data_6DSU
# 
_entry.id   6DSU 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.319 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   6DSU         
WWPDB D_1000234749 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.entry_id                        6DSU 
_pdbx_database_status.recvd_initial_deposition_date   2018-06-14 
_pdbx_database_status.SG_entry                        N 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
_audit_author.identifier_ORCID 
'Chim, N.'      1 0000-0003-2274-5305 
'Jackson, L.N.' 2 ?                   
'Chaput, J.C.'  3 0000-0003-1393-135X 
# 
_citation.abstract                  ? 
_citation.abstract_id_CAS           ? 
_citation.book_id_ISBN              ? 
_citation.book_publisher            ? 
_citation.book_publisher_city       ? 
_citation.book_title                ? 
_citation.coordinate_linkage        ? 
_citation.country                   US 
_citation.database_id_Medline       ? 
_citation.details                   ? 
_citation.id                        primary 
_citation.journal_abbrev            Elife 
_citation.journal_id_ASTM           ? 
_citation.journal_id_CSD            ? 
_citation.journal_id_ISSN           2050-084X 
_citation.journal_full              ? 
_citation.journal_issue             ? 
_citation.journal_volume            7 
_citation.language                  ? 
_citation.page_first                ? 
_citation.page_last                 ? 
_citation.title                     
'Crystal structures of DNA polymerase I capture novel intermediates in the DNA synthesis pathway.' 
_citation.year                      2018 
_citation.database_id_CSD           ? 
_citation.pdbx_database_id_DOI      10.7554/eLife.40444 
_citation.pdbx_database_id_PubMed   30338759 
_citation.unpublished_flag          ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Chim, N.'      1 0000-0003-2274-5305 
primary 'Jackson, L.N.' 2 ?                   
primary 'Trinh, A.M.'   3 ?                   
primary 'Chaput, J.C.'  4 0000-0003-1393-135X 
# 
_cell.angle_alpha                  90.00 
_cell.angle_alpha_esd              ? 
_cell.angle_beta                   90.00 
_cell.angle_beta_esd               ? 
_cell.angle_gamma                  90.00 
_cell.angle_gamma_esd              ? 
_cell.entry_id                     6DSU 
_cell.details                      ? 
_cell.formula_units_Z              ? 
_cell.length_a                     87.440 
_cell.length_a_esd                 ? 
_cell.length_b                     93.386 
_cell.length_b_esd                 ? 
_cell.length_c                     104.959 
_cell.length_c_esd                 ? 
_cell.volume                       ? 
_cell.volume_esd                   ? 
_cell.Z_PDB                        4 
_cell.reciprocal_angle_alpha       ? 
_cell.reciprocal_angle_beta        ? 
_cell.reciprocal_angle_gamma       ? 
_cell.reciprocal_angle_alpha_esd   ? 
_cell.reciprocal_angle_beta_esd    ? 
_cell.reciprocal_angle_gamma_esd   ? 
_cell.reciprocal_length_a          ? 
_cell.reciprocal_length_b          ? 
_cell.reciprocal_length_c          ? 
_cell.reciprocal_length_a_esd      ? 
_cell.reciprocal_length_b_esd      ? 
_cell.reciprocal_length_c_esd      ? 
_cell.pdbx_unique_axis             ? 
# 
_symmetry.entry_id                         6DSU 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                19 
_symmetry.space_group_name_Hall            ? 
_symmetry.space_group_name_H-M             'P 21 21 21' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     syn 
;DNA (5'-D(*GP*CP*GP*AP*TP*CP*AP*CP*GP*T)-3')
;
3045.005  1   ?       ? ? ? 
2 polymer     syn 
;DNA (5'-D(P*AP*CP*GP*TP*GP*AP*TP*CP*GP*CP*A)-3')
;
3358.211  1   ?       ? ? ? 
3 polymer     man 'DNA polymerase I'                                                                           66233.938 1   
2.7.7.7 ? ? ? 
4 non-polymer syn 'MAGNESIUM ION'                                                                              24.305    1   ? ? ? 
? 
5 non-polymer syn 'SULFATE ION'                                                                                96.063    3   ? ? ? 
? 
6 non-polymer syn "2'-deoxy-5'-O-[(R)-hydroxy{[(R)-hydroxy(phosphonooxy)phosphoryl]amino}phosphoryl]adenosine" 490.197   1   ? ? ? 
? 
7 water       nat water                                                                                        18.015    343 ? ? ? 
? 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 polydeoxyribonucleotide no no '(DG)(DC)(DG)(DA)(DT)(DC)(DA)(DC)(DG)(DT)' GCGATCACGT P ? 
2 polydeoxyribonucleotide no no '(DA)(DC)(DG)(DT)(DG)(DA)(DT)(DC)(DG)(DC)(DA)' ACGTGATCGCA T ? 
3 'polypeptide(L)'        no no 
;AKMAFTLADRVTEEMLADKAALVVEVVEENYHDAPIVGIAVVNEHGRFFLRPETALADPQFVAWLGDETKKKSMFDSKRA
AVALKWKGIELCGVSFDLLLAAYLLDPAQGVDDVAAAAKMKQYEAVRPDEAVYGKGAKRAVPDEPVLAEHLVRKAAAIWA
LERPFLDELRRNEQDRLLVELEQPLSSILAEMEFAGVKVDTKRLEQMGEELAEQLRTVEQRIYELAGQEFNINSPKQLGV
ILFEKLQLPVLKKTKTGYSTSADVLEKLAPYHEIVENILHYRQLGKLQSTYIEGLLKVVRPDTKKVHTIFNQALTQTGRL
SSTEPNLQNIPIRLEEGRKIRQAFVPSESDWLIFAADYSQIELRVLAHIAEDDNLMEAFRRDLDIHTKTAMDIFQVSEDE
VTPNMRRQAKAVNFGIVYGISDYGLAQNLNISRKEAAEFIERYFESFPGVKRYMENIVQEAKQKGYVTTLLHRRRYLPDI
TSRNFNVRSFAERMAMNTPIQGSAADIIKKAMIDLNARLKEERLQARLLLQVHDELILEAPKEEMERLCRLVPEVMEQAV
TLRVPLKVDYHYGSTWYDAK
;
;AKMAFTLADRVTEEMLADKAALVVEVVEENYHDAPIVGIAVVNEHGRFFLRPETALADPQFVAWLGDETKKKSMFDSKRA
AVALKWKGIELCGVSFDLLLAAYLLDPAQGVDDVAAAAKMKQYEAVRPDEAVYGKGAKRAVPDEPVLAEHLVRKAAAIWA
LERPFLDELRRNEQDRLLVELEQPLSSILAEMEFAGVKVDTKRLEQMGEELAEQLRTVEQRIYELAGQEFNINSPKQLGV
ILFEKLQLPVLKKTKTGYSTSADVLEKLAPYHEIVENILHYRQLGKLQSTYIEGLLKVVRPDTKKVHTIFNQALTQTGRL
SSTEPNLQNIPIRLEEGRKIRQAFVPSESDWLIFAADYSQIELRVLAHIAEDDNLMEAFRRDLDIHTKTAMDIFQVSEDE
VTPNMRRQAKAVNFGIVYGISDYGLAQNLNISRKEAAEFIERYFESFPGVKRYMENIVQEAKQKGYVTTLLHRRRYLPDI
TSRNFNVRSFAERMAMNTPIQGSAADIIKKAMIDLNARLKEERLQARLLLQVHDELILEAPKEEMERLCRLVPEVMEQAV
TLRVPLKVDYHYGSTWYDAK
;
A ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   DG  n 
1 2   DC  n 
1 3   DG  n 
1 4   DA  n 
1 5   DT  n 
1 6   DC  n 
1 7   DA  n 
1 8   DC  n 
1 9   DG  n 
1 10  DT  n 
2 1   DA  n 
2 2   DC  n 
2 3   DG  n 
2 4   DT  n 
2 5   DG  n 
2 6   DA  n 
2 7   DT  n 
2 8   DC  n 
2 9   DG  n 
2 10  DC  n 
2 11  DA  n 
3 1   ALA n 
3 2   LYS n 
3 3   MET n 
3 4   ALA n 
3 5   PHE n 
3 6   THR n 
3 7   LEU n 
3 8   ALA n 
3 9   ASP n 
3 10  ARG n 
3 11  VAL n 
3 12  THR n 
3 13  GLU n 
3 14  GLU n 
3 15  MET n 
3 16  LEU n 
3 17  ALA n 
3 18  ASP n 
3 19  LYS n 
3 20  ALA n 
3 21  ALA n 
3 22  LEU n 
3 23  VAL n 
3 24  VAL n 
3 25  GLU n 
3 26  VAL n 
3 27  VAL n 
3 28  GLU n 
3 29  GLU n 
3 30  ASN n 
3 31  TYR n 
3 32  HIS n 
3 33  ASP n 
3 34  ALA n 
3 35  PRO n 
3 36  ILE n 
3 37  VAL n 
3 38  GLY n 
3 39  ILE n 
3 40  ALA n 
3 41  VAL n 
3 42  VAL n 
3 43  ASN n 
3 44  GLU n 
3 45  HIS n 
3 46  GLY n 
3 47  ARG n 
3 48  PHE n 
3 49  PHE n 
3 50  LEU n 
3 51  ARG n 
3 52  PRO n 
3 53  GLU n 
3 54  THR n 
3 55  ALA n 
3 56  LEU n 
3 57  ALA n 
3 58  ASP n 
3 59  PRO n 
3 60  GLN n 
3 61  PHE n 
3 62  VAL n 
3 63  ALA n 
3 64  TRP n 
3 65  LEU n 
3 66  GLY n 
3 67  ASP n 
3 68  GLU n 
3 69  THR n 
3 70  LYS n 
3 71  LYS n 
3 72  LYS n 
3 73  SER n 
3 74  MET n 
3 75  PHE n 
3 76  ASP n 
3 77  SER n 
3 78  LYS n 
3 79  ARG n 
3 80  ALA n 
3 81  ALA n 
3 82  VAL n 
3 83  ALA n 
3 84  LEU n 
3 85  LYS n 
3 86  TRP n 
3 87  LYS n 
3 88  GLY n 
3 89  ILE n 
3 90  GLU n 
3 91  LEU n 
3 92  CYS n 
3 93  GLY n 
3 94  VAL n 
3 95  SER n 
3 96  PHE n 
3 97  ASP n 
3 98  LEU n 
3 99  LEU n 
3 100 LEU n 
3 101 ALA n 
3 102 ALA n 
3 103 TYR n 
3 104 LEU n 
3 105 LEU n 
3 106 ASP n 
3 107 PRO n 
3 108 ALA n 
3 109 GLN n 
3 110 GLY n 
3 111 VAL n 
3 112 ASP n 
3 113 ASP n 
3 114 VAL n 
3 115 ALA n 
3 116 ALA n 
3 117 ALA n 
3 118 ALA n 
3 119 LYS n 
3 120 MET n 
3 121 LYS n 
3 122 GLN n 
3 123 TYR n 
3 124 GLU n 
3 125 ALA n 
3 126 VAL n 
3 127 ARG n 
3 128 PRO n 
3 129 ASP n 
3 130 GLU n 
3 131 ALA n 
3 132 VAL n 
3 133 TYR n 
3 134 GLY n 
3 135 LYS n 
3 136 GLY n 
3 137 ALA n 
3 138 LYS n 
3 139 ARG n 
3 140 ALA n 
3 141 VAL n 
3 142 PRO n 
3 143 ASP n 
3 144 GLU n 
3 145 PRO n 
3 146 VAL n 
3 147 LEU n 
3 148 ALA n 
3 149 GLU n 
3 150 HIS n 
3 151 LEU n 
3 152 VAL n 
3 153 ARG n 
3 154 LYS n 
3 155 ALA n 
3 156 ALA n 
3 157 ALA n 
3 158 ILE n 
3 159 TRP n 
3 160 ALA n 
3 161 LEU n 
3 162 GLU n 
3 163 ARG n 
3 164 PRO n 
3 165 PHE n 
3 166 LEU n 
3 167 ASP n 
3 168 GLU n 
3 169 LEU n 
3 170 ARG n 
3 171 ARG n 
3 172 ASN n 
3 173 GLU n 
3 174 GLN n 
3 175 ASP n 
3 176 ARG n 
3 177 LEU n 
3 178 LEU n 
3 179 VAL n 
3 180 GLU n 
3 181 LEU n 
3 182 GLU n 
3 183 GLN n 
3 184 PRO n 
3 185 LEU n 
3 186 SER n 
3 187 SER n 
3 188 ILE n 
3 189 LEU n 
3 190 ALA n 
3 191 GLU n 
3 192 MET n 
3 193 GLU n 
3 194 PHE n 
3 195 ALA n 
3 196 GLY n 
3 197 VAL n 
3 198 LYS n 
3 199 VAL n 
3 200 ASP n 
3 201 THR n 
3 202 LYS n 
3 203 ARG n 
3 204 LEU n 
3 205 GLU n 
3 206 GLN n 
3 207 MET n 
3 208 GLY n 
3 209 GLU n 
3 210 GLU n 
3 211 LEU n 
3 212 ALA n 
3 213 GLU n 
3 214 GLN n 
3 215 LEU n 
3 216 ARG n 
3 217 THR n 
3 218 VAL n 
3 219 GLU n 
3 220 GLN n 
3 221 ARG n 
3 222 ILE n 
3 223 TYR n 
3 224 GLU n 
3 225 LEU n 
3 226 ALA n 
3 227 GLY n 
3 228 GLN n 
3 229 GLU n 
3 230 PHE n 
3 231 ASN n 
3 232 ILE n 
3 233 ASN n 
3 234 SER n 
3 235 PRO n 
3 236 LYS n 
3 237 GLN n 
3 238 LEU n 
3 239 GLY n 
3 240 VAL n 
3 241 ILE n 
3 242 LEU n 
3 243 PHE n 
3 244 GLU n 
3 245 LYS n 
3 246 LEU n 
3 247 GLN n 
3 248 LEU n 
3 249 PRO n 
3 250 VAL n 
3 251 LEU n 
3 252 LYS n 
3 253 LYS n 
3 254 THR n 
3 255 LYS n 
3 256 THR n 
3 257 GLY n 
3 258 TYR n 
3 259 SER n 
3 260 THR n 
3 261 SER n 
3 262 ALA n 
3 263 ASP n 
3 264 VAL n 
3 265 LEU n 
3 266 GLU n 
3 267 LYS n 
3 268 LEU n 
3 269 ALA n 
3 270 PRO n 
3 271 TYR n 
3 272 HIS n 
3 273 GLU n 
3 274 ILE n 
3 275 VAL n 
3 276 GLU n 
3 277 ASN n 
3 278 ILE n 
3 279 LEU n 
3 280 HIS n 
3 281 TYR n 
3 282 ARG n 
3 283 GLN n 
3 284 LEU n 
3 285 GLY n 
3 286 LYS n 
3 287 LEU n 
3 288 GLN n 
3 289 SER n 
3 290 THR n 
3 291 TYR n 
3 292 ILE n 
3 293 GLU n 
3 294 GLY n 
3 295 LEU n 
3 296 LEU n 
3 297 LYS n 
3 298 VAL n 
3 299 VAL n 
3 300 ARG n 
3 301 PRO n 
3 302 ASP n 
3 303 THR n 
3 304 LYS n 
3 305 LYS n 
3 306 VAL n 
3 307 HIS n 
3 308 THR n 
3 309 ILE n 
3 310 PHE n 
3 311 ASN n 
3 312 GLN n 
3 313 ALA n 
3 314 LEU n 
3 315 THR n 
3 316 GLN n 
3 317 THR n 
3 318 GLY n 
3 319 ARG n 
3 320 LEU n 
3 321 SER n 
3 322 SER n 
3 323 THR n 
3 324 GLU n 
3 325 PRO n 
3 326 ASN n 
3 327 LEU n 
3 328 GLN n 
3 329 ASN n 
3 330 ILE n 
3 331 PRO n 
3 332 ILE n 
3 333 ARG n 
3 334 LEU n 
3 335 GLU n 
3 336 GLU n 
3 337 GLY n 
3 338 ARG n 
3 339 LYS n 
3 340 ILE n 
3 341 ARG n 
3 342 GLN n 
3 343 ALA n 
3 344 PHE n 
3 345 VAL n 
3 346 PRO n 
3 347 SER n 
3 348 GLU n 
3 349 SER n 
3 350 ASP n 
3 351 TRP n 
3 352 LEU n 
3 353 ILE n 
3 354 PHE n 
3 355 ALA n 
3 356 ALA n 
3 357 ASP n 
3 358 TYR n 
3 359 SER n 
3 360 GLN n 
3 361 ILE n 
3 362 GLU n 
3 363 LEU n 
3 364 ARG n 
3 365 VAL n 
3 366 LEU n 
3 367 ALA n 
3 368 HIS n 
3 369 ILE n 
3 370 ALA n 
3 371 GLU n 
3 372 ASP n 
3 373 ASP n 
3 374 ASN n 
3 375 LEU n 
3 376 MET n 
3 377 GLU n 
3 378 ALA n 
3 379 PHE n 
3 380 ARG n 
3 381 ARG n 
3 382 ASP n 
3 383 LEU n 
3 384 ASP n 
3 385 ILE n 
3 386 HIS n 
3 387 THR n 
3 388 LYS n 
3 389 THR n 
3 390 ALA n 
3 391 MET n 
3 392 ASP n 
3 393 ILE n 
3 394 PHE n 
3 395 GLN n 
3 396 VAL n 
3 397 SER n 
3 398 GLU n 
3 399 ASP n 
3 400 GLU n 
3 401 VAL n 
3 402 THR n 
3 403 PRO n 
3 404 ASN n 
3 405 MET n 
3 406 ARG n 
3 407 ARG n 
3 408 GLN n 
3 409 ALA n 
3 410 LYS n 
3 411 ALA n 
3 412 VAL n 
3 413 ASN n 
3 414 PHE n 
3 415 GLY n 
3 416 ILE n 
3 417 VAL n 
3 418 TYR n 
3 419 GLY n 
3 420 ILE n 
3 421 SER n 
3 422 ASP n 
3 423 TYR n 
3 424 GLY n 
3 425 LEU n 
3 426 ALA n 
3 427 GLN n 
3 428 ASN n 
3 429 LEU n 
3 430 ASN n 
3 431 ILE n 
3 432 SER n 
3 433 ARG n 
3 434 LYS n 
3 435 GLU n 
3 436 ALA n 
3 437 ALA n 
3 438 GLU n 
3 439 PHE n 
3 440 ILE n 
3 441 GLU n 
3 442 ARG n 
3 443 TYR n 
3 444 PHE n 
3 445 GLU n 
3 446 SER n 
3 447 PHE n 
3 448 PRO n 
3 449 GLY n 
3 450 VAL n 
3 451 LYS n 
3 452 ARG n 
3 453 TYR n 
3 454 MET n 
3 455 GLU n 
3 456 ASN n 
3 457 ILE n 
3 458 VAL n 
3 459 GLN n 
3 460 GLU n 
3 461 ALA n 
3 462 LYS n 
3 463 GLN n 
3 464 LYS n 
3 465 GLY n 
3 466 TYR n 
3 467 VAL n 
3 468 THR n 
3 469 THR n 
3 470 LEU n 
3 471 LEU n 
3 472 HIS n 
3 473 ARG n 
3 474 ARG n 
3 475 ARG n 
3 476 TYR n 
3 477 LEU n 
3 478 PRO n 
3 479 ASP n 
3 480 ILE n 
3 481 THR n 
3 482 SER n 
3 483 ARG n 
3 484 ASN n 
3 485 PHE n 
3 486 ASN n 
3 487 VAL n 
3 488 ARG n 
3 489 SER n 
3 490 PHE n 
3 491 ALA n 
3 492 GLU n 
3 493 ARG n 
3 494 MET n 
3 495 ALA n 
3 496 MET n 
3 497 ASN n 
3 498 THR n 
3 499 PRO n 
3 500 ILE n 
3 501 GLN n 
3 502 GLY n 
3 503 SER n 
3 504 ALA n 
3 505 ALA n 
3 506 ASP n 
3 507 ILE n 
3 508 ILE n 
3 509 LYS n 
3 510 LYS n 
3 511 ALA n 
3 512 MET n 
3 513 ILE n 
3 514 ASP n 
3 515 LEU n 
3 516 ASN n 
3 517 ALA n 
3 518 ARG n 
3 519 LEU n 
3 520 LYS n 
3 521 GLU n 
3 522 GLU n 
3 523 ARG n 
3 524 LEU n 
3 525 GLN n 
3 526 ALA n 
3 527 ARG n 
3 528 LEU n 
3 529 LEU n 
3 530 LEU n 
3 531 GLN n 
3 532 VAL n 
3 533 HIS n 
3 534 ASP n 
3 535 GLU n 
3 536 LEU n 
3 537 ILE n 
3 538 LEU n 
3 539 GLU n 
3 540 ALA n 
3 541 PRO n 
3 542 LYS n 
3 543 GLU n 
3 544 GLU n 
3 545 MET n 
3 546 GLU n 
3 547 ARG n 
3 548 LEU n 
3 549 CYS n 
3 550 ARG n 
3 551 LEU n 
3 552 VAL n 
3 553 PRO n 
3 554 GLU n 
3 555 VAL n 
3 556 MET n 
3 557 GLU n 
3 558 GLN n 
3 559 ALA n 
3 560 VAL n 
3 561 THR n 
3 562 LEU n 
3 563 ARG n 
3 564 VAL n 
3 565 PRO n 
3 566 LEU n 
3 567 LYS n 
3 568 VAL n 
3 569 ASP n 
3 570 TYR n 
3 571 HIS n 
3 572 TYR n 
3 573 GLY n 
3 574 SER n 
3 575 THR n 
3 576 TRP n 
3 577 TYR n 
3 578 ASP n 
3 579 ALA n 
3 580 LYS n 
# 
_entity_src_gen.entity_id                          3 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      'Biological sequence' 
_entity_src_gen.pdbx_beg_seq_num                   1 
_entity_src_gen.pdbx_end_seq_num                   580 
_entity_src_gen.gene_src_common_name               ? 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 polA 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Geobacillus stearothermophilus' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     1422 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
loop_
_pdbx_entity_src_syn.entity_id 
_pdbx_entity_src_syn.pdbx_src_id 
_pdbx_entity_src_syn.pdbx_alt_source_flag 
_pdbx_entity_src_syn.pdbx_beg_seq_num 
_pdbx_entity_src_syn.pdbx_end_seq_num 
_pdbx_entity_src_syn.organism_scientific 
_pdbx_entity_src_syn.organism_common_name 
_pdbx_entity_src_syn.ncbi_taxonomy_id 
_pdbx_entity_src_syn.details 
1 1 sample 1 10 'synthetic construct' ? 32630 ? 
2 1 sample 1 11 'synthetic construct' ? 32630 ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_db_isoform 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
1 PDB 6DSU         6DSU   ? 1 ? 1 
2 PDB 6DSU         6DSU   ? 2 ? 1 
3 UNP E1C9K5_GEOSE E1C9K5 ? 3 
;AKMAFTLADRVTEEMLADKAALVVEVVEENYHDAPIVGIAVVNEHGRFFLRPETALADPQFVAWLGDETKKKSMFDSKRA
AVALKWKGIELCGVSFDLLLAAYLLDPAQGVDDVAAAAKMKQYEAVRPDEAVYGKGAKRAVPDEPVLAEHLVRKAAAIWA
LERPFLDELRRNEQDRLLVELEQPLSSILAEMEFAGVKVDTKRLEQMGEELAEQLRTVEQRIYELAGQEFNINSPKQLGV
ILFEKLQLPVLKKSKTGYSTSADVLEKLAPYHEIVENILHYRQLGKLQSTYIEGLLKVVRPDTKKVHTIFNQALTQTGRL
SSTEPNLQNIPIRLEEGRKIRQAFVPSESDWLIFAADYSQIELRVLAHIAEDDNLMEAFRRDLDIHTKTAMDIFQVSEDE
VTPNMRRQAKAVNFGIVYGISDYGLAQNLNISRKEAAEFIERYFESFPGVKRYMENIVQEAKQKGYVTTLLHRRRYLPDI
TSRNFNVRSFAERMAMNTPIQGSAADIIKKAMIDLNARLKEERLQARLLLQVHDELILEAPKEEMERLCRLVPEVMEQAV
TLRVPLKVDYHYGSTWYDAK
;
1 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 6DSU P 1 ? 10  ? 6DSU   1 ? 10  ? 1   10  
2 2 6DSU T 1 ? 11  ? 6DSU   4 ? 14  ? 4   14  
3 3 6DSU A 1 ? 580 ? E1C9K5 1 ? 580 ? 297 876 
# 
_struct_ref_seq_dif.align_id                     3 
_struct_ref_seq_dif.pdbx_pdb_id_code             6DSU 
_struct_ref_seq_dif.mon_id                       THR 
_struct_ref_seq_dif.pdbx_pdb_strand_id           A 
_struct_ref_seq_dif.seq_num                      254 
_struct_ref_seq_dif.pdbx_pdb_ins_code            ? 
_struct_ref_seq_dif.pdbx_seq_db_name             UNP 
_struct_ref_seq_dif.pdbx_seq_db_accession_code   E1C9K5 
_struct_ref_seq_dif.db_mon_id                    SER 
_struct_ref_seq_dif.pdbx_seq_db_seq_num          254 
_struct_ref_seq_dif.details                      conflict 
_struct_ref_seq_dif.pdbx_auth_seq_num            550 
_struct_ref_seq_dif.pdbx_ordinal                 1 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                                                                                      ? 
'C3 H7 N O2'        89.093  
ARG 'L-peptide linking' y ARGININE                                                                                     ? 
'C6 H15 N4 O2 1'    175.209 
ASN 'L-peptide linking' y ASPARAGINE                                                                                   ? 
'C4 H8 N2 O3'       132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                                                                              ? 
'C4 H7 N O4'        133.103 
CYS 'L-peptide linking' y CYSTEINE                                                                                     ? 
'C3 H7 N O2 S'      121.158 
DA  'DNA linking'       y "2'-DEOXYADENOSINE-5'-MONOPHOSPHATE"                                                         ? 
'C10 H14 N5 O6 P'   331.222 
DC  'DNA linking'       y "2'-DEOXYCYTIDINE-5'-MONOPHOSPHATE"                                                          ? 
'C9 H14 N3 O7 P'    307.197 
DG  'DNA linking'       y "2'-DEOXYGUANOSINE-5'-MONOPHOSPHATE"                                                         ? 
'C10 H14 N5 O7 P'   347.221 
DT  'DNA linking'       y "THYMIDINE-5'-MONOPHOSPHATE"                                                                 ? 
'C10 H15 N2 O8 P'   322.208 
DZ4 non-polymer         . "2'-deoxy-5'-O-[(R)-hydroxy{[(R)-hydroxy(phosphonooxy)phosphoryl]amino}phosphoryl]adenosine" ? 
'C10 H17 N6 O11 P3' 490.197 
GLN 'L-peptide linking' y GLUTAMINE                                                                                    ? 
'C5 H10 N2 O3'      146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                                                                              ? 
'C5 H9 N O4'        147.129 
GLY 'peptide linking'   y GLYCINE                                                                                      ? 
'C2 H5 N O2'        75.067  
HIS 'L-peptide linking' y HISTIDINE                                                                                    ? 
'C6 H10 N3 O2 1'    156.162 
HOH non-polymer         . WATER                                                                                        ? 'H2 O' 
18.015  
ILE 'L-peptide linking' y ISOLEUCINE                                                                                   ? 
'C6 H13 N O2'       131.173 
LEU 'L-peptide linking' y LEUCINE                                                                                      ? 
'C6 H13 N O2'       131.173 
LYS 'L-peptide linking' y LYSINE                                                                                       ? 
'C6 H15 N2 O2 1'    147.195 
MET 'L-peptide linking' y METHIONINE                                                                                   ? 
'C5 H11 N O2 S'     149.211 
MG  non-polymer         . 'MAGNESIUM ION'                                                                              ? 'Mg 2' 
24.305  
PHE 'L-peptide linking' y PHENYLALANINE                                                                                ? 
'C9 H11 N O2'       165.189 
PRO 'L-peptide linking' y PROLINE                                                                                      ? 
'C5 H9 N O2'        115.130 
SER 'L-peptide linking' y SERINE                                                                                       ? 
'C3 H7 N O3'        105.093 
SO4 non-polymer         . 'SULFATE ION'                                                                                ? 'O4 S -2' 
96.063  
THR 'L-peptide linking' y THREONINE                                                                                    ? 
'C4 H9 N O3'        119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                                                                                   ? 
'C11 H12 N2 O2'     204.225 
TYR 'L-peptide linking' y TYROSINE                                                                                     ? 
'C9 H11 N O3'       181.189 
VAL 'L-peptide linking' y VALINE                                                                                       ? 
'C5 H11 N O2'       117.146 
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.entry_id                   6DSU 
_exptl.crystals_number            1 
_exptl.details                    ? 
_exptl.method                     'X-RAY DIFFRACTION' 
_exptl.method_details             ? 
# 
_exptl_crystal.colour                      ? 
_exptl_crystal.density_diffrn              ? 
_exptl_crystal.density_Matthews            2.96 
_exptl_crystal.density_method              ? 
_exptl_crystal.density_percent_sol         58.39 
_exptl_crystal.description                 ? 
_exptl_crystal.F_000                       ? 
_exptl_crystal.id                          1 
_exptl_crystal.preparation                 ? 
_exptl_crystal.size_max                    ? 
_exptl_crystal.size_mid                    ? 
_exptl_crystal.size_min                    ? 
_exptl_crystal.size_rad                    ? 
_exptl_crystal.colour_lustre               ? 
_exptl_crystal.colour_modifier             ? 
_exptl_crystal.colour_primary              ? 
_exptl_crystal.density_meas                ? 
_exptl_crystal.density_meas_esd            ? 
_exptl_crystal.density_meas_gt             ? 
_exptl_crystal.density_meas_lt             ? 
_exptl_crystal.density_meas_temp           ? 
_exptl_crystal.density_meas_temp_esd       ? 
_exptl_crystal.density_meas_temp_gt        ? 
_exptl_crystal.density_meas_temp_lt        ? 
_exptl_crystal.pdbx_crystal_image_url      ? 
_exptl_crystal.pdbx_crystal_image_format   ? 
_exptl_crystal.pdbx_mosaicity              ? 
_exptl_crystal.pdbx_mosaicity_esd          ? 
# 
_exptl_crystal_grow.apparatus       ? 
_exptl_crystal_grow.atmosphere      ? 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.details         ? 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.method_ref      ? 
_exptl_crystal_grow.pH              ? 
_exptl_crystal_grow.pressure        ? 
_exptl_crystal_grow.pressure_esd    ? 
_exptl_crystal_grow.seeding         ? 
_exptl_crystal_grow.seeding_ref     ? 
_exptl_crystal_grow.temp            298 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.temp_esd        ? 
_exptl_crystal_grow.time            ? 
_exptl_crystal_grow.pdbx_details    '2.5% MPD, 52% ammonium sulfate, 0.1M MES (pH 5.8), 0.01M magnesium chloride' 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.ambient_environment              ? 
_diffrn.ambient_temp                     100 
_diffrn.ambient_temp_details             ? 
_diffrn.ambient_temp_esd                 ? 
_diffrn.crystal_id                       1 
_diffrn.crystal_support                  ? 
_diffrn.crystal_treatment                ? 
_diffrn.details                          ? 
_diffrn.id                               1 
_diffrn.ambient_pressure                 ? 
_diffrn.ambient_pressure_esd             ? 
_diffrn.ambient_pressure_gt              ? 
_diffrn.ambient_pressure_lt              ? 
_diffrn.ambient_temp_gt                  ? 
_diffrn.ambient_temp_lt                  ? 
_diffrn.pdbx_serial_crystal_experiment   ? 
# 
_diffrn_detector.details                      ? 
_diffrn_detector.detector                     CCD 
_diffrn_detector.diffrn_id                    1 
_diffrn_detector.type                         'ADSC QUANTUM 315r' 
_diffrn_detector.area_resol_mean              ? 
_diffrn_detector.dtime                        ? 
_diffrn_detector.pdbx_frames_total            ? 
_diffrn_detector.pdbx_collection_time_total   ? 
_diffrn_detector.pdbx_collection_date         2018-02-14 
_diffrn_detector.pdbx_frequency               ? 
# 
_diffrn_radiation.collimation                      ? 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.filter_edge                      ? 
_diffrn_radiation.inhomogeneity                    ? 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.polarisn_norm                    ? 
_diffrn_radiation.polarisn_ratio                   ? 
_diffrn_radiation.probe                            ? 
_diffrn_radiation.type                             ? 
_diffrn_radiation.xray_symbol                      ? 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_wavelength_list             ? 
_diffrn_radiation.pdbx_wavelength                  ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_analyzer                    ? 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.current                     ? 
_diffrn_source.details                     ? 
_diffrn_source.diffrn_id                   1 
_diffrn_source.power                       ? 
_diffrn_source.size                        ? 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.target                      ? 
_diffrn_source.type                        'ALS BEAMLINE 8.2.1' 
_diffrn_source.voltage                     ? 
_diffrn_source.take-off_angle              ? 
_diffrn_source.pdbx_wavelength_list        1 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_synchrotron_beamline   8.2.1 
_diffrn_source.pdbx_synchrotron_site       ALS 
# 
_reflns.B_iso_Wilson_estimate            ? 
_reflns.entry_id                         6DSU 
_reflns.data_reduction_details           ? 
_reflns.data_reduction_method            ? 
_reflns.d_resolution_high                1.98 
_reflns.d_resolution_low                 47.0 
_reflns.details                          ? 
_reflns.limit_h_max                      ? 
_reflns.limit_h_min                      ? 
_reflns.limit_k_max                      ? 
_reflns.limit_k_min                      ? 
_reflns.limit_l_max                      ? 
_reflns.limit_l_min                      ? 
_reflns.number_all                       ? 
_reflns.number_obs                       60008 
_reflns.observed_criterion               ? 
_reflns.observed_criterion_F_max         ? 
_reflns.observed_criterion_F_min         ? 
_reflns.observed_criterion_I_max         ? 
_reflns.observed_criterion_I_min         ? 
_reflns.observed_criterion_sigma_F       ? 
_reflns.observed_criterion_sigma_I       ? 
_reflns.percent_possible_obs             98.25 
_reflns.R_free_details                   ? 
_reflns.Rmerge_F_all                     ? 
_reflns.Rmerge_F_obs                     ? 
_reflns.Friedel_coverage                 ? 
_reflns.number_gt                        ? 
_reflns.threshold_expression             ? 
_reflns.pdbx_redundancy                  7.0 
_reflns.pdbx_Rmerge_I_obs                0.0567 
_reflns.pdbx_Rmerge_I_all                ? 
_reflns.pdbx_Rsym_value                  ? 
_reflns.pdbx_netI_over_av_sigmaI         ? 
_reflns.pdbx_netI_over_sigmaI            22.78 
_reflns.pdbx_res_netI_over_av_sigmaI_2   ? 
_reflns.pdbx_res_netI_over_sigmaI_2      ? 
_reflns.pdbx_chi_squared                 ? 
_reflns.pdbx_scaling_rejects             ? 
_reflns.pdbx_d_res_high_opt              ? 
_reflns.pdbx_d_res_low_opt               ? 
_reflns.pdbx_d_res_opt_method            ? 
_reflns.phase_calculation_details        ? 
_reflns.pdbx_Rrim_I_all                  ? 
_reflns.pdbx_Rpim_I_all                  ? 
_reflns.pdbx_d_opt                       ? 
_reflns.pdbx_number_measured_all         ? 
_reflns.pdbx_diffrn_id                   1 
_reflns.pdbx_ordinal                     1 
_reflns.pdbx_CC_half                     0.999 
_reflns.pdbx_R_split                     ? 
# 
_reflns_shell.d_res_high                  1.98 
_reflns_shell.d_res_low                   2.051 
_reflns_shell.meanI_over_sigI_all         ? 
_reflns_shell.meanI_over_sigI_obs         ? 
_reflns_shell.number_measured_all         ? 
_reflns_shell.number_measured_obs         ? 
_reflns_shell.number_possible             ? 
_reflns_shell.number_unique_all           ? 
_reflns_shell.number_unique_obs           5901 
_reflns_shell.percent_possible_all        ? 
_reflns_shell.percent_possible_obs        ? 
_reflns_shell.Rmerge_F_all                ? 
_reflns_shell.Rmerge_F_obs                ? 
_reflns_shell.Rmerge_I_all                ? 
_reflns_shell.Rmerge_I_obs                0.241 
_reflns_shell.meanI_over_sigI_gt          ? 
_reflns_shell.meanI_over_uI_all           ? 
_reflns_shell.meanI_over_uI_gt            ? 
_reflns_shell.number_measured_gt          ? 
_reflns_shell.number_unique_gt            ? 
_reflns_shell.percent_possible_gt         ? 
_reflns_shell.Rmerge_F_gt                 ? 
_reflns_shell.Rmerge_I_gt                 ? 
_reflns_shell.pdbx_redundancy             ? 
_reflns_shell.pdbx_Rsym_value             ? 
_reflns_shell.pdbx_chi_squared            ? 
_reflns_shell.pdbx_netI_over_sigmaI_all   ? 
_reflns_shell.pdbx_netI_over_sigmaI_obs   ? 
_reflns_shell.pdbx_Rrim_I_all             ? 
_reflns_shell.pdbx_Rpim_I_all             ? 
_reflns_shell.pdbx_rejects                ? 
_reflns_shell.pdbx_ordinal                1 
_reflns_shell.pdbx_diffrn_id              1 
_reflns_shell.pdbx_CC_half                0.977 
_reflns_shell.pdbx_R_split                ? 
# 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.B_iso_max                                ? 
_refine.B_iso_mean                               ? 
_refine.B_iso_min                                ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.details                                  ? 
_refine.diff_density_max                         ? 
_refine.diff_density_max_esd                     ? 
_refine.diff_density_min                         ? 
_refine.diff_density_min_esd                     ? 
_refine.diff_density_rms                         ? 
_refine.diff_density_rms_esd                     ? 
_refine.entry_id                                 6DSU 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.ls_abs_structure_details                 ? 
_refine.ls_abs_structure_Flack                   ? 
_refine.ls_abs_structure_Flack_esd               ? 
_refine.ls_abs_structure_Rogers                  ? 
_refine.ls_abs_structure_Rogers_esd              ? 
_refine.ls_d_res_high                            1.980 
_refine.ls_d_res_low                             46.693 
_refine.ls_extinction_coef                       ? 
_refine.ls_extinction_coef_esd                   ? 
_refine.ls_extinction_expression                 ? 
_refine.ls_extinction_method                     ? 
_refine.ls_goodness_of_fit_all                   ? 
_refine.ls_goodness_of_fit_all_esd               ? 
_refine.ls_goodness_of_fit_obs                   ? 
_refine.ls_goodness_of_fit_obs_esd               ? 
_refine.ls_hydrogen_treatment                    ? 
_refine.ls_matrix_type                           ? 
_refine.ls_number_constraints                    ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_reflns_all                     ? 
_refine.ls_number_reflns_obs                     59667 
_refine.ls_number_reflns_R_free                  1386 
_refine.ls_number_reflns_R_work                  ? 
_refine.ls_number_restraints                     ? 
_refine.ls_percent_reflns_obs                    98.67 
_refine.ls_percent_reflns_R_free                 2.32 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_obs                          0.2231 
_refine.ls_R_factor_R_free                       0.2716 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_R_factor_R_work                       0.2220 
_refine.ls_R_Fsqd_factor_obs                     ? 
_refine.ls_R_I_factor_obs                        ? 
_refine.ls_redundancy_reflns_all                 ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.ls_restrained_S_all                      ? 
_refine.ls_restrained_S_obs                      ? 
_refine.ls_shift_over_esd_max                    ? 
_refine.ls_shift_over_esd_mean                   ? 
_refine.ls_structure_factor_coef                 ? 
_refine.ls_weighting_details                     ? 
_refine.ls_weighting_scheme                      ? 
_refine.ls_wR_factor_all                         ? 
_refine.ls_wR_factor_obs                         ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.occupancy_max                            ? 
_refine.occupancy_min                            ? 
_refine.solvent_model_details                    'FLAT BULK SOLVENT MODEL' 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.ls_R_factor_gt                           ? 
_refine.ls_goodness_of_fit_gt                    ? 
_refine.ls_goodness_of_fit_ref                   ? 
_refine.ls_shift_over_su_max                     ? 
_refine.ls_shift_over_su_max_lt                  ? 
_refine.ls_shift_over_su_mean                    ? 
_refine.ls_shift_over_su_mean_lt                 ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          1.34 
_refine.pdbx_ls_sigma_Fsqd                       ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_ls_cross_valid_method               'FREE R-VALUE' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_stereochemistry_target_values       ML 
_refine.pdbx_R_Free_selection_details            ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.pdbx_solvent_vdw_probe_radii             1.11 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             0.90 
_refine.pdbx_real_space_R                        ? 
_refine.pdbx_density_correlation                 ? 
_refine.pdbx_pd_number_of_powder_patterns        ? 
_refine.pdbx_pd_number_of_points                 ? 
_refine.pdbx_pd_meas_number_of_points            ? 
_refine.pdbx_pd_proc_ls_prof_R_factor            ? 
_refine.pdbx_pd_proc_ls_prof_wR_factor           ? 
_refine.pdbx_pd_Marquardt_correlation_coeff      ? 
_refine.pdbx_pd_Fsqrd_R_factor                   ? 
_refine.pdbx_pd_ls_matrix_band_width             ? 
_refine.pdbx_overall_phase_error                 27.05 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_diffrn_id                           1 
_refine.overall_SU_B                             ? 
_refine.overall_SU_ML                            0.20 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_average_fsc_overall                 ? 
_refine.pdbx_average_fsc_work                    ? 
_refine.pdbx_average_fsc_free                    ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        4636 
_refine_hist.pdbx_number_atoms_nucleic_acid   428 
_refine_hist.pdbx_number_atoms_ligand         46 
_refine_hist.number_atoms_solvent             343 
_refine_hist.number_atoms_total               5453 
_refine_hist.d_res_high                       1.980 
_refine_hist.d_res_low                        46.693 
# 
loop_
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.criterion 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.number 
_refine_ls_restr.rejects 
_refine_ls_restr.type 
_refine_ls_restr.weight 
_refine_ls_restr.pdbx_restraint_function 
'X-RAY DIFFRACTION' ? 0.003  ? 5272 ? f_bond_d           ? ? 
'X-RAY DIFFRACTION' ? 0.602  ? 7224 ? f_angle_d          ? ? 
'X-RAY DIFFRACTION' ? 17.317 ? 3130 ? f_dihedral_angle_d ? ? 
'X-RAY DIFFRACTION' ? 0.042  ? 807  ? f_chiral_restr     ? ? 
'X-RAY DIFFRACTION' ? 0.004  ? 858  ? f_plane_restr      ? ? 
# 
loop_
_refine_ls_shell.pdbx_refine_id 
_refine_ls_shell.d_res_high 
_refine_ls_shell.d_res_low 
_refine_ls_shell.number_reflns_all 
_refine_ls_shell.number_reflns_obs 
_refine_ls_shell.number_reflns_R_free 
_refine_ls_shell.number_reflns_R_work 
_refine_ls_shell.percent_reflns_obs 
_refine_ls_shell.percent_reflns_R_free 
_refine_ls_shell.R_factor_all 
_refine_ls_shell.R_factor_obs 
_refine_ls_shell.R_factor_R_free 
_refine_ls_shell.R_factor_R_free_error 
_refine_ls_shell.R_factor_R_work 
_refine_ls_shell.redundancy_reflns_all 
_refine_ls_shell.redundancy_reflns_obs 
_refine_ls_shell.wR_factor_all 
_refine_ls_shell.wR_factor_obs 
_refine_ls_shell.wR_factor_R_free 
_refine_ls_shell.wR_factor_R_work 
_refine_ls_shell.pdbx_total_number_of_bins_used 
_refine_ls_shell.pdbx_phase_error 
_refine_ls_shell.pdbx_fsc_work 
_refine_ls_shell.pdbx_fsc_free 
'X-RAY DIFFRACTION' 1.9800 2.0508  . . 144 5757 99.00  . . . 0.2818 . 0.2255 . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.0508 2.1329  . . 121 5830 99.00  . . . 0.2649 . 0.2369 . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.1329 2.2300  . . 139 5625 96.00  . . . 0.4448 . 0.3793 . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.2300 2.3475  . . 137 5642 97.00  . . . 0.4579 . 0.3663 . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.3475 2.4946  . . 141 5862 100.00 . . . 0.2763 . 0.2426 . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.4946 2.6872  . . 142 5861 100.00 . . . 0.2581 . 0.2252 . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.6872 2.9576  . . 134 5882 100.00 . . . 0.2740 . 0.2171 . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.9576 3.3854  . . 143 5919 100.00 . . . 0.2668 . 0.2066 . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.3854 4.2648  . . 142 5970 100.00 . . . 0.2162 . 0.1772 . . . . . . . . . . 
'X-RAY DIFFRACTION' 4.2648 46.7060 . . 143 5933 96.00  . . . 0.2206 . 0.1789 . . . . . . . . . . 
# 
_struct.entry_id                     6DSU 
_struct.title                        'Bst DNA polymerase I pre-insertion complex structure' 
_struct.pdbx_descriptor              'DNA polymerase I/DNA Complex' 
_struct.pdbx_model_details           ? 
_struct.pdbx_formula_weight          ? 
_struct.pdbx_formula_weight_method   ? 
_struct.pdbx_model_type_details      ? 
_struct.pdbx_CASP_flag               N 
# 
_struct_keywords.entry_id        6DSU 
_struct_keywords.text            'DNA synthesis, TRANSFERASE, TRANSFERASE-DNA complex' 
_struct_keywords.pdbx_keywords   TRANSFERASE/DNA 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
D N N 4 ? 
E N N 5 ? 
F N N 5 ? 
G N N 5 ? 
H N N 6 ? 
I N N 7 ? 
J N N 7 ? 
K N N 7 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  AA1 THR C 12  ? ALA C 17  ? THR A 308 ALA A 313 5 ? 6  
HELX_P HELX_P2  AA2 ARG C 51  ? LEU C 56  ? ARG A 347 LEU A 352 1 ? 6  
HELX_P HELX_P3  AA3 ASP C 58  ? ASP C 67  ? ASP A 354 ASP A 363 1 ? 10 
HELX_P HELX_P4  AA4 ASP C 76  ? LYS C 87  ? ASP A 372 LYS A 383 1 ? 12 
HELX_P HELX_P5  AA5 LEU C 98  ? ASP C 106 ? LEU A 394 ASP A 402 1 ? 9  
HELX_P HELX_P6  AA6 PRO C 107 ? GLY C 110 ? PRO A 403 GLY A 406 5 ? 4  
HELX_P HELX_P7  AA7 ASP C 113 ? MET C 120 ? ASP A 409 MET A 416 1 ? 8  
HELX_P HELX_P8  AA8 PRO C 128 ? GLY C 134 ? PRO A 424 GLY A 430 1 ? 7  
HELX_P HELX_P9  AA9 LYS C 135 ? ARG C 139 ? LYS A 431 ARG A 435 5 ? 5  
HELX_P HELX_P10 AB1 ASP C 143 ? ASN C 172 ? ASP A 439 ASN A 468 1 ? 30 
HELX_P HELX_P11 AB2 GLN C 174 ? LEU C 181 ? GLN A 470 LEU A 477 1 ? 8  
HELX_P HELX_P12 AB3 LEU C 181 ? GLY C 196 ? LEU A 477 GLY A 492 1 ? 16 
HELX_P HELX_P13 AB4 ASP C 200 ? ALA C 226 ? ASP A 496 ALA A 522 1 ? 27 
HELX_P HELX_P14 AB5 SER C 234 ? GLU C 244 ? SER A 530 GLU A 540 1 ? 11 
HELX_P HELX_P15 AB6 SER C 261 ? ALA C 269 ? SER A 557 ALA A 565 1 ? 9  
HELX_P HELX_P16 AB7 PRO C 270 ? HIS C 272 ? PRO A 566 HIS A 568 5 ? 3  
HELX_P HELX_P17 AB8 GLU C 273 ? TYR C 291 ? GLU A 569 TYR A 587 1 ? 19 
HELX_P HELX_P18 AB9 ILE C 292 ? VAL C 299 ? ILE A 588 VAL A 595 1 ? 8  
HELX_P HELX_P19 AC1 ASN C 326 ? ILE C 330 ? ASN A 622 ILE A 626 5 ? 5  
HELX_P HELX_P20 AC2 LEU C 334 ? LYS C 339 ? LEU A 630 LYS A 635 1 ? 6  
HELX_P HELX_P21 AC3 ILE C 340 ? GLN C 342 ? ILE A 636 GLN A 638 5 ? 3  
HELX_P HELX_P22 AC4 GLN C 360 ? GLU C 371 ? GLN A 656 GLU A 667 1 ? 12 
HELX_P HELX_P23 AC5 ASP C 372 ? ARG C 381 ? ASP A 668 ARG A 677 1 ? 10 
HELX_P HELX_P24 AC6 ASP C 384 ? GLN C 395 ? ASP A 680 GLN A 691 1 ? 12 
HELX_P HELX_P25 AC7 SER C 397 ? VAL C 401 ? SER A 693 VAL A 697 5 ? 5  
HELX_P HELX_P26 AC8 THR C 402 ? VAL C 417 ? THR A 698 VAL A 713 1 ? 16 
HELX_P HELX_P27 AC9 SER C 421 ? ASN C 430 ? SER A 717 ASN A 726 1 ? 10 
HELX_P HELX_P28 AD1 SER C 432 ? PHE C 447 ? SER A 728 PHE A 743 1 ? 16 
HELX_P HELX_P29 AD2 PHE C 447 ? GLY C 465 ? PHE A 743 GLY A 761 1 ? 19 
HELX_P HELX_P30 AD3 PRO C 478 ? SER C 482 ? PRO A 774 SER A 778 5 ? 5  
HELX_P HELX_P31 AD4 ASN C 484 ? GLU C 522 ? ASN A 780 GLU A 818 1 ? 39 
HELX_P HELX_P32 AD5 GLU C 544 ? GLN C 558 ? GLU A 840 GLN A 854 1 ? 15 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
metalc1  metalc ? ? D MG .  MG ? ? ? 1_555 H DZ4 .  "O3'" ? ? A MG 901 A DZ4 905 1_555 ? ? ? ? ? ? ?            2.876 ? 
hydrog1  hydrog ? ? A DG 1  N1 ? ? ? 1_555 B DC  10 N3    ? ? P DG 1   T DC  13  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog2  hydrog ? ? A DG 1  N2 ? ? ? 1_555 B DC  10 O2    ? ? P DG 1   T DC  13  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog3  hydrog ? ? A DG 1  O6 ? ? ? 1_555 B DC  10 N4    ? ? P DG 1   T DC  13  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog4  hydrog ? ? A DC 2  N3 ? ? ? 1_555 B DG  9  N1    ? ? P DC 2   T DG  12  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog5  hydrog ? ? A DC 2  N4 ? ? ? 1_555 B DG  9  O6    ? ? P DC 2   T DG  12  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog6  hydrog ? ? A DC 2  O2 ? ? ? 1_555 B DG  9  N2    ? ? P DC 2   T DG  12  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog7  hydrog ? ? A DG 3  N1 ? ? ? 1_555 B DC  8  N3    ? ? P DG 3   T DC  11  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog8  hydrog ? ? A DG 3  N2 ? ? ? 1_555 B DC  8  O2    ? ? P DG 3   T DC  11  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog9  hydrog ? ? A DG 3  O6 ? ? ? 1_555 B DC  8  N4    ? ? P DG 3   T DC  11  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog10 hydrog ? ? A DA 4  N1 ? ? ? 1_555 B DT  7  N3    ? ? P DA 4   T DT  10  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog11 hydrog ? ? A DA 4  N6 ? ? ? 1_555 B DT  7  O4    ? ? P DA 4   T DT  10  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog12 hydrog ? ? A DT 5  N3 ? ? ? 1_555 B DA  6  N1    ? ? P DT 5   T DA  9   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog13 hydrog ? ? A DT 5  O4 ? ? ? 1_555 B DA  6  N6    ? ? P DT 5   T DA  9   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog14 hydrog ? ? A DC 6  N3 ? ? ? 1_555 B DG  5  N1    ? ? P DC 6   T DG  8   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog15 hydrog ? ? A DC 6  N4 ? ? ? 1_555 B DG  5  O6    ? ? P DC 6   T DG  8   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog16 hydrog ? ? A DC 6  O2 ? ? ? 1_555 B DG  5  N2    ? ? P DC 6   T DG  8   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog17 hydrog ? ? A DA 7  N1 ? ? ? 1_555 B DT  4  N3    ? ? P DA 7   T DT  7   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog18 hydrog ? ? A DA 7  N6 ? ? ? 1_555 B DT  4  O4    ? ? P DA 7   T DT  7   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog19 hydrog ? ? A DC 8  N3 ? ? ? 1_555 B DG  3  N1    ? ? P DC 8   T DG  6   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog20 hydrog ? ? A DC 8  N4 ? ? ? 1_555 B DG  3  O6    ? ? P DC 8   T DG  6   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog21 hydrog ? ? A DC 8  O2 ? ? ? 1_555 B DG  3  N2    ? ? P DC 8   T DG  6   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog22 hydrog ? ? A DG 9  N2 ? ? ? 1_555 B DC  2  O2    ? ? P DG 9   T DC  5   1_555 ? ? ? ? ? ? 'DG-DC PAIR' ?     ? 
hydrog23 hydrog ? ? A DT 10 N3 ? ? ? 1_555 B DA  1  N1    ? ? P DT 10  T DA  4   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog24 hydrog ? ? A DT 10 O4 ? ? ? 1_555 B DA  1  N6    ? ? P DT 10  T DA  4   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
metalc ? ? 
hydrog ? ? 
# 
_struct_mon_prot_cis.pdbx_id                1 
_struct_mon_prot_cis.label_comp_id          GLU 
_struct_mon_prot_cis.label_seq_id           324 
_struct_mon_prot_cis.label_asym_id          C 
_struct_mon_prot_cis.label_alt_id           . 
_struct_mon_prot_cis.pdbx_PDB_ins_code      ? 
_struct_mon_prot_cis.auth_comp_id           GLU 
_struct_mon_prot_cis.auth_seq_id            620 
_struct_mon_prot_cis.auth_asym_id           A 
_struct_mon_prot_cis.pdbx_label_comp_id_2   PRO 
_struct_mon_prot_cis.pdbx_label_seq_id_2    325 
_struct_mon_prot_cis.pdbx_label_asym_id_2   C 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2    ? 
_struct_mon_prot_cis.pdbx_auth_comp_id_2    PRO 
_struct_mon_prot_cis.pdbx_auth_seq_id_2     621 
_struct_mon_prot_cis.pdbx_auth_asym_id_2    A 
_struct_mon_prot_cis.pdbx_PDB_model_num     1 
_struct_mon_prot_cis.pdbx_omega_angle       -1.86 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA1 ? 6 ? 
AA2 ? 3 ? 
AA3 ? 2 ? 
AA4 ? 4 ? 
AA5 ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA1 1 2 ? parallel      
AA1 2 3 ? anti-parallel 
AA1 3 4 ? anti-parallel 
AA1 4 5 ? parallel      
AA1 5 6 ? parallel      
AA2 1 2 ? anti-parallel 
AA2 2 3 ? anti-parallel 
AA3 1 2 ? anti-parallel 
AA4 1 2 ? anti-parallel 
AA4 2 3 ? anti-parallel 
AA4 3 4 ? anti-parallel 
AA5 1 2 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA1 1 THR C 6   ? ALA C 8   ? THR A 302 ALA A 304 
AA1 2 GLY C 46  ? LEU C 50  ? GLY A 342 LEU A 346 
AA1 3 GLY C 38  ? ASN C 43  ? GLY A 334 ASN A 339 
AA1 4 LYS C 19  ? GLU C 25  ? LYS A 315 GLU A 321 
AA1 5 LYS C 71  ? MET C 74  ? LYS A 367 MET A 370 
AA1 6 VAL C 94  ? ASP C 97  ? VAL A 390 ASP A 393 
AA2 1 LYS C 305 ? VAL C 306 ? LYS A 601 VAL A 602 
AA2 2 VAL C 197 ? VAL C 199 ? VAL A 493 VAL A 495 
AA2 3 PHE C 344 ? VAL C 345 ? PHE A 640 VAL A 641 
AA3 1 ILE C 309 ? ASN C 311 ? ILE A 605 ASN A 607 
AA3 2 SER C 321 ? THR C 323 ? SER A 617 THR A 619 
AA4 1 ARG C 527 ? VAL C 532 ? ARG A 823 VAL A 828 
AA4 2 GLU C 535 ? PRO C 541 ? GLU A 831 PRO A 837 
AA4 3 TRP C 351 ? SER C 359 ? TRP A 647 SER A 655 
AA4 4 LYS C 567 ? GLY C 573 ? LYS A 863 GLY A 869 
AA5 1 TYR C 466 ? THR C 468 ? TYR A 762 THR A 764 
AA5 2 ARG C 474 ? TYR C 476 ? ARG A 770 TYR A 772 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA1 1 2 N THR C 6   ? N THR A 302 O PHE C 49  ? O PHE A 345 
AA1 2 3 O PHE C 48  ? O PHE A 344 N VAL C 41  ? N VAL A 337 
AA1 3 4 O VAL C 42  ? O VAL A 338 N ALA C 21  ? N ALA A 317 
AA1 4 5 N LEU C 22  ? N LEU A 318 O SER C 73  ? O SER A 369 
AA1 5 6 N MET C 74  ? N MET A 370 O PHE C 96  ? O PHE A 392 
AA2 1 2 O VAL C 306 ? O VAL A 602 N VAL C 197 ? N VAL A 493 
AA2 2 3 N LYS C 198 ? N LYS A 494 O VAL C 345 ? O VAL A 641 
AA3 1 2 N ASN C 311 ? N ASN A 607 O SER C 321 ? O SER A 617 
AA4 1 2 N LEU C 530 ? N LEU A 826 O ILE C 537 ? O ILE A 833 
AA4 2 3 O LEU C 538 ? O LEU A 834 N PHE C 354 ? N PHE A 650 
AA4 3 4 N ASP C 357 ? N ASP A 653 O ASP C 569 ? O ASP A 865 
AA5 1 2 N VAL C 467 ? N VAL A 763 O ARG C 475 ? O ARG A 771 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software A MG  901 ? 4  'binding site for residue MG A 901'  
AC2 Software A SO4 902 ? 5  'binding site for residue SO4 A 902' 
AC3 Software A SO4 903 ? 4  'binding site for residue SO4 A 903' 
AC4 Software A SO4 904 ? 3  'binding site for residue SO4 A 904' 
AC5 Software A DZ4 905 ? 15 'binding site for residue DZ4 A 905' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 4  SER C 359 ? SER A 655  . ? 1_555 ? 
2  AC1 4  GLN C 360 ? GLN A 656  . ? 1_555 ? 
3  AC1 4  DZ4 H .   ? DZ4 A 905  . ? 1_555 ? 
4  AC1 4  HOH K .   ? HOH A 1122 . ? 1_555 ? 
5  AC2 5  GLU C 371 ? GLU A 667  . ? 1_555 ? 
6  AC2 5  ASP C 372 ? ASP A 668  . ? 1_555 ? 
7  AC2 5  ASP C 373 ? ASP A 669  . ? 1_555 ? 
8  AC2 5  GLY C 449 ? GLY A 745  . ? 1_555 ? 
9  AC2 5  HOH K .   ? HOH A 1004 . ? 1_555 ? 
10 AC3 4  ARG C 47  ? ARG A 343  . ? 1_555 ? 
11 AC3 4  ARG C 381 ? ARG A 677  . ? 3_545 ? 
12 AC3 4  LYS C 388 ? LYS A 684  . ? 3_545 ? 
13 AC3 4  MET C 391 ? MET A 687  . ? 3_545 ? 
14 AC4 3  SER C 349 ? SER A 645  . ? 2_565 ? 
15 AC4 3  SER C 432 ? SER A 728  . ? 1_555 ? 
16 AC4 3  ARG C 433 ? ARG A 729  . ? 1_555 ? 
17 AC5 15 ARG C 319 ? ARG A 615  . ? 1_555 ? 
18 AC5 15 ASP C 357 ? ASP A 653  . ? 1_555 ? 
19 AC5 15 TYR C 358 ? TYR A 654  . ? 1_555 ? 
20 AC5 15 GLN C 360 ? GLN A 656  . ? 1_555 ? 
21 AC5 15 GLU C 362 ? GLU A 658  . ? 1_555 ? 
22 AC5 15 HIS C 386 ? HIS A 682  . ? 1_555 ? 
23 AC5 15 ARG C 406 ? ARG A 702  . ? 1_555 ? 
24 AC5 15 LYS C 410 ? LYS A 706  . ? 1_555 ? 
25 AC5 15 VAL C 417 ? VAL A 713  . ? 1_555 ? 
26 AC5 15 TYR C 418 ? TYR A 714  . ? 1_555 ? 
27 AC5 15 GLN C 501 ? GLN A 797  . ? 1_555 ? 
28 AC5 15 ASP C 534 ? ASP A 830  . ? 1_555 ? 
29 AC5 15 MG  D .   ? MG  A 901  . ? 1_555 ? 
30 AC5 15 HOH K .   ? HOH A 1122 . ? 1_555 ? 
31 AC5 15 DT  A 10  ? DT  P 10   . ? 1_555 ? 
# 
_atom_sites.entry_id                    6DSU 
_atom_sites.fract_transf_matrix[1][1]   0.011436 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.010708 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.009528 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
H  
MG 
N  
O  
P  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    O  "O5'"  . DG  A 1 1   ? 32.616  20.035 19.629  1.00 78.96  ?  1    DG  P "O5'"  1 
ATOM   2    C  "C5'"  . DG  A 1 1   ? 31.605  20.397 20.571  1.00 93.27  ?  1    DG  P "C5'"  1 
ATOM   3    C  "C4'"  . DG  A 1 1   ? 31.316  19.251 21.528  1.00 100.09 ?  1    DG  P "C4'"  1 
ATOM   4    O  "O4'"  . DG  A 1 1   ? 32.469  19.033 22.375  1.00 102.59 ?  1    DG  P "O4'"  1 
ATOM   5    C  "C3'"  . DG  A 1 1   ? 30.170  19.496 22.498  1.00 100.58 ?  1    DG  P "C3'"  1 
ATOM   6    O  "O3'"  . DG  A 1 1   ? 29.650  18.255 22.964  1.00 102.41 ?  1    DG  P "O3'"  1 
ATOM   7    C  "C2'"  . DG  A 1 1   ? 30.863  20.257 23.617  1.00 94.33  ?  1    DG  P "C2'"  1 
ATOM   8    C  "C1'"  . DG  A 1 1   ? 32.222  19.561 23.668  1.00 99.08  ?  1    DG  P "C1'"  1 
ATOM   9    N  N9     . DG  A 1 1   ? 33.315  20.461 24.002  1.00 100.48 ?  1    DG  P N9     1 
ATOM   10   C  C8     . DG  A 1 1   ? 33.684  21.596 23.324  1.00 100.48 ?  1    DG  P C8     1 
ATOM   11   N  N7     . DG  A 1 1   ? 34.707  22.205 23.852  1.00 98.05  ?  1    DG  P N7     1 
ATOM   12   C  C5     . DG  A 1 1   ? 35.038  21.422 24.948  1.00 97.03  ?  1    DG  P C5     1 
ATOM   13   C  C6     . DG  A 1 1   ? 36.066  21.583 25.903  1.00 93.63  ?  1    DG  P C6     1 
ATOM   14   O  O6     . DG  A 1 1   ? 36.917  22.480 25.972  1.00 89.71  ?  1    DG  P O6     1 
ATOM   15   N  N1     . DG  A 1 1   ? 36.049  20.563 26.849  1.00 96.49  ?  1    DG  P N1     1 
ATOM   16   C  C2     . DG  A 1 1   ? 35.155  19.521 26.871  1.00 101.91 ?  1    DG  P C2     1 
ATOM   17   N  N2     . DG  A 1 1   ? 35.301  18.633 27.866  1.00 107.98 ?  1    DG  P N2     1 
ATOM   18   N  N3     . DG  A 1 1   ? 34.188  19.358 25.982  1.00 101.14 ?  1    DG  P N3     1 
ATOM   19   C  C4     . DG  A 1 1   ? 34.190  20.343 25.053  1.00 99.05  ?  1    DG  P C4     1 
ATOM   20   P  P      . DC  A 1 2   ? 28.337  18.227 23.892  1.00 100.80 ?  2    DC  P P      1 
ATOM   21   O  OP1    . DC  A 1 2   ? 27.781  16.858 23.831  1.00 105.98 ?  2    DC  P OP1    1 
ATOM   22   O  OP2    . DC  A 1 2   ? 27.488  19.381 23.524  1.00 99.96  ?  2    DC  P OP2    1 
ATOM   23   O  "O5'"  . DC  A 1 2   ? 28.900  18.494 25.366  1.00 89.69  ?  2    DC  P "O5'"  1 
ATOM   24   C  "C5'"  . DC  A 1 2   ? 29.812  17.578 25.957  1.00 89.07  ?  2    DC  P "C5'"  1 
ATOM   25   C  "C4'"  . DC  A 1 2   ? 29.981  17.859 27.440  1.00 88.65  ?  2    DC  P "C4'"  1 
ATOM   26   O  "O4'"  . DC  A 1 2   ? 31.163  18.676 27.653  1.00 88.60  ?  2    DC  P "O4'"  1 
ATOM   27   C  "C3'"  . DC  A 1 2   ? 28.822  18.614 28.099  1.00 86.68  ?  2    DC  P "C3'"  1 
ATOM   28   O  "O3'"  . DC  A 1 2   ? 28.535  18.038 29.369  1.00 93.00  ?  2    DC  P "O3'"  1 
ATOM   29   C  "C2'"  . DC  A 1 2   ? 29.373  20.032 28.245  1.00 82.13  ?  2    DC  P "C2'"  1 
ATOM   30   C  "C1'"  . DC  A 1 2   ? 30.835  19.736 28.520  1.00 83.00  ?  2    DC  P "C1'"  1 
ATOM   31   N  N1     . DC  A 1 2   ? 31.754  20.879 28.253  1.00 74.22  ?  2    DC  P N1     1 
ATOM   32   C  C2     . DC  A 1 2   ? 32.801  21.135 29.140  1.00 70.30  ?  2    DC  P C2     1 
ATOM   33   O  O2     . DC  A 1 2   ? 32.944  20.410 30.133  1.00 70.43  ?  2    DC  P O2     1 
ATOM   34   N  N3     . DC  A 1 2   ? 33.635  22.175 28.893  1.00 67.13  ?  2    DC  P N3     1 
ATOM   35   C  C4     . DC  A 1 2   ? 33.451  22.936 27.813  1.00 69.84  ?  2    DC  P C4     1 
ATOM   36   N  N4     . DC  A 1 2   ? 34.300  23.950 27.611  1.00 65.41  ?  2    DC  P N4     1 
ATOM   37   C  C5     . DC  A 1 2   ? 32.389  22.690 26.893  1.00 70.39  ?  2    DC  P C5     1 
ATOM   38   C  C6     . DC  A 1 2   ? 31.572  21.660 27.150  1.00 70.77  ?  2    DC  P C6     1 
ATOM   39   P  P      . DG  A 1 3   ? 27.103  18.264 30.065  1.00 95.79  ?  3    DG  P P      1 
ATOM   40   O  OP1    . DG  A 1 3   ? 26.406  16.959 30.087  1.00 99.08  ?  3    DG  P OP1    1 
ATOM   41   O  OP2    . DG  A 1 3   ? 26.464  19.431 29.417  1.00 95.87  ?  3    DG  P OP2    1 
ATOM   42   O  "O5'"  . DG  A 1 3   ? 27.467  18.668 31.572  1.00 91.53  ?  3    DG  P "O5'"  1 
ATOM   43   C  "C5'"  . DG  A 1 3   ? 28.021  17.695 32.454  1.00 92.10  ?  3    DG  P "C5'"  1 
ATOM   44   C  "C4'"  . DG  A 1 3   ? 28.870  18.348 33.532  1.00 87.65  ?  3    DG  P "C4'"  1 
ATOM   45   O  "O4'"  . DG  A 1 3   ? 29.828  19.256 32.925  1.00 83.44  ?  3    DG  P "O4'"  1 
ATOM   46   C  "C3'"  . DG  A 1 3   ? 28.097  19.165 34.566  1.00 84.16  ?  3    DG  P "C3'"  1 
ATOM   47   O  "O3'"  . DG  A 1 3   ? 28.567  18.845 35.870  1.00 88.61  ?  3    DG  P "O3'"  1 
ATOM   48   C  "C2'"  . DG  A 1 3   ? 28.406  20.616 34.186  1.00 73.33  ?  3    DG  P "C2'"  1 
ATOM   49   C  "C1'"  . DG  A 1 3   ? 29.804  20.494 33.600  1.00 76.36  ?  3    DG  P "C1'"  1 
ATOM   50   N  N9     . DG  A 1 3   ? 30.133  21.545 32.637  1.00 73.50  ?  3    DG  P N9     1 
ATOM   51   C  C8     . DG  A 1 3   ? 29.391  21.928 31.546  1.00 72.32  ?  3    DG  P C8     1 
ATOM   52   N  N7     . DG  A 1 3   ? 29.939  22.889 30.854  1.00 69.23  ?  3    DG  P N7     1 
ATOM   53   C  C5     . DG  A 1 3   ? 31.125  23.159 31.525  1.00 69.96  ?  3    DG  P C5     1 
ATOM   54   C  C6     . DG  A 1 3   ? 32.139  24.105 31.240  1.00 67.88  ?  3    DG  P C6     1 
ATOM   55   O  O6     . DG  A 1 3   ? 32.192  24.919 30.308  1.00 66.52  ?  3    DG  P O6     1 
ATOM   56   N  N1     . DG  A 1 3   ? 33.172  24.049 32.172  1.00 67.75  ?  3    DG  P N1     1 
ATOM   57   C  C2     . DG  A 1 3   ? 33.219  23.190 33.244  1.00 75.76  ?  3    DG  P C2     1 
ATOM   58   N  N2     . DG  A 1 3   ? 34.300  23.284 34.034  1.00 83.18  ?  3    DG  P N2     1 
ATOM   59   N  N3     . DG  A 1 3   ? 32.275  22.297 33.521  1.00 76.38  ?  3    DG  P N3     1 
ATOM   60   C  C4     . DG  A 1 3   ? 31.261  22.339 32.623  1.00 71.44  ?  3    DG  P C4     1 
ATOM   61   P  P      . DA  A 1 4   ? 27.743  19.306 37.169  1.00 88.42  ?  4    DA  P P      1 
ATOM   62   O  OP1    . DA  A 1 4   ? 27.789  18.191 38.142  1.00 94.51  ?  4    DA  P OP1    1 
ATOM   63   O  OP2    . DA  A 1 4   ? 26.441  19.851 36.721  1.00 91.97  ?  4    DA  P OP2    1 
ATOM   64   O  "O5'"  . DA  A 1 4   ? 28.602  20.523 37.741  1.00 75.62  ?  4    DA  P "O5'"  1 
ATOM   65   C  "C5'"  . DA  A 1 4   ? 29.976  20.339 38.052  1.00 76.78  ?  4    DA  P "C5'"  1 
ATOM   66   C  "C4'"  . DA  A 1 4   ? 30.646  21.679 38.259  1.00 73.37  ?  4    DA  P "C4'"  1 
ATOM   67   O  "O4'"  . DA  A 1 4   ? 30.814  22.319 36.980  1.00 64.92  ?  4    DA  P "O4'"  1 
ATOM   68   C  "C3'"  . DA  A 1 4   ? 29.850  22.645 39.131  1.00 67.97  ?  4    DA  P "C3'"  1 
ATOM   69   O  "O3'"  . DA  A 1 4   ? 30.534  22.876 40.350  1.00 67.17  ?  4    DA  P "O3'"  1 
ATOM   70   C  "C2'"  . DA  A 1 4   ? 29.715  23.930 38.299  1.00 61.17  ?  4    DA  P "C2'"  1 
ATOM   71   C  "C1'"  . DA  A 1 4   ? 30.642  23.705 37.110  1.00 58.31  ?  4    DA  P "C1'"  1 
ATOM   72   N  N9     . DA  A 1 4   ? 30.084  24.190 35.856  1.00 61.94  ?  4    DA  P N9     1 
ATOM   73   C  C8     . DA  A 1 4   ? 28.912  23.794 35.276  1.00 65.83  ?  4    DA  P C8     1 
ATOM   74   N  N7     . DA  A 1 4   ? 28.656  24.391 34.137  1.00 65.35  ?  4    DA  P N7     1 
ATOM   75   C  C5     . DA  A 1 4   ? 29.739  25.233 33.954  1.00 62.54  ?  4    DA  P C5     1 
ATOM   76   C  C6     . DA  A 1 4   ? 30.068  26.140 32.931  1.00 59.84  ?  4    DA  P C6     1 
ATOM   77   N  N6     . DA  A 1 4   ? 29.296  26.346 31.859  1.00 53.14  ?  4    DA  P N6     1 
ATOM   78   N  N1     . DA  A 1 4   ? 31.225  26.827 33.050  1.00 65.91  ?  4    DA  P N1     1 
ATOM   79   C  C2     . DA  A 1 4   ? 31.993  26.612 34.127  1.00 68.76  ?  4    DA  P C2     1 
ATOM   80   N  N3     . DA  A 1 4   ? 31.789  25.786 35.155  1.00 61.58  ?  4    DA  P N3     1 
ATOM   81   C  C4     . DA  A 1 4   ? 30.632  25.120 35.005  1.00 62.03  ?  4    DA  P C4     1 
ATOM   82   P  P      . DT  A 1 5   ? 29.864  23.795 41.483  1.00 74.27  ?  5    DT  P P      1 
ATOM   83   O  OP1    . DT  A 1 5   ? 30.473  23.434 42.782  1.00 87.33  ?  5    DT  P OP1    1 
ATOM   84   O  OP2    . DT  A 1 5   ? 28.396  23.724 41.311  1.00 74.83  ?  5    DT  P OP2    1 
ATOM   85   O  "O5'"  . DT  A 1 5   ? 30.326  25.270 41.087  1.00 70.37  ?  5    DT  P "O5'"  1 
ATOM   86   C  "C5'"  . DT  A 1 5   ? 31.672  25.504 40.703  1.00 68.23  ?  5    DT  P "C5'"  1 
ATOM   87   C  "C4'"  . DT  A 1 5   ? 31.864  26.950 40.295  1.00 66.85  ?  5    DT  P "C4'"  1 
ATOM   88   O  "O4'"  . DT  A 1 5   ? 31.511  27.115 38.904  1.00 62.81  ?  5    DT  P "O4'"  1 
ATOM   89   C  "C3'"  . DT  A 1 5   ? 31.010  27.955 41.076  1.00 67.17  ?  5    DT  P "C3'"  1 
ATOM   90   O  "O3'"  . DT  A 1 5   ? 31.849  28.863 41.771  1.00 63.70  ?  5    DT  P "O3'"  1 
ATOM   91   C  "C2'"  . DT  A 1 5   ? 30.168  28.662 40.002  1.00 61.76  ?  5    DT  P "C2'"  1 
ATOM   92   C  "C1'"  . DT  A 1 5   ? 30.960  28.392 38.733  1.00 59.77  ?  5    DT  P "C1'"  1 
ATOM   93   N  N1     . DT  A 1 5   ? 30.130  28.382 37.496  1.00 57.49  ?  5    DT  P N1     1 
ATOM   94   C  C2     . DT  A 1 5   ? 30.436  29.251 36.474  1.00 52.75  ?  5    DT  P C2     1 
ATOM   95   O  O2     . DT  A 1 5   ? 31.359  30.043 36.525  1.00 54.68  ?  5    DT  P O2     1 
ATOM   96   N  N3     . DT  A 1 5   ? 29.616  29.160 35.380  1.00 56.01  ?  5    DT  P N3     1 
ATOM   97   C  C4     . DT  A 1 5   ? 28.542  28.305 35.210  1.00 52.06  ?  5    DT  P C4     1 
ATOM   98   O  O4     . DT  A 1 5   ? 27.863  28.299 34.188  1.00 48.34  ?  5    DT  P O4     1 
ATOM   99   C  C5     . DT  A 1 5   ? 28.277  27.418 36.320  1.00 54.26  ?  5    DT  P C5     1 
ATOM   100  C  C7     . DT  A 1 5   ? 27.138  26.443 36.251  1.00 66.29  ?  5    DT  P C7     1 
ATOM   101  C  C6     . DT  A 1 5   ? 29.075  27.499 37.396  1.00 57.74  ?  5    DT  P C6     1 
ATOM   102  P  P      . DC  A 1 6   ? 31.212  29.974 42.741  1.00 65.65  ?  6    DC  P P      1 
ATOM   103  O  OP1    . DC  A 1 6   ? 32.216  30.274 43.785  1.00 73.55  ?  6    DC  P OP1    1 
ATOM   104  O  OP2    . DC  A 1 6   ? 29.858  29.524 43.134  1.00 72.01  ?  6    DC  P OP2    1 
ATOM   105  O  "O5'"  . DC  A 1 6   ? 31.040  31.248 41.791  1.00 61.11  ?  6    DC  P "O5'"  1 
ATOM   106  C  "C5'"  . DC  A 1 6   ? 32.153  31.742 41.058  1.00 57.15  ?  6    DC  P "C5'"  1 
ATOM   107  C  "C4'"  . DC  A 1 6   ? 31.732  32.865 40.131  1.00 56.37  ?  6    DC  P "C4'"  1 
ATOM   108  O  "O4'"  . DC  A 1 6   ? 31.064  32.321 38.975  1.00 56.48  ?  6    DC  P "O4'"  1 
ATOM   109  C  "C3'"  . DC  A 1 6   ? 30.761  33.877 40.742  1.00 51.06  ?  6    DC  P "C3'"  1 
ATOM   110  O  "O3'"  . DC  A 1 6   ? 31.409  35.130 40.888  1.00 47.39  ?  6    DC  P "O3'"  1 
ATOM   111  C  "C2'"  . DC  A 1 6   ? 29.591  33.952 39.743  1.00 51.94  ?  6    DC  P "C2'"  1 
ATOM   112  C  "C1'"  . DC  A 1 6   ? 30.161  33.279 38.499  1.00 54.53  ?  6    DC  P "C1'"  1 
ATOM   113  N  N1     . DC  A 1 6   ? 29.137  32.585 37.666  1.00 58.89  ?  6    DC  P N1     1 
ATOM   114  C  C2     . DC  A 1 6   ? 29.030  32.888 36.303  1.00 64.92  ?  6    DC  P C2     1 
ATOM   115  O  O2     . DC  A 1 6   ? 29.788  33.732 35.809  1.00 66.41  ?  6    DC  P O2     1 
ATOM   116  N  N3     . DC  A 1 6   ? 28.094  32.246 35.559  1.00 67.14  ?  6    DC  P N3     1 
ATOM   117  C  C4     . DC  A 1 6   ? 27.294  31.342 36.126  1.00 66.20  ?  6    DC  P C4     1 
ATOM   118  N  N4     . DC  A 1 6   ? 26.387  30.735 35.353  1.00 63.89  ?  6    DC  P N4     1 
ATOM   119  C  C5     . DC  A 1 6   ? 27.388  31.020 37.512  1.00 63.49  ?  6    DC  P C5     1 
ATOM   120  C  C6     . DC  A 1 6   ? 28.314  31.659 38.237  1.00 59.71  ?  6    DC  P C6     1 
ATOM   121  P  P      . DA  A 1 7   ? 30.618  36.380 41.513  1.00 45.76  ?  7    DA  P P      1 
ATOM   122  O  OP1    . DA  A 1 7   ? 31.624  37.365 41.969  1.00 45.71  ?  7    DA  P OP1    1 
ATOM   123  O  OP2    . DA  A 1 7   ? 29.617  35.850 42.468  1.00 45.97  ?  7    DA  P OP2    1 
ATOM   124  O  "O5'"  . DA  A 1 7   ? 29.849  36.995 40.255  1.00 48.58  ?  7    DA  P "O5'"  1 
ATOM   125  C  "C5'"  . DA  A 1 7   ? 30.574  37.301 39.072  1.00 41.45  ?  7    DA  P "C5'"  1 
ATOM   126  C  "C4'"  . DA  A 1 7   ? 29.691  38.014 38.068  1.00 48.55  ?  7    DA  P "C4'"  1 
ATOM   127  O  "O4'"  . DA  A 1 7   ? 28.932  37.036 37.310  1.00 49.24  ?  7    DA  P "O4'"  1 
ATOM   128  C  "C3'"  . DA  A 1 7   ? 28.650  38.956 38.677  1.00 48.89  ?  7    DA  P "C3'"  1 
ATOM   129  O  "O3'"  . DA  A 1 7   ? 28.447  40.057 37.813  1.00 44.52  ?  7    DA  P "O3'"  1 
ATOM   130  C  "C2'"  . DA  A 1 7   ? 27.413  38.075 38.720  1.00 50.06  ?  7    DA  P "C2'"  1 
ATOM   131  C  "C1'"  . DA  A 1 7   ? 27.568  37.370 37.389  1.00 51.36  ?  7    DA  P "C1'"  1 
ATOM   132  N  N9     . DA  A 1 7   ? 26.775  36.158 37.254  1.00 51.41  ?  7    DA  P N9     1 
ATOM   133  C  C8     . DA  A 1 7   ? 26.508  35.224 38.218  1.00 49.77  ?  7    DA  P C8     1 
ATOM   134  N  N7     . DA  A 1 7   ? 25.757  34.233 37.796  1.00 47.82  ?  7    DA  P N7     1 
ATOM   135  C  C5     . DA  A 1 7   ? 25.519  34.541 36.465  1.00 53.68  ?  7    DA  P C5     1 
ATOM   136  C  C6     . DA  A 1 7   ? 24.787  33.889 35.453  1.00 72.71  ?  7    DA  P C6     1 
ATOM   137  N  N6     . DA  A 1 7   ? 24.135  32.737 35.644  1.00 80.47  ?  7    DA  P N6     1 
ATOM   138  N  N1     . DA  A 1 7   ? 24.752  34.469 34.231  1.00 80.72  ?  7    DA  P N1     1 
ATOM   139  C  C2     . DA  A 1 7   ? 25.405  35.623 34.045  1.00 76.68  ?  7    DA  P C2     1 
ATOM   140  N  N3     . DA  A 1 7   ? 26.124  36.327 34.918  1.00 57.59  ?  7    DA  P N3     1 
ATOM   141  C  C4     . DA  A 1 7   ? 26.141  35.724 36.118  1.00 49.97  ?  7    DA  P C4     1 
ATOM   142  P  P      . DC  A 1 8   ? 28.226  41.531 38.413  1.00 48.39  ?  8    DC  P P      1 
ATOM   143  O  OP1    . DC  A 1 8   ? 29.487  42.270 38.167  1.00 45.63  ?  8    DC  P OP1    1 
ATOM   144  O  OP2    . DC  A 1 8   ? 27.649  41.412 39.771  1.00 47.61  ?  8    DC  P OP2    1 
ATOM   145  O  "O5'"  . DC  A 1 8   ? 27.085  42.162 37.489  1.00 56.92  ?  8    DC  P "O5'"  1 
ATOM   146  C  "C5'"  . DC  A 1 8   ? 27.366  42.493 36.141  1.00 70.40  ?  8    DC  P "C5'"  1 
ATOM   147  C  "C4'"  . DC  A 1 8   ? 26.140  42.283 35.277  1.00 76.41  ?  8    DC  P "C4'"  1 
ATOM   148  O  "O4'"  . DC  A 1 8   ? 25.901  40.873 35.132  1.00 74.13  ?  8    DC  P "O4'"  1 
ATOM   149  C  "C3'"  . DC  A 1 8   ? 24.848  42.826 35.864  1.00 75.17  ?  8    DC  P "C3'"  1 
ATOM   150  O  "O3'"  . DC  A 1 8   ? 24.672  44.192 35.488  1.00 69.59  ?  8    DC  P "O3'"  1 
ATOM   151  C  "C2'"  . DC  A 1 8   ? 23.771  41.927 35.242  1.00 80.18  ?  8    DC  P "C2'"  1 
ATOM   152  C  "C1'"  . DC  A 1 8   ? 24.547  40.673 34.805  1.00 73.69  ?  8    DC  P "C1'"  1 
ATOM   153  N  N1     . DC  A 1 8   ? 24.074  39.420 35.455  1.00 65.86  ?  8    DC  P N1     1 
ATOM   154  C  C2     . DC  A 1 8   ? 23.414  38.465 34.687  1.00 65.37  ?  8    DC  P C2     1 
ATOM   155  O  O2     . DC  A 1 8   ? 23.238  38.678 33.481  1.00 64.77  ?  8    DC  P O2     1 
ATOM   156  N  N3     . DC  A 1 8   ? 22.977  37.328 35.282  1.00 66.24  ?  8    DC  P N3     1 
ATOM   157  C  C4     . DC  A 1 8   ? 23.181  37.136 36.584  1.00 67.47  ?  8    DC  P C4     1 
ATOM   158  N  N4     . DC  A 1 8   ? 22.734  35.997 37.125  1.00 53.92  ?  8    DC  P N4     1 
ATOM   159  C  C5     . DC  A 1 8   ? 23.856  38.102 37.389  1.00 62.75  ?  8    DC  P C5     1 
ATOM   160  C  C6     . DC  A 1 8   ? 24.280  39.220 36.788  1.00 60.92  ?  8    DC  P C6     1 
ATOM   161  P  P      . DG  A 1 9   ? 23.616  45.122 36.271  1.00 76.62  ?  9    DG  P P      1 
ATOM   162  O  OP1    . DG  A 1 9   ? 23.990  46.533 36.025  1.00 81.73  ?  9    DG  P OP1    1 
ATOM   163  O  OP2    . DG  A 1 9   ? 23.483  44.608 37.651  1.00 74.13  ?  9    DG  P OP2    1 
ATOM   164  O  "O5'"  . DG  A 1 9   ? 22.234  44.843 35.525  1.00 70.99  ?  9    DG  P "O5'"  1 
ATOM   165  C  "C5'"  . DG  A 1 9   ? 22.054  45.271 34.184  1.00 74.63  ?  9    DG  P "C5'"  1 
