIS B 120  ? 0.8619 0.8619 0.8619 0.0000 0.0000 0.0000 140  HIS B CD2 
8639 C  CE1 . HIS B 120  ? 0.8619 0.8619 0.8619 0.0000 0.0000 0.0000 140  HIS B CE1 
8640 N  NE2 . HIS B 120  ? 0.8619 0.8619 0.8619 0.0000 0.0000 0.0000 140  HIS B NE2 
8641 N  N   . TYR B 121  ? 0.9936 0.9936 0.9936 0.0000 0.0000 0.0000 141  TYR B N   
8642 C  CA  . TYR B 121  ? 0.9936 0.9936 0.9936 0.0000 0.0000 0.0000 141  TYR B CA  
8643 C  C   . TYR B 121  ? 0.9936 0.9936 0.9936 0.0000 0.0000 0.0000 141  TYR B C   
8644 O  O   . TYR B 121  ? 0.9936 0.9936 0.9936 0.0000 0.0000 0.0000 141  TYR B O   
8645 C  CB  . TYR B 121  ? 0.9936 0.9936 0.9936 0.0000 0.0000 0.0000 141  TYR B CB  
8646 C  CG  . TYR B 121  ? 0.9936 0.9936 0.9936 0.0000 0.0000 0.0000 141  TYR B CG  
8647 C  CD1 . TYR B 121  ? 0.9936 0.9936 0.9936 0.0000 0.0000 0.0000 141  TYR B CD1 
8648 C  CD2 . TYR B 121  ? 0.9936 0.9936 0.9936 0.0000 0.0000 0.0000 141  TYR B CD2 
8649 C  CE1 . TYR B 121  ? 0.9936 0.9936 0.9936 0.0000 0.0000 0.0000 141  TYR B CE1 
8650 C  CE2 . TYR B 121  ? 0.9936 0.9936 0.9936 0.0000 0.0000 0.0000 141  TYR B CE2 
8651 C  CZ  . TYR B 121  ? 0.9936 0.9936 0.9936 0.0000 0.0000 0.0000 141  TYR B CZ  
8652 O  OH  . TYR B 121