ATOM   166  C  "C4'"  . DG  A 1 9   ? 20.826  44.621 33.580  1.00 73.26  ?  9    DG  P "C4'"  1 
ATOM   167  O  "O4'"  . DG  A 1 9   ? 21.044  43.194 33.481  1.00 67.64  ?  9    DG  P "O4'"  1 
ATOM   168  C  "C3'"  . DG  A 1 9   ? 19.555  44.776 34.399  1.00 75.05  ?  9    DG  P "C3'"  1 
ATOM   169  O  "O3'"  . DG  A 1 9   ? 18.883  45.968 34.024  1.00 84.02  ?  9    DG  P "O3'"  1 
ATOM   170  C  "C2'"  . DG  A 1 9   ? 18.757  43.540 34.000  1.00 76.31  ?  9    DG  P "C2'"  1 
ATOM   171  C  "C1'"  . DG  A 1 9   ? 19.855  42.496 33.797  1.00 70.25  ?  9    DG  P "C1'"  1 
ATOM   172  N  N9     . DG  A 1 9   ? 20.097  41.664 34.974  1.00 67.18  ?  9    DG  P N9     1 
ATOM   173  C  C8     . DG  A 1 9   ? 20.716  42.035 36.145  1.00 64.99  ?  9    DG  P C8     1 
ATOM   174  N  N7     . DG  A 1 9   ? 20.784  41.072 37.023  1.00 64.45  ?  9    DG  P N7     1 
ATOM   175  C  C5     . DG  A 1 9   ? 20.170  39.995 36.394  1.00 64.27  ?  9    DG  P C5     1 
ATOM   176  C  C6     . DG  A 1 9   ? 19.941  38.675 36.853  1.00 63.82  ?  9    DG  P C6     1 
ATOM   177  O  O6     . DG  A 1 9   ? 20.249  38.177 37.945  1.00 62.50  ?  9    DG  P O6     1 
ATOM   178  N  N1     . DG  A 1 9   ? 19.286  37.905 35.898  1.00 72.79  ?  9    DG  P N1     1 
ATOM   179  C  C2     . DG  A 1 9   ? 18.898  38.355 34.657  1.00 78.01  ?  9    DG  P C2     1 
ATOM   180  N  N2     . DG  A 1 9   ? 18.281  37.469 33.868  1.00 84.22  ?  9    DG  P N2     1 
ATOM   181  N  N3     . DG  A 1 9   ? 19.105  39.587 34.218  1.00 74.93  ?  9    DG  P N3     1 
ATOM   182  C  C4     . DG  A 1 9   ? 19.743  40.347 35.134  1.00 69.20  ?  9    DG  P C4     1 
ATOM   183  P  P      . DT  A 1 10  ? 17.670  46.524 34.920  1.00 86.00  ?  10   DT  P P      1 
ATOM   184  O  OP1    . DT  A 1 10  ? 16.935  47.540 34.133  1.00 103.37 ?  10   DT  P OP1    1 
ATOM   185  O  OP2    . DT  A 1 10  ? 18.229  46.850 36.248  1.00 83.44  ?  10   DT  P OP2    1 
ATOM   186  O  "O5'"  . DT  A 1 10  ? 16.731  45.250 35.118  1.00 87.65  ?  10   DT  P "O5'"  1 
ATOM   187  C  "C5'"  . DT  A 1 10  ? 15.325  45.381 35.044  1.00 100.76 ?  10   DT  P "C5'"  1 
ATOM   188  C  "C4'"  . DT  A 1 10  ? 14.756  44.394 34.044  1.00 104.38 ?  10   DT  P "C4'"  1 
ATOM   189  O  "O4'"  . DT  A 1 10  ? 15.700  43.312 33.843  1.00 98.41  ?  10   DT  P "O4'"  1 
ATOM   190  C  "C3'"  . DT  A 1 10  ? 13.431  43.761 34.442  1.00 108.56 ?  10   DT  P "C3'"  1 
ATOM   191  O  "O3'"  . DT  A 1 10  ? 12.384  44.267 33.613  1.00 108.10 ?  10   DT  P "O3'"  1 
ATOM   192  C  "C2'"  . DT  A 1 10  ? 13.630  42.254 34.227  1.00 104.34 ?  10   DT  P "C2'"  1 
ATOM   193  C  "C1'"  . DT  A 1 10  ? 15.144  42.090 34.266  1.00 94.05  ?  10   DT  P "C1'"  1 
ATOM   194  N  N1     . DT  A 1 10  ? 15.703  41.767 35.614  1.00 86.58  ?  10   DT  P N1     1 
ATOM   195  C  C2     . DT  A 1 10  ? 15.527  40.512 36.145  1.00 88.31  ?  10   DT  P C2     1 
ATOM   196  O  O2     . DT  A 1 10  ? 14.906  39.627 35.583  1.00 91.82  ?  10   DT  P O2     1 
ATOM   197  N  N3     . DT  A 1 10  ? 16.102  40.332 37.378  1.00 88.46  ?  10   DT  P N3     1 
ATOM   198  C  C4     . DT  A 1 10  ? 16.827  41.254 38.110  1.00 88.88  ?  10   DT  P C4     1 
ATOM   199  O  O4     . DT  A 1 10  ? 17.304  40.994 39.211  1.00 88.07  ?  10   DT  P O4     1 
ATOM   200  C  C5     . DT  A 1 10  ? 16.981  42.545 37.487  1.00 86.26  ?  10   DT  P C5     1 
ATOM   201  C  C7     . DT  A 1 10  ? 17.747  43.633 38.179  1.00 78.40  ?  10   DT  P C7     1 
ATOM   202  C  C6     . DT  A 1 10  ? 16.424  42.732 36.283  1.00 85.26  ?  10   DT  P C6     1 
ATOM   203  P  P      . DA  B 2 1   ? 14.216  31.063 42.433  1.00 137.34 ?  4    DA  T P      1 
ATOM   204  O  OP1    . DA  B 2 1   ? 14.936  29.866 41.948  1.00 133.01 ?  4    DA  T OP1    1 
ATOM   205  O  OP2    . DA  B 2 1   ? 14.888  32.014 43.347  1.00 135.90 ?  4    DA  T OP2    1 
ATOM   206  O  "O5'"  . DA  B 2 1   ? 13.675  31.879 41.167  1.00 135.80 ?  4    DA  T "O5'"  1 
ATOM   207  C  "C5'"  . DA  B 2 1   ? 12.370  32.446 41.192  1.00 141.24 ?  4    DA  T "C5'"  1 
ATOM   208  C  "C4'"  . DA  B 2 1   ? 11.822  32.606 39.785  1.00 135.69 ?  4    DA  T "C4'"  1 
ATOM   209  O  "O4'"  . DA  B 2 1   ? 12.070  33.948 39.320  1.00 129.53 ?  4    DA  T "O4'"  1 
ATOM   210  C  "C3'"  . DA  B 2 1   ? 12.464  31.705 38.747  1.00 127.42 ?  4    DA  T "C3'"  1 
ATOM   211  O  "O3'"  . DA  B 2 1   ? 11.553  31.455 37.676  1.00 125.76 ?  4    DA  T "O3'"  1 
ATOM   212  C  "C2'"  . DA  B 2 1   ? 13.679  32.520 38.290  1.00 119.86 ?  4    DA  T "C2'"  1 
ATOM   213  C  "C1'"  . DA  B 2 1   ? 13.255  33.974 38.549  1.00 119.25 ?  4    DA  T "C1'"  1 
ATOM   214  N  N9     . DA  B 2 1   ? 14.259  34.759 39.271  1.00 110.05 ?  4    DA  T N9     1 
ATOM   215  C  C8     . DA  B 2 1   ? 14.711  34.550 40.545  1.00 107.82 ?  4    DA  T C8     1 
ATOM   216  N  N7     . DA  B 2 1   ? 15.618  35.416 40.935  1.00 103.56 ?  4    DA  T N7     1 
ATOM   217  C  C5     . DA  B 2 1   ? 15.771  36.252 39.841  1.00 97.69  ?  4    DA  T C5     1 
ATOM   218  C  C6     . DA  B 2 1   ? 16.588  37.378 39.612  1.00 88.86  ?  4    DA  T C6     1 
ATOM   219  N  N6     . DA  B 2 1   ? 17.440  37.869 40.520  1.00 85.97  ?  4    DA  T N6     1 
ATOM   220  N  N1     . DA  B 2 1   ? 16.495  37.981 38.410  1.00 86.25  ?  4    DA  T N1     1 
ATOM   221  C  C2     . DA  B 2 1   ? 15.643  37.484 37.504  1.00 91.07  ?  4    DA  T C2     1 
ATOM   222  N  N3     . DA  B 2 1   ? 14.826  36.439 37.604  1.00 95.53  ?  4    DA  T N3     1 
ATOM   223  C  C4     . DA  B 2 1   ? 14.940  35.861 38.807  1.00 99.95  ?  4    DA  T C4     1 
ATOM   224  P  P      . DC  B 2 2   ? 11.929  30.399 36.522  1.00 122.07 ?  5    DC  T P      1 
ATOM   225  O  OP1    . DC  B 2 2   ? 10.757  29.529 36.283  1.00 125.19 ?  5    DC  T OP1    1 
ATOM   226  O  OP2    . DC  B 2 2   ? 13.240  29.804 36.866  1.00 113.67 ?  5    DC  T OP2    1 
ATOM   227  O  "O5'"  . DC  B 2 2   ? 12.126  31.314 35.231  1.00 127.67 ?  5    DC  T "O5'"  1 
ATOM   228  C  "C5'"  . DC  B 2 2   ? 12.181  32.722 35.373  1.00 130.75 ?  5    DC  T "C5'"  1 
ATOM   229  C  "C4'"  . DC  B 2 2   ? 12.342  33.392 34.026  1.00 128.74 ?  5    DC  T "C4'"  1 
ATOM   230  O  "O4'"  . DC  B 2 2   ? 12.849  34.736 34.226  1.00 128.61 ?  5    DC  T "O4'"  1 
ATOM   231  C  "C3'"  . DC  B 2 2   ? 13.326  32.699 33.082  1.00 119.41 ?  5    DC  T "C3'"  1 
ATOM   232  O  "O3'"  . DC  B 2 2   ? 12.618  31.921 32.130  1.00 112.66 ?  5    DC  T "O3'"  1 
ATOM   233  C  "C2'"  . DC  B 2 2   ? 14.063  33.862 32.423  1.00 118.11 ?  5    DC  T "C2'"  1 
ATOM   234  C  "C1'"  . DC  B 2 2   ? 14.070  34.895 33.541  1.00 122.08 ?  5    DC  T "C1'"  1 
ATOM   235  N  N1     . DC  B 2 2   ? 15.201  34.731 34.521  1.00 118.49 ?  5    DC  T N1     1 
ATOM   236  C  C2     . DC  B 2 2   ? 16.127  35.763 34.677  1.00 114.03 ?  5    DC  T C2     1 
ATOM   237  O  O2     . DC  B 2 2   ? 16.002  36.794 34.002  1.00 113.72 ?  5    DC  T O2     1 
ATOM   238  N  N3     . DC  B 2 2   ? 17.146  35.607 35.561  1.00 105.63 ?  5    DC  T N3     1 
ATOM   239  C  C4     . DC  B 2 2   ? 17.250  34.483 36.271  1.00 100.83 ?  5    DC  T C4     1 
ATOM   240  N  N4     . DC  B 2 2   ? 18.269  34.378 37.131  1.00 91.04  ?  5    DC  T N4     1 
ATOM   241  C  C5     . DC  B 2 2   ? 16.314  33.417 36.129  1.00 107.34 ?  5    DC  T C5     1 
ATOM   242  C  C6     . DC  B 2 2   ? 15.315  33.581 35.253  1.00 114.58 ?  5    DC  T C6     1 
ATOM   243  P  P      . DG  B 2 3   ? 13.411  30.890 31.187  1.00 96.53  ?  6    DG  T P      1 
ATOM   244  O  OP1    . DG  B 2 3   ? 12.397  30.132 30.420  1.00 100.22 ?  6    DG  T OP1    1 
ATOM   245  O  OP2    . DG  B 2 3   ? 14.414  30.183 32.016  1.00 92.08  ?  6    DG  T OP2    1 
ATOM   246  O  "O5'"  . DG  B 2 3   ? 14.209  31.840 30.181  1.00 89.11  ?  6    DG  T "O5'"  1 
ATOM   247  C  "C5'"  . DG  B 2 3   ? 15.540  31.532 29.819  1.00 82.65  ?  6    DG  T "C5'"  1 
ATOM   248  C  "C4'"  . DG  B 2 3   ? 16.367  32.798 29.736  1.00 83.63  ?  6    DG  T "C4'"  1 
ATOM   249  O  "O4'"  . DG  B 2 3   ? 16.637  33.272 31.065  1.00 85.57  ?  6    DG  T "O4'"  1 
ATOM   250  C  "C3'"  . DG  B 2 3   ? 17.726  32.626 29.087  1.00 77.17  ?  6    DG  T "C3'"  1 
ATOM   251  O  "O3'"  . DG  B 2 3   ? 17.606  32.853 27.692  1.00 77.66  ?  6    DG  T "O3'"  1 
ATOM   252  C  "C2'"  . DG  B 2 3   ? 18.586  33.702 29.758  1.00 69.87  ?  6    DG  T "C2'"  1 
ATOM   253  C  "C1'"  . DG  B 2 3   ? 17.855  33.981 31.077  1.00 79.70  ?  6    DG  T "C1'"  1 
ATOM   254  N  N9     . DG  B 2 3   ? 18.598  33.589 32.269  1.00 85.13  ?  6    DG  T N9     1 
ATOM   255  C  C8     . DG  B 2 3   ? 18.454  32.433 33.000  1.00 88.97  ?  6    DG  T C8     1 
ATOM   256  N  N7     . DG  B 2 3   ? 19.252  32.370 34.032  1.00 86.08  ?  6    DG  T N7     1 
ATOM   257  C  C5     . DG  B 2 3   ? 19.963  33.564 33.982  1.00 85.25  ?  6    DG  T C5     1 
ATOM   258  C  C6     . DG  B 2 3   ? 20.972  34.066 34.839  1.00 84.85  ?  6    DG  T C6     1 
ATOM   259  O  O6     . DG  B 2 3   ? 21.457  33.535 35.849  1.00 82.22  ?  6    DG  T O6     1 
ATOM   260  N  N1     . DG  B 2 3   ? 21.424  35.318 34.421  1.00 84.69  ?  6    DG  T N1     1 
ATOM   261  C  C2     . DG  B 2 3   ? 20.954  35.993 33.316  1.00 81.98  ?  6    DG  T C2     1 
ATOM   262  N  N2     . DG  B 2 3   ? 21.501  37.186 33.064  1.00 76.40  ?  6    DG  T N2     1 
ATOM   263  N  N3     . DG  B 2 3   ? 20.013  35.533 32.513  1.00 83.51  ?  6    DG  T N3     1 
ATOM   264  C  C4     . DG  B 2 3   ? 19.566  34.321 32.903  1.00 85.12  ?  6    DG  T C4     1 
ATOM   265  P  P      . DT  B 2 4   ? 18.717  32.284 26.684  1.00 72.04  ?  7    DT  T P      1 
ATOM   266  O  OP1    . DT  B 2 4   ? 18.234  32.528 25.306  1.00 79.20  ?  7    DT  T OP1    1 
ATOM   267  O  OP2    . DT  B 2 4   ? 19.082  30.919 27.128  1.00 75.61  ?  7    DT  T OP2    1 
ATOM   268  O  "O5'"  . DT  B 2 4   ? 19.971  33.233 26.940  1.00 68.38  ?  7    DT  T "O5'"  1 
ATOM   269  C  "C5'"  . DT  B 2 4   ? 19.822  34.633 26.815  1.00 61.94  ?  7    DT  T "C5'"  1 
ATOM   270  C  "C4'"  . DT  B 2 4   ? 21.171  35.300 26.680  1.00 56.43  ?  7    DT  T "C4'"  1 
ATOM   271  O  "O4'"  . DT  B 2 4   ? 21.725  35.547 27.998  1.00 55.18  ?  7    DT  T "O4'"  1 
ATOM   272  C  "C3'"  . DT  B 2 4   ? 22.211  34.483 25.930  1.00 54.48  ?  7    DT  T "C3'"  1 
ATOM   273  O  "O3'"  . DT  B 2 4   ? 23.039  35.350 25.185  1.00 51.57  ?  7    DT  T "O3'"  1 
ATOM   274  C  "C2'"  . DT  B 2 4   ? 22.977  33.791 27.057  1.00 56.29  ?  7    DT  T "C2'"  1 
ATOM   275  C  "C1'"  . DT  B 2 4   ? 22.942  34.848 28.157  1.00 58.29  ?  7    DT  T "C1'"  1 
ATOM   276  N  N1     . DT  B 2 4   ? 22.980  34.276 29.551  1.00 66.84  ?  7    DT  T N1     1 
ATOM   277  C  C2     . DT  B 2 4   ? 23.813  34.839 30.500  1.00 66.03  ?  7    DT  T C2     1 
ATOM   278  O  O2     . DT  B 2 4   ? 24.541  35.791 30.275  1.00 64.44  ?  7    DT  T O2     1 
ATOM   279  N  N3     . DT  B 2 4   ? 23.764  34.239 31.732  1.00 62.34  ?  7    DT  T N3     1 
ATOM   280  C  C4     . DT  B 2 4   ? 22.983  33.160 32.106  1.00 62.47  ?  7    DT  T C4     1 
ATOM   281  O  O4     . DT  B 2 4   ? 23.010  32.692 33.241  1.00 60.81  ?  7    DT  T O4     1 
ATOM   282  C  C5     . DT  B 2 4   ? 22.134  32.621 31.069  1.00 65.02  ?  7    DT  T C5     1 
ATOM   283  C  C7     . DT  B 2 4   ? 21.243  31.450 31.357  1.00 67.18  ?  7    DT  T C7     1 
ATOM   284  C  C6     . DT  B 2 4   ? 22.172  33.198 29.858  1.00 67.53  ?  7    DT  T C6     1 
ATOM   285  P  P      . DG  B 2 5   ? 24.229  34.762 24.283  1.00 55.73  ?  8    DG  T P      1 
ATOM   286  O  OP1    . DG  B 2 5   ? 24.408  35.678 23.134  1.00 53.62  ?  8    DG  T OP1    1 
ATOM   287  O  OP2    . DG  B 2 5   ? 23.972  33.320 24.064  1.00 56.79  ?  8    DG  T OP2    1 
ATOM   288  O  "O5'"  . DG  B 2 5   ? 25.506  34.884 25.230  1.00 51.31  ?  8    DG  T "O5'"  1 
ATOM   289  C  "C5'"  . DG  B 2 5   ? 25.830  36.134 25.823  1.00 45.62  ?  8    DG  T "C5'"  1 
ATOM   290  C  "C4'"  . DG  B 2 5   ? 26.996  35.970 26.769  1.00 50.82  ?  8    DG  T "C4'"  1 
ATOM   291  O  "O4'"  . DG  B 2 5   ? 26.538  35.331 27.970  1.00 45.87  ?  8    DG  T "O4'"  1 
ATOM   292  C  "C3'"  . DG  B 2 5   ? 28.114  35.099 26.221  1.00 51.27  ?  8    DG  T "C3'"  1 
ATOM   293  O  "O3'"  . DG  B 2 5   ? 29.179  35.923 25.788  1.00 56.26  ?  8    DG  T "O3'"  1 
ATOM   294  C  "C2'"  . DG  B 2 5   ? 28.530  34.186 27.386  1.00 52.72  ?  8    DG  T "C2'"  1 
ATOM   295  C  "C1'"  . DG  B 2 5   ? 27.562  34.544 28.517  1.00 55.01  ?  8    DG  T "C1'"  1 
ATOM   296  N  N9     . DG  B 2 5   ? 26.939  33.382 29.140  1.00 53.02  ?  8    DG  T N9     1 
ATOM   297  C  C8     . DG  B 2 5   ? 26.207  32.399 28.520  1.00 56.21  ?  8    DG  T C8     1 
ATOM   298  N  N7     . DG  B 2 5   ? 25.761  31.487 29.341  1.00 55.96  ?  8    DG  T N7     1 
ATOM   299  C  C5     . DG  B 2 5   ? 26.225  31.896 30.583  1.00 56.39  ?  8    DG  T C5     1 
ATOM   300  C  C6     . DG  B 2 5   ? 26.059  31.307 31.857  1.00 58.74  ?  8    DG  T C6     1 
ATOM   301  O  O6     . DG  B 2 5   ? 25.450  30.271 32.152  1.00 63.05  ?  8    DG  T O6     1 
ATOM   302  N  N1     . DG  B 2 5   ? 26.692  32.048 32.851  1.00 72.48  ?  8    DG  T N1     1 
ATOM   303  C  C2     . DG  B 2 5   ? 27.395  33.211 32.639  1.00 70.32  ?  8    DG  T C2     1 
ATOM   304  N  N2     . DG  B 2 5   ? 27.937  33.786 33.721  1.00 72.45  ?  8    DG  T N2     1 
ATOM   305  N  N3     . DG  B 2 5   ? 27.558  33.773 31.449  1.00 56.21  ?  8    DG  T N3     1 
ATOM   306  C  C4     . DG  B 2 5   ? 26.948  33.064 30.474  1.00 54.56  ?  8    DG  T C4     1 
ATOM   307  P  P      . DA  B 2 6   ? 30.541  35.267 25.255  1.00 69.33  ?  9    DA  T P      1 
ATOM   308  O  OP1    . DA  B 2 6   ? 31.202  36.248 24.365  1.00 75.43  ?  9    DA  T OP1    1 
ATOM   309  O  OP2    . DA  B 2 6   ? 30.234  33.895 24.791  1.00 78.15  ?  9    DA  T OP2    1 
ATOM   310  O  "O5'"  . DA  B 2 6   ? 31.415  35.128 26.573  1.00 62.47  ?  9    DA  T "O5'"  1 
ATOM   311  C  "C5'"  . DA  B 2 6   ? 31.413  36.173 27.520  1.00 56.96  ?  9    DA  T "C5'"  1 
ATOM   312  C  "C4'"  . DA  B 2 6   ? 32.382  35.853 28.626  1.00 49.32  ?  9    DA  T "C4'"  1 
ATOM   313  O  "O4'"  . DA  B 2 6   ? 31.716  35.031 29.617  1.00 43.42  ?  9    DA  T "O4'"  1 
ATOM   314  C  "C3'"  . DA  B 2 6   ? 33.598  35.063 28.159  1.00 48.99  ?  9    DA  T "C3'"  1 
ATOM   315  O  "O3'"  . DA  B 2 6   ? 34.765  35.539 28.792  1.00 50.48  ?  9    DA  T "O3'"  1 
ATOM   316  C  "C2'"  . DA  B 2 6   ? 33.271  33.628 28.560  1.00 52.13  ?  9    DA  T "C2'"  1 
ATOM   317  C  "C1'"  . DA  B 2 6   ? 32.430  33.833 29.811  1.00 48.48  ?  9    DA  T "C1'"  1 
ATOM   318  N  N9     . DA  B 2 6   ? 31.469  32.760 30.041  1.00 52.48  ?  9    DA  T N9     1 
ATOM   319  C  C8     . DA  B 2 6   ? 30.667  32.160 29.108  1.00 50.85  ?  9    DA  T C8     1 
ATOM   320  N  N7     . DA  B 2 6   ? 29.900  31.216 29.598  1.00 53.22  ?  9    DA  T N7     1 
ATOM   321  C  C5     . DA  B 2 6   ? 30.220  31.195 30.948  1.00 55.32  ?  9    DA  T C5     1 
ATOM   322  C  C6     . DA  B 2 6   ? 29.752  30.411 32.023  1.00 52.07  ?  9    DA  T C6     1 
ATOM   323  N  N6     . DA  B 2 6   ? 28.822  29.462 31.888  1.00 54.23  ?  9    DA  T N6     1 
ATOM   324  N  N1     . DA  B 2 6   ? 30.282  30.643 33.246  1.00 52.86  ?  9    DA  T N1     1 
ATOM   325  C  C2     . DA  B 2 6   ? 31.215  31.596 33.375  1.00 51.92  ?  9    DA  T C2     1 
ATOM   326  N  N3     . DA  B 2 6   ? 31.732  32.395 32.440  1.00 50.29  ?  9    DA  T N3     1 
ATOM   327  C  C4     . DA  B 2 6   ? 31.186  32.140 31.237  1.00 50.71  ?  9    DA  T C4     1 
ATOM   328  P  P      . DT  B 2 7   ? 36.195  34.949 28.364  1.00 54.15  ?  10   DT  T P      1 
ATOM   329  O  OP1    . DT  B 2 7   ? 37.171  36.058 28.283  1.00 63.21  ?  10   DT  T OP1    1 
ATOM   330  O  OP2    . DT  B 2 7   ? 35.959  34.072 27.198  1.00 56.14  ?  10   DT  T OP2    1 
ATOM   331  O  "O5'"  . DT  B 2 7   ? 36.593  34.019 29.594  1.00 47.11  ?  10   DT  T "O5'"  1 
ATOM   332  C  "C5'"  . DT  B 2 7   ? 36.477  34.512 30.920  1.00 47.53  ?  10   DT  T "C5'"  1 
ATOM   333  C  "C4'"  . DT  B 2 7   ? 36.820  33.421 31.914  1.00 50.32  ?  10   DT  T "C4'"  1 
ATOM   334  O  "O4'"  . DT  B 2 7   ? 35.674  32.556 32.101  1.00 53.86  ?  10   DT  T "O4'"  1 
ATOM   335  C  "C3'"  . DT  B 2 7   ? 37.979  32.518 31.491  1.00 52.16  ?  10   DT  T "C3'"  1 
ATOM   336  O  "O3'"  . DT  B 2 7   ? 38.987  32.528 32.492  1.00 54.85  ?  10   DT  T "O3'"  1 
ATOM   337  C  "C2'"  . DT  B 2 7   ? 37.341  31.128 31.319  1.00 52.91  ?  10   DT  T "C2'"  1 
ATOM   338  C  "C1'"  . DT  B 2 7   ? 36.108  31.222 32.203  1.00 58.80  ?  10   DT  T "C1'"  1 
ATOM   339  N  N1     . DT  B 2 7   ? 34.975  30.328 31.775  1.00 59.23  ?  10   DT  T N1     1 
ATOM   340  C  C2     . DT  B 2 7   ? 34.454  29.411 32.667  1.00 66.73  ?  10   DT  T C2     1 
ATOM   341  O  O2     . DT  B 2 7   ? 34.870  29.269 33.801  1.00 70.62  ?  10   DT  T O2     1 
ATOM   342  N  N3     . DT  B 2 7   ? 33.422  28.657 32.175  1.00 70.57  ?  10   DT  T N3     1 
ATOM   343  C  C4     . DT  B 2 7   ? 32.864  28.725 30.912  1.00 57.01  ?  10   DT  T C4     1 
ATOM   344  O  O4     . DT  B 2 7   ? 31.935  28.002 30.562  1.00 55.13  ?  10   DT  T O4     1 
ATOM   345  C  C5     . DT  B 2 7   ? 33.453  29.708 30.029  1.00 53.81  ?  10   DT  T C5     1 
ATOM   346  C  C7     . DT  B 2 7   ? 32.932  29.874 28.630  1.00 64.65  ?  10   DT  T C7     1 
ATOM   347  C  C6     . DT  B 2 7   ? 34.465  30.454 30.499  1.00 54.04  ?  10   DT  T C6     1 
ATOM   348  P  P      . DC  B 2 8   ? 40.346  31.700 32.284  1.00 58.25  ?  11   DC  T P      1 
ATOM   349  O  OP1    . DC  B 2 8   ? 41.433  32.442 32.964  1.00 73.08  ?  11   DC  T OP1    1 
ATOM   350  O  OP2    . DC  B 2 8   ? 40.456  31.361 30.846  1.00 58.20  ?  11   DC  T OP2    1 
ATOM   351  O  "O5'"  . DC  B 2 8   ? 40.080  30.349 33.092  1.00 60.51  ?  11   DC  T "O5'"  1 
ATOM   352  C  "C5'"  . DC  B 2 8   ? 39.501  30.415 34.382  1.00 61.02  ?  11   DC  T "C5'"  1 
ATOM   353  C  "C4'"  . DC  B 2 8   ? 39.050  29.044 34.846  1.00 69.02  ?  11   DC  T "C4'"  1 
ATOM   354  O  "O4'"  . DC  B 2 8   ? 37.854  28.648 34.133  1.00 60.85  ?  11   DC  T "O4'"  1 
ATOM   355  C  "C3'"  . DC  B 2 8   ? 40.067  27.920 34.645  1.00 66.64  ?  11   DC  T "C3'"  1 
ATOM   356  O  "O3'"  . DC  B 2 8   ? 40.227  27.216 35.866  1.00 70.21  ?  11   DC  T "O3'"  1 
ATOM   357  C  "C2'"  . DC  B 2 8   ? 39.430  27.040 33.562  1.00 65.63  ?  11   DC  T "C2'"  1 
ATOM   358  C  "C1'"  . DC  B 2 8   ? 37.951  27.287 33.801  1.00 63.09  ?  11   DC  T "C1'"  1 
ATOM   359  N  N1     . DC  B 2 8   ? 37.088  27.041 32.612  1.00 60.98  ?  11   DC  T N1     1 
ATOM   360  C  C2     . DC  B 2 8   ? 35.971  26.205 32.726  1.00 61.69  ?  11   DC  T C2     1 
ATOM   361  O  O2     . DC  B 2 8   ? 35.730  25.667 33.812  1.00 64.04  ?  11   DC  T O2     1 
ATOM   362  N  N3     . DC  B 2 8   ? 35.186  26.006 31.637  1.00 60.33  ?  11   DC  T N3     1 
ATOM   363  C  C4     . DC  B 2 8   ? 35.481  26.607 30.483  1.00 58.23  ?  11   DC  T C4     1 
ATOM   364  N  N4     . DC  B 2 8   ? 34.679  26.381 29.439  1.00 61.58  ?  11   DC  T N4     1 
ATOM   365  C  C5     . DC  B 2 8   ? 36.610  27.466 30.349  1.00 57.42  ?  11   DC  T C5     1 
ATOM   366  C  C6     . DC  B 2 8   ? 37.376  27.655 31.430  1.00 61.83  ?  11   DC  T C6     1 
ATOM   367  P  P      . DG  B 2 9   ? 41.554  26.359 36.153  1.00 75.27  ?  12   DG  T P      1 
ATOM   368  O  OP1    . DG  B 2 9   ? 41.923  26.555 37.572  1.00 78.34  ?  12   DG  T OP1    1 
ATOM   369  O  OP2    . DG  B 2 9   ? 42.541  26.652 35.092  1.00 75.36  ?  12   DG  T OP2    1 
ATOM   370  O  "O5'"  . DG  B 2 9   ? 41.066  24.853 35.973  1.00 83.31  ?  12   DG  T "O5'"  1 
ATOM   371  C  "C5'"  . DG  B 2 9   ? 39.973  24.367 36.742  1.00 83.56  ?  12   DG  T "C5'"  1 
ATOM   372  C  "C4'"  . DG  B 2 9   ? 39.542  23.012 36.230  1.00 84.09  ?  12   DG  T "C4'"  1 
ATOM   373  O  "O4'"  . DG  B 2 9   ? 38.706  23.198 35.071  1.00 81.46  ?  12   DG  T "O4'"  1 
ATOM   374  C  "C3'"  . DG  B 2 9   ? 40.700  22.113 35.812  1.00 89.88  ?  12   DG  T "C3'"  1 
ATOM   375  O  "O3'"  . DG  B 2 9   ? 40.782  20.989 36.679  1.00 101.63 ?  12   DG  T "O3'"  1 
ATOM   376  C  "C2'"  . DG  B 2 9   ? 40.408  21.705 34.361  1.00 85.54  ?  12   DG  T "C2'"  1 
ATOM   377  C  "C1'"  . DG  B 2 9   ? 39.016  22.259 34.076  1.00 76.90  ?  12   DG  T "C1'"  1 
ATOM   378  N  N9     . DG  B 2 9   ? 38.919  22.939 32.793  1.00 73.99  ?  12   DG  T N9     1 
ATOM   379  C  C8     . DG  B 2 9   ? 39.842  23.786 32.227  1.00 74.99  ?  12   DG  T C8     1 
ATOM   380  N  N7     . DG  B 2 9   ? 39.469  24.258 31.068  1.00 72.09  ?  12   DG  T N7     1 
ATOM   381  C  C5     . DG  B 2 9   ? 38.218  23.692 30.860  1.00 70.47  ?  12   DG  T C5     1 
ATOM   382  C  C6     . DG  B 2 9   ? 37.319  23.831 29.777  1.00 70.14  ?  12   DG  T C6     1 
ATOM   383  O  O6     . DG  B 2 9   ? 37.454  24.507 28.747  1.00 67.13  ?  12   DG  T O6     1 
ATOM   384  N  N1     . DG  B 2 9   ? 36.161  23.080 29.973  1.00 80.74  ?  12   DG  T N1     1 
ATOM   385  C  C2     . DG  B 2 9   ? 35.910  22.297 31.076  1.00 86.87  ?  12   DG  T C2     1 
ATOM   386  N  N2     . DG  B 2 9   ? 34.745  21.645 31.095  1.00 89.34  ?  12   DG  T N2     1 
ATOM   387  N  N3     . DG  B 2 9   ? 36.742  22.161 32.092  1.00 84.87  ?  12   DG  T N3     1 
ATOM   388  C  C4     . DG  B 2 9   ? 37.869  22.883 31.917  1.00 76.57  ?  12   DG  T C4     1 
ATOM   389  P  P      . DC  B 2 10  ? 41.658  19.710 36.264  1.00 115.34 ?  13   DC  T P      1 
ATOM   390  O  OP1    . DC  B 2 10  ? 42.101  19.054 37.515  1.00 125.23 ?  13   DC  T OP1    1 
ATOM   391  O  OP2    . DC  B 2 10  ? 42.657  20.135 35.255  1.00 113.04 ?  13   DC  T OP2    1 
ATOM   392  O  "O5'"  . DC  B 2 10  ? 40.597  18.757 35.543  1.00 116.53 ?  13   DC  T "O5'"  1 
ATOM   393  C  "C5'"  . DC  B 2 10  ? 39.364  18.460 36.189  1.00 111.84 ?  13   DC  T "C5'"  1 
ATOM   394  C  "C4'"  . DC  B 2 10  ? 38.535  17.497 35.360  1.00 107.44 ?  13   DC  T "C4'"  1 
ATOM   395  O  "O4'"  . DC  B 2 10  ? 37.924  18.205 34.251  1.00 100.24 ?  13   DC  T "O4'"  1 
ATOM   396  C  "C3'"  . DC  B 2 10  ? 39.313  16.328 34.746  1.00 107.82 ?  13   DC  T "C3'"  1 
ATOM   397  O  "O3'"  . DC  B 2 10  ? 38.630  15.110 35.002  1.00 119.64 ?  13   DC  T "O3'"  1 
ATOM   398  C  "C2'"  . DC  B 2 10  ? 39.335  16.652 33.252  1.00 100.40 ?  13   DC  T "C2'"  1 
ATOM   399  C  "C1'"  . DC  B 2 10  ? 38.038  17.425 33.087  1.00 98.80  ?  13   DC  T "C1'"  1 
ATOM   400  N  N1     . DC  B 2 10  ? 38.038  18.334 31.904  1.00 92.28  ?  13   DC  T N1     1 
ATOM   401  C  C2     . DC  B 2 10  ? 36.998  18.259 30.966  1.00 93.64  ?  13   DC  T C2     1 
ATOM   402  O  O2     . DC  B 2 10  ? 36.085  17.439 31.137  1.00 103.33 ?  13   DC  T O2     1 
ATOM   403  N  N3     . DC  B 2 10  ? 37.023  19.093 29.894  1.00 83.01  ?  13   DC  T N3     1 
ATOM   404  C  C4     . DC  B 2 10  ? 38.026  19.963 29.747  1.00 80.36  ?  13   DC  T C4     1 
ATOM   405  N  N4     . DC  B 2 10  ? 38.011  20.765 28.679  1.00 74.77  ?  13   DC  T N4     1 
ATOM   406  C  C5     . DC  B 2 10  ? 39.091  20.048 30.690  1.00 79.80  ?  13   DC  T C5     1 
ATOM   407  C  C6     . DC  B 2 10  ? 39.057  19.224 31.741  1.00 83.70  ?  13   DC  T C6     1 
ATOM   408  P  P      . DA  B 2 11  ? 39.074  13.758 34.254  1.00 130.48 ?  14   DA  T P      1 
ATOM   409  O  OP1    . DA  B 2 11  ? 38.566  12.617 35.048  1.00 134.83 ?  14   DA  T OP1    1 
ATOM   410  O  OP2    . DA  B 2 11  ? 40.520  13.860 33.954  1.00 130.36 ?  14   DA  T OP2    1 
ATOM   411  O  "O5'"  . DA  B 2 11  ? 38.277  13.812 32.868  1.00 127.47 ?  14   DA  T "O5'"  1 
ATOM   412  C  "C5'"  . DA  B 2 11  ? 38.082  12.626 32.106  1.00 131.20 ?  14   DA  T "C5'"  1 
ATOM   413  C  "C4'"  . DA  B 2 11  ? 36.809  12.724 31.284  1.00 129.72 ?  14   DA  T "C4'"  1 
ATOM   414  O  "O4'"  . DA  B 2 11  ? 36.682  14.060 30.754  1.00 124.58 ?  14   DA  T "O4'"  1 
ATOM   415  C  "C3'"  . DA  B 2 11  ? 36.760  11.820 30.067  1.00 131.04 ?  14   DA  T "C3'"  1 
ATOM   416  O  "O3'"  . DA  B 2 11  ? 35.409  11.565 29.699  1.00 127.00 ?  14   DA  T "O3'"  1 
ATOM   417  C  "C2'"  . DA  B 2 11  ? 37.482  12.651 29.005  1.00 129.82 ?  14   DA  T "C2'"  1 
ATOM   418  C  "C1'"  . DA  B 2 11  ? 37.196  14.099 29.435  1.00 125.87 ?  14   DA  T "C1'"  1 
ATOM   419  N  N9     . DA  B 2 11  ? 38.388  14.947 29.429  1.00 125.51 ?  14   DA  T N9     1 
ATOM   420  C  C8     . DA  B 2 11  ? 39.445  14.885 30.294  1.00 128.27 ?  14   DA  T C8     1 
ATOM   421  N  N7     . DA  B 2 11  ? 40.383  15.768 30.049  1.00 126.62 ?  14   DA  T N7     1 
ATOM   422  C  C5     . DA  B 2 11  ? 39.911  16.458 28.946  1.00 121.83 ?  14   DA  T C5     1 
ATOM   423  C  C6     . DA  B 2 11  ? 40.443  17.525 28.195  1.00 116.22 ?  14   DA  T C6     1 
ATOM   424  N  N6     . DA  B 2 11  ? 41.620  18.100 28.466  1.00 116.07 ?  14   DA  T N6     1 
ATOM   425  N  N1     . DA  B 2 11  ? 39.716  17.980 27.153  1.00 112.58 ?  14   DA  T N1     1 
ATOM   426  C  C2     . DA  B 2 11  ? 38.538  17.402 26.886  1.00 111.84 ?  14   DA  T C2     1 
ATOM   427  N  N3     . DA  B 2 11  ? 37.936  16.395 27.518  1.00 115.11 ?  14   DA  T N3     1 
ATOM   428  C  C4     . DA  B 2 11  ? 38.682  15.964 28.549  1.00 120.82 ?  14   DA  T C4     1 
ATOM   429  N  N      . ALA C 3 4   ? 7.992   11.564 -2.576  1.00 65.09  ?  300  ALA A N      1 
ATOM   430  C  CA     . ALA C 3 4   ? 7.806   12.008 -3.952  1.00 63.93  ?  300  ALA A CA     1 
ATOM   431  C  C      . ALA C 3 4   ? 7.628   13.520 -4.022  1.00 54.48  ?  300  ALA A C      1 
ATOM   432  O  O      . ALA C 3 4   ? 6.604   14.063 -3.598  1.00 50.09  ?  300  ALA A O      1 
ATOM   433  C  CB     . ALA C 3 4   ? 6.619   11.307 -4.581  1.00 68.19  ?  300  ALA A CB     1 
ATOM   434  N  N      . PHE C 3 5   ? 8.636   14.195 -4.568  1.00 39.31  ?  301  PHE A N      1 
ATOM   435  C  CA     . PHE C 3 5   ? 8.603   15.642 -4.711  1.00 41.88  ?  301  PHE A CA     1 
ATOM   436  C  C      . PHE C 3 5   ? 9.402   16.031 -5.946  1.00 42.11  ?  301  PHE A C      1 
ATOM   437  O  O      . PHE C 3 5   ? 10.183  15.240 -6.484  1.00 39.44  ?  301  PHE A O      1 
ATOM   438  C  CB     . PHE C 3 5   ? 9.145   16.343 -3.462  1.00 33.16  ?  301  PHE A CB     1 
ATOM   439  C  CG     . PHE C 3 5   ? 10.609  16.111 -3.220  1.00 29.50  ?  301  PHE A CG     1 
ATOM   440  C  CD1    . PHE C 3 5   ? 11.559  16.945 -3.793  1.00 32.15  ?  301  PHE A CD1    1 
ATOM   441  C  CD2    . PHE C 3 5   ? 11.036  15.064 -2.418  1.00 34.41  ?  301  PHE A CD2    1 
ATOM   442  C  CE1    . PHE C 3 5   ? 12.905  16.738 -3.571  1.00 30.69  ?  301  PHE A CE1    1 
ATOM   443  C  CE2    . PHE C 3 5   ? 12.390  14.849 -2.193  1.00 32.16  ?  301  PHE A CE2    1 
ATOM   444  C  CZ     . PHE C 3 5   ? 13.322  15.688 -2.770  1.00 33.00  ?  301  PHE A CZ     1 
ATOM   445  N  N      . THR C 3 6   ? 9.203   17.273 -6.380  1.00 39.54  ?  302  THR A N      1 
ATOM   446  C  CA     . THR C 3 6   ? 9.820   17.798 -7.588  1.00 43.12  ?  302  THR A CA     1 
ATOM   447  C  C      . THR C 3 6   ? 11.078  18.576 -7.224  1.00 41.99  ?  302  THR A C      1 
ATOM   448  O  O      . THR C 3 6   ? 11.006  19.580 -6.509  1.00 39.95  ?  302  THR A O      1 
ATOM   449  C  CB     . THR C 3 6   ? 8.840   18.698 -8.341  1.00 46.56  ?  302  THR A CB     1 
ATOM   450  O  OG1    . THR C 3 6   ? 7.681   17.945 -8.717  1.00 47.69  ?  302  THR A OG1    1 
ATOM   451  C  CG2    . THR C 3 6   ? 9.494   19.286 -9.586  1.00 41.94  ?  302  THR A CG2    1 
ATOM   452  N  N      . LEU C 3 7   ? 12.225  18.118 -7.721  1.00 44.64  ?  303  LEU A N      1 
ATOM   453  C  CA     . LEU C 3 7   ? 13.464  18.888 -7.636  1.00 52.29  ?  303  LEU A CA     1 
ATOM   454  C  C      . LEU C 3 7   ? 13.467  19.841 -8.821  1.00 54.84  ?  303  LEU A C      1 
ATOM   455  O  O      . LEU C 3 7   ? 13.922  19.505 -9.914  1.00 52.31  ?  303  LEU A O      1 
ATOM   456  C  CB     . LEU C 3 7   ? 14.680  17.972 -7.637  1.00 55.66  ?  303  LEU A CB     1 
ATOM   457  C  CG     . LEU C 3 7   ? 15.505  17.995 -6.351  1.00 55.55  ?  303  LEU A CG     1 
ATOM   458  C  CD1    . LEU C 3 7   ? 15.743  16.583 -5.837  1.00 62.39  ?  303  LEU A CD1    1 
ATOM   459  C  CD2    . LEU C 3 7   ? 16.821  18.714 -6.587  1.00 54.10  ?  303  LEU A CD2    1 
ATOM   460  N  N      . ALA C 3 8   ? 12.945  21.045 -8.601  1.00 54.46  ?  304  ALA A N      1 
ATOM   461  C  CA     . ALA C 3 8   ? 12.700  21.979 -9.690  1.00 59.41  ?  304  ALA A CA     1 
ATOM   462  C  C      . ALA C 3 8   ? 13.970  22.723 -10.073 1.00 58.06  ?  304  ALA A C      1 
ATOM   463  O  O      . ALA C 3 8   ? 14.727  23.182 -9.212  1.00 58.69  ?  304  ALA A O      1 
ATOM   464  C  CB     . ALA C 3 8   ? 11.613  22.981 -9.304  1.00 59.91  ?  304  ALA A CB     1 
ATOM   465  N  N      . ASP C 3 9   ? 14.196  22.834 -11.378 1.00 56.66  ?  305  ASP A N      1 
ATOM   466  C  CA     . ASP C 3 9   ? 15.264  23.657 -11.922 1.00 63.90  ?  305  ASP A CA     1 
ATOM   467  C  C      . ASP C 3 9   ? 14.791  25.059 -12.276 1.00 60.14  ?  305  ASP A C      1 
ATOM   468  O  O      . ASP C 3 9   ? 15.624  25.930 -12.548 1.00 61.02  ?  305  ASP A O      1 
ATOM   469  C  CB     . ASP C 3 9   ? 15.858  22.987 -13.165 1.00 67.47  ?  305  ASP A CB     1 
ATOM   470  C  CG     . ASP C 3 9   ? 17.334  23.281 -13.338 1.00 82.45  ?  305  ASP A CG     1 
ATOM   471  O  OD1    . ASP C 3 9   ? 18.138  22.781 -12.523 1.00 84.27  ?  305  ASP A OD1    1 
ATOM   472  O  OD2    . ASP C 3 9   ? 17.689  24.007 -14.290 1.00 87.79  ?  305  ASP A OD2    1 
ATOM   473  N  N      . ARG C 3 10  ? 13.480  25.291 -12.269 1.00 51.92  ?  306  ARG A N      1 
ATOM   474  C  CA     . ARG C 3 10  ? 12.906  26.573 -12.643 1.00 57.75  ?  306  ARG A CA     1 
ATOM   475  C  C      . ARG C 3 10  ? 11.606  26.770 -11.877 1.00 48.41  ?  306  ARG A C      1 
ATOM   476  O  O      . ARG C 3 10  ? 10.893  25.808 -11.586 1.00 39.63  ?  306  ARG A O      1 
ATOM   477  C  CB     . ARG C 3 10  ? 12.652  26.649 -14.152 1.00 65.03  ?  306  ARG A CB     1 
ATOM   478  C  CG     . ARG C 3 10  ? 12.264  28.028 -14.645 1.00 78.77  ?  306  ARG A CG     1 
ATOM   479  C  CD     . ARG C 3 10  ? 11.792  28.004 -16.091 1.00 89.17  ?  306  ARG A CD     1 
ATOM   480  N  NE     . ARG C 3 10  ? 10.340  28.123 -16.190 1.00 94.68  ?  306  ARG A NE     1 
ATOM   481  C  CZ     . ARG C 3 10  ? 9.659   29.213 -15.852 1.00 94.83  ?  306  ARG A CZ     1 
ATOM   482  N  NH1    . ARG C 3 10  ? 10.298  30.276 -15.379 1.00 95.06  ?  306  ARG A NH1    1 
ATOM   483  N  NH2    . ARG C 3 10  ? 8.339   29.241 -15.975 1.00 93.20  ?  306  ARG A NH2    1 
ATOM   484  N  N      . VAL C 3 11  ? 11.297  28.025 -11.564 1.00 41.82  ?  307  VAL A N      1 
ATOM   485  C  CA     . VAL C 3 11  ? 10.058  28.357 -10.868 1.00 38.27  ?  307  VAL A CA     1 
ATOM   486  C  C      . VAL C 3 11  ? 8.892   28.268 -11.844 1.00 40.23  ?  307  VAL A C      1 
ATOM   487  O  O      . VAL C 3 11  ? 8.909   28.894 -12.910 1.00 40.57  ?  307  VAL A O      1 
ATOM   488  C  CB     . VAL C 3 11  ? 10.142  29.757 -10.240 1.00 44.39  ?  307  VAL A CB     1 
ATOM   489  C  CG1    . VAL C 3 11  ? 8.753   30.236 -9.838  1.00 44.30  ?  307  VAL A CG1    1 
ATOM   490  C  CG2    . VAL C 3 11  ? 11.075  29.749 -9.039  1.00 38.00  ?  307  VAL A CG2    1 
ATOM   491  N  N      . THR C 3 12  ? 7.870   27.504 -11.478 1.00 41.62  ?  308  THR A N      1 
ATOM   492  C  CA     . THR C 3 12  ? 6.676   27.363 -12.295 1.00 47.20  ?  308  THR A CA     1 
ATOM   493  C  C      . THR C 3 12  ? 5.481   27.989 -11.588 1.00 44.86  ?  308  THR A C      1 
ATOM   494  O  O      . THR C 3 12  ? 5.501   28.231 -10.378 1.00 43.01  ?  308  THR A O      1 
ATOM   495  C  CB     . THR C 3 12  ? 6.389   25.892 -12.609 1.00 44.46  ?  308  THR A CB     1 
ATOM   496  O  OG1    . THR C 3 12  ? 6.191   25.167 -11.388 1.00 47.39  ?  308  THR A OG1    1 
ATOM   497  C  CG2    . THR C 3 12  ? 7.549   25.283 -13.377 1.00 43.51  ?  308  THR A CG2    1 
ATOM   498  N  N      . GLU C 3 13  ? 4.431   28.245 -12.370 1.00 46.06  ?  309  GLU A N      1 
ATOM   499  C  CA     . GLU C 3 13  ? 3.253   28.926 -11.840 1.00 47.19  ?  309  GLU A CA     1 
ATOM   500  C  C      . GLU C 3 13  ? 2.618   28.143 -10.698 1.00 43.66  ?  309  GLU A C      1 
ATOM   501  O  O      . GLU C 3 13  ? 2.152   28.734 -9.717  1.00 47.35  ?  309  GLU A O      1 
ATOM   502  C  CB     . GLU C 3 13  ? 2.240   29.161 -12.962 1.00 62.26  ?  309  GLU A CB     1 
ATOM   503  C  CG     . GLU C 3 13  ? 0.835   29.510 -12.485 1.00 78.18  ?  309  GLU A CG     1 
ATOM   504  C  CD     . GLU C 3 13  ? 0.750   30.873 -11.821 1.00 91.11  ?  309  GLU A CD     1 
ATOM   505  O  OE1    . GLU C 3 13  ? 1.748   31.625 -11.861 1.00 94.16  ?  309  GLU A OE1    1 
ATOM   506  O  OE2    . GLU C 3 13  ? -0.320  31.194 -11.261 1.00 94.94  ?  309  GLU A OE2    1 
ATOM   507  N  N      . GLU C 3 14  ? 2.592   26.812 -10.801 1.00 35.01  ?  310  GLU A N      1 
ATOM   508  C  CA     . GLU C 3 14  ? 1.921   26.014 -9.781  1.00 39.30  ?  310  GLU A CA     1 
ATOM   509  C  C      . GLU C 3 14  ? 2.642   26.056 -8.436  1.00 42.60  ?  310  GLU A C      1 
ATOM   510  O  O      . GLU C 3 14  ? 2.041   25.704 -7.415  1.00 39.27  ?  310  GLU A O      1 
ATOM   511  C  CB     . GLU C 3 14  ? 1.762   24.567 -10.257 1.00 38.80  ?  310  GLU A CB     1 
ATOM   512  C  CG     . GLU C 3 14  ? 3.054   23.785 -10.375 1.00 51.75  ?  310  GLU A CG     1 
ATOM   513  C  CD     . GLU C 3 14  ? 2.816   22.325 -10.724 1.00 63.36  ?  310  GLU A CD     1 
ATOM   514  O  OE1    . GLU C 3 14  ? 1.645   21.943 -10.937 1.00 66.21  ?  310  GLU A OE1    1 
ATOM   515  O  OE2    . GLU C 3 14  ? 3.801   21.560 -10.783 1.00 62.35  ?  310  GLU A OE2    1 
ATOM   516  N  N      . MET C 3 15  ? 3.907   26.479 -8.405  1.00 40.15  ?  311  MET A N      1 
ATOM   517  C  CA     . MET C 3 15  ? 4.595   26.686 -7.138  1.00 34.83  ?  311  MET A CA     1 
ATOM   518  C  C      . MET C 3 15  ? 4.154   27.957 -6.432  1.00 30.29  ?  311  MET A C      1 
ATOM   519  O  O      . MET C 3 15  ? 4.552   28.175 -5.283  1.00 36.04  ?  311  MET A O      1 
ATOM   520  C  CB     . MET C 3 15  ? 6.106   26.749 -7.354  1.00 41.42  ?  311  MET A CB     1 
ATOM   521  C  CG     . MET C 3 15  ? 6.660   25.651 -8.218  1.00 47.69  ?  311  MET A CG     1 
ATOM   522  S  SD     . MET C 3 15  ? 8.439   25.842 -8.406  1.00 44.75  ?  311  MET A SD     1 
ATOM   523  C  CE     . MET C 3 15  ? 8.770   24.496 -9.543  1.00 50.91  ?  311  MET A CE     1 
ATOM   524  N  N      . LEU C 3 16  ? 3.350   28.793 -7.089  1.00 31.12  ?  312  LEU A N      1 
ATOM   525  C  CA     . LEU C 3 16  ? 2.960   30.108 -6.591  1.00 38.02  ?  312  LEU A CA     1 
ATOM   526  C  C      . LEU C 3 16  ? 1.472   30.169 -6.256  1.00 41.91  ?  312  LEU A C      1 
ATOM   527  O  O      . LEU C 3 16  ? 0.793   31.156 -6.550  1.00 43.72  ?  312  LEU A O      1 
ATOM   528  C  CB     . LEU C 3 16  ? 3.312   31.188 -7.612  1.00 40.46  ?  312  LEU A CB     1 
ATOM   529  C  CG     . LEU C 3 16  ? 4.701   31.070 -8.242  1.00 40.45  ?  312  LEU A CG     1 
ATOM   530  C  CD1    . LEU C 3 16  ? 4.898   32.118 -9.328  1.00 43.81  ?  312  LEU A CD1    1 
ATOM   531  C  CD2    . LEU C 3 16  ? 5.775   31.189 -7.173  1.00 37.30  ?  312  LEU A CD2    1 
ATOM   532  N  N      . ALA C 3 17  ? 0.950   29.107 -5.647  1.00 41.33  ?  313  ALA A N      1 
ATOM   533  C  CA     . ALA C 3 17  ? -0.425  29.101 -5.175  1.00 38.85  ?  313  ALA A CA     1 
ATOM   534  C  C      . ALA C 3 17  ? -0.609  30.128 -4.063  1.00 30.71  ?  313  ALA A C      1 
ATOM   535  O  O      . ALA C 3 17  ? 0.351   30.592 -3.442  1.00 43.48  ?  313  ALA A O      1 
ATOM   536  C  CB     . ALA C 3 17  ? -0.815  27.712 -4.668  1.00 39.23  ?  313  ALA A CB     1 
ATOM   537  N  N      . ASP C 3 18  ? -1.867  30.476 -3.804  1.00 23.91  ?  314  ASP A N      1 
ATOM   538  C  CA     . ASP C 3 18  ? -2.173  31.493 -2.802  1.00 36.10  ?  314  ASP A CA     1 
ATOM   539  C  C      . ASP C 3 18  ? -2.164  30.957 -1.373  1.00 28.84  ?  314  ASP A C      1 
ATOM   540  O  O      . ASP C 3 18  ? -2.415  31.727 -0.438  1.00 27.84  ?  314  ASP A O      1 
ATOM   541  C  CB     . ASP C 3 18  ? -3.524  32.142 -3.113  1.00 58.32  ?  314  ASP A CB     1 
ATOM   542  C  CG     . ASP C 3 18  ? -4.589  31.129 -3.461  1.00 75.60  ?  314  ASP A CG     1 
ATOM   543  O  OD1    . ASP C 3 18  ? -4.432  29.950 -3.081  1.00 79.17  ?  314  ASP A OD1    1 
ATOM   544  O  OD2    . ASP C 3 18  ? -5.576  31.509 -4.126  1.00 82.79  ?  314  ASP A OD2    1 
ATOM   545  N  N      . LYS C 3 19  ? -1.890  29.670 -1.177  1.00 26.96  ?  315  LYS A N      1 
ATOM   546  C  CA     . LYS C 3 19  ? -1.643  29.117 0.149   1.00 31.69  ?  315  LYS A CA     1 
ATOM   547  C  C      . LYS C 3 19  ? -0.574  28.045 0.025   1.00 22.41  ?  315  LYS A C      1 
ATOM   548  O  O      . LYS C 3 19  ? -0.641  27.204 -0.874  1.00 27.97  ?  315  LYS A O      1 
ATOM   549  C  CB     . LYS C 3 19  ? -2.916  28.528 0.777   1.00 35.04  ?  315  LYS A CB     1 
ATOM   550  C  CG     . LYS C 3 19  ? -2.712  28.074 2.227   1.00 41.26  ?  315  LYS A CG     1 
ATOM   551  C  CD     . LYS C 3 19  ? -4.032  27.770 2.931   1.00 43.84  ?  315  LYS A CD     1 
ATOM   552  C  CE     . LYS C 3 19  ? -3.797  27.307 4.370   1.00 40.51  ?  315  LYS A CE     1 
ATOM   553  N  NZ     . LYS C 3 19  ? -3.222  28.374 5.239   1.00 41.61  ?  315  LYS A NZ     1 
ATOM   554  N  N      . ALA C 3 20  ? 0.411   28.076 0.915   1.00 19.45  ?  316  ALA A N      1 
ATOM   555  C  CA     . ALA C 3 20  ? 1.502   27.123 0.807   1.00 24.98  ?  316  ALA A CA     1 
ATOM   556  C  C      . ALA C 3 20  ? 2.261   27.056 2.121   1.00 31.38  ?  316  ALA A C      1 
ATOM   557  O  O      . ALA C 3 20  ? 2.386   28.058 2.831   1.00 21.23  ?  316  ALA A O      1 
ATOM   558  C  CB     . ALA C 3 20  ? 2.451   27.502 -0.337  1.00 19.47  ?  316  ALA A CB     1 
ATOM   559  N  N      . ALA C 3 21  ? 2.749   25.867 2.448   1.00 19.56  ?  317  ALA A N      1 
ATOM   560  C  CA     . ALA C 3 21  ? 3.797   25.756 3.447   1.00 22.00  ?  317  ALA A CA     1 
ATOM   561  C  C      . ALA C 3 21  ? 5.113   26.106 2.772   1.00 22.89  ?  317  ALA A C      1 
ATOM   562  O  O      . ALA C 3 21  ? 5.400   25.627 1.672   1.00 20.34  ?  317  ALA A O      1 
ATOM   563  C  CB     . ALA C 3 21  ? 3.846   24.349 4.042   1.00 14.47  ?  317  ALA A CB     1 
ATOM   564  N  N      . LEU C 3 22  ? 5.893   26.973 3.402   1.00 21.28  ?  318  LEU A N      1 
ATOM   565  C  CA     . LEU C 3 22  ? 7.129   27.453 2.809   1.00 21.85  ?  318  LEU A CA     1 
ATOM   566  C  C      . LEU C 3 22  ? 8.277   27.232 3.777   1.00 21.54  ?  318  LEU A C      1 
ATOM   567  O  O      . LEU C 3 22  ? 8.153   27.500 4.977   1.00 18.62  ?  318  LEU A O      1 
ATOM   568  C  CB     . LEU C 3 22  ? 7.022   28.936 2.430   1.00 20.76  ?  318  LEU A CB     1 
ATOM   569  C  CG     . LEU C 3 22  ? 8.312   29.673 2.058   1.00 19.95  ?  318  LEU A CG     1 
ATOM   570  C  CD1    . LEU C 3 22  ? 8.870   29.235 0.700   1.00 14.33  ?  318  LEU A CD1    1 
ATOM   571  C  CD2    . LEU C 3 22  ? 8.050   31.168 2.073   1.00 22.89  ?  318  LEU A CD2    1 
ATOM   572  N  N      . VAL C 3 23  ? 9.388   26.740 3.243   1.00 21.38  ?  319  VAL A N      1 
ATOM   573  C  CA     . VAL C 3 23  ? 10.613  26.520 3.998   1.00 19.84  ?  319  VAL A CA     1 
ATOM   574  C  C      . VAL C 3 23  ? 11.706  27.306 3.292   1.00 23.59  ?  319  VAL A C      1 
ATOM   575  O  O      . VAL C 3 23  ? 12.018  27.040 2.124   1.00 18.69  ?  319  VAL A O      1 
ATOM   576  C  CB     . VAL C 3 23  ? 10.976  25.032 4.097   1.00 22.79  ?  319  VAL A CB     1 
ATOM   577  C  CG1    . VAL C 3 23  ? 12.386  24.868 4.642   1.00 18.22  ?  319  VAL A CG1    1 
ATOM   578  C  CG2    . VAL C 3 23  ? 9.978   24.299 4.988   1.00 26.71  ?  319  VAL A CG2    1 
ATOM   579  N  N      . VAL C 3 24  ? 12.263  28.291 3.984   1.00 25.35  ?  320  VAL A N      1 
ATOM   580  C  CA     . VAL C 3 24  ? 13.422  29.039 3.520   1.00 22.92  ?  320  VAL A CA     1 
ATOM   581  C  C      . VAL C 3 24  ? 14.524  28.730 4.521   1.00 20.16  ?  320  VAL A C      1 
ATOM   582  O  O      . VAL C 3 24  ? 14.605  29.342 5.590   1.00 24.98  ?  320  VAL A O      1 
ATOM   583  C  CB     . VAL C 3 24  ? 13.139  30.541 3.413   1.00 24.24  ?  320  VAL A CB     1 
ATOM   584  C  CG1    . VAL C 3 24  ? 14.376  31.291 2.926   1.00 20.51  ?  320  VAL A CG1    1 
ATOM   585  C  CG2    . VAL C 3 24  ? 11.958  30.786 2.472   1.00 19.40  ?  320  VAL A CG2    1 
ATOM   586  N  N      . GLU C 3 25  ? 15.349  27.745 4.193   1.00 23.48  ?  321  GLU A N      1 
ATOM   587  C  CA     . GLU C 3 25  ? 16.229  27.130 5.174   1.00 24.47  ?  321  GLU A CA     1 
ATOM   588  C  C      . GLU C 3 25  ? 17.493  27.960 5.338   1.00 25.23  ?  321  GLU A C      1 
ATOM   589  O  O      . GLU C 3 25  ? 18.252  28.150 4.381   1.00 23.64  ?  321  GLU A O      1 
ATOM   590  C  CB     . GLU C 3 25  ? 16.580  25.705 4.759   1.00 19.50  ?  321  GLU A CB     1 
ATOM   591  C  CG     . GLU C 3 25  ? 17.379  24.951 5.800   1.00 25.01  ?  321  GLU A CG     1 
ATOM   592  C  CD     . GLU C 3 25  ? 16.507  24.419 6.918   1.00 36.60  ?  321  GLU A CD     1 
ATOM   593  O  OE1    . GLU C 3 25  ? 15.397  24.959 7.120   1.00 30.08  ?  321  GLU A OE1    1 
ATOM   594  O  OE2    . GLU C 3 25  ? 16.925  23.450 7.586   1.00 30.15  ?  321  GLU A OE2    1 
ATOM   595  N  N      . VAL C 3 26  ? 17.712  28.452 6.552   1.00 23.40  ?  322  VAL A N      1 
ATOM   596  C  CA     . VAL C 3 26  ? 18.948  29.117 6.941   1.00 19.68  ?  322  VAL A CA     1 
ATOM   597  C  C      . VAL C 3 26  ? 19.566  28.254 8.028   1.00 26.77  ?  322  VAL A C      1 
ATOM   598  O  O      . VAL C 3 26  ? 19.000  28.129 9.120   1.00 25.54  ?  322  VAL A O      1 
ATOM   599  C  CB     . VAL C 3 26  ? 18.701  30.551 7.430   1.00 21.01  ?  322  VAL A CB     1 
ATOM   600  C  CG1    . VAL C 3 26  ? 19.993  31.171 7.954   1.00 18.73  ?  322  VAL A CG1    1 
ATOM   601  C  CG2    . VAL C 3 26  ? 18.116  31.390 6.310   1.00 18.79  ?  322  VAL A CG2    1 
ATOM   602  N  N      . VAL C 3 27  ? 20.712  27.644 7.732   1.00 25.04  ?  323  VAL A N      1 
ATOM   603  C  CA     . VAL C 3 27  ? 21.286  26.663 8.646   1.00 29.73  ?  323  VAL A CA     1 
ATOM   604  C  C      . VAL C 3 27  ? 22.192  27.305 9.696   1.00 27.43  ?  323  VAL A C      1 
ATOM   605  O  O      . VAL C 3 27  ? 22.249  26.824 10.834  1.00 24.14  ?  323  VAL A O      1 
ATOM   606  C  CB     . VAL C 3 27  ? 22.040  25.582 7.857   1.00 33.40  ?  323  VAL A CB     1 
ATOM   607  C  CG1    . VAL C 3 27  ? 22.728  24.625 8.808   1.00 38.40  ?  323  VAL A CG1    1 
ATOM   608  C  CG2    . VAL C 3 27  ? 21.074  24.831 6.949   1.00 33.55  ?  323  VAL A CG2    1 
ATOM   609  N  N      . GLU C 3 28  ? 22.907  28.371 9.340   1.00 25.49  ?  324  GLU A N      1 
ATOM   610  C  CA     . GLU C 3 28  ? 23.705  29.106 10.315  1.00 31.25  ?  324  GLU A CA     1 
ATOM   611  C  C      . GLU C 3 28  ? 22.834  29.554 11.482  1.00 27.91  ?  324  GLU A C      1 
ATOM   612  O  O      . GLU C 3 28  ? 21.758  30.124 11.283  1.00 28.83  ?  324  GLU A O      1 
ATOM   613  C  CB     . GLU C 3 28  ? 24.355  30.329 9.663   1.00 36.23  ?  324  GLU A CB     1 
ATOM   614  C  CG     . GLU C 3 28  ? 24.985  30.080 8.312   1.00 53.54  ?  324  GLU A CG     1 
ATOM   615  C  CD     . GLU C 3 28  ? 26.456  29.751 8.409   1.00 74.16  ?  324  GLU A CD     1 
ATOM   616  O  OE1    . GLU C 3 28  ? 26.914  29.394 9.515   1.00 82.29  ?  324  GLU A OE1    1 
ATOM   617  O  OE2    . GLU C 3 28  ? 27.152  29.860 7.378   1.00 78.08  ?  324  GLU A OE2    1 
ATOM   618  N  N      . GLU C 3 29  ? 23.320  29.323 12.706  1.00 31.83  ?  325  GLU A N      1 
ATOM   619  C  CA     . GLU C 3 29  ? 22.544  29.677 13.893  1.00 35.49  ?  325  GLU A CA     1 
ATOM   620  C  C      . GLU C 3 29  ? 22.186  31.158 13.894  1.00 31.57  ?  325  GLU A C      1 
ATOM   621  O  O      . GLU C 3 29  ? 21.023  31.530 14.088  1.00 29.43  ?  325  GLU A O      1 
ATOM   622  C  CB     . GLU C 3 29  ? 23.318  29.311 15.162  1.00 43.80  ?  325  GLU A CB     1 
ATOM   623  C  CG     . GLU C 3 29  ? 23.394  27.817 15.447  1.00 64.53  ?  325  GLU A CG     1 
ATOM   624  C  CD     . GLU C 3 29  ? 23.056  27.481 16.891  1.00 84.12  ?  325  GLU A CD     1 
ATOM   625  O  OE1    . GLU C 3 29  ? 22.088  28.062 17.424  1.00 89.20  ?  325  GLU A OE1    1 
ATOM   626  O  OE2    . GLU C 3 29  ? 23.759  26.641 17.494  1.00 91.03  ?  325  GLU A OE2    1 
ATOM   627  N  N      . ASN C 3 30  ? 23.179  32.018 13.691  1.00 29.71  ?  326  ASN A N      1 
ATOM   628  C  CA     . ASN C 3 30  ? 22.945  33.449 13.549  1.00 26.72  ?  326  ASN A CA     1 
ATOM   629  C  C      . ASN C 3 30  ? 22.558  33.717 12.101  1.00 27.77  ?  326  ASN A C      1 
ATOM   630  O  O      . ASN C 3 30  ? 23.396  33.624 11.200  1.00 20.91  ?  326  ASN A O      1 
ATOM   631  C  CB     . ASN C 3 30  ? 24.189  34.233 13.949  1.00 23.28  ?  326  ASN A CB     1 
ATOM   632  C  CG     . ASN C 3 30  ? 23.943  35.725 13.993  1.00 31.87  ?  326  ASN A CG     1 
ATOM   633  O  OD1    . ASN C 3 30  ? 23.335  36.293 13.084  1.00 27.73  ?  326  ASN A OD1    1 
ATOM   634  N  ND2    . ASN C 3 30  ? 24.405  36.369 15.059  1.00 30.43  ?  326  ASN A ND2    1 
ATOM   635  N  N      . TYR C 3 31  ? 21.289  34.030 11.864  1.00 17.81  ?  327  TYR A N      1 
ATOM   636  C  CA     . TYR C 3 31  ? 20.819  34.101 10.488  1.00 18.54  ?  327  TYR A CA     1 
ATOM   637  C  C      . TYR C 3 31  ? 21.089  35.448 9.826   1.00 24.32  ?  327  TYR A C      1 
ATOM   638  O  O      . TYR C 3 31  ? 20.685  35.642 8.676   1.00 18.41  ?  327  TYR A O      1 
ATOM   639  C  CB     . TYR C 3 31  ? 19.324  33.775 10.429  1.00 17.87  ?  327  TYR A CB     1 
ATOM   640  C  CG     . TYR C 3 31  ? 18.488  34.461 11.482  1.00 18.70  ?  327  TYR A CG     1 
ATOM   641  C  CD1    . TYR C 3 31  ? 18.239  35.828 11.425  1.00 18.63  ?  327  TYR A CD1    1 
ATOM   642  C  CD2    . TYR C 3 31  ? 17.926  33.737 12.524  1.00 19.98  ?  327  TYR A CD2    1 
ATOM   643  C  CE1    . TYR C 3 31  ? 17.467  36.450 12.379  1.00 21.50  ?  327  TYR A CE1    1 
ATOM   644  C  CE2    . TYR C 3 31  ? 17.150  34.349 13.480  1.00 20.82  ?  327  TYR A CE2    1 
ATOM   645  C  CZ     . TYR C 3 31  ? 16.920  35.704 13.404  1.00 22.28  ?  327  TYR A CZ     1 
ATOM   646  O  OH     . TYR C 3 31  ? 16.142  36.309 14.363  1.00 25.91  ?  327  TYR A OH     1 
ATOM   647  N  N      . HIS C 3 32  ? 21.772  36.371 10.496  1.00 23.28  ?  328  HIS A N      1 
ATOM   648  C  CA     . HIS C 3 32  ? 21.987  37.692 9.919   1.00 20.68  ?  328  HIS A CA     1 
ATOM   649  C  C      . HIS C 3 32  ? 22.988  37.606 8.777   1.00 19.52  ?  328  HIS A C      1 
ATOM   650  O  O      . HIS C 3 32  ? 24.140  37.205 8.972   1.00 21.10  ?  328  HIS A O      1 
ATOM   651  C  CB     . HIS C 3 32  ? 22.455  38.674 10.987  1.00 20.11  ?  328  HIS A CB     1 
ATOM   652  C  CG     . HIS C 3 32  ? 21.342  39.181 11.848  1.00 20.75  ?  328  HIS A CG     1 
ATOM   653  N  ND1    . HIS C 3 32  ? 20.412  40.092 11.395  1.00 24.03  ?  328  HIS A ND1    1 
ATOM   654  C  CD2    . HIS C 3 32  ? 20.985  38.877 13.119  1.00 26.04  ?  328  HIS A CD2    1 
ATOM   655  C  CE1    . HIS C 3 32  ? 19.541  40.342 12.357  1.00 30.57  ?  328  HIS A CE1    1 
ATOM   656  N  NE2    . HIS C 3 32  ? 19.865  39.615 13.412  1.00 24.37  ?  328  HIS A NE2    1 
ATOM   657  N  N      . ASP C 3 33  ? 22.538  37.979 7.579   1.00 19.67  ?  329  ASP A N      1 
ATOM   658  C  CA     . ASP C 3 33  ? 23.369  37.953 6.381   1.00 19.77  ?  329  ASP A CA     1 
ATOM   659  C  C      . ASP C 3 33  ? 23.881  36.546 6.095   1.00 26.60  ?  329  ASP A C      1 
ATOM   660  O  O      . ASP C 3 33  ? 24.989  36.368 5.591   1.00 20.69  ?  329  ASP A O      1 
ATOM   661  C  CB     . ASP C 3 33  ? 24.540  38.927 6.501   1.00 20.29  ?  329  ASP A CB     1 
ATOM   662  C  CG     . ASP C 3 33  ? 24.885  39.588 5.187   1.00 27.40  ?  329  ASP A CG     1 
ATOM   663  O  OD1    . ASP C 3 33  ? 25.796  40.434 5.190   1.00 24.68  ?  329  ASP A OD1    1 
ATOM   664  O  OD2    . ASP C 3 33  ? 24.239  39.284 4.159   1.00 32.65  ?  329  ASP A OD2    1 
ATOM   665  N  N      . ALA C 3 34  ? 23.091  35.556 6.416   1.00 30.83  ?  330  ALA A N      1 
ATOM   666  C  CA     . ALA C 3 34  ? 23.461  34.155 6.338   1.00 27.32  ?  330  ALA A CA     1 
ATOM   667  C  C      . ALA C 3 34  ? 22.943  33.525 5.051   1.00 29.97  ?  330  ALA A C      1 
ATOM   668  O  O      . ALA C 3 34  ? 21.973  34.007 4.455   1.00 23.07  ?  330  ALA A O      1 
ATOM   669  C  CB     . ALA C 3 34  ? 22.903  33.388 7.540   1.00 20.78  ?  330  ALA A CB     1 
ATOM   670  N  N      . PRO C 3 35  ? 23.571  32.445 4.597   1.00 33.33  ?  331  PRO A N      1 
ATOM   671  C  CA     . PRO C 3 35  ? 23.126  31.816 3.352   1.00 27.83  ?  331  PRO A CA     1 
ATOM   672  C  C      . PRO C 3 35  ? 21.769  31.154 3.518   1.00 26.18  ?  331  PRO A C      1 
ATOM   673  O  O      . PRO C 3 35  ? 21.425  30.642 4.587   1.00 18.95  ?  331  PRO A O      1 
ATOM   674  C  CB     . PRO C 3 35  ? 24.220  30.780 3.065   1.00 33.65  ?  331  PRO A CB     1 
ATOM   675  C  CG     . PRO C 3 35  ? 25.402  31.249 3.842   1.00 34.75  ?  331  PRO A CG     1 
ATOM   676  C  CD     . PRO C 3 35  ? 24.834  31.867 5.080   1.00 34.40  ?  331  PRO A CD     1 
ATOM   677  N  N      . ILE C 3 36  ? 20.988  31.186 2.448   1.00 19.12  ?  332  ILE A N      1 
ATOM   678  C  CA     . ILE C 3 36  ? 19.790  30.371 2.336   1.00 27.50  ?  332  ILE A CA     1 
ATOM   679  C  C      . ILE C 3 36  ? 20.198  29.143 1.539   1.00 28.40  ?  332  ILE A C      1 
ATOM   680  O  O      . ILE C 3 36  ? 20.591  29.252 0.373   1.00 26.35  ?  332  ILE A O      1 
ATOM   681  C  CB     . ILE C 3 36  ? 18.638  31.142 1.681   1.00 26.76  ?  332  ILE A CB     1 
ATOM   682  C  CG1    . ILE C 3 36  ? 18.244  32.330 2.571   1.00 19.40  ?  332  ILE A CG1    1 
ATOM   683  C  CG2    . ILE C 3 36  ? 17.454  30.226 1.443   1.00 28.74  ?  332  ILE A CG2    1 
ATOM   684  C  CD1    . ILE C 3 36  ? 17.187  33.240 1.977   1.00 23.55  ?  332  ILE A CD1    1 
ATOM   685  N  N      . VAL C 3 37  ? 20.154  27.969 2.179   1.00 27.37  ?  333  VAL A N      1 
ATOM   686  C  CA     . VAL C 3 37  ? 20.715  26.768 1.560   1.00 31.73  ?  333  VAL A CA     1 
ATOM   687  C  C      . VAL C 3 37  ? 19.709  26.015 0.708   1.00 31.55  ?  333  VAL A C      1 
ATOM   688  O  O      . VAL C 3 37  ? 20.098  25.088 -0.020  1.00 27.00  ?  333  VAL A O      1 
ATOM   689  C  CB     . VAL C 3 37  ? 21.290  25.811 2.622   1.00 30.58  ?  333  VAL A CB     1 
ATOM   690  C  CG1    . VAL C 3 37  ? 22.276  26.550 3.522   1.00 27.39  ?  333  VAL A CG1    1 
ATOM   691  C  CG2    . VAL C 3 37  ? 20.167  25.196 3.445   1.00 26.43  ?  333  VAL A CG2    1 
ATOM   692  N  N      . GLY C 3 38  ? 18.438  26.384 0.759   1.00 22.53  ?  334  GLY A N      1 
ATOM   693  C  CA     . GLY C 3 38  ? 17.431  25.681 -0.003  1.00 23.13  ?  334  GLY A CA     1 
ATOM   694  C  C      . GLY C 3 38  ? 16.035  26.135 0.352   1.00 21.84  ?  334  GLY A C      1 
ATOM   695  O  O      . GLY C 3 38  ? 15.808  26.695 1.430   1.00 23.64  ?  334  GLY A O      1 
ATOM   696  N  N      . ILE C 3 39  ? 15.094  25.902 -0.556  1.00 22.84  ?  335  ILE A N      1 
ATOM   697  C  CA     . ILE C 3 39  ? 13.708  26.314 -0.400  1.00 21.14  ?  335  ILE A CA     1 
ATOM   698  C  C      . ILE C 3 39  ? 12.813  25.135 -0.743  1.00 22.90  ?  335  ILE A C      1 
ATOM   699  O  O      . ILE C 3 39  ? 13.097  24.376 -1.675  1.00 24.11  ?  335  ILE A O      1 
ATOM   700  C  CB     . ILE C 3 39  ? 13.378  27.527 -1.295  1.00 25.01  ?  335  ILE A CB     1 
ATOM   701  C  CG1    . ILE C 3 39  ? 13.920  28.807 -0.660  1.00 29.27  ?  335  ILE A CG1    1 
ATOM   702  C  CG2    . ILE C 3 39  ? 11.872  27.620 -1.555  1.00 21.87  ?  335  ILE A CG2    1 
ATOM   703  C  CD1    . ILE C 3 39  ? 14.551  29.750 -1.649  1.00 28.61  ?  335  ILE A CD1    1 
ATOM   704  N  N      . ALA C 3 40  ? 11.735  24.979 0.015   1.00 22.83  ?  336  ALA A N      1 
ATOM   705  C  CA     . ALA C 3 40  ? 10.739  23.956 -0.250  1.00 23.09  ?  336  ALA A CA     1 
ATOM   706  C  C      . ALA C 3 40  ? 9.367   24.603 -0.217  1.00 17.51  ?  336  ALA A C      1 
ATOM   707  O  O      . ALA C 3 40  ? 9.112   25.501 0.593   1.00 23.30  ?  336  ALA A O      1 
ATOM   708  C  CB     . ALA C 3 40  ? 10.816  22.811 0.767   1.00 18.16  ?  336  ALA A CB     1 
ATOM   709  N  N      . VAL C 3 41  ? 8.492   24.152 -1.107  1.00 26.18  ?  337  VAL A N      1 
ATOM   710  C  CA     . VAL C 3 41  ? 7.133   24.663 -1.216  1.00 28.02  ?  337  VAL A CA     1 
ATOM   711  C  C      . VAL C 3 41  ? 6.192   23.473 -1.311  1.00 25.03  ?  337  VAL A C      1 
ATOM   712  O  O      . VAL C 3 41  ? 6.357   22.616 -2.184  1.00 26.75  ?  337  VAL A O      1 
ATOM   713  C  CB     . VAL C 3 41  ? 6.964   25.584 -2.440  1.00 26.94  ?  337  VAL A CB     1 
ATOM   714  C  CG1    . VAL C 3 41  ? 5.498   25.963 -2.629  1.00 30.05  ?  337  VAL A CG1    1 
ATOM   715  C  CG2    . VAL C 3 41  ? 7.825   26.818 -2.301  1.00 25.58  ?  337  VAL A CG2    1 
ATOM   716  N  N      . VAL C 3 42  ? 5.222   23.409 -0.407  1.00 24.60  ?  338  VAL A N      1 
ATOM   717  C  CA     . VAL C 3 42  ? 4.156   22.419 -0.478  1.00 23.33  ?  338  VAL A CA     1 
ATOM   718  C  C      . VAL C 3 42  ? 2.844   23.172 -0.586  1.00 24.13  ?  338  VAL A C      1 
ATOM   719  O  O      . VAL C 3 42  ? 2.555   24.045 0.240   1.00 25.22  ?  338  VAL A O      1 
ATOM   720  C  CB     . VAL C 3 42  ? 4.150   21.481 0.737   1.00 22.11  ?  338  VAL A CB     1 
ATOM   721  C  CG1    . VAL C 3 42  ? 2.897   20.620 0.718   1.00 20.82  ?  338  VAL A CG1    1 
ATOM   722  C  CG2    . VAL C 3 42  ? 5.411   20.607 0.733   1.00 21.41  ?  338  VAL A CG2    1 
ATOM   723  N  N      . ASN C 3 43  ? 2.054   22.843 -1.599  1.00 23.69  ?  339  ASN A N      1 
ATOM   724  C  CA     . ASN C 3 43  ? 0.784   23.519 -1.793  1.00 31.23  ?  339  ASN A CA     1 
ATOM   725  C  C      . ASN C 3 43  ? -0.202  22.513 -2.369  1.00 31.15  ?  339  ASN A C      1 
ATOM   726  O  O      . ASN C 3 43  ? 0.050   21.304 -2.382  1.00 30.34  ?  339  ASN A O      1 
ATOM   727  C  CB     . ASN C 3 43  ? 0.966   24.774 -2.664  1.00 24.91  ?  339  ASN A CB     1 
ATOM   728  C  CG     . ASN C 3 43  ? 1.492   24.463 -4.057  1.00 32.56  ?  339  ASN A CG     1 
ATOM   729  O  OD1    . ASN C 3 43  ? 1.244   23.389 -4.608  1.00 24.00  ?  339  ASN A OD1    1 
ATOM   730  N  ND2    . ASN C 3 43  ? 2.218   25.414 -4.637  1.00 31.64  ?  339  ASN A ND2    1 
ATOM   731  N  N      . GLU C 3 44  ? -1.341  23.017 -2.839  1.00 37.76  ?  340  GLU A N      1 
ATOM   732  C  CA     . GLU C 3 44  ? -2.365  22.142 -3.388  1.00 35.29  ?  340  GLU A CA     1 
ATOM   733  C  C      . GLU C 3 44  ? -1.870  21.365 -4.598  1.00 35.70  ?  340  GLU A C      1 
ATOM   734  O  O      . GLU C 3 44  ? -2.428  20.307 -4.911  1.00 28.71  ?  340  GLU A O      1 
ATOM   735  C  CB     . GLU C 3 44  ? -3.597  22.963 -3.767  1.00 60.99  ?  340  GLU A CB     1 
ATOM   736  C  CG     . GLU C 3 44  ? -3.930  24.051 -2.760  1.00 86.35  ?  340  GLU A CG     1 
ATOM   737  C  CD     . GLU C 3 44  ? -5.253  24.731 -3.043  1.00 102.02 ?  340  GLU A CD     1 
ATOM   738  O  OE1    . GLU C 3 44  ? -5.716  24.686 -4.204  1.00 104.40 ?  340  GLU A OE1    1 
ATOM   739  O  OE2    . GLU C 3 44  ? -5.832  25.307 -2.098  1.00 103.91 ?  340  GLU A OE2    1 
ATOM   740  N  N      . HIS C 3 45  ? -0.837  21.861 -5.282  1.00 29.65  ?  341  HIS A N      1 
ATOM   741  C  CA     . HIS C 3 45  ? -0.399  21.287 -6.547  1.00 28.21  ?  341  HIS A CA     1 
ATOM   742  C  C      . HIS C 3 45  ? 0.756   20.308 -6.406  1.00 35.14  ?  341  HIS A C      1 
ATOM   743  O  O      . HIS C 3 45  ? 0.998   19.530 -7.334  1.00 40.33  ?  341  HIS A O      1 
ATOM   744  C  CB     . HIS C 3 45  ? 0.008   22.397 -7.522  1.00 34.44  ?  341  HIS A CB     1 
ATOM   745  C  CG     . HIS C 3 45  ? -1.046  23.437 -7.726  1.00 43.98  ?  341  HIS A CG     1 
ATOM   746  N  ND1    . HIS C 3 45  ? -2.265  23.157 -8.306  1.00 46.03  ?  341  HIS A ND1    1 
ATOM   747  C  CD2    . HIS C 3 45  ? -1.064  24.759 -7.432  1.00 40.80  ?  341  HIS A CD2    1 
ATOM   748  C  CE1    . HIS C 3 45  ? -2.989  24.261 -8.359  1.00 46.34  ?  341  HIS A CE1    1 
ATOM   749  N  NE2    . HIS C 3 45  ? -2.283  25.247 -7.836  1.00 47.10  ?  341  HIS A NE2    1 
ATOM   750  N  N      . GLY C 3 46  ? 1.478   20.328 -5.295  1.00 38.48  ?  342  GLY A N      1 
ATOM   751  C  CA     . GLY C 3 46  ? 2.505   19.339 -5.072  1.00 32.08  ?  342  GLY A CA     1 
ATOM   752  C  C      . GLY C 3 46  ? 3.542   19.850 -4.095  1.00 33.21  ?  342  GLY A C      1 
ATOM   753  O  O      . GLY C 3 46  ? 3.307   20.799 -3.350  1.00 30.48  ?  342  GLY A O      1 
ATOM   754  N  N      . ARG C 3 47  ? 4.696   19.187 -4.115  1.00 29.09  ?  343  ARG A N      1 
ATOM   755  C  CA     . ARG C 3 47  ? 5.811   19.502 -3.238  1.00 33.63  ?  343  ARG A CA     1 
ATOM   756  C  C      . ARG C 3 47  ? 7.013   19.836 -4.103  1.00 36.33  ?  343  ARG A C      1 
ATOM   757  O  O      . ARG C 3 47  ? 7.305   19.120 -5.065  1.00 32.17  ?  343  ARG A O      1 
ATOM   758  C  CB     . ARG C 3 47  ? 6.115   18.326 -2.313  1.00 29.23  ?  343  ARG A CB     1 
ATOM   759  C  CG     . ARG C 3 47  ? 4.867   17.618 -1.831  1.00 31.50  ?  343  ARG A CG     1 
ATOM   760  C  CD     . ARG C 3 47  ? 5.188   16.579 -0.789  1.00 34.65  ?  343  ARG A CD     1 
ATOM   761  N  NE     . ARG C 3 47  ? 3.975   15.943 -0.293  1.00 45.09  ?  343  ARG A NE     1 
ATOM   762  C  CZ     . ARG C 3 47  ? 3.458   14.832 -0.804  1.00 47.09  ?  343  ARG A CZ     1 
ATOM   763  N  NH1    . ARG C 3 47  ? 4.056   14.232 -1.824  1.00 43.34  ?  343  ARG A NH1    1 
ATOM   764  N  NH2    . ARG C 3 47  ? 2.347   14.321 -0.294  1.00 49.59  ?  343  ARG A NH2    1 
ATOM   765  N  N      . PHE C 3 48  ? 7.700   20.924 -3.775  1.00 28.31  ?  344  PHE A N      1 
ATOM   766  C  CA     . PHE C 3 48  ? 8.770   21.418 -4.625  1.00 29.50  ?  344  PHE A CA     1 
ATOM   767  C  C      . PHE C 3 48  ? 10.000  21.742 -3.797  1.00 29.55  ?  344  PHE A C      1 
ATOM   768  O  O      . PHE C 3 48  ? 9.896   22.282 -2.694  1.00 24.67  ?  344  PHE A O      1 
ATOM   769  C  CB     . PHE C 3 48  ? 8.326   22.662 -5.397  1.00 30.92  ?  344  PHE A CB     1 
ATOM   770  C  CG     . PHE C 3 48  ? 7.039   22.481 -6.138  1.00 30.40  ?  344  PHE A CG     1 
ATOM   771  C  CD1    . PHE C 3 48  ? 5.836   22.849 -5.558  1.00 26.23  ?  344  PHE A CD1    1 
ATOM   772  C  CD2    . PHE C 3 48  ? 7.028   21.932 -7.410  1.00 33.34  ?  344  PHE A CD2    1 
ATOM   773  C  CE1    . PHE C 3 48  ? 4.645   22.678 -6.243  1.00 32.69  ?  344  PHE A CE1    1 
ATOM   774  C  CE2    . PHE C 3 48  ? 5.843   21.761 -8.095  1.00 35.37  ?  344  PHE A CE2    1 
ATOM   775  C  CZ     . PHE C 3 48  ? 4.651   22.134 -7.509  1.00 36.31  ?  344  PHE A CZ     1 
ATOM   776  N  N      . PHE C 3 49  ? 11.165  21.395 -4.329  1.00 28.20  ?  345  PHE A N      1 
ATOM   777  C  CA     . PHE C 3 49  ? 12.427  21.898 -3.817  1.00 29.60  ?  345  PHE A CA     1 
ATOM   778  C  C      . PHE C 3 49  ? 13.015  22.832 -4.860  1.00 31.20  ?  345  PHE A C      1 
ATOM   779  O  O      . PHE C 3 49  ? 13.111  22.474 -6.038  1.00 33.90  ?  345  PHE A O      1 
ATOM   780  C  CB     . PHE C 3 49  ? 13.409  20.772 -3.489  1.00 26.73  ?  345  PHE A CB     1 
ATOM   781  C  CG     . PHE C 3 49  ? 14.762  21.266 -3.069  1.00 30.50  ?  345  PHE A CG     1 
ATOM   782  C  CD1    . PHE C 3 49  ? 15.025  21.579 -1.741  1.00 26.87  ?  345  PHE A CD1    1 
ATOM   783  C  CD2    . PHE C 3 49  ? 15.766  21.442 -4.004  1.00 29.93  ?  345  PHE A CD2    1 
ATOM   784  C  CE1    . PHE C 3 49  ? 16.272  22.042 -1.358  1.00 33.55  ?  345  PHE A CE1    1 
ATOM   785  C  CE2    . PHE C 3 49  ? 17.013  21.908 -3.631  1.00 29.83  ?  345  PHE A CE2    1 
ATOM   786  C  CZ     . PHE C 3 49  ? 17.269  22.208 -2.309  1.00 31.48  ?  345  PHE A CZ     1 
ATOM   787  N  N      . LEU C 3 50  ? 13.383  24.030 -4.427  1.00 28.02  ?  346  LEU A N      1 
ATOM   788  C  CA     . LEU C 3 50  ? 13.962  25.041 -5.296  1.00 31.42  ?  346  LEU A CA     1 
ATOM   789  C  C      . LEU C 3 50  ? 15.343  25.391 -4.773  1.00 30.74  ?  346  LEU A C      1 
ATOM   790  O  O      . LEU C 3 50  ? 15.505  25.666 -3.580  1.00 28.59  ?  346  LEU A O      1 
ATOM   791  C  CB     . LEU C 3 50  ? 13.076  26.287 -5.352  1.00 34.80  ?  346  LEU A CB     1 
ATOM   792  C  CG     . LEU C 3 50  ? 11.732  26.081 -6.045  1.00 41.81  ?  346  LEU A CG     1 
ATOM   793  C  CD1    . LEU C 3 50  ? 10.717  27.097 -5.552  1.00 40.25  ?  346  LEU A CD1    1 
ATOM   794  C  CD2    . LEU C 3 50  ? 11.921  26.191 -7.545  1.00 45.38  ?  346  LEU A CD2    1 
ATOM   795  N  N      . ARG C 3 51  ? 16.335  25.345 -5.654  1.00 30.06  ?  347  ARG A N      1 
ATOM   796  C  CA     . ARG C 3 51  ? 17.657  25.816 -5.289  1.00 32.85  ?  347  ARG A CA     1 
ATOM   797  C  C      . ARG C 3 51  ? 17.604  27.320 -5.034  1.00 30.96  ?  347  ARG A C      1 
ATOM   798  O  O      . ARG C 3 51  ? 16.938  28.050 -5.776  1.00 29.98  ?  347  ARG A O      1 
ATOM   799  C  CB     . ARG C 3 51  ? 18.666  25.496 -6.390  1.00 38.64  ?  347  ARG A CB     1 
ATOM   800  C  CG     . ARG C 3 51  ? 19.254  24.099 -6.279  1.00 39.75  ?  347  ARG A CG     1 
ATOM   801  C  CD     . ARG C 3 51  ? 19.999  23.704 -7.542  1.00 48.70  ?  347  ARG A CD     1 
ATOM   802  N  NE     . ARG C 3 51  ? 19.082  23.408 -8.639  1.00 60.76  ?  347  ARG A NE     1 
ATOM   803  C  CZ     . ARG C 3 51  ? 18.665  22.187 -8.958  1.00 60.59  ?  347  ARG A CZ     1 
ATOM   804  N  NH1    . ARG C 3 51  ? 19.085  21.136 -8.266  1.00 50.61  ?  347  ARG A NH1    1 
ATOM   805  N  NH2    . ARG C 3 51  ? 17.829  22.015 -9.971  1.00 62.15  ?  347  ARG A NH2    1 
ATOM   806  N  N      . PRO C 3 52  ? 18.288  27.811 -3.995  1.00 31.43  ?  348  PRO A N      1 
ATOM   807  C  CA     . PRO C 3 52  ? 18.134  29.233 -3.638  1.00 42.90  ?  348  PRO A CA     1 
ATOM   808  C  C      . PRO C 3 52  ? 18.587  30.181 -4.732  1.00 42.50  ?  348  PRO A C      1 
ATOM   809  O  O      . PRO C 3 52  ? 17.890  31.161 -5.023  1.00 37.20  ?  348  PRO A O      1 
ATOM   810  C  CB     . PRO C 3 52  ? 18.989  29.365 -2.368  1.00 47.40  ?  348  PRO A CB     1 
ATOM   811  C  CG     . PRO C 3 52  ? 20.003  28.284 -2.488  1.00 47.83  ?  348  PRO A CG     1 
ATOM   812  C  CD     . PRO C 3 52  ? 19.276  27.134 -3.139  1.00 37.64  ?  348  PRO A CD     1 
ATOM   813  N  N      . GLU C 3 53  ? 19.746  29.926 -5.344  1.00 41.81  ?  349  GLU A N      1 
ATOM   814  C  CA     . GLU C 3 53  ? 20.254  30.794 -6.402  1.00 49.48  ?  349  GLU A CA     1 
ATOM   815  C  C      . GLU C 3 53  ? 19.518  30.511 -7.704  1.00 55.05  ?  349  GLU A C      1 
ATOM   816  O  O      . GLU C 3 53  ? 20.124  30.320 -8.763  1.00 67.08  ?  349  GLU A O      1 
ATOM   817  C  CB     . GLU C 3 53  ? 21.766  30.621 -6.565  1.00 59.76  ?  349  GLU A CB     1 
ATOM   818  C  CG     . GLU C 3 53  ? 22.564  31.270 -5.439  1.00 82.83  ?  349  GLU A CG     1 
ATOM   819  C  CD     . GLU C 3 53  ? 23.885  30.572 -5.163  1.00 106.12 ?  349  GLU A CD     1 
ATOM   820  O  OE1    . GLU C 3 53  ? 24.186  29.563 -5.835  1.00 113.81 ?  349  GLU A OE1    1 
ATOM   821  O  OE2    . GLU C 3 53  ? 24.623  31.032 -4.264  1.00 112.21 ?  349  GLU A OE2    1 
ATOM   822  N  N      . THR C 3 54  ? 18.195  30.478 -7.614  1.00 52.81  ?  350  THR A N      1 
ATOM   823  C  CA     . THR C 3 54  ? 17.321  30.284 -8.757  1.00 49.92  ?  350  THR A CA     1 
ATOM   824  C  C      . THR C 3 54  ? 15.993  30.933 -8.423  1.00 40.59  ?  350  THR A C      1 
ATOM   825  O  O      . THR C 3 54  ? 15.545  31.851 -9.115  1.00 33.34  ?  350  THR A O      1 
ATOM   826  C  CB     . THR C 3 54  ? 17.129  28.801 -9.066  1.00 52.12  ?  350  THR A CB     1 
ATOM   827  O  OG1    . THR C 3 54  ? 18.305  28.286 -9.701  1.00 67.82  ?  350  THR A OG1    1 
ATOM   828  C  CG2    . THR C 3 54  ? 15.925  28.594 -9.973  1.00 44.25  ?  350  THR A CG2    1 
ATOM   829  N  N      . ALA C 3 55  ? 15.376  30.466 -7.338  1.00 30.82  ?  351  ALA A N      1 
ATOM   830  C  CA     . ALA C 3 55  ? 14.121  31.054 -6.892  1.00 36.90  ?  351  ALA A CA     1 
ATOM   831  C  C      . ALA C 3 55  ? 14.316  32.505 -6.482  1.00 31.77  ?  351  ALA A C      1 
ATOM   832  O  O      . ALA C 3 55  ? 13.517  33.377 -6.839  1.00 32.80  ?  351  ALA A O      1 
ATOM   833  C  CB     . ALA C 3 55  ? 13.543  30.237 -5.736  1.00 37.54  ?  351  ALA A CB     1 
ATOM   834  N  N      . LEU C 3 56  ? 15.380  32.786 -5.728  1.00 32.52  ?  352  LEU A N      1 
ATOM   835  C  CA     . LEU C 3 56  ? 15.595  34.135 -5.218  1.00 39.82  ?  352  LEU A CA     1 
ATOM   836  C  C      . LEU C 3 56  ? 15.998  35.124 -6.306  1.00 45.83  ?  352  LEU A C      1 
ATOM   837  O  O      . LEU C 3 56  ? 15.945  36.336 -6.067  1.00 51.95  ?  352  LEU A O      1 
ATOM   838  C  CB     . LEU C 3 56  ? 16.645  34.107 -4.107  1.00 36.15  ?  352  LEU A CB     1 
ATOM   839  C  CG     . LEU C 3 56  ? 16.226  33.344 -2.846  1.00 38.76  ?  352  LEU A CG     1 
ATOM   840  C  CD1    . LEU C 3 56  ? 17.257  33.512 -1.743  1.00 39.35  ?  352  LEU A CD1    1 
ATOM   841  C  CD2    . LEU C 3 56  ? 14.853  33.798 -2.368  1.00 32.27  ?  352  LEU A CD2    1 
ATOM   842  N  N      . ALA C 3 57  ? 16.394  34.647 -7.484  1.00 38.25  ?  353  ALA A N      1 
ATOM   843  C  CA     . ALA C 3 57  ? 16.635  35.504 -8.635  1.00 46.03  ?  353  ALA A CA     1 
ATOM   844  C  C      . ALA C 3 57  ? 15.475  35.484 -9.621  1.00 45.40  ?  353  ALA A C      1 
ATOM   845  O  O      . ALA C 3 57  ? 15.574  36.086 -10.693 1.00 49.83  ?  353  ALA A O      1 
ATOM   846  C  CB     . ALA C 3 57  ? 17.927  35.093 -9.345  1.00 47.80  ?  353  ALA A CB     1 
ATOM   847  N  N      . ASP C 3 58  ? 14.381  34.803 -9.281  1.00 43.76  ?  354  ASP A N      1 
ATOM   848  C  CA     . ASP C 3 58  ? 13.229  34.704 -10.167 1.00 49.78  ?  354  ASP A CA     1 
ATOM   849  C  C      . ASP C 3 58  ? 12.230  35.792 -9.799  1.00 42.91  ?  354  ASP A C      1 
ATOM   850  O  O      . ASP C 3 58  ? 11.682  35.760 -8.687  1.00 35.03  ?  354  ASP A O      1 
ATOM   851  C  CB     . ASP C 3 58  ? 12.584  33.330 -10.055 1.00 49.10  ?  354  ASP A CB     1 
ATOM   852  C  CG     . ASP C 3 58  ? 11.381  33.175 -10.963 1.00 59.26  ?  354  ASP A CG     1 
ATOM   853  O  OD1    . ASP C 3 58  ? 11.558  32.743 -12.121 1.00 68.46  ?  354  ASP A OD1    1 
ATOM   854  O  OD2    . ASP C 3 58  ? 10.258  33.490 -10.518 1.00 61.91  ?  354  ASP A OD2    1 
ATOM   855  N  N      . PRO C 3 59  ? 11.964  36.763 -10.672 1.00 42.55  ?  355  PRO A N      1 
ATOM   856  C  CA     . PRO C 3 59  ? 11.016  37.829 -10.302 1.00 39.65  ?  355  PRO A CA     1 
ATOM   857  C  C      . PRO C 3 59  ? 9.659   37.311 -9.851  1.00 38.83  ?  355  PRO A C      1 
ATOM   858  O  O      . PRO C 3 59  ? 9.073   37.873 -8.918  1.00 40.54  ?  355  PRO A O      1 
ATOM   859  C  CB     . PRO C 3 59  ? 10.914  38.669 -11.587 1.00 42.06  ?  355  PRO A CB     1 
ATOM   860  C  CG     . PRO C 3 59  ? 11.497  37.816 -12.673 1.00 43.42  ?  355  PRO A CG     1 
ATOM   861  C  CD     . PRO C 3 59  ? 12.530  36.966 -12.015 1.00 46.29  ?  355  PRO A CD     1 
ATOM   862  N  N      . GLN C 3 60  ? 9.141   36.253 -10.483 1.00 39.73  ?  356  GLN A N      1 
ATOM   863  C  CA     . GLN C 3 60  ? 7.830   35.737 -10.097 1.00 39.35  ?  356  GLN A CA     1 
ATOM   864  C  C      . GLN C 3 60  ? 7.854   35.154 -8.689  1.00 38.31  ?  356  GLN A C      1 
ATOM   865  O  O      . GLN C 3 60  ? 6.894   35.317 -7.927  1.00 39.51  ?  356  GLN A O      1 
ATOM   866  C  CB     . GLN C 3 60  ? 7.351   34.684 -11.100 1.00 40.20  ?  356  GLN A CB     1 
ATOM   867  C  CG     . GLN C 3 60  ? 6.944   35.238 -12.461 1.00 55.72  ?  356  GLN A CG     1 
ATOM   868  C  CD     . GLN C 3 60  ? 8.133   35.599 -13.329 1.00 71.76  ?  356  GLN A CD     1 
ATOM   869  O  OE1    . GLN C 3 60  ? 9.237   35.087 -13.136 1.00 69.85  ?  356  GLN A OE1    1 
ATOM   870  N  NE2    . GLN C 3 60  ? 7.914   36.486 -14.294 1.00 82.66  ?  356  GLN A NE2    1 
ATOM   871  N  N      . PHE C 3 61  ? 8.935   34.464 -8.327  1.00 30.25  ?  357  PHE A N      1 
ATOM   872  C  CA     . PHE C 3 61  ? 9.022   33.901 -6.985  1.00 23.04  ?  357  PHE A CA     1 
ATOM   873  C  C      . PHE C 3 61  ? 9.174   34.997 -5.938  1.00 32.17  ?  357  PHE A C      1 
ATOM   874  O  O      . PHE C 3 61  ? 8.508   34.971 -4.896  1.00 23.07  ?  357  PHE A O      1 
ATOM   875  C  CB     . PHE C 3 61  ? 10.182  32.911 -6.899  1.00 28.90  ?  357  PHE A CB     1 
ATOM   876  C  CG     . PHE C 3 61  ? 10.217  32.146 -5.613  1.00 33.03  ?  357  PHE A CG     1 
ATOM   877  C  CD1    . PHE C 3 61  ? 9.384   31.058 -5.426  1.00 34.74  ?  357  PHE A CD1    1 
ATOM   878  C  CD2    . PHE C 3 61  ? 11.061  32.526 -4.583  1.00 26.29  ?  357  PHE A CD2    1 
ATOM   879  C  CE1    . PHE C 3 61  ? 9.398   30.351 -4.239  1.00 32.70  ?  357  PHE A CE1    1 
ATOM   880  C  CE2    . PHE C 3 61  ? 11.082  31.822 -3.394  1.00 30.84  ?  357  PHE A CE2    1 
ATOM   881  C  CZ     . PHE C 3 61  ? 10.247  30.731 -3.223  1.00 20.77  ?  357  PHE A CZ     1 
ATOM   882  N  N      . VAL C 3 62  ? 10.052  35.967 -6.196  1.00 34.68  ?  358  VAL A N      1 
ATOM   883  C  CA     . VAL C 3 62  ? 10.227  37.079 -5.266  1.00 36.53  ?  358  VAL A CA     1 
ATOM   884  C  C      . VAL C 3 62  ? 8.921   37.848 -5.106  1.00 33.30  ?  358  VAL A C      1 
ATOM   885  O  O      . VAL C 3 62  ? 8.532   38.225 -3.993  1.00 33.56  ?  358  VAL A O      1 
ATOM   886  C  CB     . VAL C 3 62  ? 11.368  37.999 -5.737  1.00 39.43  ?  358  VAL A CB     1 
ATOM   887  C  CG1    . VAL C 3 62  ? 11.403  39.265 -4.898  1.00 32.94  ?  358  VAL A CG1    1 
ATOM   888  C  CG2    . VAL C 3 62  ? 12.700  37.271 -5.663  1.00 44.07  ?  358  VAL A CG2    1 
ATOM   889  N  N      . ALA C 3 63  ? 8.231   38.105 -6.219  1.00 30.46  ?  359  ALA A N      1 
ATOM   890  C  CA     . ALA C 3 63  ? 6.937   38.775 -6.136  1.00 27.37  ?  359  ALA A CA     1 
ATOM   891  C  C      . ALA C 3 63  ? 5.970   37.968 -5.282  1.00 35.05  ?  359  ALA A C      1 
ATOM   892  O  O      . ALA C 3 63  ? 5.241   38.527 -4.454  1.00 28.55  ?  359  ALA A O      1 
ATOM   893  C  CB     . ALA C 3 63  ? 6.368   39.003 -7.538  1.00 35.88  ?  359  ALA A CB     1 
ATOM   894  N  N      . TRP C 3 64  ? 5.965   36.646 -5.457  1.00 31.64  ?  360  TRP A N      1 
ATOM   895  C  CA     . TRP C 3 64  ? 5.121   35.784 -4.637  1.00 28.74  ?  360  TRP A CA     1 
ATOM   896  C  C      . TRP C 3 64  ? 5.529   35.838 -3.166  1.00 31.14  ?  360  TRP A C      1 
ATOM   897  O  O      . TRP C 3 64  ? 4.667   35.882 -2.279  1.00 28.76  ?  360  TRP A O      1 
ATOM   898  C  CB     . TRP C 3 64  ? 5.181   34.356 -5.180  1.00 25.13  ?  360  TRP A CB     1 
ATOM   899  C  CG     . TRP C 3 64  ? 4.457   33.353 -4.357  1.00 32.51  ?  360  TRP A CG     1 
ATOM   900  C  CD1    . TRP C 3 64  ? 3.127   33.054 -4.409  1.00 25.38  ?  360  TRP A CD1    1 
ATOM   901  C  CD2    . TRP C 3 64  ? 5.025   32.497 -3.363  1.00 31.36  ?  360  TRP A CD2    1 
ATOM   902  N  NE1    . TRP C 3 64  ? 2.830   32.068 -3.499  1.00 27.07  ?  360  TRP A NE1    1 
ATOM   903  C  CE2    . TRP C 3 64  ? 3.979   31.710 -2.843  1.00 30.29  ?  360  TRP A CE2    1 
ATOM   904  C  CE3    . TRP C 3 64  ? 6.315   32.325 -2.856  1.00 26.74  ?  360  TRP A CE3    1 
ATOM   905  C  CZ2    . TRP C 3 64  ? 4.185   30.761 -1.846  1.00 24.83  ?  360  TRP A CZ2    1 
ATOM   906  C  CZ3    . TRP C 3 64  ? 6.518   31.384 -1.867  1.00 30.79  ?  360  TRP A CZ3    1 
ATOM   907  C  CH2    . TRP C 3 64  ? 5.458   30.613 -1.372  1.00 25.04  ?  360  TRP A CH2    1 
ATOM   908  N  N      . LEU C 3 65  ? 6.835   35.845 -2.886  1.00 24.48  ?  361  LEU A N      1 
ATOM   909  C  CA     . LEU C 3 65  ? 7.293   35.946 -1.502  1.00 23.44  ?  361  LEU A CA     1 
ATOM   910  C  C      . LEU C 3 65  ? 6.756   37.198 -0.827  1.00 29.51  ?  361  LEU A C      1 
ATOM   911  O  O      . LEU C 3 65  ? 6.403   37.172 0.359   1.00 22.08  ?  361  LEU A O      1 
ATOM   912  C  CB     . LEU C 3 65  ? 8.820   35.949 -1.446  1.00 20.36  ?  361  LEU A CB     1 
ATOM   913  C  CG     . LEU C 3 65  ? 9.514   34.606 -1.626  1.00 28.29  ?  361  LEU A CG     1 
ATOM   914  C  CD1    . LEU C 3 65  ? 11.025  34.809 -1.620  1.00 27.62  ?  361  LEU A CD1    1 
ATOM   915  C  CD2    . LEU C 3 65  ? 9.078   33.647 -0.524  1.00 15.96  ?  361  LEU A CD2    1 
ATOM   916  N  N      . GLY C 3 66  ? 6.706   38.309 -1.557  1.00 24.58  ?  362  GLY A N      1 
ATOM   917  C  CA     . GLY C 3 66  ? 6.326   39.586 -1.000  1.00 36.68  ?  362  GLY A CA     1 
ATOM   918  C  C      . GLY C 3 66  ? 4.867   39.948 -1.112  1.00 36.70  ?  362  GLY A C      1 
ATOM   919  O  O      . GLY C 3 66  ? 4.474   41.036 -0.679  1.00 30.67  ?  362  GLY A O      1 
ATOM   920  N  N      . ASP C 3 67  ? 4.039   39.077 -1.679  1.00 30.85  ?  363  ASP A N      1 
ATOM   921  C  CA     . ASP C 3 67  ? 2.616   39.355 -1.832  1.00 31.26  ?  363  ASP A CA     1 
ATOM   922  C  C      . ASP C 3 67  ? 1.898   38.944 -0.550  1.00 35.73  ?  363  ASP A C      1 
ATOM   923  O  O      . ASP C 3 67  ? 1.853   37.759 -0.203  1.00 38.91  ?  363  ASP A O      1 
ATOM   924  C  CB     . ASP C 3 67  ? 2.055   38.632 -3.054  1.00 31.59  ?  363  ASP A CB     1 
ATOM   925  C  CG     . ASP C 3 67  ? 0.615   39.004 -3.343  1.00 38.01  ?  363  ASP A CG     1 
ATOM   926  O  OD1    . ASP C 3 67  ? -0.012  39.672 -2.494  1.00 43.32  ?  363  ASP A OD1    1 
ATOM   927  O  OD2    . ASP C 3 67  ? 0.111   38.629 -4.422  1.00 45.21  ?  363  ASP A OD2    1 
ATOM   928  N  N      . GLU C 3 68  ? 1.340   39.934 0.154   1.00 31.00  ?  364  GLU A N      1 
ATOM   929  C  CA     . GLU C 3 68  ? 0.607   39.667 1.388   1.00 35.43  ?  364  GLU A CA     1 
ATOM   930  C  C      . GLU C 3 68  ? -0.598  38.767 1.154   1.00 34.82  ?  364  GLU A C      1 
ATOM   931  O  O      . GLU C 3 68  ? -1.023  38.053 2.067   1.00 40.32  ?  364  GLU A O      1 
ATOM   932  C  CB     . GLU C 3 68  ? 0.162   40.988 2.019   1.00 48.56  ?  364  GLU A CB     1 
ATOM   933  C  CG     . GLU C 3 68  ? -1.016  40.871 2.976   1.00 64.56  ?  364  GLU A CG     1 
ATOM   934  C  CD     . GLU C 3 68  ? -0.637  40.244 4.304   1.00 76.22  ?  364  GLU A CD     1 
ATOM   935  O  OE1    . GLU C 3 68  ? 0.561   39.951 4.508   1.00 79.00  ?  364  GLU A OE1    1 
ATOM   936  O  OE2    . GLU C 3 68  ? -1.540  40.049 5.146   1.00 79.93  ?  364  GLU A OE2    1 
ATOM   937  N  N      . THR C 3 69  ? -1.174  38.794 -0.048  1.00 39.81  ?  365  THR A N      1 
ATOM   938  C  CA     . THR C 3 69  ? -2.362  37.996 -0.317  1.00 34.37  ?  365  THR A CA     1 
ATOM   939  C  C      . THR C 3 69  ? -2.052  36.522 -0.546  1.00 34.88  ?  365  THR A C      1 
ATOM   940  O  O      . THR C 3 69  ? -2.978  35.702 -0.535  1.00 37.86  ?  365  THR A O      1 
ATOM   941  C  CB     . THR C 3 69  ? -3.113  38.557 -1.526  1.00 37.68  ?  365  THR A CB     1 
ATOM   942  O  OG1    . THR C 3 69  ? -2.400  38.235 -2.726  1.00 47.29  ?  365  THR A OG1    1 
ATOM   943  C  CG2    . THR C 3 69  ? -3.240  40.070 -1.411  1.00 32.13  ?  365  THR A CG2    1 
ATOM   944  N  N      . LYS C 3 70  ? -0.787  36.164 -0.746  1.00 30.17  ?  366  LYS A N      1 
ATOM   945  C  CA     . LYS C 3 70  ? -0.378  34.774 -0.915  1.00 31.59  ?  366  LYS A CA     1 
ATOM   946  C  C      . LYS C 3 70  ? 0.075   34.261 0.448   1.00 29.42  ?  366  LYS A C      1 
ATOM   947  O  O      . LYS C 3 70  ? 1.128   34.666 0.956   1.00 23.67  ?  366  LYS A O      1 
ATOM   948  C  CB     . LYS C 3 70  ? 0.722   34.660 -1.970  1.00 32.74  ?  366  LYS A CB     1 
ATOM   949  C  CG     . LYS C 3 70  ? 0.348   35.275 -3.327  1.00 31.71  ?  366  LYS A CG     1 
ATOM   950  C  CD     . LYS C 3 70  ? -0.624  34.387 -4.108  1.00 33.95  ?  366  LYS A CD     1 
ATOM   951  C  CE     . LYS C 3 70  ? -1.016  34.993 -5.452  1.00 41.31  ?  366  LYS A CE     1 
ATOM   952  N  NZ     . LYS C 3 70  ? -2.081  36.026 -5.313  1.00 47.81  ?  366  LYS A NZ     1 
ATOM   953  N  N      . LYS C 3 71  ? -0.727  33.381 1.045   1.00 22.66  ?  367  LYS A N      1 
ATOM   954  C  CA     . LYS C 3 71  ? -0.531  32.989 2.435   1.00 25.21  ?  367  LYS A CA     1 
ATOM   955  C  C      . LYS C 3 71  ? 0.486   31.862 2.539   1.00 29.77  ?  367  LYS A C      1 
ATOM   956  O  O      . LYS C 3 71  ? 0.404   30.869 1.809   1.00 31.16  ?  367  LYS A O      1 
ATOM   957  C  CB     . LYS C 3 71  ? -1.859  32.559 3.055   1.00 26.12  ?  367  LYS A CB     1 
ATOM   958  C  CG     . LYS C 3 71  ? -2.939  33.620 2.949   1.00 24.17  ?  367  LYS A CG     1 
ATOM   959  C  CD     . LYS C 3 71  ? -2.461  34.936 3.548   1.00 29.71  ?  367  LYS A CD     1 
ATOM   960  C  CE     . LYS C 3 71  ? -3.524  36.018 3.428   1.00 40.21  ?  367  LYS A CE     1 
ATOM   961  N  NZ     . LYS C 3 71  ? -3.069  37.301 4.030   1.00 46.98  ?  367  LYS A NZ     1 
ATOM   962  N  N      . LYS C 3 72  ? 1.441   32.019 3.449   1.00 22.86  ?  368  LYS A N      1 
ATOM   963  C  CA     . LYS C 3 72  ? 2.476   31.026 3.680   1.00 23.57  ?  368  LYS A CA     1 
ATOM   964  C  C      . LYS C 3 72  ? 2.379   30.504 5.102   1.00 22.63  ?  368  LYS A C      1 
ATOM   965  O  O      . LYS C 3 72  ? 2.170   31.271 6.045   1.00 21.80  ?  368  LYS A O      1 
ATOM   966  C  CB     . LYS C 3 72  ? 3.873   31.598 3.449   1.00 25.87  ?  368  LYS A CB     1 
ATOM   967  C  CG     . LYS C 3 72  ? 4.142   32.069 2.028   1.00 27.43  ?  368  LYS A CG     1 
ATOM   968  C  CD     . LYS C 3 72  ? 3.848   33.541 1.885   1.00 26.99  ?  368  LYS A CD     1 
ATOM   969  C  CE     . LYS C 3 72  ? 4.125   34.035 0.476   1.00 27.51  ?  368  LYS A CE     1 
ATOM   970  N  NZ     . LYS C 3 72  ? 3.790   35.477 0.371   1.00 23.26  ?  368  LYS A NZ     1 
ATOM   971  N  N      . SER C 3 73  ? 2.523   29.197 5.249   1.00 17.19  ?  369  SER A N      1 
ATOM   972  C  CA     . SER C 3 73  ? 2.697   28.584 6.555   1.00 16.34  ?  369  SER A CA     1 
ATOM   973  C  C      . SER C 3 73  ? 4.162   28.212 6.707   1.00 16.70  ?  369  SER A C      1 
ATOM   974  O  O      . SER C 3 73  ? 4.762   27.653 5.783   1.00 20.69  ?  369  SER A O      1 
ATOM   975  C  CB     . SER C 3 73  ? 1.798   27.362 6.709   1.00 26.19  ?  369  SER A CB     1 
ATOM   976  O  OG     . SER C 3 73  ? 0.442   27.752 6.644   1.00 31.68  ?  369  SER A OG     1 
ATOM   977  N  N      . MET C 3 74  ? 4.749   28.560 7.850   1.00 15.62  ?  370  MET A N      1 
ATOM   978  C  CA     . MET C 3 74  ? 6.175   28.359 8.057   1.00 16.65  ?  370  MET A CA     1 
ATOM   979  C  C      . MET C 3 74  ? 6.443   27.945 9.495   1.00 9.04   ?  370  MET A C      1 
ATOM   980  O  O      . MET C 3 74  ? 5.555   27.951 10.354  1.00 25.03  ?  370  MET A O      1 
ATOM   981  C  CB     . MET C 3 74  ? 6.986   29.624 7.740   1.00 15.57  ?  370  MET A CB     1 
ATOM   982  C  CG     . MET C 3 74  ? 6.738   30.191 6.355   1.00 23.15  ?  370  MET A CG     1 
ATOM   983  S  SD     . MET C 3 74  ? 7.761   31.631 6.014   1.00 22.83  ?  370  MET A SD     1 
ATOM   984  C  CE     . MET C 3 74  ? 9.379   30.870 5.865   1.00 16.75  ?  370  MET A CE     1 
ATOM   985  N  N      . PHE C 3 75  ? 7.701   27.592 9.739   1.00 17.92  ?  371  PHE A N      1 
ATOM   986  C  CA     . PHE C 3 75  ? 8.248   27.398 11.074  1.00 14.63  ?  371  PHE A CA     1 
ATOM   987  C  C      . PHE C 3 75  ? 9.359   28.424 11.274  1.00 21.84  ?  371  PHE A C      1 
ATOM   988  O  O      . PHE C 3 75  ? 10.339  28.430 10.521  1.00 21.68  ?  371  PHE A O      1 
ATOM   989  C  CB     . PHE C 3 75  ? 8.774   25.967 11.229  1.00 13.93  ?  371  PHE A CB     1 
ATOM   990  C  CG     . PHE C 3 75  ? 9.337   25.673 12.582  1.00 22.44  ?  371  PHE A CG     1 
ATOM   991  C  CD1    . PHE C 3 75  ? 8.543   25.108 13.571  1.00 13.25  ?  371  PHE A CD1    1 
ATOM   992  C  CD2    . PHE C 3 75  ? 10.660  25.961 12.871  1.00 20.64  ?  371  PHE A CD2    1 
ATOM   993  C  CE1    . PHE C 3 75  ? 9.056   24.839 14.824  1.00 12.83  ?  371  PHE A CE1    1 
ATOM   994  C  CE2    . PHE C 3 75  ? 11.185  25.695 14.124  1.00 27.25  ?  371  PHE A CE2    1 
ATOM   995  C  CZ     . PHE C 3 75  ? 10.378  25.135 15.105  1.00 19.47  ?  371  PHE A CZ     1 
ATOM   996  N  N      . ASP C 3 76  ? 9.203   29.295 12.277  1.00 29.36  ?  372  ASP A N      1 
ATOM   997  C  CA     . ASP C 3 76  ? 10.169  30.362 12.584  1.00 32.50  ?  372  ASP A CA     1 
ATOM   998  C  C      . ASP C 3 76  ? 10.354  31.288 11.378  1.00 21.12  ?  372  ASP A C      1 
ATOM   999  O  O      . ASP C 3 76  ? 11.441  31.427 10.816  1.00 26.68  ?  372  ASP A O      1 
ATOM   1000 C  CB     . ASP C 3 76  ? 11.512  29.781 13.053  1.00 32.18  ?  372  ASP A CB     1 
ATOM   1001 C  CG     . ASP C 3 76  ? 12.445  30.840 13.690  1.00 37.27  ?  372  ASP A CG     1 
ATOM   1002 O  OD1    . ASP C 3 76  ? 12.094  32.042 13.734  1.00 24.94  ?  372  ASP A OD1    1 
ATOM   1003 O  OD2    . ASP C 3 76  ? 13.545  30.456 14.152  1.00 33.13  ?  372  ASP A OD2    1 
ATOM   1004 N  N      . SER C 3 77  ? 9.254   31.935 10.996  1.00 22.12  ?  373  SER A N      1 
ATOM   1005 C  CA     . SER C 3 77  ? 9.276   32.788 9.814   1.00 25.15  ?  373  SER A CA     1 
ATOM   1006 C  C      . SER C 3 77  ? 10.256  33.950 9.960   1.00 25.20  ?  373  SER A C      1 
ATOM   1007 O  O      . SER C 3 77  ? 10.777  34.443 8.954   1.00 25.39  ?  373  SER A O      1 
ATOM   1008 C  CB     . SER C 3 77  ? 7.868   33.302 9.524   1.00 25.23  ?  373  SER A CB     1 
ATOM   1009 O  OG     . SER C 3 77  ? 7.289   33.867 10.688  1.00 30.18  ?  373  SER A OG     1 
ATOM   1010 N  N      . LYS C 3 78  ? 10.535  34.387 11.194  1.00 23.63  ?  374  LYS A N      1 
ATOM   1011 C  CA     . LYS C 3 78  ? 11.436  35.521 11.392  1.00 16.82  ?  374  LYS A CA     1 
ATOM   1012 C  C      . LYS C 3 78  ? 12.854  35.197 10.935  1.00 24.82  ?  374  LYS A C      1 
ATOM   1013 O  O      . LYS C 3 78  ? 13.555  36.065 10.401  1.00 18.72  ?  374  LYS A O      1 
ATOM   1014 C  CB     . LYS C 3 78  ? 11.431  35.959 12.859  1.00 22.71  ?  374  LYS A CB     1 
ATOM   1015 C  CG     . LYS C 3 78  ? 12.522  36.966 13.206  1.00 16.96  ?  374  LYS A CG     1 
ATOM   1016 C  CD     . LYS C 3 78  ? 12.240  37.720 14.507  1.00 21.52  ?  374  LYS A CD     1 
ATOM   1017 C  CE     . LYS C 3 78  ? 12.444  36.848 15.748  1.00 20.80  ?  374  LYS A CE     1 
ATOM   1018 N  NZ     . LYS C 3 78  ? 13.855  36.381 15.900  1.00 18.86  ?  374  LYS A NZ     1 
ATOM   1019 N  N      . ARG C 3 79  ? 13.306  33.963 11.164  1.00 18.77  ?  375  ARG A N      1 
ATOM   1020 C  CA     . ARG C 3 79  ? 14.605  33.545 10.651  1.00 22.40  ?  375  ARG A CA     1 
ATOM   1021 C  C      . ARG C 3 79  ? 14.684  33.758 9.145   1.00 19.20  ?  375  ARG A C      1 
ATOM   1022 O  O      . ARG C 3 79  ? 15.628  34.376 8.639   1.00 16.25  ?  375  ARG A O      1 
ATOM   1023 C  CB     . ARG C 3 79  ? 14.851  32.079 11.012  1.00 29.18  ?  375  ARG A CB     1 
ATOM   1024 C  CG     . ARG C 3 79  ? 15.961  31.390 10.231  1.00 20.21  ?  375  ARG A CG     1 
ATOM   1025 C  CD     . ARG C 3 79  ? 16.227  29.988 10.804  1.00 25.03  ?  375  ARG A CD     1 
ATOM   1026 N  NE     . ARG C 3 79  ? 16.758  30.097 12.155  1.00 28.89  ?  375  ARG A NE     1 
ATOM   1027 C  CZ     . ARG C 3 79  ? 18.054  30.133 12.445  1.00 30.35  ?  375  ARG A CZ     1 
ATOM   1028 N  NH1    . ARG C 3 79  ? 18.960  30.041 11.477  1.00 20.41  ?  375  ARG A NH1    1 
ATOM   1029 N  NH2    . ARG C 3 79  ? 18.449  30.253 13.702  1.00 29.09  ?  375  ARG A NH2    1 
ATOM   1030 N  N      . ALA C 3 80  ? 13.691  33.250 8.415   1.00 17.15  ?  376  ALA A N      1 
ATOM   1031 C  CA     . ALA C 3 80  ? 13.662  33.412 6.966   1.00 24.28  ?  376  ALA A CA     1 
ATOM   1032 C  C      . ALA C 3 80  ? 13.441  34.866 6.576   1.00 19.91  ?  376  ALA A C      1 
ATOM   1033 O  O      . ALA C 3 80  ? 14.116  35.384 5.679   1.00 20.60  ?  376  ALA A O      1 
ATOM   1034 C  CB     . ALA C 3 80  ? 12.568  32.527 6.372   1.00 18.75  ?  376  ALA A CB     1 
ATOM   1035 N  N      . ALA C 3 81  ? 12.494  35.539 7.234   1.00 21.77  ?  377  ALA A N      1 
ATOM   1036 C  CA     . ALA C 3 81  ? 12.233  36.946 6.947   1.00 24.74  ?  377  ALA A CA     1 
ATOM   1037 C  C      . ALA C 3 81  ? 13.509  37.774 7.021   1.00 15.50  ?  377  ALA A C      1 
ATOM   1038 O  O      . ALA C 3 81  ? 13.767  38.625 6.161   1.00 17.98  ?  377  ALA A O      1 
ATOM   1039 C  CB     . ALA C 3 81  ? 11.189  37.496 7.922   1.00 19.25  ?  377  ALA A CB     1 
ATOM   1040 N  N      . VAL C 3 82  ? 14.319  37.543 8.053   1.00 13.55  ?  378  VAL A N      1 
ATOM   1041 C  CA     . VAL C 3 82  ? 15.518  38.351 8.232   1.00 18.32  ?  378  VAL A CA     1 
ATOM   1042 C  C      . VAL C 3 82  ? 16.582  37.971 7.210   1.00 19.47  ?  378  VAL A C      1 
ATOM   1043 O  O      . VAL C 3 82  ? 17.261  38.841 6.648   1.00 18.18  ?  378  VAL A O      1 
ATOM   1044 C  CB     . VAL C 3 82  ? 16.038  38.218 9.672   1.00 19.14  ?  378  VAL A CB     1 
ATOM   1045 C  CG1    . VAL C 3 82  ? 17.465  38.743 9.763   1.00 17.80  ?  378  VAL A CG1    1 
ATOM   1046 C  CG2    . VAL C 3 82  ? 15.127  38.976 10.620  1.00 12.67  ?  378  VAL A CG2    1 
ATOM   1047 N  N      . ALA C 3 83  ? 16.766  36.674 6.959   1.00 14.49  ?  379  ALA A N      1 
ATOM   1048 C  CA     . ALA C 3 83  ? 17.753  36.289 5.959   1.00 25.14  ?  379  ALA A CA     1 
ATOM   1049 C  C      . ALA C 3 83  ? 17.381  36.860 4.599   1.00 19.74  ?  379  ALA A C      1 
ATOM   1050 O  O      . ALA C 3 83  ? 18.256  37.257 3.821   1.00 23.19  ?  379  ALA A O      1 
ATOM   1051 C  CB     . ALA C 3 83  ? 17.896  34.766 5.893   1.00 14.59  ?  379  ALA A CB     1 
ATOM   1052 N  N      . LEU C 3 84  ? 16.084  36.926 4.302   1.00 19.55  ?  380  LEU A N      1 
ATOM   1053 C  CA     . LEU C 3 84  ? 15.660  37.526 3.043   1.00 27.37  ?  380  LEU A CA     1 
ATOM   1054 C  C      . LEU C 3 84  ? 15.838  39.044 3.064   1.00 24.93  ?  380  LEU A C      1 
ATOM   1055 O  O      . LEU C 3 84  ? 16.214  39.638 2.048   1.00 23.48  ?  380  LEU A O      1 
ATOM   1056 C  CB     . LEU C 3 84  ? 14.215  37.131 2.740   1.00 19.16  ?  380  LEU A CB     1 
ATOM   1057 C  CG     . LEU C 3 84  ? 14.029  35.648 2.400   1.00 23.15  ?  380  LEU A CG     1 
ATOM   1058 C  CD1    . LEU C 3 84  ? 12.558  35.287 2.444   1.00 20.38  ?  380  LEU A CD1    1 
ATOM   1059 C  CD2    . LEU C 3 84  ? 14.626  35.305 1.038   1.00 24.91  ?  380  LEU A CD2    1 
ATOM   1060 N  N      . LYS C 3 85  ? 15.602  39.688 4.213   1.00 23.43  ?  381  LYS A N      1 
ATOM   1061 C  CA     . LYS C 3 85  ? 15.861  41.123 4.313   1.00 22.06  ?  381  LYS A CA     1 
ATOM   1062 C  C      . LYS C 3 85  ? 17.296  41.460 3.923   1.00 24.51  ?  381  LYS A C      1 
ATOM   1063 O  O      . LYS C 3 85  ? 17.548  42.467 3.248   1.00 22.19  ?  381  LYS A O      1 
ATOM   1064 C  CB     . LYS C 3 85  ? 15.575  41.623 5.731   1.00 28.73  ?  381  LYS A CB     1 
ATOM   1065 C  CG     . LYS C 3 85  ? 14.122  41.897 6.043   1.00 32.35  ?  381  LYS A CG     1 
ATOM   1066 C  CD     . LYS C 3 85  ? 13.972  42.327 7.503   1.00 29.50  ?  381  LYS A CD     1 
ATOM   1067 C  CE     . LYS C 3 85  ? 12.519  42.388 7.942   1.00 33.26  ?  381  LYS A CE     1 
ATOM   1068 N  NZ     . LYS C 3 85  ? 11.716  43.370 7.161   1.00 36.94  ?  381  LYS A NZ     1 
ATOM   1069 N  N      . TRP C 3 86  ? 18.257  40.634 4.346   1.00 23.03  ?  382  TRP A N      1 
ATOM   1070 C  CA     . TRP C 3 86  ? 19.652  40.903 4.018   1.00 24.45  ?  382  TRP A CA     1 
ATOM   1071 C  C      . TRP C 3 86  ? 19.934  40.733 2.534   1.00 27.47  ?  382  TRP A C      1 
ATOM   1072 O  O      . TRP C 3 86  ? 20.939  41.257 2.040   1.00 22.98  ?  382  TRP A O      1 
ATOM   1073 C  CB     . TRP C 3 86  ? 20.575  39.996 4.832   1.00 26.98  ?  382  TRP A CB     1 
ATOM   1074 C  CG     . TRP C 3 86  ? 20.747  40.428 6.252   1.00 23.67  ?  382  TRP A CG     1 
ATOM   1075 C  CD1    . TRP C 3 86  ? 20.015  40.020 7.321   1.00 17.48  ?  382  TRP A CD1    1 
ATOM   1076 C  CD2    . TRP C 3 86  ? 21.724  41.347 6.759   1.00 19.87  ?  382  TRP A CD2    1 
ATOM   1077 N  NE1    . TRP C 3 86  ? 20.471  40.624 8.467   1.00 16.45  ?  382  TRP A NE1    1 
ATOM   1078 C  CE2    . TRP C 3 86  ? 21.520  41.444 8.151   1.00 17.98  ?  382  TRP A CE2    1 
ATOM   1079 C  CE3    . TRP C 3 86  ? 22.748  42.098 6.173   1.00 21.46  ?  382  TRP A CE3    1 
ATOM   1080 C  CZ2    . TRP C 3 86  ? 22.299  42.261 8.965   1.00 19.17  ?  382  TRP A CZ2    1 
ATOM   1081 C  CZ3    . TRP C 3 86  ? 23.527  42.908 6.985   1.00 22.85  ?  382  TRP A CZ3    1 
ATOM   1082 C  CH2    . TRP C 3 86  ? 23.295  42.983 8.368   1.00 22.46  ?  382  TRP A CH2    1 
ATOM   1083 N  N      . LYS C 3 87  ? 19.085  40.002 1.819   1.00 24.37  ?  383  LYS A N      1 
ATOM   1084 C  CA     . LYS C 3 87  ? 19.158  39.922 0.369   1.00 29.98  ?  383  LYS A CA     1 
ATOM   1085 C  C      . LYS C 3 87  ? 18.236  40.923 -0.317  1.00 34.06  ?  383  LYS A C      1 
ATOM   1086 O  O      . LYS C 3 87  ? 18.027  40.826 -1.529  1.00 29.26  ?  383  LYS A O      1 
ATOM   1087 C  CB     . LYS C 3 87  ? 18.827  38.504 -0.100  1.00 26.69  ?  383  LYS A CB     1 
ATOM   1088 C  CG     . LYS C 3 87  ? 19.765  37.434 0.442   1.00 31.08  ?  383  LYS A CG     1 
ATOM   1089 C  CD     . LYS C 3 87  ? 19.274  36.042 0.074   1.00 35.72  ?  383  LYS A CD     1 
ATOM   1090 C  CE     . LYS C 3 87  ? 20.236  34.967 0.559   1.00 35.40  ?  383  LYS A CE     1 
ATOM   1091 N  NZ     . LYS C 3 87  ? 21.566  35.068 -0.103  1.00 37.93  ?  383  LYS A NZ     1 
ATOM   1092 N  N      . GLY C 3 88  ? 17.679  41.876 0.425   1.00 30.24  ?  384  GLY A N      1 
ATOM   1093 C  CA     . GLY C 3 88  ? 16.787  42.849 -0.183  1.00 37.40  ?  384  GLY A CA     1 
ATOM   1094 C  C      . GLY C 3 88  ? 15.475  42.265 -0.650  1.00 31.72  ?  384  GLY A C      1 
ATOM   1095 O  O      . GLY C 3 88  ? 14.891  42.763 -1.618  1.00 32.77  ?  384  GLY A O      1 
ATOM   1096 N  N      . ILE C 3 89  ? 14.990  41.222 0.017   1.00 24.94  ?  385  ILE A N      1 
ATOM   1097 C  CA     . ILE C 3 89  ? 13.769  40.530 -0.372  1.00 27.23  ?  385  ILE A CA     1 
ATOM   1098 C  C      . ILE C 3 89  ? 12.784  40.606 0.781   1.00 30.56  ?  385  ILE A C      1 
ATOM   1099 O  O      . ILE C 3 89  ? 13.154  40.383 1.940   1.00 30.05  ?  385  ILE A O      1 
ATOM   1100 C  CB     . ILE C 3 89  ? 14.045  39.068 -0.763  1.00 34.97  ?  385  ILE A CB     1 
ATOM   1101 C  CG1    . ILE C 3 89  ? 14.975  39.020 -1.972  1.00 31.42  ?  385  ILE A CG1    1 
ATOM   1102 C  CG2    . ILE C 3 89  ? 12.748  38.340 -1.059  1.00 26.96  ?  385  ILE A CG2    1 
ATOM   1103 C  CD1    . ILE C 3 89  ? 15.335  37.623 -2.393  1.00 26.01  ?  385  ILE A CD1    1 
ATOM   1104 N  N      . GLU C 3 90  ? 11.534  40.921 0.466   1.00 27.55  ?  386  GLU A N      1 
ATOM   1105 C  CA     . GLU C 3 90  ? 10.499  41.083 1.472   1.00 24.73  ?  386  GLU A CA     1 
ATOM   1106 C  C      . GLU C 3 90  ? 9.659   39.817 1.535   1.00 29.60  ?  386  GLU A C      1 
ATOM   1107 O  O      . GLU C 3 90  ? 9.223   39.300 0.502   1.00 27.15  ?  386  GLU A O      1 
ATOM   1108 C  CB     . GLU C 3 90  ? 9.623   42.299 1.164   1.00 42.12  ?  386  GLU A CB     1 
ATOM   1109 C  CG     . GLU C 3 90  ? 8.787   42.779 2.346   1.00 64.94  ?  386  GLU A CG     1 
ATOM   1110 C  CD     . GLU C 3 90  ? 7.991   44.036 2.034   1.00 83.75  ?  386  GLU A CD     1 
ATOM   1111 O  OE1    . GLU C 3 90  ? 8.108   44.554 0.903   1.00 92.60  ?  386  GLU A OE1    1 
ATOM   1112 O  OE2    . GLU C 3 90  ? 7.246   44.508 2.920   1.00 88.15  ?  386  GLU A OE2    1 
ATOM   1113 N  N      . LEU C 3 91  ? 9.459   39.310 2.743   1.00 29.20  ?  387  LEU A N      1 
ATOM   1114 C  CA     . LEU C 3 91  ? 8.619   38.148 2.980   1.00 24.21  ?  387  LEU A CA     1 
ATOM   1115 C  C      . LEU C 3 91  ? 7.325   38.629 3.619   1.00 28.05  ?  387  LEU A C      1 
ATOM   1116 O  O      . LEU C 3 91  ? 7.347   39.208 4.710   1.00 28.58  ?  387  LEU A O      1 
ATOM   1117 C  CB     . LEU C 3 91  ? 9.332   37.131 3.872   1.00 17.23  ?  387  LEU A CB     1 
ATOM   1118 C  CG     . LEU C 3 91  ? 8.523   35.905 4.299   1.00 25.21  ?  387  LEU A CG     1 
ATOM   1119 C  CD1    . LEU C 3 91  ? 8.109   35.069 3.093   1.00 21.23  ?  387  LEU A CD1    1 
ATOM   1120 C  CD2    . LEU C 3 91  ? 9.323   35.068 5.293   1.00 21.74  ?  387  LEU A CD2    1 
ATOM   1121 N  N      . CYS C 3 92  ? 6.210   38.416 2.929   1.00 22.33  ?  388  CYS A N      1 
ATOM   1122 C  CA     . CYS C 3 92  ? 4.900   38.815 3.416   1.00 26.35  ?  388  CYS A CA     1 
ATOM   1123 C  C      . CYS C 3 92  ? 3.955   37.622 3.372   1.00 21.60  ?  388  CYS A C      1 
ATOM   1124 O  O      . CYS C 3 92  ? 4.274   36.560 2.829   1.00 23.71  ?  388  CYS A O      1 
ATOM   1125 C  CB     . CYS C 3 92  ? 4.323   39.977 2.593   1.00 31.62  ?  388  CYS A CB     1 
ATOM   1126 S  SG     . CYS C 3 92  ? 5.295   41.497 2.669   1.00 39.98  ?  388  CYS A SG     1 
ATOM   1127 N  N      . GLY C 3 93  ? 2.778   37.809 3.961   1.00 23.71  ?  389  GLY A N      1 
ATOM   1128 C  CA     . GLY C 3 93  ? 1.735   36.812 3.882   1.00 30.90  ?  389  GLY A CA     1 
ATOM   1129 C  C      . GLY C 3 93  ? 1.916   35.597 4.760   1.00 23.27  ?  389  GLY A C      1 
ATOM   1130 O  O      . GLY C 3 93  ? 1.226   34.597 4.550   1.00 22.33  ?  389  GLY A O      1 
ATOM   1131 N  N      . VAL C 3 94  ? 2.816   35.640 5.740   1.00 30.00  ?  390  VAL A N      1 
ATOM   1132 C  CA     . VAL C 3 94  ? 2.956   34.515 6.658   1.00 22.40  ?  390  VAL A CA     1 
ATOM   1133 C  C      . VAL C 3 94  ? 1.763   34.522 7.605   1.00 28.72  ?  390  VAL A C      1 
ATOM   1134 O  O      . VAL C 3 94  ? 1.706   35.330 8.540   1.00 22.89  ?  390  VAL A O      1 
ATOM   1135 C  CB     . VAL C 3 94  ? 4.288   34.573 7.430   1.00 31.08  ?  390  VAL A CB     1 
ATOM   1136 C  CG1    . VAL C 3 94  ? 4.396   33.397 8.393   1.00 23.09  ?  390  VAL A CG1    1 
ATOM   1137 C  CG2    . VAL C 3 94  ? 5.468   34.571 6.462   1.00 26.70  ?  390  VAL A CG2    1 
ATOM   1138 N  N      . SER C 3 95  ? 0.792   33.637 7.361   1.00 21.08  ?  391  SER A N      1 
ATOM   1139 C  CA     . SER C 3 95  ? -0.420  33.577 8.168   1.00 25.06  ?  391  SER A CA     1 
ATOM   1140 C  C      . SER C 3 95  ? -0.360  32.524 9.267   1.00 26.02  ?  391  SER A C      1 
ATOM   1141 O  O      . SER C 3 95  ? -1.230  32.519 10.144  1.00 23.21  ?  391  SER A O      1 
ATOM   1142 C  CB     . SER C 3 95  ? -1.643  33.311 7.276   1.00 26.79  ?  391  SER A CB     1 
ATOM   1143 O  OG     . SER C 3 95  ? -1.524  32.068 6.600   1.00 31.90  ?  391  SER A OG     1 
ATOM   1144 N  N      . PHE C 3 96  ? 0.633   31.641 9.250   1.00 18.85  ?  392  PHE A N      1 
ATOM   1145 C  CA     . PHE C 3 96  ? 0.761   30.631 10.295  1.00 19.10  ?  392  PHE A CA     1 
ATOM   1146 C  C      . PHE C 3 96  ? 2.236   30.351 10.531  1.00 22.58  ?  392  PHE A C      1 
ATOM   1147 O  O      . PHE C 3 96  ? 2.962   30.018 9.591   1.00 19.05  ?  392  PHE A O      1 
ATOM   1148 C  CB     . PHE C 3 96  ? 0.025   29.347 9.918   1.00 18.54  ?  392  PHE A CB     1 
ATOM   1149 C  CG     . PHE C 3 96  ? 0.183   28.249 10.924  1.00 25.82  ?  392  PHE A CG     1 
ATOM   1150 C  CD1    . PHE C 3 96  ? -0.551  28.260 12.097  1.00 24.57  ?  392  PHE A CD1    1 
ATOM   1151 C  CD2    . PHE C 3 96  ? 1.079   27.215 10.706  1.00 26.23  ?  392  PHE A CD2    1 
ATOM   1152 C  CE1    . PHE C 3 96  ? -0.399  27.252 13.029  1.00 23.65  ?  392  PHE A CE1    1 
ATOM   1153 C  CE2    . PHE C 3 96  ? 1.233   26.206 11.637  1.00 28.01  ?  392  PHE A CE2    1 
ATOM   1154 C  CZ     . PHE C 3 96  ? 0.493   26.226 12.796  1.00 22.11  ?  392  PHE A CZ     1 
ATOM   1155 N  N      . ASP C 3 97  ? 2.677   30.497 11.779  1.00 13.73  ?  393  ASP A N      1 
ATOM   1156 C  CA     . ASP C 3 97  ? 4.050   30.196 12.181  1.00 17.60  ?  393  ASP A CA     1 
ATOM   1157 C  C      . ASP C 3 97  ? 3.973   29.048 13.182  1.00 22.80  ?  393  ASP A C      1 
ATOM   1158 O  O      . ASP C 3 97  ? 3.594   29.250 14.340  1.00 19.63  ?  393  ASP A O      1 
ATOM   1159 C  CB     . ASP C 3 97  ? 4.736   31.430 12.771  1.00 20.79  ?  393  ASP A CB     1 
ATOM   1160 C  CG     . ASP C 3 97  ? 6.240   31.236 12.967  1.00 28.07  ?  393  ASP A CG     1 
ATOM   1161 O  OD1    . ASP C 3 97  ? 6.664   30.124 13.347  1.00 28.82  ?  393  ASP A OD1    1 
ATOM   1162 O  OD2    . ASP C 3 97  ? 7.000   32.205 12.739  1.00 25.44  ?  393  ASP A OD2    1 
ATOM   1163 N  N      . LEU C 3 98  ? 4.330   27.844 12.726  1.00 20.89  ?  394  LEU A N      1 
ATOM   1164 C  CA     . LEU C 3 98  ? 4.210   26.657 13.566  1.00 21.21  ?  394  LEU A CA     1 
ATOM   1165 C  C      . LEU C 3 98  ? 5.074   26.759 14.816  1.00 22.29  ?  394  LEU A C      1 
ATOM   1166 O  O      . LEU C 3 98  ? 4.715   26.204 15.860  1.00 19.55  ?  394  LEU A O      1 
ATOM   1167 C  CB     . LEU C 3 98  ? 4.579   25.410 12.761  1.00 16.81  ?  394  LEU A CB     1 
ATOM   1168 C  CG     . LEU C 3 98  ? 4.598   24.061 13.482  1.00 18.47  ?  394  LEU A CG     1 
ATOM   1169 C  CD1    . LEU C 3 98  ? 3.186   23.668 13.908  1.00 17.34  ?  394  LEU A CD1    1 
ATOM   1170 C  CD2    . LEU C 3 98  ? 5.233   22.979 12.611  1.00 22.39  ?  394  LEU A CD2    1 
ATOM   1171 N  N      . LEU C 3 99  ? 6.214   27.452 14.733  1.00 17.43  ?  395  LEU A N      1 
ATOM   1172 C  CA     . LEU C 3 99  ? 7.047   27.640 15.917  1.00 12.37  ?  395  LEU A CA     1 
ATOM   1173 C  C      . LEU C 3 99  ? 6.292   28.399 17.001  1.00 20.82  ?  395  LEU A C      1 
ATOM   1174 O  O      . LEU C 3 99  ? 6.241   27.968 18.158  1.00 21.95  ?  395  LEU A O      1 
ATOM   1175 C  CB     . LEU C 3 99  ? 8.340   28.375 15.554  1.00 13.99  ?  395  LEU A CB     1 
ATOM   1176 C  CG     . LEU C 3 99  ? 9.140   28.772 16.805  1.00 25.58  ?  395  LEU A CG     1 
ATOM   1177 C  CD1    . LEU C 3 99  ? 9.521   27.543 17.623  1.00 25.47  ?  395  LEU A CD1    1 
ATOM   1178 C  CD2    . LEU C 3 99  ? 10.377  29.602 16.480  1.00 21.65  ?  395  LEU A CD2    1 
ATOM   1179 N  N      . LEU C 3 100 ? 5.689   29.535 16.637  1.00 15.20  ?  396  LEU A N      1 
ATOM   1180 C  CA     . LEU C 3 100 ? 4.946   30.324 17.613  1.00 21.34  ?  396  LEU A CA     1 
ATOM   1181 C  C      . LEU C 3 100 ? 3.695   29.597 18.087  1.00 15.94  ?  396  LEU A C      1 
ATOM   1182 O  O      . LEU C 3 100 ? 3.308   29.725 19.256  1.00 15.33  ?  396  LEU A O      1 
ATOM   1183 C  CB     . LEU C 3 100 ? 4.601   31.689 17.009  1.00 15.77  ?  396  LEU A CB     1 
ATOM   1184 C  CG     . LEU C 3 100 ? 5.858   32.456 16.585  1.00 19.15  ?  396  LEU A CG     1 
ATOM   1185 C  CD1    . LEU C 3 100 ? 5.516   33.726 15.812  1.00 19.49  ?  396  LEU A CD1    1 
ATOM   1186 C  CD2    . LEU C 3 100 ? 6.701   32.785 17.817  1.00 20.52  ?  396  LEU A CD2    1 
ATOM   1187 N  N      . ALA C 3 101 ? 3.053   28.827 17.207  1.00 18.48  ?  397  ALA A N      1 
ATOM   1188 C  CA     . ALA C 3 101 ? 1.891   28.047 17.616  1.00 18.31  ?  397  ALA A CA     1 
ATOM   1189 C  C      . ALA C 3 101 ? 2.273   26.990 18.644  1.00 16.86  ?  397  ALA A C      1 
ATOM   1190 O  O      . ALA C 3 101 ? 1.581   26.815 19.653  1.00 16.72  ?  397  ALA A O      1 
ATOM   1191 C  CB     . ALA C 3 101 ? 1.233   27.398 16.396  1.00 18.63  ?  397  ALA A CB     1 
ATOM   1192 N  N      . ALA C 3 102 ? 3.360   26.256 18.396  1.00 15.49  ?  398  ALA A N      1 
ATOM   1193 C  CA     . ALA C 3 102 ? 3.775   25.238 19.357  1.00 21.90  ?  398  ALA A CA     1 
ATOM   1194 C  C      . ALA C 3 102 ? 4.199   25.877 20.672  1.00 26.80  ?  398  ALA A C      1 
ATOM   1195 O  O      . ALA C 3 102 ? 3.897   25.361 21.755  1.00 22.46  ?  398  ALA A O      1 
ATOM   1196 C  CB     . ALA C 3 102 ? 4.909   24.390 18.778  1.00 18.01  ?  398  ALA A CB     1 
ATOM   1197 N  N      . TYR C 3 103 ? 4.894   27.009 20.595  1.00 18.97  ?  399  TYR A N      1 
ATOM   1198 C  CA     . TYR C 3 103 ? 5.305   27.709 21.804  1.00 20.49  ?  399  TYR A CA     1 
ATOM   1199 C  C      . TYR C 3 103 ? 4.103   28.152 22.632  1.00 19.95  ?  399  TYR A C      1 
ATOM   1200 O  O      . TYR C 3 103 ? 4.102   28.017 23.863  1.00 21.16  ?  399  TYR A O      1 
ATOM   1201 C  CB     . TYR C 3 103 ? 6.180   28.897 21.420  1.00 25.93  ?  399  TYR A CB     1 
ATOM   1202 C  CG     . TYR C 3 103 ? 6.454   29.864 22.536  1.00 21.31  ?  399  TYR A CG     1 
ATOM   1203 C  CD1    . TYR C 3 103 ? 7.328   29.538 23.567  1.00 18.45  ?  399  TYR A CD1    1 
ATOM   1204 C  CD2    . TYR C 3 103 ? 5.854   31.112 22.553  1.00 24.04  ?  399  TYR A CD2    1 
ATOM   1205 C  CE1    . TYR C 3 103 ? 7.588   30.433 24.583  1.00 26.49  ?  399  TYR A CE1    1 
ATOM   1206 C  CE2    . TYR C 3 103 ? 6.106   32.007 23.555  1.00 24.17  ?  399  TYR A CE2    1 
ATOM   1207 C  CZ     . TYR C 3 103 ? 6.972   31.668 24.571  1.00 24.65  ?  399  TYR A CZ     1 
ATOM   1208 O  OH     . TYR C 3 103 ? 7.220   32.576 25.574  1.00 33.05  ?  399  TYR A OH     1 
ATOM   1209 N  N      . LEU C 3 104 ? 3.064   28.679 21.979  1.00 20.95  ?  400  LEU A N      1 
ATOM   1210 C  CA     . LEU C 3 104 ? 1.880   29.105 22.721  1.00 22.99  ?  400  LEU A CA     1 
ATOM   1211 C  C      . LEU C 3 104 ? 1.133   27.921 23.321  1.00 23.00  ?  400  LEU A C      1 
ATOM   1212 O  O      . LEU C 3 104 ? 0.579   28.031 24.422  1.00 22.82  ?  400  LEU A O      1 
ATOM   1213 C  CB     . LEU C 3 104 ? 0.950   29.913 21.812  1.00 18.75  ?  400  LEU A CB     1 
ATOM   1214 C  CG     . LEU C 3 104 ? 1.418   31.322 21.451  1.00 24.47  ?  400  LEU A CG     1 
ATOM   1215 C  CD1    . LEU C 3 104 ? 0.421   31.991 20.509  1.00 20.22  ?  400  LEU A CD1    1 
ATOM   1216 C  CD2    . LEU C 3 104 ? 1.614   32.155 22.717  1.00 31.16  ?  400  LEU A CD2    1 
ATOM   1217 N  N      . LEU C 3 105 ? 1.118   26.783 22.622  1.00 21.57  ?  401  LEU A N      1 
ATOM   1218 C  CA     . LEU C 3 105 ? 0.399   25.611 23.108  1.00 24.54  ?  401  LEU A CA     1 
ATOM   1219 C  C      . LEU C 3 105 ? 1.053   25.013 24.344  1.00 27.83  ?  401  LEU A C      1 
ATOM   1220 O  O      . LEU C 3 105 ? 0.360   24.449 25.199  1.00 28.17  ?  401  LEU A O      1 
ATOM   1221 C  CB     . LEU C 3 105 ? 0.309   24.558 22.005  1.00 23.31  ?  401  LEU A CB     1 
ATOM   1222 C  CG     . LEU C 3 105 ? -0.802  24.771 20.983  1.00 22.06  ?  401  LEU A CG     1 
ATOM   1223 C  CD1    . LEU C 3 105 ? -0.899  23.557 20.084  1.00 20.63  ?  401  LEU A CD1    1 
ATOM   1224 C  CD2    . LEU C 3 105 ? -2.124  25.025 21.698  1.00 20.59  ?  401  LEU A CD2    1 
ATOM   1225 N  N      . ASP C 3 106 ? 2.374   25.108 24.448  1.00 26.72  ?  402  ASP A N      1 
ATOM   1226 C  CA     . ASP C 3 106 ? 3.086   24.588 25.605  1.00 33.10  ?  402  ASP A CA     1 
ATOM   1227 C  C      . ASP C 3 106 ? 4.537   25.043 25.546  1.00 25.95  ?  402  ASP A C      1 
ATOM   1228 O  O      . ASP C 3 106 ? 5.365   24.409 24.879  1.00 26.95  ?  402  ASP A O      1 
ATOM   1229 C  CB     . ASP C 3 106 ? 2.993   23.062 25.658  1.00 40.47  ?  402  ASP A CB     1 
ATOM   1230 C  CG     . ASP C 3 106 ? 3.629   22.482 26.908  1.00 40.22  ?  402  ASP A CG     1 
ATOM   1231 O  OD1    . ASP C 3 106 ? 4.156   23.263 27.728  1.00 43.11  ?  402  ASP A OD1    1 
ATOM   1232 O  OD2    . ASP C 3 106 ? 3.601   21.242 27.071  1.00 52.29  ?  402  ASP A OD2    1 
ATOM   1233 N  N      . PRO C 3 107 ? 4.877   26.136 26.229  1.00 27.40  ?  403  PRO A N      1 
ATOM   1234 C  CA     . PRO C 3 107 ? 6.255   26.648 26.153  1.00 30.51  ?  403  PRO A CA     1 
ATOM   1235 C  C      . PRO C 3 107 ? 7.281   25.706 26.750  1.00 37.45  ?  403  PRO A C      1 
ATOM   1236 O  O      . PRO C 3 107 ? 8.458   25.767 26.372  1.00 34.97  ?  403  PRO A O      1 
ATOM   1237 C  CB     . PRO C 3 107 ? 6.190   27.965 26.945  1.00 35.21  ?  403  PRO A CB     1 
ATOM   1238 C  CG     . PRO C 3 107 ? 4.729   28.246 27.168  1.00 40.22  ?  403  PRO A CG     1 
ATOM   1239 C  CD     . PRO C 3 107 ? 4.030   26.927 27.136  1.00 27.28  ?  403  PRO A CD     1 
ATOM   1240 N  N      . ALA C 3 108 ? 6.877   24.847 27.687  1.00 35.49  ?  404  ALA A N      1 
ATOM   1241 C  CA     . ALA C 3 108 ? 7.829   23.957 28.342  1.00 35.27  ?  404  ALA A CA     1 
ATOM   1242 C  C      . ALA C 3 108 ? 8.393   22.908 27.392  1.00 41.54  ?  404  ALA A C      1 
ATOM   1243 O  O      . ALA C 3 108 ? 9.455   22.344 27.674  1.00 43.91  ?  404  ALA A O      1 
ATOM   1244 C  CB     . ALA C 3 108 ? 7.169   23.275 29.542  1.00 25.96  ?  404  ALA A CB     1 
ATOM   1245 N  N      . GLN C 3 109 ? 7.716   22.641 26.273  1.00 42.73  ?  405  GLN A N      1 
ATOM   1246 C  CA     . GLN C 3 109 ? 8.202   21.634 25.336  1.00 46.60  ?  405  GLN A CA     1 
ATOM   1247 C  C      . GLN C 3 109 ? 9.549   21.998 24.729  1.00 44.83  ?  405  GLN A C      1 
ATOM   1248 O  O      . GLN C 3 109 ? 10.247  21.112 24.222  1.00 38.49  ?  405  GLN A O      1 
ATOM   1249 C  CB     . GLN C 3 109 ? 7.178   21.410 24.223  1.00 50.12  ?  405  GLN A CB     1 
ATOM   1250 C  CG     . GLN C 3 109 ? 5.950   20.657 24.680  1.00 54.24  ?  405  GLN A CG     1 
ATOM   1251 C  CD     . GLN C 3 109 ? 6.307   19.396 25.440  1.00 66.54  ?  405  GLN A CD     1 
ATOM   1252 O  OE1    . GLN C 3 109 ? 7.069   18.559 24.955  1.00 68.25  ?  405  GLN A OE1    1 
ATOM   1253 N  NE2    . GLN C 3 109 ? 5.769   19.260 26.646  1.00 71.14  ?  405  GLN A NE2    1 
ATOM   1254 N  N      . GLY C 3 110 ? 9.934   23.270 24.764  1.00 42.65  ?  406  GLY A N      1 
ATOM   1255 C  CA     . GLY C 3 110 ? 11.188  23.661 24.147  1.00 41.15  ?  406  GLY A CA     1 
ATOM   1256 C  C      . GLY C 3 110 ? 11.251  23.362 22.667  1.00 40.35  ?  406  GLY A C      1 
ATOM   1257 O  O      . GLY C 3 110 ? 12.342  23.147 22.129  1.00 34.65  ?  406  GLY A O      1 
ATOM   1258 N  N      . VAL C 3 111 ? 10.102  23.335 21.991  1.00 40.51  ?  407  VAL A N      1 
ATOM   1259 C  CA     . VAL C 3 111 ? 10.041  23.076 20.557  1.00 44.28  ?  407  VAL A CA     1 
ATOM   1260 C  C      . VAL C 3 111 ? 10.969  24.035 19.827  1.00 44.19  ?  407  VAL A C      1 
ATOM   1261 O  O      . VAL C 3 111 ? 10.723  25.245 19.786  1.00 53.65  ?  407  VAL A O      1 
ATOM   1262 C  CB     . VAL C 3 111 ? 8.602   23.203 20.027  1.00 35.59  ?  407  VAL A CB     1 
ATOM   1263 C  CG1    . VAL C 3 111 ? 8.599   23.146 18.504  1.00 37.02  ?  407  VAL A CG1    1 
ATOM   1264 C  CG2    . VAL C 3 111 ? 7.722   22.108 20.612  1.00 36.32  ?  407  VAL A CG2    1 
ATOM   1265 N  N      . ASP C 3 112 ? 12.043  23.500 19.248  1.00 33.98  ?  408  ASP A N      1 
ATOM   1266 C  CA     . ASP C 3 112 ? 13.013  24.308 18.526  1.00 44.23  ?  408  ASP A CA     1 
ATOM   1267 C  C      . ASP C 3 112 ? 13.181  23.889 17.074  1.00 38.12  ?  408  ASP A C      1 
ATOM   1268 O  O      . ASP C 3 112 ? 13.965  24.515 16.353  1.00 41.22  ?  408  ASP A O      1 
ATOM   1269 C  CB     . ASP C 3 112 ? 14.378  24.263 19.225  1.00 56.56  ?  408  ASP A CB     1 
ATOM   1270 C  CG     . ASP C 3 112 ? 14.881  22.854 19.419  1.00 63.68  ?  408  ASP A CG     1 
ATOM   1271 O  OD1    . ASP C 3 112 ? 14.112  21.911 19.136  1.00 66.66  ?  408  ASP A OD1    1 
ATOM   1272 O  OD2    . ASP C 3 112 ? 16.039  22.690 19.855  1.00 71.13  ?  408  ASP A OD2    1 
ATOM   1273 N  N      . ASP C 3 113 ? 12.486  22.850 16.625  1.00 24.76  ?  409  ASP A N      1 
ATOM   1274 C  CA     . ASP C 3 113 ? 12.504  22.502 15.215  1.00 21.54  ?  409  ASP A CA     1 
ATOM   1275 C  C      . ASP C 3 113 ? 11.169  21.873 14.853  1.00 21.85  ?  409  ASP A C      1 
ATOM   1276 O  O      . ASP C 3 113 ? 10.351  21.546 15.717  1.00 22.16  ?  409  ASP A O      1 
ATOM   1277 C  CB     . ASP C 3 113 ? 13.686  21.583 14.877  1.00 31.68  ?  409  ASP A CB     1 
ATOM   1278 C  CG     . ASP C 3 113 ? 13.603  20.228 15.562  1.00 37.64  ?  409  ASP A CG     1 
ATOM   1279 O  OD1    . ASP C 3 113 ? 14.522  19.408 15.352  1.00 45.85  ?  409  ASP A OD1    1 
ATOM   1280 O  OD2    . ASP C 3 113 ? 12.621  19.972 16.290  1.00 47.70  ?  409  ASP A OD2    1 
ATOM   1281 N  N      . VAL C 3 114 ? 10.962  21.706 13.548  1.00 23.55  ?  410  VAL A N      1 
ATOM   1282 C  CA     . VAL C 3 114 ? 9.696   21.180 13.051  1.00 21.17  ?  410  VAL A CA     1 
ATOM   1283 C  C      . VAL C 3 114 ? 9.416   19.797 13.627  1.00 14.61  ?  410  VAL A C      1 
ATOM   1284 O  O      . VAL C 3 114 ? 8.265   19.455 13.920  1.00 20.47  ?  410  VAL A O      1 
ATOM   1285 C  CB     . VAL C 3 114 ? 9.705   21.163 11.514  1.00 20.84  ?  410  VAL A CB     1 
ATOM   1286 C  CG1    . VAL C 3 114 ? 8.535   20.345 10.996  1.00 21.43  ?  410  VAL A CG1    1 
ATOM   1287 C  CG2    . VAL C 3 114 ? 9.659   22.585 10.984  1.00 17.15  ?  410  VAL A CG2    1 
ATOM   1288 N  N      . ALA C 3 115 ? 10.454  18.975 13.792  1.00 14.95  ?  411  ALA A N      1 
ATOM   1289 C  CA     . ALA C 3 115 ? 10.227  17.607 14.251  1.00 16.99  ?  411  ALA A CA     1 
ATOM   1290 C  C      . ALA C 3 115 ? 9.645   17.593 15.658  1.00 24.87  ?  411  ALA A C      1 
ATOM   1291 O  O      . ALA C 3 115 ? 8.725   16.821 15.956  1.00 19.09  ?  411  ALA A O      1 
ATOM   1292 C  CB     . ALA C 3 115 ? 11.525  16.801 14.194  1.00 17.78  ?  411  ALA A CB     1 
ATOM   1293 N  N      . ALA C 3 116 ? 10.175  18.435 16.545  1.00 26.69  ?  412  ALA A N      1 
ATOM   1294 C  CA     . ALA C 3 116 ? 9.647   18.468 17.904  1.00 26.75  ?  412  ALA A CA     1 
ATOM   1295 C  C      . ALA C 3 116 ? 8.203   18.952 17.919  1.00 27.29  ?  412  ALA A C      1 
ATOM   1296 O  O      . ALA C 3 116 ? 7.388   18.460 18.707  1.00 19.15  ?  412  ALA A O      1 
ATOM   1297 C  CB     . ALA C 3 116 ? 10.527  19.342 18.799  1.00 27.24  ?  412  ALA A CB     1 
ATOM   1298 N  N      . ALA C 3 117 ? 7.856   19.903 17.047  1.00 21.25  ?  413  ALA A N      1 
ATOM   1299 C  CA     . ALA C 3 117 ? 6.474   20.372 17.018  1.00 23.03  ?  413  ALA A CA     1 
ATOM   1300 C  C      . ALA C 3 117 ? 5.546   19.316 16.429  1.00 23.81  ?  413  ALA A C      1 
ATOM   1301 O  O      . ALA C 3 117 ? 4.435   19.108 16.932  1.00 20.06  ?  413  ALA A O      1 
ATOM   1302 C  CB     . ALA C 3 117 ? 6.373   21.684 16.236  1.00 22.60  ?  413  ALA A CB     1 
ATOM   1303 N  N      . ALA C 3 118 ? 5.987   18.636 15.365  1.00 27.17  ?  414  ALA A N      1 
ATOM   1304 C  CA     . ALA C 3 118 ? 5.164   17.601 14.745  1.00 27.20  ?  414  ALA A CA     1 
ATOM   1305 C  C      . ALA C 3 118 ? 4.926   16.446 15.702  1.00 22.48  ?  414  ALA A C      1 
ATOM   1306 O  O      . ALA C 3 118 ? 3.847   15.840 15.707  1.00 22.60  ?  414  ALA A O      1 
ATOM   1307 C  CB     . ALA C 3 118 ? 5.829   17.093 13.465  1.00 24.84  ?  414  ALA A CB     1 
ATOM   1308 N  N      . LYS C 3 119 ? 5.931   16.118 16.509  1.00 17.88  ?  415  LYS A N      1 
ATOM   1309 C  CA     . LYS C 3 119 ? 5.768   15.064 17.494  1.00 24.88  ?  415  LYS A CA     1 
ATOM   1310 C  C      . LYS C 3 119 ? 4.681   15.417 18.504  1.00 31.25  ?  415  LYS A C      1 
ATOM   1311 O  O      . LYS C 3 119 ? 4.082   14.519 19.102  1.00 29.59  ?  415  LYS A O      1 
ATOM   1312 C  CB     . LYS C 3 119 ? 7.111   14.800 18.174  1.00 25.91  ?  415  LYS A CB     1 
ATOM   1313 C  CG     . LYS C 3 119 ? 7.207   13.489 18.937  1.00 48.74  ?  415  LYS A CG     1 
ATOM   1314 C  CD     . LYS C 3 119 ? 8.658   13.156 19.261  1.00 49.91  ?  415  LYS A CD     1 
ATOM   1315 C  CE     . LYS C 3 119 ? 8.762   12.112 20.366  1.00 54.29  ?  415  LYS A CE     1 
ATOM   1316 N  NZ     . LYS C 3 119 ? 8.177   10.794 19.986  1.00 59.79  ?  415  LYS A NZ     1 
ATOM   1317 N  N      . MET C 3 120 ? 4.394   16.711 18.698  1.00 33.58  ?  416  MET A N      1 
ATOM   1318 C  CA     . MET C 3 120 ? 3.277   17.076 19.566  1.00 36.66  ?  416  MET A CA     1 
ATOM   1319 C  C      . MET C 3 120 ? 1.953   16.557 19.026  1.00 32.62  ?  416  MET A C      1 
ATOM   1320 O  O      . MET C 3 120 ? 0.994   16.412 19.794  1.00 32.64  ?  416  MET A O      1 
ATOM   1321 C  CB     . MET C 3 120 ? 3.192   18.595 19.747  1.00 36.55  ?  416  MET A CB     1 
ATOM   1322 C  CG     . MET C 3 120 ? 4.336   19.215 20.533  1.00 40.36  ?  416  MET A CG     1 
ATOM   1323 S  SD     . MET C 3 120 ? 4.338   21.022 20.427  1.00 46.97  ?  416  MET A SD     1 
ATOM   1324 C  CE     . MET C 3 120 ? 2.902   21.437 21.416  1.00 44.15  ?  416  MET A CE     1 
ATOM   1325 N  N      . LYS C 3 121 ? 1.887   16.265 17.725  1.00 32.48  ?  417  LYS A N      1 
ATOM   1326 C  CA     . LYS C 3 121 ? 0.672   15.807 17.062  1.00 18.11  ?  417  LYS A CA     1 
ATOM   1327 C  C      . LYS C 3 121 ? 0.857   14.444 16.397  1.00 29.63  ?  417  LYS A C      1 
ATOM   1328 O  O      . LYS C 3 121 ? 0.221   14.151 15.383  1.00 29.25  ?  417  LYS A O      1 
ATOM   1329 C  CB     . LYS C 3 121 ? 0.203   16.837 16.032  1.00 21.42  ?  417  LYS A CB     1 
ATOM   1330 C  CG     . LYS C 3 121 ? -0.139  18.198 16.612  1.00 27.89  ?  417  LYS A CG     1 
ATOM   1331 C  CD     . LYS C 3 121 ? -1.308  18.105 17.582  1.00 32.88  ?  417  LYS A CD     1 
ATOM   1332 C  CE     . LYS C 3 121 ? -1.627  19.454 18.206  1.00 40.44  ?  417  LYS A CE     1 
ATOM   1333 N  NZ     . LYS C 3 121 ? -2.813  19.370 19.107  1.00 39.81  ?  417  LYS A NZ     1 
ATOM   1334 N  N      . GLN C 3 122 ? 1.725   13.600 16.951  1.00 29.65  ?  418  GLN A N      1 
ATOM   1335 C  CA     . GLN C 3 122 ? 1.905   12.232 16.463  1.00 28.55  ?  418  GLN A CA     1 
ATOM   1336 C  C      . GLN C 3 122 ? 2.334   12.196 14.997  1.00 29.06  ?  418  GLN A C      1 
ATOM   1337 O  O      . GLN C 3 122 ? 2.057   11.231 14.283  1.00 29.60  ?  418  GLN A O      1 
ATOM   1338 C  CB     . GLN C 3 122 ? 0.634   11.395 16.655  1.00 38.32  ?  418  GLN A CB     1 
ATOM   1339 C  CG     . GLN C 3 122 ? 0.082   11.352 18.082  1.00 38.48  ?  418  GLN A CG     1 
ATOM   1340 C  CD     . GLN C 3 122 ? 1.162   11.142 19.135  1.00 52.38  ?  418  GLN A CD     1 
ATOM   1341 O  OE1    . GLN C 3 122 ? 1.831   12.090 19.546  1.00 70.42  ?  418  GLN A OE1    1 
ATOM   1342 N  NE2    . GLN C 3 122 ? 1.334   9.899  19.578  1.00 45.30  ?  418  GLN A NE2    1 
ATOM   1343 N  N      . TYR C 3 123 ? 2.992   13.249 14.527  1.00 28.71  ?  419  TYR A N      1 
ATOM   1344 C  CA     . TYR C 3 123 ? 3.533   13.303 13.173  1.00 28.17  ?  419  TYR A CA     1 
ATOM   1345 C  C      . TYR C 3 123 ? 5.038   13.110 13.290  1.00 27.80  ?  419  TYR A C      1 
ATOM   1346 O  O      . TYR C 3 123 ? 5.734   13.955 13.859  1.00 19.96  ?  419  TYR A O      1 
ATOM   1347 C  CB     . TYR C 3 123 ? 3.192   14.628 12.498  1.00 22.59  ?  419  TYR A CB     1 
ATOM   1348 C  CG     . TYR C 3 123 ? 3.535   14.704 11.024  1.00 23.09  ?  419  TYR A CG     1 
ATOM   1349 C  CD1    . TYR C 3 123 ? 2.542   14.611 10.055  1.00 23.08  ?  419  TYR A CD1    1 
ATOM   1350 C  CD2    . TYR C 3 123 ? 4.845   14.869 10.602  1.00 18.40  ?  419  TYR A CD2    1 
ATOM   1351 C  CE1    . TYR C 3 123 ? 2.847   14.686 8.709   1.00 27.64  ?  419  TYR A CE1    1 
ATOM   1352 C  CE2    . TYR C 3 123 ? 5.162   14.945 9.254   1.00 17.95  ?  419  TYR A CE2    1 
ATOM   1353 C  CZ     . TYR C 3 123 ? 4.158   14.856 8.314   1.00 29.38  ?  419  TYR A CZ     1 
ATOM   1354 O  OH     . TYR C 3 123 ? 4.469   14.927 6.974   1.00 26.50  ?  419  TYR A OH     1 
ATOM   1355 N  N      . GLU C 3 124 ? 5.547   11.994 12.772  1.00 17.47  ?  420  GLU A N      1 
ATOM   1356 C  CA     . GLU C 3 124 ? 6.974   11.724 12.900  1.00 27.06  ?  420  GLU A CA     1 
ATOM   1357 C  C      . GLU C 3 124 ? 7.644   11.484 11.552  1.00 33.40  ?  420  GLU A C      1 
ATOM   1358 O  O      . GLU C 3 124 ? 8.740   10.918 11.504  1.00 34.11  ?  420  GLU A O      1 
ATOM   1359 C  CB     . GLU C 3 124 ? 7.207   10.539 13.839  1.00 31.00  ?  420  GLU A CB     1 
ATOM   1360 C  CG     . GLU C 3 124 ? 6.564   10.741 15.194  1.00 38.69  ?  420  GLU A CG     1 
ATOM   1361 C  CD     . GLU C 3 124 ? 7.008   9.717  16.212  1.00 57.09  ?  420  GLU A CD     1 
ATOM   1362 O  OE1    . GLU C 3 124 ? 8.042   9.052  15.979  1.00 62.08  ?  420  GLU A OE1    1 
ATOM   1363 O  OE2    . GLU C 3 124 ? 6.324   9.579  17.247  1.00 57.39  ?  420  GLU A OE2    1 
ATOM   1364 N  N      . ALA C 3 125 ? 7.022   11.912 10.459  1.00 26.46  ?  421  ALA A N      1 
ATOM   1365 C  CA     . ALA C 3 125 ? 7.609   11.722 9.133   1.00 29.78  ?  421  ALA A CA     1 
ATOM   1366 C  C      . ALA C 3 125 ? 8.549   12.858 8.747   1.00 28.51  ?  421  ALA A C      1 
ATOM   1367 O  O      . ALA C 3 125 ? 8.569   13.312 7.599   1.00 27.26  ?  421  ALA A O      1 
ATOM   1368 C  CB     . ALA C 3 125 ? 6.497   11.552 8.101   1.00 24.55  ?  421  ALA A CB     1 
ATOM   1369 N  N      . VAL C 3 126 ? 9.340   13.328 9.705   1.00 26.10  ?  422  VAL A N      1 
ATOM   1370 C  CA     . VAL C 3 126 ? 10.264  14.436 9.502   1.00 26.14  ?  422  VAL A CA     1 
ATOM   1371 C  C      . VAL C 3 126 ? 11.396  14.276 10.505  1.00 30.96  ?  422  VAL A C      1 
ATOM   1372 O  O      . VAL C 3 126 ? 11.169  13.905 11.659  1.00 32.04  ?  422  VAL A O      1 
ATOM   1373 C  CB     . VAL C 3 126 ? 9.546   15.798 9.645   1.00 24.10  ?  422  VAL A CB     1 
ATOM   1374 C  CG1    . VAL C 3 126 ? 8.969   15.960 11.048  1.00 20.21  ?  422  VAL A CG1    1 
ATOM   1375 C  CG2    . VAL C 3 126 ? 10.486  16.952 9.302   1.00 18.66  ?  422  VAL A CG2    1 
ATOM   1376 N  N      . ARG C 3 127 ? 12.629  14.540 10.053  1.00 19.68  ?  423  ARG A N      1 
ATOM   1377 C  CA     . ARG C 3 127 ? 13.740  14.340 10.974  1.00 19.61  ?  423  ARG A CA     1 
ATOM   1378 C  C      . ARG C 3 127 ? 14.053  15.623 11.739  1.00 16.81  ?  423  ARG A C      1 
ATOM   1379 O  O      . ARG C 3 127 ? 13.804  16.730 11.245  1.00 18.04  ?  423  ARG A O      1 
ATOM   1380 C  CB     . ARG C 3 127 ? 14.985  13.893 10.217  1.00 26.33  ?  423  ARG A CB     1 
ATOM   1381 C  CG     . ARG C 3 127 ? 14.815  12.609 9.436   1.00 32.70  ?  423  ARG A CG     1 
ATOM   1382 C  CD     . ARG C 3 127 ? 15.866  12.514 8.344   1.00 43.59  ?  423  ARG A CD     1 
ATOM   1383 N  NE     . ARG C 3 127 ? 17.206  12.316 8.885   1.00 48.50  ?  423  ARG A NE     1 
ATOM   1384 C  CZ     . ARG C 3 127 ? 18.326  12.533 8.203   1.00 55.16  ?  423  ARG A CZ     1 
ATOM   1385 N  NH1    . ARG C 3 127 ? 19.501  12.319 8.777   1.00 60.32  ?  423  ARG A NH1    1 
ATOM   1386 N  NH2    . ARG C 3 127 ? 18.273  12.974 6.952   1.00 45.15  ?  423  ARG A NH2    1 
ATOM   1387 N  N      . PRO C 3 128 ? 14.599  15.502 12.947  1.00 23.64  ?  424  PRO A N      1 
ATOM   1388 C  CA     . PRO C 3 128 ? 15.068  16.698 13.659  1.00 23.37  ?  424  PRO A CA     1 
ATOM   1389 C  C      . PRO C 3 128 ? 16.238  17.328 12.916  1.00 27.94  ?  424  PRO A C      1 
ATOM   1390 O  O      . PRO C 3 128 ? 17.066  16.634 12.322  1.00 25.28  ?  424  PRO A O      1 
ATOM   1391 C  CB     . PRO C 3 128 ? 15.494  16.156 15.033  1.00 23.87  ?  424  PRO A CB     1 
ATOM   1392 C  CG     . PRO C 3 128 ? 14.890  14.770 15.121  1.00 28.15  ?  424  PRO A CG     1 
ATOM   1393 C  CD     . PRO C 3 128 ? 14.812  14.267 13.722  1.00 26.47  ?  424  PRO A CD     1 
ATOM   1394 N  N      . ASP C 3 129 ? 16.302  18.661 12.957  1.00 26.37  ?  425  ASP A N      1 
ATOM   1395 C  CA     . ASP C 3 129 ? 17.367  19.369 12.250  1.00 27.14  ?  425  ASP A CA     1 
ATOM   1396 C  C      . ASP C 3 129 ? 18.745  18.877 12.677  1.00 32.68  ?  425  ASP A C      1 
ATOM   1397 O  O      . ASP C 3 129 ? 19.665  18.791 11.854  1.00 25.11  ?  425  ASP A O      1 
ATOM   1398 C  CB     . ASP C 3 129 ? 17.247  20.876 12.480  1.00 28.80  ?  425  ASP A CB     1 
ATOM   1399 C  CG     . ASP C 3 129 ? 16.092  21.498 11.717  1.00 39.70  ?  425  ASP A CG     1 
ATOM   1400 O  OD1    . ASP C 3 129 ? 15.650  20.902 10.711  1.00 31.89  ?  425  ASP A OD1    1 
ATOM   1401 O  OD2    . ASP C 3 129 ? 15.630  22.586 12.121  1.00 41.06  ?  425  ASP A OD2    1 
ATOM   1402 N  N      . GLU C 3 130 ? 18.913  18.546 13.959  1.00 32.76  ?  426  GLU A N      1 
ATOM   1403 C  CA     . GLU C 3 130 ? 20.233  18.138 14.426  1.00 37.47  ?  426  GLU A CA     1 
ATOM   1404 C  C      . GLU C 3 130 ? 20.665  16.806 13.818  1.00 32.26  ?  426  GLU A C      1 
ATOM   1405 O  O      . GLU C 3 130 ? 21.863  16.577 13.618  1.00 38.19  ?  426  GLU A O      1 
ATOM   1406 C  CB     . GLU C 3 130 ? 20.255  18.067 15.953  1.00 45.56  ?  426  GLU A CB     1 
ATOM   1407 C  CG     . GLU C 3 130 ? 21.535  17.484 16.528  1.00 63.55  ?  426  GLU A CG     1 
ATOM   1408 C  CD     . GLU C 3 130 ? 21.680  17.750 18.014  1.00 75.62  ?  426  GLU A CD     1 
ATOM   1409 O  OE1    . GLU C 3 130 ? 21.293  18.851 18.461  1.00 75.77  ?  426  GLU A OE1    1 
ATOM   1410 O  OE2    . GLU C 3 130 ? 22.180  16.860 18.735  1.00 79.76  ?  426  GLU A OE2    1 
ATOM   1411 N  N      . ALA C 3 131 ? 19.715  15.922 13.510  1.00 32.98  ?  427  ALA A N      1 
ATOM   1412 C  CA     . ALA C 3 131 ? 20.074  14.663 12.865  1.00 34.70  ?  427  ALA A CA     1 
ATOM   1413 C  C      . ALA C 3 131 ? 20.525  14.874 11.423  1.00 33.22  ?  427  ALA A C      1 
ATOM   1414 O  O      . ALA C 3 131 ? 21.361  14.115 10.918  1.00 34.22  ?  427  ALA A O      1 
ATOM   1415 C  CB     . ALA C 3 131 ? 18.894  13.690 12.914  1.00 36.28  ?  427  ALA A CB     1 
ATOM   1416 N  N      . VAL C 3 132 ? 19.985  15.887 10.748  1.00 30.51  ?  428  VAL A N      1 
ATOM   1417 C  CA     . VAL C 3 132 ? 20.342  16.130 9.355   1.00 27.28  ?  428  VAL A CA     1 
ATOM   1418 C  C      . VAL C 3 132 ? 21.668  16.872 9.259   1.00 33.82  ?  428  VAL A C      1 
ATOM   1419 O  O      . VAL C 3 132 ? 22.566  16.475 8.507   1.00 35.25  ?  428  VAL A O      1 
ATOM   1420 C  CB     . VAL C 3 132 ? 19.219  16.905 8.642   1.00 30.82  ?  428  VAL A CB     1 
ATOM   1421 C  CG1    . VAL C 3 132 ? 19.618  17.200 7.205   1.00 37.61  ?  428  VAL A CG1    1 
ATOM   1422 C  CG2    . VAL C 3 132 ? 17.913  16.132 8.692   1.00 34.73  ?  428  VAL A CG2    1 
ATOM   1423 N  N      . TYR C 3 133 ? 21.813  17.954 10.024  1.00 37.55  ?  429  TYR A N      1 
ATOM   1424 C  CA     . TYR C 3 133 ? 22.973  18.832 9.933   1.00 31.00  ?  429  TYR A CA     1 
ATOM   1425 C  C      . TYR C 3 133 ? 24.086  18.483 10.915  1.00 36.34  ?  429  TYR A C      1 
ATOM   1426 O  O      . TYR C 3 133 ? 25.170  19.068 10.825  1.00 39.03  ?  429  TYR A O      1 
ATOM   1427 C  CB     . TYR C 3 133 ? 22.554  20.290 10.151  1.00 34.37  ?  429  TYR A CB     1 
ATOM   1428 C  CG     . TYR C 3 133 ? 21.425  20.745 9.247   1.00 33.89  ?  429  TYR A CG     1 
ATOM   1429 C  CD1    . TYR C 3 133 ? 20.189  21.114 9.769   1.00 35.60  ?  429  TYR A CD1    1 
ATOM   1430 C  CD2    . TYR C 3 133 ? 21.593  20.794 7.872   1.00 32.76  ?  429  TYR A CD2    1 
ATOM   1431 C  CE1    . TYR C 3 133 ? 19.159  21.525 8.942   1.00 27.55  ?  429  TYR A CE1    1 
ATOM   1432 C  CE2    . TYR C 3 133 ? 20.574  21.199 7.041   1.00 30.15  ?  429  TYR A CE2    1 
ATOM   1433 C  CZ     . TYR C 3 133 ? 19.360  21.563 7.577   1.00 34.45  ?  429  TYR A CZ     1 
ATOM   1434 O  OH     . TYR C 3 133 ? 18.352  21.966 6.732   1.00 26.24  ?  429  TYR A OH     1 
ATOM   1435 N  N      . GLY C 3 134 ? 23.869  17.540 11.831  1.00 36.74  ?  430  GLY A N      1 
ATOM   1436 C  CA     . GLY C 3 134 ? 24.848  17.273 12.869  1.00 41.63  ?  430  GLY A CA     1 
ATOM   1437 C  C      . GLY C 3 134 ? 24.904  18.431 13.835  1.00 45.86  ?  430  GLY A C      1 
ATOM   1438 O  O      . GLY C 3 134 ? 24.185  19.415 13.650  1.00 39.84  ?  430  GLY A O      1 
ATOM   1439 N  N      . LYS C 3 135 ? 25.739  18.342 14.868  1.00 60.35  ?  431  LYS A N      1 
ATOM   1440 C  CA     . LYS C 3 135 ? 25.856  19.439 15.815  1.00 63.30  ?  431  LYS A CA     1 
ATOM   1441 C  C      . LYS C 3 135 ? 27.324  19.711 16.114  1.00 63.64  ?  431  LYS A C      1 
ATOM   1442 O  O      . LYS C 3 135 ? 28.152  18.793 16.113  1.00 63.72  ?  431  LYS A O      1 
ATOM   1443 C  CB     . LYS C 3 135 ? 25.094  19.145 17.109  1.00 63.13  ?  431  LYS A CB     1 
ATOM   1444 C  CG     . LYS C 3 135 ? 25.729  18.104 18.016  1.00 64.42  ?  431  LYS A CG     1 
ATOM   1445 C  CD     . LYS C 3 135 ? 25.023  18.057 19.361  1.00 69.71  ?  431  LYS A CD     1 
ATOM   1446 C  CE     . LYS C 3 135 ? 25.584  16.975 20.266  1.00 76.93  ?  431  LYS A CE     1 
ATOM   1447 N  NZ     . LYS C 3 135 ? 24.866  16.966 21.572  1.00 79.29  ?  431  LYS A NZ     1 
ATOM   1448 N  N      . GLY C 3 136 ? 27.636  20.978 16.381  1.00 60.46  ?  432  GLY A N      1 
ATOM   1449 C  CA     . GLY C 3 136 ? 28.997  21.375 16.678  1.00 59.64  ?  432  GLY A CA     1 
ATOM   1450 C  C      . GLY C 3 136 ? 29.937  21.373 15.490  1.00 63.97  ?  432  GLY A C      1 
ATOM   1451 O  O      . GLY C 3 136 ? 29.567  21.815 14.397  1.00 62.91  ?  432  GLY A O      1 
ATOM   1452 N  N      . ALA C 3 137 ? 31.163  20.879 15.691  1.00 61.37  ?  433  ALA A N      1 
ATOM   1453 C  CA     . ALA C 3 137 ? 32.128  20.823 14.597  1.00 54.72  ?  433  ALA A CA     1 
ATOM   1454 C  C      . ALA C 3 137 ? 31.569  20.058 13.404  1.00 58.63  ?  433  ALA A C      1 
ATOM   1455 O  O      . ALA C 3 137 ? 31.743  20.476 12.256  1.00 64.03  ?  433  ALA A O      1 
ATOM   1456 C  CB     . ALA C 3 137 ? 33.431  20.189 15.083  1.00 41.18  ?  433  ALA A CB     1 
ATOM   1457 N  N      . LYS C 3 138 ? 30.890  18.937 13.656  1.00 56.05  ?  434  LYS A N      1 
ATOM   1458 C  CA     . LYS C 3 138 ? 30.357  18.122 12.572  1.00 59.75  ?  434  LYS A CA     1 
ATOM   1459 C  C      . LYS C 3 138 ? 29.205  18.788 11.831  1.00 57.12  ?  434  LYS A C      1 
ATOM   1460 O  O      . LYS C 3 138 ? 28.752  18.242 10.820  1.00 51.45  ?  434  LYS A O      1 
ATOM   1461 C  CB     . LYS C 3 138 ? 29.898  16.765 13.113  1.00 61.44  ?  434  LYS A CB     1 
ATOM   1462 C  CG     . LYS C 3 138 ? 31.023  15.856 13.587  1.00 62.13  ?  434  LYS A CG     1 
ATOM   1463 C  CD     . LYS C 3 138 ? 31.637  16.348 14.885  1.00 64.71  ?  434  LYS A CD     1 
ATOM   1464 C  CE     . LYS C 3 138 ? 32.799  15.465 15.300  1.00 66.19  ?  434  LYS A CE     1 
ATOM   1465 N  NZ     . LYS C 3 138 ? 33.835  15.408 14.233  1.00 67.94  ?  434  LYS A NZ     1 
ATOM   1466 N  N      . ARG C 3 139 ? 28.719  19.935 12.302  1.00 56.24  ?  435  ARG A N      1 
ATOM   1467 C  CA     . ARG C 3 139 ? 27.589  20.587 11.651  1.00 50.57  ?  435  ARG A CA     1 
ATOM   1468 C  C      . ARG C 3 139 ? 27.964  20.990 10.231  1.00 53.31  ?  435  ARG A C      1 
ATOM   1469 O  O      . ARG C 3 139 ? 28.966  21.676 10.010  1.00 67.08  ?  435  ARG A O      1 
ATOM   1470 C  CB     . ARG C 3 139 ? 27.146  21.808 12.462  1.00 44.31  ?  435  ARG A CB     1 
ATOM   1471 C  CG     . ARG C 3 139 ? 25.856  22.466 11.981  1.00 47.73  ?  435  ARG A CG     1 
ATOM   1472 C  CD     . ARG C 3 139 ? 25.329  23.468 13.007  1.00 48.90  ?  435  ARG A CD     1 
ATOM   1473 N  NE     . ARG C 3 139 ? 24.183  24.228 12.512  1.00 48.37  ?  435  ARG A NE     1 
ATOM   1474 C  CZ     . ARG C 3 139 ? 22.913  23.903 12.736  1.00 53.30  ?  435  ARG A CZ     1 
ATOM   1475 N  NH1    . ARG C 3 139 ? 22.618  22.826 13.451  1.00 66.18  ?  435  ARG A NH1    1 
ATOM   1476 N  NH2    . ARG C 3 139 ? 21.937  24.656 12.248  1.00 52.68  ?  435  ARG A NH2    1 
ATOM   1477 N  N      . ALA C 3 140 ? 27.167  20.543 9.264   1.00 44.23  ?  436  ALA A N      1 
ATOM   1478 C  CA     . ALA C 3 140 ? 27.449  20.816 7.863   1.00 43.11  ?  436  ALA A CA     1 
ATOM   1479 C  C      . ALA C 3 140 ? 26.178  20.626 7.053   1.00 45.76  ?  436  ALA A C      1 
ATOM   1480 O  O      . ALA C 3 140 ? 25.308  19.829 7.415   1.00 34.38  ?  436  ALA A O      1 
ATOM   1481 C  CB     . ALA C 3 140 ? 28.560  19.909 7.322   1.00 46.09  ?  436  ALA A CB     1 
ATOM   1482 N  N      . VAL C 3 141 ? 26.083  21.365 5.958   1.00 45.58  ?  437  VAL A N      1 
ATOM   1483 C  CA     . VAL C 3 141 ? 24.954  21.190 5.040   1.00 42.52  ?  437  VAL A CA     1 
ATOM   1484 C  C      . VAL C 3 141 ? 25.160  19.905 4.247   1.00 36.25  ?  437  VAL A C      1 
ATOM   1485 O  O      . VAL C 3 141 ? 26.245  19.703 3.677   1.00 35.33  ?  437  VAL A O      1 
ATOM   1486 C  CB     . VAL C 3 141 ? 24.832  22.401 4.115   1.00 39.05  ?  437  VAL A CB     1 
ATOM   1487 C  CG1    . VAL C 3 141 ? 23.547  22.329 3.307   1.00 37.86  ?  437  VAL A CG1    1 
ATOM   1488 C  CG2    . VAL C 3 141 ? 24.884  23.689 4.929   1.00 43.97  ?  437  VAL A CG2    1 
ATOM   1489 N  N      . PRO C 3 142 ? 24.181  19.007 4.198   1.00 38.66  ?  438  PRO A N      1 
ATOM   1490 C  CA     . PRO C 3 142 ? 24.357  17.749 3.468   1.00 40.28  ?  438  PRO A CA     1 
ATOM   1491 C  C      . PRO C 3 142 ? 24.074  17.922 1.981   1.00 40.49  ?  438  PRO A C      1 
ATOM   1492 O  O      . PRO C 3 142 ? 23.545  18.939 1.532   1.00 37.67  ?  438  PRO A O      1 
ATOM   1493 C  CB     . PRO C 3 142 ? 23.330  16.823 4.122   1.00 36.13  ?  438  PRO A CB     1 
ATOM   1494 C  CG     . PRO C 3 142 ? 22.232  17.746 4.527   1.00 34.44  ?  438  PRO A CG     1 
ATOM   1495 C  CD     . PRO C 3 142 ? 22.887  19.061 4.901   1.00 32.36  ?  438  PRO A CD     1 
ATOM   1496 N  N      . ASP C 3 143 ? 24.436  16.888 1.217   1.00 46.34  ?  439  ASP A N      1 
ATOM   1497 C  CA     . ASP C 3 143 ? 24.240  16.879 -0.229  1.00 46.78  ?  439  ASP A CA     1 
ATOM   1498 C  C      . ASP C 3 143 ? 22.803  17.221 -0.603  1.00 42.48  ?  439  ASP A C      1 
ATOM   1499 O  O      . ASP C 3 143 ? 21.883  17.035 0.201   1.00 43.60  ?  439  ASP A O      1 
ATOM   1500 C  CB     . ASP C 3 143 ? 24.623  15.518 -0.815  1.00 51.74  ?  439  ASP A CB     1 
ATOM   1501 C  CG     . ASP C 3 143 ? 26.124  15.314 -0.882  1.00 69.13  ?  439  ASP A CG     1 
ATOM   1502 O  OD1    . ASP C 3 143 ? 26.868  16.216 -0.441  1.00 72.93  ?  439  ASP A OD1    1 
ATOM   1503 O  OD2    . ASP C 3 143 ? 26.559  14.253 -1.379  1.00 79.11  ?  439  ASP A OD2    1 
ATOM   1504 N  N      . GLU C 3 144 ? 22.601  17.705 -1.828  1.00 37.51  ?  440  GLU A N      1 
ATOM   1505 C  CA     . GLU C 3 144 ? 21.280  18.186 -2.222  1.00 35.45  ?  440  GLU A CA     1 
ATOM   1506 C  C      . GLU C 3 144 ? 20.175  17.152 -2.055  1.00 35.10  ?  440  GLU A C      1 
ATOM   1507 O  O      . GLU C 3 144 ? 19.084  17.530 -1.591  1.00 28.41  ?  440  GLU A O      1 
ATOM   1508 C  CB     . GLU C 3 144 ? 21.314  18.682 -3.672  1.00 37.33  ?  440  GLU A CB     1 
ATOM   1509 C  CG     . GLU C 3 144 ? 19.970  19.198 -4.158  1.00 32.91  ?  440  GLU A CG     1 
ATOM   1510 C  CD     . GLU C 3 144 ? 20.060  19.860 -5.515  1.00 49.53  ?  440  GLU A CD     1 
ATOM   1511 O  OE1    . GLU C 3 144 ? 19.800  19.182 -6.531  1.00 50.68  ?  440  GLU A OE1    1 
ATOM   1512 O  OE2    . GLU C 3 144 ? 20.404  21.060 -5.564  1.00 50.81  ?  440  GLU A OE2    1 
ATOM   1513 N  N      . PRO C 3 145 ? 20.353  15.881 -2.428  1.00 30.87  ?  441  PRO A N      1 
ATOM   1514 C  CA     . PRO C 3 145 ? 19.244  14.926 -2.254  1.00 34.56  ?  441  PRO A CA     1 
ATOM   1515 C  C      . PRO C 3 145 ? 18.800  14.810 -0.809  1.00 35.66  ?  441  PRO A C      1 
ATOM   1516 O  O      . PRO C 3 145 ? 17.596  14.835 -0.523  1.00 35.25  ?  441  PRO A O      1 
ATOM   1517 C  CB     . PRO C 3 145 ? 19.828  13.611 -2.794  1.00 35.22  ?  441  PRO A CB     1 
ATOM   1518 C  CG     . PRO C 3 145 ? 20.919  14.026 -3.708  1.00 33.81  ?  441  PRO A CG     1 
ATOM   1519 C  CD     . PRO C 3 145 ? 21.506  15.269 -3.111  1.00 35.02  ?  441  PRO A CD     1 
ATOM   1520 N  N      . VAL C 3 146 ? 19.750  14.683 0.117   1.00 31.56  ?  442  VAL A N      1 
ATOM   1521 C  CA     . VAL C 3 146 ? 19.402  14.623 1.532   1.00 27.38  ?  442  VAL A CA     1 
ATOM   1522 C  C      . VAL C 3 146 ? 18.815  15.950 1.989   1.00 31.22  ?  442  VAL A C      1 
ATOM   1523 O  O      . VAL C 3 146 ? 17.803  15.990 2.698   1.00 30.17  ?  442  VAL A O      1 
ATOM   1524 C  CB     . VAL C 3 146 ? 20.631  14.231 2.371   1.00 36.60  ?  442  VAL A CB     1 
ATOM   1525 C  CG1    . VAL C 3 146 ? 20.307  14.329 3.850   1.00 38.52  ?  442  VAL A CG1    1 
ATOM   1526 C  CG2    . VAL C 3 146 ? 21.080  12.832 2.018   1.00 39.14  ?  442  VAL A CG2    1 
ATOM   1527 N  N      . LEU C 3 147 ? 19.442  17.060 1.594   1.00 32.00  ?  443  LEU A N      1 
ATOM   1528 C  CA     . LEU C 3 147 ? 18.934  18.364 1.999   1.00 26.29  ?  443  LEU A CA     1 
ATOM   1529 C  C      . LEU C 3 147 ? 17.517  18.577 1.483   1.00 27.46  ?  443  LEU A C      1 
ATOM   1530 O  O      . LEU C 3 147 ? 16.619  18.972 2.238   1.00 23.26  ?  443  LEU A O      1 
ATOM   1531 C  CB     . LEU C 3 147 ? 19.866  19.470 1.502   1.00 25.63  ?  443  LEU A CB     1 
ATOM   1532 C  CG     . LEU C 3 147 ? 19.323  20.893 1.671   1.00 30.20  ?  443  LEU A CG     1 
ATOM   1533 C  CD1    . LEU C 3 147 ? 19.143  21.222 3.142   1.00 23.51  ?  443  LEU A CD1    1 
ATOM   1534 C  CD2    . LEU C 3 147 ? 20.216  21.922 0.989   1.00 25.16  ?  443  LEU A CD2    1 
ATOM   1535 N  N      . ALA C 3 148 ? 17.295  18.300 0.195   1.00 29.19  ?  444  ALA A N      1 
ATOM   1536 C  CA     . ALA C 3 148 ? 15.990  18.539 -0.415  1.00 29.66  ?  444  ALA A CA     1 
ATOM   1537 C  C      . ALA C 3 148 ? 14.909  17.672 0.216   1.00 35.98  ?  444  ALA A C      1 
ATOM   1538 O  O      . ALA C 3 148 ? 13.754  18.099 0.341   1.00 23.95  ?  444  ALA A O      1 
ATOM   1539 C  CB     . ALA C 3 148 ? 16.060  18.290 -1.923  1.00 31.67  ?  444  ALA A CB     1 
ATOM   1540 N  N      . GLU C 3 149 ? 15.250  16.441 0.599   1.00 33.14  ?  445  GLU A N      1 
ATOM   1541 C  CA     . GLU C 3 149 ? 14.255  15.600 1.251   1.00 32.71  ?  445  GLU A CA     1 
ATOM   1542 C  C      . GLU C 3 149 ? 13.881  16.159 2.616   1.00 29.31  ?  445  GLU A C      1 
ATOM   1543 O  O      . GLU C 3 149 ? 12.703  16.164 2.991   1.00 34.13  ?  445  GLU A O      1 
ATOM   1544 C  CB     . GLU C 3 149 ? 14.760  14.165 1.377   1.00 30.85  ?  445  GLU A CB     1 
ATOM   1545 C  CG     . GLU C 3 149 ? 13.861  13.320 2.263   1.00 36.10  ?  445  GLU A CG     1 
ATOM   1546 C  CD     . GLU C 3 149 ? 13.959  11.839 1.980   1.00 51.33  ?  445  GLU A CD     1 
ATOM   1547 O  OE1    . GLU C 3 149 ? 14.873  11.420 1.237   1.00 52.00  ?  445  GLU A OE1    1 
ATOM   1548 O  OE2    . GLU C 3 149 ? 13.107  11.095 2.505   1.00 46.65  ?  445  GLU A OE2    1 
ATOM   1549 N  N      . HIS C 3 150 ? 14.868  16.654 3.366   1.00 31.44  ?  446  HIS A N      1 
ATOM   1550 C  CA     . HIS C 3 150 ? 14.579  17.227 4.678   1.00 29.52  ?  446  HIS A CA     1 
ATOM   1551 C  C      . HIS C 3 150 ? 13.679  18.449 4.555   1.00 25.30  ?  446  HIS A C      1 
ATOM   1552 O  O      . HIS C 3 150 ? 12.680  18.575 5.273   1.00 22.09  ?  446  HIS A O      1 
ATOM   1553 C  CB     . HIS C 3 150 ? 15.882  17.587 5.396   1.00 24.15  ?  446  HIS A CB     1 
ATOM   1554 C  CG     . HIS C 3 150 ? 15.679  18.143 6.772   1.00 28.47  ?  446  HIS A CG     1 
ATOM   1555 N  ND1    . HIS C 3 150 ? 14.926  17.501 7.731   1.00 28.01  ?  446  HIS A ND1    1 
ATOM   1556 C  CD2    . HIS C 3 150 ? 16.133  19.281 7.350   1.00 27.62  ?  446  HIS A CD2    1 
ATOM   1557 C  CE1    . HIS C 3 150 ? 14.922  18.221 8.840   1.00 27.00  ?  446  HIS A CE1    1 
ATOM   1558 N  NE2    . HIS C 3 150 ? 15.649  19.304 8.635   1.00 26.81  ?  446  HIS A NE2    1 
ATOM   1559 N  N      . LEU C 3 151 ? 14.012  19.362 3.641   1.00 18.92  ?  447  LEU A N      1 
ATOM   1560 C  CA     . LEU C 3 151 ? 13.229  20.586 3.513   1.00 26.23  ?  447  LEU A CA     1 
ATOM   1561 C  C      . LEU C 3 151 ? 11.795  20.284 3.094   1.00 22.57  ?  447  LEU A C      1 
ATOM   1562 O  O      . LEU C 3 151 ? 10.848  20.899 3.602   1.00 20.67  ?  447  LEU A O      1 
ATOM   1563 C  CB     . LEU C 3 151 ? 13.904  21.537 2.523   1.00 21.88  ?  447  LEU A CB     1 
ATOM   1564 C  CG     . LEU C 3 151 ? 15.335  21.952 2.884   1.00 24.64  ?  447  LEU A CG     1 
ATOM   1565 C  CD1    . LEU C 3 151 ? 15.745  23.203 2.123   1.00 17.25  ?  447  LEU A CD1    1 
ATOM   1566 C  CD2    . LEU C 3 151 ? 15.494  22.162 4.385   1.00 28.93  ?  447  LEU A CD2    1 
ATOM   1567 N  N      . VAL C 3 152 ? 11.612  19.323 2.186   1.00 22.85  ?  448  VAL A N      1 
ATOM   1568 C  CA     . VAL C 3 152 ? 10.271  18.978 1.725   1.00 23.64  ?  448  VAL A CA     1 
ATOM   1569 C  C      . VAL C 3 152 ? 9.493   18.255 2.820   1.00 22.47  ?  448  VAL A C      1 
ATOM   1570 O  O      . VAL C 3 152 ? 8.281   18.451 2.970   1.00 18.34  ?  448  VAL A O      1 
ATOM   1571 C  CB     . VAL C 3 152 ? 10.357  18.144 0.436   1.00 22.36  ?  448  VAL A CB     1 
ATOM   1572 C  CG1    . VAL C 3 152 ? 8.984   17.644 0.025   1.00 21.54  ?  448  VAL A CG1    1 
ATOM   1573 C  CG2    . VAL C 3 152 ? 10.990  18.976 -0.684  1.00 21.34  ?  448  VAL A CG2    1 
ATOM   1574 N  N      . ARG C 3 153 ? 10.170  17.408 3.601   1.00 17.97  ?  449  ARG A N      1 
ATOM   1575 C  CA     . ARG C 3 153 ? 9.501   16.782 4.738   1.00 20.89  ?  449  ARG A CA     1 
ATOM   1576 C  C      . ARG C 3 153 ? 9.092   17.821 5.776   1.00 22.67  ?  449  ARG A C      1 
ATOM   1577 O  O      . ARG C 3 153 ? 8.015   17.718 6.379   1.00 16.37  ?  449  ARG A O      1 
ATOM   1578 C  CB     . ARG C 3 153 ? 10.400  15.708 5.356   1.00 19.61  ?  449  ARG A CB     1 
ATOM   1579 C  CG     . ARG C 3 153 ? 10.437  14.425 4.542   1.00 28.87  ?  449  ARG A CG     1 
ATOM   1580 C  CD     . ARG C 3 153 ? 11.259  13.342 5.211   1.00 29.09  ?  449  ARG A CD     1 
ATOM   1581 N  NE     . ARG C 3 153 ? 11.185  12.089 4.469   1.00 35.72  ?  449  ARG A NE     1 
ATOM   1582 C  CZ     . ARG C 3 153 ? 10.179  11.226 4.570   1.00 37.49  ?  449  ARG A CZ     1 
ATOM   1583 N  NH1    . ARG C 3 153 ? 9.163   11.486 5.383   1.00 31.02  ?  449  ARG A NH1    1 
ATOM   1584 N  NH2    . ARG C 3 153 ? 10.184  10.108 3.858   1.00 37.61  ?  449  ARG A NH2    1 
ATOM   1585 N  N      . LYS C 3 154 ? 9.927   18.841 5.993   1.00 17.33  ?  450  LYS A N      1 
ATOM   1586 C  CA     . LYS C 3 154 ? 9.546   19.894 6.929   1.00 22.85  ?  450  LYS A CA     1 
ATOM   1587 C  C      . LYS C 3 154 ? 8.371   20.702 6.398   1.00 18.16  ?  450  LYS A C      1 
ATOM   1588 O  O      . LYS C 3 154 ? 7.458   21.050 7.156   1.00 20.08  ?  450  LYS A O      1 
ATOM   1589 C  CB     . LYS C 3 154 ? 10.739  20.802 7.230   1.00 21.87  ?  450  LYS A CB     1 
ATOM   1590 C  CG     . LYS C 3 154 ? 11.746  20.168 8.173   1.00 26.11  ?  450  LYS A CG     1 
ATOM   1591 C  CD     . LYS C 3 154 ? 12.622  21.208 8.857   1.00 32.00  ?  450  LYS A CD     1 
ATOM   1592 C  CE     . LYS C 3 154 ? 13.501  21.942 7.865   1.00 40.61  ?  450  LYS A CE     1 
ATOM   1593 N  NZ     . LYS C 3 154 ? 14.368  22.940 8.550   1.00 32.40  ?  450  LYS A NZ     1 
ATOM   1594 N  N      . ALA C 3 155 ? 8.371   20.999 5.096   1.00 22.40  ?  451  ALA A N      1 
ATOM   1595 C  CA     . ALA C 3 155 ? 7.261   21.733 4.501   1.00 17.41  ?  451  ALA A CA     1 
ATOM   1596 C  C      . ALA C 3 155 ? 5.985   20.904 4.508   1.00 18.28  ?  451  ALA A C      1 
ATOM   1597 O  O      . ALA C 3 155 ? 4.891   21.436 4.725   1.00 15.34  ?  451  ALA A O      1 
ATOM   1598 C  CB     . ALA C 3 155 ? 7.619   22.147 3.074   1.00 16.88  ?  451  ALA A CB     1 
ATOM   1599 N  N      . ALA C 3 156 ? 6.105   19.597 4.263   1.00 18.73  ?  452  ALA A N      1 
ATOM   1600 C  CA     . ALA C 3 156 ? 4.932   18.731 4.286   1.00 20.61  ?  452  ALA A CA     1 
ATOM   1601 C  C      . ALA C 3 156 ? 4.376   18.596 5.698   1.00 21.47  ?  452  ALA A C      1 
ATOM   1602 O  O      . ALA C 3 156 ? 3.155   18.527 5.889   1.00 17.01  ?  452  ALA A O      1 
ATOM   1603 C  CB     . ALA C 3 156 ? 5.283   17.360 3.704   1.00 17.53  ?  452  ALA A CB     1 
ATOM   1604 N  N      . ALA C 3 157 ? 5.255   18.558 6.700   1.00 19.00  ?  453  ALA A N      1 
ATOM   1605 C  CA     . ALA C 3 157 ? 4.793   18.521 8.081   1.00 18.83  ?  453  ALA A CA     1 
ATOM   1606 C  C      . ALA C 3 157 ? 4.068   19.813 8.442   1.00 22.56  ?  453  ALA A C      1 
ATOM   1607 O  O      . ALA C 3 157 ? 2.996   19.785 9.056   1.00 20.52  ?  453  ALA A O      1 
ATOM   1608 C  CB     . ALA C 3 157 ? 5.971   18.268 9.024   1.00 12.55  ?  453  ALA A CB     1 
ATOM   1609 N  N      . ILE C 3 158 ? 4.634   20.959 8.054   1.00 19.10  ?  454  ILE A N      1 
ATOM   1610 C  CA     . ILE C 3 158 ? 3.974   22.237 8.315   1.00 17.75  ?  454  ILE A CA     1 
ATOM   1611 C  C      . ILE C 3 158 ? 2.610   22.269 7.641   1.00 18.07  ?  454  ILE A C      1 
ATOM   1612 O  O      . ILE C 3 158 ? 1.606   22.670 8.243   1.00 21.50  ?  454  ILE A O      1 
ATOM   1613 C  CB     . ILE C 3 158 ? 4.865   23.402 7.846   1.00 17.95  ?  454  ILE A CB     1 
ATOM   1614 C  CG1    . ILE C 3 158 ? 6.152   23.451 8.665   1.00 25.01  ?  454  ILE A CG1    1 
ATOM   1615 C  CG2    . ILE C 3 158 ? 4.114   24.715 7.938   1.00 26.26  ?  454  ILE A CG2    1 
ATOM   1616 C  CD1    . ILE C 3 158 ? 7.230   24.308 8.047   1.00 17.30  ?  454  ILE A CD1    1 
ATOM   1617 N  N      . TRP C 3 159 ? 2.555   21.841 6.381   1.00 21.16  ?  455  TRP A N      1 
ATOM   1618 C  CA     . TRP C 3 159 ? 1.290   21.704 5.670   1.00 18.47  ?  455  TRP A CA     1 
ATOM   1619 C  C      . TRP C 3 159 ? 0.283   20.877 6.466   1.00 28.02  ?  455  TRP A C      1 
ATOM   1620 O  O      . TRP C 3 159 ? -0.876  21.276 6.634   1.00 28.39  ?  455  TRP A O      1 
ATOM   1621 C  CB     . TRP C 3 159 ? 1.564   21.069 4.307   1.00 27.01  ?  455  TRP A CB     1 
ATOM   1622 C  CG     . TRP C 3 159 ? 0.423   21.078 3.360   1.00 33.65  ?  455  TRP A CG     1 
ATOM   1623 C  CD1    . TRP C 3 159 ? -0.266  20.000 2.898   1.00 33.53  ?  455  TRP A CD1    1 
ATOM   1624 C  CD2    . TRP C 3 159 ? -0.157  22.225 2.735   1.00 30.08  ?  455  TRP A CD2    1 
ATOM   1625 N  NE1    . TRP C 3 159 ? -1.243  20.402 2.022   1.00 35.44  ?  455  TRP A NE1    1 
ATOM   1626 C  CE2    . TRP C 3 159 ? -1.197  21.766 1.905   1.00 35.14  ?  455  TRP A CE2    1 
ATOM   1627 C  CE3    . TRP C 3 159 ? 0.104   23.599 2.797   1.00 29.11  ?  455  TRP A CE3    1 
ATOM   1628 C  CZ2    . TRP C 3 159 ? -1.979  22.629 1.144   1.00 37.29  ?  455  TRP A CZ2    1 
ATOM   1629 C  CZ3    . TRP C 3 159 ? -0.672  24.456 2.039   1.00 33.52  ?  455  TRP A CZ3    1 
ATOM   1630 C  CH2    . TRP C 3 159 ? -1.702  23.967 1.223   1.00 35.20  ?  455  TRP A CH2    1 
ATOM   1631 N  N      . ALA C 3 160 ? 0.712   19.714 6.963   1.00 20.65  ?  456  ALA A N      1 
ATOM   1632 C  CA     . ALA C 3 160 ? -0.188  18.822 7.680   1.00 19.74  ?  456  ALA A CA     1 
ATOM   1633 C  C      . ALA C 3 160 ? -0.504  19.300 9.092   1.00 24.89  ?  456  ALA A C      1 
ATOM   1634 O  O      . ALA C 3 160 ? -1.546  18.929 9.638   1.00 34.14  ?  456  ALA A O      1 
ATOM   1635 C  CB     . ALA C 3 160 ? 0.401   17.420 7.726   1.00 30.00  ?  456  ALA A CB     1 
ATOM   1636 N  N      . LEU C 3 161 ? 0.355   20.113 9.692   1.00 17.89  ?  457  LEU A N      1 
ATOM   1637 C  CA     . LEU C 3 161 ? 0.199   20.436 11.102  1.00 16.87  ?  457  LEU A CA     1 
ATOM   1638 C  C      . LEU C 3 161 ? -0.603  21.706 11.356  1.00 19.19  ?  457  LEU A C      1 
ATOM   1639 O  O      . LEU C 3 161 ? -1.035  21.921 12.493  1.00 22.01  ?  457  LEU A O      1 
ATOM   1640 C  CB     . LEU C 3 161 ? 1.573   20.549 11.761  1.00 16.79  ?  457  LEU A CB     1 
ATOM   1641 C  CG     . LEU C 3 161 ? 2.329   19.225 11.866  1.00 23.78  ?  457  LEU A CG     1 
ATOM   1642 C  CD1    . LEU C 3 161 ? 3.675   19.446 12.531  1.00 31.24  ?  457  LEU A CD1    1 
ATOM   1643 C  CD2    . LEU C 3 161 ? 1.507   18.221 12.647  1.00 21.36  ?  457  LEU A CD2    1 
ATOM   1644 N  N      . GLU C 3 162 ? -0.838  22.537 10.338  1.00 21.64  ?  458  GLU A N      1 
ATOM   1645 C  CA     . GLU C 3 162 ? -1.517  23.809 10.578  1.00 24.47  ?  458  GLU A CA     1 
ATOM   1646 C  C      . GLU C 3 162 ? -2.883  23.605 11.230  1.00 29.88  ?  458  GLU A C      1 
ATOM   1647 O  O      . GLU C 3 162 ? -3.184  24.213 12.264  1.00 24.79  ?  458  GLU A O      1 
ATOM   1648 C  CB     . GLU C 3 162 ? -1.653  24.594 9.273   1.00 21.67  ?  458  GLU A CB     1 
ATOM   1649 C  CG     . GLU C 3 162 ? -2.502  25.855 9.415   1.00 26.53  ?  458  GLU A CG     1 
ATOM   1650 C  CD     . GLU C 3 162 ? -2.403  26.770 8.209   1.00 39.41  ?  458  GLU A CD     1 
ATOM   1651 O  OE1    . GLU C 3 162 ? -3.270  27.658 8.056   1.00 39.17  ?  458  GLU A OE1    1 
ATOM   1652 O  OE2    . GLU C 3 162 ? -1.454  26.604 7.414   1.00 45.85  ?  458  GLU A OE2    1 
ATOM   1653 N  N      . ARG C 3 163 ? -3.728  22.756 10.640  1.00 24.58  ?  459  ARG A N      1 
ATOM   1654 C  CA     . ARG C 3 163 ? -5.092  22.606 11.150  1.00 24.92  ?  459  ARG A CA     1 
ATOM   1655 C  C      . ARG C 3 163 ? -5.130  22.089 12.582  1.00 27.68  ?  459  ARG A C      1 
ATOM   1656 O  O      . ARG C 3 163 ? -5.825  22.691 13.418  1.00 25.43  ?  459  ARG A O      1 
ATOM   1657 C  CB     . ARG C 3 163 ? -5.903  21.722 10.200  1.00 44.04  ?  459  ARG A CB     1 
ATOM   1658 C  CG     . ARG C 3 163 ? -6.081  22.337 8.818   1.00 65.48  ?  459  ARG A CG     1 
ATOM   1659 C  CD     . ARG C 3 163 ? -7.380  21.912 8.145   1.00 75.50  ?  459  ARG A CD     1 
ATOM   1660 N  NE     . ARG C 3 163 ? -7.244  20.646 7.433   1.00 76.83  ?  459  ARG A NE     1 
ATOM   1661 C  CZ     . ARG C 3 163 ? -6.499  20.484 6.345   1.00 75.38  ?  459  ARG A CZ     1 
ATOM   1662 N  NH1    . ARG C 3 163 ? -5.812  21.507 5.853   1.00 68.28  ?  459  ARG A NH1    1 
ATOM   1663 N  NH2    . ARG C 3 163 ? -6.432  19.299 5.755   1.00 80.73  ?  459  ARG A NH2    1 
ATOM   1664 N  N      . PRO C 3 164 ? -4.459  20.987 12.932  1.00 31.31  ?  460  PRO A N      1 
ATOM   1665 C  CA     . PRO C 3 164 ? -4.518  20.533 14.334  1.00 34.59  ?  460  PRO A CA     1 
ATOM   1666 C  C      . PRO C 3 164 ? -3.983  21.557 15.323  1.00 27.17  ?  460  PRO A C      1 
ATOM   1667 O  O      . PRO C 3 164 ? -4.541  21.705 16.419  1.00 22.35  ?  460  PRO A O      1 
ATOM   1668 C  CB     . PRO C 3 164 ? -3.683  19.241 14.331  1.00 28.49  ?  460  PRO A CB     1 
ATOM   1669 C  CG     . PRO C 3 164 ? -3.017  19.180 12.986  1.00 25.53  ?  460  PRO A CG     1 
ATOM   1670 C  CD     . PRO C 3 164 ? -3.871  19.967 12.049  1.00 27.91  ?  460  PRO A CD     1 
ATOM   1671 N  N      . PHE C 3 165 ? -2.916  22.274 14.975  1.00 16.59  ?  461  PHE A N      1 
ATOM   1672 C  CA     . PHE C 3 165 ? -2.412  23.304 15.880  1.00 17.63  ?  461  PHE A CA     1 
ATOM   1673 C  C      . PHE C 3 165 ? -3.416  24.443 16.038  1.00 20.80  ?  461  PHE A C      1 
ATOM   1674 O  O      . PHE C 3 165 ? -3.697  24.883 17.160  1.00 20.32  ?  461  PHE A O      1 
ATOM   1675 C  CB     . PHE C 3 165 ? -1.057  23.817 15.390  1.00 18.73  ?  461  PHE A CB     1 
ATOM   1676 C  CG     . PHE C 3 165 ? 0.100   23.023 15.913  1.00 26.03  ?  461  PHE A CG     1 
ATOM   1677 C  CD1    . PHE C 3 165 ? 0.429   21.799 15.353  1.00 28.71  ?  461  PHE A CD1    1 
ATOM   1678 C  CD2    . PHE C 3 165 ? 0.839   23.483 16.986  1.00 30.28  ?  461  PHE A CD2    1 
ATOM   1679 C  CE1    . PHE C 3 165 ? 1.483   21.061 15.843  1.00 25.15  ?  461  PHE A CE1    1 
ATOM   1680 C  CE2    . PHE C 3 165 ? 1.896   22.744 17.481  1.00 35.89  ?  461  PHE A CE2    1 
ATOM   1681 C  CZ     . PHE C 3 165 ? 2.216   21.533 16.908  1.00 23.97  ?  461  PHE A CZ     1 
ATOM   1682 N  N      . LEU C 3 166 ? -3.983  24.923 14.926  1.00 26.21  ?  462  LEU A N      1 
ATOM   1683 C  CA     . LEU C 3 166 ? -4.977  25.989 15.009  1.00 27.78  ?  462  LEU A CA     1 
ATOM   1684 C  C      . LEU C 3 166 ? -6.213  25.537 15.771  1.00 27.10  ?  462  LEU A C      1 
ATOM   1685 O  O      . LEU C 3 166 ? -6.823  26.335 16.493  1.00 20.15  ?  462  LEU A O      1 
ATOM   1686 C  CB     . LEU C 3 166 ? -5.363  26.470 13.606  1.00 22.25  ?  462  LEU A CB     1 
ATOM   1687 C  CG     . LEU C 3 166 ? -4.404  27.441 12.903  1.00 29.84  ?  462  LEU A CG     1 
ATOM   1688 C  CD1    . LEU C 3 166 ? -4.906  27.766 11.502  1.00 32.07  ?  462  LEU A CD1    1 
ATOM   1689 C  CD2    . LEU C 3 166 ? -4.204  28.726 13.714  1.00 23.31  ?  462  LEU A CD2    1 
ATOM   1690 N  N      . ASP C 3 167 ? -6.595  24.265 15.624  1.00 22.02  ?  463  ASP A N      1 
ATOM   1691 C  CA     . ASP C 3 167 ? -7.736  23.737 16.361  1.00 22.93  ?  463  ASP A CA     1 
ATOM   1692 C  C      . ASP C 3 167 ? -7.490  23.788 17.862  1.00 27.19  ?  463  ASP A C      1 
ATOM   1693 O  O      . ASP C 3 167 ? -8.375  24.176 18.629  1.00 25.65  ?  463  ASP A O      1 
ATOM   1694 C  CB     . ASP C 3 167 ? -8.042  22.304 15.922  1.00 36.91  ?  463  ASP A CB     1 
ATOM   1695 C  CG     . ASP C 3 167 ? -8.702  22.238 14.556  1.00 51.82  ?  463  ASP A CG     1 
ATOM   1696 O  OD1    . ASP C 3 167 ? -8.635  21.168 13.911  1.00 61.73  ?  463  ASP A OD1    1 
ATOM   1697 O  OD2    . ASP C 3 167 ? -9.277  23.260 14.124  1.00 58.28  ?  463  ASP A OD2    1 
ATOM   1698 N  N      . GLU C 3 168 ? -6.298  23.380 18.307  1.00 18.57  ?  464  GLU A N      1 
ATOM   1699 C  CA     . GLU C 3 168 ? -6.044  23.386 19.744  1.00 25.47  ?  464  GLU A CA     1 
ATOM   1700 C  C      . GLU C 3 168 ? -5.854  24.806 20.265  1.00 17.41  ?  464  GLU A C      1 
ATOM   1701 O  O      . GLU C 3 168 ? -6.284  25.127 21.380  1.00 22.32  ?  464  GLU A O      1 
ATOM   1702 C  CB     . GLU C 3 168 ? -4.832  22.518 20.088  1.00 19.55  ?  464  GLU A CB     1 
ATOM   1703 C  CG     . GLU C 3 168 ? -4.695  22.299 21.601  1.00 34.23  ?  464  GLU A CG     1 
ATOM   1704 C  CD     . GLU C 3 168 ? -3.468  21.496 21.985  1.00 52.24  ?  464  GLU A CD     1 
ATOM   1705 O  OE1    . GLU C 3 168 ? -2.736  21.050 21.076  1.00 57.06  ?  464  GLU A OE1    1 
ATOM   1706 O  OE2    . GLU C 3 168 ? -3.237  21.314 23.201  1.00 48.26  ?  464  GLU A OE2    1 
ATOM   1707 N  N      . LEU C 3 169 ? -5.217  25.673 19.476  1.00 16.42  ?  465  LEU A N      1 
ATOM   1708 C  CA     . LEU C 3 169 ? -5.121  27.078 19.864  1.00 20.76  ?  465  LEU A CA     1 
ATOM   1709 C  C      . LEU C 3 169 ? -6.502  27.680 20.065  1.00 26.85  ?  465  LEU A C      1 
ATOM   1710 O  O      . LEU C 3 169 ? -6.720  28.466 20.997  1.00 19.68  ?  465  LEU A O      1 
ATOM   1711 C  CB     . LEU C 3 169 ? -4.348  27.866 18.810  1.00 19.41  ?  465  LEU A CB     1 
ATOM   1712 C  CG     . LEU C 3 169 ? -2.841  27.652 18.750  1.00 27.03  ?  465  LEU A CG     1 
ATOM   1713 C  CD1    . LEU C 3 169 ? -2.304  28.263 17.473  1.00 19.01  ?  465  LEU A CD1    1 
ATOM   1714 C  CD2    . LEU C 3 169 ? -2.172  28.274 19.973  1.00 30.56  ?  465  LEU A CD2    1 
ATOM   1715 N  N      . ARG C 3 170 ? -7.451  27.321 19.201  1.00 18.15  ?  466  ARG A N      1 
ATOM   1716 C  CA     . ARG C 3 170 ? -8.803  27.847 19.339  1.00 26.92  ?  466  ARG A CA     1 
ATOM   1717 C  C      . ARG C 3 170 ? -9.501  27.267 20.563  1.00 30.78  ?  466  ARG A C      1 
ATOM   1718 O  O      . ARG C 3 170 ? -10.206 27.990 21.275  1.00 22.74  ?  466  ARG A O      1 
ATOM   1719 C  CB     . ARG C 3 170 ? -9.605  27.571 18.069  1.00 31.88  ?  466  ARG A CB     1 
ATOM   1720 C  CG     . ARG C 3 170 ? -11.064 27.990 18.147  1.00 46.17  ?  466  ARG A CG     1 
ATOM   1721 C  CD     . ARG C 3 170 ? -11.628 28.255 16.760  1.00 65.02  ?  466  ARG A CD     1 
ATOM   1722 N  NE     . ARG C 3 170 ? -13.075 28.071 16.707  1.00 82.21  ?  466  ARG A NE     1 
ATOM   1723 C  CZ     . ARG C 3 170 ? -13.962 28.967 17.130  1.00 86.56  ?  466  ARG A CZ     1 
ATOM   1724 N  NH1    . ARG C 3 170 ? -15.259 28.707 17.037  1.00 87.60  ?  466  ARG A NH1    1 
ATOM   1725 N  NH2    . ARG C 3 170 ? -13.555 30.116 17.651  1.00 86.25  ?  466  ARG A NH2    1 
ATOM   1726 N  N      . ARG C 3 171 ? -9.311  25.971 20.835  1.00 24.70  ?  467  ARG A N      1 
ATOM   1727 C  CA     . ARG C 3 171 ? -9.885  25.392 22.051  1.00 26.12  ?  467  ARG A CA     1 
ATOM   1728 C  C      . ARG C 3 171 ? -9.328  26.070 23.296  1.00 23.09  ?  467  ARG A C      1 
ATOM   1729 O  O      . ARG C 3 171 ? -10.042 26.247 24.291  1.00 29.96  ?  467  ARG A O      1 
ATOM   1730 C  CB     . ARG C 3 171 ? -9.626  23.884 22.107  1.00 24.50  ?  467  ARG A CB     1 
ATOM   1731 C  CG     . ARG C 3 171 ? -10.495 23.057 21.183  1.00 33.27  ?  467  ARG A CG     1 
ATOM   1732 C  CD     . ARG C 3 171 ? -10.409 21.577 21.528  1.00 44.44  ?  467  ARG A CD     1 
ATOM   1733 N  NE     . ARG C 3 171 ? -9.050  21.059 21.400  1.00 50.02  ?  467  ARG A NE     1 
ATOM   1734 C  CZ     . ARG C 3 171 ? -8.552  20.537 20.283  1.00 41.64  ?  467  ARG A CZ     1 
ATOM   1735 N  NH1    . ARG C 3 171 ? -9.304  20.463 19.194  1.00 38.85  ?  467  ARG A NH1    1 
ATOM   1736 N  NH2    . ARG C 3 171 ? -7.305  20.086 20.254  1.00 33.68  ?  467  ARG A NH2    1 
ATOM   1737 N  N      . ASN C 3 172 ? -8.054  26.462 23.257  1.00 33.30  ?  468  ASN A N      1 
ATOM   1738 C  CA     . ASN C 3 172 ? -7.402  27.184 24.342  1.00 38.22  ?  468  ASN A CA     1 
ATOM   1739 C  C      . ASN C 3 172 ? -7.755  28.663 24.376  1.00 37.68  ?  468  ASN A C      1 
ATOM   1740 O  O      . ASN C 3 172 ? -7.299  29.366 25.284  1.00 36.75  ?  468  ASN A O      1 
ATOM   1741 C  CB     . ASN C 3 172 ? -5.882  27.055 24.226  1.00 31.61  ?  468  ASN A CB     1 
ATOM   1742 C  CG     . ASN C 3 172 ? -5.381  25.671 24.559  1.00 32.14  ?  468  ASN A CG     1 
ATOM   1743 O  OD1    . ASN C 3 172 ? -6.158  24.776 24.866  1.00 34.10  ?  468  ASN A OD1    1 
ATOM   1744 N  ND2    . ASN C 3 172 ? -4.066  25.489 24.494  1.00 30.90  ?  468  ASN A ND2    1 
ATOM   1745 N  N      . GLU C 3 173 ? -8.533  29.157 23.412  1.00 39.87  ?  469  GLU A N      1 
ATOM   1746 C  CA     . GLU C 3 173 ? -8.791  30.591 23.282  1.00 30.99  ?  469  GLU A CA     1 
ATOM   1747 C  C      . GLU C 3 173 ? -7.493  31.360 23.049  1.00 42.83  ?  469  GLU A C      1 
ATOM   1748 O  O      . GLU C 3 173 ? -7.315  32.478 23.534  1.00 33.41  ?  469  GLU A O      1 
ATOM   1749 C  CB     . GLU C 3 173 ? -9.539  31.134 24.503  1.00 36.29  ?  469  GLU A CB     1 
ATOM   1750 C  CG     . GLU C 3 173 ? -10.941 30.574 24.663  1.00 52.23  ?  469  GLU A CG     1 
ATOM   1751 C  CD     . GLU C 3 173 ? -11.740 31.295 25.732  1.00 72.40  ?  469  GLU A CD     1 
ATOM   1752 O  OE1    . GLU C 3 173 ? -11.122 31.912 26.625  1.00 79.91  ?  469  GLU A OE1    1 
ATOM   1753 O  OE2    . GLU C 3 173 ? -12.986 31.253 25.674  1.00 76.95  ?  469  GLU A OE2    1 
ATOM   1754 N  N      . GLN C 3 174 ? -6.579  30.751 22.294  1.00 27.57  ?  470  GLN A N      1 
ATOM   1755 C  CA     . GLN C 3 174 ? -5.291  31.343 21.966  1.00 25.62  ?  470  GLN A CA     1 
ATOM   1756 C  C      . GLN C 3 174 ? -5.156  31.667 20.485  1.00 24.21  ?  470  GLN A C      1 
ATOM   1757 O  O      . GLN C 3 174 ? -4.070  32.052 20.046  1.00 22.69  ?  470  GLN A O      1 
ATOM   1758 C  CB     . GLN C 3 174 ? -4.154  30.412 22.388  1.00 28.11  ?  470  GLN A CB     1 
ATOM   1759 C  CG     . GLN C 3 174 ? -4.050  30.187 23.868  1.00 29.74  ?  470  GLN A CG     1 
ATOM   1760 C  CD     . GLN C 3 174 ? -2.959  29.197 24.198  1.00 35.07  ?  470  GLN A CD     1 
ATOM   1761 O  OE1    . GLN C 3 174 ? -2.878  28.127 23.597  1.00 26.81  ?  470  GLN A OE1    1 
ATOM   1762 N  NE2    . GLN C 3 174 ? -2.097  29.556 25.140  1.00 28.16  ?  470  GLN A NE2    1 
ATOM   1763 N  N      . ASP C 3 175 ? -6.229  31.507 19.705  1.00 31.51  ?  471  ASP A N      1 
ATOM   1764 C  CA     . ASP C 3 175 ? -6.162  31.796 18.274  1.00 31.63  ?  471  ASP A CA     1 
ATOM   1765 C  C      . ASP C 3 175 ? -5.798  33.251 18.011  1.00 25.78  ?  471  ASP A C      1 
ATOM   1766 O  O      . ASP C 3 175 ? -5.010  33.548 17.106  1.00 23.91  ?  471  ASP A O      1 
ATOM   1767 C  CB     . ASP C 3 175 ? -7.493  31.452 17.602  1.00 42.16  ?  471  ASP A CB     1 
ATOM   1768 C  CG     . ASP C 3 175 ? -8.699  31.912 18.409  1.00 60.84  ?  471  ASP A CG     1 
ATOM   1769 O  OD1    . ASP C 3 175 ? -8.672  31.791 19.653  1.00 64.15  ?  471  ASP A OD1    1 
ATOM   1770 O  OD2    . ASP C 3 175 ? -9.681  32.383 17.796  1.00 63.72  ?  471  ASP A OD2    1 
ATOM   1771 N  N      . ARG C 3 176 ? -6.374  34.178 18.777  1.00 26.03  ?  472  ARG A N      1 
ATOM   1772 C  CA     . ARG C 3 176 ? -6.053  35.585 18.565  1.00 26.19  ?  472  ARG A CA     1 
ATOM   1773 C  C      . ARG C 3 176 ? -4.669  35.929 19.097  1.00 20.78  ?  472  ARG A C      1 
ATOM   1774 O  O      . ARG C 3 176 ? -3.978  36.778 18.524  1.00 27.15  ?  472  ARG A O      1 
ATOM   1775 C  CB     . ARG C 3 176 ? -7.120  36.470 19.215  1.00 30.53  ?  472  ARG A CB     1 
ATOM   1776 C  CG     . ARG C 3 176 ? -8.521  36.271 18.655  1.00 43.37  ?  472  ARG A CG     1 
ATOM   1777 C  CD     . ARG C 3 176 ? -9.500  37.223 19.322  1.00 48.66  ?  472  ARG A CD     1 
ATOM   1778 N  NE     . ARG C 3 176 ? -9.191  38.617 19.017  1.00 57.83  ?  472  ARG A NE     1 
ATOM   1779 C  CZ     . ARG C 3 176 ? -9.508  39.646 19.798  1.00 69.35  ?  472  ARG A CZ     1 
ATOM   1780 N  NH1    . ARG C 3 176 ? -10.139 39.441 20.947  1.00 68.39  ?  472  ARG A NH1    1 
ATOM   1781 N  NH2    . ARG C 3 176 ? -9.184  40.880 19.436  1.00 71.34  ?  472  ARG A NH2    1 
ATOM   1782 N  N      . LEU C 3 177 ? -4.250  35.285 20.188  1.00 25.74  ?  473  LEU A N      1 
ATOM   1783 C  CA     . LEU C 3 177 ? -2.892  35.467 20.688  1.00 20.57  ?  473  LEU A CA     1 
ATOM   1784 C  C      . LEU C 3 177 ? -1.862  35.202 19.596  1.00 24.04  ?  473  LEU A C      1 
ATOM   1785 O  O      . LEU C 3 177 ? -0.898  35.962 19.435  1.00 22.16  ?  473  LEU A O      1 
ATOM   1786 C  CB     . LEU C 3 177 ? -2.664  34.548 21.886  1.00 21.48  ?  473  LEU A CB     1 
ATOM   1787 C  CG     . LEU C 3 177 ? -1.330  34.599 22.630  1.00 22.19  ?  473  LEU A CG     1 
ATOM   1788 C  CD1    . LEU C 3 177 ? -1.018  36.006 23.136  1.00 27.20  ?  473  LEU A CD1    1 
ATOM   1789 C  CD2    . LEU C 3 177 ? -1.388  33.605 23.792  1.00 22.24  ?  473  LEU A CD2    1 
ATOM   1790 N  N      . LEU C 3 178 ? -2.062  34.141 18.815  1.00 19.20  ?  474  LEU A N      1 
ATOM   1791 C  CA     . LEU C 3 178 ? -1.133  33.846 17.730  1.00 18.07  ?  474  LEU A CA     1 
ATOM   1792 C  C      . LEU C 3 178 ? -1.261  34.863 16.601  1.00 17.14  ?  474  LEU A C      1 
ATOM   1793 O  O      . LEU C 3 178 ? -0.267  35.465 16.176  1.00 18.99  ?  474  LEU A O      1 
ATOM   1794 C  CB     . LEU C 3 178 ? -1.373  32.428 17.205  1.00 18.70  ?  474  LEU A CB     1 
ATOM   1795 C  CG     . LEU C 3 178 ? -0.529  31.987 16.006  1.00 26.81  ?  474  LEU A CG     1 
ATOM   1796 C  CD1    . LEU C 3 178 ? 0.930   31.839 16.408  1.00 21.91  ?  474  LEU A CD1    1 
ATOM   1797 C  CD2    . LEU C 3 178 ? -1.064  30.674 15.433  1.00 19.98  ?  474  LEU A CD2    1 
ATOM   1798 N  N      . VAL C 3 179 ? -2.483  35.074 16.107  1.00 34.27  ?  475  VAL A N      1 
ATOM   1799 C  CA     . VAL C 3 179 ? -2.661  35.807 14.856  1.00 29.63  ?  475  VAL A CA     1 
ATOM   1800 C  C      . VAL C 3 179 ? -2.572  37.319 15.052  1.00 20.13  ?  475  VAL A C      1 
ATOM   1801 O  O      . VAL C 3 179 ? -2.138  38.036 14.143  1.00 23.19  ?  475  VAL A O      1 
ATOM   1802 C  CB     . VAL C 3 179 ? -3.994  35.411 14.198  1.00 27.69  ?  475  VAL A CB     1 
ATOM   1803 C  CG1    . VAL C 3 179 ? -4.249  36.267 12.968  1.00 34.23  ?  475  VAL A CG1    1 
ATOM   1804 C  CG2    . VAL C 3 179 ? -3.990  33.932 13.837  1.00 27.54  ?  475  VAL A CG2    1 
ATOM   1805 N  N      . GLU C 3 180 ? -2.971  37.832 16.213  1.00 19.21  ?  476  GLU A N      1 
ATOM   1806 C  CA     . GLU C 3 180 ? -2.985  39.268 16.446  1.00 25.79  ?  476  GLU A CA     1 
ATOM   1807 C  C      . GLU C 3 180 ? -1.848  39.768 17.322  1.00 30.70  ?  476  GLU A C      1 
ATOM   1808 O  O      . GLU C 3 180 ? -1.636  40.981 17.384  1.00 26.32  ?  476  GLU A O      1 
ATOM   1809 C  CB     . GLU C 3 180 ? -4.320  39.688 17.076  1.00 25.13  ?  476  GLU A CB     1 
ATOM   1810 C  CG     . GLU C 3 180 ? -5.494  39.529 16.141  1.00 36.71  ?  476  GLU A CG     1 
ATOM   1811 C  CD     . GLU C 3 180 ? -6.812  39.799 16.824  1.00 42.20  ?  476  GLU A CD     1 
ATOM   1812 O  OE1    . GLU C 3 180 ? -7.841  39.284 16.339  1.00 44.87  ?  476  GLU A OE1    1 
ATOM   1813 O  OE2    . GLU C 3 180 ? -6.821  40.517 17.846  1.00 47.35  ?  476  GLU A OE2    1 
ATOM   1814 N  N      . LEU C 3 181 ? -1.112  38.884 18.000  1.00 26.64  ?  477  LEU A N      1 
ATOM   1815 C  CA     . LEU C 3 181 ? -0.028  39.319 18.878  1.00 17.06  ?  477  LEU A CA     1 
ATOM   1816 C  C      . LEU C 3 181 ? 1.308   38.727 18.446  1.00 23.65  ?  477  LEU A C      1 
ATOM   1817 O  O      . LEU C 3 181 ? 2.171   39.471 17.979  1.00 21.87  ?  477  LEU A O      1 
ATOM   1818 C  CB     . LEU C 3 181 ? -0.345  38.974 20.335  1.00 19.24  ?  477  LEU A CB     1 
ATOM   1819 C  CG     . LEU C 3 181 ? 0.605   39.612 21.355  1.00 38.87  ?  477  LEU A CG     1 
ATOM   1820 C  CD1    . LEU C 3 181 ? 0.235   41.073 21.617  1.00 30.22  ?  477  LEU A CD1    1 
ATOM   1821 C  CD2    . LEU C 3 181 ? 0.646   38.827 22.658  1.00 40.70  ?  477  LEU A CD2    1 
ATOM   1822 N  N      . GLU C 3 182 ? 1.506   37.408 18.572  1.00 26.89  ?  478  GLU A N      1 
ATOM   1823 C  CA     . GLU C 3 182 ? 2.832   36.823 18.364  1.00 25.61  ?  478  GLU A CA     1 
ATOM   1824 C  C      . GLU C 3 182 ? 3.287   36.929 16.913  1.00 22.05  ?  478  GLU A C      1 
ATOM   1825 O  O      . GLU C 3 182 ? 4.462   37.208 16.647  1.00 16.58  ?  478  GLU A O      1 
ATOM   1826 C  CB     . GLU C 3 182 ? 2.855   35.356 18.798  1.00 19.61  ?  478  GLU A CB     1 
ATOM   1827 C  CG     . GLU C 3 182 ? 2.599   35.106 20.277  1.00 27.36  ?  478  GLU A CG     1 
ATOM   1828 C  CD     . GLU C 3 182 ? 3.645   35.744 21.176  1.00 34.20  ?  478  GLU A CD     1 
ATOM   1829 O  OE1    . GLU C 3 182 ? 4.683   36.215 20.659  1.00 32.26  ?  478  GLU A OE1    1 
ATOM   1830 O  OE2    . GLU C 3 182 ? 3.424   35.778 22.405  1.00 36.34  ?  478  GLU A OE2    1 
ATOM   1831 N  N      . GLN C 3 183 ? 2.392   36.677 15.955  1.00 15.92  ?  479  GLN A N      1 
ATOM   1832 C  CA     . GLN C 3 183 ? 2.835   36.706 14.562  1.00 18.23  ?  479  GLN A CA     1 
ATOM   1833 C  C      . GLN C 3 183 ? 3.069   38.126 14.077  1.00 18.90  ?  479  GLN A C      1 
ATOM   1834 O  O      . GLN C 3 183 ? 4.101   38.371 13.428  1.00 19.77  ?  479  GLN A O      1 
ATOM   1835 C  CB     . GLN C 3 183 ? 1.850   35.937 13.677  1.00 15.76  ?  479  GLN A CB     1 
ATOM   1836 C  CG     . GLN C 3 183 ? 2.077   34.421 13.720  1.00 24.75  ?  479  GLN A CG     1 
ATOM   1837 C  CD     . GLN C 3 183 ? 0.983   33.636 13.019  1.00 24.42  ?  479  GLN A CD     1 
ATOM   1838 O  OE1    . GLN C 3 183 ? 0.917   32.414 13.130  1.00 26.09  ?  479  GLN A OE1    1 
ATOM   1839 N  NE2    . GLN C 3 183 ? 0.122   34.335 12.289  1.00 28.04  ?  479  GLN A NE2    1 
ATOM   1840 N  N      . PRO C 3 184 ? 2.194   39.099 14.346  1.00 21.77  ?  480  PRO A N      1 
ATOM   1841 C  CA     . PRO C 3 184 ? 2.560   40.487 14.032  1.00 21.82  ?  480  PRO A CA     1 
ATOM   1842 C  C      . PRO C 3 184 ? 3.828   40.924 14.738  1.00 21.83  ?  480  PRO A C      1 
ATOM   1843 O  O      . PRO C 3 184 ? 4.621   41.683 14.173  1.00 17.52  ?  480  PRO A O      1 
ATOM   1844 C  CB     . PRO C 3 184 ? 1.338   41.289 14.506  1.00 21.02  ?  480  PRO A CB     1 
ATOM   1845 C  CG     . PRO C 3 184 ? 0.212   40.310 14.486  1.00 27.18  ?  480  PRO A CG     1 
ATOM   1846 C  CD     . PRO C 3 184 ? 0.826   38.994 14.878  1.00 22.76  ?  480  PRO A CD     1 
ATOM   1847 N  N      . LEU C 3 185 ? 4.036   40.471 15.976  1.00 19.13  ?  481  LEU A N      1 
ATOM   1848 C  CA     . LEU C 3 185 ? 5.239   40.861 16.699  1.00 21.59  ?  481  LEU A CA     1 
ATOM   1849 C  C      . LEU C 3 185 ? 6.485   40.296 16.030  1.00 18.77  ?  481  LEU A C      1 
ATOM   1850 O  O      . LEU C 3 185 ? 7.534   40.955 15.990  1.00 16.68  ?  481  LEU A O      1 
ATOM   1851 C  CB     . LEU C 3 185 ? 5.142   40.404 18.156  1.00 18.24  ?  481  LEU A CB     1 
ATOM   1852 C  CG     . LEU C 3 185 ? 6.353   40.710 19.041  1.00 20.73  ?  481  LEU A CG     1 
ATOM   1853 C  CD1    . LEU C 3 185 ? 6.541   42.216 19.187  1.00 24.18  ?  481  LEU A CD1    1 
ATOM   1854 C  CD2    . LEU C 3 185 ? 6.199   40.052 20.409  1.00 17.57  ?  481  LEU A CD2    1 
ATOM   1855 N  N      . SER C 3 186 ? 6.382   39.082 15.479  1.00 16.21  ?  482  SER A N      1 
ATOM   1856 C  CA     . SER C 3 186 ? 7.507   38.468 14.788  1.00 23.93  ?  482  SER A CA     1 
ATOM   1857 C  C      . SER C 3 186 ? 8.018   39.356 13.661  1.00 23.84  ?  482  SER A C      1 
ATOM   1858 O  O      . SER C 3 186 ? 9.230   39.457 13.439  1.00 18.84  ?  482  SER A O      1 
ATOM   1859 C  CB     . SER C 3 186 ? 7.089   37.097 14.246  1.00 18.68  ?  482  SER A CB     1 
ATOM   1860 O  OG     . SER C 3 186 ? 8.192   36.416 13.691  1.00 30.92  ?  482  SER A OG     1 
ATOM   1861 N  N      . SER C 3 187 ? 7.104   39.990 12.921  1.00 23.03  ?  483  SER A N      1 
ATOM   1862 C  CA     . SER C 3 187 ? 7.511   40.888 11.843  1.00 20.32  ?  483  SER A CA     1 
ATOM   1863 C  C      . SER C 3 187 ? 8.178   42.144 12.388  1.00 22.54  ?  483  SER A C      1 
ATOM   1864 O  O      . SER C 3 187 ? 9.156   42.635 11.812  1.00 19.12  ?  483  SER A O      1 
ATOM   1865 C  CB     . SER C 3 187 ? 6.301   41.263 10.987  1.00 27.42  ?  483  SER A CB     1 
ATOM   1866 O  OG     . SER C 3 187 ? 5.669   40.108 10.469  1.00 33.13  ?  483  SER A OG     1 
ATOM   1867 N  N      . ILE C 3 188 ? 7.655   42.682 13.490  1.00 19.57  ?  484  ILE A N      1 
ATOM   1868 C  CA     . ILE C 3 188 ? 8.245   43.871 14.094  1.00 16.66  ?  484  ILE A CA     1 
ATOM   1869 C  C      . ILE C 3 188 ? 9.643   43.563 14.603  1.00 22.94  ?  484  ILE A C      1 
ATOM   1870 O  O      . ILE C 3 188 ? 10.579  44.354 14.420  1.00 19.56  ?  484  ILE A O      1 
ATOM   1871 C  CB     . ILE C 3 188 ? 7.333   44.399 15.217  1.00 13.03  ?  484  ILE A CB     1 
ATOM   1872 C  CG1    . ILE C 3 188 ? 6.038   44.964 14.621  1.00 20.37  ?  484  ILE A CG1    1 
ATOM   1873 C  CG2    . ILE C 3 188 ? 8.069   45.443 16.055  1.00 22.96  ?  484  ILE A CG2    1 
ATOM   1874 C  CD1    . ILE C 3 188 ? 4.931   45.140 15.631  1.00 25.43  ?  484  ILE A CD1    1 
ATOM   1875 N  N      . LEU C 3 189 ? 9.805   42.408 15.252  1.00 17.47  ?  485  LEU A N      1 
ATOM   1876 C  CA     . LEU C 3 189 ? 11.118  41.994 15.729  1.00 23.54  ?  485  LEU A CA     1 
ATOM   1877 C  C      . LEU C 3 189 ? 12.088  41.790 14.572  1.00 18.48  ?  485  LEU A C      1 
ATOM   1878 O  O      . LEU C 3 189 ? 13.280  42.088 14.695  1.00 15.71  ?  485  LEU A O      1 
ATOM   1879 C  CB     . LEU C 3 189 ? 10.994  40.717 16.563  1.00 18.58  ?  485  LEU A CB     1 
ATOM   1880 C  CG     . LEU C 3 189 ? 10.153  40.820 17.841  1.00 20.23  ?  485  LEU A CG     1 
ATOM   1881 C  CD1    . LEU C 3 189 ? 9.943   39.444 18.462  1.00 20.32  ?  485  LEU A CD1    1 
ATOM   1882 C  CD2    . LEU C 3 189 ? 10.807  41.762 18.832  1.00 15.64  ?  485  LEU A CD2    1 
ATOM   1883 N  N      . ALA C 3 190 ? 11.607  41.259 13.449  1.00 17.30  ?  486  ALA A N      1 
ATOM   1884 C  CA     . ALA C 3 190 ? 12.496  41.077 12.309  1.00 16.06  ?  486  ALA A CA     1 
ATOM   1885 C  C      . ALA C 3 190 ? 13.038  42.419 11.824  1.00 11.86  ?  486  ALA A C      1 
ATOM   1886 O  O      . ALA C 3 190 ? 14.231  42.543 11.527  1.00 17.71  ?  486  ALA A O      1 
ATOM   1887 C  CB     . ALA C 3 190 ? 11.771  40.336 11.190  1.00 14.26  ?  486  ALA A CB     1 
ATOM   1888 N  N      . GLU C 3 191 ? 12.177  43.445 11.761  1.00 17.74  ?  487  GLU A N      1 
ATOM   1889 C  CA     . GLU C 3 191 ? 12.630  44.779 11.365  1.00 27.40  ?  487  GLU A CA     1 
ATOM   1890 C  C      . GLU C 3 191 ? 13.611  45.350 12.378  1.00 22.89  ?  487  GLU A C      1 
ATOM   1891 O  O      . GLU C 3 191 ? 14.569  46.039 12.005  1.00 19.43  ?  487  GLU A O      1 
ATOM   1892 C  CB     . GLU C 3 191 ? 11.448  45.746 11.220  1.00 33.45  ?  487  GLU A CB     1 
ATOM   1893 C  CG     . GLU C 3 191 ? 10.327  45.329 10.290  1.00 57.29  ?  487  GLU A CG     1 
ATOM   1894 C  CD     . GLU C 3 191 ? 9.078   46.204 10.445  1.00 71.30  ?  487  GLU A CD     1 
ATOM   1895 O  OE1    . GLU C 3 191 ? 9.146   47.269 11.102  1.00 71.93  ?  487  GLU A OE1    1 
ATOM   1896 O  OE2    . GLU C 3 191 ? 8.018   45.818 9.909   1.00 72.25  ?  487  GLU A OE2    1 
ATOM   1897 N  N      . MET C 3 192 ? 13.361  45.118 13.668  1.00 16.54  ?  488  MET A N      1 
ATOM   1898 C  CA     . MET C 3 192 ? 14.257  45.639 14.698  1.00 28.98  ?  488  MET A CA     1 
ATOM   1899 C  C      . MET C 3 192 ? 15.630  44.992 14.598  1.00 17.28  ?  488  MET A C      1 
ATOM   1900 O  O      . MET C 3 192 ? 16.659  45.675 14.665  1.00 20.60  ?  488  MET A O      1 
ATOM   1901 C  CB     . MET C 3 192 ? 13.668  45.406 16.089  1.00 22.08  ?  488  MET A CB     1 
ATOM   1902 C  CG     . MET C 3 192 ? 12.365  46.116 16.358  1.00 31.49  ?  488  MET A CG     1 
ATOM   1903 S  SD     . MET C 3 192 ? 11.515  45.405 17.788  1.00 24.82  ?  488  MET A SD     1 
ATOM   1904 C  CE     . MET C 3 192 ? 12.745  45.686 19.075  1.00 18.41  ?  488  MET A CE     1 
ATOM   1905 N  N      . GLU C 3 193 ? 15.662  43.666 14.453  1.00 13.66  ?  489  GLU A N      1 
ATOM   1906 C  CA     . GLU C 3 193 ? 16.935  42.958 14.335  1.00 16.30  ?  489  GLU A CA     1 
ATOM   1907 C  C      . GLU C 3 193 ? 17.698  43.406 13.101  1.00 20.58  ?  489  GLU A C      1 
ATOM   1908 O  O      . GLU C 3 193 ? 18.911  43.640 13.151  1.00 18.38  ?  489  GLU A O      1 
ATOM   1909 C  CB     . GLU C 3 193 ? 16.698  41.454 14.273  1.00 19.06  ?  489  GLU A CB     1 
ATOM   1910 C  CG     . GLU C 3 193 ? 15.957  40.871 15.455  1.00 21.36  ?  489  GLU A CG     1 
ATOM   1911 C  CD     . GLU C 3 193 ? 15.747  39.383 15.284  1.00 19.50  ?  489  GLU A CD     1 
ATOM   1912 O  OE1    . GLU C 3 193 ? 16.109  38.855 14.209  1.00 22.33  ?  489  GLU A OE1    1 
ATOM   1913 O  OE2    . GLU C 3 193 ? 15.229  38.735 16.213  1.00 24.53  ?  489  GLU A OE2    1 
ATOM   1914 N  N      . PHE C 3 194 ? 17.002  43.492 11.968  1.00 23.97  ?  490  PHE A N      1 
ATOM   1915 C  CA     . PHE C 3 194 ? 17.647  43.903 10.730  1.00 24.35  ?  490  PHE A CA     1 
ATOM   1916 C  C      . PHE C 3 194 ? 18.213  45.313 10.846  1.00 23.21  ?  490  PHE A C      1 
ATOM   1917 O  O      . PHE C 3 194 ? 19.342  45.575 10.412  1.00 22.27  ?  490  PHE A O      1 
ATOM   1918 C  CB     . PHE C 3 194 ? 16.649  43.809 9.578   1.00 20.37  ?  490  PHE A CB     1 
ATOM   1919 C  CG     . PHE C 3 194 ? 17.233  44.148 8.250   1.00 19.97  ?  490  PHE A CG     1 
ATOM   1920 C  CD1    . PHE C 3 194 ? 18.294  43.421 7.750   1.00 17.92  ?  490  PHE A CD1    1 
ATOM   1921 C  CD2    . PHE C 3 194 ? 16.721  45.189 7.497   1.00 25.89  ?  490  PHE A CD2    1 
ATOM   1922 C  CE1    . PHE C 3 194 ? 18.845  43.728 6.521   1.00 16.72  ?  490  PHE A CE1    1 
ATOM   1923 C  CE2    . PHE C 3 194 ? 17.260  45.501 6.269   1.00 28.10  ?  490  PHE A CE2    1 
ATOM   1924 C  CZ     . PHE C 3 194 ? 18.321  44.770 5.775   1.00 26.72  ?  490  PHE A CZ     1 
ATOM   1925 N  N      . ALA C 3 195 ? 17.444  46.235 11.430  1.00 19.36  ?  491  ALA A N      1 
ATOM   1926 C  CA     . ALA C 3 195 ? 17.930  47.600 11.600  1.00 25.04  ?  491  ALA A CA     1 
ATOM   1927 C  C      . ALA C 3 195 ? 19.194  47.627 12.448  1.00 29.72  ?  491  ALA A C      1 
ATOM   1928 O  O      . ALA C 3 195 ? 20.147  48.352 12.136  1.00 21.45  ?  491  ALA A O      1 
ATOM   1929 C  CB     . ALA C 3 195 ? 16.843  48.475 12.227  1.00 22.88  ?  491  ALA A CB     1 
ATOM   1930 N  N      . GLY C 3 196 ? 19.225  46.834 13.512  1.00 18.98  ?  492  GLY A N      1 
ATOM   1931 C  CA     . GLY C 3 196 ? 20.373  46.793 14.392  1.00 25.57  ?  492  GLY A CA     1 
ATOM   1932 C  C      . GLY C 3 196 ? 20.501  48.075 15.192  1.00 24.44  ?  492  GLY A C      1 
ATOM   1933 O  O      . GLY C 3 196 ? 19.735  49.023 15.044  1.00 24.84  ?  492  GLY A O      1 
ATOM   1934 N  N      . VAL C 3 197 ? 21.503  48.088 16.065  1.00 22.27  ?  493  VAL A N      1 
ATOM   1935 C  CA     . VAL C 3 197 ? 21.832  49.256 16.872  1.00 25.73  ?  493  VAL A CA     1 
ATOM   1936 C  C      . VAL C 3 197 ? 23.289  49.606 16.624  1.00 24.78  ?  493  VAL A C      1 
ATOM   1937 O  O      . VAL C 3 197 ? 24.158  48.729 16.673  1.00 23.71  ?  493  VAL A O      1 
ATOM   1938 C  CB     . VAL C 3 197 ? 21.581  49.009 18.371  1.00 24.51  ?  493  VAL A CB     1 
ATOM   1939 C  CG1    . VAL C 3 197 ? 21.832  50.282 19.149  1.00 22.31  ?  493  VAL A CG1    1 
ATOM   1940 C  CG2    . VAL C 3 197 ? 20.162  48.511 18.595  1.00 23.75  ?  493  VAL A CG2    1 
ATOM   1941 N  N      . LYS C 3 198 ? 23.555  50.884 16.372  1.00 25.84  ?  494  LYS A N      1 
ATOM   1942 C  CA     . LYS C 3 198 ? 24.916  51.316 16.097  1.00 21.02  ?  494  LYS A CA     1 
ATOM   1943 C  C      . LYS C 3 198 ? 25.738  51.341 17.379  1.00 26.31  ?  494  LYS A C      1 
ATOM   1944 O  O      . LYS C 3 198 ? 25.280  51.805 18.427  1.00 19.50  ?  494  LYS A O      1 
ATOM   1945 C  CB     . LYS C 3 198 ? 24.917  52.698 15.442  1.00 26.74  ?  494  LYS A CB     1 
ATOM   1946 C  CG     . LYS C 3 198 ? 26.242  53.068 14.794  1.00 27.11  ?  494  LYS A CG     1 
ATOM   1947 C  CD     . LYS C 3 198 ? 26.229  54.510 14.323  1.00 44.87  ?  494  LYS A CD     1 
ATOM   1948 C  CE     . LYS C 3 198 ? 27.630  55.108 14.318  1.00 54.92  ?  494  LYS A CE     1 
ATOM   1949 N  NZ     . LYS C 3 198 ? 27.596  56.593 14.197  1.00 58.53  ?  494  LYS A NZ     1 
ATOM   1950 N  N      . VAL C 3 199 ? 26.967  50.842 17.286  1.00 23.56  ?  495  VAL A N      1 
ATOM   1951 C  CA     . VAL C 3 199 ? 27.892  50.799 18.410  1.00 29.36  ?  495  VAL A CA     1 
ATOM   1952 C  C      . VAL C 3 199 ? 29.059  51.731 18.118  1.00 30.41  ?  495  VAL A C      1 
ATOM   1953 O  O      . VAL C 3 199 ? 29.626  51.702 17.019  1.00 25.67  ?  495  VAL A O      1 
ATOM   1954 C  CB     . VAL C 3 199 ? 28.391  49.369 18.677  1.00 25.87  ?  495  VAL A CB     1 
ATOM   1955 C  CG1    . VAL C 3 199 ? 29.467  49.392 19.746  1.00 22.56  ?  495  VAL A CG1    1 
ATOM   1956 C  CG2    . VAL C 3 199 ? 27.231  48.476 19.092  1.00 27.76  ?  495  VAL A CG2    1 
ATOM   1957 N  N      . ASP C 3 200 ? 29.410  52.557 19.101  1.00 30.94  ?  496  ASP A N      1 
ATOM   1958 C  CA     . ASP C 3 200 ? 30.599  53.404 19.043  1.00 31.16  ?  496  ASP A CA     1 
ATOM   1959 C  C      . ASP C 3 200 ? 31.786  52.559 19.485  1.00 35.74  ?  496  ASP A C      1 
ATOM   1960 O  O      . ASP C 3 200 ? 32.160  52.531 20.659  1.00 35.54  ?  496  ASP A O      1 
ATOM   1961 C  CB     . ASP C 3 200 ? 30.421  54.636 19.921  1.00 31.85  ?  496  ASP A CB     1 
ATOM   1962 C  CG     . ASP C 3 200 ? 31.581  55.611 19.812  1.00 42.42  ?  496  ASP A CG     1 
ATOM   1963 O  OD1    . ASP C 3 200 ? 32.669  55.214 19.339  1.00 50.22  ?  496  ASP A OD1    1 
ATOM   1964 O  OD2    . ASP C 3 200 ? 31.404  56.780 20.213  1.00 54.85  ?  496  ASP A OD2    1 
ATOM   1965 N  N      . THR C 3 201 ? 32.380  51.846 18.529  1.00 33.81  ?  497  THR A N      1 
ATOM   1966 C  CA     . THR C 3 201 ? 33.430  50.897 18.878  1.00 36.84  ?  497  THR A CA     1 
ATOM   1967 C  C      . THR C 3 201 ? 34.672  51.593 19.414  1.00 29.10  ?  497  THR A C      1 
ATOM   1968 O  O      . THR C 3 201 ? 35.371  51.032 20.266  1.00 35.86  ?  497  THR A O      1 
ATOM   1969 C  CB     . THR C 3 201 ? 33.788  50.044 17.666  1.00 31.92  ?  497  THR A CB     1 
ATOM   1970 O  OG1    . THR C 3 201 ? 34.134  50.901 16.575  1.00 37.79  ?  497  THR A OG1    1 
ATOM   1971 C  CG2    . THR C 3 201 ? 32.604  49.180 17.267  1.00 30.19  ?  497  THR A CG2    1 
ATOM   1972 N  N      . LYS C 3 202 ? 34.979  52.797 18.923  1.00 33.46  ?  498  LYS A N      1 
ATOM   1973 C  CA     . LYS C 3 202 ? 36.126  53.522 19.459  1.00 43.55  ?  498  LYS A CA     1 
ATOM   1974 C  C      . LYS C 3 202 ? 35.956  53.767 20.949  1.00 36.21  ?  498  LYS A C      1 
ATOM   1975 O  O      . LYS C 3 202 ? 36.917  53.653 21.719  1.00 35.77  ?  498  LYS A O      1 
ATOM   1976 C  CB     . LYS C 3 202 ? 36.327  54.845 18.716  1.00 50.22  ?  498  LYS A CB     1 
ATOM   1977 C  CG     . LYS C 3 202 ? 36.830  54.689 17.287  1.00 58.70  ?  498  LYS A CG     1 
ATOM   1978 C  CD     . LYS C 3 202 ? 37.410  55.992 16.751  1.00 72.06  ?  498  LYS A CD     1 
ATOM   1979 C  CE     . LYS C 3 202 ? 37.879  55.842 15.307  1.00 76.14  ?  498  LYS A CE     1 
ATOM   1980 N  NZ     . LYS C 3 202 ? 38.844  54.719 15.140  1.00 75.60  ?  498  LYS A NZ     1 
ATOM   1981 N  N      . ARG C 3 203 ? 34.737  54.100 21.376  1.00 34.16  ?  499  ARG A N      1 
ATOM   1982 C  CA     . ARG C 3 203 ? 34.488  54.296 22.798  1.00 45.00  ?  499  ARG A CA     1 
ATOM   1983 C  C      . ARG C 3 203 ? 34.635  52.986 23.564  1.00 43.78  ?  499  ARG A C      1 
ATOM   1984 O  O      . ARG C 3 203 ? 35.271  52.946 24.623  1.00 51.33  ?  499  ARG A O      1 
ATOM   1985 C  CB     . ARG C 3 203 ? 33.103  54.907 23.009  1.00 50.07  ?  499  ARG A CB     1 
ATOM   1986 C  CG     . ARG C 3 203 ? 32.686  54.979 24.464  1.00 58.87  ?  499  ARG A CG     1 
ATOM   1987 C  CD     . ARG C 3 203 ? 31.720  56.116 24.703  1.00 64.11  ?  499  ARG A CD     1 
ATOM   1988 N  NE     . ARG C 3 203 ? 32.218  57.026 25.728  1.00 76.25  ?  499  ARG A NE     1 
ATOM   1989 C  CZ     . ARG C 3 203 ? 31.642  58.181 26.043  1.00 86.02  ?  499  ARG A CZ     1 
ATOM   1990 N  NH1    . ARG C 3 203 ? 30.543  58.571 25.409  1.00 86.95  ?  499  ARG A NH1    1 
ATOM   1991 N  NH2    . ARG C 3 203 ? 32.165  58.947 26.991  1.00 90.65  ?  499  ARG A NH2    1 
ATOM   1992 N  N      . LEU C 3 204 ? 34.062  51.898 23.040  1.00 38.03  ?  500  LEU A N      1 
ATOM   1993 C  CA     . LEU C 3 204 ? 34.278  50.588 23.652  1.00 43.08  ?  500  LEU A CA     1 
ATOM   1994 C  C      . LEU C 3 204 ? 35.765  50.258 23.724  1.00 41.07  ?  500  LEU A C      1 
ATOM   1995 O  O      . LEU C 3 204 ? 36.269  49.834 24.771  1.00 37.72  ?  500  LEU A O      1 
ATOM   1996 C  CB     . LEU C 3 204 ? 33.523  49.508 22.878  1.00 36.71  ?  500  LEU A CB     1 
ATOM   1997 C  CG     . LEU C 3 204 ? 32.021  49.371 23.122  1.00 32.13  ?  500  LEU A CG     1 
ATOM   1998 C  CD1    . LEU C 3 204 ? 31.476  48.220 22.308  1.00 34.16  ?  500  LEU A CD1    1 
ATOM   1999 C  CD2    . LEU C 3 204 ? 31.721  49.172 24.606  1.00 30.34  ?  500  LEU A CD2    1 
ATOM   2000 N  N      . GLU C 3 205 ? 36.487  50.445 22.615  1.00 35.22  ?  501  GLU A N      1 
ATOM   2001 C  CA     . GLU C 3 205 ? 37.930  50.221 22.630  1.00 37.21  ?  501  GLU A CA     1 
ATOM   2002 C  C      . GLU C 3 205 ? 38.602  51.089 23.684  1.00 47.35  ?  501  GLU A C      1 
ATOM   2003 O  O      . GLU C 3 205 ? 39.485  50.626 24.415  1.00 54.80  ?  501  GLU A O      1 
ATOM   2004 C  CB     . GLU C 3 205 ? 38.526  50.498 21.249  1.00 47.27  ?  501  GLU A CB     1 
ATOM   2005 C  CG     . GLU C 3 205 ? 38.639  49.276 20.348  1.00 60.16  ?  501  GLU A CG     1 
ATOM   2006 C  CD     . GLU C 3 205 ? 38.505  49.618 18.874  1.00 68.54  ?  501  GLU A CD     1 
ATOM   2007 O  OE1    . GLU C 3 205 ? 37.721  48.939 18.177  1.00 69.33  ?  501  GLU A OE1    1 
ATOM   2008 O  OE2    . GLU C 3 205 ? 39.170  50.572 18.415  1.00 72.49  ?  501  GLU A OE2    1 
ATOM   2009 N  N      . GLN C 3 206 ? 38.192  52.355 23.776  1.00 47.77  ?  502  GLN A N      1 
ATOM   2010 C  CA     . GLN C 3 206 ? 38.739  53.241 24.796  1.00 50.91  ?  502  GLN A CA     1 
ATOM   2011 C  C      . GLN C 3 206 ? 38.469  52.690 26.191  1.00 50.48  ?  502  GLN A C      1 
ATOM   2012 O  O      . GLN C 3 206 ? 39.369  52.644 27.037  1.00 47.80  ?  502  GLN A O      1 
ATOM   2013 C  CB     . GLN C 3 206 ? 38.150  54.643 24.629  1.00 51.07  ?  502  GLN A CB     1 
ATOM   2014 C  CG     . GLN C 3 206 ? 38.813  55.722 25.461  1.00 60.93  ?  502  GLN A CG     1 
ATOM   2015 C  CD     . GLN C 3 206 ? 38.166  57.077 25.254  1.00 69.33  ?  502  GLN A CD     1 
ATOM   2016 O  OE1    . GLN C 3 206 ? 37.025  57.167 24.802  1.00 70.47  ?  502  GLN A OE1    1 
ATOM   2017 N  NE2    . GLN C 3 206 ? 38.895  58.139 25.576  1.00 72.42  ?  502  GLN A NE2    1 
ATOM   2018 N  N      . MET C 3 207 ? 37.234  52.247 26.445  1.00 50.47  ?  503  MET A N      1 
ATOM   2019 C  CA     . MET C 3 207 ? 36.920  51.636 27.735  1.00 52.32  ?  503  MET A CA     1 
ATOM   2020 C  C      . MET C 3 207 ? 37.752  50.382 27.970  1.00 51.47  ?  503  MET A C      1 
ATOM   2021 O  O      . MET C 3 207 ? 38.285  50.178 29.067  1.00 48.44  ?  503  MET A O      1 
ATOM   2022 C  CB     . MET C 3 207 ? 35.429  51.306 27.817  1.00 57.03  ?  503  MET A CB     1 
ATOM   2023 C  CG     . MET C 3 207 ? 34.529  52.509 28.044  1.00 63.40  ?  503  MET A CG     1 
ATOM   2024 S  SD     . MET C 3 207 ? 32.781  52.107 27.837  1.00 65.32  ?  503  MET A SD     1 
ATOM   2025 C  CE     . MET C 3 207 ? 32.021  53.616 28.435  1.00 64.95  ?  503  MET A CE     1 
ATOM   2026 N  N      . GLY C 3 208 ? 37.874  49.530 26.948  1.00 53.53  ?  504  GLY A N      1 
ATOM   2027 C  CA     . GLY C 3 208 ? 38.639  48.304 27.105  1.00 51.09  ?  504  GLY A CA     1 
ATOM   2028 C  C      . GLY C 3 208 ? 40.068  48.556 27.543  1.00 51.12  ?  504  GLY A C      1 
ATOM   2029 O  O      . GLY C 3 208 ? 40.585  47.878 28.433  1.00 49.00  ?  504  GLY A O      1 
ATOM   2030 N  N      . GLU C 3 209 ? 40.694  49.559 26.947  1.00 53.79  ?  505  GLU A N      1 
ATOM   2031 C  CA     . GLU C 3 209 ? 42.056  49.907 27.306  1.00 63.11  ?  505  GLU A CA     1 
ATOM   2032 C  C      . GLU C 3 209 ? 42.124  50.305 28.773  1.00 61.85  ?  505  GLU A C      1 
ATOM   2033 O  O      . GLU C 3 209 ? 43.038  49.919 29.483  1.00 57.20  ?  505  GLU A O      1 
ATOM   2034 C  CB     . GLU C 3 209 ? 42.576  51.063 26.440  1.00 30.00  ?  505  GLU A CB     1 
ATOM   2035 C  CG     . GLU C 3 209 ? 42.590  50.784 24.948  1.00 30.00  ?  505  GLU A CG     1 
ATOM   2036 C  CD     . GLU C 3 209 ? 42.810  52.034 24.118  1.00 30.00  ?  505  GLU A CD     1 
ATOM   2037 O  OE1    . GLU C 3 209 ? 42.842  53.149 24.689  1.00 30.00  ?  505  GLU A OE1    1 
ATOM   2038 O  OE2    . GLU C 3 209 ? 42.949  51.905 22.887  1.00 30.00  ?  505  GLU A OE2    1 
ATOM   2039 N  N      . GLU C 3 210 ? 41.135  51.059 29.228  1.00 62.14  ?  506  GLU A N      1 
ATOM   2040 C  CA     . GLU C 3 210 ? 41.129  51.547 30.604  1.00 56.04  ?  506  GLU A CA     1 
ATOM   2041 C  C      . GLU C 3 210 ? 40.890  50.413 31.592  1.00 52.72  ?  506  GLU A C      1 
ATOM   2042 O  O      . GLU C 3 210 ? 41.571  50.319 32.620  1.00 55.66  ?  506  GLU A O      1 
ATOM   2043 C  CB     . GLU C 3 210 ? 40.074  52.642 30.775  1.00 61.99  ?  506  GLU A CB     1 
ATOM   2044 C  CG     . GLU C 3 210 ? 40.509  54.005 30.256  1.00 73.06  ?  506  GLU A CG     1 
ATOM   2045 C  CD     . GLU C 3 210 ? 39.433  55.068 30.408  1.00 80.61  ?  506  GLU A CD     1 
ATOM   2046 O  OE1    . GLU C 3 210 ? 38.261  54.707 30.647  1.00 80.48  ?  506  GLU A OE1    1 
ATOM   2047 O  OE2    . GLU C 3 210 ? 39.761  56.268 30.287  1.00 84.21  ?  506  GLU A OE2    1 
ATOM   2048 N  N      . LEU C 3 211 ? 39.917  49.545 31.307  1.00 42.62  ?  507  LEU A N      1 
ATOM   2049 C  CA     . LEU C 3 211 ? 39.689  48.393 32.172  1.00 44.90  ?  507  LEU A CA     1 
ATOM   2050 C  C      . LEU C 3 211 ? 40.933  47.516 32.241  1.00 45.93  ?  507  LEU A C      1 
ATOM   2051 O  O      . LEU C 3 211 ? 41.379  47.134 33.330  1.00 43.49  ?  507  LEU A O      1 
ATOM   2052 C  CB     . LEU C 3 211 ? 38.484  47.596 31.677  1.00 44.66  ?  507  LEU A CB     1 
ATOM   2053 C  CG     . LEU C 3 211 ? 37.121  48.227 31.962  1.00 45.48  ?  507  LEU A CG     1 
ATOM   2054 C  CD1    . LEU C 3 211 ? 36.028  47.514 31.185  1.00 45.01  ?  507  LEU A CD1    1 
ATOM   2055 C  CD2    . LEU C 3 211 ? 36.826  48.189 33.453  1.00 41.14  ?  507  LEU A CD2    1 
ATOM   2056 N  N      . ALA C 3 212 ? 41.519  47.199 31.084  1.00 43.64  ?  508  ALA A N      1 
ATOM   2057 C  CA     . ALA C 3 212 ? 42.762  46.438 31.069  1.00 45.31  ?  508  ALA A CA     1 
ATOM   2058 C  C      . ALA C 3 212 ? 43.856  47.116 31.885  1.00 49.66  ?  508  ALA A C      1 
ATOM   2059 O  O      . ALA C 3 212 ? 44.798  46.445 32.318  1.00 57.56  ?  508  ALA A O      1 
ATOM   2060 C  CB     . ALA C 3 212 ? 43.229  46.224 29.628  1.00 43.42  ?  508  ALA A CB     1 
ATOM   2061 N  N      . GLU C 3 213 ? 43.750  48.428 32.107  1.00 56.55  ?  509  GLU A N      1 
ATOM   2062 C  CA     . GLU C 3 213 ? 44.720  49.128 32.944  1.00 65.60  ?  509  GLU A CA     1 
ATOM   2063 C  C      . GLU C 3 213 ? 44.403  48.945 34.423  1.00 65.13  ?  509  GLU A C      1 
ATOM   2064 O  O      . GLU C 3 213 ? 45.283  48.595 35.217  1.00 61.50  ?  509  GLU A O      1 
ATOM   2065 C  CB     . GLU C 3 213 ? 44.751  50.615 32.584  1.00 72.28  ?  509  GLU A CB     1 
ATOM   2066 C  CG     . GLU C 3 213 ? 45.883  51.390 33.241  1.00 77.98  ?  509  GLU A CG     1 
ATOM   2067 C  CD     . GLU C 3 213 ? 47.089  51.548 32.333  1.00 90.90  ?  509  GLU A CD     1 
ATOM   2068 O  OE1    . GLU C 3 213 ? 46.899  51.867 31.140  1.00 93.64  ?  509  GLU A OE1    1 
ATOM   2069 O  OE2    . GLU C 3 213 ? 48.226  51.352 32.813  1.00 97.61  ?  509  GLU A OE2    1 
ATOM   2070 N  N      . GLN C 3 214 ? 43.148  49.187 34.814  1.00 64.64  ?  510  GLN A N      1 
ATOM   2071 C  CA     . GLN C 3 214 ? 42.752  48.958 36.200  1.00 63.04  ?  510  GLN A CA     1 
ATOM   2072 C  C      . GLN C 3 214 ? 42.895  47.493 36.585  1.00 59.32  ?  510  GLN A C      1 
ATOM   2073 O  O      . GLN C 3 214 ? 43.199  47.182 37.743  1.00 60.13  ?  510  GLN A O      1 
ATOM   2074 C  CB     . GLN C 3 214 ? 41.314  49.422 36.424  1.00 66.28  ?  510  GLN A CB     1 
ATOM   2075 C  CG     . GLN C 3 214 ? 41.083  50.894 36.143  1.00 73.56  ?  510  GLN A CG     1 
ATOM   2076 C  CD     . GLN C 3 214 ? 39.671  51.328 36.475  1.00 81.26  ?  510  GLN A CD     1 
ATOM   2077 O  OE1    . GLN C 3 214 ? 38.908  51.722 35.593  1.00 84.55  ?  510  GLN A OE1    1 
ATOM   2078 N  NE2    . GLN C 3 214 ? 39.314  51.259 37.753  1.00 83.02  ?  510  GLN A NE2    1 
ATOM   2079 N  N      . LEU C 3 215 ? 42.675  46.581 35.636  1.00 54.74  ?  511  LEU A N      1 
ATOM   2080 C  CA     . LEU C 3 215 ? 42.869  45.163 35.914  1.00 53.90  ?  511  LEU A CA     1 
ATOM   2081 C  C      . LEU C 3 215 ? 44.338  44.855 36.172  1.00 58.59  ?  511  LEU A C      1 
ATOM   2082 O  O      . LEU C 3 215 ? 44.674  44.138 37.121  1.00 62.99  ?  511  LEU A O      1 
ATOM   2083 C  CB     . LEU C 3 215 ? 42.334  44.322 34.755  1.00 54.45  ?  511  LEU A CB     1 
ATOM   2084 C  CG     . LEU C 3 215 ? 40.824  44.083 34.761  1.00 60.33  ?  511  LEU A CG     1 
ATOM   2085 C  CD1    . LEU C 3 215 ? 40.364  43.483 33.441  1.00 56.26  ?  511  LEU A CD1    1 
ATOM   2086 C  CD2    . LEU C 3 215 ? 40.438  43.180 35.924  1.00 59.92  ?  511  LEU A CD2    1 
ATOM   2087 N  N      . ARG C 3 216 ? 45.226  45.434 35.383  1.00 55.88  ?  512  ARG A N      1 
ATOM   2088 C  CA     . ARG C 3 216 ? 46.636  45.171 35.593  1.00 49.01  ?  512  ARG A CA     1 
ATOM   2089 C  C      . ARG C 3 216 ? 47.057  45.651 36.979  1.00 53.65  ?  512  ARG A C      1 
ATOM   2090 O  O      . ARG C 3 216 ? 47.955  45.091 37.579  1.00 55.32  ?  512  ARG A O      1 
ATOM   2091 C  CB     . ARG C 3 216 ? 47.493  45.808 34.499  1.00 30.00  ?  512  ARG A CB     1 
ATOM   2092 C  CG     . ARG C 3 216 ? 47.328  45.191 33.114  1.00 30.00  ?  512  ARG A CG     1 
ATOM   2093 C  CD     . ARG C 3 216 ? 47.146  46.259 32.041  1.00 30.00  ?  512  ARG A CD     1 
ATOM   2094 N  NE     . ARG C 3 216 ? 47.253  45.722 30.686  1.00 30.00  ?  512  ARG A NE     1 
ATOM   2095 C  CZ     . ARG C 3 216 ? 47.982  46.265 29.714  1.00 30.00  ?  512  ARG A CZ     1 
ATOM   2096 N  NH1    . ARG C 3 216 ? 48.685  47.369 29.937  1.00 30.00  ?  512  ARG A NH1    1 
ATOM   2097 N  NH2    . ARG C 3 216 ? 48.010  45.703 28.513  1.00 30.00  ?  512  ARG A NH2    1 
ATOM   2098 N  N      . THR C 3 217 ? 46.397  46.680 37.491  1.00 56.68  ?  513  THR A N      1 
ATOM   2099 C  CA     . THR C 3 217 ? 46.731  47.198 38.814  1.00 64.35  ?  513  THR A CA     1 
ATOM   2100 C  C      . THR C 3 217 ? 46.160  46.313 39.917  1.00 59.91  ?  513  THR A C      1 
ATOM   2101 O  O      . THR C 3 217 ? 46.907  45.763 40.734  1.00 53.50  ?  513  THR A O      1 
ATOM   2102 C  CB     . THR C 3 217 ? 46.218  48.634 38.962  1.00 64.07  ?  513  THR A CB     1 
ATOM   2103 O  OG1    . THR C 3 217 ? 46.967  49.504 38.104  1.00 59.40  ?  513  THR A OG1    1 
ATOM   2104 C  CG2    . THR C 3 217 ? 46.350  49.100 40.403  1.00 56.05  ?  513  THR A CG2    1 
ATOM   2105 N  N      . VAL C 3 218 ? 44.832  46.172 39.957  1.00 56.46  ?  514  VAL A N      1 
ATOM   2106 C  CA     . VAL C 3 218 ? 44.198  45.343 40.980  1.00 53.70  ?  514  VAL A CA     1 
ATOM   2107 C  C      . VAL C 3 218 ? 44.823  43.955 40.999  1.00 51.01  ?  514  VAL A C      1 
ATOM   2108 O  O      . VAL C 3 218 ? 45.017  43.356 42.063  1.00 58.17  ?  514  VAL A O      1 
ATOM   2109 C  CB     . VAL C 3 218 ? 42.677  45.272 40.748  1.00 48.81  ?  514  VAL A CB     1 
ATOM   2110 C  CG1    . VAL C 3 218 ? 41.999  44.547 41.900  1.00 45.55  ?  514  VAL A CG1    1 
ATOM   2111 C  CG2    . VAL C 3 218 ? 42.099  46.666 40.573  1.00 55.62  ?  514  VAL A CG2    1 
ATOM   2112 N  N      . GLU C 3 219 ? 45.150  43.425 39.819  1.00 41.73  ?  515  GLU A N      1 
ATOM   2113 C  CA     . GLU C 3 219 ? 45.746  42.096 39.740  1.00 48.92  ?  515  GLU A CA     1 
ATOM   2114 C  C      . GLU C 3 219 ? 47.059  42.041 40.510  1.00 53.79  ?  515  GLU A C      1 
ATOM   2115 O  O      . GLU C 3 219 ? 47.259  41.169 41.364  1.00 51.33  ?  515  GLU A O      1 
ATOM   2116 C  CB     . GLU C 3 219 ? 45.955  41.713 38.275  1.00 53.66  ?  515  GLU A CB     1 
ATOM   2117 C  CG     . GLU C 3 219 ? 46.146  40.229 38.030  1.00 69.09  ?  515  GLU A CG     1 
ATOM   2118 C  CD     . GLU C 3 219 ? 46.340  39.910 36.559  1.00 80.13  ?  515  GLU A CD     1 
ATOM   2119 O  OE1    . GLU C 3 219 ? 47.494  39.966 36.083  1.00 83.19  ?  515  GLU A OE1    1 
ATOM   2120 O  OE2    . GLU C 3 219 ? 45.336  39.618 35.875  1.00 80.09  ?  515  GLU A OE2    1 
ATOM   2121 N  N      . GLN C 3 220 ? 47.969  42.976 40.222  1.00 60.02  ?  516  GLN A N      1 
ATOM   2122 C  CA     . GLN C 3 220 ? 49.243  43.017 40.933  1.00 56.91  ?  516  GLN A CA     1 
ATOM   2123 C  C      . GLN C 3 220 ? 49.033  43.160 42.435  1.00 56.28  ?  516  GLN A C      1 
ATOM   2124 O  O      . GLN C 3 220 ? 49.717  42.506 43.231  1.00 69.21  ?  516  GLN A O      1 
ATOM   2125 C  CB     . GLN C 3 220 ? 50.104  44.162 40.398  1.00 63.03  ?  516  GLN A CB     1 
ATOM   2126 C  CG     . GLN C 3 220 ? 50.665  43.919 39.006  1.00 70.59  ?  516  GLN A CG     1 
ATOM   2127 C  CD     . GLN C 3 220 ? 51.644  42.761 38.966  1.00 73.14  ?  516  GLN A CD     1 
ATOM   2128 O  OE1    . GLN C 3 220 ? 52.660  42.766 39.662  1.00 75.11  ?  516  GLN A OE1    1 
ATOM   2129 N  NE2    . GLN C 3 220 ? 51.338  41.756 38.152  1.00 71.80  ?  516  GLN A NE2    1 
ATOM   2130 N  N      . ARG C 3 221 ? 48.092  44.014 42.843  1.00 52.56  ?  517  ARG A N      1 
ATOM   2131 C  CA     . ARG C 3 221 ? 47.801  44.169 44.264  1.00 51.44  ?  517  ARG A CA     1 
ATOM   2132 C  C      . ARG C 3 221 ? 47.367  42.845 44.884  1.00 51.04  ?  517  ARG A C      1 
ATOM   2133 O  O      . ARG C 3 221 ? 47.804  42.494 45.986  1.00 57.49  ?  517  ARG A O      1 
ATOM   2134 C  CB     . ARG C 3 221 ? 46.727  45.240 44.460  1.00 53.51  ?  517  ARG A CB     1 
ATOM   2135 C  CG     . ARG C 3 221 ? 46.393  45.534 45.906  1.00 53.46  ?  517  ARG A CG     1 
ATOM   2136 C  CD     . ARG C 3 221 ? 47.642  45.898 46.679  1.00 63.34  ?  517  ARG A CD     1 
ATOM   2137 N  NE     . ARG C 3 221 ? 47.363  46.117 48.092  1.00 65.44  ?  517  ARG A NE     1 
ATOM   2138 C  CZ     . ARG C 3 221 ? 48.303  46.220 49.023  1.00 72.49  ?  517  ARG A CZ     1 
ATOM   2139 N  NH1    . ARG C 3 221 ? 49.582  46.117 48.686  1.00 74.84  ?  517  ARG A NH1    1 
ATOM   2140 N  NH2    . ARG C 3 221 ? 47.968  46.420 50.290  1.00 76.09  ?  517  ARG A NH2    1 
ATOM   2141 N  N      . ILE C 3 222 ? 46.515  42.092 44.184  1.00 47.73  ?  518  ILE A N      1 
ATOM   2142 C  CA     . ILE C 3 222 ? 46.069  40.800 44.700  1.00 44.03  ?  518  ILE A CA     1 
ATOM   2143 C  C      . ILE C 3 222 ? 47.242  39.836 44.806  1.00 52.09  ?  518  ILE A C      1 
ATOM   2144 O  O      . ILE C 3 222 ? 47.333  39.046 45.754  1.00 50.98  ?  518  ILE A O      1 
ATOM   2145 C  CB     . ILE C 3 222 ? 44.944  40.233 43.815  1.00 45.61  ?  518  ILE A CB     1 
ATOM   2146 C  CG1    . ILE C 3 222 ? 43.667  41.054 43.996  1.00 50.80  ?  518  ILE A CG1    1 
ATOM   2147 C  CG2    . ILE C 3 222 ? 44.695  38.768 44.137  1.00 51.21  ?  518  ILE A CG2    1 
ATOM   2148 C  CD1    . ILE C 3 222 ? 42.579  40.729 42.995  1.00 51.00  ?  518  ILE A CD1    1 
ATOM   2149 N  N      . TYR C 3 223 ? 48.160  39.884 43.839  1.00 55.24  ?  519  TYR A N      1 
ATOM   2150 C  CA     . TYR C 3 223 ? 49.340  39.030 43.909  1.00 61.81  ?  519  TYR A CA     1 
ATOM   2151 C  C      . TYR C 3 223 ? 50.225  39.394 45.093  1.00 64.03  ?  519  TYR A C      1 
ATOM   2152 O  O      . TYR C 3 223 ? 50.968  38.543 45.596  1.00 63.64  ?  519  TYR A O      1 
ATOM   2153 C  CB     . TYR C 3 223 ? 50.127  39.118 42.602  1.00 67.54  ?  519  TYR A CB     1 
ATOM   2154 C  CG     . TYR C 3 223 ? 49.382  38.557 41.414  1.00 73.45  ?  519  TYR A CG     1 
ATOM   2155 C  CD1    . TYR C 3 223 ? 48.561  37.446 41.548  1.00 75.30  ?  519  TYR A CD1    1 
ATOM   2156 C  CD2    . TYR C 3 223 ? 49.491  39.144 40.161  1.00 75.08  ?  519  TYR A CD2    1 
ATOM   2157 C  CE1    . TYR C 3 223 ? 47.874  36.929 40.465  1.00 76.87  ?  519  TYR A CE1    1 
ATOM   2158 C  CE2    . TYR C 3 223 ? 48.808  38.635 39.073  1.00 76.92  ?  519  TYR A CE2    1 
ATOM   2159 C  CZ     . TYR C 3 223 ? 48.001  37.528 39.230  1.00 77.12  ?  519  TYR A CZ     1 
ATOM   2160 O  OH     . TYR C 3 223 ? 47.320  37.019 38.149  1.00 75.91  ?  519  TYR A OH     1 
ATOM   2161 N  N      . GLU C 3 224 ? 50.160  40.645 45.552  1.00 65.26  ?  520  GLU A N      1 
ATOM   2162 C  CA     . GLU C 3 224 ? 50.927  41.039 46.729  1.00 69.40  ?  520  GLU A CA     1 
ATOM   2163 C  C      . GLU C 3 224 ? 50.237  40.608 48.016  1.00 65.37  ?  520  GLU A C      1 
ATOM   2164 O  O      . GLU C 3 224 ? 50.890  40.091 48.930  1.00 71.23  ?  520  GLU A O      1 
ATOM   2165 C  CB     . GLU C 3 224 ? 51.161  42.550 46.726  1.00 75.38  ?  520  GLU A CB     1 
ATOM   2166 C  CG     . GLU C 3 224 ? 52.228  42.989 45.745  1.00 85.40  ?  520  GLU A CG     1 
ATOM   2167 C  CD     . GLU C 3 224 ? 53.548  42.278 45.978  1.00 93.47  ?  520  GLU A CD     1 
ATOM   2168 O  OE1    . GLU C 3 224 ? 54.020  42.258 47.135  1.00 95.83  ?  520  GLU A OE1    1 
ATOM   2169 O  OE2    . GLU C 3 224 ? 54.107  41.729 45.006  1.00 95.56  ?  520  GLU A OE2    1 
ATOM   2170 N  N      . LEU C 3 225 ? 48.921  40.810 48.106  1.00 55.14  ?  521  LEU A N      1 
ATOM   2171 C  CA     . LEU C 3 225 ? 48.194  40.387 49.298  1.00 58.47  ?  521  LEU A CA     1 
ATOM   2172 C  C      . LEU C 3 225 ? 48.208  38.873 49.451  1.00 61.43  ?  521  LEU A C      1 
ATOM   2173 O  O      . LEU C 3 225 ? 48.153  38.365 50.576  1.00 68.67  ?  521  LEU A O      1 
ATOM   2174 C  CB     . LEU C 3 225 ? 46.761  40.911 49.253  1.00 53.28  ?  521  LEU A CB     1 
ATOM   2175 C  CG     . LEU C 3 225 ? 46.665  42.438 49.225  1.00 57.99  ?  521  LEU A CG     1 
ATOM   2176 C  CD1    . LEU C 3 225 ? 45.238  42.896 49.476  1.00 61.13  ?  521  LEU A CD1    1 
ATOM   2177 C  CD2    . LEU C 3 225 ? 47.622  43.049 50.241  1.00 64.39  ?  521  LEU A CD2    1 
ATOM   2178 N  N      . ALA C 3 226 ? 48.291  38.142 48.342  1.00 60.82  ?  522  ALA A N      1 
ATOM   2179 C  CA     . ALA C 3 226 ? 48.439  36.695 48.381  1.00 62.33  ?  522  ALA A CA     1 
ATOM   2180 C  C      . ALA C 3 226 ? 49.892  36.242 48.456  1.00 68.68  ?  522  ALA A C      1 
ATOM   2181 O  O      . ALA C 3 226 ? 50.139  35.053 48.664  1.00 69.63  ?  522  ALA A O      1 
ATOM   2182 C  CB     . ALA C 3 226 ? 47.782  36.063 47.153  1.00 53.69  ?  522  ALA A CB     1 
ATOM   2183 N  N      . GLY C 3 227 ? 50.845  37.156 48.304  1.00 70.60  ?  523  GLY A N      1 
ATOM   2184 C  CA     . GLY C 3 227 ? 52.256  36.785 48.264  1.00 73.46  ?  523  GLY A CA     1 
ATOM   2185 C  C      . GLY C 3 227 ? 52.536  35.653 47.305  1.00 76.54  ?  523  GLY A C      1 
ATOM   2186 O  O      . GLY C 3 227 ? 53.246  34.702 47.654  1.00 79.22  ?  523  GLY A O      1 
ATOM   2187 N  N      . GLN C 3 228 ? 51.951  35.720 46.114  1.00 72.74  ?  524  GLN A N      1 
ATOM   2188 C  CA     . GLN C 3 228 ? 52.034  34.615 45.178  1.00 69.45  ?  524  GLN A CA     1 
ATOM   2189 C  C      . GLN C 3 228 ? 51.203  34.962 43.951  1.00 72.72  ?  524  GLN A C      1 
ATOM   2190 O  O      . GLN C 3 228 ? 50.294  35.792 44.005  1.00 72.52  ?  524  GLN A O      1 
ATOM   2191 C  CB     . GLN C 3 228 ? 51.540  33.308 45.810  1.00 70.92  ?  524  GLN A CB     1 
ATOM   2192 C  CG     . GLN C 3 228 ? 51.316  32.174 44.829  1.00 72.42  ?  524  GLN A CG     1 
ATOM   2193 C  CD     . GLN C 3 228 ? 50.471  31.056 45.418  1.00 73.48  ?  524  GLN A CD     1 
ATOM   2194 O  OE1    . GLN C 3 228 ? 50.295  30.983 46.630  1.00 77.72  ?  524  GLN A OE1    1 
ATOM   2195 N  NE2    . GLN C 3 228 ? 49.934  30.187 44.560  1.00 70.66  ?  524  GLN A NE2    1 
ATOM   2196 N  N      . GLU C 3 229 ? 51.527  34.307 42.847  1.00 75.67  ?  525  GLU A N      1 
ATOM   2197 C  CA     . GLU C 3 229 ? 50.792  34.436 41.598  1.00 73.30  ?  525  GLU A CA     1 
ATOM   2198 C  C      . GLU C 3 229 ? 49.843  33.255 41.444  1.00 72.01  ?  525  GLU A C      1 
ATOM   2199 O  O      . GLU C 3 229 ? 50.123  32.149 41.911  1.00 74.20  ?  525  GLU A O      1 
ATOM   2200 C  CB     . GLU C 3 229 ? 51.748  34.484 40.401  1.00 83.31  ?  525  GLU A CB     1 
ATOM   2201 C  CG     . GLU C 3 229 ? 52.853  35.522 40.521  1.00 92.60  ?  525  GLU A CG     1 
ATOM   2202 C  CD     . GLU C 3 229 ? 52.525  36.817 39.795  1.00 100.71 ?  525  GLU A CD     1 
ATOM   2203 O  OE1    . GLU C 3 229 ? 53.358  37.747 39.825  1.00 104.82 ?  525  GLU A OE1    1 
ATOM   2204 O  OE2    . GLU C 3 229 ? 51.436  36.907 39.190  1.00 102.28 ?  525  GLU A OE2    1 
ATOM   2205 N  N      . PHE C 3 230 ? 48.721  33.497 40.773  1.00 67.19  ?  526  PHE A N      1 
ATOM   2206 C  CA     . PHE C 3 230 ? 47.722  32.465 40.514  1.00 59.34  ?  526  PHE A CA     1 
ATOM   2207 C  C      . PHE C 3 230 ? 46.682  33.055 39.573  1.00 58.76  ?  526  PHE A C      1 
ATOM   2208 O  O      . PHE C 3 230 ? 46.661  34.263 39.326  1.00 61.16  ?  526  PHE A O      1 
ATOM   2209 C  CB     . PHE C 3 230 ? 47.072  31.962 41.807  1.00 50.48  ?  526  PHE A CB     1 
ATOM   2210 C  CG     . PHE C 3 230 ? 46.248  32.999 42.519  1.00 49.79  ?  526  PHE A CG     1 
ATOM   2211 C  CD1    . PHE C 3 230 ? 46.849  33.970 43.306  1.00 56.99  ?  526  PHE A CD1    1 
ATOM   2212 C  CD2    . PHE C 3 230 ? 44.869  32.995 42.411  1.00 42.96  ?  526  PHE A CD2    1 
ATOM   2213 C  CE1    . PHE C 3 230 ? 46.088  34.920 43.964  1.00 43.85  ?  526  PHE A CE1    1 
ATOM   2214 C  CE2    . PHE C 3 230 ? 44.105  33.940 43.067  1.00 47.08  ?  526  PHE A CE2    1 
ATOM   2215 C  CZ     . PHE C 3 230 ? 44.716  34.903 43.845  1.00 43.59  ?  526  PHE A CZ     1 
ATOM   2216 N  N      . ASN C 3 231 ? 45.820  32.187 39.045  1.00 54.52  ?  527  ASN A N      1 
ATOM   2217 C  CA     . ASN C 3 231 ? 44.758  32.602 38.131  1.00 54.03  ?  527  ASN A CA     1 
ATOM   2218 C  C      . ASN C 3 231 ? 43.576  33.077 38.963  1.00 49.24  ?  527  ASN A C      1 
ATOM   2219 O  O      . ASN C 3 231 ? 42.792  32.271 39.471  1.00 53.73  ?  527  ASN A O      1 
ATOM   2220 C  CB     . ASN C 3 231 ? 44.360  31.465 37.200  1.00 54.12  ?  527  ASN A CB     1 
ATOM   2221 C  CG     . ASN C 3 231 ? 43.368  31.908 36.141  1.00 55.90  ?  527  ASN A CG     1 
ATOM   2222 O  OD1    . ASN C 3 231 ? 43.104  33.101 35.987  1.00 51.46  ?  527  ASN A OD1    1 
ATOM   2223 N  ND2    . ASN C 3 231 ? 42.816  30.951 35.403  1.00 60.00  ?  527  ASN A ND2    1 
ATOM   2224 N  N      . ILE C 3 232 ? 43.443  34.396 39.095  1.00 46.43  ?  528  ILE A N      1 
ATOM   2225 C  CA     . ILE C 3 232 ? 42.363  34.954 39.899  1.00 43.30  ?  528  ILE A CA     1 
ATOM   2226 C  C      . ILE C 3 232 ? 41.006  34.530 39.358  1.00 51.54  ?  528  ILE A C      1 
ATOM   2227 O  O      . ILE C 3 232 ? 40.044  34.383 40.122  1.00 51.72  ?  528  ILE A O      1 
ATOM   2228 C  CB     . ILE C 3 232 ? 42.495  36.486 39.960  1.00 50.27  ?  528  ILE A CB     1 
ATOM   2229 C  CG1    . ILE C 3 232 ? 43.880  36.872 40.483  1.00 39.08  ?  528  ILE A CG1    1 
ATOM   2230 C  CG2    . ILE C 3 232 ? 41.392  37.079 40.823  1.00 52.35  ?  528  ILE A CG2    1 
ATOM   2231 C  CD1    . ILE C 3 232 ? 44.153  38.357 40.456  1.00 39.27  ?  528  ILE A CD1    1 
ATOM   2232 N  N      . ASN C 3 233 ? 40.903  34.322 38.046  1.00 49.54  ?  529  ASN A N      1 
ATOM   2233 C  CA     . ASN C 3 233 ? 39.637  33.972 37.414  1.00 50.47  ?  529  ASN A CA     1 
ATOM   2234 C  C      . ASN C 3 233 ? 39.286  32.500 37.550  1.00 50.77  ?  529  ASN A C      1 
ATOM   2235 O  O      . ASN C 3 233 ? 38.242  32.079 37.041  1.00 48.25  ?  529  ASN A O      1 
ATOM   2236 C  CB     . ASN C 3 233 ? 39.670  34.358 35.935  1.00 51.04  ?  529  ASN A CB     1 
ATOM   2237 C  CG     . ASN C 3 233 ? 39.888  35.836 35.735  1.00 60.48  ?  529  ASN A CG     1 
ATOM   2238 O  OD1    . ASN C 3 233 ? 41.008  36.281 35.488  1.00 70.50  ?  529  ASN A OD1    1 
ATOM   2239 N  ND2    . ASN C 3 233 ? 38.819  36.612 35.857  1.00 59.46  ?  529  ASN A ND2    1 
ATOM   2240 N  N      . SER C 3 234 ? 40.127  31.712 38.214  1.00 50.21  ?  530  SER A N      1 
ATOM   2241 C  CA     . SER C 3 234 ? 39.813  30.319 38.485  1.00 50.70  ?  530  SER A CA     1 
ATOM   2242 C  C      . SER C 3 234 ? 39.195  30.206 39.871  1.00 59.97  ?  530  SER A C      1 
ATOM   2243 O  O      . SER C 3 234 ? 39.920  30.274 40.874  1.00 55.17  ?  530  SER A O      1 
ATOM   2244 C  CB     . SER C 3 234 ? 41.068  29.448 38.385  1.00 42.47  ?  530  SER A CB     1 
ATOM   2245 O  OG     . SER C 3 234 ? 40.800  28.144 38.865  1.00 48.06  ?  530  SER A OG     1 
ATOM   2246 N  N      . PRO C 3 235 ? 37.879  30.036 39.991  1.00 63.76  ?  531  PRO A N      1 
ATOM   2247 C  CA     . PRO C 3 235 ? 37.294  29.839 41.325  1.00 57.71  ?  531  PRO A CA     1 
ATOM   2248 C  C      . PRO C 3 235 ? 37.972  28.729 42.100  1.00 62.69  ?  531  PRO A C      1 
ATOM   2249 O  O      . PRO C 3 235 ? 38.098  28.815 43.329  1.00 65.17  ?  531  PRO A O      1 
ATOM   2250 C  CB     . PRO C 3 235 ? 35.826  29.509 41.016  1.00 56.85  ?  531  PRO A CB     1 
ATOM   2251 C  CG     . PRO C 3 235 ? 35.569  30.109 39.682  1.00 52.41  ?  531  PRO A CG     1 
ATOM   2252 C  CD     . PRO C 3 235 ? 36.864  30.002 38.926  1.00 53.22  ?  531  PRO A CD     1 
ATOM   2253 N  N      . LYS C 3 236 ? 38.430  27.688 41.405  1.00 64.00  ?  532  LYS A N      1 
ATOM   2254 C  CA     . LYS C 3 236 ? 39.187  26.621 42.049  1.00 66.32  ?  532  LYS A CA     1 
ATOM   2255 C  C      . LYS C 3 236 ? 40.448  27.171 42.709  1.00 66.35  ?  532  LYS A C      1 
ATOM   2256 O  O      . LYS C 3 236 ? 40.631  27.059 43.926  1.00 69.58  ?  532  LYS A O      1 
ATOM   2257 C  CB     . LYS C 3 236 ? 39.537  25.547 41.016  1.00 68.14  ?  532  LYS A CB     1 
ATOM   2258 C  CG     . LYS C 3 236 ? 39.950  24.204 41.594  1.00 72.75  ?  532  LYS A CG     1 
ATOM   2259 C  CD     . LYS C 3 236 ? 38.825  23.185 41.476  1.00 78.93  ?  532  LYS A CD     1 
ATOM   2260 C  CE     . LYS C 3 236 ? 39.324  21.864 40.902  1.00 86.20  ?  532  LYS A CE     1 
ATOM   2261 N  NZ     . LYS C 3 236 ? 39.722  21.970 39.467  1.00 87.17  ?  532  LYS A NZ     1 
ATOM   2262 N  N      . GLN C 3 237 ? 41.334  27.777 41.914  1.00 64.70  ?  533  GLN A N      1 
ATOM   2263 C  CA     . GLN C 3 237 ? 42.591  28.277 42.464  1.00 62.63  ?  533  GLN A CA     1 
ATOM   2264 C  C      . GLN C 3 237 ? 42.350  29.324 43.542  1.00 60.12  ?  533  GLN A C      1 
ATOM   2265 O  O      . GLN C 3 237 ? 43.008  29.311 44.589  1.00 61.81  ?  533  GLN A O      1 
ATOM   2266 C  CB     . GLN C 3 237 ? 43.465  28.864 41.356  1.00 64.45  ?  533  GLN A CB     1 
ATOM   2267 C  CG     . GLN C 3 237 ? 43.977  27.858 40.347  1.00 68.90  ?  533  GLN A CG     1 
ATOM   2268 C  CD     . GLN C 3 237 ? 44.978  28.468 39.385  1.00 72.13  ?  533  GLN A CD     1 
ATOM   2269 O  OE1    . GLN C 3 237 ? 45.503  29.556 39.624  1.00 72.84  ?  533  GLN A OE1    1 
ATOM   2270 N  NE2    . GLN C 3 237 ? 45.246  27.769 38.288  1.00 74.68  ?  533  GLN A NE2    1 
ATOM   2271 N  N      . LEU C 3 238 ? 41.419  30.250 43.299  1.00 49.02  ?  534  LEU A N      1 
ATOM   2272 C  CA     . LEU C 3 238 ? 41.167  31.313 44.267  1.00 51.21  ?  534  LEU A CA     1 
ATOM   2273 C  C      . LEU C 3 238 ? 40.749  30.742 45.616  1.00 54.65  ?  534  LEU A C      1 
ATOM   2274 O  O      . LEU C 3 238 ? 41.140  31.263 46.667  1.00 55.24  ?  534  LEU A O      1 
ATOM   2275 C  CB     . LEU C 3 238 ? 40.103  32.270 43.735  1.00 38.32  ?  534  LEU A CB     1 
ATOM   2276 C  CG     . LEU C 3 238 ? 39.769  33.423 44.680  1.00 44.30  ?  534  LEU A CG     1 
ATOM   2277 C  CD1    . LEU C 3 238 ? 41.011  34.263 44.926  1.00 49.32  ?  534  LEU A CD1    1 
ATOM   2278 C  CD2    . LEU C 3 238 ? 38.635  34.273 44.133  1.00 48.97  ?  534  LEU A CD2    1 
ATOM   2279 N  N      . GLY C 3 239 ? 39.953  29.671 45.607  1.00 55.20  ?  535  GLY A N      1 
ATOM   2280 C  CA     . GLY C 3 239 ? 39.585  29.030 46.857  1.00 48.06  ?  535  GLY A CA     1 
ATOM   2281 C  C      . GLY C 3 239 ? 40.787  28.566 47.654  1.00 52.46  ?  535  GLY A C      1 
ATOM   2282 O  O      . GLY C 3 239 ? 40.775  28.612 48.887  1.00 54.41  ?  535  GLY A O      1 
ATOM   2283 N  N      . VAL C 3 240 ? 41.841  28.122 46.966  1.00 58.10  ?  536  VAL A N      1 
ATOM   2284 C  CA     . VAL C 3 240 ? 43.050  27.680 47.655  1.00 66.37  ?  536  VAL A CA     1 
ATOM   2285 C  C      . VAL C 3 240 ? 43.726  28.855 48.350  1.00 63.85  ?  536  VAL A C      1 
ATOM   2286 O  O      . VAL C 3 240 ? 44.149  28.754 49.508  1.00 62.29  ?  536  VAL A O      1 
ATOM   2287 C  CB     . VAL C 3 240 ? 44.007  26.988 46.668  1.00 67.70  ?  536  VAL A CB     1 
ATOM   2288 C  CG1    . VAL C 3 240 ? 45.264  26.532 47.387  1.00 57.78  ?  536  VAL A CG1    1 
ATOM   2289 C  CG2    . VAL C 3 240 ? 43.315  25.817 45.985  1.00 69.42  ?  536  VAL A CG2    1 
ATOM   2290 N  N      . ILE C 3 241 ? 43.845  29.984 47.649  1.00 55.86  ?  537  ILE A N      1 
ATOM   2291 C  CA     . ILE C 3 241 ? 44.477  31.161 48.239  1.00 56.09  ?  537  ILE A CA     1 
ATOM   2292 C  C      . ILE C 3 241 ? 43.664  31.660 49.427  1.00 46.13  ?  537  ILE A C      1 
ATOM   2293 O  O      . ILE C 3 241 ? 44.208  31.949 50.499  1.00 49.26  ?  537  ILE A O      1 
ATOM   2294 C  CB     . ILE C 3 241 ? 44.662  32.260 47.177  1.00 55.86  ?  537  ILE A CB     1 
ATOM   2295 C  CG1    . ILE C 3 241 ? 45.674  31.805 46.123  1.00 50.36  ?  537  ILE A CG1    1 
ATOM   2296 C  CG2    . ILE C 3 241 ? 45.097  33.572 47.823  1.00 48.16  ?  537  ILE A CG2    1 
ATOM   2297 C  CD1    . ILE C 3 241 ? 47.001  31.356 46.709  1.00 53.63  ?  537  ILE A CD1    1 
ATOM   2298 N  N      . LEU C 3 242 ? 42.344  31.753 49.258  1.00 48.40  ?  538  LEU A N      1 
ATOM   2299 C  CA     . LEU C 3 242 ? 41.499  32.326 50.300  1.00 48.37  ?  538  LEU A CA     1 
ATOM   2300 C  C      . LEU C 3 242 ? 41.326  31.365 51.471  1.00 52.01  ?  538  LEU A C      1 
ATOM   2301 O  O      . LEU C 3 242 ? 41.750  31.652 52.597  1.00 52.16  ?  538  LEU A O      1 
ATOM   2302 C  CB     . LEU C 3 242 ? 40.139  32.717 49.715  1.00 43.02  ?  538  LEU A CB     1 
ATOM   2303 C  CG     . LEU C 3 242 ? 40.136  33.890 48.732  1.00 46.03  ?  538  LEU A CG     1 
ATOM   2304 C  CD1    . LEU C 3 242 ? 38.709  34.298 48.376  1.00 50.22  ?  538  LEU A CD1    1 
ATOM   2305 C  CD2    . LEU C 3 242 ? 40.918  35.068 49.297  1.00 42.63  ?  538  LEU A CD2    1 
ATOM   2306 N  N      . PHE C 3 243 ? 40.702  30.213 51.223  1.00 56.56  ?  539  PHE A N      1 
ATOM   2307 C  CA     . PHE C 3 243 ? 40.257  29.311 52.277  1.00 58.35  ?  539  PHE A CA     1 
ATOM   2308 C  C      . PHE C 3 243 ? 41.290  28.249 52.634  1.00 70.19  ?  539  PHE A C      1 
ATOM   2309 O  O      . PHE C 3 243 ? 40.927  27.210 53.196  1.00 83.27  ?  539  PHE A O      1 
ATOM   2310 C  CB     . PHE C 3 243 ? 38.941  28.646 51.869  1.00 55.70  ?  539  PHE A CB     1 
ATOM   2311 C  CG     . PHE C 3 243 ? 37.881  29.619 51.441  1.00 59.20  ?  539  PHE A CG     1 
ATOM   2312 C  CD1    . PHE C 3 243 ? 37.269  30.446 52.367  1.00 59.05  ?  539  PHE A CD1    1 
ATOM   2313 C  CD2    . PHE C 3 243 ? 37.496  29.709 50.115  1.00 52.12  ?  539  PHE A CD2    1 
ATOM   2314 C  CE1    . PHE C 3 243 ? 36.294  31.341 51.981  1.00 48.01  ?  539  PHE A CE1    1 
ATOM   2315 C  CE2    . PHE C 3 243 ? 36.520  30.602 49.720  1.00 47.90  ?  539  PHE A CE2    1 
ATOM   2316 C  CZ     . PHE C 3 243 ? 35.919  31.420 50.653  1.00 54.24  ?  539  PHE A CZ     1 
ATOM   2317 N  N      . GLU C 3 244 ? 42.562  28.481 52.322  1.00 65.39  ?  540  GLU A N      1 
ATOM   2318 C  CA     . GLU C 3 244 ? 43.607  27.531 52.678  1.00 67.73  ?  540  GLU A CA     1 
ATOM   2319 C  C      . GLU C 3 244 ? 44.895  28.265 53.017  1.00 66.73  ?  540  GLU A C      1 
ATOM   2320 O  O      . GLU C 3 244 ? 45.442  28.101 54.111  1.00 69.31  ?  540  GLU A O      1 
ATOM   2321 C  CB     . GLU C 3 244 ? 43.843  26.533 51.541  1.00 69.63  ?  540  GLU A CB     1 
ATOM   2322 C  CG     . GLU C 3 244 ? 45.305  26.159 51.349  1.00 73.79  ?  540  GLU A CG     1 
ATOM   2323 C  CD     . GLU C 3 244 ? 45.493  24.938 50.468  1.00 75.60  ?  540  GLU A CD     1 
ATOM   2324 O  OE1    . GLU C 3 244 ? 44.481  24.351 50.028  1.00 69.47  ?  540  GLU A OE1    1 
ATOM   2325 O  OE2    . GLU C 3 244 ? 46.660  24.565 50.224  1.00 75.67  ?  540  GLU A OE2    1 
ATOM   2326 N  N      . LYS C 3 245 ? 45.383  29.081 52.082  1.00 67.59  ?  541  LYS A N      1 
ATOM   2327 C  CA     . LYS C 3 245 ? 46.617  29.822 52.317  1.00 68.54  ?  541  LYS A CA     1 
ATOM   2328 C  C      . LYS C 3 245 ? 46.389  30.985 53.276  1.00 67.50  ?  541  LYS A C      1 
ATOM   2329 O  O      . LYS C 3 245 ? 47.221  31.246 54.154  1.00 73.03  ?  541  LYS A O      1 
ATOM   2330 C  CB     . LYS C 3 245 ? 47.184  30.316 50.986  1.00 71.07  ?  541  LYS A CB     1 
ATOM   2331 C  CG     . LYS C 3 245 ? 48.564  30.935 51.082  1.00 76.80  ?  541  LYS A CG     1 
ATOM   2332 C  CD     . LYS C 3 245 ? 49.064  31.349 49.706  1.00 78.66  ?  541  LYS A CD     1 
ATOM   2333 C  CE     . LYS C 3 245 ? 50.478  31.900 49.775  1.00 79.76  ?  541  LYS A CE     1 
ATOM   2334 N  NZ     . LYS C 3 245 ? 50.574  33.058 50.703  1.00 80.60  ?  541  LYS A NZ     1 
ATOM   2335 N  N      . LEU C 3 246 ? 45.264  31.686 53.131  1.00 56.84  ?  542  LEU A N      1 
ATOM   2336 C  CA     . LEU C 3 246 ? 44.923  32.803 54.000  1.00 54.59  ?  542  LEU A CA     1 
ATOM   2337 C  C      . LEU C 3 246 ? 44.060  32.401 55.187  1.00 51.68  ?  542  LEU A C      1 
ATOM   2338 O  O      . LEU C 3 246 ? 43.885  33.210 56.104  1.00 57.63  ?  542  LEU A O      1 
ATOM   2339 C  CB     . LEU C 3 246 ? 44.205  33.896 53.202  1.00 51.34  ?  542  LEU A CB     1 
ATOM   2340 C  CG     . LEU C 3 246 ? 45.059  34.588 52.139  1.00 55.89  ?  542  LEU A CG     1 
ATOM   2341 C  CD1    . LEU C 3 246 ? 44.286  35.719 51.476  1.00 52.45  ?  542  LEU A CD1    1 
ATOM   2342 C  CD2    . LEU C 3 246 ? 46.354  35.098 52.756  1.00 50.74  ?  542  LEU A CD2    1 
ATOM   2343 N  N      . GLN C 3 247 ? 43.508  31.186 55.189  1.00 51.66  ?  543  GLN A N      1 
ATOM   2344 C  CA     . GLN C 3 247 ? 42.772  30.659 56.335  1.00 57.81  ?  543  GLN A CA     1 
ATOM   2345 C  C      . GLN C 3 247 ? 41.489  31.436 56.615  1.00 59.13  ?  543  GLN A C      1 
ATOM   2346 O  O      . GLN C 3 247 ? 41.077  31.565 57.770  1.00 52.67  ?  543  GLN A O      1 
ATOM   2347 C  CB     . GLN C 3 247 ? 43.651  30.637 57.588  1.00 55.60  ?  543  GLN A CB     1 
ATOM   2348 C  CG     . GLN C 3 247 ? 44.819  29.675 57.508  1.00 63.62  ?  543  GLN A CG     1 
ATOM   2349 C  CD     . GLN C 3 247 ? 44.374  28.228 57.489  1.00 65.79  ?  543  GLN A CD     1 
ATOM   2350 O  OE1    . GLN C 3 247 ? 43.812  27.726 58.462  1.00 63.73  ?  543  GLN A OE1    1 
ATOM   2351 N  NE2    . GLN C 3 247 ? 44.620  27.549 56.374  1.00 57.44  ?  543  GLN A NE2    1 
ATOM   2352 N  N      . LEU C 3 248 ? 40.845  31.953 55.573  1.00 49.81  ?  544  LEU A N      1 
ATOM   2353 C  CA     . LEU C 3 248 ? 39.597  32.673 55.759  1.00 48.97  ?  544  LEU A CA     1 
ATOM   2354 C  C      . LEU C 3 248 ? 38.453  31.700 56.049  1.00 56.36  ?  544  LEU A C      1 
ATOM   2355 O  O      . LEU C 3 248 ? 38.484  30.546 55.612  1.00 49.58  ?  544  LEU A O      1 
ATOM   2356 C  CB     . LEU C 3 248 ? 39.272  33.499 54.519  1.00 47.10  ?  544  LEU A CB     1 
ATOM   2357 C  CG     . LEU C 3 248 ? 40.329  34.524 54.119  1.00 47.09  ?  544  LEU A CG     1 
ATOM   2358 C  CD1    . LEU C 3 248 ? 39.855  35.351 52.930  1.00 45.32  ?  544  LEU A CD1    1 
ATOM   2359 C  CD2    . LEU C 3 248 ? 40.668  35.420 55.296  1.00 48.45  ?  544  LEU A CD2    1 
ATOM   2360 N  N      . PRO C 3 249 ? 37.432  32.143 56.781  1.00 57.68  ?  545  PRO A N      1 
ATOM   2361 C  CA     . PRO C 3 249 ? 36.326  31.242 57.127  1.00 54.51  ?  545  PRO A CA     1 
ATOM   2362 C  C      . PRO C 3 249 ? 35.530  30.814 55.903  1.00 59.98  ?  545  PRO A C      1 
ATOM   2363 O  O      . PRO C 3 249 ? 35.409  31.548 54.919  1.00 51.01  ?  545  PRO A O      1 
ATOM   2364 C  CB     . PRO C 3 249 ? 35.460  32.084 58.074  1.00 50.07  ?  545  PRO A CB     1 
ATOM   2365 C  CG     . PRO C 3 249 ? 36.348  33.202 58.530  1.00 54.87  ?  545  PRO A CG     1 
ATOM   2366 C  CD     . PRO C 3 249 ? 37.276  33.471 57.392  1.00 59.60  ?  545  PRO A CD     1 
ATOM   2367 N  N      . VAL C 3 250 ? 34.968  29.611 55.984  1.00 63.93  ?  546  VAL A N      1 
ATOM   2368 C  CA     . VAL C 3 250 ? 34.145  29.047 54.919  1.00 57.39  ?  546  VAL A CA     1 
ATOM   2369 C  C      . VAL C 3 250 ? 32.689  29.196 55.351  1.00 65.75  ?  546  VAL A C      1 
ATOM   2370 O  O      . VAL C 3 250 ? 32.170  28.384 56.121  1.00 70.87  ?  546  VAL A O      1 
ATOM   2371 C  CB     . VAL C 3 250 ? 34.505  27.585 54.637  1.00 59.03  ?  546  VAL A CB     1 
ATOM   2372 C  CG1    . VAL C 3 250 ? 33.813  27.103 53.370  1.00 48.62  ?  546  VAL A CG1    1 
ATOM   2373 C  CG2    . VAL C 3 250 ? 36.014  27.416 54.531  1.00 56.92  ?  546  VAL A CG2    1 
ATOM   2374 N  N      . LEU C 3 251 ? 32.022  30.237 54.851  1.00 76.29  ?  547  LEU A N      1 
ATOM   2375 C  CA     . LEU C 3 251 ? 30.636  30.507 55.214  1.00 83.33  ?  547  LEU A CA     1 
ATOM   2376 C  C      . LEU C 3 251 ? 29.632  29.819 54.301  1.00 90.07  ?  547  LEU A C      1 
ATOM   2377 O  O      . LEU C 3 251 ? 28.475  29.635 54.700  1.00 94.00  ?  547  LEU A O      1 
ATOM   2378 C  CB     . LEU C 3 251 ? 30.373  32.017 55.202  1.00 77.27  ?  547  LEU A CB     1 
ATOM   2379 C  CG     . LEU C 3 251 ? 31.233  32.873 56.136  1.00 76.08  ?  547  LEU A CG     1 
ATOM   2380 C  CD1    . LEU C 3 251 ? 30.854  34.345 56.019  1.00 77.59  ?  547  LEU A CD1    1 
ATOM   2381 C  CD2    . LEU C 3 251 ? 31.112  32.392 57.576  1.00 63.01  ?  547  LEU A CD2    1 
ATOM   2382 N  N      . LYS C 3 252 ? 30.044  29.442 53.094  1.00 88.52  ?  548  LYS A N      1 
ATOM   2383 C  CA     . LYS C 3 252 ? 29.163  28.815 52.122  1.00 86.88  ?  548  LYS A CA     1 
ATOM   2384 C  C      . LYS C 3 252 ? 29.994  27.899 51.239  1.00 81.80  ?  548  LYS A C      1 
ATOM   2385 O  O      . LYS C 3 252 ? 31.162  28.177 50.955  1.00 75.95  ?  548  LYS A O      1 
ATOM   2386 C  CB     . LYS C 3 252 ? 28.421  29.861 51.280  1.00 85.48  ?  548  LYS A CB     1 
ATOM   2387 C  CG     . LYS C 3 252 ? 28.187  29.460 49.831  1.00 85.13  ?  548  LYS A CG     1 
ATOM   2388 C  CD     . LYS C 3 252 ? 26.704  29.382 49.512  1.00 83.97  ?  548  LYS A CD     1 
ATOM   2389 C  CE     . LYS C 3 252 ? 25.894  30.185 50.516  1.00 86.48  ?  548  LYS A CE     1 
ATOM   2390 N  NZ     . LYS C 3 252 ? 24.678  30.784 49.904  1.00 85.20  ?  548  LYS A NZ     1 
ATOM   2391 N  N      . LYS C 3 253 ? 29.378  26.803 50.806  1.00 81.31  ?  549  LYS A N      1 
ATOM   2392 C  CA     . LYS C 3 253 ? 30.072  25.749 50.075  1.00 84.74  ?  549  LYS A CA     1 
ATOM   2393 C  C      . LYS C 3 253 ? 29.268  25.402 48.830  1.00 91.00  ?  549  LYS A C      1 
ATOM   2394 O  O      . LYS C 3 253 ? 28.152  24.883 48.933  1.00 93.91  ?  549  LYS A O      1 
ATOM   2395 C  CB     . LYS C 3 253 ? 30.281  24.515 50.956  1.00 84.60  ?  549  LYS A CB     1 
ATOM   2396 C  CG     . LYS C 3 253 ? 29.029  24.034 51.687  1.00 86.12  ?  549  LYS A CG     1 
ATOM   2397 C  CD     . LYS C 3 253 ? 28.683  24.935 52.869  1.00 87.82  ?  549  LYS A CD     1 
ATOM   2398 C  CE     . LYS C 3 253 ? 27.243  24.748 53.319  1.00 90.88  ?  549  LYS A CE     1 
ATOM   2399 N  NZ     . LYS C 3 253 ? 26.635  26.044 53.737  1.00 89.56  ?  549  LYS A NZ     1 
ATOM   2400 N  N      . THR C 3 254 ? 29.859  25.637 47.663  1.00 96.67  ?  550  THR A N      1 
ATOM   2401 C  CA     . THR C 3 254 ? 29.222  25.269 46.408  1.00 98.01  ?  550  THR A CA     1 
ATOM   2402 C  C      . THR C 3 254 ? 28.998  23.756 46.417  1.00 106.15 ?  550  THR A C      1 
ATOM   2403 O  O      . THR C 3 254 ? 29.237  23.094 47.424  1.00 111.89 ?  550  THR A O      1 
ATOM   2404 C  CB     . THR C 3 254 ? 30.092  25.624 45.195  1.00 30.00  ?  550  THR A CB     1 
ATOM   2405 O  OG1    . THR C 3 254 ? 31.412  25.098 45.375  1.00 30.00  ?  550  THR A OG1    1 
ATOM   2406 C  CG2    . THR C 3 254 ? 30.168  27.121 45.021  1.00 30.00  ?  550  THR A CG2    1 
ATOM   2407 N  N      . LYS C 3 255 ? 28.546  23.198 45.301  1.00 105.22 ?  551  LYS A N      1 
ATOM   2408 C  CA     . LYS C 3 255 ? 28.300  21.763 45.259  1.00 104.18 ?  551  LYS A CA     1 
ATOM   2409 C  C      . LYS C 3 255 ? 29.588  20.950 45.221  1.00 101.29 ?  551  LYS A C      1 
ATOM   2410 O  O      . LYS C 3 255 ? 29.567  19.763 45.563  1.00 99.08  ?  551  LYS A O      1 
ATOM   2411 C  CB     . LYS C 3 255 ? 27.423  21.418 44.051  1.00 105.55 ?  551  LYS A CB     1 
ATOM   2412 C  CG     . LYS C 3 255 ? 26.654  20.112 44.195  1.00 107.29 ?  551  LYS A CG     1 
ATOM   2413 C  CD     . LYS C 3 255 ? 25.795  19.826 42.969  1.00 102.63 ?  551  LYS A CD     1 
ATOM   2414 C  CE     . LYS C 3 255 ? 24.971  18.559 43.157  1.00 102.09 ?  551  LYS A CE     1 
ATOM   2415 N  NZ     . LYS C 3 255 ? 24.226  18.204 41.918  1.00 98.04  ?  551  LYS A NZ     1 
ATOM   2416 N  N      . THR C 3 256 ? 30.710  21.559 44.826  1.00 99.63  ?  552  THR A N      1 
ATOM   2417 C  CA     . THR C 3 256 ? 31.954  20.822 44.630  1.00 98.88  ?  552  THR A CA     1 
ATOM   2418 C  C      . THR C 3 256 ? 33.144  21.511 45.295  1.00 97.41  ?  552  THR A C      1 
ATOM   2419 O  O      . THR C 3 256 ? 34.281  21.365 44.839  1.00 97.20  ?  552  THR A O      1 
ATOM   2420 C  CB     . THR C 3 256 ? 32.231  20.613 43.140  1.00 99.47  ?  552  THR A CB     1 
ATOM   2421 O  OG1    . THR C 3 256 ? 32.734  21.828 42.568  1.00 98.63  ?  552  THR A OG1    1 
ATOM   2422 C  CG2    . THR C 3 256 ? 30.952  20.211 42.414  1.00 98.40  ?  552  THR A CG2    1 
ATOM   2423 N  N      . GLY C 3 257 ? 32.918  22.251 46.366  1.00 95.35  ?  553  GLY A N      1 
ATOM   2424 C  CA     . GLY C 3 257 ? 34.028  22.865 47.075  1.00 92.63  ?  553  GLY A CA     1 
ATOM   2425 C  C      . GLY C 3 257 ? 33.597  24.169 47.725  1.00 86.98  ?  553  GLY A C      1 
ATOM   2426 O  O      . GLY C 3 257 ? 32.452  24.314 48.145  1.00 90.74  ?  553  GLY A O      1 
ATOM   2427 N  N      . TYR C 3 258 ? 34.540  25.106 47.799  1.00 76.25  ?  554  TYR A N      1 
ATOM   2428 C  CA     . TYR C 3 258 ? 34.276  26.396 48.423  1.00 68.49  ?  554  TYR A CA     1 
ATOM   2429 C  C      . TYR C 3 258 ? 33.597  27.326 47.430  1.00 60.34  ?  554  TYR A C      1 
ATOM   2430 O  O      . TYR C 3 258 ? 33.999  27.404 46.265  1.00 60.55  ?  554  TYR A O      1 
ATOM   2431 C  CB     . TYR C 3 258 ? 35.565  27.053 48.916  1.00 60.73  ?  554  TYR A CB     1 
ATOM   2432 C  CG     . TYR C 3 258 ? 36.523  26.146 49.641  1.00 57.05  ?  554  TYR A CG     1 
ATOM   2433 C  CD1    . TYR C 3 258 ? 37.717  25.762 49.051  1.00 52.72  ?  554  TYR A CD1    1 
ATOM   2434 C  CD2    . TYR C 3 258 ? 36.249  25.694 50.925  1.00 55.75  ?  554  TYR A CD2    1 
ATOM   2435 C  CE1    . TYR C 3 258 ? 38.610  24.946 49.712  1.00 54.03  ?  554  TYR A CE1    1 
ATOM   2436 C  CE2    . TYR C 3 258 ? 37.136  24.875 51.595  1.00 62.87  ?  554  TYR A CE2    1 
ATOM   2437 C  CZ     . TYR C 3 258 ? 38.315  24.503 50.983  1.00 62.25  ?  554  TYR A CZ     1 
ATOM   2438 O  OH     . TYR C 3 258 ? 39.202  23.686 51.647  1.00 71.34  ?  554  TYR A OH     1 
ATOM   2439 N  N      . SER C 3 259 ? 32.577  28.040 47.894  1.00 58.76  ?  555  SER A N      1 
ATOM   2440 C  CA     . SER C 3 259 ? 31.988  29.101 47.097  1.00 61.29  ?  555  SER A CA     1 
ATOM   2441 C  C      . SER C 3 259 ? 32.850  30.352 47.190  1.00 60.74  ?  555  SER A C      1 
ATOM   2442 O  O      . SER C 3 259 ? 33.373  30.685 48.257  1.00 58.62  ?  555  SER A O      1 
ATOM   2443 C  CB     . SER C 3 259 ? 30.566  29.407 47.569  1.00 60.82  ?  555  SER A CB     1 
ATOM   2444 O  OG     . SER C 3 259 ? 29.989  30.451 46.804  1.00 64.03  ?  555  SER A OG     1 
ATOM   2445 N  N      . THR C 3 260 ? 33.014  31.033 46.057  1.00 49.54  ?  556  THR A N      1 
ATOM   2446 C  CA     . THR C 3 260 ? 33.670  32.334 46.009  1.00 44.67  ?  556  THR A CA     1 
ATOM   2447 C  C      . THR C 3 260 ? 32.721  33.393 45.460  1.00 49.66  ?  556  THR A C      1 
ATOM   2448 O  O      . THR C 3 260 ? 33.143  34.329 44.779  1.00 50.71  ?  556  THR A O      1 
ATOM   2449 C  CB     . THR C 3 260 ? 34.954  32.279 45.181  1.00 50.16  ?  556  THR A CB     1 
ATOM   2450 O  OG1    . THR C 3 260 ? 34.685  31.678 43.909  1.00 49.12  ?  556  THR A OG1    1 
ATOM   2451 C  CG2    . THR C 3 260 ? 36.026  31.478 45.903  1.00 45.97  ?  556  THR A CG2    1 
ATOM   2452 N  N      . SER C 3 261 ? 31.431  33.245 45.744  1.00 53.20  ?  557  SER A N      1 
ATOM   2453 C  CA     . SER C 3 261 ? 30.447  34.207 45.275  1.00 56.41  ?  557  SER A CA     1 
ATOM   2454 C  C      . SER C 3 261 ? 30.697  35.574 45.899  1.00 59.28  ?  557  SER A C      1 
ATOM   2455 O  O      . SER C 3 261 ? 31.167  35.688 47.035  1.00 52.84  ?  557  SER A O      1 
ATOM   2456 C  CB     . SER C 3 261 ? 29.035  33.727 45.616  1.00 60.88  ?  557  SER A CB     1 
ATOM   2457 O  OG     . SER C 3 261 ? 28.055  34.669 45.213  1.00 66.78  ?  557  SER A OG     1 
ATOM   2458 N  N      . ALA C 3 262 ? 30.383  36.626 45.138  1.00 63.64  ?  558  ALA A N      1 
ATOM   2459 C  CA     . ALA C 3 262 ? 30.399  37.968 45.707  1.00 65.80  ?  558  ALA A CA     1 
ATOM   2460 C  C      . ALA C 3 262 ? 29.556  38.025 46.971  1.00 71.56  ?  558  ALA A C      1 
ATOM   2461 O  O      . ALA C 3 262 ? 29.837  38.821 47.874  1.00 72.37  ?  558  ALA A O      1 
ATOM   2462 C  CB     . ALA C 3 262 ? 29.904  38.987 44.682  1.00 58.75  ?  558  ALA A CB     1 
ATOM   2463 N  N      . ASP C 3 263 ? 28.522  37.185 47.051  1.00 79.24  ?  559  ASP A N      1 
ATOM   2464 C  CA     . ASP C 3 263 ? 27.777  37.009 48.293  1.00 82.90  ?  559  ASP A CA     1 
ATOM   2465 C  C      . ASP C 3 263 ? 28.710  36.608 49.429  1.00 69.52  ?  559  ASP A C      1 
ATOM   2466 O  O      . ASP C 3 263 ? 28.768  37.268 50.473  1.00 69.08  ?  559  ASP A O      1 
ATOM   2467 C  CB     . ASP C 3 263 ? 26.686  35.953 48.090  1.00 95.85  ?  559  ASP A CB     1 
ATOM   2468 C  CG     . ASP C 3 263 ? 25.343  36.383 48.645  1.00 107.59 ?  559  ASP A CG     1 
ATOM   2469 O  OD1    . ASP C 3 263 ? 24.609  37.107 47.939  1.00 109.52 ?  559  ASP A OD1    1 
ATOM   2470 O  OD2    . ASP C 3 263 ? 25.022  35.996 49.787  1.00 113.02 ?  559  ASP A OD2    1 
ATOM   2471 N  N      . VAL C 3 264 ? 29.460  35.522 49.233  1.00 63.19  ?  560  VAL A N      1 
ATOM   2472 C  CA     . VAL C 3 264 ? 30.343  35.019 50.280  1.00 61.97  ?  560  VAL A CA     1 
ATOM   2473 C  C      . VAL C 3 264 ? 31.484  35.992 50.537  1.00 60.30  ?  560  VAL A C      1 
ATOM   2474 O  O      . VAL C 3 264 ? 31.869  36.229 51.688  1.00 59.99  ?  560  VAL A O      1 
ATOM   2475 C  CB     . VAL C 3 264 ? 30.871  33.621 49.905  1.00 54.67  ?  560  VAL A CB     1 
ATOM   2476 C  CG1    . VAL C 3 264 ? 31.932  33.163 50.899  1.00 59.80  ?  560  VAL A CG1    1 
ATOM   2477 C  CG2    . VAL C 3 264 ? 29.726  32.625 49.837  1.00 56.79  ?  560  VAL A CG2    1 
ATOM   2478 N  N      . LEU C 3 265 ? 32.043  36.570 49.471  1.00 48.40  ?  561  LEU A N      1 
ATOM   2479 C  CA     . LEU C 3 265 ? 33.217  37.423 49.619  1.00 52.60  ?  561  LEU A CA     1 
ATOM   2480 C  C      . LEU C 3 265 ? 32.884  38.703 50.376  1.00 55.05  ?  561  LEU A C      1 
ATOM   2481 O  O      . LEU C 3 265 ? 33.690  39.179 51.183  1.00 51.00  ?  561  LEU A O      1 
ATOM   2482 C  CB     . LEU C 3 265 ? 33.806  37.738 48.246  1.00 47.20  ?  561  LEU A CB     1 
ATOM   2483 C  CG     . LEU C 3 265 ? 34.326  36.531 47.462  1.00 46.21  ?  561  LEU A CG     1 
ATOM   2484 C  CD1    . LEU C 3 265 ? 35.131  37.000 46.263  1.00 52.00  ?  561  LEU A CD1    1 
ATOM   2485 C  CD2    . LEU C 3 265 ? 35.158  35.619 48.350  1.00 49.56  ?  561  LEU A CD2    1 
ATOM   2486 N  N      . GLU C 3 266 ? 31.703  39.277 50.127  1.00 57.04  ?  562  GLU A N      1 
ATOM   2487 C  CA     . GLU C 3 266 ? 31.256  40.430 50.904  1.00 63.01  ?  562  GLU A CA     1 
ATOM   2488 C  C      . GLU C 3 266 ? 31.408  40.171 52.399  1.00 68.83  ?  562  GLU A C      1 
ATOM   2489 O  O      . GLU C 3 266 ? 31.991  40.982 53.129  1.00 72.15  ?  562  GLU A O      1 
ATOM   2490 C  CB     . GLU C 3 266 ? 29.800  40.759 50.563  1.00 72.43  ?  562  GLU A CB     1 
ATOM   2491 C  CG     . GLU C 3 266 ? 29.610  41.664 49.353  1.00 80.82  ?  562  GLU A CG     1 
ATOM   2492 C  CD     . GLU C 3 266 ? 29.630  43.139 49.717  1.00 89.68  ?  562  GLU A CD     1 
ATOM   2493 O  OE1    . GLU C 3 266 ? 29.971  43.463 50.875  1.00 95.62  ?  562  GLU A OE1    1 
ATOM   2494 O  OE2    . GLU C 3 266 ? 29.300  43.973 48.847  1.00 86.39  ?  562  GLU A OE2    1 
ATOM   2495 N  N      . LYS C 3 267 ? 30.891  39.034 52.871  1.00 71.43  ?  563  LYS A N      1 
ATOM   2496 C  CA     . LYS C 3 267 ? 31.008  38.690 54.282  1.00 65.99  ?  563  LYS A CA     1 
ATOM   2497 C  C      . LYS C 3 267 ? 32.448  38.414 54.696  1.00 58.07  ?  563  LYS A C      1 
ATOM   2498 O  O      . LYS C 3 267 ? 32.744  38.405 55.895  1.00 51.62  ?  563  LYS A O      1 
ATOM   2499 C  CB     . LYS C 3 267 ? 30.127  37.478 54.597  1.00 69.47  ?  563  LYS A CB     1 
ATOM   2500 C  CG     . LYS C 3 267 ? 28.648  37.701 54.309  1.00 72.48  ?  563  LYS A CG     1 
ATOM   2501 C  CD     . LYS C 3 267 ? 27.844  36.417 54.456  1.00 73.62  ?  563  LYS A CD     1 
ATOM   2502 C  CE     . LYS C 3 267 ? 26.352  36.668 54.265  1.00 71.67  ?  563  LYS A CE     1 
ATOM   2503 N  NZ     . LYS C 3 267 ? 26.033  37.274 52.940  1.00 58.53  ?  563  LYS A NZ     1 
ATOM   2504 N  N      . LEU C 3 268 ? 33.352  38.207 53.740  1.00 55.15  ?  564  LEU A N      1 
ATOM   2505 C  CA     . LEU C 3 268 ? 34.736  37.881 54.059  1.00 54.20  ?  564  LEU A CA     1 
ATOM   2506 C  C      . LEU C 3 268 ? 35.655  39.095 54.103  1.00 56.73  ?  564  LEU A C      1 
ATOM   2507 O  O      . LEU C 3 268 ? 36.770  38.990 54.623  1.00 45.06  ?  564  LEU A O      1 
ATOM   2508 C  CB     . LEU C 3 268 ? 35.293  36.884 53.039  1.00 51.97  ?  564  LEU A CB     1 
ATOM   2509 C  CG     . LEU C 3 268 ? 34.963  35.408 53.246  1.00 57.12  ?  564  LEU A CG     1 
ATOM   2510 C  CD1    . LEU C 3 268 ? 35.848  34.549 52.356  1.00 47.51  ?  564  LEU A CD1    1 
ATOM   2511 C  CD2    . LEU C 3 268 ? 35.117  35.012 54.709  1.00 44.80  ?  564  LEU A CD2    1 
ATOM   2512 N  N      . ALA C 3 269 ? 35.224  40.238 53.569  1.00 53.00  ?  565  ALA A N      1 
ATOM   2513 C  CA     . ALA C 3 269 ? 36.066  41.425 53.428  1.00 51.57  ?  565  ALA A CA     1 
ATOM   2514 C  C      . ALA C 3 269 ? 36.697  41.868 54.745  1.00 57.19  ?  565  ALA A C      1 
ATOM   2515 O  O      . ALA C 3 269 ? 37.849  42.324 54.752  1.00 52.62  ?  565  ALA A O      1 
ATOM   2516 C  CB     . ALA C 3 269 ? 35.271  42.577 52.816  1.00 57.96  ?  565  ALA A CB     1 
ATOM   2517 N  N      . PRO C 3 270 ? 35.987  41.771 55.872  1.00 59.15  ?  566  PRO A N      1 
ATOM   2518 C  CA     . PRO C 3 270 ? 36.580  42.218 57.144  1.00 58.06  ?  566  PRO A CA     1 
ATOM   2519 C  C      . PRO C 3 270 ? 37.864  41.502 57.516  1.00 49.43  ?  566  PRO A C      1 
ATOM   2520 O  O      . PRO C 3 270 ? 38.664  42.065 58.270  1.00 50.91  ?  566  PRO A O      1 
ATOM   2521 C  CB     . PRO C 3 270 ? 35.472  41.930 58.167  1.00 63.08  ?  566  PRO A CB     1 
ATOM   2522 C  CG     . PRO C 3 270 ? 34.213  41.908 57.355  1.00 58.84  ?  566  PRO A CG     1 
ATOM   2523 C  CD     . PRO C 3 270 ? 34.587  41.329 56.036  1.00 62.20  ?  566  PRO A CD     1 
ATOM   2524 N  N      . TYR C 3 271 ? 38.104  40.297 56.999  1.00 50.31  ?  567  TYR A N      1 
ATOM   2525 C  CA     . TYR C 3 271 ? 39.227  39.494 57.466  1.00 52.40  ?  567  TYR A CA     1 
ATOM   2526 C  C      . TYR C 3 271 ? 40.520  39.730 56.698  1.00 49.76  ?  567  TYR A C      1 
ATOM   2527 O  O      . TYR C 3 271 ? 41.595  39.446 57.234  1.00 51.12  ?  567  TYR A O      1 
ATOM   2528 C  CB     . TYR C 3 271 ? 38.870  38.005 57.410  1.00 52.45  ?  567  TYR A CB     1 
ATOM   2529 C  CG     . TYR C 3 271 ? 37.685  37.649 58.271  1.00 52.86  ?  567  TYR A CG     1 
ATOM   2530 C  CD1    . TYR C 3 271 ? 36.418  37.534 57.721  1.00 56.38  ?  567  TYR A CD1    1 
ATOM   2531 C  CD2    . TYR C 3 271 ? 37.828  37.454 59.637  1.00 55.55  ?  567  TYR A CD2    1 
ATOM   2532 C  CE1    . TYR C 3 271 ? 35.326  37.218 58.502  1.00 56.66  ?  567  TYR A CE1    1 
ATOM   2533 C  CE2    . TYR C 3 271 ? 36.740  37.136 60.431  1.00 56.26  ?  567  TYR A CE2    1 
ATOM   2534 C  CZ     . TYR C 3 271 ? 35.490  37.020 59.854  1.00 56.20  ?  567  TYR A CZ     1 
ATOM   2535 O  OH     . TYR C 3 271 ? 34.395  36.706 60.624  1.00 58.67  ?  567  TYR A OH     1 
ATOM   2536 N  N      . HIS C 3 272 ? 40.456  40.241 55.471  1.00 54.39  ?  568  HIS A N      1 
ATOM   2537 C  CA     . HIS C 3 272 ? 41.680  40.441 54.708  1.00 58.10  ?  568  HIS A CA     1 
ATOM   2538 C  C      . HIS C 3 272 ? 41.425  41.455 53.604  1.00 54.07  ?  568  HIS A C      1 
ATOM   2539 O  O      . HIS C 3 272 ? 40.362  41.445 52.979  1.00 45.64  ?  568  HIS A O      1 
ATOM   2540 C  CB     . HIS C 3 272 ? 42.188  39.119 54.118  1.00 52.22  ?  568  HIS A CB     1 
ATOM   2541 C  CG     . HIS C 3 272 ? 43.656  39.114 53.826  1.00 48.95  ?  568  HIS A CG     1 
ATOM   2542 N  ND1    . HIS C 3 272 ? 44.192  39.694 52.696  1.00 58.42  ?  568  HIS A ND1    1 
ATOM   2543 C  CD2    . HIS C 3 272 ? 44.700  38.602 54.518  1.00 52.29  ?  568  HIS A CD2    1 
ATOM   2544 C  CE1    . HIS C 3 272 ? 45.504  39.539 52.705  1.00 49.59  ?  568  HIS A CE1    1 
ATOM   2545 N  NE2    . HIS C 3 272 ? 45.838  38.879 53.800  1.00 58.18  ?  568  HIS A NE2    1 
ATOM   2546 N  N      . GLU C 3 273 ? 42.411  42.325 53.371  1.00 47.82  ?  569  GLU A N      1 
ATOM   2547 C  CA     . GLU C 3 273 ? 42.283  43.351 52.344  1.00 50.96  ?  569  GLU A CA     1 
ATOM   2548 C  C      . GLU C 3 273 ? 42.217  42.763 50.941  1.00 52.41  ?  569  GLU A C      1 
ATOM   2549 O  O      . GLU C 3 273 ? 41.793  43.459 50.012  1.00 49.77  ?  569  GLU A O      1 
ATOM   2550 C  CB     . GLU C 3 273 ? 43.450  44.335 52.443  1.00 66.16  ?  569  GLU A CB     1 
ATOM   2551 C  CG     . GLU C 3 273 ? 43.297  45.587 51.591  1.00 73.94  ?  569  GLU A CG     1 
ATOM   2552 C  CD     . GLU C 3 273 ? 44.532  46.468 51.631  1.00 84.47  ?  569  GLU A CD     1 
ATOM   2553 O  OE1    . GLU C 3 273 ? 45.636  45.933 51.868  1.00 88.06  ?  569  GLU A OE1    1 
ATOM   2554 O  OE2    . GLU C 3 273 ? 44.401  47.695 51.430  1.00 87.66  ?  569  GLU A OE2    1 
ATOM   2555 N  N      . ILE C 3 274 ? 42.624  41.504 50.763  1.00 45.28  ?  570  ILE A N      1 
ATOM   2556 C  CA     . ILE C 3 274 ? 42.592  40.900 49.435  1.00 43.96  ?  570  ILE A CA     1 
ATOM   2557 C  C      . ILE C 3 274 ? 41.162  40.780 48.931  1.00 46.90  ?  570  ILE A C      1 
ATOM   2558 O  O      . ILE C 3 274 ? 40.907  40.904 47.728  1.00 40.99  ?  570  ILE A O      1 
ATOM   2559 C  CB     . ILE C 3 274 ? 43.291  39.527 49.444  1.00 52.81  ?  570  ILE A CB     1 
ATOM   2560 C  CG1    . ILE C 3 274 ? 43.633  39.094 48.019  1.00 43.63  ?  570  ILE A CG1    1 
ATOM   2561 C  CG2    . ILE C 3 274 ? 42.399  38.481 50.087  1.00 51.81  ?  570  ILE A CG2    1 
ATOM   2562 C  CD1    . ILE C 3 274 ? 44.137  37.672 47.918  1.00 55.07  ?  570  ILE A CD1    1 
ATOM   2563 N  N      . VAL C 3 275 ? 40.206  40.552 49.834  1.00 46.92  ?  571  VAL A N      1 
ATOM   2564 C  CA     . VAL C 3 275 ? 38.839  40.262 49.411  1.00 40.81  ?  571  VAL A CA     1 
ATOM   2565 C  C      . VAL C 3 275 ? 38.266  41.426 48.611  1.00 43.97  ?  571  VAL A C      1 
ATOM   2566 O  O      . VAL C 3 275 ? 37.707  41.238 47.524  1.00 40.48  ?  571  VAL A O      1 
ATOM   2567 C  CB     . VAL C 3 275 ? 37.958  39.924 50.626  1.00 41.37  ?  571  VAL A CB     1 
ATOM   2568 C  CG1    . VAL C 3 275 ? 36.560  39.538 50.168  1.00 57.42  ?  571  VAL A CG1    1 
ATOM   2569 C  CG2    . VAL C 3 275 ? 38.590  38.802 51.449  1.00 42.60  ?  571  VAL A CG2    1 
ATOM   2570 N  N      . GLU C 3 276 ? 38.391  42.649 49.136  1.00 40.56  ?  572  GLU A N      1 
ATOM   2571 C  CA     . GLU C 3 276 ? 37.850  43.803 48.424  1.00 50.80  ?  572  GLU A CA     1 
ATOM   2572 C  C      . GLU C 3 276 ? 38.444  43.912 47.025  1.00 38.97  ?  572  GLU A C      1 
ATOM   2573 O  O      . GLU C 3 276 ? 37.742  44.265 46.070  1.00 43.71  ?  572  GLU A O      1 
ATOM   2574 C  CB     . GLU C 3 276 ? 38.096  45.087 49.221  1.00 51.75  ?  572  GLU A CB     1 
ATOM   2575 C  CG     . GLU C 3 276 ? 39.556  45.358 49.560  1.00 60.79  ?  572  GLU A CG     1 
ATOM   2576 C  CD     . GLU C 3 276 ? 39.746  46.649 50.344  1.00 67.69  ?  572  GLU A CD     1 
ATOM   2577 O  OE1    . GLU C 3 276 ? 38.975  47.606 50.118  1.00 69.96  ?  572  GLU A OE1    1 
ATOM   2578 O  OE2    . GLU C 3 276 ? 40.665  46.704 51.190  1.00 63.06  ?  572  GLU A OE2    1 
ATOM   2579 N  N      . ASN C 3 277 ? 39.733  43.597 46.881  1.00 39.78  ?  573  ASN A N      1 
ATOM   2580 C  CA     . ASN C 3 277 ? 40.368  43.675 45.570  1.00 45.12  ?  573  ASN A CA     1 
ATOM   2581 C  C      . ASN C 3 277 ? 39.881  42.567 44.645  1.00 46.34  ?  573  ASN A C      1 
ATOM   2582 O  O      . ASN C 3 277 ? 39.650  42.807 43.455  1.00 48.40  ?  573  ASN A O      1 
ATOM   2583 C  CB     . ASN C 3 277 ? 41.886  43.626 45.718  1.00 43.74  ?  573  ASN A CB     1 
ATOM   2584 C  CG     . ASN C 3 277 ? 42.441  44.872 46.366  1.00 51.89  ?  573  ASN A CG     1 
ATOM   2585 O  OD1    . ASN C 3 277 ? 42.581  45.911 45.719  1.00 54.78  ?  573  ASN A OD1    1 
ATOM   2586 N  ND2    . ASN C 3 277 ? 42.752  44.782 47.653  1.00 44.50  ?  573  ASN A ND2    1 
ATOM   2587 N  N      . ILE C 3 278 ? 39.723  41.347 45.163  1.00 46.62  ?  574  ILE A N      1 
ATOM   2588 C  CA     . ILE C 3 278 ? 39.171  40.275 44.338  1.00 42.02  ?  574  ILE A CA     1 
ATOM   2589 C  C      . ILE C 3 278 ? 37.779  40.647 43.848  1.00 38.27  ?  574  ILE A C      1 
ATOM   2590 O  O      . ILE C 3 278 ? 37.423  40.399 42.689  1.00 37.99  ?  574  ILE A O      1 
ATOM   2591 C  CB     . ILE C 3 278 ? 39.158  38.944 45.111  1.00 43.03  ?  574  ILE A CB     1 
ATOM   2592 C  CG1    . ILE C 3 278 ? 40.582  38.409 45.260  1.00 48.74  ?  574  ILE A CG1    1 
ATOM   2593 C  CG2    . ILE C 3 278 ? 38.250  37.934 44.407  1.00 36.05  ?  574  ILE A CG2    1 
ATOM   2594 C  CD1    . ILE C 3 278 ? 40.679  37.167 46.108  1.00 51.74  ?  574  ILE A CD1    1 
ATOM   2595 N  N      . LEU C 3 279 ? 36.968  41.246 44.721  1.00 43.24  ?  575  LEU A N      1 
ATOM   2596 C  CA     . LEU C 3 279 ? 35.656  41.726 44.299  1.00 49.42  ?  575  LEU A CA     1 
ATOM   2597 C  C      . LEU C 3 279 ? 35.791  42.788 43.216  1.00 46.61  ?  575  LEU A C      1 
ATOM   2598 O  O      . LEU C 3 279 ? 35.120  42.729 42.179  1.00 45.69  ?  575  LEU A O      1 
ATOM   2599 C  CB     . LEU C 3 279 ? 34.891  42.272 45.505  1.00 43.16  ?  575  LEU A CB     1 
ATOM   2600 C  CG     . LEU C 3 279 ? 34.535  41.225 46.560  1.00 48.23  ?  575  LEU A CG     1 
ATOM   2601 C  CD1    . LEU C 3 279 ? 34.267  41.876 47.911  1.00 51.83  ?  575  LEU A CD1    1 
ATOM   2602 C  CD2    . LEU C 3 279 ? 33.333  40.415 46.098  1.00 47.06  ?  575  LEU A CD2    1 
ATOM   2603 N  N      . HIS C 3 280 ? 36.662  43.773 43.445  1.00 50.18  ?  576  HIS A N      1 
ATOM   2604 C  CA     . HIS C 3 280 ? 36.923  44.790 42.433  1.00 45.78  ?  576  HIS A CA     1 
ATOM   2605 C  C      . HIS C 3 280 ? 37.419  44.157 41.139  1.00 41.54  ?  576  HIS A C      1 
ATOM   2606 O  O      . HIS C 3 280 ? 36.989  44.539 40.043  1.00 38.57  ?  576  HIS A O      1 
ATOM   2607 C  CB     . HIS C 3 280 ? 37.940  45.795 42.976  1.00 49.30  ?  576  HIS A CB     1 
ATOM   2608 C  CG     . HIS C 3 280 ? 38.157  46.985 42.096  1.00 53.86  ?  576  HIS A CG     1 
ATOM   2609 N  ND1    . HIS C 3 280 ? 37.164  47.518 41.303  1.00 56.95  ?  576  HIS A ND1    1 
ATOM   2610 C  CD2    . HIS C 3 280 ? 39.251  47.759 41.900  1.00 53.57  ?  576  HIS A CD2    1 
ATOM   2611 C  CE1    . HIS C 3 280 ? 37.640  48.562 40.647  1.00 56.19  ?  576  HIS A CE1    1 
ATOM   2612 N  NE2    . HIS C 3 280 ? 38.904  48.729 40.992  1.00 60.22  ?  576  HIS A NE2    1 
ATOM   2613 N  N      . TYR C 3 281 ? 38.321  43.179 41.248  1.00 39.76  ?  577  TYR A N      1 
ATOM   2614 C  CA     . TYR C 3 281 ? 38.858  42.523 40.060  1.00 33.87  ?  577  TYR A CA     1 
ATOM   2615 C  C      . TYR C 3 281 ? 37.774  41.797 39.279  1.00 42.53  ?  577  TYR A C      1 
ATOM   2616 O  O      . TYR C 3 281 ? 37.850  41.706 38.048  1.00 43.59  ?  577  TYR A O      1 
ATOM   2617 C  CB     . TYR C 3 281 ? 39.967  41.549 40.466  1.00 38.98  ?  577  TYR A CB     1 
ATOM   2618 C  CG     . TYR C 3 281 ? 40.510  40.692 39.342  1.00 37.97  ?  577  TYR A CG     1 
ATOM   2619 C  CD1    . TYR C 3 281 ? 41.650  41.068 38.645  1.00 46.58  ?  577  TYR A CD1    1 
ATOM   2620 C  CD2    . TYR C 3 281 ? 39.893  39.495 38.991  1.00 42.45  ?  577  TYR A CD2    1 
ATOM   2621 C  CE1    . TYR C 3 281 ? 42.156  40.285 37.623  1.00 50.63  ?  577  TYR A CE1    1 
ATOM   2622 C  CE2    . TYR C 3 281 ? 40.392  38.706 37.968  1.00 46.82  ?  577  TYR A CE2    1 
ATOM   2623 C  CZ     . TYR C 3 281 ? 41.524  39.107 37.289  1.00 51.54  ?  577  TYR A CZ     1 
ATOM   2624 O  OH     . TYR C 3 281 ? 42.032  38.332 36.272  1.00 57.55  ?  577  TYR A OH     1 
ATOM   2625 N  N      . ARG C 3 282 ? 36.759  41.275 39.969  1.00 43.44  ?  578  ARG A N      1 
ATOM   2626 C  CA     . ARG C 3 282 ? 35.747  40.478 39.289  1.00 41.59  ?  578  ARG A CA     1 
ATOM   2627 C  C      . ARG C 3 282 ? 34.746  41.342 38.537  1.00 40.15  ?  578  ARG A C      1 
ATOM   2628 O  O      . ARG C 3 282 ? 34.329  40.982 37.432  1.00 43.35  ?  578  ARG A O      1 
ATOM   2629 C  CB     . ARG C 3 282 ? 35.029  39.575 40.285  1.00 40.53  ?  578  ARG A CB     1 
ATOM   2630 C  CG     . ARG C 3 282 ? 35.523  38.151 40.227  1.00 46.60  ?  578  ARG A CG     1 
ATOM   2631 C  CD     . ARG C 3 282 ? 34.742  37.269 41.160  1.00 48.54  ?  578  ARG A CD     1 
ATOM   2632 N  NE     . ARG C 3 282 ? 35.414  35.993 41.362  1.00 41.50  ?  578  ARG A NE     1 
ATOM   2633 C  CZ     . ARG C 3 282 ? 35.019  35.085 42.242  1.00 41.17  ?  578  ARG A CZ     1 
ATOM   2634 N  NH1    . ARG C 3 282 ? 33.959  35.323 42.999  1.00 45.11  ?  578  ARG A NH1    1 
ATOM   2635 N  NH2    . ARG C 3 282 ? 35.684  33.946 42.370  1.00 46.02  ?  578  ARG A NH2    1 
ATOM   2636 N  N      . GLN C 3 283 ? 34.335  42.473 39.113  1.00 47.98  ?  579  GLN A N      1 
ATOM   2637 C  CA     . GLN C 3 283 ? 33.469  43.382 38.369  1.00 58.00  ?  579  GLN A CA     1 
ATOM   2638 C  C      . GLN C 3 283 ? 34.194  43.934 37.148  1.00 49.31  ?  579  GLN A C      1 
ATOM   2639 O  O      . GLN C 3 283 ? 33.667  43.902 36.030  1.00 51.65  ?  579  GLN A O      1 
ATOM   2640 C  CB     . GLN C 3 283 ? 32.977  44.515 39.271  1.00 74.50  ?  579  GLN A CB     1 
ATOM   2641 C  CG     . GLN C 3 283 ? 34.081  45.364 39.875  1.00 89.08  ?  579  GLN A CG     1 
ATOM   2642 C  CD     . GLN C 3 283 ? 33.596  46.736 40.301  1.00 99.72  ?  579  GLN A CD     1 
ATOM   2643 O  OE1    . GLN C 3 283 ? 32.829  47.385 39.589  1.00 99.94  ?  579  GLN A OE1    1 
ATOM   2644 N  NE2    . GLN C 3 283 ? 34.040  47.186 41.470  1.00 103.68 ?  579  GLN A NE2    1 
ATOM   2645 N  N      . LEU C 3 284 ? 35.415  44.441 37.344  1.00 47.74  ?  580  LEU A N      1 
ATOM   2646 C  CA     . LEU C 3 284 ? 36.232  44.881 36.218  1.00 48.91  ?  580  LEU A CA     1 
ATOM   2647 C  C      . LEU C 3 284 ? 36.373  43.773 35.183  1.00 45.69  ?  580  LEU A C      1 
ATOM   2648 O  O      . LEU C 3 284 ? 36.175  43.994 33.983  1.00 49.49  ?  580  LEU A O      1 
ATOM   2649 C  CB     . LEU C 3 284 ? 37.612  45.328 36.705  1.00 50.31  ?  580  LEU A CB     1 
ATOM   2650 C  CG     . LEU C 3 284 ? 37.712  46.543 37.629  1.00 52.26  ?  580  LEU A CG     1 
ATOM   2651 C  CD1    . LEU C 3 284 ? 39.170  46.895 37.894  1.00 44.41  ?  580  LEU A CD1    1 
ATOM   2652 C  CD2    . LEU C 3 284 ? 36.969  47.728 37.037  1.00 59.37  ?  580  LEU A CD2    1 
ATOM   2653 N  N      . GLY C 3 285 ? 36.719  42.565 35.635  1.00 35.76  ?  581  GLY A N      1 
ATOM   2654 C  CA     . GLY C 3 285 ? 36.861  41.452 34.711  1.00 35.42  ?  581  GLY A CA     1 
ATOM   2655 C  C      . GLY C 3 285 ? 35.566  41.090 34.013  1.00 41.33  ?  581  GLY A C      1 
ATOM   2656 O  O      . GLY C 3 285 ? 35.573  40.702 32.840  1.00 38.45  ?  581  GLY A O      1 
ATOM   2657 N  N      . LYS C 3 286 ? 34.439  41.211 34.717  1.00 37.62  ?  582  LYS A N      1 
ATOM   2658 C  CA     . LYS C 3 286 ? 33.146  40.942 34.097  1.00 39.51  ?  582  LYS A CA     1 
ATOM   2659 C  C      . LYS C 3 286 ? 32.866  41.933 32.971  1.00 35.64  ?  582  LYS A C      1 
ATOM   2660 O  O      . LYS C 3 286 ? 32.424  41.548 31.882  1.00 33.02  ?  582  LYS A O      1 
ATOM   2661 C  CB     . LYS C 3 286 ? 32.044  40.987 35.157  1.00 43.62  ?  582  LYS A CB     1 
ATOM   2662 C  CG     . LYS C 3 286 ? 30.649  40.642 34.650  1.00 47.27  ?  582  LYS A CG     1 
ATOM   2663 C  CD     . LYS C 3 286 ? 30.489  39.149 34.418  1.00 47.85  ?  582  LYS A CD     1 
ATOM   2664 C  CE     . LYS C 3 286 ? 29.028  38.783 34.204  1.00 41.05  ?  582  LYS A CE     1 
ATOM   2665 N  NZ     . LYS C 3 286 ? 28.841  37.312 34.066  1.00 46.99  ?  582  LYS A NZ     1 
ATOM   2666 N  N      . LEU C 3 287 ? 33.122  43.221 33.214  1.00 38.21  ?  583  LEU A N      1 
ATOM   2667 C  CA     . LEU C 3 287 ? 32.937  44.218 32.163  1.00 37.07  ?  583  LEU A CA     1 
ATOM   2668 C  C      . LEU C 3 287 ? 33.869  43.952 30.988  1.00 41.77  ?  583  LEU A C      1 
ATOM   2669 O  O      . LEU C 3 287 ? 33.432  43.890 29.832  1.00 44.67  ?  583  LEU A O      1 
ATOM   2670 C  CB     . LEU C 3 287 ? 33.174  45.622 32.721  1.00 40.80  ?  583  LEU A CB     1 
ATOM   2671 C  CG     . LEU C 3 287 ? 32.172  46.152 33.744  1.00 43.38  ?  583  LEU A CG     1 
ATOM   2672 C  CD1    . LEU C 3 287 ? 32.691  47.430 34.390  1.00 48.83  ?  583  LEU A CD1    1 
ATOM   2673 C  CD2    . LEU C 3 287 ? 30.835  46.394 33.073  1.00 37.35  ?  583  LEU A CD2    1 
ATOM   2674 N  N      . GLN C 3 288 ? 35.163  43.784 31.271  1.00 34.94  ?  584  GLN A N      1 
ATOM   2675 C  CA     . GLN C 3 288 ? 36.158  43.687 30.208  1.00 44.32  ?  584  GLN A CA     1 
ATOM   2676 C  C      . GLN C 3 288 ? 35.890  42.493 29.303  1.00 44.54  ?  584  GLN A C      1 
ATOM   2677 O  O      . GLN C 3 288 ? 35.943  42.607 28.073  1.00 45.98  ?  584  GLN A O      1 
ATOM   2678 C  CB     . GLN C 3 288 ? 37.558  43.593 30.817  1.00 47.80  ?  584  GLN A CB     1 
ATOM   2679 C  CG     . GLN C 3 288 ? 38.671  43.348 29.811  1.00 49.34  ?  584  GLN A CG     1 
ATOM   2680 C  CD     . GLN C 3 288 ? 38.979  44.568 28.964  1.00 55.83  ?  584  GLN A CD     1 
ATOM   2681 O  OE1    . GLN C 3 288 ? 38.105  45.107 28.284  1.00 58.35  ?  584  GLN A OE1    1 
ATOM   2682 N  NE2    . GLN C 3 288 ? 40.231  45.015 29.006  1.00 49.14  ?  584  GLN A NE2    1 
ATOM   2683 N  N      . SER C 3 289 ? 35.604  41.334 29.894  1.00 45.42  ?  585  SER A N      1 
ATOM   2684 C  CA     . SER C 3 289 ? 35.489  40.099 29.130  1.00 46.62  ?  585  SER A CA     1 
ATOM   2685 C  C      . SER C 3 289 ? 34.100  39.879 28.552  1.00 48.80  ?  585  SER A C      1 
ATOM   2686 O  O      . SER C 3 289 ? 33.974  39.318 27.456  1.00 45.33  ?  585  SER A O      1 
ATOM   2687 C  CB     . SER C 3 289 ? 35.870  38.906 30.011  1.00 52.70  ?  585  SER A CB     1 
ATOM   2688 O  OG     . SER C 3 289 ? 37.183  39.057 30.520  1.00 55.17  ?  585  SER A OG     1 
ATOM   2689 N  N      . THR C 3 290 ? 33.055  40.307 29.256  1.00 40.69  ?  586  THR A N      1 
ATOM   2690 C  CA     . THR C 3 290 ? 31.694  40.062 28.797  1.00 45.67  ?  586  THR A CA     1 
ATOM   2691 C  C      . THR C 3 290 ? 31.129  41.206 27.964  1.00 48.29  ?  586  THR A C      1 
ATOM   2692 O  O      . THR C 3 290 ? 30.450  40.960 26.961  1.00 51.31  ?  586  THR A O      1 
ATOM   2693 C  CB     . THR C 3 290 ? 30.775  39.803 29.991  1.00 45.58  ?  586  THR A CB     1 
ATOM   2694 O  OG1    . THR C 3 290 ? 30.956  38.458 30.452  1.00 48.47  ?  586  THR A OG1    1 
ATOM   2695 C  CG2    . THR C 3 290 ? 29.322  40.018 29.599  1.00 36.94  ?  586  THR A CG2    1 
ATOM   2696 N  N      . TYR C 3 291 ? 31.386  42.453 28.351  1.00 42.93  ?  587  TYR A N      1 
ATOM   2697 C  CA     . TYR C 3 291 ? 30.683  43.580 27.755  1.00 45.50  ?  587  TYR A CA     1 
ATOM   2698 C  C      . TYR C 3 291 ? 31.533  44.436 26.833  1.00 44.23  ?  587  TYR A C      1 
ATOM   2699 O  O      . TYR C 3 291 ? 30.989  45.042 25.910  1.00 50.35  ?  587  TYR A O      1 
ATOM   2700 C  CB     . TYR C 3 291 ? 30.081  44.460 28.854  1.00 44.52  ?  587  TYR A CB     1 
ATOM   2701 C  CG     . TYR C 3 291 ? 29.045  43.732 29.679  1.00 40.12  ?  587  TYR A CG     1 
ATOM   2702 C  CD1    . TYR C 3 291 ? 29.339  43.285 30.960  1.00 46.40  ?  587  TYR A CD1    1 
ATOM   2703 C  CD2    . TYR C 3 291 ? 27.780  43.471 29.168  1.00 39.94  ?  587  TYR A CD2    1 
ATOM   2704 C  CE1    . TYR C 3 291 ? 28.398  42.613 31.716  1.00 49.09  ?  587  TYR A CE1    1 
ATOM   2705 C  CE2    . TYR C 3 291 ? 26.830  42.797 29.916  1.00 47.21  ?  587  TYR A CE2    1 
ATOM   2706 C  CZ     . TYR C 3 291 ? 27.146  42.371 31.192  1.00 57.44  ?  587  TYR A CZ     1 
ATOM   2707 O  OH     . TYR C 3 291 ? 26.214  41.700 31.951  1.00 64.42  ?  587  TYR A OH     1 
ATOM   2708 N  N      . ILE C 3 292 ? 32.842  44.510 27.052  1.00 42.09  ?  588  ILE A N      1 
ATOM   2709 C  CA     . ILE C 3 292 ? 33.716  45.209 26.119  1.00 38.44  ?  588  ILE A CA     1 
ATOM   2710 C  C      . ILE C 3 292 ? 34.112  44.244 25.011  1.00 38.61  ?  588  ILE A C      1 
ATOM   2711 O  O      . ILE C 3 292 ? 33.693  44.395 23.859  1.00 35.02  ?  588  ILE A O      1 
ATOM   2712 C  CB     . ILE C 3 292 ? 34.955  45.783 26.825  1.00 36.96  ?  588  ILE A CB     1 
ATOM   2713 C  CG1    . ILE C 3 292 ? 34.533  46.829 27.856  1.00 46.70  ?  588  ILE A CG1    1 
ATOM   2714 C  CG2    . ILE C 3 292 ? 35.917  46.372 25.809  1.00 40.02  ?  588  ILE A CG2    1 
ATOM   2715 C  CD1    . ILE C 3 292 ? 33.494  47.796 27.335  1.00 46.63  ?  588  ILE A CD1    1 
ATOM   2716 N  N      . GLU C 3 293 ? 34.917  43.238 25.360  1.00 37.38  ?  589  GLU A N      1 
ATOM   2717 C  CA     . GLU C 3 293 ? 35.347  42.256 24.371  1.00 35.40  ?  589  GLU A CA     1 
ATOM   2718 C  C      . GLU C 3 293 ? 34.160  41.502 23.783  1.00 36.07  ?  589  GLU A C      1 
ATOM   2719 O  O      . GLU C 3 293 ? 34.129  41.217 22.581  1.00 42.45  ?  589  GLU A O      1 
ATOM   2720 C  CB     . GLU C 3 293 ? 36.346  41.284 25.000  1.00 35.94  ?  589  GLU A CB     1 
ATOM   2721 C  CG     . GLU C 3 293 ? 37.677  41.926 25.368  1.00 55.02  ?  589  GLU A CG     1 
ATOM   2722 C  CD     . GLU C 3 293 ? 38.737  40.910 25.752  1.00 72.20  ?  589  GLU A CD     1 
ATOM   2723 O  OE1    . GLU C 3 293 ? 39.165  40.903 26.927  1.00 76.15  ?  589  GLU A OE1    1 
ATOM   2724 O  OE2    . GLU C 3 293 ? 39.142  40.117 24.877  1.00 79.77  ?  589  GLU A OE2    1 
ATOM   2725 N  N      . GLY C 3 294 ? 33.173  41.169 24.616  1.00 26.57  ?  590  GLY A N      1 
ATOM   2726 C  CA     . GLY C 3 294 ? 32.021  40.430 24.122  1.00 31.65  ?  590  GLY A CA     1 
ATOM   2727 C  C      . GLY C 3 294 ? 31.214  41.209 23.101  1.00 38.80  ?  590  GLY A C      1 
ATOM   2728 O  O      . GLY C 3 294 ? 30.806  40.665 22.072  1.00 38.25  ?  590  GLY A O      1 
ATOM   2729 N  N      . LEU C 3 295 ? 30.964  42.492 23.374  1.00 29.87  ?  591  LEU A N      1 
ATOM   2730 C  CA     . LEU C 3 295 ? 30.245  43.323 22.413  1.00 32.99  ?  591  LEU A CA     1 
ATOM   2731 C  C      . LEU C 3 295 ? 31.065  43.532 21.148  1.00 35.34  ?  591  LEU A C      1 
ATOM   2732 O  O      . LEU C 3 295 ? 30.542  43.429 20.032  1.00 34.35  ?  591  LEU A O      1 
ATOM   2733 C  CB     . LEU C 3 295 ? 29.885  44.669 23.041  1.00 41.80  ?  591  LEU A CB     1 
ATOM   2734 C  CG     . LEU C 3 295 ? 28.465  44.838 23.577  1.00 46.41  ?  591  LEU A CG     1 
ATOM   2735 C  CD1    . LEU C 3 295 ? 28.285  46.242 24.130  1.00 48.80  ?  591  LEU A CD1    1 
ATOM   2736 C  CD2    . LEU C 3 295 ? 27.447  44.554 22.484  1.00 42.91  ?  591  LEU A CD2    1 
ATOM   2737 N  N      . LEU C 3 296 ? 32.357  43.830 21.301  1.00 33.80  ?  592  LEU A N      1 
ATOM   2738 C  CA     . LEU C 3 296 ? 33.187  44.094 20.132  1.00 32.52  ?  592  LEU A CA     1 
ATOM   2739 C  C      . LEU C 3 296 ? 33.211  42.903 19.185  1.00 35.43  ?  592  LEU A C      1 
ATOM   2740 O  O      . LEU C 3 296 ? 33.394  43.078 17.975  1.00 35.18  ?  592  LEU A O      1 
ATOM   2741 C  CB     . LEU C 3 296 ? 34.604  44.471 20.567  1.00 30.63  ?  592  LEU A CB     1 
ATOM   2742 C  CG     . LEU C 3 296 ? 34.702  45.773 21.369  1.00 35.79  ?  592  LEU A CG     1 
ATOM   2743 C  CD1    . LEU C 3 296 ? 36.136  46.064 21.799  1.00 30.43  ?  592  LEU A CD1    1 
ATOM   2744 C  CD2    . LEU C 3 296 ? 34.129  46.937 20.572  1.00 33.96  ?  592  LEU A CD2    1 
ATOM   2745 N  N      . LYS C 3 297 ? 33.009  41.691 19.709  1.00 33.79  ?  593  LYS A N      1 
ATOM   2746 C  CA     . LYS C 3 297 ? 33.053  40.501 18.864  1.00 34.93  ?  593  LYS A CA     1 
ATOM   2747 C  C      . LYS C 3 297 ? 31.845  40.397 17.941  1.00 33.79  ?  593  LYS A C      1 
ATOM   2748 O  O      . LYS C 3 297 ? 31.952  39.811 16.858  1.00 35.99  ?  593  LYS A O      1 
ATOM   2749 C  CB     . LYS C 3 297 ? 33.150  39.240 19.723  1.00 35.93  ?  593  LYS A CB     1 
ATOM   2750 C  CG     . LYS C 3 297 ? 34.512  38.994 20.330  1.00 51.23  ?  593  LYS A CG     1 
ATOM   2751 C  CD     . LYS C 3 297 ? 34.467  37.800 21.267  1.00 62.19  ?  593  LYS A CD     1 
ATOM   2752 C  CE     . LYS C 3 297 ? 35.803  37.590 21.957  1.00 62.60  ?  593  LYS A CE     1 
ATOM   2753 N  NZ     . LYS C 3 297 ? 35.645  36.844 23.234  1.00 60.93  ?  593  LYS A NZ     1 
ATOM   2754 N  N      . VAL C 3 298 ? 30.691  40.930 18.342  1.00 29.61  ?  594  VAL A N      1 
ATOM   2755 C  CA     . VAL C 3 298 ? 29.466  40.756 17.568  1.00 28.01  ?  594  VAL A CA     1 
ATOM   2756 C  C      . VAL C 3 298 ? 29.076  42.019 16.803  1.00 36.15  ?  594  VAL A C      1 
ATOM   2757 O  O      . VAL C 3 298 ? 28.022  42.043 16.158  1.00 30.91  ?  594  VAL A O      1 
ATOM   2758 C  CB     . VAL C 3 298 ? 28.304  40.267 18.450  1.00 33.26  ?  594  VAL A CB     1 
ATOM   2759 C  CG1    . VAL C 3 298 ? 28.676  38.956 19.141  1.00 35.73  ?  594  VAL A CG1    1 
ATOM   2760 C  CG2    . VAL C 3 298 ? 27.905  41.325 19.462  1.00 25.30  ?  594  VAL A CG2    1 
ATOM   2761 N  N      . VAL C 3 299 ? 29.896  43.067 16.844  1.00 34.55  ?  595  VAL A N      1 
ATOM   2762 C  CA     . VAL C 3 299 ? 29.635  44.257 16.038  1.00 30.94  ?  595  VAL A CA     1 
ATOM   2763 C  C      . VAL C 3 299 ? 30.040  43.979 14.596  1.00 25.34  ?  595  VAL A C      1 
ATOM   2764 O  O      . VAL C 3 299 ? 31.178  43.582 14.324  1.00 26.76  ?  595  VAL A O      1 
ATOM   2765 C  CB     . VAL C 3 299 ? 30.389  45.478 16.592  1.00 31.02  ?  595  VAL A CB     1 
ATOM   2766 C  CG1    . VAL C 3 299 ? 30.193  46.674 15.664  1.00 26.54  ?  595  VAL A CG1    1 
ATOM   2767 C  CG2    . VAL C 3 299 ? 29.920  45.813 17.995  1.00 29.10  ?  595  VAL A CG2    1 
ATOM   2768 N  N      . ARG C 3 300 ? 29.117  44.190 13.669  1.00 26.37  ?  596  ARG A N      1 
ATOM   2769 C  CA     . ARG C 3 300 ? 29.431  44.024 12.254  1.00 25.37  ?  596  ARG A CA     1 
ATOM   2770 C  C      . ARG C 3 300 ? 30.407  45.108 11.821  1.00 32.58  ?  596  ARG A C      1 
ATOM   2771 O  O      . ARG C 3 300 ? 30.058  46.295 11.871  1.00 36.45  ?  596  ARG A O      1 
ATOM   2772 C  CB     . ARG C 3 300 ? 28.167  44.092 11.414  1.00 24.31  ?  596  ARG A CB     1 
ATOM   2773 C  CG     . ARG C 3 300 ? 27.057  43.219 11.932  1.00 35.28  ?  596  ARG A CG     1 
ATOM   2774 C  CD     . ARG C 3 300 ? 26.699  42.169 10.919  1.00 43.12  ?  596  ARG A CD     1 
ATOM   2775 N  NE     . ARG C 3 300 ? 26.206  40.962 11.565  1.00 45.86  ?  596  ARG A NE     1 
ATOM   2776 C  CZ     . ARG C 3 300 ? 26.158  39.776 10.972  1.00 41.09  ?  596  ARG A CZ     1 
ATOM   2777 N  NH1    . ARG C 3 300 ? 26.573  39.650 9.719   1.00 31.87  ?  596  ARG A NH1    1 
ATOM   2778 N  NH2    . ARG C 3 300 ? 25.699  38.721 11.629  1.00 45.73  ?  596  ARG A NH2    1 
ATOM   2779 N  N      . PRO C 3 301 ? 31.622  44.762 11.390  1.00 34.23  ?  597  PRO A N      1 
ATOM   2780 C  CA     . PRO C 3 301 ? 32.584  45.806 11.008  1.00 40.19  ?  597  PRO A CA     1 
ATOM   2781 C  C      . PRO C 3 301 ? 32.133  46.622 9.816   1.00 37.16  ?  597  PRO A C      1 
ATOM   2782 O  O      . PRO C 3 301 ? 32.581  47.763 9.656   1.00 43.51  ?  597  PRO A O      1 
ATOM   2783 C  CB     . PRO C 3 301 ? 33.859  45.010 10.700  1.00 44.54  ?  597  PRO A CB     1 
ATOM   2784 C  CG     . PRO C 3 301 ? 33.370  43.647 10.341  1.00 36.77  ?  597  PRO A CG     1 
ATOM   2785 C  CD     . PRO C 3 301 ? 32.164  43.407 11.190  1.00 32.18  ?  597  PRO A CD     1 
ATOM   2786 N  N      . ASP C 3 302 ? 31.253  46.074 8.977   1.00 41.26  ?  598  ASP A N      1 
ATOM   2787 C  CA     . ASP C 3 302 ? 30.785  46.806 7.806   1.00 48.25  ?  598  ASP A CA     1 
ATOM   2788 C  C      . ASP C 3 302 ? 29.883  47.970 8.199   1.00 57.83  ?  598  ASP A C      1 
ATOM   2789 O  O      . ASP C 3 302 ? 29.935  49.039 7.579   1.00 69.53  ?  598  ASP A O      1 
ATOM   2790 C  CB     . ASP C 3 302 ? 30.059  45.852 6.859   1.00 39.35  ?  598  ASP A CB     1 
ATOM   2791 C  CG     . ASP C 3 302 ? 29.287  44.776 7.598   1.00 47.52  ?  598  ASP A CG     1 
ATOM   2792 O  OD1    . ASP C 3 302 ? 28.079  44.604 7.329   1.00 55.55  ?  598  ASP A OD1    1 
ATOM   2793 O  OD2    . ASP C 3 302 ? 29.892  44.109 8.464   1.00 53.85  ?  598  ASP A OD2    1 
ATOM   2794 N  N      . THR C 3 303 ? 29.056  47.790 9.223   1.00 47.13  ?  599  THR A N      1 
ATOM   2795 C  CA     . THR C 3 303 ? 28.112  48.820 9.621   1.00 41.98  ?  599  THR A CA     1 
ATOM   2796 C  C      . THR C 3 303 ? 28.288  49.301 11.050  1.00 34.59  ?  599  THR A C      1 
ATOM   2797 O  O      . THR C 3 303 ? 27.605  50.252 11.446  1.00 36.19  ?  599  THR A O      1 
ATOM   2798 C  CB     . THR C 3 303 ? 26.674  48.321 9.438   1.00 42.89  ?  599  THR A CB     1 
ATOM   2799 O  OG1    . THR C 3 303 ? 26.482  47.135 10.220  1.00 51.89  ?  599  THR A OG1    1 
ATOM   2800 C  CG2    . THR C 3 303 ? 26.421  48.000 7.967   1.00 47.79  ?  599  THR A CG2    1 
ATOM   2801 N  N      . LYS C 3 304 ? 29.177  48.685 11.828  1.00 31.19  ?  600  LYS A N      1 
ATOM   2802 C  CA     . LYS C 3 304 ? 29.351  49.023 13.236  1.00 35.42  ?  600  LYS A CA     1 
ATOM   2803 C  C      . LYS C 3 304 ? 28.037  48.915 14.001  1.00 26.40  ?  600  LYS A C      1 
ATOM   2804 O  O      . LYS C 3 304 ? 27.813  49.623 14.985  1.00 30.64  ?  600  LYS A O      1 
ATOM   2805 C  CB     . LYS C 3 304 ? 29.968  50.415 13.398  1.00 49.40  ?  600  LYS A CB     1 
ATOM   2806 C  CG     . LYS C 3 304 ? 31.469  50.439 13.147  1.00 58.11  ?  600  LYS A CG     1 
ATOM   2807 C  CD     . LYS C 3 304 ? 32.005  51.857 13.058  1.00 74.85  ?  600  LYS A CD     1 
ATOM   2808 C  CE     . LYS C 3 304 ? 31.444  52.585 11.845  1.00 82.66  ?  600  LYS A CE     1 
ATOM   2809 N  NZ     . LYS C 3 304 ? 31.987  53.967 11.715  1.00 83.24  ?  600  LYS A NZ     1 
ATOM   2810 N  N      . LYS C 3 305 ? 27.162  48.022 13.559  1.00 22.73  ?  601  LYS A N      1 
ATOM   2811 C  CA     . LYS C 3 305 ? 25.925  47.726 14.259  1.00 29.57  ?  601  LYS A CA     1 
ATOM   2812 C  C      . LYS C 3 305 ? 25.996  46.337 14.876  1.00 28.69  ?  601  LYS A C      1 
ATOM   2813 O  O      . LYS C 3 305 ? 26.685  45.446 14.368  1.00 27.13  ?  601  LYS A O      1 
ATOM   2814 C  CB     . LYS C 3 305 ? 24.723  47.800 13.316  1.00 29.81  ?  601  LYS A CB     1 
ATOM   2815 C  CG     . LYS C 3 305 ? 24.366  49.195 12.853  1.00 30.22  ?  601  LYS A CG     1 
ATOM   2816 C  CD     . LYS C 3 305 ? 23.259  49.126 11.826  1.00 27.65  ?  601  LYS A CD     1 
ATOM   2817 C  CE     . LYS C 3 305 ? 22.629  50.484 11.583  1.00 35.39  ?  601  LYS A CE     1 
ATOM   2818 N  NZ     . LYS C 3 305 ? 21.449  50.343 10.689  1.00 40.07  ?  601  LYS A NZ     1 
ATOM   2819 N  N      . VAL C 3 306 ? 25.290  46.167 15.989  1.00 22.59  ?  602  VAL A N      1 
ATOM   2820 C  CA     . VAL C 3 306 ? 24.992  44.850 16.530  1.00 26.43  ?  602  VAL A CA     1 
ATOM   2821 C  C      . VAL C 3 306 ? 23.589  44.483 16.081  1.00 26.28  ?  602  VAL A C      1 
ATOM   2822 O  O      . VAL C 3 306 ? 22.673  45.316 16.126  1.00 27.49  ?  602  VAL A O      1 
ATOM   2823 C  CB     . VAL C 3 306 ? 25.107  44.817 18.063  1.00 23.20  ?  602  VAL A CB     1 
ATOM   2824 C  CG1    . VAL C 3 306 ? 26.532  45.115 18.493  1.00 27.57  ?  602  VAL A CG1    1 
ATOM   2825 C  CG2    . VAL C 3 306 ? 24.116  45.783 18.699  1.00 17.20  ?  602  VAL A CG2    1 
ATOM   2826 N  N      . HIS C 3 307 ? 23.426  43.256 15.621  1.00 23.70  ?  603  HIS A N      1 
ATOM   2827 C  CA     . HIS C 3 307 ? 22.138  42.755 15.160  1.00 16.53  ?  603  HIS A CA     1 
ATOM   2828 C  C      . HIS C 3 307 ? 21.795  41.587 16.071  1.00 18.62  ?  603  HIS A C      1 
ATOM   2829 O  O      . HIS C 3 307 ? 22.183  40.444 15.820  1.00 21.63  ?  603  HIS A O      1 
ATOM   2830 C  CB     . HIS C 3 307 ? 22.193  42.349 13.695  1.00 14.42  ?  603  HIS A CB     1 
ATOM   2831 C  CG     . HIS C 3 307 ? 22.527  43.478 12.770  1.00 23.88  ?  603  HIS A CG     1 
ATOM   2832 N  ND1    . HIS C 3 307 ? 21.563  44.224 12.127  1.00 18.95  ?  603  HIS A ND1    1 
ATOM   2833 C  CD2    . HIS C 3 307 ? 23.720  43.999 12.393  1.00 24.37  ?  603  HIS A CD2    1 
ATOM   2834 C  CE1    . HIS C 3 307 ? 22.147  45.149 11.385  1.00 21.24  ?  603  HIS A CE1    1 
ATOM   2835 N  NE2    . HIS C 3 307 ? 23.455  45.035 11.531  1.00 23.45  ?  603  HIS A NE2    1 
ATOM   2836 N  N      . THR C 3 308 ? 21.104  41.893 17.161  1.00 20.36  ?  604  THR A N      1 
ATOM   2837 C  CA     . THR C 3 308 ? 20.704  40.847 18.078  1.00 16.08  ?  604  THR A CA     1 
ATOM   2838 C  C      . THR C 3 308 ? 19.688  39.930 17.397  1.00 20.68  ?  604  THR A C      1 
ATOM   2839 O  O      . THR C 3 308 ? 19.160  40.224 16.322  1.00 24.84  ?  604  THR A O      1 
ATOM   2840 C  CB     . THR C 3 308 ? 20.130  41.462 19.356  1.00 19.68  ?  604  THR A CB     1 
ATOM   2841 O  OG1    . THR C 3 308 ? 19.920  40.438 20.333  1.00 22.84  ?  604  THR A OG1    1 
ATOM   2842 C  CG2    . THR C 3 308 ? 18.811  42.160 19.062  1.00 22.10  ?  604  THR A CG2    1 
ATOM   2843 N  N      . ILE C 3 309 ? 19.440  38.788 18.026  1.00 19.73  ?  605  ILE A N      1 
ATOM   2844 C  CA     . ILE C 3 309 ? 18.387  37.873 17.611  1.00 23.49  ?  605  ILE A CA     1 
ATOM   2845 C  C      . ILE C 3 309 ? 17.430  37.737 18.783  1.00 20.94  ?  605  ILE A C      1 
ATOM   2846 O  O      . ILE C 3 309 ? 17.831  37.304 19.870  1.00 21.22  ?  605  ILE A O      1 
ATOM   2847 C  CB     . ILE C 3 309 ? 18.949  36.510 17.180  1.00 25.56  ?  605  ILE A CB     1 
ATOM   2848 C  CG1    . ILE C 3 309 ? 19.751  36.672 15.886  1.00 22.53  ?  605  ILE A CG1    1 
ATOM   2849 C  CG2    . ILE C 3 309 ? 17.828  35.494 17.004  1.00 21.67  ?  605  ILE A CG2    1 
ATOM   2850 C  CD1    . ILE C 3 309 ? 20.281  35.379 15.317  1.00 30.48  ?  605  ILE A CD1    1 
ATOM   2851 N  N      . PHE C 3 310 ? 16.183  38.148 18.582  1.00 21.09  ?  606  PHE A N      1 
ATOM   2852 C  CA     . PHE C 3 310 ? 15.177  37.991 19.622  1.00 24.19  ?  606  PHE A CA     1 
ATOM   2853 C  C      . PHE C 3 310 ? 14.629  36.578 19.561  1.00 30.18  ?  606  PHE A C      1 
ATOM   2854 O  O      . PHE C 3 310 ? 14.162  36.129 18.509  1.00 29.69  ?  606  PHE A O      1 
ATOM   2855 C  CB     . PHE C 3 310 ? 14.059  39.015 19.463  1.00 28.51  ?  606  PHE A CB     1 
ATOM   2856 C  CG     . PHE C 3 310 ? 14.471  40.405 19.831  1.00 30.80  ?  606  PHE A CG     1 
ATOM   2857 C  CD1    . PHE C 3 310 ? 14.710  41.355 18.851  1.00 22.06  ?  606  PHE A CD1    1 
ATOM   2858 C  CD2    . PHE C 3 310 ? 14.640  40.758 21.158  1.00 33.95  ?  606  PHE A CD2    1 
ATOM   2859 C  CE1    . PHE C 3 310 ? 15.100  42.627 19.188  1.00 27.29  ?  606  PHE A CE1    1 
ATOM   2860 C  CE2    . PHE C 3 310 ? 15.029  42.034 21.503  1.00 24.42  ?  606  PHE A CE2    1 
ATOM   2861 C  CZ     . PHE C 3 310 ? 15.260  42.969 20.516  1.00 23.80  ?  606  PHE A CZ     1 
ATOM   2862 N  N      . ASN C 3 311 ? 14.726  35.861 20.669  1.00 21.65  ?  607  ASN A N      1 
ATOM   2863 C  CA     . ASN C 3 311 ? 14.108  34.549 20.766  1.00 21.43  ?  607  ASN A CA     1 
ATOM   2864 C  C      . ASN C 3 311 ? 12.706  34.770 21.316  1.00 26.17  ?  607  ASN A C      1 
ATOM   2865 O  O      . ASN C 3 311 ? 12.535  35.173 22.470  1.00 32.24  ?  607  ASN A O      1 
ATOM   2866 C  CB     . ASN C 3 311 ? 14.928  33.603 21.634  1.00 19.81  ?  607  ASN A CB     1 
ATOM   2867 C  CG     . ASN C 3 311 ? 14.504  32.155 21.465  1.00 34.34  ?  607  ASN A CG     1 
ATOM   2868 O  OD1    . ASN C 3 311 ? 13.374  31.872 21.055  1.00 26.70  ?  607  ASN A OD1    1 
ATOM   2869 N  ND2    . ASN C 3 311 ? 15.409  31.228 21.778  1.00 34.69  ?  607  ASN A ND2    1 
ATOM   2870 N  N      . GLN C 3 312 ? 11.708  34.551 20.470  1.00 21.28  ?  608  GLN A N      1 
ATOM   2871 C  CA     . GLN C 3 312 ? 10.324  34.823 20.818  1.00 26.59  ?  608  GLN A CA     1 
ATOM   2872 C  C      . GLN C 3 312 ? 9.617   33.620 21.420  1.00 21.65  ?  608  GLN A C      1 
ATOM   2873 O  O      . GLN C 3 312 ? 8.546   33.779 22.017  1.00 30.16  ?  608  GLN A O      1 
ATOM   2874 C  CB     . GLN C 3 312 ? 9.578   35.301 19.568  1.00 24.62  ?  608  GLN A CB     1 
ATOM   2875 C  CG     . GLN C 3 312 ? 8.221   35.900 19.807  1.00 24.39  ?  608  GLN A CG     1 
ATOM   2876 C  CD     . GLN C 3 312 ? 7.576   36.353 18.511  1.00 25.53  ?  608  GLN A CD     1 
ATOM   2877 O  OE1    . GLN C 3 312 ? 8.231   36.408 17.471  1.00 27.99  ?  608  GLN A OE1    1 
ATOM   2878 N  NE2    . GLN C 3 312 ? 6.291   36.677 18.565  1.00 16.63  ?  608  GLN A NE2    1 
ATOM   2879 N  N      . ALA C 3 313 ? 10.192  32.426 21.298  1.00 21.20  ?  609  ALA A N      1 
ATOM   2880 C  CA     . ALA C 3 313 ? 9.558   31.202 21.776  1.00 23.81  ?  609  ALA A CA     1 
ATOM   2881 C  C      . ALA C 3 313 ? 10.519  30.430 22.679  1.00 22.42  ?  609  ALA A C      1 
ATOM   2882 O  O      . ALA C 3 313 ? 10.816  29.261 22.445  1.00 34.39  ?  609  ALA A O      1 
ATOM   2883 C  CB     . ALA C 3 313 ? 9.108   30.341 20.601  1.00 31.04  ?  609  ALA A CB     1 
ATOM   2884 N  N      . LEU C 3 314 ? 11.002  31.091 23.727  1.00 24.34  ?  610  LEU A N      1 
ATOM   2885 C  CA     . LEU C 3 314 ? 11.952  30.478 24.647  1.00 26.33  ?  610  LEU A CA     1 
ATOM   2886 C  C      . LEU C 3 314 ? 11.466  30.508 26.091  1.00 25.14  ?  610  LEU A C      1 
ATOM   2887 O  O      . LEU C 3 314 ? 11.395  29.457 26.732  1.00 26.39  ?  610  LEU A O      1 
ATOM   2888 C  CB     . LEU C 3 314 ? 13.314  31.165 24.520  1.00 30.67  ?  610  LEU A CB     1 
ATOM   2889 C  CG     . LEU C 3 314 ? 14.345  30.647 25.526  1.00 38.57  ?  610  LEU A CG     1 
ATOM   2890 C  CD1    . LEU C 3 314 ? 14.735  29.209 25.207  1.00 36.52  ?  610  LEU A CD1    1 
ATOM   2891 C  CD2    . LEU C 3 314 ? 15.555  31.552 25.555  1.00 42.12  ?  610  LEU A CD2    1 
ATOM   2892 N  N      . THR C 3 315 ? 11.130  31.675 26.636  1.00 23.59  ?  611  THR A N      1 
ATOM   2893 C  CA     . THR C 3 315 ? 10.817  31.745 28.057  1.00 25.78  ?  611  THR A CA     1 
ATOM   2894 C  C      . THR C 3 315 ? 9.448   31.134 28.363  1.00 30.27  ?  611  THR A C      1 
ATOM   2895 O  O      . THR C 3 315 ? 8.564   31.056 27.506  1.00 23.21  ?  611  THR A O      1 
ATOM   2896 C  CB     . THR C 3 315 ? 10.849  33.193 28.540  1.00 27.76  ?  611  THR A CB     1 
ATOM   2897 O  OG1    . THR C 3 315 ? 9.716   33.890 28.011  1.00 24.48  ?  611  THR A OG1    1 
ATOM   2898 C  CG2    . THR C 3 315 ? 12.113  33.887 28.054  1.00 36.29  ?  611  THR A CG2    1 
ATOM   2899 N  N      . GLN C 3 316 ? 9.278   30.701 29.611  1.00 22.11  ?  612  GLN A N      1 
ATOM   2900 C  CA     . GLN C 3 316 ? 8.007   30.149 30.064  1.00 31.24  ?  612  GLN A CA     1 
ATOM   2901 C  C      . GLN C 3 316 ? 7.016   31.224 30.470  1.00 30.31  ?  612  GLN A C      1 
ATOM   2902 O  O      . GLN C 3 316 ? 5.871   30.899 30.796  1.00 33.27  ?  612  GLN A O      1 
ATOM   2903 C  CB     . GLN C 3 316 ? 8.229   29.205 31.247  1.00 31.56  ?  612  GLN A CB     1 
ATOM   2904 C  CG     . GLN C 3 316 ? 9.325   28.193 31.029  1.00 59.89  ?  612  GLN A CG     1 
ATOM   2905 C  CD     . GLN C 3 316 ? 8.907   27.090 30.090  1.00 65.52  ?  612  GLN A CD     1 
ATOM   2906 O  OE1    . GLN C 3 316 ? 7.922   26.389 30.336  1.00 66.96  ?  612  GLN A OE1    1 
ATOM   2907 N  NE2    . GLN C 3 316 ? 9.650   26.928 29.001  1.00 61.72  ?  612  GLN A NE2    1 
ATOM   2908 N  N      . THR C 3 317 ? 7.434   32.487 30.466  1.00 27.10  ?  613  THR A N      1 
ATOM   2909 C  CA     . THR C 3 317 ? 6.593   33.602 30.865  1.00 36.14  ?  613  THR A CA     1 
ATOM   2910 C  C      . THR C 3 317 ? 6.059   34.391 29.682  1.00 29.65  ?  613  THR A C      1 
ATOM   2911 O  O      . THR C 3 317 ? 5.144   35.200 29.860  1.00 33.65  ?  613  THR A O      1 
ATOM   2912 C  CB     . THR C 3 317 ? 7.383   34.554 31.766  1.00 32.18  ?  613  THR A CB     1 
ATOM   2913 O  OG1    . THR C 3 317 ? 8.579   34.948 31.079  1.00 25.97  ?  613  THR A OG1    1 
ATOM   2914 C  CG2    . THR C 3 317 ? 7.757   33.870 33.067  1.00 41.88  ?  613  THR A CG2    1 
ATOM   2915 N  N      . GLY C 3 318 ? 6.624   34.202 28.495  1.00 23.07  ?  614  GLY A N      1 
ATOM   2916 C  CA     . GLY C 3 318 ? 6.290   35.017 27.350  1.00 20.66  ?  614  GLY A CA     1 
ATOM   2917 C  C      . GLY C 3 318 ? 7.201   36.206 27.138  1.00 19.28  ?  614  GLY A C      1 
ATOM   2918 O  O      . GLY C 3 318 ? 7.036   36.919 26.141  1.00 21.49  ?  614  GLY A O      1 
ATOM   2919 N  N      . ARG C 3 319 ? 8.149   36.453 28.040  1.00 24.02  ?  615  ARG A N      1 
ATOM   2920 C  CA     . ARG C 3 319 ? 9.114   37.518 27.810  1.00 20.42  ?  615  ARG A CA     1 
ATOM   2921 C  C      . ARG C 3 319 ? 10.017  37.173 26.629  1.00 26.84  ?  615  ARG A C      1 
ATOM   2922 O  O      . ARG C 3 319 ? 10.315  36.005 26.366  1.00 20.05  ?  615  ARG A O      1 
ATOM   2923 C  CB     . ARG C 3 319 ? 9.957   37.769 29.061  1.00 26.90  ?  615  ARG A CB     1 
ATOM   2924 C  CG     . ARG C 3 319 ? 9.158   38.349 30.223  1.00 39.45  ?  615  ARG A CG     1 
ATOM   2925 C  CD     . ARG C 3 319 ? 10.050  39.073 31.215  1.00 48.81  ?  615  ARG A CD     1 
ATOM   2926 N  NE     . ARG C 3 319 ? 9.291   39.666 32.315  1.00 51.40  ?  615  ARG A NE     1 
ATOM   2927 C  CZ     . ARG C 3 319 ? 8.754   40.883 32.288  1.00 59.34  ?  615  ARG A CZ     1 
ATOM   2928 N  NH1    . ARG C 3 319 ? 8.885   41.647 31.211  1.00 58.97  ?  615  ARG A NH1    1 
ATOM   2929 N  NH2    . ARG C 3 319 ? 8.084   41.338 33.340  1.00 60.46  ?  615  ARG A NH2    1 
ATOM   2930 N  N      . LEU C 3 320 ? 10.430  38.206 25.898  1.00 28.48  ?  616  LEU A N      1 
ATOM   2931 C  CA     . LEU C 3 320 ? 11.431  38.040 24.854  1.00 27.19  ?  616  LEU A CA     1 
ATOM   2932 C  C      . LEU C 3 320 ? 12.801  37.787 25.467  1.00 31.81  ?  616  LEU A C      1 
ATOM   2933 O  O      . LEU C 3 320 ? 13.139  38.315 26.528  1.00 30.47  ?  616  LEU A O      1 
ATOM   2934 C  CB     . LEU C 3 320 ? 11.505  39.290 23.978  1.00 28.62  ?  616  LEU A CB     1 
ATOM   2935 C  CG     . LEU C 3 320 ? 10.234  39.679 23.234  1.00 27.51  ?  616  LEU A CG     1 
ATOM   2936 C  CD1    . LEU C 3 320 ? 10.422  40.998 22.503  1.00 26.25  ?  616  LEU A CD1    1 
ATOM   2937 C  CD2    . LEU C 3 320 ? 9.866   38.565 22.265  1.00 28.31  ?  616  LEU A CD2    1 
ATOM   2938 N  N      . SER C 3 321 ? 13.602  36.978 24.783  1.00 20.73  ?  617  SER A N      1 
ATOM   2939 C  CA     . SER C 3 321 ? 15.014  36.864 25.106  1.00 28.20  ?  617  SER A CA     1 
ATOM   2940 C  C      . SER C 3 321 ? 15.832  37.331 23.908  1.00 29.50  ?  617  SER A C      1 
ATOM   2941 O  O      . SER C 3 321 ? 15.337  37.395 22.777  1.00 23.79  ?  617  SER A O      1 
ATOM   2942 C  CB     . SER C 3 321 ? 15.397  35.431 25.510  1.00 31.85  ?  617  SER A CB     1 
ATOM   2943 O  OG     . SER C 3 321 ? 15.299  34.541 24.413  1.00 39.95  ?  617  SER A OG     1 
ATOM   2944 N  N      . SER C 3 322 ? 17.093  37.663 24.168  1.00 20.30  ?  618  SER A N      1 
ATOM   2945 C  CA     . SER C 3 322 ? 17.955  38.290 23.176  1.00 28.16  ?  618  SER A CA     1 
ATOM   2946 C  C      . SER C 3 322 ? 19.322  37.624 23.199  1.00 24.99  ?  618  SER A C      1 
ATOM   2947 O  O      . SER C 3 322 ? 19.842  37.307 24.269  1.00 31.11  ?  618  SER A O      1 
ATOM   2948 C  CB     . SER C 3 322 ? 18.090  39.795 23.457  1.00 30.22  ?  618  SER A CB     1 
ATOM   2949 O  OG     . SER C 3 322 ? 19.189  40.359 22.764  1.00 41.76  ?  618  SER A OG     1 
ATOM   2950 N  N      . THR C 3 323 ? 19.904  37.404 22.021  1.00 19.64  ?  619  THR A N      1 
ATOM   2951 C  CA     . THR C 3 323 ? 21.221  36.781 21.936  1.00 27.29  ?  619  THR A CA     1 
ATOM   2952 C  C      . THR C 3 323 ? 22.059  37.459 20.867  1.00 20.19  ?  619  THR A C      1 
ATOM   2953 O  O      . THR C 3 323 ? 21.530  38.003 19.893  1.00 21.66  ?  619  THR A O      1 
ATOM   2954 C  CB     . THR C 3 323 ? 21.141  35.269 21.636  1.00 31.14  ?  619  THR A CB     1 
ATOM   2955 O  OG1    . THR C 3 323 ? 20.501  35.068 20.374  1.00 33.72  ?  619  THR A OG1    1 
ATOM   2956 C  CG2    . THR C 3 323 ? 20.365  34.538 22.723  1.00 34.29  ?  619  THR A CG2    1 
ATOM   2957 N  N      . GLU C 3 324 ? 23.374  37.425 21.079  1.00 23.29  ?  620  GLU A N      1 
ATOM   2958 C  CA     . GLU C 3 324 ? 24.360  37.800 20.070  1.00 32.00  ?  620  GLU A CA     1 
ATOM   2959 C  C      . GLU C 3 324 ? 24.144  39.213 19.518  1.00 31.40  ?  620  GLU A C      1 
ATOM   2960 O  O      . GLU C 3 324 ? 23.929  39.392 18.315  1.00 37.59  ?  620  GLU A O      1 
ATOM   2961 C  CB     . GLU C 3 324 ? 24.391  36.781 18.939  1.00 40.74  ?  620  GLU A CB     1 
ATOM   2962 C  CG     . GLU C 3 324 ? 24.570  35.357 19.408  1.00 56.00  ?  620  GLU A CG     1 
ATOM   2963 C  CD     . GLU C 3 324 ? 24.900  34.404 18.273  1.00 69.15  ?  620  GLU A CD     1 
ATOM   2964 O  OE1    . GLU C 3 324 ? 25.910  34.636 17.576  1.00 71.92  ?  620  GLU A OE1    1 
ATOM   2965 O  OE2    . GLU C 3 324 ? 24.160  33.413 18.089  1.00 72.06  ?  620  GLU A OE2    1 
ATOM   2966 N  N      . PRO C 3 325 ? 24.228  40.242 20.371  1.00 29.76  ?  621  PRO A N      1 
ATOM   2967 C  CA     . PRO C 3 325 ? 24.475  40.074 21.799  1.00 35.41  ?  621  PRO A CA     1 
ATOM   2968 C  C      . PRO C 3 325 ? 23.180  40.041 22.589  1.00 29.36  ?  621  PRO A C      1 
ATOM   2969 O  O      . PRO C 3 325 ? 22.149  40.471 22.078  1.00 22.67  ?  621  PRO A O      1 
ATOM   2970 C  CB     . PRO C 3 325 ? 25.297  41.314 22.144  1.00 30.77  ?  621  PRO A CB     1 
ATOM   2971 C  CG     . PRO C 3 325 ? 24.712  42.374 21.256  1.00 26.51  ?  621  PRO A CG     1 
ATOM   2972 C  CD     . PRO C 3 325 ? 24.266  41.665 19.985  1.00 29.34  ?  621  PRO A CD     1 
ATOM   2973 N  N      . ASN C 3 326 ? 23.226  39.517 23.809  1.00 19.88  ?  622  ASN A N      1 
ATOM   2974 C  CA     . ASN C 3 326 ? 22.115  39.667 24.741  1.00 25.64  ?  622  ASN A CA     1 
ATOM   2975 C  C      . ASN C 3 326 ? 22.175  41.089 25.281  1.00 36.07  ?  622  ASN A C      1 
ATOM   2976 O  O      . ASN C 3 326 ? 22.948  41.391 26.191  1.00 40.96  ?  622  ASN A O      1 
ATOM   2977 C  CB     . ASN C 3 326 ? 22.194  38.632 25.856  1.00 35.55  ?  622  ASN A CB     1 
ATOM   2978 C  CG     . ASN C 3 326 ? 21.157  38.866 26.945  1.00 38.39  ?  622  ASN A CG     1 
ATOM   2979 O  OD1    . ASN C 3 326 ? 20.229  39.658 26.781  1.00 32.59  ?  622  ASN A OD1    1 
ATOM   2980 N  ND2    . ASN C 3 326 ? 21.312  38.173 28.066  1.00 37.99  ?  622  ASN A ND2    1 
ATOM   2981 N  N      . LEU C 3 327 ? 21.368  41.974 24.707  1.00 34.06  ?  623  LEU A N      1 
ATOM   2982 C  CA     . LEU C 3 327 ? 21.359  43.369 25.123  1.00 29.53  ?  623  LEU A CA     1 
ATOM   2983 C  C      . LEU C 3 327 ? 20.489  43.614 26.345  1.00 35.65  ?  623  LEU A C      1 
ATOM   2984 O  O      . LEU C 3 327 ? 20.384  44.761 26.793  1.00 49.91  ?  623  LEU A O      1 
ATOM   2985 C  CB     . LEU C 3 327 ? 20.895  44.256 23.964  1.00 32.05  ?  623  LEU A CB     1 
ATOM   2986 C  CG     . LEU C 3 327 ? 21.851  44.302 22.769  1.00 40.45  ?  623  LEU A CG     1 
ATOM   2987 C  CD1    . LEU C 3 327 ? 21.258  45.106 21.624  1.00 45.59  ?  623  LEU A CD1    1 
ATOM   2988 C  CD2    . LEU C 3 327 ? 23.201  44.871 23.187  1.00 47.36  ?  623  LEU A CD2    1 
ATOM   2989 N  N      . GLN C 3 328 ? 19.877  42.570 26.899  1.00 31.76  ?  624  GLN A N      1 
ATOM   2990 C  CA     . GLN C 3 328 ? 18.990  42.696 28.044  1.00 42.46  ?  624  GLN A CA     1 
ATOM   2991 C  C      . GLN C 3 328 ? 19.716  42.514 29.370  1.00 46.00  ?  624  GLN A C      1 
ATOM   2992 O  O      . GLN C 3 328 ? 19.073  42.232 30.387  1.00 59.75  ?  624  GLN A O      1 
ATOM   2993 C  CB     . GLN C 3 328 ? 17.835  41.700 27.919  1.00 53.60  ?  624  GLN A CB     1 
ATOM   2994 C  CG     . GLN C 3 328 ? 16.967  41.955 26.693  1.00 63.64  ?  624  GLN A CG     1 
ATOM   2995 C  CD     . GLN C 3 328 ? 15.962  40.853 26.437  1.00 72.34  ?  624  GLN A CD     1 
ATOM   2996 O  OE1    . GLN C 3 328 ? 16.126  39.726 26.905  1.00 74.12  ?  624  GLN A OE1    1 
ATOM   2997 N  NE2    . GLN C 3 328 ? 14.911  41.173 25.689  1.00 73.53  ?  624  GLN A NE2    1 
ATOM   2998 N  N      . ASN C 3 329 ? 21.046  42.663 29.383  1.00 40.98  ?  625  ASN A N      1 
ATOM   2999 C  CA     . ASN C 3 329 ? 21.771  42.718 30.647  1.00 43.92  ?  625  ASN A CA     1 
ATOM   3000 C  C      . ASN C 3 329 ? 22.971  43.656 30.562  1.00 44.67  ?  625  ASN A C      1 
ATOM   3001 O  O      . ASN C 3 329 ? 23.940  43.489 31.310  1.00 44.01  ?  625  ASN A O      1 
ATOM   3002 C  CB     . ASN C 3 329 ? 22.198  41.314 31.101  1.00 40.73  ?  625  ASN A CB     1 
ATOM   3003 C  CG     . ASN C 3 329 ? 23.094  40.614 30.100  1.00 44.22  ?  625  ASN A CG     1 
ATOM   3004 O  OD1    . ASN C 3 329 ? 23.282  41.079 28.974  1.00 37.63  ?  625  ASN A OD1    1 
ATOM   3005 N  ND2    . ASN C 3 329 ? 23.647  39.477 30.506  1.00 46.61  ?  625  ASN A ND2    1 
ATOM   3006 N  N      . ILE C 3 330 ? 22.919  44.644 29.673  1.00 48.39  ?  626  ILE A N      1 
ATOM   3007 C  CA     . ILE C 3 330 ? 23.954  45.683 29.656  1.00 44.73  ?  626  ILE A CA     1 
ATOM   3008 C  C      . ILE C 3 330 ? 23.966  46.395 31.005  1.00 45.25  ?  626  ILE A C      1 
ATOM   3009 O  O      . ILE C 3 330 ? 22.892  46.777 31.512  1.00 44.15  ?  626  ILE A O      1 
ATOM   3010 C  CB     . ILE C 3 330 ? 23.701  46.676 28.509  1.00 44.13  ?  626  ILE A CB     1 
ATOM   3011 C  CG1    . ILE C 3 330 ? 23.602  45.936 27.171  1.00 43.93  ?  626  ILE A CG1    1 
ATOM   3012 C  CG2    . ILE C 3 330 ? 24.797  47.729 28.457  1.00 34.77  ?  626  ILE A CG2    1 
ATOM   3013 C  CD1    . ILE C 3 330 ? 24.885  45.239 26.755  1.00 25.19  ?  626  ILE A CD1    1 
ATOM   3014 N  N      . PRO C 3 331 ? 25.128  46.604 31.626  1.00 51.50  ?  627  PRO A N      1 
ATOM   3015 C  CA     . PRO C 3 331 ? 25.151  47.098 33.011  1.00 55.96  ?  627  PRO A CA     1 
ATOM   3016 C  C      . PRO C 3 331 ? 24.460  48.445 33.166  1.00 58.92  ?  627  PRO A C      1 
ATOM   3017 O  O      . PRO C 3 331 ? 24.660  49.367 32.372  1.00 50.66  ?  627  PRO A O      1 
ATOM   3018 C  CB     . PRO C 3 331 ? 26.648  47.204 33.325  1.00 51.37  ?  627  PRO A CB     1 
ATOM   3019 C  CG     . PRO C 3 331 ? 27.314  46.298 32.350  1.00 48.07  ?  627  PRO A CG     1 
ATOM   3020 C  CD     . PRO C 3 331 ? 26.480  46.353 31.104  1.00 50.81  ?  627  PRO A CD     1 
ATOM   3021 N  N      . ILE C 3 332 ? 23.659  48.558 34.225  1.00 61.87  ?  628  ILE A N      1 
ATOM   3022 C  CA     . ILE C 3 332 ? 22.944  49.790 34.532  1.00 68.50  ?  628  ILE A CA     1 
ATOM   3023 C  C      . ILE C 3 332 ? 23.091  50.103 36.016  1.00 73.87  ?  628  ILE A C      1 
ATOM   3024 O  O      . ILE C 3 332 ? 23.139  51.271 36.418  1.00 74.17  ?  628  ILE A O      1 
ATOM   3025 C  CB     . ILE C 3 332 ? 21.460  49.681 34.142  1.00 70.42  ?  628  ILE A CB     1 
ATOM   3026 C  CG1    . ILE C 3 332 ? 20.791  51.056 34.199  1.00 71.14  ?  628  ILE A CG1    1 
ATOM   3027 C  CG2    . ILE C 3 332 ? 20.739  48.699 35.059  1.00 75.02  ?  628  ILE A CG2    1 
ATOM   3028 C  CD1    . ILE C 3 332 ? 21.367  52.048 33.218  1.00 74.18  ?  628  ILE A CD1    1 
ATOM   3029 N  N      . ARG C 3 333 ? 23.164  49.055 36.838  1.00 73.87  ?  629  ARG A N      1 
ATOM   3030 C  CA     . ARG C 3 333 ? 23.181  49.235 38.286  1.00 70.33  ?  629  ARG A CA     1 
ATOM   3031 C  C      . ARG C 3 333 ? 24.407  50.025 38.728  1.00 66.86  ?  629  ARG A C      1 
ATOM   3032 O  O      . ARG C 3 333 ? 24.288  51.114 39.300  1.00 71.71  ?  629  ARG A O      1 
ATOM   3033 C  CB     . ARG C 3 333 ? 23.127  47.870 38.974  1.00 72.73  ?  629  ARG A CB     1 
ATOM   3034 C  CG     . ARG C 3 333 ? 22.980  47.924 40.482  1.00 82.21  ?  629  ARG A CG     1 
ATOM   3035 C  CD     . ARG C 3 333 ? 22.780  46.526 41.049  1.00 89.14  ?  629  ARG A CD     1 
ATOM   3036 N  NE     . ARG C 3 333 ? 22.802  46.515 42.508  1.00 95.65  ?  629  ARG A NE     1 
ATOM   3037 C  CZ     . ARG C 3 333 ? 23.904  46.369 43.236  1.00 94.87  ?  629  ARG A CZ     1 
ATOM   3038 N  NH1    . ARG C 3 333 ? 25.080  46.222 42.641  1.00 92.60  ?  629  ARG A NH1    1 
ATOM   3039 N  NH2    . ARG C 3 333 ? 23.832  46.371 44.560  1.00 94.35  ?  629  ARG A NH2    1 
ATOM   3040 N  N      . LEU C 3 334 ? 25.596  49.490 38.468  1.00 66.15  ?  630  LEU A N      1 
ATOM   3041 C  CA     . LEU C 3 334 ? 26.831  50.169 38.832  1.00 64.15  ?  630  LEU A CA     1 
ATOM   3042 C  C      . LEU C 3 334 ? 27.211  51.190 37.765  1.00 66.13  ?  630  LEU A C      1 
ATOM   3043 O  O      . LEU C 3 334 ? 27.099  50.927 36.564  1.00 59.21  ?  630  LEU A O      1 
ATOM   3044 C  CB     . LEU C 3 334 ? 27.957  49.150 39.021  1.00 59.24  ?  630  LEU A CB     1 
ATOM   3045 C  CG     . LEU C 3 334 ? 27.648  47.997 39.984  1.00 61.78  ?  630  LEU A CG     1 
ATOM   3046 C  CD1    . LEU C 3 334 ? 28.735  46.934 39.926  1.00 58.68  ?  630  LEU A CD1    1 
ATOM   3047 C  CD2    . LEU C 3 334 ? 27.465  48.505 41.410  1.00 56.62  ?  630  LEU A CD2    1 
ATOM   3048 N  N      . GLU C 3 335 ? 27.661  52.366 38.212  1.00 68.30  ?  631  GLU A N      1 
ATOM   3049 C  CA     . GLU C 3 335 ? 27.995  53.438 37.278  1.00 76.33  ?  631  GLU A CA     1 
ATOM   3050 C  C      . GLU C 3 335 ? 29.130  53.037 36.345  1.00 78.61  ?  631  GLU A C      1 
ATOM   3051 O  O      . GLU C 3 335 ? 29.074  53.300 35.138  1.00 82.27  ?  631  GLU A O      1 
ATOM   3052 C  CB     . GLU C 3 335 ? 28.365  54.707 38.047  1.00 82.67  ?  631  GLU A CB     1 
ATOM   3053 C  CG     . GLU C 3 335 ? 28.994  55.805 37.191  1.00 91.58  ?  631  GLU A CG     1 
ATOM   3054 C  CD     . GLU C 3 335 ? 28.034  56.384 36.166  1.00 102.10 ?  631  GLU A CD     1 
ATOM   3055 O  OE1    . GLU C 3 335 ? 26.819  56.447 36.452  1.00 105.35 ?  631  GLU A OE1    1 
ATOM   3056 O  OE2    . GLU C 3 335 ? 28.493  56.777 35.072  1.00 106.08 ?  631  GLU A OE2    1 
ATOM   3057 N  N      . GLU C 3 336 ? 30.177  52.410 36.884  1.00 72.62  ?  632  GLU A N      1 
ATOM   3058 C  CA     . GLU C 3 336 ? 31.320  52.052 36.051  1.00 69.28  ?  632  GLU A CA     1 
ATOM   3059 C  C      . GLU C 3 336 ? 30.928  51.108 34.922  1.00 60.50  ?  632  GLU A C      1 
ATOM   3060 O  O      . GLU C 3 336 ? 31.603  51.070 33.885  1.00 58.39  ?  632  GLU A O      1 
ATOM   3061 C  CB     . GLU C 3 336 ? 32.430  51.437 36.907  1.00 77.45  ?  632  GLU A CB     1 
ATOM   3062 C  CG     . GLU C 3 336 ? 33.068  52.410 37.882  1.00 86.81  ?  632  GLU A CG     1 
ATOM   3063 C  CD     . GLU C 3 336 ? 34.290  51.831 38.574  1.00 94.93  ?  632  GLU A CD     1 
ATOM   3064 O  OE1    . GLU C 3 336 ? 34.538  50.615 38.429  1.00 97.68  ?  632  GLU A OE1    1 
ATOM   3065 O  OE2    . GLU C 3 336 ? 35.006  52.592 39.259  1.00 99.40  ?  632  GLU A OE2    1 
ATOM   3066 N  N      . GLY C 3 337 ? 29.859  50.338 35.106  1.00 56.49  ?  633  GLY A N      1 
ATOM   3067 C  CA     . GLY C 3 337 ? 29.373  49.431 34.086  1.00 58.60  ?  633  GLY A CA     1 
ATOM   3068 C  C      . GLY C 3 337 ? 28.199  50.014 33.328  1.00 57.20  ?  633  GLY A C      1 
ATOM   3069 O  O      . GLY C 3 337 ? 27.900  49.598 32.205  1.00 47.51  ?  633  GLY A O      1 
ATOM   3070 N  N      . ARG C 3 338 ? 27.520  50.985 33.942  1.00 60.92  ?  634  ARG A N      1 
ATOM   3071 C  CA     . ARG C 3 338 ? 26.437  51.682 33.257  1.00 51.66  ?  634  ARG A CA     1 
ATOM   3072 C  C      . ARG C 3 338 ? 26.946  52.477 32.060  1.00 37.45  ?  634  ARG A C      1 
ATOM   3073 O  O      . ARG C 3 338 ? 26.201  52.691 31.097  1.00 40.88  ?  634  ARG A O      1 
ATOM   3074 C  CB     . ARG C 3 338 ? 25.711  52.598 34.244  1.00 66.05  ?  634  ARG A CB     1 
ATOM   3075 C  CG     . ARG C 3 338 ? 24.471  53.276 33.704  1.00 72.45  ?  634  ARG A CG     1 
ATOM   3076 C  CD     . ARG C 3 338 ? 23.925  54.261 34.724  1.00 78.94  ?  634  ARG A CD     1 
ATOM   3077 N  NE     . ARG C 3 338 ? 22.537  54.618 34.456  1.00 84.85  ?  634  ARG A NE     1 
ATOM   3078 C  CZ     . ARG C 3 338 ? 21.814  55.431 35.220  1.00 92.46  ?  634  ARG A CZ     1 
ATOM   3079 N  NH1    . ARG C 3 338 ? 22.349  55.977 36.303  1.00 95.68  ?  634  ARG A NH1    1 
ATOM   3080 N  NH2    . ARG C 3 338 ? 20.555  55.697 34.900  1.00 91.54  ?  634  ARG A NH2    1 
ATOM   3081 N  N      . LYS C 3 339 ? 28.209  52.913 32.095  1.00 24.22  ?  635  LYS A N      1 
ATOM   3082 C  CA     . LYS C 3 339 ? 28.761  53.716 31.012  1.00 39.22  ?  635  LYS A CA     1 
ATOM   3083 C  C      . LYS C 3 339 ? 28.908  52.935 29.715  1.00 49.05  ?  635  LYS A C      1 
ATOM   3084 O  O      . LYS C 3 339 ? 29.111  53.550 28.664  1.00 54.91  ?  635  LYS A O      1 
ATOM   3085 C  CB     . LYS C 3 339 ? 30.114  54.295 31.424  1.00 41.41  ?  635  LYS A CB     1 
ATOM   3086 C  CG     . LYS C 3 339 ? 30.028  55.290 32.575  1.00 50.53  ?  635  LYS A CG     1 
ATOM   3087 C  CD     . LYS C 3 339 ? 31.293  56.126 32.693  1.00 57.19  ?  635  LYS A CD     1 
ATOM   3088 C  CE     . LYS C 3 339 ? 31.175  57.127 33.833  1.00 58.68  ?  635  LYS A CE     1 
ATOM   3089 N  NZ     . LYS C 3 339 ? 32.337  58.058 33.878  1.00 57.45  ?  635  LYS A NZ     1 
ATOM   3090 N  N      . ILE C 3 340 ? 28.810  51.604 29.762  1.00 51.69  ?  636  ILE A N      1 
ATOM   3091 C  CA     . ILE C 3 340 ? 28.848  50.810 28.539  1.00 45.47  ?  636  ILE A CA     1 
ATOM   3092 C  C      . ILE C 3 340 ? 27.709  51.196 27.610  1.00 38.05  ?  636  ILE A C      1 
ATOM   3093 O  O      . ILE C 3 340 ? 27.828  51.079 26.386  1.00 32.22  ?  636  ILE A O      1 
ATOM   3094 C  CB     . ILE C 3 340 ? 28.815  49.308 28.883  1.00 46.80  ?  636  ILE A CB     1 
ATOM   3095 C  CG1    . ILE C 3 340 ? 30.227  48.803 29.175  1.00 44.28  ?  636  ILE A CG1    1 
ATOM   3096 C  CG2    . ILE C 3 340 ? 28.167  48.507 27.764  1.00 43.82  ?  636  ILE A CG2    1 
ATOM   3097 C  CD1    . ILE C 3 340 ? 30.254  47.424 29.769  1.00 60.37  ?  636  ILE A CD1    1 
ATOM   3098 N  N      . ARG C 3 341 ? 26.587  51.651 28.166  1.00 41.16  ?  637  ARG A N      1 
ATOM   3099 C  CA     . ARG C 3 341 ? 25.476  52.077 27.326  1.00 38.95  ?  637  ARG A CA     1 
ATOM   3100 C  C      . ARG C 3 341 ? 25.801  53.334 26.529  1.00 30.53  ?  637  ARG A C      1 
ATOM   3101 O  O      . ARG C 3 341 ? 25.069  53.658 25.589  1.00 35.45  ?  637  ARG A O      1 
ATOM   3102 C  CB     . ARG C 3 341 ? 24.234  52.303 28.180  1.00 32.13  ?  637  ARG A CB     1 
ATOM   3103 C  CG     . ARG C 3 341 ? 23.620  51.025 28.712  1.00 37.80  ?  637  ARG A CG     1 
ATOM   3104 C  CD     . ARG C 3 341 ? 22.862  51.286 29.995  1.00 40.61  ?  637  ARG A CD     1 
ATOM   3105 N  NE     . ARG C 3 341 ? 22.179  50.086 30.462  1.00 41.26  ?  637  ARG A NE     1 
ATOM   3106 C  CZ     . ARG C 3 341 ? 20.876  49.872 30.331  1.00 40.70  ?  637  ARG A CZ     1 
ATOM   3107 N  NH1    . ARG C 3 341 ? 20.110  50.787 29.757  1.00 38.85  ?  637  ARG A NH1    1 
ATOM   3108 N  NH2    . ARG C 3 341 ? 20.341  48.748 30.783  1.00 48.82  ?  637  ARG A NH2    1 
ATOM   3109 N  N      . GLN C 3 342 ? 26.877  54.046 26.880  1.00 30.49  ?  638  GLN A N      1 
ATOM   3110 C  CA     . GLN C 3 342 ? 27.302  55.191 26.082  1.00 30.70  ?  638  GLN A CA     1 
ATOM   3111 C  C      . GLN C 3 342 ? 27.743  54.782 24.685  1.00 37.20  ?  638  GLN A C      1 
ATOM   3112 O  O      . GLN C 3 342 ? 27.806  55.635 23.793  1.00 29.08  ?  638  GLN A O      1 
ATOM   3113 C  CB     . GLN C 3 342 ? 28.449  55.933 26.771  1.00 33.57  ?  638  GLN A CB     1 
ATOM   3114 C  CG     . GLN C 3 342 ? 28.060  56.682 28.030  1.00 43.46  ?  638  GLN A CG     1 
ATOM   3115 C  CD     . GLN C 3 342 ? 29.256  57.310 28.721  1.00 47.22  ?  638  GLN A CD     1 
ATOM   3116 O  OE1    . GLN C 3 342 ? 30.404  56.940 28.466  1.00 52.84  ?  638  GLN A OE1    1 
ATOM   3117 N  NE2    . GLN C 3 342 ? 28.993  58.270 29.599  1.00 50.08  ?  638  GLN A NE2    1 
ATOM   3118 N  N      . ALA C 3 343 ? 28.068  53.503 24.483  1.00 37.45  ?  639  ALA A N      1 
ATOM   3119 C  CA     . ALA C 3 343 ? 28.529  53.006 23.194  1.00 40.07  ?  639  ALA A CA     1 
ATOM   3120 C  C      . ALA C 3 343 ? 27.390  52.716 22.233  1.00 27.24  ?  639  ALA A C      1 
ATOM   3121 O  O      . ALA C 3 343 ? 27.646  52.459 21.050  1.00 29.67  ?  639  ALA A O      1 
ATOM   3122 C  CB     . ALA C 3 343 ? 29.360  51.735 23.386  1.00 43.34  ?  639  ALA A CB     1 
ATOM   3123 N  N      . PHE C 3 344 ? 26.152  52.733 22.709  1.00 22.84  ?  640  PHE A N      1 
ATOM   3124 C  CA     . PHE C 3 344 ? 24.983  52.476 21.879  1.00 26.86  ?  640  PHE A CA     1 
ATOM   3125 C  C      . PHE C 3 344 ? 24.416  53.819 21.443  1.00 24.85  ?  640  PHE A C      1 
ATOM   3126 O  O      . PHE C 3 344 ? 23.831  54.545 22.251  1.00 22.67  ?  640  PHE A O      1 
ATOM   3127 C  CB     . PHE C 3 344 ? 23.953  51.652 22.640  1.00 31.98  ?  640  PHE A CB     1 
ATOM   3128 C  CG     . PHE C 3 344 ? 24.431  50.282 22.988  1.00 37.54  ?  640  PHE A CG     1 
ATOM   3129 C  CD1    . PHE C 3 344 ? 24.094  49.200 22.196  1.00 38.60  ?  640  PHE A CD1    1 
ATOM   3130 C  CD2    . PHE C 3 344 ? 25.236  50.075 24.095  1.00 40.94  ?  640  PHE A CD2    1 
ATOM   3131 C  CE1    . PHE C 3 344 ? 24.537  47.935 22.510  1.00 33.62  ?  640  PHE A CE1    1 
ATOM   3132 C  CE2    . PHE C 3 344 ? 25.680  48.812 24.414  1.00 37.33  ?  640  PHE A CE2    1 
ATOM   3133 C  CZ     . PHE C 3 344 ? 25.329  47.741 23.622  1.00 33.08  ?  640  PHE A CZ     1 
ATOM   3134 N  N      . VAL C 3 345 ? 24.598  54.143 20.169  1.00 27.57  ?  641  VAL A N      1 
ATOM   3135 C  CA     . VAL C 3 345 ? 24.332  55.481 19.656  1.00 25.90  ?  641  VAL A CA     1 
ATOM   3136 C  C      . VAL C 3 345 ? 23.276  55.405 18.562  1.00 28.00  ?  641  VAL A C      1 
ATOM   3137 O  O      . VAL C 3 345 ? 22.969  54.309 18.069  1.00 28.49  ?  641  VAL A O      1 
ATOM   3138 C  CB     . VAL C 3 345 ? 25.621  56.124 19.128  1.00 25.21  ?  641  VAL A CB     1 
ATOM   3139 C  CG1    . VAL C 3 345 ? 26.610  56.340 20.264  1.00 26.16  ?  641  VAL A CG1    1 
ATOM   3140 C  CG2    . VAL C 3 345 ? 26.232  55.239 18.047  1.00 27.11  ?  641  VAL A CG2    1 
ATOM   3141 N  N      . PRO C 3 346 ? 22.697  56.533 18.156  1.00 32.27  ?  642  PRO A N      1 
ATOM   3142 C  CA     . PRO C 3 346 ? 21.801  56.521 16.999  1.00 29.24  ?  642  PRO A CA     1 
ATOM   3143 C  C      . PRO C 3 346 ? 22.568  56.154 15.740  1.00 24.75  ?  642  PRO A C      1 
ATOM   3144 O  O      . PRO C 3 346 ? 23.764  56.424 15.610  1.00 20.83  ?  642  PRO A O      1 
ATOM   3145 C  CB     . PRO C 3 346 ? 21.275  57.961 16.936  1.00 29.35  ?  642  PRO A CB     1 
ATOM   3146 C  CG     . PRO C 3 346 ? 21.549  58.533 18.292  1.00 24.49  ?  642  PRO A CG     1 
ATOM   3147 C  CD     . PRO C 3 346 ? 22.800  57.869 18.762  1.00 25.04  ?  642  PRO A CD     1 
ATOM   3148 N  N      . SER C 3 347 ? 21.868  55.526 14.804  1.00 22.07  ?  643  SER A N      1 
ATOM   3149 C  CA     . SER C 3 347 ? 22.540  55.067 13.599  1.00 25.12  ?  643  SER A CA     1 
ATOM   3150 C  C      . SER C 3 347 ? 22.682  56.159 12.549  1.00 36.47  ?  643  SER A C      1 
ATOM   3151 O  O      . SER C 3 347 ? 23.218  55.883 11.470  1.00 28.07  ?  643  SER A O      1 
ATOM   3152 C  CB     . SER C 3 347 ? 21.795  53.868 13.007  1.00 25.91  ?  643  SER A CB     1 
ATOM   3153 O  OG     . SER C 3 347 ? 20.466  54.221 12.672  1.00 25.62  ?  643  SER A OG     1 
ATOM   3154 N  N      . GLU C 3 348 ? 22.230  57.381 12.836  1.00 32.41  ?  644  GLU A N      1 
ATOM   3155 C  CA     . GLU C 3 348 ? 22.306  58.482 11.887  1.00 35.21  ?  644  GLU A CA     1 
ATOM   3156 C  C      . GLU C 3 348 ? 22.594  59.778 12.630  1.00 34.28  ?  644  GLU A C      1 
ATOM   3157 O  O      . GLU C 3 348 ? 22.246  59.931 13.804  1.00 38.73  ?  644  GLU A O      1 
ATOM   3158 C  CB     . GLU C 3 348 ? 21.007  58.622 11.077  1.00 37.42  ?  644  GLU A CB     1 
ATOM   3159 C  CG     . GLU C 3 348 ? 20.423  57.293 10.625  1.00 58.04  ?  644  GLU A CG     1 
ATOM   3160 C  CD     . GLU C 3 348 ? 19.537  57.426 9.403   1.00 71.40  ?  644  GLU A CD     1 
ATOM   3161 O  OE1    . GLU C 3 348 ? 19.756  58.364 8.608   1.00 77.19  ?  644  GLU A OE1    1 
ATOM   3162 O  OE2    . GLU C 3 348 ? 18.624  56.589 9.237   1.00 73.70  ?  644  GLU A OE2    1 
ATOM   3163 N  N      . SER C 3 349 ? 23.228  60.714 11.930  1.00 38.25  ?  645  SER A N      1 
ATOM   3164 C  CA     . SER C 3 349 ? 23.531  62.009 12.522  1.00 38.51  ?  645  SER A CA     1 
ATOM   3165 C  C      . SER C 3 349 ? 22.253  62.812 12.739  1.00 37.69  ?  645  SER A C      1 
ATOM   3166 O  O      . SER C 3 349 ? 21.303  62.731 11.954  1.00 32.77  ?  645  SER A O      1 
ATOM   3167 C  CB     . SER C 3 349 ? 24.500  62.783 11.632  1.00 45.29  ?  645  SER A CB     1 
ATOM   3168 O  OG     . SER C 3 349 ? 24.100  62.711 10.276  1.00 59.33  ?  645  SER A OG     1 
ATOM   3169 N  N      . ASP C 3 350 ? 22.230  63.589 13.819  1.00 30.92  ?  646  ASP A N      1 
ATOM   3170 C  CA     . ASP C 3 350 ? 21.070  64.385 14.197  1.00 36.46  ?  646  ASP A CA     1 
ATOM   3171 C  C      . ASP C 3 350 ? 19.875  63.522 14.573  1.00 32.23  ?  646  ASP A C      1 
ATOM   3172 O  O      . ASP C 3 350 ? 18.732  63.995 14.545  1.00 30.37  ?  646  ASP A O      1 
ATOM   3173 C  CB     . ASP C 3 350 ? 20.679  65.362 13.083  1.00 50.67  ?  646  ASP A CB     1 
ATOM   3174 C  CG     . ASP C 3 350 ? 21.795  66.329 12.743  1.00 64.70  ?  646  ASP A CG     1 
ATOM   3175 O  OD1    . ASP C 3 350 ? 22.590  66.664 13.647  1.00 68.07  ?  646  ASP A OD1    1 
ATOM   3176 O  OD2    . ASP C 3 350 ? 21.875  66.756 11.571  1.00 71.45  ?  646  ASP A OD2    1 
ATOM   3177 N  N      . TRP C 3 351 ? 20.109  62.253 14.895  1.00 31.36  ?  647  TRP A N      1 
ATOM   3178 C  CA     . TRP C 3 351 ? 19.104  61.399 15.505  1.00 25.62  ?  647  TRP A CA     1 
ATOM   3179 C  C      . TRP C 3 351 ? 19.420  61.230 16.984  1.00 21.04  ?  647  TRP A C      1 
ATOM   3180 O  O      . TRP C 3 351 ? 20.536  61.490 17.439  1.00 33.22  ?  647  TRP A O      1 
ATOM   3181 C  CB     . TRP C 3 351 ? 19.033  60.024 14.827  1.00 27.16  ?  647  TRP A CB     1 
ATOM   3182 C  CG     . TRP C 3 351 ? 18.367  60.024 13.477  1.00 26.97  ?  647  TRP A CG     1 
ATOM   3183 C  CD1    . TRP C 3 351 ? 18.513  60.950 12.491  1.00 31.66  ?  647  TRP A CD1    1 
ATOM   3184 C  CD2    . TRP C 3 351 ? 17.438  59.049 12.976  1.00 19.59  ?  647  TRP A CD2    1 
ATOM   3185 N  NE1    . TRP C 3 351 ? 17.743  60.612 11.402  1.00 24.99  ?  647  TRP A NE1    1 
ATOM   3186 C  CE2    . TRP C 3 351 ? 17.074  59.451 11.674  1.00 24.51  ?  647  TRP A CE2    1 
ATOM   3187 C  CE3    . TRP C 3 351 ? 16.883  57.876 13.501  1.00 26.03  ?  647  TRP A CE3    1 
ATOM   3188 C  CZ2    . TRP C 3 351 ? 16.181  58.721 10.888  1.00 28.71  ?  647  TRP A CZ2    1 
ATOM   3189 C  CZ3    . TRP C 3 351 ? 15.995  57.153 12.721  1.00 30.74  ?  647  TRP A CZ3    1 
ATOM   3190 C  CH2    . TRP C 3 351 ? 15.654  57.579 11.428  1.00 33.14  ?  647  TRP A CH2    1 
ATOM   3191 N  N      . LEU C 3 352 ? 18.414  60.794 17.735  1.00 24.00  ?  648  LEU A N      1 
ATOM   3192 C  CA     . LEU C 3 352 ? 18.560  60.585 19.164  1.00 21.82  ?  648  LEU A CA     1 
ATOM   3193 C  C      . LEU C 3 352 ? 17.934  59.254 19.547  1.00 20.40  ?  648  LEU A C      1 
ATOM   3194 O  O      . LEU C 3 352 ? 17.068  58.719 18.850  1.00 25.54  ?  648  LEU A O      1 
ATOM   3195 C  CB     . LEU C 3 352 ? 17.924  61.725 19.974  1.00 18.63  ?  648  LEU A CB     1 
ATOM   3196 C  CG     . LEU C 3 352 ? 18.518  63.118 19.743  1.00 23.79  ?  648  LEU A CG     1 
ATOM   3197 C  CD1    . LEU C 3 352 ? 17.750  64.180 20.524  1.00 31.20  ?  648  LEU A CD1    1 
ATOM   3198 C  CD2    . LEU C 3 352 ? 19.990  63.139 20.114  1.00 27.16  ?  648  LEU A CD2    1 
ATOM   3199 N  N      . ILE C 3 353 ? 18.390  58.731 20.676  1.00 19.97  ?  649  ILE A N      1 
ATOM   3200 C  CA     . ILE C 3 353 ? 17.813  57.545 21.285  1.00 16.86  ?  649  ILE A CA     1 
ATOM   3201 C  C      . ILE C 3 353 ? 16.666  57.971 22.190  1.00 26.44  ?  649  ILE A C      1 
ATOM   3202 O  O      . ILE C 3 353 ? 16.824  58.857 23.034  1.00 21.69  ?  649  ILE A O      1 
ATOM   3203 C  CB     . ILE C 3 353 ? 18.874  56.765 22.077  1.00 24.56  ?  649  ILE A CB     1 
ATOM   3204 C  CG1    . ILE C 3 353 ? 20.000  56.324 21.148  1.00 21.35  ?  649  ILE A CG1    1 
ATOM   3205 C  CG2    . ILE C 3 353 ? 18.240  55.570 22.787  1.00 26.78  ?  649  ILE A CG2    1 
ATOM   3206 C  CD1    . ILE C 3 353 ? 19.521  55.511 19.979  1.00 20.43  ?  649  ILE A CD1    1 
ATOM   3207 N  N      . PHE C 3 354 ? 15.512  57.337 22.015  1.00 23.06  ?  650  PHE A N      1 
ATOM   3208 C  CA     . PHE C 3 354 ? 14.345  57.554 22.858  1.00 22.53  ?  650  PHE A CA     1 
ATOM   3209 C  C      . PHE C 3 354 ? 14.039  56.252 23.583  1.00 18.67  ?  650  PHE A C      1 
ATOM   3210 O  O      . PHE C 3 354 ? 13.963  55.198 22.951  1.00 21.45  ?  650  PHE A O      1 
ATOM   3211 C  CB     . PHE C 3 354 ? 13.150  57.998 22.014  1.00 26.18  ?  650  PHE A CB     1 
ATOM   3212 C  CG     . PHE C 3 354 ? 11.940  58.379 22.810  1.00 19.99  ?  650  PHE A CG     1 
ATOM   3213 C  CD1    . PHE C 3 354 ? 11.664  59.707 23.070  1.00 24.39  ?  650  PHE A CD1    1 
ATOM   3214 C  CD2    . PHE C 3 354 ? 11.074  57.412 23.287  1.00 27.50  ?  650  PHE A CD2    1 
ATOM   3215 C  CE1    . PHE C 3 354 ? 10.546  60.069 23.794  1.00 14.14  ?  650  PHE A CE1    1 
ATOM   3216 C  CE2    . PHE C 3 354 ? 9.953   57.766 24.012  1.00 23.64  ?  650  PHE A CE2    1 
ATOM   3217 C  CZ     . PHE C 3 354 ? 9.688   59.094 24.266  1.00 22.23  ?  650  PHE A CZ     1 
ATOM   3218 N  N      . ALA C 3 355 ? 13.870  56.320 24.902  1.00 17.23  ?  651  ALA A N      1 
ATOM   3219 C  CA     . ALA C 3 355 ? 13.655  55.129 25.714  1.00 17.38  ?  651  ALA A CA     1 
ATOM   3220 C  C      . ALA C 3 355 ? 12.484  55.367 26.651  1.00 25.24  ?  651  ALA A C      1 
ATOM   3221 O  O      . ALA C 3 355 ? 12.475  56.344 27.409  1.00 28.11  ?  651  ALA A O      1 
ATOM   3222 C  CB     . ALA C 3 355 ? 14.913  54.755 26.504  1.00 19.34  ?  651  ALA A CB     1 
ATOM   3223 N  N      . ALA C 3 356 ? 11.506  54.470 26.604  1.00 22.38  ?  652  ALA A N      1 
ATOM   3224 C  CA     . ALA C 3 356 ? 10.326  54.530 27.450  1.00 22.74  ?  652  ALA A CA     1 
ATOM   3225 C  C      . ALA C 3 356 ? 10.196  53.207 28.184  1.00 24.44  ?  652  ALA A C      1 
ATOM   3226 O  O      . ALA C 3 356 ? 10.299  52.139 27.573  1.00 21.04  ?  652  ALA A O      1 
ATOM   3227 C  CB     . ALA C 3 356 ? 9.067   54.814 26.628  1.00 14.76  ?  652  ALA A CB     1 
ATOM   3228 N  N      . ASP C 3 357 ? 9.971   53.277 29.489  1.00 21.83  ?  653  ASP A N      1 
ATOM   3229 C  CA     . ASP C 3 357 ? 9.882   52.079 30.306  1.00 24.88  ?  653  ASP A CA     1 
ATOM   3230 C  C      . ASP C 3 357 ? 8.645   52.156 31.180  1.00 22.54  ?  653  ASP A C      1 
ATOM   3231 O  O      . ASP C 3 357 ? 8.330   53.211 31.738  1.00 21.50  ?  653  ASP A O      1 
ATOM   3232 C  CB     . ASP C 3 357 ? 11.125  51.897 31.186  1.00 34.23  ?  653  ASP A CB     1 
ATOM   3233 C  CG     . ASP C 3 357 ? 11.249  52.970 32.248  1.00 71.60  ?  653  ASP A CG     1 
ATOM   3234 O  OD1    . ASP C 3 357 ? 11.254  54.168 31.894  1.00 87.45  ?  653  ASP A OD1    1 
ATOM   3235 O  OD2    . ASP C 3 357 ? 11.328  52.615 33.443  1.00 84.06  ?  653  ASP A OD2    1 
ATOM   3236 N  N      . TYR C 3 358 ? 7.937   51.037 31.278  1.00 13.32  ?  654  TYR A N      1 
ATOM   3237 C  CA     . TYR C 3 358 ? 6.870   50.935 32.255  1.00 14.73  ?  654  TYR A CA     1 
ATOM   3238 C  C      . TYR C 3 358 ? 7.440   51.074 33.656  1.00 21.35  ?  654  TYR A C      1 
ATOM   3239 O  O      . TYR C 3 358 ? 8.501   50.528 33.973  1.00 23.62  ?  654  TYR A O      1 
ATOM   3240 C  CB     . TYR C 3 358 ? 6.135   49.605 32.117  1.00 12.90  ?  654  TYR A CB     1 
ATOM   3241 C  CG     . TYR C 3 358 ? 5.253   49.541 30.904  1.00 15.83  ?  654  TYR A CG     1 
ATOM   3242 C  CD1    . TYR C 3 358 ? 5.591   48.742 29.824  1.00 15.12  ?  654  TYR A CD1    1 
ATOM   3243 C  CD2    . TYR C 3 358 ? 4.091   50.300 30.826  1.00 14.36  ?  654  TYR A CD2    1 
ATOM   3244 C  CE1    . TYR C 3 358 ? 4.794   48.683 28.704  1.00 22.63  ?  654  TYR A CE1    1 
ATOM   3245 C  CE2    . TYR C 3 358 ? 3.279   50.246 29.700  1.00 10.90  ?  654  TYR A CE2    1 
ATOM   3246 C  CZ     . TYR C 3 358 ? 3.644   49.434 28.644  1.00 19.80  ?  654  TYR A CZ     1 
ATOM   3247 O  OH     . TYR C 3 358 ? 2.864   49.353 27.516  1.00 19.64  ?  654  TYR A OH     1 
ATOM   3248 N  N      . SER C 3 359 ? 6.738   51.836 34.484  1.00 17.18  ?  655  SER A N      1 
ATOM   3249 C  CA     . SER C 3 359 ? 7.056   51.955 35.898  1.00 21.20  ?  655  SER A CA     1 
ATOM   3250 C  C      . SER C 3 359 ? 6.251   50.910 36.664  1.00 12.65  ?  655  SER A C      1 
ATOM   3251 O  O      . SER C 3 359 ? 5.021   51.002 36.755  1.00 17.17  ?  655  SER A O      1 
ATOM   3252 C  CB     . SER C 3 359 ? 6.760   53.367 36.396  1.00 28.26  ?  655  SER A CB     1 
ATOM   3253 O  OG     . SER C 3 359 ? 7.161   53.515 37.743  1.00 32.15  ?  655  SER A OG     1 
ATOM   3254 N  N      . GLN C 3 360 ? 6.960   49.952 37.242  1.00 14.74  ?  656  GLN A N      1 
ATOM   3255 C  CA     . GLN C 3 360 ? 6.386   48.900 38.077  1.00 23.30  ?  656  GLN A CA     1 
ATOM   3256 C  C      . GLN C 3 360 ? 5.186   48.211 37.470  1.00 23.53  ?  656  GLN A C      1 
ATOM   3257 O  O      . GLN C 3 360 ? 4.172   48.026 38.115  1.00 17.26  ?  656  GLN A O      1 
ATOM   3258 C  CB     . GLN C 3 360 ? 6.022   49.483 39.434  1.00 36.35  ?  656  GLN A CB     1 
ATOM   3259 C  CG     . GLN C 3 360 ? 6.917   50.643 39.807  1.00 56.25  ?  656  GLN A CG     1 
ATOM   3260 C  CD     . GLN C 3 360 ? 6.859   50.997 41.265  1.00 84.37  ?  656  GLN A CD     1 
ATOM   3261 O  OE1    . GLN C 3 360 ? 6.027   51.798 41.689  1.00 93.18  ?  656  GLN A OE1    1 
ATOM   3262 N  NE2    . GLN C 3 360 ? 7.766   50.427 42.045  1.00 103.23 ?  656  GLN A NE2    1 
ATOM   3263 N  N      . ILE C 3 361 ? 5.332   47.800 36.227  1.00 20.29  ?  657  ILE A N      1 
ATOM   3264 C  CA     . ILE C 3 361 ? 4.215   47.175 35.527  1.00 25.92  ?  657  ILE A CA     1 
ATOM   3265 C  C      . ILE C 3 361 ? 3.819   45.867 36.204  1.00 12.36  ?  657  ILE A C      1 
ATOM   3266 O  O      . ILE C 3 361 ? 2.629   45.549 36.311  1.00 14.62  ?  657  ILE A O      1 
ATOM   3267 C  CB     . ILE C 3 361 ? 4.549   46.978 34.035  1.00 13.64  ?  657  ILE A CB     1 
ATOM   3268 C  CG1    . ILE C 3 361 ? 3.300   46.529 33.273  1.00 18.40  ?  657  ILE A CG1    1 
ATOM   3269 C  CG2    . ILE C 3 361 ? 5.709   46.001 33.837  1.00 15.51  ?  657  ILE A CG2    1 
ATOM   3270 C  CD1    . ILE C 3 361 ? 3.461   46.572 31.772  1.00 21.15  ?  657  ILE A CD1    1 
ATOM   3271 N  N      . GLU C 3 362 ? 4.796   45.100 36.690  1.00 13.64  ?  658  GLU A N      1 
ATOM   3272 C  CA     . GLU C 3 362 ? 4.475   43.830 37.341  1.00 17.24  ?  658  GLU A CA     1 
ATOM   3273 C  C      . GLU C 3 362 ? 3.580   44.042 38.559  1.00 17.21  ?  658  GLU A C      1 
ATOM   3274 O  O      . GLU C 3 362 ? 2.575   43.343 38.736  1.00 19.00  ?  658  GLU A O      1 
ATOM   3275 C  CB     . GLU C 3 362 ? 5.758   43.104 37.735  1.00 17.56  ?  658  GLU A CB     1 
ATOM   3276 C  CG     . GLU C 3 362 ? 6.629   42.698 36.551  1.00 23.97  ?  658  GLU A CG     1 
ATOM   3277 C  CD     . GLU C 3 362 ? 7.461   43.852 36.000  1.00 35.14  ?  658  GLU A CD     1 
ATOM   3278 O  OE1    . GLU C 3 362 ? 8.160   43.641 34.988  1.00 35.64  ?  658  GLU A OE1    1 
ATOM   3279 O  OE2    . GLU C 3 362 ? 7.430   44.960 36.584  1.00 32.11  ?  658  GLU A OE2    1 
ATOM   3280 N  N      . LEU C 3 363 ? 3.932   45.003 39.415  1.00 19.29  ?  659  LEU A N      1 
ATOM   3281 C  CA     . LEU C 3 363 ? 3.120   45.260 40.601  1.00 20.19  ?  659  LEU A CA     1 
ATOM   3282 C  C      . LEU C 3 363 ? 1.771   45.872 40.235  1.00 17.73  ?  659  LEU A C      1 
ATOM   3283 O  O      . LEU C 3 363 ? 0.772   45.635 40.926  1.00 15.26  ?  659  LEU A O      1 
ATOM   3284 C  CB     . LEU C 3 363 ? 3.878   46.159 41.577  1.00 13.76  ?  659  LEU A CB     1 
ATOM   3285 C  CG     . LEU C 3 363 ? 4.976   45.511 42.423  1.00 24.26  ?  659  LEU A CG     1 
ATOM   3286 C  CD1    . LEU C 3 363 ? 5.755   46.581 43.176  1.00 23.12  ?  659  LEU A CD1    1 
ATOM   3287 C  CD2    . LEU C 3 363 ? 4.357   44.530 43.389  1.00 32.62  ?  659  LEU A CD2    1 
ATOM   3288 N  N      . ARG C 3 364 ? 1.721   46.680 39.171  1.00 14.33  ?  660  ARG A N      1 
ATOM   3289 C  CA     . ARG C 3 364 ? 0.433   47.182 38.704  1.00 18.57  ?  660  ARG A CA     1 
ATOM   3290 C  C      . ARG C 3 364 ? -0.425  46.050 38.156  1.00 16.66  ?  660  ARG A C      1 
ATOM   3291 O  O      . ARG C 3 364 ? -1.628  45.981 38.434  1.00 16.25  ?  660  ARG A O      1 
ATOM   3292 C  CB     . ARG C 3 364 ? 0.640   48.274 37.653  1.00 15.34  ?  660  ARG A CB     1 
ATOM   3293 C  CG     . ARG C 3 364 ? 1.273   49.520 38.236  1.00 18.88  ?  660  ARG A CG     1 
ATOM   3294 C  CD     . ARG C 3 364 ? 1.603   50.546 37.176  1.00 18.63  ?  660  ARG A CD     1 
ATOM   3295 N  NE     . ARG C 3 364 ? 2.362   51.656 37.740  1.00 22.37  ?  660  ARG A NE     1 
ATOM   3296 C  CZ     . ARG C 3 364 ? 1.820   52.780 38.189  1.00 22.05  ?  660  ARG A CZ     1 
ATOM   3297 N  NH1    . ARG C 3 364 ? 0.507   52.955 38.134  1.00 19.61  ?  660  ARG A NH1    1 
ATOM   3298 N  NH2    . ARG C 3 364 ? 2.592   53.735 38.682  1.00 21.26  ?  660  ARG A NH2    1 
ATOM   3299 N  N      . VAL C 3 365 ? 0.180   45.139 37.395  1.00 14.27  ?  661  VAL A N      1 
ATOM   3300 C  CA     . VAL C 3 365 ? -0.560  43.969 36.938  1.00 15.61  ?  661  VAL A CA     1 
ATOM   3301 C  C      . VAL C 3 365 ? -1.063  43.166 38.126  1.00 14.07  ?  661  VAL A C      1 
ATOM   3302 O  O      . VAL C 3 365 ? -2.195  42.668 38.122  1.00 17.40  ?  661  VAL A O      1 
ATOM   3303 C  CB     . VAL C 3 365 ? 0.305   43.110 36.002  1.00 17.73  ?  661  VAL A CB     1 
ATOM   3304 C  CG1    . VAL C 3 365 ? -0.263  41.697 35.924  1.00 15.95  ?  661  VAL A CG1    1 
ATOM   3305 C  CG2    . VAL C 3 365 ? 0.367   43.742 34.615  1.00 20.94  ?  661  VAL A CG2    1 
ATOM   3306 N  N      . LEU C 3 366 ? -0.234  43.025 39.165  1.00 14.27  ?  662  LEU A N      1 
ATOM   3307 C  CA     . LEU C 3 366 ? -0.668  42.289 40.350  1.00 26.47  ?  662  LEU A CA     1 
ATOM   3308 C  C      . LEU C 3 366 ? -1.870  42.964 41.002  1.00 24.42  ?  662  LEU A C      1 
ATOM   3309 O  O      . LEU C 3 366 ? -2.855  42.302 41.351  1.00 18.07  ?  662  LEU A O      1 
ATOM   3310 C  CB     . LEU C 3 366 ? 0.484   42.158 41.346  1.00 26.12  ?  662  LEU A CB     1 
ATOM   3311 C  CG     . LEU C 3 366 ? 0.113   41.548 42.702  1.00 23.36  ?  662  LEU A CG     1 
ATOM   3312 C  CD1    . LEU C 3 366 ? -0.468  40.149 42.538  1.00 22.83  ?  662  LEU A CD1    1 
ATOM   3313 C  CD2    . LEU C 3 366 ? 1.320   41.525 43.616  1.00 16.21  ?  662  LEU A CD2    1 
ATOM   3314 N  N      . ALA C 3 367 ? -1.798  44.288 41.176  1.00 17.17  ?  663  ALA A N      1 
ATOM   3315 C  CA     . ALA C 3 367 ? -2.923  45.051 41.707  1.00 19.69  ?  663  ALA A CA     1 
ATOM   3316 C  C      . ALA C 3 367 ? -4.203  44.734 40.954  1.00 17.41  ?  663  ALA A C      1 
ATOM   3317 O  O      . ALA C 3 367 ? -5.266  44.526 41.552  1.00 23.34  ?  663  ALA A O      1 
ATOM   3318 C  CB     . ALA C 3 367 ? -2.626  46.551 41.613  1.00 12.46  ?  663  ALA A CB     1 
ATOM   3319 N  N      . HIS C 3 368 ? -4.121  44.748 39.630  1.00 19.71  ?  664  HIS A N      1 
ATOM   3320 C  CA     . HIS C 3 368 ? -5.296  44.533 38.803  1.00 20.81  ?  664  HIS A CA     1 
ATOM   3321 C  C      . HIS C 3 368 ? -5.801  43.101 38.936  1.00 19.46  ?  664  HIS A C      1 
ATOM   3322 O  O      . HIS C 3 368 ? -6.998  42.867 39.148  1.00 23.02  ?  664  HIS A O      1 
ATOM   3323 C  CB     . HIS C 3 368 ? -4.945  44.871 37.355  1.00 19.11  ?  664  HIS A CB     1 
ATOM   3324 C  CG     . HIS C 3 368 ? -5.921  44.347 36.358  1.00 21.36  ?  664  HIS A CG     1 
ATOM   3325 N  ND1    . HIS C 3 368 ? -7.065  45.030 36.011  1.00 22.37  ?  664  HIS A ND1    1 
ATOM   3326 C  CD2    . HIS C 3 368 ? -5.927  43.205 35.632  1.00 25.18  ?  664  HIS A CD2    1 
ATOM   3327 C  CE1    . HIS C 3 368 ? -7.734  44.333 35.111  1.00 26.13  ?  664  HIS A CE1    1 
ATOM   3328 N  NE2    . HIS C 3 368 ? -7.065  43.220 34.865  1.00 23.96  ?  664  HIS A NE2    1 
ATOM   3329 N  N      . ILE C 3 369 ? -4.899  42.128 38.827  1.00 15.59  ?  665  ILE A N      1 
ATOM   3330 C  CA     . ILE C 3 369 ? -5.315  40.729 38.853  1.00 17.00  ?  665  ILE A CA     1 
ATOM   3331 C  C      . ILE C 3 369 ? -5.817  40.336 40.237  1.00 27.94  ?  665  ILE A C      1 
ATOM   3332 O  O      . ILE C 3 369 ? -6.805  39.604 40.369  1.00 22.05  ?  665  ILE A O      1 
ATOM   3333 C  CB     . ILE C 3 369 ? -4.159  39.830 38.394  1.00 23.36  ?  665  ILE A CB     1 
ATOM   3334 C  CG1    . ILE C 3 369 ? -3.865  40.076 36.916  1.00 23.28  ?  665  ILE A CG1    1 
ATOM   3335 C  CG2    . ILE C 3 369 ? -4.499  38.376 38.636  1.00 40.81  ?  665  ILE A CG2    1 
ATOM   3336 C  CD1    . ILE C 3 369 ? -2.713  39.257 36.387  1.00 40.42  ?  665  ILE A CD1    1 
ATOM   3337 N  N      . ALA C 3 370 ? -5.149  40.806 41.290  1.00 28.06  ?  666  ALA A N      1 
ATOM   3338 C  CA     . ALA C 3 370 ? -5.573  40.462 42.638  1.00 32.98  ?  666  ALA A CA     1 
ATOM   3339 C  C      . ALA C 3 370 ? -6.741  41.313 43.110  1.00 32.68  ?  666  ALA A C      1 
ATOM   3340 O  O      . ALA C 3 370 ? -7.410  40.935 44.077  1.00 30.86  ?  666  ALA A O      1 
ATOM   3341 C  CB     . ALA C 3 370 ? -4.398  40.596 43.611  1.00 20.10  ?  666  ALA A CB     1 
ATOM   3342 N  N      . GLU C 3 371 ? -7.013  42.435 42.441  1.00 24.80  ?  667  GLU A N      1 
ATOM   3343 C  CA     . GLU C 3 371 ? -8.044  43.376 42.878  1.00 26.85  ?  667  GLU A CA     1 
ATOM   3344 C  C      . GLU C 3 371 ? -7.890  43.672 44.364  1.00 28.92  ?  667  GLU A C      1 
ATOM   3345 O  O      . GLU C 3 371 ? -8.857  43.701 45.132  1.00 27.39  ?  667  GLU A O      1 
ATOM   3346 C  CB     . GLU C 3 371 ? -9.443  42.861 42.550  1.00 31.51  ?  667  GLU A CB     1 
ATOM   3347 C  CG     . GLU C 3 371 ? -9.723  42.808 41.055  1.00 33.78  ?  667  GLU A CG     1 
ATOM   3348 C  CD     . GLU C 3 371 ? -11.091 42.237 40.734  1.00 52.92  ?  667  GLU A CD     1 
ATOM   3349 O  OE1    . GLU C 3 371 ? -11.200 41.002 40.576  1.00 61.06  ?  667  GLU A OE1    1 
ATOM   3350 O  OE2    . GLU C 3 371 ? -12.058 43.023 40.645  1.00 56.75  ?  667  GLU A OE2    1 
ATOM   3351 N  N      . ASP C 3 372 ? -6.645  43.874 44.771  1.00 22.95  ?  668  ASP A N      1 
ATOM   3352 C  CA     . ASP C 3 372 ? -6.332  44.233 46.143  1.00 24.26  ?  668  ASP A CA     1 
ATOM   3353 C  C      . ASP C 3 372 ? -6.561  45.730 46.319  1.00 30.58  ?  668  ASP A C      1 
ATOM   3354 O  O      . ASP C 3 372 ? -5.889  46.545 45.677  1.00 20.48  ?  668  ASP A O      1 
ATOM   3355 C  CB     . ASP C 3 372 ? -4.893  43.841 46.462  1.00 25.37  ?  668  ASP A CB     1 
ATOM   3356 C  CG     . ASP C 3 372 ? -4.499  44.192 47.870  1.00 31.36  ?  668  ASP A CG     1 
ATOM   3357 O  OD1    . ASP C 3 372 ? -4.281  45.390 48.140  1.00 31.35  ?  668  ASP A OD1    1 
ATOM   3358 O  OD2    . ASP C 3 372 ? -4.423  43.272 48.708  1.00 34.51  ?  668  ASP A OD2    1 
ATOM   3359 N  N      . ASP C 3 373 ? -7.533  46.086 47.161  1.00 29.53  ?  669  ASP A N      1 
ATOM   3360 C  CA     . ASP C 3 373 ? -7.907  47.489 47.315  1.00 31.97  ?  669  ASP A CA     1 
ATOM   3361 C  C      . ASP C 3 373 ? -6.709  48.334 47.719  1.00 28.79  ?  669  ASP A C      1 
ATOM   3362 O  O      . ASP C 3 373 ? -6.465  49.401 47.145  1.00 28.62  ?  669  ASP A O      1 
ATOM   3363 C  CB     . ASP C 3 373 ? -9.027  47.626 48.344  1.00 35.35  ?  669  ASP A CB     1 
ATOM   3364 C  CG     . ASP C 3 373 ? -10.267 46.834 47.971  1.00 45.04  ?  669  ASP A CG     1 
ATOM   3365 O  OD1    . ASP C 3 373 ? -10.442 46.522 46.773  1.00 47.66  ?  669  ASP A OD1    1 
ATOM   3366 O  OD2    . ASP C 3 373 ? -11.074 46.533 48.878  1.00 48.11  ?  669  ASP A OD2    1 
ATOM   3367 N  N      . ASN C 3 374 ? -5.941  47.864 48.704  1.00 24.28  ?  670  ASN A N      1 
ATOM   3368 C  CA     . ASN C 3 374 ? -4.801  48.635 49.184  1.00 30.53  ?  670  ASN A CA     1 
ATOM   3369 C  C      . ASN C 3 374 ? -3.770  48.840 48.081  1.00 25.84  ?  670  ASN A C      1 
ATOM   3370 O  O      . ASN C 3 374 ? -3.219  49.937 47.930  1.00 20.06  ?  670  ASN A O      1 
ATOM   3371 C  CB     . ASN C 3 374 ? -4.171  47.940 50.391  1.00 31.29  ?  670  ASN A CB     1 
ATOM   3372 C  CG     . ASN C 3 374 ? -3.561  48.918 51.374  1.00 61.93  ?  670  ASN A CG     1 
ATOM   3373 O  OD1    . ASN C 3 374 ? -4.020  50.054 51.501  1.00 73.00  ?  670  ASN A OD1    1 
ATOM   3374 N  ND2    . ASN C 3 374 ? -2.522  48.483 52.078  1.00 70.74  ?  670  ASN A ND2    1 
ATOM   3375 N  N      . LEU C 3 375 ? -3.499  47.797 47.294  1.00 23.56  ?  671  LEU A N      1 
ATOM   3376 C  CA     . LEU C 3 375 ? -2.510  47.927 46.230  1.00 20.72  ?  671  LEU A CA     1 
ATOM   3377 C  C      . LEU C 3 375 ? -3.038  48.779 45.081  1.00 17.98  ?  671  LEU A C      1 
ATOM   3378 O  O      . LEU C 3 375 ? -2.290  49.573 44.501  1.00 23.06  ?  671  LEU A O      1 
ATOM   3379 C  CB     . LEU C 3 375 ? -2.090  46.548 45.726  1.00 21.13  ?  671  LEU A CB     1 
ATOM   3380 C  CG     . LEU C 3 375 ? -0.819  46.485 44.879  1.00 23.82  ?  671  LEU A CG     1 
ATOM   3381 C  CD1    . LEU C 3 375 ? 0.324   47.221 45.563  1.00 28.65  ?  671  LEU A CD1    1 
ATOM   3382 C  CD2    . LEU C 3 375 ? -0.444  45.034 44.643  1.00 30.94  ?  671  LEU A CD2    1 
ATOM   3383 N  N      . MET C 3 376 ? -4.314  48.618 44.716  1.00 19.25  ?  672  MET A N      1 
ATOM   3384 C  CA     . MET C 3 376 ? -4.860  49.443 43.641  1.00 19.81  ?  672  MET A CA     1 
ATOM   3385 C  C      . MET C 3 376 ? -4.879  50.911 44.036  1.00 21.52  ?  672  MET A C      1 
ATOM   3386 O  O      . MET C 3 376 ? -4.575  51.787 43.217  1.00 20.96  ?  672  MET A O      1 
ATOM   3387 C  CB     . MET C 3 376 ? -6.269  48.987 43.264  1.00 18.62  ?  672  MET A CB     1 
ATOM   3388 C  CG     . MET C 3 376 ? -6.352  47.579 42.693  1.00 25.49  ?  672  MET A CG     1 
ATOM   3389 S  SD     . MET C 3 376 ? -8.020  47.218 42.104  1.00 34.97  ?  672  MET A SD     1 
ATOM   3390 C  CE     . MET C 3 376 ? -8.946  47.247 43.632  1.00 41.01  ?  672  MET A CE     1 
ATOM   3391 N  N      . GLU C 3 377 ? -5.242  51.199 45.288  1.00 24.41  ?  673  GLU A N      1 
ATOM   3392 C  CA     . GLU C 3 377 ? -5.296  52.581 45.750  1.00 26.19  ?  673  GLU A CA     1 
ATOM   3393 C  C      . GLU C 3 377 ? -3.907  53.206 45.775  1.00 22.55  ?  673  GLU A C      1 
ATOM   3394 O  O      . GLU C 3 377 ? -3.743  54.388 45.443  1.00 22.37  ?  673  GLU A O      1 
ATOM   3395 C  CB     . GLU C 3 377 ? -5.947  52.645 47.136  1.00 26.64  ?  673  GLU A CB     1 
ATOM   3396 C  CG     . GLU C 3 377 ? -5.986  54.041 47.772  1.00 32.81  ?  673  GLU A CG     1 
ATOM   3397 C  CD     . GLU C 3 377 ? -7.013  54.973 47.132  1.00 40.80  ?  673  GLU A CD     1 
ATOM   3398 O  OE1    . GLU C 3 377 ? -7.714  54.551 46.187  1.00 39.80  ?  673  GLU A OE1    1 
ATOM   3399 O  OE2    . GLU C 3 377 ? -7.120  56.136 47.580  1.00 31.88  ?  673  GLU A OE2    1 
ATOM   3400 N  N      . ALA C 3 378 ? -2.893  52.437 46.168  1.00 23.12  ?  674  ALA A N      1 
ATOM   3401 C  CA     . ALA C 3 378 ? -1.539  52.973 46.149  1.00 22.17  ?  674  ALA A CA     1 
ATOM   3402 C  C      . ALA C 3 378 ? -1.161  53.451 44.752  1.00 24.63  ?  674  ALA A C      1 
ATOM   3403 O  O      . ALA C 3 378 ? -0.566  54.523 44.598  1.00 24.23  ?  674  ALA A O      1 
ATOM   3404 C  CB     . ALA C 3 378 ? -0.547  51.928 46.658  1.00 24.06  ?  674  ALA A CB     1 
ATOM   3405 N  N      . PHE C 3 379 ? -1.515  52.684 43.715  1.00 16.41  ?  675  PHE A N      1 
ATOM   3406 C  CA     . PHE C 3 379 ? -1.173  53.099 42.357  1.00 21.13  ?  675  PHE A CA     1 
ATOM   3407 C  C      . PHE C 3 379 ? -2.108  54.179 41.829  1.00 22.55  ?  675  PHE A C      1 
ATOM   3408 O  O      . PHE C 3 379 ? -1.675  55.041 41.057  1.00 26.67  ?  675  PHE A O      1 
ATOM   3409 C  CB     . PHE C 3 379 ? -1.172  51.899 41.408  1.00 18.04  ?  675  PHE A CB     1 
ATOM   3410 C  CG     . PHE C 3 379 ? 0.023   51.010 41.569  1.00 22.18  ?  675  PHE A CG     1 
ATOM   3411 C  CD1    . PHE C 3 379 ? -0.125  49.687 41.945  1.00 21.16  ?  675  PHE A CD1    1 
ATOM   3412 C  CD2    . PHE C 3 379 ? 1.300   51.507 41.367  1.00 13.86  ?  675  PHE A CD2    1 
ATOM   3413 C  CE1    . PHE C 3 379 ? 0.971   48.873 42.105  1.00 16.15  ?  675  PHE A CE1    1 
ATOM   3414 C  CE2    . PHE C 3 379 ? 2.409   50.694 41.526  1.00 19.46  ?  675  PHE A CE2    1 
ATOM   3415 C  CZ     . PHE C 3 379 ? 2.243   49.374 41.892  1.00 16.71  ?  675  PHE A CZ     1 
ATOM   3416 N  N      . ARG C 3 380 ? -3.380  54.158 42.226  1.00 20.06  ?  676  ARG A N      1 
ATOM   3417 C  CA     . ARG C 3 380 ? -4.273  55.246 41.842  1.00 28.62  ?  676  ARG A CA     1 
ATOM   3418 C  C      . ARG C 3 380 ? -3.819  56.577 42.427  1.00 26.88  ?  676  ARG A C      1 
ATOM   3419 O  O      . ARG C 3 380 ? -4.014  57.628 41.803  1.00 28.06  ?  676  ARG A O      1 
ATOM   3420 C  CB     . ARG C 3 380 ? -5.700  54.911 42.265  1.00 18.04  ?  676  ARG A CB     1 
ATOM   3421 C  CG     . ARG C 3 380 ? -6.251  53.747 41.469  1.00 25.50  ?  676  ARG A CG     1 
ATOM   3422 C  CD     . ARG C 3 380 ? -7.525  53.187 42.052  1.00 25.29  ?  676  ARG A CD     1 
ATOM   3423 N  NE     . ARG C 3 380 ? -8.138  52.236 41.132  1.00 25.44  ?  676  ARG A NE     1 
ATOM   3424 C  CZ     . ARG C 3 380 ? -9.103  51.389 41.471  1.00 38.76  ?  676  ARG A CZ     1 
ATOM   3425 N  NH1    . ARG C 3 380 ? -9.554  51.368 42.716  1.00 37.21  ?  676  ARG A NH1    1 
ATOM   3426 N  NH2    . ARG C 3 380 ? -9.610  50.561 40.569  1.00 35.67  ?  676  ARG A NH2    1 
ATOM   3427 N  N      . ARG C 3 381 ? -3.196  56.560 43.603  1.00 17.63  ?  677  ARG A N      1 
ATOM   3428 C  CA     . ARG C 3 381 ? -2.618  57.769 44.173  1.00 21.47  ?  677  ARG A CA     1 
ATOM   3429 C  C      . ARG C 3 381 ? -1.212  58.032 43.659  1.00 14.12  ?  677  ARG A C      1 
ATOM   3430 O  O      . ARG C 3 381 ? -0.577  58.993 44.101  1.00 25.07  ?  677  ARG A O      1 
ATOM   3431 C  CB     . ARG C 3 381 ? -2.588  57.684 45.701  1.00 21.40  ?  677  ARG A CB     1 
ATOM   3432 C  CG     . ARG C 3 381 ? -3.931  57.452 46.347  1.00 24.15  ?  677  ARG A CG     1 
ATOM   3433 C  CD     . ARG C 3 381 ? -3.752  57.088 47.811  1.00 30.16  ?  677  ARG A CD     1 
ATOM   3434 N  NE     . ARG C 3 381 ? -2.948  58.086 48.511  1.00 42.29  ?  677  ARG A NE     1 
ATOM   3435 C  CZ     . ARG C 3 381 ? -2.511  57.958 49.760  1.00 44.51  ?  677  ARG A CZ     1 
ATOM   3436 N  NH1    . ARG C 3 381 ? -2.793  56.866 50.459  1.00 33.24  ?  677  ARG A NH1    1 
ATOM   3437 N  NH2    . ARG C 3 381 ? -1.787  58.925 50.309  1.00 39.53  ?  677  ARG A NH2    1 
ATOM   3438 N  N      . ASP C 3 382 ? -0.715  57.193 42.756  1.00 18.98  ?  678  ASP A N      1 
ATOM   3439 C  CA     . ASP C 3 382 ? 0.647   57.278 42.231  1.00 23.10  ?  678  ASP A CA     1 
ATOM   3440 C  C      . ASP C 3 382 ? 1.668   57.410 43.361  1.00 35.41  ?  678  ASP A C      1 
ATOM   3441 O  O      . ASP C 3 382 ? 2.594   58.224 43.309  1.00 27.58  ?  678  ASP A O      1 
ATOM   3442 C  CB     . ASP C 3 382 ? 0.785   58.429 41.231  1.00 30.17  ?  678  ASP A CB     1 
ATOM   3443 C  CG     . ASP C 3 382 ? 1.965   58.244 40.291  1.00 41.81  ?  678  ASP A CG     1 
ATOM   3444 O  OD1    . ASP C 3 382 ? 2.409   57.088 40.104  1.00 46.93  ?  678  ASP A OD1    1 
ATOM   3445 O  OD2    . ASP C 3 382 ? 2.453   59.251 39.741  1.00 48.49  ?  678  ASP A OD2    1 
ATOM   3446 N  N      . LEU C 3 383 ? 1.497   56.587 44.393  1.00 39.29  ?  679  LEU A N      1 
ATOM   3447 C  CA     . LEU C 3 383 ? 2.425   56.580 45.513  1.00 30.93  ?  679  LEU A CA     1 
ATOM   3448 C  C      . LEU C 3 383 ? 3.738   55.909 45.122  1.00 27.68  ?  679  LEU A C      1 
ATOM   3449 O  O      . LEU C 3 383 ? 3.844   55.239 44.094  1.00 24.77  ?  679  LEU A O      1 
ATOM   3450 C  CB     . LEU C 3 383 ? 1.815   55.853 46.710  1.00 29.40  ?  679  LEU A CB     1 
ATOM   3451 C  CG     . LEU C 3 383 ? 0.476   56.388 47.201  1.00 36.23  ?  679  LEU A CG     1 
ATOM   3452 C  CD1    . LEU C 3 383 ? -0.048  55.520 48.332  1.00 37.39  ?  679  LEU A CD1    1 
ATOM   3453 C  CD2    . LEU C 3 383 ? 0.616   57.839 47.645  1.00 36.96  ?  679  LEU A CD2    1 
ATOM   3454 N  N      . ASP C 3 384 ? 4.757   56.108 45.955  1.00 21.45  ?  680  ASP A N      1 
ATOM   3455 C  CA     . ASP C 3 384 ? 5.971   55.308 45.849  1.00 27.62  ?  680  ASP A CA     1 
ATOM   3456 C  C      . ASP C 3 384 ? 5.659   53.953 46.466  1.00 14.31  ?  680  ASP A C      1 
ATOM   3457 O  O      . ASP C 3 384 ? 5.449   53.852 47.678  1.00 19.67  ?  680  ASP A O      1 
ATOM   3458 C  CB     . ASP C 3 384 ? 7.144   55.983 46.551  1.00 37.66  ?  680  ASP A CB     1 
ATOM   3459 C  CG     . ASP C 3 384 ? 8.440   55.213 46.381  1.00 45.34  ?  680  ASP A CG     1 
ATOM   3460 O  OD1    . ASP C 3 384 ? 9.371   55.741 45.737  1.00 54.79  ?  680  ASP A OD1    1 
ATOM   3461 O  OD2    . ASP C 3 384 ? 8.521   54.068 46.874  1.00 46.54  ?  680  ASP A OD2    1 
ATOM   3462 N  N      . ILE C 3 385 ? 5.596   52.914 45.634  1.00 17.84  ?  681  ILE A N      1 
ATOM   3463 C  CA     . ILE C 3 385 ? 5.040   51.649 46.104  1.00 18.04  ?  681  ILE A CA     1 
ATOM   3464 C  C      . ILE C 3 385 ? 5.908   51.057 47.207  1.00 23.29  ?  681  ILE A C      1 
ATOM   3465 O  O      . ILE C 3 385 ? 5.399   50.539 48.208  1.00 27.68  ?  681  ILE A O      1 
ATOM   3466 C  CB     . ILE C 3 385 ? 4.855   50.670 44.930  1.00 22.33  ?  681  ILE A CB     1 
ATOM   3467 C  CG1    . ILE C 3 385 ? 4.070   49.438 45.385  1.00 33.69  ?  681  ILE A CG1    1 
ATOM   3468 C  CG2    . ILE C 3 385 ? 6.204   50.251 44.367  1.00 28.11  ?  681  ILE A CG2    1 
ATOM   3469 C  CD1    . ILE C 3 385 ? 2.680   49.752 45.916  1.00 38.12  ?  681  ILE A CD1    1 
ATOM   3470 N  N      . HIS C 3 386 ? 7.230   51.135 47.055  1.00 21.53  ?  682  HIS A N      1 
ATOM   3471 C  CA     . HIS C 3 386 ? 8.111   50.598 48.085  1.00 25.56  ?  682  HIS A CA     1 
ATOM   3472 C  C      . HIS C 3 386 ? 7.927   51.337 49.402  1.00 27.50  ?  682  HIS A C      1 
ATOM   3473 O  O      . HIS C 3 386 ? 7.832   50.711 50.463  1.00 22.46  ?  682  HIS A O      1 
ATOM   3474 C  CB     . HIS C 3 386 ? 9.556   50.657 47.601  1.00 21.84  ?  682  HIS A CB     1 
ATOM   3475 C  CG     . HIS C 3 386 ? 9.781   49.878 46.344  1.00 22.82  ?  682  HIS A CG     1 
ATOM   3476 N  ND1    . HIS C 3 386 ? 9.124   48.694 46.086  1.00 25.37  ?  682  HIS A ND1    1 
ATOM   3477 C  CD2    . HIS C 3 386 ? 10.563  50.117 45.266  1.00 30.34  ?  682  HIS A CD2    1 
ATOM   3478 C  CE1    . HIS C 3 386 ? 9.496   48.233 44.905  1.00 21.48  ?  682  HIS A CE1    1 
ATOM   3479 N  NE2    . HIS C 3 386 ? 10.373  49.076 44.389  1.00 29.21  ?  682  HIS A NE2    1 
ATOM   3480 N  N      . THR C 3 387 ? 7.841   52.667 49.354  1.00 24.41  ?  683  THR A N      1 
ATOM   3481 C  CA     . THR C 3 387 ? 7.610   53.422 50.578  1.00 29.77  ?  683  THR A CA     1 
ATOM   3482 C  C      . THR C 3 387 ? 6.248   53.099 51.174  1.00 27.42  ?  683  THR A C      1 
ATOM   3483 O  O      . THR C 3 387 ? 6.112   52.964 52.396  1.00 25.13  ?  683  THR A O      1 
ATOM   3484 C  CB     . THR C 3 387 ? 7.730   54.918 50.305  1.00 25.70  ?  683  THR A CB     1 
ATOM   3485 O  OG1    . THR C 3 387 ? 9.071   55.216 49.901  1.00 28.69  ?  683  THR A OG1    1 
ATOM   3486 C  CG2    . THR C 3 387 ? 7.389   55.706 51.556  1.00 28.89  ?  683  THR A CG2    1 
ATOM   3487 N  N      . LYS C 3 388 ? 5.223   52.986 50.326  1.00 24.43  ?  684  LYS A N      1 
ATOM   3488 C  CA     . LYS C 3 388 ? 3.903   52.624 50.825  1.00 28.92  ?  684  LYS A CA     1 
ATOM   3489 C  C      . LYS C 3 388 ? 3.906   51.221 51.412  1.00 22.83  ?  684  LYS A C      1 
ATOM   3490 O  O      . LYS C 3 388 ? 3.290   50.978 52.456  1.00 24.24  ?  684  LYS A O      1 
ATOM   3491 C  CB     . LYS C 3 388 ? 2.863   52.731 49.712  1.00 24.60  ?  684  LYS A CB     1 
ATOM   3492 C  CG     . LYS C 3 388 ? 1.453   52.396 50.177  1.00 23.80  ?  684  LYS A CG     1 
ATOM   3493 C  CD     . LYS C 3 388 ? 1.015   53.374 51.261  1.00 39.24  ?  684  LYS A CD     1 
ATOM   3494 C  CE     . LYS C 3 388 ? -0.425  53.146 51.687  1.00 46.50  ?  684  LYS A CE     1 
ATOM   3495 N  NZ     . LYS C 3 388 ? -0.871  54.201 52.643  1.00 50.68  ?  684  LYS A NZ     1 
ATOM   3496 N  N      . THR C 3 389 ? 4.591   50.280 50.756  1.00 18.98  ?  685  THR A N      1 
ATOM   3497 C  CA     . THR C 3 389 ? 4.667   48.931 51.305  1.00 19.25  ?  685  THR A CA     1 
ATOM   3498 C  C      . THR C 3 389 ? 5.331   48.939 52.676  1.00 25.56  ?  685  THR A C      1 
ATOM   3499 O  O      . THR C 3 389 ? 4.904   48.216 53.584  1.00 28.68  ?  685  THR A O      1 
ATOM   3500 C  CB     . THR C 3 389 ? 5.413   48.006 50.342  1.00 18.55  ?  685  THR A CB     1 
ATOM   3501 O  OG1    . THR C 3 389 ? 4.819   48.091 49.042  1.00 24.97  ?  685  THR A OG1    1 
ATOM   3502 C  CG2    . THR C 3 389 ? 5.335   46.568 50.824  1.00 26.43  ?  685  THR A CG2    1 
ATOM   3503 N  N      . ALA C 3 390 ? 6.373   49.756 52.853  1.00 19.20  ?  686  ALA A N      1 
ATOM   3504 C  CA     . ALA C 3 390 ? 7.033   49.826 54.154  1.00 23.76  ?  686  ALA A CA     1 
ATOM   3505 C  C      . ALA C 3 390 ? 6.109   50.415 55.212  1.00 26.65  ?  686  ALA A C      1 
ATOM   3506 O  O      . ALA C 3 390 ? 6.114   49.974 56.369  1.00 25.96  ?  686  ALA A O      1 
ATOM   3507 C  CB     . ALA C 3 390 ? 8.322   50.648 54.060  1.00 22.33  ?  686  ALA A CB     1 
ATOM   3508 N  N      . MET C 3 391 ? 5.332   51.433 54.844  1.00 31.22  ?  687  MET A N      1 
ATOM   3509 C  CA     . MET C 3 391 ? 4.421   52.042 55.807  1.00 33.01  ?  687  MET A CA     1 
ATOM   3510 C  C      . MET C 3 391 ? 3.444   51.015 56.355  1.00 31.81  ?  687  MET A C      1 
ATOM   3511 O  O      . MET C 3 391 ? 3.126   51.024 57.551  1.00 30.18  ?  687  MET A O      1 
ATOM   3512 C  CB     . MET C 3 391 ? 3.668   53.199 55.157  1.00 26.19  ?  687  MET A CB     1 
ATOM   3513 C  CG     . MET C 3 391 ? 4.541   54.390 54.849  1.00 32.30  ?  687  MET A CG     1 
ATOM   3514 S  SD     . MET C 3 391 ? 3.722   55.557 53.755  1.00 38.42  ?  687  MET A SD     1 
ATOM   3515 C  CE     . MET C 3 391 ? 2.140   55.745 54.577  1.00 37.29  ?  687  MET A CE     1 
ATOM   3516 N  N      . ASP C 3 392 ? 2.975   50.109 55.498  1.00 29.54  ?  688  ASP A N      1 
ATOM   3517 C  CA     . ASP C 3 392 ? 1.995   49.115 55.915  1.00 40.30  ?  688  ASP A CA     1 
ATOM   3518 C  C      . ASP C 3 392 ? 2.649   47.972 56.680  1.00 36.81  ?  688  ASP A C      1 
ATOM   3519 O  O      . ASP C 3 392 ? 2.177   47.587 57.755  1.00 38.10  ?  688  ASP A O      1 
ATOM   3520 C  CB     . ASP C 3 392 ? 1.238   48.581 54.697  1.00 37.73  ?  688  ASP A CB     1 
ATOM   3521 C  CG     . ASP C 3 392 ? 0.553   49.681 53.913  1.00 51.64  ?  688  ASP A CG     1 
ATOM   3522 O  OD1    . ASP C 3 392 ? 0.585   49.635 52.665  1.00 56.00  ?  688  ASP A OD1    1 
ATOM   3523 O  OD2    . ASP C 3 392 ? -0.004  50.603 54.546  1.00 50.32  ?  688  ASP A OD2    1 
ATOM   3524 N  N      . ILE C 3 393 ? 3.735   47.417 56.141  1.00 31.59  ?  689  ILE A N      1 
ATOM   3525 C  CA     . ILE C 3 393 ? 4.407   46.306 56.811  1.00 32.81  ?  689  ILE A CA     1 
ATOM   3526 C  C      . ILE C 3 393 ? 4.821   46.704 58.220  1.00 36.15  ?  689  ILE A C      1 
ATOM   3527 O  O      . ILE C 3 393 ? 4.593   45.966 59.186  1.00 35.66  ?  689  ILE A O      1 
ATOM   3528 C  CB     . ILE C 3 393 ? 5.617   45.835 55.988  1.00 32.22  ?  689  ILE A CB     1 
ATOM   3529 C  CG1    . ILE C 3 393 ? 5.162   45.018 54.789  1.00 26.25  ?  689  ILE A CG1    1 
ATOM   3530 C  CG2    . ILE C 3 393 ? 6.552   45.008 56.840  1.00 39.78  ?  689  ILE A CG2    1 
ATOM   3531 C  CD1    . ILE C 3 393 ? 6.313   44.559 53.955  1.00 32.99  ?  689  ILE A CD1    1 
ATOM   3532 N  N      . PHE C 3 394 ? 5.445   47.871 58.358  1.00 30.20  ?  690  PHE A N      1 
ATOM   3533 C  CA     . PHE C 3 394 ? 5.983   48.311 59.637  1.00 36.34  ?  690  PHE A CA     1 
ATOM   3534 C  C      . PHE C 3 394 ? 5.042   49.233 60.397  1.00 34.65  ?  690  PHE A C      1 
ATOM   3535 O  O      . PHE C 3 394 ? 5.370   49.639 61.514  1.00 43.41  ?  690  PHE A O      1 
ATOM   3536 C  CB     . PHE C 3 394 ? 7.336   49.000 59.431  1.00 25.14  ?  690  PHE A CB     1 
ATOM   3537 C  CG     . PHE C 3 394 ? 8.336   48.155 58.693  1.00 27.18  ?  690  PHE A CG     1 
ATOM   3538 C  CD1    . PHE C 3 394 ? 8.922   47.057 59.305  1.00 36.29  ?  690  PHE A CD1    1 
ATOM   3539 C  CD2    . PHE C 3 394 ? 8.694   48.458 57.391  1.00 29.69  ?  690  PHE A CD2    1 
ATOM   3540 C  CE1    . PHE C 3 394 ? 9.838   46.276 58.629  1.00 34.43  ?  690  PHE A CE1    1 
ATOM   3541 C  CE2    . PHE C 3 394 ? 9.612   47.681 56.711  1.00 32.36  ?  690  PHE A CE2    1 
ATOM   3542 C  CZ     . PHE C 3 394 ? 10.184  46.589 57.331  1.00 40.68  ?  690  PHE A CZ     1 
ATOM   3543 N  N      . GLN C 3 395 ? 3.885   49.566 59.832  1.00 39.82  ?  691  GLN A N      1 
ATOM   3544 C  CA     . GLN C 3 395 ? 2.876   50.354 60.533  1.00 43.26  ?  691  GLN A CA     1 
ATOM   3545 C  C      . GLN C 3 395 ? 3.480   51.660 61.047  1.00 40.49  ?  691  GLN A C      1 
ATOM   3546 O  O      . GLN C 3 395 ? 3.483   51.960 62.243  1.00 42.16  ?  691  GLN A O      1 
ATOM   3547 C  CB     . GLN C 3 395 ? 2.254   49.542 61.675  1.00 46.60  ?  691  GLN A CB     1 
ATOM   3548 C  CG     . GLN C 3 395 ? 1.706   48.180 61.249  1.00 55.68  ?  691  GLN A CG     1 
ATOM   3549 C  CD     . GLN C 3 395 ? 1.837   47.129 62.341  1.00 73.98  ?  691  GLN A CD     1 
ATOM   3550 O  OE1    . GLN C 3 395 ? 2.285   47.422 63.450  1.00 77.79  ?  691  GLN A OE1    1 
ATOM   3551 N  NE2    . GLN C 3 395 ? 1.452   45.895 62.028  1.00 76.29  ?  691  GLN A NE2    1 
ATOM   3552 N  N      . VAL C 3 396 ? 4.030   52.430 60.110  1.00 34.74  ?  692  VAL A N      1 
ATOM   3553 C  CA     . VAL C 3 396 ? 4.619   53.726 60.414  1.00 38.21  ?  692  VAL A CA     1 
ATOM   3554 C  C      . VAL C 3 396 ? 4.149   54.718 59.362  1.00 32.72  ?  692  VAL A C      1 
ATOM   3555 O  O      . VAL C 3 396 ? 3.715   54.345 58.271  1.00 39.97  ?  692  VAL A O      1 
ATOM   3556 C  CB     . VAL C 3 396 ? 6.164   53.677 60.467  1.00 40.67  ?  692  VAL A CB     1 
ATOM   3557 C  CG1    . VAL C 3 396 ? 6.625   52.589 61.428  1.00 38.76  ?  692  VAL A CG1    1 
ATOM   3558 C  CG2    . VAL C 3 396 ? 6.744   53.467 59.076  1.00 35.20  ?  692  VAL A CG2    1 
ATOM   3559 N  N      . SER C 3 397 ? 4.225   55.998 59.712  1.00 33.16  ?  693  SER A N      1 
ATOM   3560 C  CA     . SER C 3 397 ? 3.862   57.039 58.769  1.00 35.24  ?  693  SER A CA     1 
ATOM   3561 C  C      . SER C 3 397 ? 4.968   57.204 57.733  1.00 37.07  ?  693  SER A C      1 
ATOM   3562 O  O      . SER C 3 397 ? 6.087   56.710 57.893  1.00 40.78  ?  693  SER A O      1 
ATOM   3563 C  CB     . SER C 3 397 ? 3.617   58.358 59.494  1.00 46.77  ?  693  SER A CB     1 
ATOM   3564 O  OG     . SER C 3 397 ? 4.843   58.912 59.931  1.00 49.68  ?  693  SER A OG     1 
ATOM   3565 N  N      . GLU C 3 398 ? 4.646   57.921 56.656  1.00 39.37  ?  694  GLU A N      1 
ATOM   3566 C  CA     . GLU C 3 398 ? 5.619   58.091 55.584  1.00 38.63  ?  694  GLU A CA     1 
ATOM   3567 C  C      . GLU C 3 398 ? 6.917   58.706 56.092  1.00 44.58  ?  694  GLU A C      1 
ATOM   3568 O  O      . GLU C 3 398 ? 7.998   58.368 55.595  1.00 44.83  ?  694  GLU A O      1 
ATOM   3569 C  CB     . GLU C 3 398 ? 5.021   58.943 54.465  1.00 46.11  ?  694  GLU A CB     1 
ATOM   3570 C  CG     . GLU C 3 398 ? 5.908   59.055 53.237  1.00 42.07  ?  694  GLU A CG     1 
ATOM   3571 C  CD     . GLU C 3 398 ? 5.268   59.868 52.128  1.00 49.43  ?  694  GLU A CD     1 
ATOM   3572 O  OE1    . GLU C 3 398 ? 5.981   60.232 51.169  1.00 48.92  ?  694  GLU A OE1    1 
ATOM   3573 O  OE2    . GLU C 3 398 ? 4.052   60.143 52.215  1.00 51.25  ?  694  GLU A OE2    1 
ATOM   3574 N  N      . ASP C 3 399 ? 6.837   59.592 57.087  1.00 46.26  ?  695  ASP A N      1 
ATOM   3575 C  CA     . ASP C 3 399 ? 8.022   60.258 57.612  1.00 51.07  ?  695  ASP A CA     1 
ATOM   3576 C  C      . ASP C 3 399 ? 8.871   59.353 58.496  1.00 49.08  ?  695  ASP A C      1 
ATOM   3577 O  O      . ASP C 3 399 ? 10.040  59.670 58.745  1.00 41.60  ?  695  ASP A O      1 
ATOM   3578 C  CB     . ASP C 3 399 ? 7.613   61.508 58.396  1.00 65.60  ?  695  ASP A CB     1 
ATOM   3579 C  CG     . ASP C 3 399 ? 6.753   62.454 57.578  1.00 80.71  ?  695  ASP A CG     1 
ATOM   3580 O  OD1    . ASP C 3 399 ? 6.969   62.544 56.352  1.00 84.06  ?  695  ASP A OD1    1 
ATOM   3581 O  OD2    . ASP C 3 399 ? 5.860   63.105 58.159  1.00 83.66  ?  695  ASP A OD2    1 
ATOM   3582 N  N      . GLU C 3 400 ? 8.315   58.248 58.982  1.00 46.46  ?  696  GLU A N      1 
ATOM   3583 C  CA     . GLU C 3 400 ? 9.062   57.308 59.804  1.00 42.24  ?  696  GLU A CA     1 
ATOM   3584 C  C      . GLU C 3 400 ? 9.703   56.190 58.992  1.00 43.05  ?  696  GLU A C      1 
ATOM   3585 O  O      . GLU C 3 400 ? 10.315  55.293 59.579  1.00 35.07  ?  696  GLU A O      1 
ATOM   3586 C  CB     . GLU C 3 400 ? 8.152   56.698 60.878  1.00 40.71  ?  696  GLU A CB     1 
ATOM   3587 C  CG     . GLU C 3 400 ? 7.362   57.710 61.689  1.00 53.35  ?  696  GLU A CG     1 
ATOM   3588 C  CD     . GLU C 3 400 ? 6.492   57.055 62.750  1.00 68.81  ?  696  GLU A CD     1 
ATOM   3589 O  OE1    . GLU C 3 400 ? 6.978   56.866 63.885  1.00 75.43  ?  696  GLU A OE1    1 
ATOM   3590 O  OE2    . GLU C 3 400 ? 5.329   56.716 62.444  1.00 69.77  ?  696  GLU A OE2    1 
ATOM   3591 N  N      . VAL C 3 401 ? 9.575   56.206 57.668  1.00 33.26  ?  697  VAL A N      1 
ATOM   3592 C  CA     . VAL C 3 401 ? 10.151  55.148 56.843  1.00 28.98  ?  697  VAL A CA     1 
ATOM   3593 C  C      . VAL C 3 401 ? 11.636  55.443 56.671  1.00 32.99  ?  697  VAL A C      1 
ATOM   3594 O  O      . VAL C 3 401 ? 12.015  56.450 56.070  1.00 28.55  ?  697  VAL A O      1 
ATOM   3595 C  CB     . VAL C 3 401 ? 9.445   55.033 55.489  1.00 30.93  ?  697  VAL A CB     1 
ATOM   3596 C  CG1    . VAL C 3 401 ? 10.147  54.001 54.616  1.00 35.62  ?  697  VAL A CG1    1 
ATOM   3597 C  CG2    . VAL C 3 401 ? 7.992   54.639 55.691  1.00 34.82  ?  697  VAL A CG2    1 
ATOM   3598 N  N      . THR C 3 402 ? 12.479  54.581 57.214  1.00 27.27  ?  698  THR A N      1 
ATOM   3599 C  CA     . THR C 3 402 ? 13.903  54.783 57.051  1.00 26.22  ?  698  THR A CA     1 
ATOM   3600 C  C      . THR C 3 402 ? 14.370  54.173 55.738  1.00 24.98  ?  698  THR A C      1 
ATOM   3601 O  O      . THR C 3 402 ? 13.673  53.354 55.136  1.00 25.68  ?  698  THR A O      1 
ATOM   3602 C  CB     . THR C 3 402 ? 14.664  54.175 58.226  1.00 35.25  ?  698  THR A CB     1 
ATOM   3603 O  OG1    . THR C 3 402 ? 14.315  52.792 58.364  1.00 34.65  ?  698  THR A OG1    1 
ATOM   3604 C  CG2    . THR C 3 402 ? 14.323  54.913 59.509  1.00 29.17  ?  698  THR A CG2    1 
ATOM   3605 N  N      . PRO C 3 403 ? 15.538  54.583 55.253  1.00 25.27  ?  699  PRO A N      1 
ATOM   3606 C  CA     . PRO C 3 403 ? 16.075  53.962 54.034  1.00 24.27  ?  699  PRO A CA     1 
ATOM   3607 C  C      . PRO C 3 403 ? 16.168  52.446 54.118  1.00 24.09  ?  699  PRO A C      1 
ATOM   3608 O  O      . PRO C 3 403 ? 15.916  51.765 53.115  1.00 22.89  ?  699  PRO A O      1 
ATOM   3609 C  CB     . PRO C 3 403 ? 17.451  54.620 53.892  1.00 25.17  ?  699  PRO A CB     1 
ATOM   3610 C  CG     . PRO C 3 403 ? 17.298  55.948 54.562  1.00 34.86  ?  699  PRO A CG     1 
ATOM   3611 C  CD     . PRO C 3 403 ? 16.339  55.737 55.699  1.00 26.51  ?  699  PRO A CD     1 
ATOM   3612 N  N      . ASN C 3 404 ? 16.505  51.891 55.288  1.00 32.52  ?  700  ASN A N      1 
ATOM   3613 C  CA     . ASN C 3 404 ? 16.591  50.438 55.409  1.00 31.43  ?  700  ASN A CA     1 
ATOM   3614 C  C      . ASN C 3 404 ? 15.209  49.799 55.399  1.00 24.41  ?  700  ASN A C      1 
ATOM   3615 O  O      . ASN C 3 404 ? 15.036  48.692 54.876  1.00 24.29  ?  700  ASN A O      1 
ATOM   3616 C  CB     . ASN C 3 404 ? 17.342  50.038 56.679  1.00 29.49  ?  700  ASN A CB     1 
ATOM   3617 C  CG     . ASN C 3 404 ? 17.761  48.578 56.664  1.00 28.53  ?  700  ASN A CG     1 
ATOM   3618 O  OD1    . ASN C 3 404 ? 18.134  48.047 55.619  1.00 26.82  ?  700  ASN A OD1    1 
ATOM   3619 N  ND2    . ASN C 3 404 ? 17.689  47.918 57.815  1.00 33.75  ?  700  ASN A ND2    1 
ATOM   3620 N  N      . MET C 3 405 ? 14.218  50.461 55.998  1.00 26.74  ?  701  MET A N      1 
ATOM   3621 C  CA     . MET C 3 405 ? 12.851  49.956 55.916  1.00 25.77  ?  701  MET A CA     1 
ATOM   3622 C  C      . MET C 3 405 ? 12.370  49.925 54.475  1.00 23.57  ?  701  MET A C      1 
ATOM   3623 O  O      . MET C 3 405 ? 11.720  48.964 54.046  1.00 23.89  ?  701  MET A O      1 
ATOM   3624 C  CB     . MET C 3 405 ? 11.912  50.814 56.760  1.00 30.04  ?  701  MET A CB     1 
ATOM   3625 C  CG     . MET C 3 405 ? 12.000  50.570 58.250  1.00 37.79  ?  701  MET A CG     1 
ATOM   3626 S  SD     . MET C 3 405 ? 11.075  51.814 59.175  1.00 35.69  ?  701  MET A SD     1 
ATOM   3627 C  CE     . MET C 3 405 ? 9.513   51.796 58.308  1.00 32.34  ?  701  MET A CE     1 
ATOM   3628 N  N      . ARG C 3 406 ? 12.660  50.977 53.714  1.00 21.55  ?  702  ARG A N      1 
ATOM   3629 C  CA     . ARG C 3 406 ? 12.246  50.972 52.319  1.00 20.10  ?  702  ARG A CA     1 
ATOM   3630 C  C      . ARG C 3 406 ? 13.001  49.911 51.532  1.00 19.66  ?  702  ARG A C      1 
ATOM   3631 O  O      . ARG C 3 406 ? 12.438  49.287 50.628  1.00 18.89  ?  702  ARG A O      1 
ATOM   3632 C  CB     . ARG C 3 406 ? 12.449  52.348 51.695  1.00 19.89  ?  702  ARG A CB     1 
ATOM   3633 C  CG     . ARG C 3 406 ? 11.842  52.455 50.301  1.00 18.61  ?  702  ARG A CG     1 
ATOM   3634 C  CD     . ARG C 3 406 ? 12.241  53.753 49.627  1.00 29.03  ?  702  ARG A CD     1 
ATOM   3635 N  NE     . ARG C 3 406 ? 11.645  53.869 48.301  1.00 30.48  ?  702  ARG A NE     1 
ATOM   3636 C  CZ     . ARG C 3 406 ? 12.204  53.407 47.188  1.00 29.20  ?  702  ARG A CZ     1 
ATOM   3637 N  NH1    . ARG C 3 406 ? 13.377  52.793 47.237  1.00 29.48  ?  702  ARG A NH1    1 
ATOM   3638 N  NH2    . ARG C 3 406 ? 11.588  53.561 46.024  1.00 30.58  ?  702  ARG A NH2    1 
ATOM   3639 N  N      . ARG C 3 407 ? 14.272  49.678 51.873  1.00 20.96  ?  703  ARG A N      1 
ATOM   3640 C  CA     . ARG C 3 407 ? 15.041  48.653 51.174  1.00 26.81  ?  703  ARG A CA     1 
ATOM   3641 C  C      . ARG C 3 407 ? 14.475  47.263 51.434  1.00 28.59  ?  703  ARG A C      1 
ATOM   3642 O  O      . ARG C 3 407 ? 14.506  46.394 50.554  1.00 21.10  ?  703  ARG A O      1 
ATOM   3643 C  CB     . ARG C 3 407 ? 16.511  48.714 51.588  1.00 38.78  ?  703  ARG A CB     1 
ATOM   3644 C  CG     . ARG C 3 407 ? 17.388  47.680 50.890  1.00 32.38  ?  703  ARG A CG     1 
ATOM   3645 C  CD     . ARG C 3 407 ? 18.776  47.614 51.509  1.00 32.45  ?  703  ARG A CD     1 
ATOM   3646 N  NE     . ARG C 3 407 ? 18.744  47.136 52.889  1.00 48.37  ?  703  ARG A NE     1 
ATOM   3647 C  CZ     . ARG C 3 407 ? 18.770  45.853 53.241  1.00 47.06  ?  703  ARG A CZ     1 
ATOM   3648 N  NH1    . ARG C 3 407 ? 18.828  44.908 52.313  1.00 46.46  ?  703  ARG A NH1    1 
ATOM   3649 N  NH2    . ARG C 3 407 ? 18.735  45.515 54.521  1.00 45.16  ?  703  ARG A NH2    1 
ATOM   3650 N  N      . GLN C 3 408 ? 13.955  47.031 52.637  1.00 25.84  ?  704  GLN A N      1 
ATOM   3651 C  CA     . GLN C 3 408 ? 13.382  45.731 52.947  1.00 23.88  ?  704  GLN A CA     1 
ATOM   3652 C  C      . GLN C 3 408 ? 11.989  45.585 52.347  1.00 25.32  ?  704  GLN A C      1 
ATOM   3653 O  O      . GLN C 3 408 ? 11.621  44.499 51.888  1.00 25.94  ?  704  GLN A O      1 
ATOM   3654 C  CB     . GLN C 3 408 ? 13.366  45.527 54.459  1.00 24.03  ?  704  GLN A CB     1 
ATOM   3655 C  CG     . GLN C 3 408 ? 14.769  45.446 55.034  1.00 35.31  ?  704  GLN A CG     1 
ATOM   3656 C  CD     . GLN C 3 408 ? 14.807  44.803 56.396  1.00 50.83  ?  704  GLN A CD     1 
ATOM   3657 O  OE1    . GLN C 3 408 ? 15.669  43.970 56.678  1.00 61.13  ?  704  GLN A OE1    1 
ATOM   3658 N  NE2    . GLN C 3 408 ? 13.867  45.180 57.251  1.00 50.60  ?  704  GLN A NE2    1 
ATOM   3659 N  N      . ALA C 3 409 ? 11.212  46.670 52.324  1.00 22.23  ?  705  ALA A N      1 
ATOM   3660 C  CA     . ALA C 3 409 ? 9.931   46.640 51.622  1.00 24.58  ?  705  ALA A CA     1 
ATOM   3661 C  C      . ALA C 3 409 ? 10.131  46.390 50.133  1.00 29.59  ?  705  ALA A C      1 
ATOM   3662 O  O      . ALA C 3 409 ? 9.333   45.692 49.494  1.00 20.08  ?  705  ALA A O      1 
ATOM   3663 C  CB     . ALA C 3 409 ? 9.176   47.950 51.850  1.00 19.72  ?  705  ALA A CB     1 
ATOM   3664 N  N      . LYS C 3 410 ? 11.198  46.955 49.566  1.00 24.79  ?  706  LYS A N      1 
ATOM   3665 C  CA     . LYS C 3 410 ? 11.487  46.767 48.151  1.00 23.00  ?  706  LYS A CA     1 
ATOM   3666 C  C      . LYS C 3 410 ? 11.865  45.322 47.852  1.00 26.29  ?  706  LYS A C      1 
ATOM   3667 O  O      . LYS C 3 410 ? 11.525  44.791 46.788  1.00 26.30  ?  706  LYS A O      1 
ATOM   3668 C  CB     . LYS C 3 410 ? 12.604  47.722 47.729  1.00 18.46  ?  706  LYS A CB     1 
ATOM   3669 C  CG     . LYS C 3 410 ? 13.021  47.605 46.273  1.00 25.27  ?  706  LYS A CG     1 
ATOM   3670 C  CD     . LYS C 3 410 ? 14.027  48.687 45.928  1.00 30.95  ?  706  LYS A CD     1 
ATOM   3671 C  CE     . LYS C 3 410 ? 14.267  48.756 44.431  1.00 33.90  ?  706  LYS A CE     1 
ATOM   3672 N  NZ     . LYS C 3 410 ? 15.136  49.913 44.085  1.00 49.98  ?  706  LYS A NZ     1 
ATOM   3673 N  N      . ALA C 3 411 ? 12.577  44.673 48.775  1.00 22.89  ?  707  ALA A N      1 
ATOM   3674 C  CA     . ALA C 3 411 ? 12.933  43.275 48.576  1.00 19.23  ?  707  ALA A CA     1 
ATOM   3675 C  C      . ALA C 3 411 ? 11.702  42.381 48.649  1.00 28.19  ?  707  ALA A C      1 
ATOM   3676 O  O      . ALA C 3 411 ? 11.574  41.428 47.874  1.00 20.83  ?  707  ALA A O      1 
ATOM   3677 C  CB     . ALA C 3 411 ? 13.979  42.851 49.607  1.00 24.71  ?  707  ALA A CB     1 
ATOM   3678 N  N      . VAL C 3 412 ? 10.787  42.669 49.577  1.00 26.84  ?  708  VAL A N      1 
ATOM   3679 C  CA     . VAL C 3 412 ? 9.535   41.921 49.628  1.00 28.04  ?  708  VAL A CA     1 
ATOM   3680 C  C      . VAL C 3 412 ? 8.761   42.088 48.325  1.00 31.92  ?  708  VAL A C      1 
ATOM   3681 O  O      . VAL C 3 412 ? 8.204   41.120 47.790  1.00 25.06  ?  708  VAL A O      1 
ATOM   3682 C  CB     . VAL C 3 412 ? 8.701   42.355 50.847  1.00 31.01  ?  708  VAL A CB     1 
ATOM   3683 C  CG1    . VAL C 3 412 ? 7.313   41.735 50.788  1.00 28.63  ?  708  VAL A CG1    1 
ATOM   3684 C  CG2    . VAL C 3 412 ? 9.408   41.967 52.131  1.00 34.01  ?  708  VAL A CG2    1 
ATOM   3685 N  N      . ASN C 3 413 ? 8.724   43.311 47.786  1.00 26.32  ?  709  ASN A N      1 
ATOM   3686 C  CA     . ASN C 3 413 ? 8.023   43.549 46.526  1.00 28.34  ?  709  ASN A CA     1 
ATOM   3687 C  C      . ASN C 3 413 ? 8.711   42.833 45.370  1.00 33.67  ?  709  ASN A C      1 
ATOM   3688 O  O      . ASN C 3 413 ? 8.048   42.247 44.508  1.00 29.10  ?  709  ASN A O      1 
ATOM   3689 C  CB     . ASN C 3 413 ? 7.928   45.050 46.241  1.00 31.01  ?  709  ASN A CB     1 
ATOM   3690 C  CG     . ASN C 3 413 ? 6.820   45.733 47.029  1.00 22.51  ?  709  ASN A CG     1 
ATOM   3691 O  OD1    . ASN C 3 413 ? 5.883   45.089 47.499  1.00 23.38  ?  709  ASN A OD1    1 
ATOM   3692 N  ND2    . ASN C 3 413 ? 6.915   47.053 47.156  1.00 20.76  ?  709  ASN A ND2    1 
ATOM   3693 N  N      . PHE C 3 414 ? 10.043  42.900 45.317  1.00 41.41  ?  710  PHE A N      1 
ATOM   3694 C  CA     . PHE C 3 414 ? 10.786  42.135 44.322  1.00 34.72  ?  710  PHE A CA     1 
ATOM   3695 C  C      . PHE C 3 414 ? 10.474  40.651 44.443  1.00 41.83  ?  710  PHE A C      1 
ATOM   3696 O  O      . PHE C 3 414 ? 10.339  39.946 43.435  1.00 42.69  ?  710  PHE A O      1 
ATOM   3697 C  CB     . PHE C 3 414 ? 12.285  42.391 44.489  1.00 42.71  ?  710  PHE A CB     1 
ATOM   3698 C  CG     . PHE C 3 414 ? 13.148  41.708 43.462  1.00 56.07  ?  710  PHE A CG     1 
ATOM   3699 C  CD1    . PHE C 3 414 ? 13.523  42.370 42.304  1.00 61.90  ?  710  PHE A CD1    1 
ATOM   3700 C  CD2    . PHE C 3 414 ? 13.607  40.414 43.666  1.00 64.66  ?  710  PHE A CD2    1 
ATOM   3701 C  CE1    . PHE C 3 414 ? 14.327  41.751 41.361  1.00 61.29  ?  710  PHE A CE1    1 
ATOM   3702 C  CE2    . PHE C 3 414 ? 14.411  39.789 42.726  1.00 62.03  ?  710  PHE A CE2    1 
ATOM   3703 C  CZ     . PHE C 3 414 ? 14.773  40.461 41.574  1.00 59.41  ?  710  PHE A CZ     1 
ATOM   3704 N  N      . GLY C 3 415 ? 10.342  40.160 45.674  1.00 41.53  ?  711  GLY A N      1 
ATOM   3705 C  CA     . GLY C 3 415 ? 10.001  38.762 45.864  1.00 46.56  ?  711  GLY A CA     1 
ATOM   3706 C  C      . GLY C 3 415 ? 8.543   38.468 45.568  1.00 51.11  ?  711  GLY A C      1 
ATOM   3707 O  O      . GLY C 3 415 ? 8.217   37.427 44.989  1.00 44.26  ?  711  GLY A O      1 
ATOM   3708 N  N      . ILE C 3 416 ? 7.645   39.379 45.954  1.00 54.39  ?  712  ILE A N      1 
ATOM   3709 C  CA     . ILE C 3 416 ? 6.217   39.137 45.768  1.00 50.57  ?  712  ILE A CA     1 
ATOM   3710 C  C      . ILE C 3 416 ? 5.895   38.864 44.309  1.00 49.95  ?  712  ILE A C      1 
ATOM   3711 O  O      . ILE C 3 416 ? 4.972   38.100 44.001  1.00 49.63  ?  712  ILE A O      1 
ATOM   3712 C  CB     . ILE C 3 416 ? 5.389   40.316 46.310  1.00 46.22  ?  712  ILE A CB     1 
ATOM   3713 C  CG1    . ILE C 3 416 ? 5.206   40.188 47.822  1.00 55.75  ?  712  ILE A CG1    1 
ATOM   3714 C  CG2    . ILE C 3 416 ? 4.037   40.366 45.627  1.00 44.14  ?  712  ILE A CG2    1 
ATOM   3715 C  CD1    . ILE C 3 416 ? 4.355   39.002 48.233  1.00 62.25  ?  712  ILE A CD1    1 
ATOM   3716 N  N      . VAL C 3 417 ? 6.644   39.475 43.387  1.00 42.68  ?  713  VAL A N      1 
ATOM   3717 C  CA     . VAL C 3 417 ? 6.364   39.328 41.965  1.00 32.94  ?  713  VAL A CA     1 
ATOM   3718 C  C      . VAL C 3 417 ? 7.108   38.162 41.335  1.00 45.85  ?  713  VAL A C      1 
ATOM   3719 O  O      . VAL C 3 417 ? 6.932   37.903 40.136  1.00 55.58  ?  713  VAL A O      1 
ATOM   3720 C  CB     . VAL C 3 417 ? 6.714   40.627 41.213  1.00 40.56  ?  713  VAL A CB     1 
ATOM   3721 C  CG1    . VAL C 3 417 ? 5.824   41.765 41.692  1.00 41.83  ?  713  VAL A CG1    1 
ATOM   3722 C  CG2    . VAL C 3 417 ? 8.176   40.967 41.423  1.00 42.96  ?  713  VAL A CG2    1 
ATOM   3723 N  N      A TYR C 3 418 ? 7.964   37.476 42.077  0.53 40.59  ?  714  TYR A N      1 
ATOM   3724 N  N      B TYR C 3 418 ? 7.901   37.424 42.114  0.47 40.63  ?  714  TYR A N      1 
ATOM   3725 C  CA     A TYR C 3 418 ? 8.830   36.461 41.495  0.53 43.75  ?  714  TYR A CA     1 
ATOM   3726 C  CA     B TYR C 3 418 ? 8.588   36.232 41.633  0.47 43.76  ?  714  TYR A CA     1 
ATOM   3727 C  C      A TYR C 3 418 ? 8.566   35.108 42.142  0.53 44.82  ?  714  TYR A C      1 
ATOM   3728 C  C      B TYR C 3 418 ? 8.196   34.978 42.408  0.47 44.90  ?  714  TYR A C      1 
ATOM   3729 O  O      A TYR C 3 418 ? 7.724   34.967 43.032  0.53 46.05  ?  714  TYR A O      1 
ATOM   3730 O  O      B TYR C 3 418 ? 8.834   33.933 42.238  0.47 45.92  ?  714  TYR A O      1 
ATOM   3731 C  CB     A TYR C 3 418 ? 10.302  36.857 41.641  0.53 46.98  ?  714  TYR A CB     1 
ATOM   3732 C  CB     B TYR C 3 418 ? 10.106  36.435 41.689  0.47 46.36  ?  714  TYR A CB     1 
ATOM   3733 C  CG     A TYR C 3 418 ? 10.803  37.786 40.560  0.53 47.49  ?  714  TYR A CG     1 
ATOM   3734 C  CG     B TYR C 3 418 ? 10.633  37.408 40.656  0.47 47.79  ?  714  TYR A CG     1 
ATOM   3735 C  CD1    A TYR C 3 418 ? 11.959  38.531 40.740  0.53 49.20  ?  714  TYR A CD1    1 
ATOM   3736 C  CD1    B TYR C 3 418 ? 10.045  37.508 39.402  0.47 52.13  ?  714  TYR A CD1    1 
ATOM   3737 C  CD2    A TYR C 3 418 ? 10.127  37.910 39.354  0.53 52.43  ?  714  TYR A CD2    1 
ATOM   3738 C  CD2    B TYR C 3 418 ? 11.718  38.228 40.935  0.47 48.56  ?  714  TYR A CD2    1 
ATOM   3739 C  CE1    A TYR C 3 418 ? 12.427  39.377 39.752  0.53 51.90  ?  714  TYR A CE1    1 
ATOM   3740 C  CE1    B TYR C 3 418 ? 10.525  38.396 38.453  0.47 53.52  ?  714  TYR A CE1    1 
ATOM   3741 C  CE2    A TYR C 3 418 ? 10.589  38.756 38.358  0.53 52.89  ?  714  TYR A CE2    1 
ATOM   3742 C  CE2    B TYR C 3 418 ? 12.204  39.118 39.995  0.47 50.50  ?  714  TYR A CE2    1 
ATOM   3743 C  CZ     A TYR C 3 418 ? 11.740  39.487 38.564  0.53 53.65  ?  714  TYR A CZ     1 
ATOM   3744 C  CZ     B TYR C 3 418 ? 11.604  39.199 38.756  0.47 53.10  ?  714  TYR A CZ     1 
ATOM   3745 O  OH     A TYR C 3 418 ? 12.208  40.331 37.582  0.53 55.29  ?  714  TYR A OH     1 
ATOM   3746 O  OH     B TYR C 3 418 ? 12.082  40.083 37.815  0.47 54.06  ?  714  TYR A OH     1 
ATOM   3747 N  N      A GLY C 3 419 ? 9.301   34.104 41.670  0.30 48.18  ?  715  GLY A N      1 
ATOM   3748 N  N      B GLY C 3 419 ? 7.159   35.086 43.233  0.70 46.39  ?  715  GLY A N      1 
ATOM   3749 C  CA     A GLY C 3 419 ? 9.264   32.785 42.264  0.30 47.29  ?  715  GLY A CA     1 
ATOM   3750 C  CA     B GLY C 3 419 ? 6.661   33.961 44.000  0.70 46.51  ?  715  GLY A CA     1 
ATOM   3751 C  C      A GLY C 3 419 ? 10.253  32.643 43.401  0.30 44.23  ?  715  GLY A C      1 
ATOM   3752 C  C      B GLY C 3 419 ? 6.662   34.126 45.507  0.70 40.10  ?  715  GLY A C      1 
ATOM   3753 O  O      A GLY C 3 419 ? 10.784  31.554 43.635  0.30 47.86  ?  715  GLY A O      1 
ATOM   3754 O  O      B GLY C 3 419 ? 5.662   33.904 46.168  0.70 51.10  ?  715  GLY A O      1 
ATOM   3755 N  N      A ILE C 3 420 ? 10.527  33.740 44.099  0.49 46.65  ?  716  ILE A N      1 
ATOM   3756 N  N      B ILE C 3 420 ? 7.797   34.534 46.045  0.51 40.41  ?  716  ILE A N      1 
ATOM   3757 C  CA     A ILE C 3 420 ? 11.373  33.703 45.286  0.49 41.05  ?  716  ILE A CA     1 
ATOM   3758 C  CA     B ILE C 3 420 ? 7.981   34.707 47.484  0.51 36.70  ?  716  ILE A CA     1 
ATOM   3759 C  C      A ILE C 3 420 ? 10.528  33.288 46.483  0.49 38.00  ?  716  ILE A C      1 
ATOM   3760 C  C      B ILE C 3 420 ? 7.709   33.395 48.213  0.51 42.90  ?  716  ILE A C      1 
ATOM   3761 O  O      A ILE C 3 420 ? 9.329   33.577 46.551  0.49 36.29  ?  716  ILE A O      1 
ATOM   3762 O  O      B ILE C 3 420 ? 6.561   32.958 48.353  0.51 44.82  ?  716  ILE A O      1 
ATOM   3763 C  CB     A ILE C 3 420 ? 12.047  35.073 45.502  0.49 42.54  ?  716  ILE A CB     1 
ATOM   3764 C  CB     B ILE C 3 420 ? 7.121   35.867 48.040  0.51 35.49  ?  716  ILE A CB     1 
ATOM   3765 C  CG1    A ILE C 3 420 ? 13.027  35.358 44.364  0.49 41.32  ?  716  ILE A CG1    1 
ATOM   3766 C  CG1    B ILE C 3 420 ? 6.249   35.431 49.217  0.51 32.94  ?  716  ILE A CG1    1 
ATOM   3767 C  CG2    A ILE C 3 420 ? 12.743  35.133 46.856  0.49 44.37  ?  716  ILE A CG2    1 
ATOM   3768 C  CG2    B ILE C 3 420 ? 6.246   36.478 46.972  0.51 44.07  ?  716  ILE A CG2    1 
ATOM   3769 C  CD1    A ILE C 3 420 ? 13.034  36.799 43.912  0.49 36.05  ?  716  ILE A CD1    1 
ATOM   3770 C  CD1    B ILE C 3 420 ? 4.814   35.112 48.827  0.51 33.92  ?  716  ILE A CD1    1 
ATOM   3771 N  N      A SER C 3 421 ? 11.148  32.590 47.431  0.57 45.53  ?  717  SER A N      1 
ATOM   3772 N  N      B SER C 3 421 ? 8.780   32.741 48.656  0.43 49.85  ?  717  SER A N      1 
ATOM   3773 C  CA     A SER C 3 421 ? 10.468  32.074 48.613  0.57 51.95  ?  717  SER A CA     1 
ATOM   3774 C  CA     B SER C 3 421 ? 8.685   31.616 49.577  0.43 51.08  ?  717  SER A CA     1 
ATOM   3775 C  C      A SER C 3 421 ? 11.049  32.720 49.865  0.57 56.76  ?  717  SER A C      1 
ATOM   3776 C  C      B SER C 3 421 ? 9.245   32.025 50.934  0.43 53.20  ?  717  SER A C      1 
ATOM   3777 O  O      A SER C 3 421 ? 11.921  33.587 49.793  0.57 56.78  ?  717  SER A O      1 
ATOM   3778 O  O      B SER C 3 421 ? 8.489   32.122 51.904  0.43 51.07  ?  717  SER A O      1 
ATOM   3779 C  CB     A SER C 3 421 ? 10.595  30.552 48.692  0.57 55.72  ?  717  SER A CB     1 
ATOM   3780 C  CB     B SER C 3 421 ? 9.408   30.392 49.015  0.43 55.20  ?  717  SER A CB     1 
ATOM   3781 O  OG     A SER C 3 421 ? 11.952  30.168 48.832  0.57 55.00  ?  717  SER A OG     1 
ATOM   3782 O  OG     B SER C 3 421 ? 8.539   29.594 48.220  0.43 51.60  ?  717  SER A OG     1 
ATOM   3783 N  N      . ASP C 3 422 ? 10.551  32.289 51.027  1.00 56.53  ?  718  ASP A N      1 
ATOM   3784 C  CA     . ASP C 3 422 ? 11.148  32.719 52.290  1.00 63.59  ?  718  ASP A CA     1 
ATOM   3785 C  C      . ASP C 3 422 ? 12.667  32.642 52.234  1.00 60.76  ?  718  ASP A C      1 
ATOM   3786 O  O      . ASP C 3 422 ? 13.361  33.618 52.542  1.00 56.37  ?  718  ASP A O      1 
ATOM   3787 C  CB     . ASP C 3 422 ? 10.640  31.870 53.456  1.00 71.02  ?  718  ASP A CB     1 
ATOM   3788 C  CG     . ASP C 3 422 ? 9.798   32.667 54.424  1.00 88.52  ?  718  ASP A CG     1 
ATOM   3789 O  OD1    . ASP C 3 422 ? 9.574   33.868 54.165  1.00 95.02  ?  718  ASP A OD1    1 
ATOM   3790 O  OD2    . ASP C 3 422 ? 9.364   32.096 55.445  1.00 97.16  ?  718  ASP A OD2    1 
ATOM   3791 N  N      . TYR C 3 423 ? 13.189  31.478 51.841  1.00 56.06  ?  719  TYR A N      1 
ATOM   3792 C  CA     . TYR C 3 423 ? 14.635  31.318 51.741  1.00 57.30  ?  719  TYR A CA     1 
ATOM   3793 C  C      . TYR C 3 423 ? 15.234  32.354 50.799  1.00 55.67  ?  719  TYR A C      1 
ATOM   3794 O  O      . TYR C 3 423 ? 16.332  32.866 51.045  1.00 56.00  ?  719  TYR A O      1 
ATOM   3795 C  CB     . TYR C 3 423 ? 14.981  29.901 51.278  1.00 63.63  ?  719  TYR A CB     1 
ATOM   3796 C  CG     . TYR C 3 423 ? 16.453  29.575 51.404  1.00 72.19  ?  719  TYR A CG     1 
ATOM   3797 C  CD1    . TYR C 3 423 ? 16.969  29.048 52.581  1.00 76.70  ?  719  TYR A CD1    1 
ATOM   3798 C  CD2    . TYR C 3 423 ? 17.329  29.807 50.352  1.00 73.29  ?  719  TYR A CD2    1 
ATOM   3799 C  CE1    . TYR C 3 423 ? 18.317  28.754 52.704  1.00 83.64  ?  719  TYR A CE1    1 
ATOM   3800 C  CE2    . TYR C 3 423 ? 18.678  29.516 50.465  1.00 77.47  ?  719  TYR A CE2    1 
ATOM   3801 C  CZ     . TYR C 3 423 ? 19.167  28.990 51.644  1.00 83.95  ?  719  TYR A CZ     1 
ATOM   3802 O  OH     . TYR C 3 423 ? 20.508  28.700 51.761  1.00 86.37  ?  719  TYR A OH     1 
ATOM   3803 N  N      . GLY C 3 424 ? 14.523  32.682 49.719  1.00 53.95  ?  720  GLY A N      1 
ATOM   3804 C  CA     . GLY C 3 424 ? 15.016  33.699 48.806  1.00 52.00  ?  720  GLY A CA     1 
ATOM   3805 C  C      . GLY C 3 424 ? 14.957  35.091 49.403  1.00 46.62  ?  720  GLY A C      1 
ATOM   3806 O  O      . GLY C 3 424 ? 15.892  35.882 49.251  1.00 50.06  ?  720  GLY A O      1 
ATOM   3807 N  N      . LEU C 3 425 ? 13.858  35.411 50.091  1.00 48.91  ?  721  LEU A N      1 
ATOM   3808 C  CA     . LEU C 3 425 ? 13.768  36.683 50.797  1.00 41.32  ?  721  LEU A CA     1 
ATOM   3809 C  C      . LEU C 3 425 ? 14.806  36.754 51.910  1.00 39.86  ?  721  LEU A C      1 
ATOM   3810 O  O      . LEU C 3 425 ? 15.643  37.662 51.943  1.00 36.90  ?  721  LEU A O      1 
ATOM   3811 C  CB     . LEU C 3 425 ? 12.360  36.876 51.359  1.00 35.78  ?  721  LEU A CB     1 
ATOM   3812 C  CG     . LEU C 3 425 ? 12.146  38.230 52.035  1.00 32.85  ?  721  LEU A CG     1 
ATOM   3813 C  CD1    . LEU C 3 425 ? 12.303  39.347 51.015  1.00 32.56  ?  721  LEU A CD1    1 
ATOM   3814 C  CD2    . LEU C 3 425 ? 10.788  38.296 52.712  1.00 40.89  ?  721  LEU A CD2    1 
ATOM   3815 N  N      . ALA C 3 426 ? 14.766  35.794 52.838  1.00 39.30  ?  722  ALA A N      1 
ATOM   3816 C  CA     . ALA C 3 426 ? 15.793  35.716 53.874  1.00 43.60  ?  722  ALA A CA     1 
ATOM   3817 C  C      . ALA C 3 426 ? 17.184  35.829 53.268  1.00 43.07  ?  722  ALA A C      1 
ATOM   3818 O  O      . ALA C 3 426 ? 18.046  36.538 53.800  1.00 50.69  ?  722  ALA A O      1 
ATOM   3819 C  CB     . ALA C 3 426 ? 15.652  34.411 54.668  1.00 49.10  ?  722  ALA A CB     1 
ATOM   3820 N  N      . GLN C 3 427 ? 17.401  35.179 52.122  1.00 45.14  ?  723  GLN A N      1 
ATOM   3821 C  CA     . GLN C 3 427 ? 18.708  35.233 51.479  1.00 45.41  ?  723  GLN A CA     1 
ATOM   3822 C  C      . GLN C 3 427 ? 19.018  36.640 50.984  1.00 39.06  ?  723  GLN A C      1 
ATOM   3823 O  O      . GLN C 3 427 ? 20.082  37.193 51.285  1.00 42.36  ?  723  GLN A O      1 
ATOM   3824 C  CB     . GLN C 3 427 ? 18.769  34.223 50.333  1.00 61.18  ?  723  GLN A CB     1 
ATOM   3825 C  CG     . GLN C 3 427 ? 20.140  34.069 49.673  1.00 70.03  ?  723  GLN A CG     1 
ATOM   3826 C  CD     . GLN C 3 427 ? 20.212  34.741 48.315  1.00 76.95  ?  723  GLN A CD     1 
ATOM   3827 O  OE1    . GLN C 3 427 ? 19.186  35.054 47.710  1.00 76.67  ?  723  GLN A OE1    1 
ATOM   3828 N  NE2    . GLN C 3 427 ? 21.428  34.972 47.831  1.00 81.49  ?  723  GLN A NE2    1 
ATOM   3829 N  N      . ASN C 3 428 ? 18.094  37.243 50.228  1.00 37.51  ?  724  ASN A N      1 
ATOM   3830 C  CA     . ASN C 3 428 ? 18.348  38.574 49.685  1.00 38.20  ?  724  ASN A CA     1 
ATOM   3831 C  C      . ASN C 3 428 ? 18.461  39.624 50.783  1.00 34.59  ?  724  ASN A C      1 
ATOM   3832 O  O      . ASN C 3 428 ? 19.220  40.589 50.636  1.00 38.26  ?  724  ASN A O      1 
ATOM   3833 C  CB     . ASN C 3 428 ? 17.251  38.952 48.687  1.00 46.87  ?  724  ASN A CB     1 
ATOM   3834 C  CG     . ASN C 3 428 ? 17.338  38.151 47.400  1.00 52.26  ?  724  ASN A CG     1 
ATOM   3835 O  OD1    . ASN C 3 428 ? 18.407  37.649 47.042  1.00 45.31  ?  724  ASN A OD1    1 
ATOM   3836 N  ND2    . ASN C 3 428 ? 16.215  38.030 46.695  1.00 51.86  ?  724  ASN A ND2    1 
ATOM   3837 N  N      . LEU C 3 429 ? 17.728  39.459 51.882  1.00 34.34  ?  725  LEU A N      1 
ATOM   3838 C  CA     . LEU C 3 429 ? 17.774  40.407 52.987  1.00 39.75  ?  725  LEU A CA     1 
ATOM   3839 C  C      . LEU C 3 429 ? 18.801  40.032 54.044  1.00 45.07  ?  725  LEU A C      1 
ATOM   3840 O  O      . LEU C 3 429 ? 18.947  40.760 55.032  1.00 48.26  ?  725  LEU A O      1 
ATOM   3841 C  CB     . LEU C 3 429 ? 16.384  40.541 53.625  1.00 32.43  ?  725  LEU A CB     1 
ATOM   3842 C  CG     . LEU C 3 429 ? 15.407  41.314 52.734  1.00 38.32  ?  725  LEU A CG     1 
ATOM   3843 C  CD1    . LEU C 3 429 ? 14.055  41.511 53.410  1.00 35.69  ?  725  LEU A CD1    1 
ATOM   3844 C  CD2    . LEU C 3 429 ? 16.014  42.654 52.332  1.00 37.97  ?  725  LEU A CD2    1 
ATOM   3845 N  N      . ASN C 3 430 ? 19.521  38.930 53.852  1.00 45.68  ?  726  ASN A N      1 
ATOM   3846 C  CA     . ASN C 3 430 ? 20.531  38.475 54.801  1.00 47.13  ?  726  ASN A CA     1 
ATOM   3847 C  C      . ASN C 3 430 ? 19.930  38.349 56.199  1.00 38.19  ?  726  ASN A C      1 
ATOM   3848 O  O      . ASN C 3 430 ? 20.480  38.833 57.191  1.00 42.70  ?  726  ASN A O      1 
ATOM   3849 C  CB     . ASN C 3 430 ? 21.742  39.410 54.794  1.00 52.50  ?  726  ASN A CB     1 
ATOM   3850 C  CG     . ASN C 3 430 ? 22.922  38.837 55.547  1.00 62.18  ?  726  ASN A CG     1 
ATOM   3851 O  OD1    . ASN C 3 430 ? 23.024  37.625 55.737  1.00 59.42  ?  726  ASN A OD1    1 
ATOM   3852 N  ND2    . ASN C 3 430 ? 23.826  39.707 55.979  1.00 70.73  ?  726  ASN A ND2    1 
ATOM   3853 N  N      . ILE C 3 431 ? 18.773  37.690 56.269  1.00 35.21  ?  727  ILE A N      1 
ATOM   3854 C  CA     . ILE C 3 431 ? 18.025  37.540 57.509  1.00 41.15  ?  727  ILE A CA     1 
ATOM   3855 C  C      . ILE C 3 431 ? 17.583  36.089 57.659  1.00 44.45  ?  727  ILE A C      1 
ATOM   3856 O  O      . ILE C 3 431 ? 17.765  35.259 56.768  1.00 55.27  ?  727  ILE A O      1 
ATOM   3857 C  CB     . ILE C 3 431 ? 16.804  38.481 57.575  1.00 40.59  ?  727  ILE A CB     1 
ATOM   3858 C  CG1    . ILE C 3 431 ? 15.818  38.159 56.449  1.00 43.51  ?  727  ILE A CG1    1 
ATOM   3859 C  CG2    . ILE C 3 431 ? 17.250  39.930 57.490  1.00 35.89  ?  727  ILE A CG2    1 
ATOM   3860 C  CD1    . ILE C 3 431 ? 14.548  38.987 56.483  1.00 38.91  ?  727  ILE A CD1    1 
ATOM   3861 N  N      . SER C 3 432 ? 16.992  35.797 58.814  1.00 43.40  ?  728  SER A N      1 
ATOM   3862 C  CA     . SER C 3 432 ? 16.513  34.459 59.120  1.00 40.72  ?  728  SER A CA     1 
ATOM   3863 C  C      . SER C 3 432 ? 15.255  34.133 58.319  1.00 47.05  ?  728  SER A C      1 
ATOM   3864 O  O      . SER C 3 432 ? 14.557  35.016 57.815  1.00 41.92  ?  728  SER A O      1 
ATOM   3865 C  CB     . SER C 3 432 ? 16.221  34.332 60.614  1.00 46.68  ?  728  SER A CB     1 
ATOM   3866 O  OG     . SER C 3 432 ? 15.771  33.029 60.936  1.00 67.04  ?  728  SER A OG     1 
ATOM   3867 N  N      . ARG C 3 433 ? 14.963  32.834 58.212  1.00 52.68  ?  729  ARG A N      1 
ATOM   3868 C  CA     . ARG C 3 433 ? 13.731  32.421 57.549  1.00 52.14  ?  729  ARG A CA     1 
ATOM   3869 C  C      . ARG C 3 433 ? 12.510  32.806 58.374  1.00 52.38  ?  729  ARG A C      1 
ATOM   3870 O  O      . ARG C 3 433 ? 11.503  33.265 57.824  1.00 58.25  ?  729  ARG A O      1 
ATOM   3871 C  CB     . ARG C 3 433 ? 13.745  30.916 57.281  1.00 59.50  ?  729  ARG A CB     1 
ATOM   3872 C  CG     . ARG C 3 433 ? 14.867  30.465 56.365  1.00 72.39  ?  729  ARG A CG     1 
ATOM   3873 C  CD     . ARG C 3 433 ? 14.613  29.075 55.798  1.00 84.51  ?  729  ARG A CD     1 
ATOM   3874 N  NE     . ARG C 3 433 ? 13.519  29.068 54.830  1.00 90.51  ?  729  ARG A NE     1 
ATOM   3875 C  CZ     . ARG C 3 433 ? 13.318  28.106 53.933  1.00 92.08  ?  729  ARG A CZ     1 
ATOM   3876 N  NH1    . ARG C 3 433 ? 14.142  27.068 53.870  1.00 87.05  ?  729  ARG A NH1    1 
ATOM   3877 N  NH2    . ARG C 3 433 ? 12.296  28.186 53.091  1.00 94.54  ?  729  ARG A NH2    1 
ATOM   3878 N  N      . LYS C 3 434 ? 12.576  32.626 59.695  1.00 55.28  ?  730  LYS A N      1 
ATOM   3879 C  CA     . LYS C 3 434 ? 11.456  33.034 60.535  1.00 60.29  ?  730  LYS A CA     1 
ATOM   3880 C  C      . LYS C 3 434 ? 11.212  34.533 60.424  1.00 56.77  ?  730  LYS A C      1 
ATOM   3881 O  O      . LYS C 3 434 ? 10.061  34.983 60.376  1.00 50.65  ?  730  LYS A O      1 
ATOM   3882 C  CB     . LYS C 3 434 ? 11.706  32.632 61.988  1.00 67.85  ?  730  LYS A CB     1 
ATOM   3883 C  CG     . LYS C 3 434 ? 10.521  32.897 62.902  1.00 78.40  ?  730  LYS A CG     1 
ATOM   3884 C  CD     . LYS C 3 434 ? 9.251   32.278 62.333  1.00 92.79  ?  730  LYS A CD     1 
ATOM   3885 C  CE     . LYS C 3 434 ? 8.022   32.679 63.134  1.00 100.64 ?  730  LYS A CE     1 
ATOM   3886 N  NZ     . LYS C 3 434 ? 6.768   32.171 62.507  1.00 101.74 ?  730  LYS A NZ     1 
ATOM   3887 N  N      . GLU C 3 435 ? 12.287  35.324 60.374  1.00 48.49  ?  731  GLU A N      1 
ATOM   3888 C  CA     . GLU C 3 435 ? 12.137  36.762 60.185  1.00 42.38  ?  731  GLU A CA     1 
ATOM   3889 C  C      . GLU C 3 435 ? 11.590  37.080 58.799  1.00 44.24  ?  731  GLU A C      1 
ATOM   3890 O  O      . GLU C 3 435 ? 10.707  37.934 58.657  1.00 48.79  ?  731  GLU A O      1 
ATOM   3891 C  CB     . GLU C 3 435 ? 13.477  37.462 60.417  1.00 54.75  ?  731  GLU A CB     1 
ATOM   3892 C  CG     . GLU C 3 435 ? 13.980  37.355 61.851  1.00 66.85  ?  731  GLU A CG     1 
ATOM   3893 C  CD     . GLU C 3 435 ? 15.373  37.928 62.038  1.00 81.97  ?  731  GLU A CD     1 
ATOM   3894 O  OE1    . GLU C 3 435 ? 16.183  37.857 61.089  1.00 83.45  ?  731  GLU A OE1    1 
ATOM   3895 O  OE2    . GLU C 3 435 ? 15.659  38.447 63.138  1.00 89.77  ?  731  GLU A OE2    1 
ATOM   3896 N  N      . ALA C 3 436 ? 12.100  36.404 57.765  1.00 35.51  ?  732  ALA A N      1 
ATOM   3897 C  CA     . ALA C 3 436 ? 11.547  36.579 56.427  1.00 43.57  ?  732  ALA A CA     1 
ATOM   3898 C  C      . ALA C 3 436 ? 10.098  36.114 56.375  1.00 44.24  ?  732  ALA A C      1 
ATOM   3899 O  O      . ALA C 3 436 ? 9.259   36.735 55.712  1.00 42.33  ?  732  ALA A O      1 
ATOM   3900 C  CB     . ALA C 3 436 ? 12.396  35.825 55.403  1.00 37.77  ?  732  ALA A CB     1 
ATOM   3901 N  N      . ALA C 3 437 ? 9.787   35.019 57.075  1.00 34.53  ?  733  ALA A N      1 
ATOM   3902 C  CA     . ALA C 3 437 ? 8.401   34.581 57.200  1.00 41.82  ?  733  ALA A CA     1 
ATOM   3903 C  C      . ALA C 3 437 ? 7.547   35.636 57.891  1.00 42.57  ?  733  ALA A C      1 
ATOM   3904 O  O      . ALA C 3 437 ? 6.375   35.827 57.542  1.00 47.22  ?  733  ALA A O      1 
ATOM   3905 C  CB     . ALA C 3 437 ? 8.338   33.259 57.965  1.00 36.21  ?  733  ALA A CB     1 
ATOM   3906 N  N      . GLU C 3 438 ? 8.114   36.330 58.879  1.00 43.05  ?  734  GLU A N      1 
ATOM   3907 C  CA     . GLU C 3 438 ? 7.369   37.392 59.543  1.00 43.94  ?  734  GLU A CA     1 
ATOM   3908 C  C      . GLU C 3 438 ? 7.079   38.539 58.583  1.00 34.21  ?  734  GLU A C      1 
ATOM   3909 O  O      . GLU C 3 438 ? 5.986   39.115 58.612  1.00 37.36  ?  734  GLU A O      1 
ATOM   3910 C  CB     . GLU C 3 438 ? 8.138   37.886 60.768  1.00 53.50  ?  734  GLU A CB     1 
ATOM   3911 C  CG     . GLU C 3 438 ? 8.372   36.810 61.822  1.00 68.44  ?  734  GLU A CG     1 
ATOM   3912 C  CD     . GLU C 3 438 ? 9.244   37.287 62.972  1.00 80.11  ?  734  GLU A CD     1 
ATOM   3913 O  OE1    . GLU C 3 438 ? 9.724   38.440 62.926  1.00 83.29  ?  734  GLU A OE1    1 
ATOM   3914 O  OE2    . GLU C 3 438 ? 9.452   36.505 63.924  1.00 79.08  ?  734  GLU A OE2    1 
ATOM   3915 N  N      . PHE C 3 439 ? 8.045   38.891 57.726  1.00 34.72  ?  735  PHE A N      1 
ATOM   3916 C  CA     . PHE C 3 439 ? 7.810   39.942 56.739  1.00 31.52  ?  735  PHE A CA     1 
ATOM   3917 C  C      . PHE C 3 439 ? 6.650   39.577 55.823  1.00 39.44  ?  735  PHE A C      1 
ATOM   3918 O  O      . PHE C 3 439 ? 5.780   40.407 55.536  1.00 37.26  ?  735  PHE A O      1 
ATOM   3919 C  CB     . PHE C 3 439 ? 9.068   40.193 55.902  1.00 42.35  ?  735  PHE A CB     1 
ATOM   3920 C  CG     . PHE C 3 439 ? 10.111  41.022 56.588  1.00 51.04  ?  735  PHE A CG     1 
ATOM   3921 C  CD1    . PHE C 3 439 ? 11.363  41.177 56.018  1.00 59.32  ?  735  PHE A CD1    1 
ATOM   3922 C  CD2    . PHE C 3 439 ? 9.848   41.643 57.794  1.00 53.00  ?  735  PHE A CD2    1 
ATOM   3923 C  CE1    . PHE C 3 439 ? 12.336  41.934 56.639  1.00 56.13  ?  735  PHE A CE1    1 
ATOM   3924 C  CE2    . PHE C 3 439 ? 10.819  42.401 58.421  1.00 61.77  ?  735  PHE A CE2    1 
ATOM   3925 C  CZ     . PHE C 3 439 ? 12.064  42.546 57.842  1.00 58.25  ?  735  PHE A CZ     1 
ATOM   3926 N  N      . ILE C 3 440 ? 6.641   38.336 55.334  1.00 39.27  ?  736  ILE A N      1 
ATOM   3927 C  CA     . ILE C 3 440 ? 5.609   37.904 54.395  1.00 34.97  ?  736  ILE A CA     1 
ATOM   3928 C  C      . ILE C 3 440 ? 4.229   38.024 55.027  1.00 30.74  ?  736  ILE A C      1 
ATOM   3929 O  O      . ILE C 3 440 ? 3.279   38.500 54.394  1.00 37.33  ?  736  ILE A O      1 
ATOM   3930 C  CB     . ILE C 3 440 ? 5.889   36.464 53.929  1.00 34.27  ?  736  ILE A CB     1 
ATOM   3931 C  CG1    . ILE C 3 440 ? 7.330   36.330 53.430  1.00 34.95  ?  736  ILE A CG1    1 
ATOM   3932 C  CG2    . ILE C 3 440 ? 4.882   36.038 52.867  1.00 42.66  ?  736  ILE A CG2    1 
ATOM   3933 C  CD1    . ILE C 3 440 ? 7.577   36.940 52.074  1.00 39.84  ?  736  ILE A CD1    1 
ATOM   3934 N  N      . GLU C 3 441 ? 4.091   37.599 56.284  1.00 39.38  ?  737  GLU A N      1 
ATOM   3935 C  CA     . GLU C 3 441 ? 2.770   37.614 56.900  1.00 43.49  ?  737  GLU A CA     1 
ATOM   3936 C  C      . GLU C 3 441 ? 2.301   39.039 57.164  1.00 43.04  ?  737  GLU A C      1 
ATOM   3937 O  O      . GLU C 3 441 ? 1.115   39.345 56.995  1.00 35.23  ?  737  GLU A O      1 
ATOM   3938 C  CB     . GLU C 3 441 ? 2.764   36.791 58.185  1.00 55.42  ?  737  GLU A CB     1 
ATOM   3939 C  CG     . GLU C 3 441 ? 1.354   36.469 58.645  1.00 66.01  ?  737  GLU A CG     1 
ATOM   3940 C  CD     . GLU C 3 441 ? 0.405   36.255 57.471  1.00 75.51  ?  737  GLU A CD     1 
ATOM   3941 O  OE1    . GLU C 3 441 ? 0.690   35.391 56.612  1.00 76.80  ?  737  GLU A OE1    1 
ATOM   3942 O  OE2    . GLU C 3 441 ? -0.621  36.964 57.396  1.00 72.81  ?  737  GLU A OE2    1 
ATOM   3943 N  N      . ARG C 3 442 ? 3.212   39.928 57.574  1.00 42.19  ?  738  ARG A N      1 
ATOM   3944 C  CA     . ARG C 3 442 ? 2.855   41.340 57.674  1.00 40.60  ?  738  ARG A CA     1 
ATOM   3945 C  C      . ARG C 3 442 ? 2.378   41.869 56.331  1.00 33.05  ?  738  ARG A C      1 
ATOM   3946 O  O      . ARG C 3 442 ? 1.412   42.638 56.261  1.00 34.81  ?  738  ARG A O      1 
ATOM   3947 C  CB     . ARG C 3 442 ? 4.045   42.167 58.165  1.00 37.61  ?  738  ARG A CB     1 
ATOM   3948 C  CG     . ARG C 3 442 ? 4.403   41.999 59.626  1.00 44.01  ?  738  ARG A CG     1 
ATOM   3949 C  CD     . ARG C 3 442 ? 3.197   42.164 60.533  1.00 53.28  ?  738  ARG A CD     1 
ATOM   3950 N  NE     . ARG C 3 442 ? 2.604   40.871 60.855  1.00 66.89  ?  738  ARG A NE     1 
ATOM   3951 C  CZ     . ARG C 3 442 ? 3.142   40.001 61.704  1.00 73.33  ?  738  ARG A CZ     1 
ATOM   3952 N  NH1    . ARG C 3 442 ? 4.286   40.286 62.312  1.00 76.26  ?  738  ARG A NH1    1 
ATOM   3953 N  NH2    . ARG C 3 442 ? 2.540   38.844 61.943  1.00 70.67  ?  738  ARG A NH2    1 
ATOM   3954 N  N      . TYR C 3 443 ? 3.050   41.471 55.251  1.00 26.34  ?  739  TYR A N      1 
ATOM   3955 C  CA     . TYR C 3 443 ? 2.655   41.934 53.931  1.00 28.01  ?  739  TYR A CA     1 
ATOM   3956 C  C      . TYR C 3 443 ? 1.246   41.468 53.588  1.00 34.97  ?  739  TYR A C      1 
ATOM   3957 O  O      . TYR C 3 443 ? 0.422   42.249 53.100  1.00 27.01  ?  739  TYR A O      1 
ATOM   3958 C  CB     . TYR C 3 443 ? 3.656   41.449 52.885  1.00 27.74  ?  739  TYR A CB     1 
ATOM   3959 C  CG     . TYR C 3 443 ? 3.284   41.886 51.505  1.00 31.23  ?  739  TYR A CG     1 
ATOM   3960 C  CD1    . TYR C 3 443 ? 3.801   43.052 50.969  1.00 27.12  ?  739  TYR A CD1    1 
ATOM   3961 C  CD2    . TYR C 3 443 ? 2.390   41.148 50.744  1.00 31.02  ?  739  TYR A CD2    1 
ATOM   3962 C  CE1    . TYR C 3 443 ? 3.450   43.462 49.699  1.00 26.82  ?  739  TYR A CE1    1 
ATOM   3963 C  CE2    . TYR C 3 443 ? 2.029   41.551 49.484  1.00 31.59  ?  739  TYR A CE2    1 
ATOM   3964 C  CZ     . TYR C 3 443 ? 2.561   42.706 48.966  1.00 25.91  ?  739  TYR A CZ     1 
ATOM   3965 O  OH     . TYR C 3 443 ? 2.195   43.106 47.708  1.00 24.24  ?  739  TYR A OH     1 
ATOM   3966 N  N      . PHE C 3 444 ? 0.952   40.187 53.829  1.00 24.89  ?  740  PHE A N      1 
ATOM   3967 C  CA     . PHE C 3 444 ? -0.378  39.678 53.519  1.00 31.77  ?  740  PHE A CA     1 
ATOM   3968 C  C      . PHE C 3 444 ? -1.432  40.275 54.442  1.00 33.44  ?  740  PHE A C      1 
ATOM   3969 O  O      . PHE C 3 444 ? -2.595  40.405 54.044  1.00 41.84  ?  740  PHE A O      1 
ATOM   3970 C  CB     . PHE C 3 444 ? -0.378  38.149 53.580  1.00 27.74  ?  740  PHE A CB     1 
ATOM   3971 C  CG     . PHE C 3 444 ? 0.331   37.503 52.420  1.00 23.45  ?  740  PHE A CG     1 
ATOM   3972 C  CD1    . PHE C 3 444 ? 0.230   38.045 51.149  1.00 26.40  ?  740  PHE A CD1    1 
ATOM   3973 C  CD2    . PHE C 3 444 ? 1.111   36.376 52.599  1.00 37.61  ?  740  PHE A CD2    1 
ATOM   3974 C  CE1    . PHE C 3 444 ? 0.877   37.469 50.078  1.00 26.21  ?  740  PHE A CE1    1 
ATOM   3975 C  CE2    . PHE C 3 444 ? 1.766   35.793 51.529  1.00 28.91  ?  740  PHE A CE2    1 
ATOM   3976 C  CZ     . PHE C 3 444 ? 1.647   36.343 50.264  1.00 26.47  ?  740  PHE A CZ     1 
ATOM   3977 N  N      . GLU C 3 445 ? -1.048  40.653 55.666  1.00 31.85  ?  741  GLU A N      1 
ATOM   3978 C  CA     . GLU C 3 445 ? -1.951  41.427 56.512  1.00 37.40  ?  741  GLU A CA     1 
ATOM   3979 C  C      . GLU C 3 445 ? -2.293  42.762 55.866  1.00 40.63  ?  741  GLU A C      1 
ATOM   3980 O  O      . GLU C 3 445 ? -3.431  43.236 55.964  1.00 35.59  ?  741  GLU A O      1 
ATOM   3981 C  CB     . GLU C 3 445 ? -1.328  41.663 57.890  1.00 51.83  ?  741  GLU A CB     1 
ATOM   3982 C  CG     . GLU C 3 445 ? -1.406  40.496 58.849  1.00 67.49  ?  741  GLU A CG     1 
ATOM   3983 C  CD     . GLU C 3 445 ? -1.011  40.889 60.264  1.00 86.88  ?  741  GLU A CD     1 
ATOM   3984 O  OE1    . GLU C 3 445 ? -1.069  42.096 60.587  1.00 91.24  ?  741  GLU A OE1    1 
ATOM   3985 O  OE2    . GLU C 3 445 ? -0.640  39.994 61.052  1.00 93.28  ?  741  GLU A OE2    1 
ATOM   3986 N  N      . SER C 3 446 ? -1.313  43.390 55.211  1.00 34.65  ?  742  SER A N      1 
ATOM   3987 C  CA     . SER C 3 446 ? -1.541  44.689 54.591  1.00 31.75  ?  742  SER A CA     1 
ATOM   3988 C  C      . SER C 3 446 ? -2.187  44.566 53.220  1.00 30.86  ?  742  SER A C      1 
ATOM   3989 O  O      . SER C 3 446 ? -2.905  45.477 52.798  1.00 27.41  ?  742  SER A O      1 
ATOM   3990 C  CB     . SER C 3 446 ? -0.223  45.458 54.469  1.00 39.20  ?  742  SER A CB     1 
ATOM   3991 O  OG     . SER C 3 446 ? 0.255   45.860 55.739  1.00 51.44  ?  742  SER A OG     1 
ATOM   3992 N  N      . PHE C 3 447 ? -1.945  43.467 52.509  1.00 24.73  ?  743  PHE A N      1 
ATOM   3993 C  CA     . PHE C 3 447 ? -2.471  43.267 51.161  1.00 25.24  ?  743  PHE A CA     1 
ATOM   3994 C  C      . PHE C 3 447 ? -3.235  41.951 51.117  1.00 31.52  ?  743  PHE A C      1 
ATOM   3995 O  O      . PHE C 3 447 ? -2.830  40.994 50.445  1.00 27.87  ?  743  PHE A O      1 
ATOM   3996 C  CB     . PHE C 3 447 ? -1.339  43.314 50.135  1.00 23.26  ?  743  PHE A CB     1 
ATOM   3997 C  CG     . PHE C 3 447 ? -0.590  44.611 50.152  1.00 23.21  ?  743  PHE A CG     1 
ATOM   3998 C  CD1    . PHE C 3 447 ? 0.529   44.771 50.951  1.00 25.87  ?  743  PHE A CD1    1 
ATOM   3999 C  CD2    . PHE C 3 447 ? -1.042  45.691 49.408  1.00 28.72  ?  743  PHE A CD2    1 
ATOM   4000 C  CE1    . PHE C 3 447 ? 1.207   45.978 50.983  1.00 26.42  ?  743  PHE A CE1    1 
ATOM   4001 C  CE2    . PHE C 3 447 ? -0.369  46.901 49.436  1.00 33.47  ?  743  PHE A CE2    1 
ATOM   4002 C  CZ     . PHE C 3 447 ? 0.759   47.042 50.225  1.00 37.17  ?  743  PHE A CZ     1 
ATOM   4003 N  N      . PRO C 3 448 ? -4.366  41.877 51.822  1.00 31.23  ?  744  PRO A N      1 
ATOM   4004 C  CA     . PRO C 3 448 ? -5.117  40.612 51.873  1.00 33.44  ?  744  PRO A CA     1 
ATOM   4005 C  C      . PRO C 3 448 ? -5.593  40.128 50.514  1.00 22.07  ?  744  PRO A C      1 
ATOM   4006 O  O      . PRO C 3 448 ? -5.766  38.919 50.328  1.00 21.03  ?  744  PRO A O      1 
ATOM   4007 C  CB     . PRO C 3 448 ? -6.296  40.944 52.800  1.00 30.56  ?  744  PRO A CB     1 
ATOM   4008 C  CG     . PRO C 3 448 ? -6.431  42.440 52.720  1.00 28.96  ?  744  PRO A CG     1 
ATOM   4009 C  CD     . PRO C 3 448 ? -5.029  42.949 52.587  1.00 26.79  ?  744  PRO A CD     1 
ATOM   4010 N  N      . GLY C 3 449 ? -5.817  41.032 49.560  1.00 22.70  ?  745  GLY A N      1 
ATOM   4011 C  CA     . GLY C 3 449 ? -6.203  40.605 48.227  1.00 24.10  ?  745  GLY A CA     1 
ATOM   4012 C  C      . GLY C 3 449 ? -5.072  39.928 47.481  1.00 22.08  ?  745  GLY A C      1 
ATOM   4013 O  O      . GLY C 3 449 ? -5.307  39.027 46.671  1.00 20.66  ?  745  GLY A O      1 
ATOM   4014 N  N      . VAL C 3 450 ? -3.833  40.352 47.730  1.00 27.89  ?  746  VAL A N      1 
ATOM   4015 C  CA     . VAL C 3 450 ? -2.704  39.644 47.141  1.00 23.62  ?  746  VAL A CA     1 
ATOM   4016 C  C      . VAL C 3 450 ? -2.596  38.245 47.732  1.00 18.20  ?  746  VAL A C      1 
ATOM   4017 O  O      . VAL C 3 450 ? -2.358  37.268 47.011  1.00 19.79  ?  746  VAL A O      1 
ATOM   4018 C  CB     . VAL C 3 450 ? -1.405  40.448 47.322  1.00 20.26  ?  746  VAL A CB     1 
ATOM   4019 C  CG1    . VAL C 3 450 ? -0.224  39.682 46.726  1.00 15.46  ?  746  VAL A CG1    1 
ATOM   4020 C  CG2    . VAL C 3 450 ? -1.535  41.809 46.655  1.00 19.30  ?  746  VAL A CG2    1 
ATOM   4021 N  N      . LYS C 3 451 ? -2.788  38.118 49.047  1.00 18.14  ?  747  LYS A N      1 
ATOM   4022 C  CA     . LYS C 3 451 ? -2.741  36.802 49.672  1.00 24.36  ?  747  LYS A CA     1 
ATOM   4023 C  C      . LYS C 3 451 ? -3.841  35.905 49.122  1.00 27.84  ?  747  LYS A C      1 
ATOM   4024 O  O      . LYS C 3 451 ? -3.611  34.727 48.827  1.00 24.12  ?  747  LYS A O      1 
ATOM   4025 C  CB     . LYS C 3 451 ? -2.863  36.933 51.189  1.00 21.92  ?  747  LYS A CB     1 
ATOM   4026 C  CG     . LYS C 3 451 ? -2.878  35.586 51.913  1.00 25.27  ?  747  LYS A CG     1 
ATOM   4027 C  CD     . LYS C 3 451 ? -3.062  35.751 53.409  1.00 35.58  ?  747  LYS A CD     1 
ATOM   4028 C  CE     . LYS C 3 451 ? -3.103  34.397 54.104  1.00 40.30  ?  747  LYS A CE     1 
ATOM   4029 N  NZ     . LYS C 3 451 ? -3.498  34.526 55.530  1.00 44.13  ?  747  LYS A NZ     1 
ATOM   4030 N  N      . ARG C 3 452 ? -5.051  36.449 48.987  1.00 24.48  ?  748  ARG A N      1 
ATOM   4031 C  CA     . ARG C 3 452 ? -6.135  35.691 48.373  1.00 27.21  ?  748  ARG A CA     1 
ATOM   4032 C  C      . ARG C 3 452 ? -5.770  35.262 46.955  1.00 31.67  ?  748  ARG A C      1 
ATOM   4033 O  O      . ARG C 3 452 ? -6.030  34.119 46.558  1.00 27.00  ?  748  ARG A O      1 
ATOM   4034 C  CB     . ARG C 3 452 ? -7.419  36.523 48.393  1.00 26.29  ?  748  ARG A CB     1 
ATOM   4035 C  CG     . ARG C 3 452 ? -8.439  36.142 47.339  1.00 40.22  ?  748  ARG A CG     1 
ATOM   4036 C  CD     . ARG C 3 452 ? -9.678  37.025 47.423  1.00 58.29  ?  748  ARG A CD     1 
ATOM   4037 N  NE     . ARG C 3 452 ? -10.500 36.913 46.222  1.00 65.62  ?  748  ARG A NE     1 
ATOM   4038 C  CZ     . ARG C 3 452 ? -11.427 35.979 46.031  1.00 63.15  ?  748  ARG A CZ     1 
ATOM   4039 N  NH1    . ARG C 3 452 ? -11.659 35.066 46.966  1.00 61.66  ?  748  ARG A NH1    1 
ATOM   4040 N  NH2    . ARG C 3 452 ? -12.122 35.956 44.901  1.00 54.42  ?  748  ARG A NH2    1 
ATOM   4041 N  N      . TYR C 3 453 ? -5.144  36.155 46.182  1.00 22.63  ?  749  TYR A N      1 
ATOM   4042 C  CA     . TYR C 3 453 ? -4.762  35.795 44.822  1.00 25.03  ?  749  TYR A CA     1 
ATOM   4043 C  C      . TYR C 3 453 ? -3.692  34.708 44.812  1.00 26.33  ?  749  TYR A C      1 
ATOM   4044 O  O      . TYR C 3 453 ? -3.748  33.787 43.989  1.00 24.61  ?  749  TYR A O      1 
ATOM   4045 C  CB     . TYR C 3 453 ? -4.277  37.026 44.050  1.00 18.14  ?  749  TYR A CB     1 
ATOM   4046 C  CG     . TYR C 3 453 ? -3.432  36.631 42.867  1.00 25.76  ?  749  TYR A CG     1 
ATOM   4047 C  CD1    . TYR C 3 453 ? -4.017  36.236 41.674  1.00 22.92  ?  749  TYR A CD1    1 
ATOM   4048 C  CD2    . TYR C 3 453 ? -2.047  36.601 42.961  1.00 25.49  ?  749  TYR A CD2    1 
ATOM   4049 C  CE1    . TYR C 3 453 ? -3.244  35.841 40.597  1.00 29.33  ?  749  TYR A CE1    1 
ATOM   4050 C  CE2    . TYR C 3 453 ? -1.268  36.211 41.895  1.00 28.08  ?  749  TYR A CE2    1 
ATOM   4051 C  CZ     . TYR C 3 453 ? -1.869  35.833 40.715  1.00 28.55  ?  749  TYR A CZ     1 
ATOM   4052 O  OH     . TYR C 3 453 ? -1.084  35.446 39.654  1.00 33.43  ?  749  TYR A OH     1 
ATOM   4053 N  N      . MET C 3 454 ? -2.700  34.807 45.704  1.00 17.94  ?  750  MET A N      1 
ATOM   4054 C  CA     . MET C 3 454 ? -1.652  33.792 45.762  1.00 19.37  ?  750  MET A CA     1 
ATOM   4055 C  C      . MET C 3 454 ? -2.228  32.427 46.114  1.00 24.75  ?  750  MET A C      1 
ATOM   4056 O  O      . MET C 3 454 ? -1.830  31.410 45.537  1.00 23.26  ?  750  MET A O      1 
ATOM   4057 C  CB     . MET C 3 454 ? -0.577  34.186 46.777  1.00 20.82  ?  750  MET A CB     1 
ATOM   4058 C  CG     . MET C 3 454 ? 0.163   35.478 46.455  1.00 36.36  ?  750  MET A CG     1 
ATOM   4059 S  SD     . MET C 3 454 ? 1.047   35.413 44.879  1.00 42.98  ?  750  MET A SD     1 
ATOM   4060 C  CE     . MET C 3 454 ? 1.738   37.064 44.790  1.00 48.60  ?  750  MET A CE     1 
ATOM   4061 N  N      . GLU C 3 455 ? -3.163  32.381 47.063  1.00 23.70  ?  751  GLU A N      1 
ATOM   4062 C  CA     . GLU C 3 455 ? -3.792  31.106 47.386  1.00 33.55  ?  751  GLU A CA     1 
ATOM   4063 C  C      . GLU C 3 455 ? -4.688  30.626 46.248  1.00 28.45  ?  751  GLU A C      1 
ATOM   4064 O  O      . GLU C 3 455 ? -4.679  29.437 45.910  1.00 25.82  ?  751  GLU A O      1 
ATOM   4065 C  CB     . GLU C 3 455 ? -4.577  31.226 48.689  1.00 34.55  ?  751  GLU A CB     1 
ATOM   4066 C  CG     . GLU C 3 455 ? -3.780  31.870 49.811  1.00 38.31  ?  751  GLU A CG     1 
ATOM   4067 C  CD     . GLU C 3 455 ? -4.622  32.163 51.036  1.00 50.14  ?  751  GLU A CD     1 
ATOM   4068 O  OE1    . GLU C 3 455 ? -4.260  31.700 52.139  1.00 51.63  ?  751  GLU A OE1    1 
ATOM   4069 O  OE2    . GLU C 3 455 ? -5.651  32.855 50.890  1.00 46.23  ?  751  GLU A OE2    1 
ATOM   4070 N  N      . ASN C 3 456 ? -5.449  31.530 45.623  1.00 25.94  ?  752  ASN A N      1 
ATOM   4071 C  CA     . ASN C 3 456 ? -6.406  31.093 44.607  1.00 28.49  ?  752  ASN A CA     1 
ATOM   4072 C  C      . ASN C 3 456 ? -5.711  30.617 43.339  1.00 27.74  ?  752  ASN A C      1 
ATOM   4073 O  O      . ASN C 3 456 ? -6.192  29.689 42.677  1.00 26.74  ?  752  ASN A O      1 
ATOM   4074 C  CB     . ASN C 3 456 ? -7.385  32.211 44.262  1.00 29.61  ?  752  ASN A CB     1 
ATOM   4075 C  CG     . ASN C 3 456 ? -8.423  32.425 45.337  1.00 27.95  ?  752  ASN A CG     1 
ATOM   4076 O  OD1    . ASN C 3 456 ? -8.547  31.630 46.264  1.00 34.78  ?  752  ASN A OD1    1 
ATOM   4077 N  ND2    . ASN C 3 456 ? -9.182  33.506 45.215  1.00 37.02  ?  752  ASN A ND2    1 
ATOM   4078 N  N      . ILE C 3 457 ? -4.599  31.254 42.965  1.00 19.12  ?  753  ILE A N      1 
ATOM   4079 C  CA     . ILE C 3 457 ? -3.938  30.887 41.719  1.00 23.55  ?  753  ILE A CA     1 
ATOM   4080 C  C      . ILE C 3 457 ? -3.233  29.546 41.869  1.00 26.12  ?  753  ILE A C      1 
ATOM   4081 O  O      . ILE C 3 457 ? -3.161  28.758 40.920  1.00 21.38  ?  753  ILE A O      1 
ATOM   4082 C  CB     . ILE C 3 457 ? -2.971  31.998 41.275  1.00 16.88  ?  753  ILE A CB     1 
ATOM   4083 C  CG1    . ILE C 3 457 ? -2.516  31.759 39.837  1.00 24.82  ?  753  ILE A CG1    1 
ATOM   4084 C  CG2    . ILE C 3 457 ? -1.774  32.054 42.188  1.00 23.81  ?  753  ILE A CG2    1 
ATOM   4085 C  CD1    . ILE C 3 457 ? -3.634  31.823 38.831  1.00 27.65  ?  753  ILE A CD1    1 
ATOM   4086 N  N      . VAL C 3 458 ? -2.699  29.267 43.058  1.00 27.37  ?  754  VAL A N      1 
ATOM   4087 C  CA     . VAL C 3 458 ? -2.119  27.955 43.318  1.00 19.97  ?  754  VAL A CA     1 
ATOM   4088 C  C      . VAL C 3 458 ? -3.188  26.878 43.210  1.00 24.55  ?  754  VAL A C      1 
ATOM   4089 O  O      . VAL C 3 458 ? -2.964  25.811 42.626  1.00 22.01  ?  754  VAL A O      1 
ATOM   4090 C  CB     . VAL C 3 458 ? -1.438  27.931 44.696  1.00 27.02  ?  754  VAL A CB     1 
ATOM   4091 C  CG1    . VAL C 3 458 ? -1.269  26.492 45.166  1.00 25.57  ?  754  VAL A CG1    1 
ATOM   4092 C  CG2    . VAL C 3 458 ? -0.101  28.644 44.637  1.00 26.17  ?  754  VAL A CG2    1 
ATOM   4093 N  N      . GLN C 3 459 ? -4.364  27.133 43.785  1.00 22.78  ?  755  GLN A N      1 
ATOM   4094 C  CA     . GLN C 3 459 ? -5.430  26.143 43.712  1.00 22.00  ?  755  GLN A CA     1 
ATOM   4095 C  C      . GLN C 3 459 ? -5.945  25.998 42.287  1.00 21.75  ?  755  GLN A C      1 
ATOM   4096 O  O      . GLN C 3 459 ? -6.324  24.897 41.868  1.00 24.03  ?  755  GLN A O      1 
ATOM   4097 C  CB     . GLN C 3 459 ? -6.564  26.510 44.669  1.00 29.19  ?  755  GLN A CB     1 
ATOM   4098 C  CG     . GLN C 3 459 ? -6.224  26.269 46.134  1.00 53.72  ?  755  GLN A CG     1 
ATOM   4099 C  CD     . GLN C 3 459 ? -5.680  24.869 46.390  1.00 63.97  ?  755  GLN A CD     1 
ATOM   4100 O  OE1    . GLN C 3 459 ? -6.357  23.871 46.140  1.00 64.74  ?  755  GLN A OE1    1 
ATOM   4101 N  NE2    . GLN C 3 459 ? -4.447  24.791 46.885  1.00 64.71  ?  755  GLN A NE2    1 
ATOM   4102 N  N      . GLU C 3 460 ? -5.956  27.095 41.526  1.00 20.18  ?  756  GLU A N      1 
ATOM   4103 C  CA     . GLU C 3 460 ? -6.336  27.022 40.120  1.00 28.13  ?  756  GLU A CA     1 
ATOM   4104 C  C      . GLU C 3 460 ? -5.297  26.257 39.309  1.00 20.26  ?  756  GLU A C      1 
ATOM   4105 O  O      . GLU C 3 460 ? -5.646  25.505 38.393  1.00 26.61  ?  756  GLU A O      1 
ATOM   4106 C  CB     . GLU C 3 460 ? -6.526  28.430 39.558  1.00 23.69  ?  756  GLU A CB     1 
ATOM   4107 C  CG     . GLU C 3 460 ? -6.935  28.458 38.106  1.00 34.40  ?  756  GLU A CG     1 
ATOM   4108 C  CD     . GLU C 3 460 ? -7.078  29.867 37.560  1.00 55.13  ?  756  GLU A CD     1 
ATOM   4109 O  OE1    . GLU C 3 460 ? -6.655  30.826 38.241  1.00 52.90  ?  756  GLU A OE1    1 
ATOM   4110 O  OE2    . GLU C 3 460 ? -7.617  30.015 36.443  1.00 60.42  ?  756  GLU A OE2    1 
ATOM   4111 N  N      . ALA C 3 461 ? -4.013  26.453 39.616  1.00 24.08  ?  757  ALA A N      1 
ATOM   4112 C  CA     . ALA C 3 461 ? -2.975  25.685 38.938  1.00 24.78  ?  757  ALA A CA     1 
ATOM   4113 C  C      . ALA C 3 461 ? -3.153  24.190 39.178  1.00 24.91  ?  757  ALA A C      1 
ATOM   4114 O  O      . ALA C 3 461 ? -2.978  23.381 38.258  1.00 19.97  ?  757  ALA A O      1 
ATOM   4115 C  CB     . ALA C 3 461 ? -1.596  26.148 39.403  1.00 24.04  ?  757  ALA A CB     1 
ATOM   4116 N  N      . LYS C 3 462 ? -3.513  23.806 40.409  1.00 20.93  ?  758  LYS A N      1 
ATOM   4117 C  CA     . LYS C 3 462 ? -3.709  22.395 40.735  1.00 30.02  ?  758  LYS A CA     1 
ATOM   4118 C  C      . LYS C 3 462 ? -4.947  21.826 40.054  1.00 27.44  ?  758  LYS A C      1 
ATOM   4119 O  O      . LYS C 3 462 ? -4.942  20.669 39.618  1.00 25.97  ?  758  LYS A O      1 
ATOM   4120 C  CB     . LYS C 3 462 ? -3.833  22.205 42.250  1.00 33.68  ?  758  LYS A CB     1 
ATOM   4121 C  CG     . LYS C 3 462 ? -2.639  22.662 43.072  1.00 40.44  ?  758  LYS A CG     1 
ATOM   4122 C  CD     . LYS C 3 462 ? -2.816  22.291 44.547  1.00 51.17  ?  758  LYS A CD     1 
ATOM   4123 C  CE     . LYS C 3 462 ? -1.861  23.068 45.454  1.00 51.92  ?  758  LYS A CE     1 
ATOM   4124 N  NZ     . LYS C 3 462 ? -0.414  22.769 45.229  1.00 49.21  ?  758  LYS A NZ     1 
ATOM   4125 N  N      . GLN C 3 463 ? -6.029  22.607 39.987  1.00 20.61  ?  759  GLN A N      1 
ATOM   4126 C  CA     . GLN C 3 463 ? -7.276  22.090 39.429  1.00 28.46  ?  759  GLN A CA     1 
ATOM   4127 C  C      . GLN C 3 463 ? -7.205  22.010 37.911  1.00 24.16  ?  759  GLN A C      1 
ATOM   4128 O  O      . GLN C 3 463 ? -7.557  20.986 37.319  1.00 26.26  ?  759  GLN A O      1 
ATOM   4129 C  CB     . GLN C 3 463 ? -8.455  22.961 39.866  1.00 27.56  ?  759  GLN A CB     1 
ATOM   4130 C  CG     . GLN C 3 463 ? -9.799  22.549 39.272  1.00 34.51  ?  759  GLN A CG     1 
ATOM   4131 C  CD     . GLN C 3 463 ? -10.252 23.439 38.122  1.00 38.87  ?  759  GLN A CD     1 
ATOM   4132 O  OE1    . GLN C 3 463 ? -10.350 24.657 38.266  1.00 44.66  ?  759  GLN A OE1    1 
ATOM   4133 N  NE2    . GLN C 3 463 ? -10.536 22.827 36.971  1.00 34.39  ?  759  GLN A NE2    1 
ATOM   4134 N  N      . LYS C 3 464 ? -6.761  23.081 37.263  1.00 24.36  ?  760  LYS A N      1 
ATOM   4135 C  CA     . LYS C 3 464 ? -6.728  23.090 35.807  1.00 26.33  ?  760  LYS A CA     1 
ATOM   4136 C  C      . LYS C 3 464 ? -5.452  22.481 35.240  1.00 21.51  ?  760  LYS A C      1 
ATOM   4137 O  O      . LYS C 3 464 ? -5.479  21.923 34.136  1.00 23.17  ?  760  LYS A O      1 
ATOM   4138 C  CB     . LYS C 3 464 ? -6.908  24.519 35.292  1.00 27.47  ?  760  LYS A CB     1 
ATOM   4139 C  CG     . LYS C 3 464 ? -8.274  25.092 35.607  1.00 37.83  ?  760  LYS A CG     1 
ATOM   4140 C  CD     . LYS C 3 464 ? -8.484  26.444 34.962  1.00 47.05  ?  760  LYS A CD     1 
ATOM   4141 C  CE     . LYS C 3 464 ? -9.905  26.927 35.186  1.00 54.40  ?  760  LYS A CE     1 
ATOM   4142 N  NZ     . LYS C 3 464 ? -10.066 28.362 34.839  1.00 58.39  ?  760  LYS A NZ     1 
ATOM   4143 N  N      . GLY C 3 465 ? -4.346  22.544 35.977  1.00 21.39  ?  761  GLY A N      1 
ATOM   4144 C  CA     . GLY C 3 465 ? -3.073  22.058 35.490  1.00 21.89  ?  761  GLY A CA     1 
ATOM   4145 C  C      . GLY C 3 465 ? -2.184  23.120 34.886  1.00 24.18  ?  761  GLY A C      1 
ATOM   4146 O  O      . GLY C 3 465 ? -1.049  22.810 34.501  1.00 23.87  ?  761  GLY A O      1 
ATOM   4147 N  N      . TYR C 3 466 ? -2.656  24.361 34.813  1.00 16.03  ?  762  TYR A N      1 
ATOM   4148 C  CA     . TYR C 3 466 ? -1.916  25.455 34.203  1.00 19.10  ?  762  TYR A CA     1 
ATOM   4149 C  C      . TYR C 3 466 ? -2.432  26.762 34.788  1.00 19.40  ?  762  TYR A C      1 
ATOM   4150 O  O      . TYR C 3 466 ? -3.473  26.803 35.446  1.00 24.30  ?  762  TYR A O      1 
ATOM   4151 C  CB     . TYR C 3 466 ? -2.067  25.445 32.680  1.00 24.88  ?  762  TYR A CB     1 
ATOM   4152 C  CG     . TYR C 3 466 ? -3.500  25.585 32.218  1.00 15.57  ?  762  TYR A CG     1 
ATOM   4153 C  CD1    . TYR C 3 466 ? -4.047  26.837 31.950  1.00 21.44  ?  762  TYR A CD1    1 
ATOM   4154 C  CD2    . TYR C 3 466 ? -4.309  24.467 32.050  1.00 24.33  ?  762  TYR A CD2    1 
ATOM   4155 C  CE1    . TYR C 3 466 ? -5.365  26.968 31.528  1.00 22.49  ?  762  TYR A CE1    1 
ATOM   4156 C  CE2    . TYR C 3 466 ? -5.623  24.590 31.628  1.00 29.28  ?  762  TYR A CE2    1 
ATOM   4157 C  CZ     . TYR C 3 466 ? -6.144  25.840 31.369  1.00 29.67  ?  762  TYR A CZ     1 
ATOM   4158 O  OH     . TYR C 3 466 ? -7.450  25.953 30.954  1.00 27.69  ?  762  TYR A OH     1 
ATOM   4159 N  N      . VAL C 3 467 ? -1.679  27.831 34.542  1.00 19.56  ?  763  VAL A N      1 
ATOM   4160 C  CA     . VAL C 3 467 ? -2.117  29.193 34.811  1.00 18.86  ?  763  VAL A CA     1 
ATOM   4161 C  C      . VAL C 3 467 ? -2.064  29.950 33.491  1.00 22.11  ?  763  VAL A C      1 
ATOM   4162 O  O      . VAL C 3 467 ? -1.419  29.523 32.532  1.00 21.31  ?  763  VAL A O      1 
ATOM   4163 C  CB     . VAL C 3 467 ? -1.261  29.890 35.889  1.00 19.92  ?  763  VAL A CB     1 
ATOM   4164 C  CG1    . VAL C 3 467 ? -1.439  29.198 37.230  1.00 17.71  ?  763  VAL A CG1    1 
ATOM   4165 C  CG2    . VAL C 3 467 ? 0.208   29.897 35.484  1.00 14.93  ?  763  VAL A CG2    1 
ATOM   4166 N  N      . THR C 3 468 ? -2.772  31.075 33.438  1.00 16.77  ?  764  THR A N      1 
ATOM   4167 C  CA     . THR C 3 468 ? -2.863  31.855 32.214  1.00 22.85  ?  764  THR A CA     1 
ATOM   4168 C  C      . THR C 3 468 ? -2.555  33.317 32.509  1.00 23.66  ?  764  THR A C      1 
ATOM   4169 O  O      . THR C 3 468 ? -2.657  33.781 33.647  1.00 23.34  ?  764  THR A O      1 
ATOM   4170 C  CB     . THR C 3 468 ? -4.252  31.720 31.561  1.00 25.33  ?  764  THR A CB     1 
ATOM   4171 O  OG1    . THR C 3 468 ? -5.243  32.325 32.399  1.00 35.42  ?  764  THR A OG1    1 
ATOM   4172 C  CG2    . THR C 3 468 ? -4.602  30.252 31.369  1.00 22.50  ?  764  THR A CG2    1 
ATOM   4173 N  N      . THR C 3 469 ? -2.160  34.040 31.467  1.00 27.68  ?  765  THR A N      1 
ATOM   4174 C  CA     . THR C 3 469 ? -1.932  35.472 31.565  1.00 22.81  ?  765  THR A CA     1 
ATOM   4175 C  C      . THR C 3 469 ? -3.148  36.225 31.042  1.00 25.16  ?  765  THR A C      1 
ATOM   4176 O  O      . THR C 3 469 ? -4.139  35.638 30.604  1.00 23.02  ?  765  THR A O      1 
ATOM   4177 C  CB     . THR C 3 469 ? -0.689  35.885 30.781  1.00 20.03  ?  765  THR A CB     1 
ATOM   4178 O  OG1    . THR C 3 469 ? -0.938  35.683 29.384  1.00 20.43  ?  765  THR A OG1    1 
ATOM   4179 C  CG2    . THR C 3 469 ? 0.517   35.068 31.210  1.00 16.38  ?  765  THR A CG2    1 
ATOM   4180 N  N      . LEU C 3 470 ? -3.037  37.555 31.050  1.00 19.36  ?  766  LEU A N      1 
ATOM   4181 C  CA     . LEU C 3 470 ? -4.147  38.408 30.643  1.00 25.16  ?  766  LEU A CA     1 
ATOM   4182 C  C      . LEU C 3 470 ? -4.600  38.104 29.222  1.00 22.26  ?  766  LEU A C      1 
ATOM   4183 O  O      . LEU C 3 470 ? -5.798  38.165 28.919  1.00 28.45  ?  766  LEU A O      1 
ATOM   4184 C  CB     . LEU C 3 470 ? -3.740  39.874 30.762  1.00 31.58  ?  766  LEU A CB     1 
ATOM   4185 C  CG     . LEU C 3 470 ? -4.840  40.858 31.148  1.00 54.71  ?  766  LEU A CG     1 
ATOM   4186 C  CD1    . LEU C 3 470 ? -5.160  40.729 32.632  1.00 51.31  ?  766  LEU A CD1    1 
ATOM   4187 C  CD2    . LEU C 3 470 ? -4.436  42.281 30.791  1.00 61.91  ?  766  LEU A CD2    1 
ATOM   4188 N  N      . LEU C 3 471 ? -3.659  37.781 28.333  1.00 20.96  ?  767  LEU A N      1 
ATOM   4189 C  CA     . LEU C 3 471 ? -3.959  37.534 26.929  1.00 33.00  ?  767  LEU A CA     1 
ATOM   4190 C  C      . LEU C 3 471 ? -3.996  36.048 26.591  1.00 25.24  ?  767  LEU A C      1 
ATOM   4191 O  O      . LEU C 3 471 ? -3.919  35.681 25.413  1.00 23.44  ?  767  LEU A O      1 
ATOM   4192 C  CB     . LEU C 3 471 ? -2.955  38.267 26.037  1.00 29.96  ?  767  LEU A CB     1 
ATOM   4193 C  CG     . LEU C 3 471 ? -3.021  39.799 26.110  1.00 32.31  ?  767  LEU A CG     1 
ATOM   4194 C  CD1    . LEU C 3 471 ? -2.191  40.442 25.010  1.00 33.38  ?  767  LEU A CD1    1 
ATOM   4195 C  CD2    . LEU C 3 471 ? -4.468  40.292 26.058  1.00 26.60  ?  767  LEU A CD2    1 
ATOM   4196 N  N      . HIS C 3 472 ? -4.110  35.188 27.601  1.00 17.96  ?  768  HIS A N      1 
ATOM   4197 C  CA     . HIS C 3 472 ? -4.392  33.765 27.461  1.00 18.39  ?  768  HIS A CA     1 
ATOM   4198 C  C      . HIS C 3 472 ? -3.152  32.944 27.145  1.00 20.93  ?  768  HIS A C      1 
ATOM   4199 O  O      . HIS C 3 472 ? -3.277  31.806 26.680  1.00 18.47  ?  768  HIS A O      1 
ATOM   4200 C  CB     . HIS C 3 472 ? -5.460  33.502 26.395  1.00 24.35  ?  768  HIS A CB     1 
ATOM   4201 C  CG     . HIS C 3 472 ? -6.747  34.220 26.654  1.00 41.79  ?  768  HIS A CG     1 
ATOM   4202 N  ND1    . HIS C 3 472 ? -7.091  34.701 27.899  1.00 44.13  ?  768  HIS A ND1    1 
ATOM   4203 C  CD2    . HIS C 3 472 ? -7.768  34.550 25.828  1.00 43.68  ?  768  HIS A CD2    1 
ATOM   4204 C  CE1    . HIS C 3 472 ? -8.271  35.291 27.831  1.00 42.20  ?  768  HIS A CE1    1 
ATOM   4205 N  NE2    . HIS C 3 472 ? -8.703  35.214 26.586  1.00 47.01  ?  768  HIS A NE2    1 
ATOM   4206 N  N      . ARG C 3 473 ? -1.959  33.478 27.366  1.00 14.07  ?  769  ARG A N      1 
ATOM   4207 C  CA     . ARG C 3 473 ? -0.796  32.611 27.401  1.00 18.07  ?  769  ARG A CA     1 
ATOM   4208 C  C      . ARG C 3 473 ? -0.957  31.659 28.573  1.00 14.60  ?  769  ARG A C      1 
ATOM   4209 O  O      . ARG C 3 473 ? -1.512  32.023 29.611  1.00 21.36  ?  769  ARG A O      1 
ATOM   4210 C  CB     . ARG C 3 473 ? 0.481   33.431 27.543  1.00 19.80  ?  769  ARG A CB     1 
ATOM   4211 C  CG     . ARG C 3 473 ? 1.756   32.640 27.334  1.00 32.84  ?  769  ARG A CG     1 
ATOM   4212 C  CD     . ARG C 3 473 ? 2.946   33.569 27.419  1.00 37.88  ?  769  ARG A CD     1 
ATOM   4213 N  NE     . ARG C 3 473 ? 2.649   34.850 26.784  1.00 33.86  ?  769  ARG A NE     1 
ATOM   4214 C  CZ     . ARG C 3 473 ? 2.948   35.147 25.523  1.00 24.98  ?  769  ARG A CZ     1 
ATOM   4215 N  NH1    . ARG C 3 473 ? 3.564   34.255 24.757  1.00 25.70  ?  769  ARG A NH1    1 
ATOM   4216 N  NH2    . ARG C 3 473 ? 2.637   36.339 25.032  1.00 19.83  ?  769  ARG A NH2    1 
ATOM   4217 N  N      . ARG C 3 474 ? -0.530  30.421 28.404  1.00 18.54  ?  770  ARG A N      1 
ATOM   4218 C  CA     . ARG C 3 474 ? -0.660  29.499 29.513  1.00 25.24  ?  770  ARG A CA     1 
ATOM   4219 C  C      . ARG C 3 474 ? 0.683   28.860 29.808  1.00 28.97  ?  770  ARG A C      1 
ATOM   4220 O  O      . ARG C 3 474 ? 1.600   28.854 28.982  1.00 17.44  ?  770  ARG A O      1 
ATOM   4221 C  CB     . ARG C 3 474 ? -1.747  28.440 29.271  1.00 21.08  ?  770  ARG A CB     1 
ATOM   4222 C  CG     . ARG C 3 474 ? -1.582  27.531 28.085  1.00 33.40  ?  770  ARG A CG     1 
ATOM   4223 C  CD     . ARG C 3 474 ? -2.621  26.404 28.139  1.00 36.75  ?  770  ARG A CD     1 
ATOM   4224 N  NE     . ARG C 3 474 ? -3.996  26.881 27.995  1.00 29.55  ?  770  ARG A NE     1 
ATOM   4225 C  CZ     . ARG C 3 474 ? -5.067  26.090 27.998  1.00 25.29  ?  770  ARG A CZ     1 
ATOM   4226 N  NH1    . ARG C 3 474 ? -4.930  24.778 28.156  1.00 25.09  ?  770  ARG A NH1    1 
ATOM   4227 N  NH2    . ARG C 3 474 ? -6.280  26.605 27.852  1.00 28.45  ?  770  ARG A NH2    1 
ATOM   4228 N  N      . ARG C 3 475 ? 0.794   28.362 31.033  1.00 20.67  ?  771  ARG A N      1 
ATOM   4229 C  CA     . ARG C 3 475 ? 1.985   27.657 31.476  1.00 19.20  ?  771  ARG A CA     1 
ATOM   4230 C  C      . ARG C 3 475 ? 1.536   26.464 32.298  1.00 18.33  ?  771  ARG A C      1 
ATOM   4231 O  O      . ARG C 3 475 ? 0.927   26.637 33.357  1.00 20.16  ?  771  ARG A O      1 
ATOM   4232 C  CB     . ARG C 3 475 ? 2.896   28.570 32.299  1.00 16.06  ?  771  ARG A CB     1 
ATOM   4233 C  CG     . ARG C 3 475 ? 4.128   27.860 32.833  1.00 15.47  ?  771  ARG A CG     1 
ATOM   4234 C  CD     . ARG C 3 475 ? 4.993   28.816 33.620  1.00 26.34  ?  771  ARG A CD     1 
ATOM   4235 N  NE     . ARG C 3 475 ? 6.254   28.194 33.998  1.00 23.58  ?  771  ARG A NE     1 
ATOM   4236 C  CZ     . ARG C 3 475 ? 7.288   28.858 34.498  1.00 26.73  ?  771  ARG A CZ     1 
ATOM   4237 N  NH1    . ARG C 3 475 ? 7.210   30.167 34.676  1.00 24.15  ?  771  ARG A NH1    1 
ATOM   4238 N  NH2    . ARG C 3 475 ? 8.402   28.210 34.810  1.00 25.74  ?  771  ARG A NH2    1 
ATOM   4239 N  N      . TYR C 3 476 ? 1.811   25.264 31.800  1.00 16.38  ?  772  TYR A N      1 
ATOM   4240 C  CA     . TYR C 3 476 ? 1.450   24.051 32.514  1.00 27.53  ?  772  TYR A CA     1 
ATOM   4241 C  C      . TYR C 3 476 ? 2.390   23.853 33.691  1.00 22.91  ?  772  TYR A C      1 
ATOM   4242 O  O      . TYR C 3 476 ? 3.594   24.094 33.588  1.00 21.08  ?  772  TYR A O      1 
ATOM   4243 C  CB     . TYR C 3 476 ? 1.483   22.849 31.567  1.00 20.14  ?  772  TYR A CB     1 
ATOM   4244 C  CG     . TYR C 3 476 ? 0.367   22.930 30.553  1.00 27.76  ?  772  TYR A CG     1 
ATOM   4245 C  CD1    . TYR C 3 476 ? 0.578   23.503 29.309  1.00 30.14  ?  772  TYR A CD1    1 
ATOM   4246 C  CD2    . TYR C 3 476 ? -0.912  22.474 30.858  1.00 23.36  ?  772  TYR A CD2    1 
ATOM   4247 C  CE1    . TYR C 3 476 ? -0.439  23.604 28.391  1.00 24.74  ?  772  TYR A CE1    1 
ATOM   4248 C  CE2    . TYR C 3 476 ? -1.938  22.574 29.944  1.00 24.93  ?  772  TYR A CE2    1 
ATOM   4249 C  CZ     . TYR C 3 476 ? -1.694  23.144 28.710  1.00 20.77  ?  772  TYR A CZ     1 
ATOM   4250 O  OH     . TYR C 3 476 ? -2.702  23.249 27.777  1.00 26.33  ?  772  TYR A OH     1 
ATOM   4251 N  N      . LEU C 3 477 ? 1.825   23.440 34.826  1.00 17.83  ?  773  LEU A N      1 
ATOM   4252 C  CA     . LEU C 3 477 ? 2.568   23.304 36.079  1.00 22.22  ?  773  LEU A CA     1 
ATOM   4253 C  C      . LEU C 3 477 ? 2.372   21.896 36.630  1.00 24.56  ?  773  LEU A C      1 
ATOM   4254 O  O      . LEU C 3 477 ? 1.753   21.700 37.686  1.00 26.74  ?  773  LEU A O      1 
ATOM   4255 C  CB     . LEU C 3 477 ? 2.140   24.364 37.091  1.00 26.18  ?  773  LEU A CB     1 
ATOM   4256 C  CG     . LEU C 3 477 ? 2.581   25.782 36.715  1.00 28.61  ?  773  LEU A CG     1 
ATOM   4257 C  CD1    . LEU C 3 477 ? 1.915   26.836 37.597  1.00 26.67  ?  773  LEU A CD1    1 
ATOM   4258 C  CD2    . LEU C 3 477 ? 4.102   25.903 36.780  1.00 27.52  ?  773  LEU A CD2    1 
ATOM   4259 N  N      . PRO C 3 478 ? 2.918   20.891 35.946  1.00 22.58  ?  774  PRO A N      1 
ATOM   4260 C  CA     . PRO C 3 478 ? 2.740   19.505 36.402  1.00 36.38  ?  774  PRO A CA     1 
ATOM   4261 C  C      . PRO C 3 478 ? 3.357   19.223 37.760  1.00 34.07  ?  774  PRO A C      1 
ATOM   4262 O  O      . PRO C 3 478 ? 2.848   18.364 38.489  1.00 29.15  ?  774  PRO A O      1 
ATOM   4263 C  CB     . PRO C 3 478 ? 3.420   18.694 35.292  1.00 24.75  ?  774  PRO A CB     1 
ATOM   4264 C  CG     . PRO C 3 478 ? 4.420   19.628 34.704  1.00 32.66  ?  774  PRO A CG     1 
ATOM   4265 C  CD     . PRO C 3 478 ? 3.790   20.983 34.764  1.00 35.14  ?  774  PRO A CD     1 
ATOM   4266 N  N      . ASP C 3 479 ? 4.432   19.920 38.129  1.00 29.28  ?  775  ASP A N      1 
ATOM   4267 C  CA     . ASP C 3 479 ? 5.062   19.694 39.424  1.00 27.90  ?  775  ASP A CA     1 
ATOM   4268 C  C      . ASP C 3 479 ? 4.266   20.279 40.578  1.00 32.22  ?  775  ASP A C      1 
ATOM   4269 O  O      . ASP C 3 479 ? 4.695   20.142 41.731  1.00 32.78  ?  775  ASP A O      1 
ATOM   4270 C  CB     . ASP C 3 479 ? 6.480   20.277 39.438  1.00 38.01  ?  775  ASP A CB     1 
ATOM   4271 C  CG     . ASP C 3 479 ? 7.373   19.658 38.387  1.00 48.02  ?  775  ASP A CG     1 
ATOM   4272 O  OD1    . ASP C 3 479 ? 8.225   20.382 37.825  1.00 51.63  ?  775  ASP A OD1    1 
ATOM   4273 O  OD2    . ASP C 3 479 ? 7.212   18.453 38.109  1.00 56.22  ?  775  ASP A OD2    1 
ATOM   4274 N  N      . ILE C 3 480 ? 3.125   20.918 40.308  1.00 25.55  ?  776  ILE A N      1 
ATOM   4275 C  CA     . ILE C 3 480 ? 2.357   21.542 41.377  1.00 25.82  ?  776  ILE A CA     1 
ATOM   4276 C  C      . ILE C 3 480 ? 1.830   20.508 42.364  1.00 36.90  ?  776  ILE A C      1 
ATOM   4277 O  O      . ILE C 3 480 ? 1.528   20.846 43.513  1.00 45.56  ?  776  ILE A O      1 
ATOM   4278 C  CB     . ILE C 3 480 ? 1.208   22.387 40.782  1.00 34.33  ?  776  ILE A CB     1 
ATOM   4279 C  CG1    . ILE C 3 480 ? 0.770   23.453 41.781  1.00 41.77  ?  776  ILE A CG1    1 
ATOM   4280 C  CG2    . ILE C 3 480 ? 0.028   21.515 40.400  1.00 28.95  ?  776  ILE A CG2    1 
ATOM   4281 C  CD1    . ILE C 3 480 ? 0.784   24.843 41.206  1.00 39.34  ?  776  ILE A CD1    1 
ATOM   4282 N  N      . THR C 3 481 ? 1.714   19.249 41.946  1.00 41.89  ?  777  THR A N      1 
ATOM   4283 C  CA     . THR C 3 481 ? 1.275   18.172 42.823  1.00 53.13  ?  777  THR A CA     1 
ATOM   4284 C  C      . THR C 3 481 ? 2.429   17.354 43.393  1.00 60.45  ?  777  THR A C      1 
ATOM   4285 O  O      . THR C 3 481 ? 2.200   16.536 44.291  1.00 66.83  ?  777  THR A O      1 
ATOM   4286 C  CB     . THR C 3 481 ? 0.325   17.232 42.073  1.00 50.82  ?  777  THR A CB     1 
ATOM   4287 O  OG1    . THR C 3 481 ? 0.998   16.688 40.930  1.00 55.61  ?  777  THR A OG1    1 
ATOM   4288 C  CG2    . THR C 3 481 ? -0.919  17.980 41.613  1.00 52.25  ?  777  THR A CG2    1 
ATOM   4289 N  N      . SER C 3 482 ? 3.651   17.560 42.902  1.00 50.19  ?  778  SER A N      1 
ATOM   4290 C  CA     . SER C 3 482 ? 4.788   16.745 43.310  1.00 47.33  ?  778  SER A CA     1 
ATOM   4291 C  C      . SER C 3 482 ? 4.893   16.668 44.828  1.00 52.51  ?  778  SER A C      1 
ATOM   4292 O  O      . SER C 3 482 ? 4.548   17.608 45.550  1.00 55.02  ?  778  SER A O      1 
ATOM   4293 C  CB     . SER C 3 482 ? 6.084   17.311 42.729  1.00 46.39  ?  778  SER A CB     1 
ATOM   4294 O  OG     . SER C 3 482 ? 7.201   16.559 43.166  1.00 50.89  ?  778  SER A OG     1 
ATOM   4295 N  N      . ARG C 3 483 ? 5.380   15.529 45.312  1.00 55.90  ?  779  ARG A N      1 
ATOM   4296 C  CA     . ARG C 3 483 ? 5.555   15.315 46.740  1.00 60.28  ?  779  ARG A CA     1 
ATOM   4297 C  C      . ARG C 3 483 ? 6.915   15.773 47.250  1.00 59.32  ?  779  ARG A C      1 
ATOM   4298 O  O      . ARG C 3 483 ? 7.152   15.718 48.461  1.00 54.79  ?  779  ARG A O      1 
ATOM   4299 C  CB     . ARG C 3 483 ? 5.342   13.839 47.085  1.00 60.37  ?  779  ARG A CB     1 
ATOM   4300 C  CG     . ARG C 3 483 ? 3.891   13.392 47.017  1.00 66.19  ?  779  ARG A CG     1 
ATOM   4301 C  CD     . ARG C 3 483 ? 3.584   12.437 48.154  1.00 86.34  ?  779  ARG A CD     1 
ATOM   4302 N  NE     . ARG C 3 483 ? 3.157   11.123 47.683  1.00 91.69  ?  779  ARG A NE     1 
ATOM   4303 C  CZ     . ARG C 3 483 ? 3.161   10.027 48.435  1.00 90.41  ?  779  ARG A CZ     1 
ATOM   4304 N  NH1    . ARG C 3 483 ? 3.580   10.084 49.692  1.00 91.26  ?  779  ARG A NH1    1 
ATOM   4305 N  NH2    . ARG C 3 483 ? 2.753   8.870  47.928  1.00 86.61  ?  779  ARG A NH2    1 
ATOM   4306 N  N      . ASN C 3 484 ? 7.808   16.219 46.368  1.00 56.69  ?  780  ASN A N      1 
ATOM   4307 C  CA     . ASN C 3 484 ? 9.061   16.833 46.792  1.00 48.69  ?  780  ASN A CA     1 
ATOM   4308 C  C      . ASN C 3 484 ? 8.812   18.302 47.113  1.00 48.97  ?  780  ASN A C      1 
ATOM   4309 O  O      . ASN C 3 484 ? 8.360   19.064 46.251  1.00 50.54  ?  780  ASN A O      1 
ATOM   4310 C  CB     . ASN C 3 484 ? 10.131  16.689 45.712  1.00 48.94  ?  780  ASN A CB     1 
ATOM   4311 C  CG     . ASN C 3 484 ? 11.457  17.311 46.119  1.00 50.65  ?  780  ASN A CG     1 
ATOM   4312 O  OD1    . ASN C 3 484 ? 11.682  18.505 45.924  1.00 52.40  ?  780  ASN A OD1    1 
ATOM   4313 N  ND2    . ASN C 3 484 ? 12.341  16.502 46.689  1.00 54.70  ?  780  ASN A ND2    1 
ATOM   4314 N  N      . PHE C 3 485 ? 9.108   18.700 48.354  1.00 42.12  ?  781  PHE A N      1 
ATOM   4315 C  CA     . PHE C 3 485 ? 8.789   20.054 48.795  1.00 46.49  ?  781  PHE A CA     1 
ATOM   4316 C  C      . PHE C 3 485 ? 9.406   21.103 47.877  1.00 48.76  ?  781  PHE A C      1 
ATOM   4317 O  O      . PHE C 3 485 ? 8.772   22.118 47.567  1.00 45.61  ?  781  PHE A O      1 
ATOM   4318 C  CB     . PHE C 3 485 ? 9.259   20.266 50.235  1.00 40.42  ?  781  PHE A CB     1 
ATOM   4319 C  CG     . PHE C 3 485 ? 8.846   21.589 50.815  1.00 50.47  ?  781  PHE A CG     1 
ATOM   4320 C  CD1    . PHE C 3 485 ? 7.606   21.739 51.415  1.00 54.23  ?  781  PHE A CD1    1 
ATOM   4321 C  CD2    . PHE C 3 485 ? 9.693   22.684 50.756  1.00 50.06  ?  781  PHE A CD2    1 
ATOM   4322 C  CE1    . PHE C 3 485 ? 7.219   22.956 51.949  1.00 52.88  ?  781  PHE A CE1    1 
ATOM   4323 C  CE2    . PHE C 3 485 ? 9.311   23.906 51.288  1.00 50.13  ?  781  PHE A CE2    1 
ATOM   4324 C  CZ     . PHE C 3 485 ? 8.072   24.041 51.885  1.00 46.86  ?  781  PHE A CZ     1 
ATOM   4325 N  N      . ASN C 3 486 ? 10.644  20.880 47.435  1.00 45.89  ?  782  ASN A N      1 
ATOM   4326 C  CA     . ASN C 3 486 ? 11.318  21.888 46.623  1.00 49.55  ?  782  ASN A CA     1 
ATOM   4327 C  C      . ASN C 3 486 ? 10.718  21.969 45.226  1.00 44.71  ?  782  ASN A C      1 
ATOM   4328 O  O      . ASN C 3 486 ? 10.492  23.067 44.705  1.00 43.97  ?  782  ASN A O      1 
ATOM   4329 C  CB     . ASN C 3 486 ? 12.813  21.586 46.553  1.00 63.02  ?  782  ASN A CB     1 
ATOM   4330 C  CG     . ASN C 3 486 ? 13.477  21.637 47.911  1.00 70.59  ?  782  ASN A CG     1 
ATOM   4331 O  OD1    . ASN C 3 486 ? 13.146  22.481 48.745  1.00 69.56  ?  782  ASN A OD1    1 
ATOM   4332 N  ND2    . ASN C 3 486 ? 14.412  20.724 48.148  1.00 74.40  ?  782  ASN A ND2    1 
ATOM   4333 N  N      . VAL C 3 487 ? 10.452  20.820 44.603  1.00 46.59  ?  783  VAL A N      1 
ATOM   4334 C  CA     . VAL C 3 487 ? 9.865   20.830 43.267  1.00 47.47  ?  783  VAL A CA     1 
ATOM   4335 C  C      . VAL C 3 487 ? 8.465   21.429 43.308  1.00 42.96  ?  783  VAL A C      1 
ATOM   4336 O  O      . VAL C 3 487 ? 8.063   22.167 42.400  1.00 32.01  ?  783  VAL A O      1 
ATOM   4337 C  CB     . VAL C 3 487 ? 9.863   19.410 42.675  1.00 40.98  ?  783  VAL A CB     1 
ATOM   4338 C  CG1    . VAL C 3 487 ? 9.197   19.406 41.310  1.00 43.35  ?  783  VAL A CG1    1 
ATOM   4339 C  CG2    . VAL C 3 487 ? 11.286  18.879 42.584  1.00 43.84  ?  783  VAL A CG2    1 
ATOM   4340 N  N      . ARG C 3 488 ? 7.707   21.134 44.367  1.00 44.57  ?  784  ARG A N      1 
ATOM   4341 C  CA     . ARG C 3 488 ? 6.359   21.678 44.489  1.00 37.55  ?  784  ARG A CA     1 
ATOM   4342 C  C      . ARG C 3 488 ? 6.392   23.165 44.814  1.00 40.60  ?  784  ARG A C      1 
ATOM   4343 O  O      . ARG C 3 488 ? 5.565   23.934 44.311  1.00 35.96  ?  784  ARG A O      1 
ATOM   4344 C  CB     . ARG C 3 488 ? 5.577   20.913 45.557  1.00 28.74  ?  784  ARG A CB     1 
ATOM   4345 C  CG     . ARG C 3 488 ? 4.110   21.297 45.627  1.00 35.23  ?  784  ARG A CG     1 
ATOM   4346 C  CD     . ARG C 3 488 ? 3.353   20.505 46.679  1.00 49.63  ?  784  ARG A CD     1 
ATOM   4347 N  NE     . ARG C 3 488 ? 3.869   20.729 48.025  1.00 61.48  ?  784  ARG A NE     1 
ATOM   4348 C  CZ     . ARG C 3 488 ? 4.545   19.825 48.728  1.00 66.06  ?  784  ARG A CZ     1 
ATOM   4349 N  NH1    . ARG C 3 488 ? 4.784   18.625 48.214  1.00 69.55  ?  784  ARG A NH1    1 
ATOM   4350 N  NH2    . ARG C 3 488 ? 4.976   20.118 49.948  1.00 58.52  ?  784  ARG A NH2    1 
ATOM   4351 N  N      . SER C 3 489 ? 7.334   23.590 45.657  1.00 41.20  ?  785  SER A N      1 
ATOM   4352 C  CA     . SER C 3 489 ? 7.422   25.004 46.004  1.00 38.09  ?  785  SER A CA     1 
ATOM   4353 C  C      . SER C 3 489 ? 7.676   25.850 44.765  1.00 32.30  ?  785  SER A C      1 
ATOM   4354 O  O      . SER C 3 489 ? 6.997   26.856 44.534  1.00 33.08  ?  785  SER A O      1 
ATOM   4355 C  CB     . SER C 3 489 ? 8.521   25.219 47.042  1.00 48.00  ?  785  SER A CB     1 
ATOM   4356 O  OG     . SER C 3 489 ? 8.314   24.388 48.169  1.00 55.49  ?  785  SER A OG     1 
ATOM   4357 N  N      . PHE C 3 490 ? 8.646   25.446 43.944  1.00 36.56  ?  786  PHE A N      1 
ATOM   4358 C  CA     . PHE C 3 490 ? 8.931   26.188 42.723  1.00 35.12  ?  786  PHE A CA     1 
ATOM   4359 C  C      . PHE C 3 490 ? 7.698   26.266 41.830  1.00 31.13  ?  786  PHE A C      1 
ATOM   4360 O  O      . PHE C 3 490 ? 7.377   27.330 41.290  1.00 28.94  ?  786  PHE A O      1 
ATOM   4361 C  CB     . PHE C 3 490 ? 10.105  25.543 41.986  1.00 34.44  ?  786  PHE A CB     1 
ATOM   4362 C  CG     . PHE C 3 490 ? 10.513  26.277 40.743  1.00 37.24  ?  786  PHE A CG     1 
ATOM   4363 C  CD1    . PHE C 3 490 ? 10.236  25.754 39.491  1.00 32.99  ?  786  PHE A CD1    1 
ATOM   4364 C  CD2    . PHE C 3 490 ? 11.162  27.499 40.827  1.00 48.99  ?  786  PHE A CD2    1 
ATOM   4365 C  CE1    . PHE C 3 490 ? 10.606  26.433 38.344  1.00 33.85  ?  786  PHE A CE1    1 
ATOM   4366 C  CE2    . PHE C 3 490 ? 11.534  28.181 39.685  1.00 51.17  ?  786  PHE A CE2    1 
ATOM   4367 C  CZ     . PHE C 3 490 ? 11.256  27.645 38.442  1.00 49.71  ?  786  PHE A CZ     1 
ATOM   4368 N  N      . ALA C 3 491 ? 6.982   25.147 41.674  1.00 24.88  ?  787  ALA A N      1 
ATOM   4369 C  CA     . ALA C 3 491 ? 5.773   25.154 40.855  1.00 33.53  ?  787  ALA A CA     1 
ATOM   4370 C  C      . ALA C 3 491 ? 4.728   26.106 41.422  1.00 21.56  ?  787  ALA A C      1 
ATOM   4371 O  O      . ALA C 3 491 ? 4.039   26.803 40.668  1.00 22.38  ?  787  ALA A O      1 
ATOM   4372 C  CB     . ALA C 3 491 ? 5.200   23.740 40.738  1.00 27.12  ?  787  ALA A CB     1 
ATOM   4373 N  N      . GLU C 3 492 ? 4.579   26.141 42.747  1.00 27.89  ?  788  GLU A N      1 
ATOM   4374 C  CA     . GLU C 3 492 ? 3.637   27.086 43.335  1.00 31.63  ?  788  GLU A CA     1 
ATOM   4375 C  C      . GLU C 3 492 ? 4.068   28.522 43.065  1.00 28.23  ?  788  GLU A C      1 
ATOM   4376 O  O      . GLU C 3 492 ? 3.234   29.389 42.777  1.00 24.51  ?  788  GLU A O      1 
ATOM   4377 C  CB     . GLU C 3 492 ? 3.495   26.839 44.839  1.00 26.92  ?  788  GLU A CB     1 
ATOM   4378 C  CG     . GLU C 3 492 ? 2.838   25.518 45.206  1.00 29.66  ?  788  GLU A CG     1 
ATOM   4379 C  CD     . GLU C 3 492 ? 2.677   25.337 46.712  1.00 46.22  ?  788  GLU A CD     1 
ATOM   4380 O  OE1    . GLU C 3 492 ? 3.162   26.198 47.474  1.00 46.93  ?  788  GLU A OE1    1 
ATOM   4381 O  OE2    . GLU C 3 492 ? 2.062   24.334 47.137  1.00 49.91  ?  788  GLU A OE2    1 
ATOM   4382 N  N      . ARG C 3 493 ? 5.370   28.796 43.144  1.00 23.49  ?  789  ARG A N      1 
ATOM   4383 C  CA     . ARG C 3 493 ? 5.823   30.156 42.885  1.00 29.14  ?  789  ARG A CA     1 
ATOM   4384 C  C      . ARG C 3 493 ? 5.684   30.521 41.414  1.00 22.02  ?  789  ARG A C      1 
ATOM   4385 O  O      . ARG C 3 493 ? 5.485   31.694 41.087  1.00 18.86  ?  789  ARG A O      1 
ATOM   4386 C  CB     . ARG C 3 493 ? 7.264   30.330 43.360  1.00 36.64  ?  789  ARG A CB     1 
ATOM   4387 C  CG     . ARG C 3 493 ? 7.440   30.010 44.830  1.00 41.55  ?  789  ARG A CG     1 
ATOM   4388 C  CD     . ARG C 3 493 ? 8.733   30.573 45.384  1.00 41.95  ?  789  ARG A CD     1 
ATOM   4389 N  NE     . ARG C 3 493 ? 9.916   30.031 44.722  1.00 47.39  ?  789  ARG A NE     1 
ATOM   4390 C  CZ     . ARG C 3 493 ? 10.560  28.935 45.110  1.00 55.20  ?  789  ARG A CZ     1 
ATOM   4391 N  NH1    . ARG C 3 493 ? 10.134  28.245 46.160  1.00 60.36  ?  789  ARG A NH1    1 
ATOM   4392 N  NH2    . ARG C 3 493 ? 11.634  28.529 44.446  1.00 59.29  ?  789  ARG A NH2    1 
ATOM   4393 N  N      . MET C 3 494 ? 5.789   29.542 40.513  1.00 22.38  ?  790  MET A N      1 
ATOM   4394 C  CA     . MET C 3 494 ? 5.546   29.842 39.108  1.00 18.06  ?  790  MET A CA     1 
ATOM   4395 C  C      . MET C 3 494 ? 4.068   30.072 38.850  1.00 20.45  ?  790  MET A C      1 
ATOM   4396 O  O      . MET C 3 494 ? 3.704   30.867 37.974  1.00 26.94  ?  790  MET A O      1 
ATOM   4397 C  CB     . MET C 3 494 ? 6.075   28.717 38.226  1.00 27.80  ?  790  MET A CB     1 
ATOM   4398 C  CG     . MET C 3 494 ? 7.573   28.522 38.329  1.00 37.91  ?  790  MET A CG     1 
ATOM   4399 S  SD     . MET C 3 494 ? 8.469   30.057 38.011  1.00 45.43  ?  790  MET A SD     1 
ATOM   4400 C  CE     . MET C 3 494 ? 8.497   30.795 39.645  1.00 59.75  ?  790  MET A CE     1 
ATOM   4401 N  N      . ALA C 3 495 ? 3.205   29.390 39.605  1.00 24.92  ?  791  ALA A N      1 
ATOM   4402 C  CA     . ALA C 3 495 ? 1.775   29.649 39.514  1.00 22.19  ?  791  ALA A CA     1 
ATOM   4403 C  C      . ALA C 3 495 ? 1.459   31.086 39.895  1.00 19.08  ?  791  ALA A C      1 
ATOM   4404 O  O      . ALA C 3 495 ? 0.635   31.746 39.250  1.00 22.61  ?  791  ALA A O      1 
ATOM   4405 C  CB     . ALA C 3 495 ? 1.010   28.674 40.412  1.00 22.25  ?  791  ALA A CB     1 
ATOM   4406 N  N      . MET C 3 496 ? 2.109   31.594 40.942  1.00 20.25  ?  792  MET A N      1 
ATOM   4407 C  CA     . MET C 3 496 ? 1.848   32.962 41.371  1.00 23.81  ?  792  MET A CA     1 
ATOM   4408 C  C      . MET C 3 496 ? 2.496   33.970 40.433  1.00 19.80  ?  792  MET A C      1 
ATOM   4409 O  O      . MET C 3 496 ? 1.913   35.017 40.131  1.00 30.03  ?  792  MET A O      1 
ATOM   4410 C  CB     . MET C 3 496 ? 2.360   33.158 42.797  1.00 18.79  ?  792  MET A CB     1 
ATOM   4411 C  CG     . MET C 3 496 ? 1.764   32.193 43.797  1.00 25.17  ?  792  MET A CG     1 
ATOM   4412 S  SD     . MET C 3 496 ? 2.519   32.371 45.421  1.00 36.02  ?  792  MET A SD     1 
ATOM   4413 C  CE     . MET C 3 496 ? 3.973   31.343 45.245  1.00 38.79  ?  792  MET A CE     1 
ATOM   4414 N  N      . ASN C 3 497 ? 3.700   33.666 39.960  1.00 22.94  ?  793  ASN A N      1 
ATOM   4415 C  CA     . ASN C 3 497 ? 4.496   34.647 39.236  1.00 23.38  ?  793  ASN A CA     1 
ATOM   4416 C  C      . ASN C 3 497 ? 4.122   34.726 37.763  1.00 24.25  ?  793  ASN A C      1 
ATOM   4417 O  O      . ASN C 3 497 ? 4.227   35.796 37.156  1.00 17.89  ?  793  ASN A O      1 
ATOM   4418 C  CB     . ASN C 3 497 ? 5.977   34.303 39.412  1.00 22.11  ?  793  ASN A CB     1 
ATOM   4419 C  CG     . ASN C 3 497 ? 6.828   34.694 38.223  1.00 43.69  ?  793  ASN A CG     1 
ATOM   4420 O  OD1    . ASN C 3 497 ? 7.483   35.733 38.236  1.00 47.47  ?  793  ASN A OD1    1 
ATOM   4421 N  ND2    . ASN C 3 497 ? 6.855   33.842 37.201  1.00 51.14  ?  793  ASN A ND2    1 
ATOM   4422 N  N      . THR C 3 498 ? 3.681   33.631 37.175  1.00 20.85  ?  794  THR A N      1 
ATOM   4423 C  CA     . THR C 3 498 ? 3.564   33.617 35.725  1.00 22.80  ?  794  THR A CA     1 
ATOM   4424 C  C      . THR C 3 498 ? 2.439   34.529 35.240  1.00 22.12  ?  794  THR A C      1 
ATOM   4425 O  O      . THR C 3 498 ? 2.634   35.270 34.266  1.00 23.23  ?  794  THR A O      1 
ATOM   4426 C  CB     . THR C 3 498 ? 3.396   32.178 35.236  1.00 24.05  ?  794  THR A CB     1 
ATOM   4427 O  OG1    . THR C 3 498 ? 4.630   31.483 35.455  1.00 22.31  ?  794  THR A OG1    1 
ATOM   4428 C  CG2    . THR C 3 498 ? 3.063   32.141 33.758  1.00 16.11  ?  794  THR A CG2    1 
ATOM   4429 N  N      . PRO C 3 499 ? 1.274   34.551 35.897  1.00 21.07  ?  795  PRO A N      1 
ATOM   4430 C  CA     . PRO C 3 499 ? 0.238   35.511 35.479  1.00 22.95  ?  795  PRO A CA     1 
ATOM   4431 C  C      . PRO C 3 499 ? 0.695   36.952 35.585  1.00 27.08  ?  795  PRO A C      1 
ATOM   4432 O  O      . PRO C 3 499 ? 0.185   37.814 34.858  1.00 28.03  ?  795  PRO A O      1 
ATOM   4433 C  CB     . PRO C 3 499 ? -0.928  35.208 36.429  1.00 18.22  ?  795  PRO A CB     1 
ATOM   4434 C  CG     . PRO C 3 499 ? -0.718  33.776 36.816  1.00 26.58  ?  795  PRO A CG     1 
ATOM   4435 C  CD     . PRO C 3 499 ? 0.769   33.601 36.903  1.00 21.04  ?  795  PRO A CD     1 
ATOM   4436 N  N      . ILE C 3 500 ? 1.651   37.233 36.466  1.00 17.78  ?  796  ILE A N      1 
ATOM   4437 C  CA     . ILE C 3 500 ? 2.155   38.593 36.632  1.00 17.83  ?  796  ILE A CA     1 
ATOM   4438 C  C      . ILE C 3 500 ? 3.188   38.915 35.560  1.00 15.94  ?  796  ILE A C      1 
ATOM   4439 O  O      . ILE C 3 500 ? 3.009   39.835 34.752  1.00 19.31  ?  796  ILE A O      1 
ATOM   4440 C  CB     . ILE C 3 500 ? 2.737   38.766 38.047  1.00 20.89  ?  796  ILE A CB     1 
ATOM   4441 C  CG1    . ILE C 3 500 ? 1.624   38.646 39.091  1.00 23.83  ?  796  ILE A CG1    1 
ATOM   4442 C  CG2    . ILE C 3 500 ? 3.484   40.083 38.168  1.00 20.88  ?  796  ILE A CG2    1 
ATOM   4443 C  CD1    . ILE C 3 500 ? 2.130   38.590 40.520  1.00 25.10  ?  796  ILE A CD1    1 
ATOM   4444 N  N      . GLN C 3 501 ? 4.286   38.155 35.537  1.00 15.01  ?  797  GLN A N      1 
ATOM   4445 C  CA     . GLN C 3 501 ? 5.337   38.398 34.553  1.00 21.22  ?  797  GLN A CA     1 
ATOM   4446 C  C      . GLN C 3 501 ? 4.825   38.190 33.136  1.00 20.61  ?  797  GLN A C      1 
ATOM   4447 O  O      . GLN C 3 501 ? 5.138   38.975 32.232  1.00 18.87  ?  797  GLN A O      1 
ATOM   4448 C  CB     . GLN C 3 501 ? 6.531   37.483 34.824  1.00 25.77  ?  797  GLN A CB     1 
ATOM   4449 C  CG     . GLN C 3 501 ? 7.085   37.594 36.225  1.00 34.88  ?  797  GLN A CG     1 
ATOM   4450 C  CD     . GLN C 3 501 ? 7.725   38.933 36.501  1.00 48.10  ?  797  GLN A CD     1 
ATOM   4451 O  OE1    . GLN C 3 501 ? 8.278   39.569 35.602  1.00 53.16  ?  797  GLN A OE1    1 
ATOM   4452 N  NE2    . GLN C 3 501 ? 7.647   39.377 37.752  1.00 51.72  ?  797  GLN A NE2    1 
ATOM   4453 N  N      . GLY C 3 502 ? 4.040   37.133 32.924  1.00 19.93  ?  798  GLY A N      1 
ATOM   4454 C  CA     . GLY C 3 502 ? 3.531   36.857 31.592  1.00 18.47  ?  798  GLY A CA     1 
ATOM   4455 C  C      . GLY C 3 502 ? 2.541   37.903 31.118  1.00 19.69  ?  798  GLY A C      1 
ATOM   4456 O  O      . GLY C 3 502 ? 2.477   38.210 29.927  1.00 15.09  ?  798  GLY A O      1 
ATOM   4457 N  N      . SER C 3 503 ? 1.744   38.455 32.036  1.00 21.88  ?  799  SER A N      1 
ATOM   4458 C  CA     . SER C 3 503 ? 0.816   39.508 31.638  1.00 18.31  ?  799  SER A CA     1 
ATOM   4459 C  C      . SER C 3 503 ? 1.564   40.793 31.296  1.00 20.20  ?  799  SER A C      1 
ATOM   4460 O  O      . SER C 3 503 ? 1.227   41.475 30.318  1.00 17.24  ?  799  SER A O      1 
ATOM   4461 C  CB     . SER C 3 503 ? -0.212  39.750 32.741  1.00 19.22  ?  799  SER A CB     1 
ATOM   4462 O  OG     . SER C 3 503 ? -1.121  38.666 32.825  1.00 15.77  ?  799  SER A OG     1 
ATOM   4463 N  N      . ALA C 3 504 ? 2.591   41.129 32.078  1.00 17.36  ?  800  ALA A N      1 
ATOM   4464 C  CA     . ALA C 3 504 ? 3.446   42.260 31.730  1.00 22.99  ?  800  ALA A CA     1 
ATOM   4465 C  C      . ALA C 3 504 ? 4.100   42.052 30.370  1.00 14.92  ?  800  ALA A C      1 
ATOM   4466 O  O      . ALA C 3 504 ? 4.214   42.992 29.573  1.00 15.72  ?  800  ALA A O      1 
ATOM   4467 C  CB     . ALA C 3 504 ? 4.508   42.465 32.811  1.00 16.87  ?  800  ALA A CB     1 
ATOM   4468 N  N      . ALA C 3 505 ? 4.540   40.823 30.092  1.00 14.73  ?  801  ALA A N      1 
ATOM   4469 C  CA     . ALA C 3 505 ? 5.077   40.501 28.779  1.00 22.66  ?  801  ALA A CA     1 
ATOM   4470 C  C      . ALA C 3 505 ? 4.034   40.720 27.689  1.00 22.64  ?  801  ALA A C      1 
ATOM   4471 O  O      . ALA C 3 505 ? 4.349   41.260 26.621  1.00 18.55  ?  801  ALA A O      1 
ATOM   4472 C  CB     . ALA C 3 505 ? 5.577   39.056 28.770  1.00 26.75  ?  801  ALA A CB     1 
ATOM   4473 N  N      . ASP C 3 506 ? 2.791   40.290 27.932  1.00 20.46  ?  802  ASP A N      1 
ATOM   4474 C  CA     . ASP C 3 506 ? 1.718   40.517 26.965  1.00 19.62  ?  802  ASP A CA     1 
ATOM   4475 C  C      . ASP C 3 506 ? 1.540   42.002 26.687  1.00 13.88  ?  802  ASP A C      1 
ATOM   4476 O  O      . ASP C 3 506 ? 1.381   42.419 25.532  1.00 16.51  ?  802  ASP A O      1 
ATOM   4477 C  CB     . ASP C 3 506 ? 0.397   39.939 27.479  1.00 18.49  ?  802  ASP A CB     1 
ATOM   4478 C  CG     . ASP C 3 506 ? 0.451   38.440 27.701  1.00 36.06  ?  802  ASP A CG     1 
ATOM   4479 O  OD1    . ASP C 3 506 ? 1.306   37.761 27.089  1.00 38.68  ?  802  ASP A OD1    1 
ATOM   4480 O  OD2    . ASP C 3 506 ? -0.390  37.938 28.477  1.00 31.56  ?  802  ASP A OD2    1 
ATOM   4481 N  N      . ILE C 3 507 ? 1.511   42.809 27.751  1.00 14.94  ?  803  ILE A N      1 
ATOM   4482 C  CA     . ILE C 3 507 ? 1.272   44.239 27.609  1.00 17.28  ?  803  ILE A CA     1 
ATOM   4483 C  C      . ILE C 3 507 ? 2.388   44.884 26.803  1.00 15.49  ?  803  ILE A C      1 
ATOM   4484 O  O      . ILE C 3 507 ? 2.140   45.742 25.950  1.00 12.65  ?  803  ILE A O      1 
ATOM   4485 C  CB     . ILE C 3 507 ? 1.131   44.902 28.992  1.00 18.12  ?  803  ILE A CB     1 
ATOM   4486 C  CG1    . ILE C 3 507 ? -0.140  44.435 29.709  1.00 19.77  ?  803  ILE A CG1    1 
ATOM   4487 C  CG2    . ILE C 3 507 ? 1.139   46.419 28.851  1.00 20.14  ?  803  ILE A CG2    1 
ATOM   4488 C  CD1    . ILE C 3 507 ? -0.086  44.682 31.209  1.00 16.26  ?  803  ILE A CD1    1 
ATOM   4489 N  N      . ILE C 3 508 ? 3.636   44.498 27.068  1.00 17.24  ?  804  ILE A N      1 
ATOM   4490 C  CA     . ILE C 3 508 ? 4.748   45.088 26.330  1.00 22.02  ?  804  ILE A CA     1 
ATOM   4491 C  C      . ILE C 3 508 ? 4.656   44.728 24.850  1.00 16.54  ?  804  ILE A C      1 
ATOM   4492 O  O      . ILE C 3 508 ? 4.875   45.575 23.976  1.00 16.64  ?  804  ILE A O      1 
ATOM   4493 C  CB     . ILE C 3 508 ? 6.091   44.650 26.941  1.00 19.19  ?  804  ILE A CB     1 
ATOM   4494 C  CG1    . ILE C 3 508 ? 6.177   45.084 28.408  1.00 28.02  ?  804  ILE A CG1    1 
ATOM   4495 C  CG2    . ILE C 3 508 ? 7.251   45.225 26.130  1.00 23.98  ?  804  ILE A CG2    1 
ATOM   4496 C  CD1    . ILE C 3 508 ? 7.397   44.549 29.140  1.00 33.45  ?  804  ILE A CD1    1 
ATOM   4497 N  N      . LYS C 3 509 ? 4.324   43.470 24.545  1.00 14.86  ?  805  LYS A N      1 
ATOM   4498 C  CA     . LYS C 3 509 ? 4.217   43.052 23.147  1.00 12.01  ?  805  LYS A CA     1 
ATOM   4499 C  C      . LYS C 3 509 ? 3.092   43.792 22.439  1.00 9.91   ?  805  LYS A C      1 
ATOM   4500 O  O      . LYS C 3 509 ? 3.229   44.195 21.279  1.00 17.30  ?  805  LYS A O      1 
ATOM   4501 C  CB     . LYS C 3 509 ? 3.988   41.546 23.056  1.00 14.62  ?  805  LYS A CB     1 
ATOM   4502 C  CG     . LYS C 3 509 ? 5.135   40.717 23.578  1.00 14.83  ?  805  LYS A CG     1 
ATOM   4503 C  CD     . LYS C 3 509 ? 4.825   39.243 23.433  1.00 21.57  ?  805  LYS A CD     1 
ATOM   4504 C  CE     . LYS C 3 509 ? 6.060   38.409 23.690  1.00 20.70  ?  805  LYS A CE     1 
ATOM   4505 N  NZ     . LYS C 3 509 ? 5.785   36.966 23.412  1.00 25.40  ?  805  LYS A NZ     1 
ATOM   4506 N  N      . LYS C 3 510 ? 1.951   43.945 23.111  1.00 18.39  ?  806  LYS A N      1 
ATOM   4507 C  CA     . LYS C 3 510 ? 0.849   44.677 22.503  1.00 24.30  ?  806  LYS A CA     1 
ATOM   4508 C  C      . LYS C 3 510 ? 1.221   46.137 22.292  1.00 21.68  ?  806  LYS A C      1 
ATOM   4509 O  O      . LYS C 3 510 ? 0.889   46.730 21.258  1.00 15.41  ?  806  LYS A O      1 
ATOM   4510 C  CB     . LYS C 3 510 ? -0.406  44.555 23.367  1.00 22.13  ?  806  LYS A CB     1 
ATOM   4511 C  CG     . LYS C 3 510 ? -1.615  45.234 22.761  1.00 35.24  ?  806  LYS A CG     1 
ATOM   4512 C  CD     . LYS C 3 510 ? -2.910  44.666 23.314  1.00 53.39  ?  806  LYS A CD     1 
ATOM   4513 C  CE     . LYS C 3 510 ? -4.108  45.252 22.587  1.00 52.67  ?  806  LYS A CE     1 
ATOM   4514 N  NZ     . LYS C 3 510 ? -4.061  46.742 22.566  1.00 58.64  ?  806  LYS A NZ     1 
ATOM   4515 N  N      . ALA C 3 511 ? 1.911   46.736 23.264  1.00 16.95  ?  807  ALA A N      1 
ATOM   4516 C  CA     . ALA C 3 511 ? 2.373   48.106 23.091  1.00 25.33  ?  807  ALA A CA     1 
ATOM   4517 C  C      . ALA C 3 511 ? 3.292   48.225 21.881  1.00 23.86  ?  807  ALA A C      1 
ATOM   4518 O  O      . ALA C 3 511 ? 3.179   49.177 21.101  1.00 13.57  ?  807  ALA A O      1 
ATOM   4519 C  CB     . ALA C 3 511 ? 3.073   48.590 24.364  1.00 14.56  ?  807  ALA A CB     1 
ATOM   4520 N  N      . MET C 3 512 ? 4.201   47.263 21.697  1.00 16.45  ?  808  MET A N      1 
ATOM   4521 C  CA     . MET C 3 512 ? 5.086   47.312 20.534  1.00 17.58  ?  808  MET A CA     1 
ATOM   4522 C  C      . MET C 3 512 ? 4.296   47.302 19.234  1.00 13.47  ?  808  MET A C      1 
ATOM   4523 O  O      . MET C 3 512 ? 4.618   48.041 18.296  1.00 19.77  ?  808  MET A O      1 
ATOM   4524 C  CB     . MET C 3 512 ? 6.064   46.137 20.551  1.00 18.72  ?  808  MET A CB     1 
ATOM   4525 C  CG     . MET C 3 512 ? 7.057   46.157 21.691  1.00 20.63  ?  808  MET A CG     1 
ATOM   4526 S  SD     . MET C 3 512 ? 8.070   44.668 21.722  1.00 28.22  ?  808  MET A SD     1 
ATOM   4527 C  CE     . MET C 3 512 ? 9.051   44.876 20.241  1.00 17.72  ?  808  MET A CE     1 
ATOM   4528 N  N      . ILE C 3 513 ? 3.272   46.451 19.153  1.00 18.47  ?  809  ILE A N      1 
ATOM   4529 C  CA     . ILE C 3 513 ? 2.457   46.365 17.945  1.00 21.41  ?  809  ILE A CA     1 
ATOM   4530 C  C      . ILE C 3 513 ? 1.682   47.657 17.737  1.00 21.64  ?  809  ILE A C      1 
ATOM   4531 O  O      . ILE C 3 513 ? 1.561   48.157 16.609  1.00 19.89  ?  809  ILE A O      1 
ATOM   4532 C  CB     . ILE C 3 513 ? 1.517   45.149 18.036  1.00 21.31  ?  809  ILE A CB     1 
ATOM   4533 C  CG1    . ILE C 3 513 ? 2.318   43.845 17.965  1.00 27.69  ?  809  ILE A CG1    1 
ATOM   4534 C  CG2    . ILE C 3 513 ? 0.442   45.220 16.962  1.00 24.04  ?  809  ILE A CG2    1 
ATOM   4535 C  CD1    . ILE C 3 513 ? 1.534   42.644 18.438  1.00 19.63  ?  809  ILE A CD1    1 
ATOM   4536 N  N      . ASP C 3 514 ? 1.124   48.200 18.822  1.00 15.76  ?  810  ASP A N      1 
ATOM   4537 C  CA     . ASP C 3 514 ? 0.394   49.461 18.768  1.00 21.61  ?  810  ASP A CA     1 
ATOM   4538 C  C      . ASP C 3 514 ? 1.313   50.619 18.413  1.00 17.54  ?  810  ASP A C      1 
ATOM   4539 O  O      . ASP C 3 514 ? 0.931   51.506 17.642  1.00 20.78  ?  810  ASP A O      1 
ATOM   4540 C  CB     . ASP C 3 514 ? -0.282  49.730 20.113  1.00 14.98  ?  810  ASP A CB     1 
ATOM   4541 C  CG     . ASP C 3 514 ? -1.413  48.762 20.414  1.00 42.95  ?  810  ASP A CG     1 
ATOM   4542 O  OD1    . ASP C 3 514 ? -1.820  47.993 19.515  1.00 48.06  ?  810  ASP A OD1    1 
ATOM   4543 O  OD2    . ASP C 3 514 ? -1.902  48.782 21.564  1.00 43.24  ?  810  ASP A OD2    1 
ATOM   4544 N  N      . LEU C 3 515 ? 2.518   50.642 18.984  1.00 17.17  ?  811  LEU A N      1 
ATOM   4545 C  CA     . LEU C 3 515 ? 3.467   51.702 18.664  1.00 23.65  ?  811  LEU A CA     1 
ATOM   4546 C  C      . LEU C 3 515 ? 3.879   51.643 17.201  1.00 28.27  ?  811  LEU A C      1 
ATOM   4547 O  O      . LEU C 3 515 ? 3.941   52.672 16.518  1.00 22.39  ?  811  LEU A O      1 
ATOM   4548 C  CB     . LEU C 3 515 ? 4.693   51.590 19.563  1.00 20.53  ?  811  LEU A CB     1 
ATOM   4549 C  CG     . LEU C 3 515 ? 5.786   52.627 19.316  1.00 23.35  ?  811  LEU A CG     1 
ATOM   4550 C  CD1    . LEU C 3 515 ? 5.237   54.025 19.567  1.00 23.92  ?  811  LEU A CD1    1 
ATOM   4551 C  CD2    . LEU C 3 515 ? 6.986   52.348 20.204  1.00 34.48  ?  811  LEU A CD2    1 
ATOM   4552 N  N      . ASN C 3 516 ? 4.171   50.441 16.707  1.00 21.72  ?  812  ASN A N      1 
ATOM   4553 C  CA     . ASN C 3 516 ? 4.566   50.279 15.315  1.00 19.78  ?  812  ASN A CA     1 
ATOM   4554 C  C      . ASN C 3 516 ? 3.477   50.774 14.366  1.00 14.15  ?  812  ASN A C      1 
ATOM   4555 O  O      . ASN C 3 516 ? 3.774   51.386 13.333  1.00 22.89  ?  812  ASN A O      1 
ATOM   4556 C  CB     . ASN C 3 516 ? 4.905   48.811 15.055  1.00 23.75  ?  812  ASN A CB     1 
ATOM   4557 C  CG     . ASN C 3 516 ? 5.222   48.530 13.608  1.00 35.80  ?  812  ASN A CG     1 
ATOM   4558 O  OD1    . ASN C 3 516 ? 6.356   48.701 13.164  1.00 38.50  ?  812  ASN A OD1    1 
ATOM   4559 N  ND2    . ASN C 3 516 ? 4.220   48.078 12.862  1.00 32.74  ?  812  ASN A ND2    1 
ATOM   4560 N  N      . ALA C 3 517 ? 2.209   50.535 14.705  1.00 18.24  ?  813  ALA A N      1 
ATOM   4561 C  CA     . ALA C 3 517 ? 1.130   51.040 13.863  1.00 28.51  ?  813  ALA A CA     1 
ATOM   4562 C  C      . ALA C 3 517 ? 1.026   52.558 13.951  1.00 26.08  ?  813  ALA A C      1 
ATOM   4563 O  O      . ALA C 3 517 ? 0.878   53.236 12.927  1.00 22.53  ?  813  ALA A O      1 
ATOM   4564 C  CB     . ALA C 3 517 ? -0.192  50.382 14.251  1.00 23.86  ?  813  ALA A CB     1 
ATOM   4565 N  N      . ARG C 3 518 ? 1.128   53.112 15.163  1.00 21.59  ?  814  ARG A N      1 
ATOM   4566 C  CA     . ARG C 3 518 ? 1.030   54.559 15.332  1.00 26.99  ?  814  ARG A CA     1 
ATOM   4567 C  C      . ARG C 3 518 ? 2.165   55.282 14.621  1.00 21.69  ?  814  ARG A C      1 
ATOM   4568 O  O      . ARG C 3 518 ? 1.949   56.320 13.987  1.00 21.68  ?  814  ARG A O      1 
ATOM   4569 C  CB     . ARG C 3 518 ? 1.016   54.924 16.818  1.00 28.01  ?  814  ARG A CB     1 
ATOM   4570 C  CG     . ARG C 3 518 ? -0.331  54.774 17.476  1.00 42.08  ?  814  ARG A CG     1 
ATOM   4571 C  CD     . ARG C 3 518 ? -1.382  55.622 16.778  1.00 44.95  ?  814  ARG A CD     1 
ATOM   4572 N  NE     . ARG C 3 518 ? -1.103  57.052 16.875  1.00 56.48  ?  814  ARG A NE     1 
ATOM   4573 C  CZ     . ARG C 3 518 ? -1.318  57.780 17.966  1.00 56.63  ?  814  ARG A CZ     1 
ATOM   4574 N  NH1    . ARG C 3 518 ? -1.799  57.208 19.062  1.00 50.71  ?  814  ARG A NH1    1 
ATOM   4575 N  NH2    . ARG C 3 518 ? -1.046  59.078 17.964  1.00 57.36  ?  814  ARG A NH2    1 
ATOM   4576 N  N      . LEU C 3 519 ? 3.394   54.769 14.739  1.00 16.41  ?  815  LEU A N      1 
ATOM   4577 C  CA     . LEU C 3 519 ? 4.507   55.419 14.059  1.00 19.07  ?  815  LEU A CA     1 
ATOM   4578 C  C      . LEU C 3 519 ? 4.268   55.465 12.559  1.00 23.27  ?  815  LEU A C      1 
ATOM   4579 O  O      . LEU C 3 519 ? 4.636   56.437 11.889  1.00 22.78  ?  815  LEU A O      1 
ATOM   4580 C  CB     . LEU C 3 519 ? 5.814   54.694 14.370  1.00 18.24  ?  815  LEU A CB     1 
ATOM   4581 C  CG     . LEU C 3 519 ? 6.245   54.724 15.832  1.00 20.99  ?  815  LEU A CG     1 
ATOM   4582 C  CD1    . LEU C 3 519 ? 7.507   53.924 16.008  1.00 19.26  ?  815  LEU A CD1    1 
ATOM   4583 C  CD2    . LEU C 3 519 ? 6.435   56.164 16.291  1.00 25.11  ?  815  LEU A CD2    1 
ATOM   4584 N  N      . LYS C 3 520 ? 3.665   54.410 12.012  1.00 21.98  ?  816  LYS A N      1 
ATOM   4585 C  CA     . LYS C 3 520 ? 3.354   54.387 10.590  1.00 27.78  ?  816  LYS A CA     1 
ATOM   4586 C  C      . LYS C 3 520 ? 2.177   55.307 10.272  1.00 20.06  ?  816  LYS A C      1 
ATOM   4587 O  O      . LYS C 3 520 ? 2.212   56.044 9.278   1.00 26.09  ?  816  LYS A O      1 
ATOM   4588 C  CB     . LYS C 3 520 ? 3.083   52.944 10.159  1.00 32.59  ?  816  LYS A CB     1 
ATOM   4589 C  CG     . LYS C 3 520 ? 2.252   52.777 8.906   1.00 47.24  ?  816  LYS A CG     1 
ATOM   4590 C  CD     . LYS C 3 520 ? 1.644   51.375 8.861   1.00 65.91  ?  816  LYS A CD     1 
ATOM   4591 C  CE     . LYS C 3 520 ? 0.922   51.052 10.171  1.00 74.79  ?  816  LYS A CE     1 
ATOM   4592 N  NZ     . LYS C 3 520 ? 0.435   49.641 10.262  1.00 69.70  ?  816  LYS A NZ     1 
ATOM   4593 N  N      . GLU C 3 521 ? 1.138   55.291 11.113  1.00 22.26  ?  817  GLU A N      1 
ATOM   4594 C  CA     . GLU C 3 521 ? 0.038   56.248 10.985  1.00 23.93  ?  817  GLU A CA     1 
ATOM   4595 C  C      . GLU C 3 521 ? 0.543   57.687 10.958  1.00 28.48  ?  817  GLU A C      1 
ATOM   4596 O  O      . GLU C 3 521 ? 0.082   58.505 10.153  1.00 27.66  ?  817  GLU A O      1 
ATOM   4597 C  CB     . GLU C 3 521 ? -0.952  56.072 12.140  1.00 36.22  ?  817  GLU A CB     1 
ATOM   4598 C  CG     . GLU C 3 521 ? -1.934  54.919 12.009  1.00 63.82  ?  817  GLU A CG     1 
ATOM   4599 C  CD     . GLU C 3 521 ? -2.794  54.757 13.256  1.00 86.16  ?  817  GLU A CD     1 
ATOM   4600 O  OE1    . GLU C 3 521 ? -2.540  53.821 14.044  1.00 90.68  ?  817  GLU A OE1    1 
ATOM   4601 O  OE2    . GLU C 3 521 ? -3.714  55.578 13.459  1.00 93.25  ?  817  GLU A OE2    1 
ATOM   4602 N  N      . GLU C 3 522 ? 1.469   58.025 11.852  1.00 28.32  ?  818  GLU A N      1 
ATOM   4603 C  CA     . GLU C 3 522 ? 1.978   59.387 11.943  1.00 28.46  ?  818  GLU A CA     1 
ATOM   4604 C  C      . GLU C 3 522 ? 3.076   59.680 10.931  1.00 30.70  ?  818  GLU A C      1 
ATOM   4605 O  O      . GLU C 3 522 ? 3.552   60.818 10.872  1.00 38.95  ?  818  GLU A O      1 
ATOM   4606 C  CB     . GLU C 3 522 ? 2.504   59.655 13.357  1.00 24.15  ?  818  GLU A CB     1 
ATOM   4607 C  CG     . GLU C 3 522 ? 1.505   59.362 14.456  1.00 26.38  ?  818  GLU A CG     1 
ATOM   4608 C  CD     . GLU C 3 522 ? 0.406   60.398 14.516  1.00 49.25  ?  818  GLU A CD     1 
ATOM   4609 O  OE1    . GLU C 3 522 ? 0.677   61.563 14.155  1.00 57.63  ?  818  GLU A OE1    1 
ATOM   4610 O  OE2    . GLU C 3 522 ? -0.724  60.049 14.922  1.00 52.75  ?  818  GLU A OE2    1 
ATOM   4611 N  N      . ARG C 3 523 ? 3.491   58.687 10.144  1.00 29.51  ?  819  ARG A N      1 
ATOM   4612 C  CA     . ARG C 3 523 ? 4.555   58.858 9.154   1.00 29.47  ?  819  ARG A CA     1 
ATOM   4613 C  C      . ARG C 3 523 ? 5.843   59.370 9.795   1.00 27.87  ?  819  ARG A C      1 
ATOM   4614 O  O      . ARG C 3 523 ? 6.558   60.196 9.222   1.00 32.79  ?  819  ARG A O      1 
ATOM   4615 C  CB     . ARG C 3 523 ? 4.114   59.782 8.018   1.00 37.57  ?  819  ARG A CB     1 
ATOM   4616 C  CG     . ARG C 3 523 ? 3.266   59.104 6.965   1.00 38.99  ?  819  ARG A CG     1 
ATOM   4617 C  CD     . ARG C 3 523 ? 1.818   59.018 7.387   1.00 40.42  ?  819  ARG A CD     1 
ATOM   4618 N  NE     . ARG C 3 523 ? 0.968   58.652 6.260   1.00 38.17  ?  819  ARG A NE     1 
ATOM   4619 C  CZ     . ARG C 3 523 ? 0.522   57.423 6.026   1.00 34.59  ?  819  ARG A CZ     1 
ATOM   4620 N  NH1    . ARG C 3 523 ? 0.836   56.428 6.847   1.00 33.35  ?  819  ARG A NH1    1 
ATOM   4621 N  NH2    . ARG C 3 523 ? -0.242  57.189 4.968   1.00 38.05  ?  819  ARG A NH2    1 
ATOM   4622 N  N      . LEU C 3 524 ? 6.146   58.876 10.987  1.00 27.47  ?  820  LEU A N      1 
ATOM   4623 C  CA     . LEU C 3 524 ? 7.394   59.231 11.644  1.00 27.42  ?  820  LEU A CA     1 
ATOM   4624 C  C      . LEU C 3 524 ? 8.527   58.342 11.145  1.00 32.84  ?  820  LEU A C      1 
ATOM   4625 O  O      . LEU C 3 524 ? 8.313   57.198 10.740  1.00 28.37  ?  820  LEU A O      1 
ATOM   4626 C  CB     . LEU C 3 524 ? 7.257   59.099 13.157  1.00 23.15  ?  820  LEU A CB     1 
ATOM   4627 C  CG     . LEU C 3 524 ? 6.365   60.116 13.864  1.00 23.46  ?  820  LEU A CG     1 
ATOM   4628 C  CD1    . LEU C 3 524 ? 5.973   59.622 15.248  1.00 28.33  ?  820  LEU A CD1    1 
ATOM   4629 C  CD2    . LEU C 3 524 ? 7.093   61.446 13.968  1.00 28.64  ?  820  LEU A CD2    1 
ATOM   4630 N  N      . GLN C 3 525 ? 9.742   58.893 11.154  1.00 26.41  ?  821  GLN A N      1 
ATOM   4631 C  CA     . GLN C 3 525 ? 10.922  58.108 10.821  1.00 31.69  ?  821  GLN A CA     1 
ATOM   4632 C  C      . GLN C 3 525 ? 11.416  57.273 11.994  1.00 34.39  ?  821  GLN A C      1 
ATOM   4633 O  O      . GLN C 3 525 ? 12.170  56.316 11.783  1.00 39.28  ?  821  GLN A O      1 
ATOM   4634 C  CB     . GLN C 3 525 ? 12.049  59.022 10.344  1.00 29.20  ?  821  GLN A CB     1 
ATOM   4635 C  CG     . GLN C 3 525 ? 11.640  59.980 9.245   1.00 32.14  ?  821  GLN A CG     1 
ATOM   4636 C  CD     . GLN C 3 525 ? 12.832  60.617 8.574   1.00 36.69  ?  821  GLN A CD     1 
ATOM   4637 O  OE1    . GLN C 3 525 ? 13.767  59.928 8.171   1.00 39.48  ?  821  GLN A OE1    1 
ATOM   4638 N  NE2    . GLN C 3 525 ? 12.815  61.940 8.462   1.00 40.39  ?  821  GLN A NE2    1 
ATOM   4639 N  N      . ALA C 3 526 ? 11.014  57.622 13.216  1.00 30.81  ?  822  ALA A N      1 
ATOM   4640 C  CA     . ALA C 3 526 ? 11.421  56.874 14.395  1.00 24.56  ?  822  ALA A CA     1 
ATOM   4641 C  C      . ALA C 3 526 ? 11.164  55.391 14.189  1.00 31.08  ?  822  ALA A C      1 
ATOM   4642 O  O      . ALA C 3 526 ? 10.181  54.999 13.560  1.00 23.59  ?  822  ALA A O      1 
ATOM   4643 C  CB     . ALA C 3 526 ? 10.654  57.365 15.625  1.00 23.01  ?  822  ALA A CB     1 
ATOM   4644 N  N      . ARG C 3 527 ? 12.021  54.581 14.780  1.00 25.18  ?  823  ARG A N      1 
ATOM   4645 C  CA     . ARG C 3 527 ? 11.874  53.153 14.675  1.00 32.12  ?  823  ARG A CA     1 
ATOM   4646 C  C      . ARG C 3 527 ? 12.327  52.441 15.931  1.00 20.47  ?  823  ARG A C      1 
ATOM   4647 O  O      . ARG C 3 527 ? 13.232  52.897 16.617  1.00 22.12  ?  823  ARG A O      1 
ATOM   4648 C  CB     . ARG C 3 527 ? 12.661  52.637 13.480  1.00 30.00  ?  823  ARG A CB     1 
ATOM   4649 C  CG     . ARG C 3 527 ? 14.162  52.701 13.646  1.00 30.00  ?  823  ARG A CG     1 
ATOM   4650 C  CD     . ARG C 3 527 ? 14.840  52.403 12.323  1.00 30.00  ?  823  ARG A CD     1 
ATOM   4651 N  NE     . ARG C 3 527 ? 16.106  53.100 12.206  1.00 30.00  ?  823  ARG A NE     1 
ATOM   4652 C  CZ     . ARG C 3 527 ? 16.528  53.709 11.108  1.00 30.00  ?  823  ARG A CZ     1 
ATOM   4653 N  NH1    . ARG C 3 527 ? 17.706  54.314 11.106  1.00 30.00  ?  823  ARG A NH1    1 
ATOM   4654 N  NH2    . ARG C 3 527 ? 15.781  53.712 10.018  1.00 30.00  ?  823  ARG A NH2    1 
ATOM   4655 N  N      . LEU C 3 528 ? 11.644  51.360 16.262  1.00 19.55  ?  824  LEU A N      1 
ATOM   4656 C  CA     . LEU C 3 528 ? 12.066  50.549 17.393  1.00 21.98  ?  824  LEU A CA     1 
ATOM   4657 C  C      . LEU C 3 528 ? 13.407  49.900 17.104  1.00 20.07  ?  824  LEU A C      1 
ATOM   4658 O  O      . LEU C 3 528 ? 13.667  49.441 15.990  1.00 27.60  ?  824  LEU A O      1 
ATOM   4659 C  CB     . LEU C 3 528 ? 11.035  49.466 17.683  1.00 21.76  ?  824  LEU A CB     1 
ATOM   4660 C  CG     . LEU C 3 528 ? 9.864   49.792 18.591  1.00 35.04  ?  824  LEU A CG     1 
ATOM   4661 C  CD1    . LEU C 3 528 ? 8.882   48.635 18.548  1.00 34.66  ?  824  LEU A CD1    1 
ATOM   4662 C  CD2    . LEU C 3 528 ? 10.363  50.032 20.011  1.00 30.99  ?  824  LEU A CD2    1 
ATOM   4663 N  N      . LEU C 3 529 ? 14.262  49.871 18.120  1.00 18.60  ?  825  LEU A N      1 
ATOM   4664 C  CA     . LEU C 3 529 ? 15.535  49.170 18.067  1.00 20.36  ?  825  LEU A CA     1 
ATOM   4665 C  C      . LEU C 3 529 ? 15.587  47.991 19.024  1.00 24.87  ?  825  LEU A C      1 
ATOM   4666 O  O      . LEU C 3 529 ? 16.043  46.907 18.655  1.00 27.25  ?  825  LEU A O      1 
ATOM   4667 C  CB     . LEU C 3 529 ? 16.674  50.138 18.399  1.00 25.89  ?  825  LEU A CB     1 
ATOM   4668 C  CG     . LEU C 3 529 ? 16.837  51.331 17.465  1.00 27.50  ?  825  LEU A CG     1 
ATOM   4669 C  CD1    . LEU C 3 529 ? 17.976  52.199 17.954  1.00 37.63  ?  825  LEU A CD1    1 
ATOM   4670 C  CD2    . LEU C 3 529 ? 17.083  50.848 16.044  1.00 24.60  ?  825  LEU A CD2    1 
ATOM   4671 N  N      . LEU C 3 530 ? 15.128  48.181 20.256  1.00 24.41  ?  826  LEU A N      1 
ATOM   4672 C  CA     . LEU C 3 530 ? 15.269  47.163 21.279  1.00 22.54  ?  826  LEU A CA     1 
ATOM   4673 C  C      . LEU C 3 530 ? 14.043  47.149 22.168  1.00 22.42  ?  826  LEU A C      1 
ATOM   4674 O  O      . LEU C 3 530 ? 13.426  48.188 22.423  1.00 17.53  ?  826  LEU A O      1 
ATOM   4675 C  CB     . LEU C 3 530 ? 16.511  47.403 22.143  1.00 22.10  ?  826  LEU A CB     1 
ATOM   4676 C  CG     . LEU C 3 530 ? 17.846  47.458 21.413  1.00 29.69  ?  826  LEU A CG     1 
ATOM   4677 C  CD1    . LEU C 3 530 ? 18.962  47.725 22.407  1.00 37.91  ?  826  LEU A CD1    1 
ATOM   4678 C  CD2    . LEU C 3 530 ? 18.094  46.166 20.636  1.00 28.69  ?  826  LEU A CD2    1 
ATOM   4679 N  N      . GLN C 3 531 ? 13.686  45.960 22.615  1.00 19.01  ?  827  GLN A N      1 
ATOM   4680 C  CA     . GLN C 3 531 ? 12.809  45.789 23.756  1.00 21.58  ?  827  GLN A CA     1 
ATOM   4681 C  C      . GLN C 3 531 ? 13.636  45.076 24.806  1.00 22.38  ?  827  GLN A C      1 
ATOM   4682 O  O      . GLN C 3 531 ? 14.129  43.968 24.568  1.00 22.19  ?  827  GLN A O      1 
ATOM   4683 C  CB     . GLN C 3 531 ? 11.553  45.002 23.392  1.00 21.21  ?  827  GLN A CB     1 
ATOM   4684 C  CG     . GLN C 3 531 ? 10.524  44.931 24.516  1.00 28.78  ?  827  GLN A CG     1 
ATOM   4685 C  CD     . GLN C 3 531 ? 10.508  43.577 25.193  1.00 30.98  ?  827  GLN A CD     1 
ATOM   4686 O  OE1    . GLN C 3 531 ? 11.536  43.093 25.660  1.00 43.51  ?  827  GLN A OE1    1 
ATOM   4687 N  NE2    . GLN C 3 531 ? 9.340   42.947 25.230  1.00 37.97  ?  827  GLN A NE2    1 
ATOM   4688 N  N      . VAL C 3 532 ? 13.850  45.740 25.928  1.00 23.54  ?  828  VAL A N      1 
ATOM   4689 C  CA     . VAL C 3 532 ? 14.670  45.208 26.999  1.00 36.27  ?  828  VAL A CA     1 
ATOM   4690 C  C      . VAL C 3 532 ? 13.813  45.250 28.248  1.00 25.75  ?  828  VAL A C      1 
ATOM   4691 O  O      . VAL C 3 532 ? 13.536  46.331 28.781  1.00 37.26  ?  828  VAL A O      1 
ATOM   4692 C  CB     . VAL C 3 532 ? 15.970  46.002 27.183  1.00 46.46  ?  828  VAL A CB     1 
ATOM   4693 C  CG1    . VAL C 3 532 ? 16.820  45.374 28.273  1.00 47.22  ?  828  VAL A CG1    1 
ATOM   4694 C  CG2    . VAL C 3 532 ? 16.737  46.067 25.878  1.00 48.70  ?  828  VAL A CG2    1 
ATOM   4695 N  N      . HIS C 3 533 ? 13.358  44.083 28.694  1.00 29.42  ?  829  HIS A N      1 
ATOM   4696 C  CA     . HIS C 3 533 ? 12.663  44.029 29.967  1.00 31.97  ?  829  HIS A CA     1 
ATOM   4697 C  C      . HIS C 3 533 ? 11.305  44.710 29.859  1.00 27.48  ?  829  HIS A C      1 
ATOM   4698 O  O      . HIS C 3 533 ? 10.406  44.213 29.174  1.00 40.00  ?  829  HIS A O      1 
ATOM   4699 C  CB     . HIS C 3 533 ? 13.523  44.691 31.045  1.00 30.73  ?  829  HIS A CB     1 
ATOM   4700 C  CG     . HIS C 3 533 ? 14.933  44.183 31.087  1.00 54.76  ?  829  HIS A CG     1 
ATOM   4701 N  ND1    . HIS C 3 533 ? 16.016  45.006 31.315  1.00 60.56  ?  829  HIS A ND1    1 
ATOM   4702 C  CD2    . HIS C 3 533 ? 15.433  42.931 30.961  1.00 63.37  ?  829  HIS A CD2    1 
ATOM   4703 C  CE1    . HIS C 3 533 ? 17.122  44.284 31.313  1.00 62.60  ?  829  HIS A CE1    1 
ATOM   4704 N  NE2    . HIS C 3 533 ? 16.796  43.021 31.101  1.00 60.48  ?  829  HIS A NE2    1 
ATOM   4705 N  N      . ASP C 3 534 ? 11.146  45.845 30.540  1.00 33.54  ?  830  ASP A N      1 
ATOM   4706 C  CA     . ASP C 3 534 ? 9.914   46.622 30.499  1.00 22.06  ?  830  ASP A CA     1 
ATOM   4707 C  C      . ASP C 3 534 ? 10.099  47.938 29.758  1.00 23.67  ?  830  ASP A C      1 
ATOM   4708 O  O      . ASP C 3 534 ? 9.291   48.857 29.921  1.00 29.51  ?  830  ASP A O      1 
ATOM   4709 C  CB     . ASP C 3 534 ? 9.402   46.892 31.913  1.00 31.53  ?  830  ASP A CB     1 
ATOM   4710 C  CG     . ASP C 3 534 ? 9.168   45.621 32.705  1.00 41.60  ?  830  ASP A CG     1 
ATOM   4711 O  OD1    . ASP C 3 534 ? 8.810   44.588 32.099  1.00 48.00  ?  830  ASP A OD1    1 
ATOM   4712 O  OD2    . ASP C 3 534 ? 9.339   45.659 33.943  1.00 50.42  ?  830  ASP A OD2    1 
ATOM   4713 N  N      . GLU C 3 535 ? 11.154  48.045 28.956  1.00 19.38  ?  831  GLU A N      1 
ATOM   4714 C  CA     . GLU C 3 535 ? 11.499  49.270 28.254  1.00 23.16  ?  831  GLU A CA     1 
ATOM   4715 C  C      . GLU C 3 535 ? 11.462  49.037 26.750  1.00 21.92  ?  831  GLU A C      1 
ATOM   4716 O  O      . GLU C 3 535 ? 11.783  47.943 26.270  1.00 19.34  ?  831  GLU A O      1 
ATOM   4717 C  CB     . GLU C 3 535 ? 12.894  49.766 28.678  1.00 32.15  ?  831  GLU A CB     1 
ATOM   4718 C  CG     . GLU C 3 535 ? 13.276  51.118 28.103  1.00 49.22  ?  831  GLU A CG     1 
ATOM   4719 C  CD     . GLU C 3 535 ? 14.497  51.721 28.779  1.00 62.51  ?  831  GLU A CD     1 
ATOM   4720 O  OE1    . GLU C 3 535 ? 15.510  51.006 28.942  1.00 66.98  ?  831  GLU A OE1    1 
ATOM   4721 O  OE2    . GLU C 3 535 ? 14.440  52.911 29.159  1.00 65.65  ?  831  GLU A OE2    1 
ATOM   4722 N  N      . LEU C 3 536 ? 11.047  50.069 26.020  1.00 19.13  ?  832  LEU A N      1 
ATOM   4723 C  CA     . LEU C 3 536 ? 11.158  50.135 24.569  1.00 17.63  ?  832  LEU A CA     1 
ATOM   4724 C  C      . LEU C 3 536 ? 12.149  51.235 24.223  1.00 16.60  ?  832  LEU A C      1 
ATOM   4725 O  O      . LEU C 3 536 ? 12.020  52.363 24.708  1.00 21.96  ?  832  LEU A O      1 
ATOM   4726 C  CB     . LEU C 3 536 ? 9.806   50.437 23.912  1.00 19.09  ?  832  LEU A CB     1 
ATOM   4727 C  CG     . LEU C 3 536 ? 8.642   49.472 24.131  1.00 23.92  ?  832  LEU A CG     1 
ATOM   4728 C  CD1    . LEU C 3 536 ? 7.397   49.927 23.369  1.00 20.57  ?  832  LEU A CD1    1 
ATOM   4729 C  CD2    . LEU C 3 536 ? 9.054   48.080 23.704  1.00 25.31  ?  832  LEU A CD2    1 
ATOM   4730 N  N      . ILE C 3 537 ? 13.135  50.910 23.394  1.00 19.27  ?  833  ILE A N      1 
ATOM   4731 C  CA     . ILE C 3 537 ? 14.143  51.868 22.963  1.00 19.17  ?  833  ILE A CA     1 
ATOM   4732 C  C      . ILE C 3 537 ? 13.946  52.119 21.476  1.00 21.78  ?  833  ILE A C      1 
ATOM   4733 O  O      . ILE C 3 537 ? 13.831  51.172 20.687  1.00 24.42  ?  833  ILE A O      1 
ATOM   4734 C  CB     . ILE C 3 537 ? 15.564  51.365 23.264  1.00 23.99  ?  833  ILE A CB     1 
ATOM   4735 C  CG1    . ILE C 3 537 ? 15.740  51.146 24.769  1.00 32.85  ?  833  ILE A CG1    1 
ATOM   4736 C  CG2    . ILE C 3 537 ? 16.608  52.347 22.751  1.00 21.99  ?  833  ILE A CG2    1 
ATOM   4737 C  CD1    . ILE C 3 537 ? 15.477  49.728 25.217  1.00 44.43  ?  833  ILE A CD1    1 
ATOM   4738 N  N      . LEU C 3 538 ? 13.873  53.389 21.102  1.00 18.86  ?  834  LEU A N      1 
ATOM   4739 C  CA     . LEU C 3 538 ? 13.752  53.797 19.713  1.00 20.68  ?  834  LEU A CA     1 
ATOM   4740 C  C      . LEU C 3 538 ? 14.875  54.767 19.386  1.00 16.09  ?  834  LEU A C      1 
ATOM   4741 O  O      . LEU C 3 538 ? 15.497  55.351 20.276  1.00 22.16  ?  834  LEU A O      1 
ATOM   4742 C  CB     . LEU C 3 538 ? 12.402  54.473 19.427  1.00 23.23  ?  834  LEU A CB     1 
ATOM   4743 C  CG     . LEU C 3 538 ? 11.096  53.773 19.805  1.00 29.50  ?  834  LEU A CG     1 
ATOM   4744 C  CD1    . LEU C 3 538 ? 10.849  53.864 21.305  1.00 33.48  ?  834  LEU A CD1    1 
ATOM   4745 C  CD2    . LEU C 3 538 ? 9.930   54.376 19.035  1.00 35.49  ?  834  LEU A CD2    1 
ATOM   4746 N  N      . GLU C 3 539 ? 15.142  54.920 18.096  1.00 16.74  ?  835  GLU A N      1 
ATOM   4747 C  CA     . GLU C 3 539 ? 15.928  56.034 17.604  1.00 22.40  ?  835  GLU A CA     1 
ATOM   4748 C  C      . GLU C 3 539 ? 15.071  56.807 16.617  1.00 19.61  ?  835  GLU A C      1 
ATOM   4749 O  O      . GLU C 3 539 ? 14.193  56.244 15.960  1.00 22.16  ?  835  GLU A O      1 
ATOM   4750 C  CB     . GLU C 3 539 ? 17.236  55.583 16.948  1.00 23.74  ?  835  GLU A CB     1 
ATOM   4751 C  CG     . GLU C 3 539 ? 17.076  54.806 15.665  1.00 22.75  ?  835  GLU A CG     1 
ATOM   4752 C  CD     . GLU C 3 539 ? 18.416  54.426 15.061  1.00 37.60  ?  835  GLU A CD     1 
ATOM   4753 O  OE1    . GLU C 3 539 ? 19.455  54.783 15.654  1.00 32.64  ?  835  GLU A OE1    1 
ATOM   4754 O  OE2    . GLU C 3 539 ? 18.433  53.769 13.999  1.00 31.00  ?  835  GLU A OE2    1 
ATOM   4755 N  N      . ALA C 3 540 ? 15.316  58.106 16.531  1.00 21.28  ?  836  ALA A N      1 
ATOM   4756 C  CA     . ALA C 3 540 ? 14.487  58.964 15.703  1.00 22.69  ?  836  ALA A CA     1 
ATOM   4757 C  C      . ALA C 3 540 ? 15.220  60.272 15.484  1.00 28.38  ?  836  ALA A C      1 
ATOM   4758 O  O      . ALA C 3 540 ? 16.115  60.625 16.264  1.00 22.49  ?  836  ALA A O      1 
ATOM   4759 C  CB     . ALA C 3 540 ? 13.117  59.214 16.354  1.00 16.08  ?  836  ALA A CB     1 
ATOM   4760 N  N      . PRO C 3 541 ? 14.872  61.008 14.431  1.00 30.22  ?  837  PRO A N      1 
ATOM   4761 C  CA     . PRO C 3 541 ? 15.466  62.330 14.227  1.00 28.67  ?  837  PRO A CA     1 
ATOM   4762 C  C      . PRO C 3 541 ? 15.189  63.229 15.418  1.00 21.91  ?  837  PRO A C      1 
ATOM   4763 O  O      . PRO C 3 541 ? 14.177  63.091 16.107  1.00 23.02  ?  837  PRO A O      1 
ATOM   4764 C  CB     . PRO C 3 541 ? 14.766  62.842 12.961  1.00 28.47  ?  837  PRO A CB     1 
ATOM   4765 C  CG     . PRO C 3 541 ? 14.327  61.601 12.250  1.00 36.48  ?  837  PRO A CG     1 
ATOM   4766 C  CD     . PRO C 3 541 ? 13.976  60.619 13.330  1.00 23.65  ?  837  PRO A CD     1 
ATOM   4767 N  N      . LYS C 3 542 ? 16.104  64.166 15.663  1.00 25.20  ?  838  LYS A N      1 
ATOM   4768 C  CA     . LYS C 3 542 ? 15.904  65.042 16.808  1.00 25.95  ?  838  LYS A CA     1 
ATOM   4769 C  C      . LYS C 3 542 ? 14.629  65.864 16.651  1.00 32.73  ?  838  LYS A C      1 
ATOM   4770 O  O      . LYS C 3 542 ? 13.981  66.191 17.648  1.00 26.34  ?  838  LYS A O      1 
ATOM   4771 C  CB     . LYS C 3 542 ? 17.131  65.932 17.018  1.00 23.91  ?  838  LYS A CB     1 
ATOM   4772 C  CG     . LYS C 3 542 ? 17.389  66.942 15.927  1.00 44.82  ?  838  LYS A CG     1 
ATOM   4773 C  CD     . LYS C 3 542 ? 18.860  67.323 15.892  1.00 57.91  ?  838  LYS A CD     1 
ATOM   4774 C  CE     . LYS C 3 542 ? 19.054  68.642 15.173  1.00 63.64  ?  838  LYS A CE     1 
ATOM   4775 N  NZ     . LYS C 3 542 ? 18.071  68.808 14.067  1.00 65.38  ?  838  LYS A NZ     1 
ATOM   4776 N  N      . GLU C 3 543 ? 14.222  66.150 15.412  1.00 21.73  ?  839  GLU A N      1 
ATOM   4777 C  CA     . GLU C 3 543 ? 12.989  66.892 15.170  1.00 33.54  ?  839  GLU A CA     1 
ATOM   4778 C  C      . GLU C 3 543 ? 11.723  66.114 15.533  1.00 25.33  ?  839  GLU A C      1 
ATOM   4779 O  O      . GLU C 3 543 ? 10.651  66.724 15.609  1.00 39.62  ?  839  GLU A O      1 
ATOM   4780 C  CB     . GLU C 3 543 ? 12.924  67.328 13.704  1.00 43.38  ?  839  GLU A CB     1 
ATOM   4781 C  CG     . GLU C 3 543 ? 14.082  68.211 13.270  1.00 65.15  ?  839  GLU A CG     1 
ATOM   4782 C  CD     . GLU C 3 543 ? 13.921  68.732 11.853  1.00 89.57  ?  839  GLU A CD     1 
ATOM   4783 O  OE1    . GLU C 3 543 ? 13.053  68.211 11.120  1.00 95.73  ?  839  GLU A OE1    1 
ATOM   4784 O  OE2    . GLU C 3 543 ? 14.659  69.666 11.474  1.00 95.46  ?  839  GLU A OE2    1 
ATOM   4785 N  N      . GLU C 3 544 ? 11.807  64.803 15.759  1.00 19.23  ?  840  GLU A N      1 
ATOM   4786 C  CA     . GLU C 3 544 ? 10.643  64.016 16.149  1.00 20.67  ?  840  GLU A CA     1 
ATOM   4787 C  C      . GLU C 3 544 ? 10.548  63.782 17.650  1.00 22.73  ?  840  GLU A C      1 
ATOM   4788 O  O      . GLU C 3 544 ? 9.610   63.118 18.097  1.00 21.18  ?  840  GLU A O      1 
ATOM   4789 C  CB     . GLU C 3 544 ? 10.642  62.659 15.435  1.00 25.57  ?  840  GLU A CB     1 
ATOM   4790 C  CG     . GLU C 3 544 ? 10.485  62.739 13.924  1.00 34.29  ?  840  GLU A CG     1 
ATOM   4791 C  CD     . GLU C 3 544 ? 10.346  61.365 13.287  1.00 46.39  ?  840  GLU A CD     1 
ATOM   4792 O  OE1    . GLU C 3 544 ? 10.125  61.293 12.059  1.00 46.18  ?  840  GLU A OE1    1 
ATOM   4793 O  OE2    . GLU C 3 544 ? 10.456  60.354 14.014  1.00 43.00  ?  840  GLU A OE2    1 
ATOM   4794 N  N      . MET C 3 545 ? 11.486  64.306 18.441  1.00 21.44  ?  841  MET A N      1 
ATOM   4795 C  CA     . MET C 3 545 ? 11.503  63.979 19.864  1.00 22.39  ?  841  MET A CA     1 
ATOM   4796 C  C      . MET C 3 545 ? 10.261  64.504 20.579  1.00 20.18  ?  841  MET A C      1 
ATOM   4797 O  O      . MET C 3 545 ? 9.655   63.789 21.385  1.00 27.11  ?  841  MET A O      1 
ATOM   4798 C  CB     . MET C 3 545 ? 12.774  64.523 20.518  1.00 27.00  ?  841  MET A CB     1 
ATOM   4799 C  CG     . MET C 3 545 ? 14.034  63.743 20.165  1.00 33.92  ?  841  MET A CG     1 
ATOM   4800 S  SD     . MET C 3 545 ? 13.965  62.012 20.671  1.00 34.01  ?  841  MET A SD     1 
ATOM   4801 C  CE     . MET C 3 545 ? 13.549  61.199 19.134  1.00 25.97  ?  841  MET A CE     1 
ATOM   4802 N  N      . GLU C 3 546 ? 9.872   65.755 20.313  1.00 22.16  ?  842  GLU A N      1 
ATOM   4803 C  CA     . GLU C 3 546 ? 8.741   66.334 21.038  1.00 27.85  ?  842  GLU A CA     1 
ATOM   4804 C  C      . GLU C 3 546 ? 7.451   65.576 20.751  1.00 26.80  ?  842  GLU A C      1 
ATOM   4805 O  O      . GLU C 3 546 ? 6.628   65.366 21.651  1.00 19.03  ?  842  GLU A O      1 
ATOM   4806 C  CB     . GLU C 3 546 ? 8.581   67.815 20.692  1.00 25.26  ?  842  GLU A CB     1 
ATOM   4807 C  CG     . GLU C 3 546 ? 9.794   68.686 21.009  1.00 26.53  ?  842  GLU A CG     1 
ATOM   4808 C  CD     . GLU C 3 546 ? 9.443   70.164 21.096  1.00 29.25  ?  842  GLU A CD     1 
ATOM   4809 O  OE1    . GLU C 3 546 ? 8.596   70.524 21.940  1.00 40.29  ?  842  GLU A OE1    1 
ATOM   4810 O  OE2    . GLU C 3 546 ? 10.002  70.964 20.315  1.00 35.33  ?  842  GLU A OE2    1 
ATOM   4811 N  N      . ARG C 3 547 ? 7.253   65.161 19.501  1.00 17.05  ?  843  ARG A N      1 
ATOM   4812 C  CA     . ARG C 3 547 ? 6.075   64.369 19.179  1.00 18.30  ?  843  ARG A CA     1 
ATOM   4813 C  C      . ARG C 3 547 ? 6.135   62.996 19.835  1.00 16.47  ?  843  ARG A C      1 
ATOM   4814 O  O      . ARG C 3 547 ? 5.115   62.490 20.317  1.00 19.10  ?  843  ARG A O      1 
ATOM   4815 C  CB     . ARG C 3 547 ? 5.934   64.240 17.665  1.00 18.81  ?  843  ARG A CB     1 
ATOM   4816 C  CG     . ARG C 3 547 ? 5.475   65.511 16.986  1.00 35.98  ?  843  ARG A CG     1 
ATOM   4817 C  CD     . ARG C 3 547 ? 4.553   65.184 15.835  1.00 36.17  ?  843  ARG A CD     1 
ATOM   4818 N  NE     . ARG C 3 547 ? 5.281   64.815 14.628  1.00 54.40  ?  843  ARG A NE     1 
ATOM   4819 C  CZ     . ARG C 3 547 ? 4.768   64.078 13.649  1.00 51.80  ?  843  ARG A CZ     1 
ATOM   4820 N  NH1    . ARG C 3 547 ? 3.530   63.612 13.750  1.00 37.10  ?  843  ARG A NH1    1 
ATOM   4821 N  NH2    . ARG C 3 547 ? 5.494   63.799 12.575  1.00 51.48  ?  843  ARG A NH2    1 
ATOM   4822 N  N      . LEU C 3 548 ? 7.322   62.382 19.877  1.00 19.45  ?  844  LEU A N      1 
ATOM   4823 C  CA     . LEU C 3 548 ? 7.454   61.076 20.518  1.00 21.84  ?  844  LEU A CA     1 
ATOM   4824 C  C      . LEU C 3 548 ? 7.192   61.160 22.013  1.00 21.00  ?  844  LEU A C      1 
ATOM   4825 O  O      . LEU C 3 548 ? 6.685   60.207 22.616  1.00 17.71  ?  844  LEU A O      1 
ATOM   4826 C  CB     . LEU C 3 548 ? 8.848   60.495 20.273  1.00 16.83  ?  844  LEU A CB     1 
ATOM   4827 C  CG     . LEU C 3 548 ? 9.155   59.999 18.866  1.00 22.08  ?  844  LEU A CG     1 
ATOM   4828 C  CD1    . LEU C 3 548 ? 10.544  59.369 18.842  1.00 31.31  ?  844  LEU A CD1    1 
ATOM   4829 C  CD2    . LEU C 3 548 ? 8.098   59.006 18.425  1.00 21.20  ?  844  LEU A CD2    1 
ATOM   4830 N  N      . CYS C 3 549 ? 7.562   62.282 22.636  1.00 20.20  ?  845  CYS A N      1 
ATOM   4831 C  CA     . CYS C 3 549 ? 7.347   62.429 24.070  1.00 19.55  ?  845  CYS A CA     1 
ATOM   4832 C  C      . CYS C 3 549 ? 5.876   62.294 24.429  1.00 27.31  ?  845  CYS A C      1 
ATOM   4833 O  O      . CYS C 3 549 ? 5.546   61.822 25.522  1.00 25.72  ?  845  CYS A O      1 
ATOM   4834 C  CB     . CYS C 3 549 ? 7.889   63.776 24.551  1.00 25.55  ?  845  CYS A CB     1 
ATOM   4835 S  SG     . CYS C 3 549 ? 9.683   63.811 24.707  1.00 36.10  ?  845  CYS A SG     1 
ATOM   4836 N  N      . ARG C 3 550 ? 4.986   62.705 23.530  1.00 19.05  ?  846  ARG A N      1 
ATOM   4837 C  CA     . ARG C 3 550 ? 3.555   62.527 23.723  1.00 19.63  ?  846  ARG A CA     1 
ATOM   4838 C  C      . ARG C 3 550 ? 3.062   61.209 23.152  1.00 25.98  ?  846  ARG A C      1 
ATOM   4839 O  O      . ARG C 3 550 ? 2.209   60.552 23.757  1.00 25.35  ?  846  ARG A O      1 
ATOM   4840 C  CB     . ARG C 3 550 ? 2.793   63.685 23.080  1.00 25.98  ?  846  ARG A CB     1 
ATOM   4841 C  CG     . ARG C 3 550 ? 2.893   64.966 23.872  1.00 29.25  ?  846  ARG A CG     1 
ATOM   4842 C  CD     . ARG C 3 550 ? 2.364   66.145 23.084  1.00 23.71  ?  846  ARG A CD     1 
ATOM   4843 N  NE     . ARG C 3 550 ? 0.944   66.042 22.758  1.00 38.13  ?  846  ARG A NE     1 
ATOM   4844 C  CZ     . ARG C 3 550 ? -0.042  66.373 23.587  1.00 35.73  ?  846  ARG A CZ     1 
ATOM   4845 N  NH1    . ARG C 3 550 ? 0.231   66.802 24.813  1.00 27.91  ?  846  ARG A NH1    1 
ATOM   4846 N  NH2    . ARG C 3 550 ? -1.304  66.268 23.191  1.00 37.22  ?  846  ARG A NH2    1 
ATOM   4847 N  N      . LEU C 3 551 ? 3.604   60.801 22.005  1.00 26.33  ?  847  LEU A N      1 
ATOM   4848 C  CA     . LEU C 3 551 ? 3.094   59.623 21.311  1.00 31.66  ?  847  LEU A CA     1 
ATOM   4849 C  C      . LEU C 3 551 ? 3.446   58.333 22.048  1.00 25.35  ?  847  LEU A C      1 
ATOM   4850 O  O      . LEU C 3 551 ? 2.567   57.522 22.358  1.00 22.39  ?  847  LEU A O      1 
ATOM   4851 C  CB     . LEU C 3 551 ? 3.637   59.596 19.882  1.00 30.74  ?  847  LEU A CB     1 
ATOM   4852 C  CG     . LEU C 3 551 ? 3.069   58.520 18.962  1.00 35.30  ?  847  LEU A CG     1 
ATOM   4853 C  CD1    . LEU C 3 551 ? 1.570   58.465 19.115  1.00 34.65  ?  847  LEU A CD1    1 
ATOM   4854 C  CD2    . LEU C 3 551 ? 3.440   58.848 17.531  1.00 21.32  ?  847  LEU A CD2    1 
ATOM   4855 N  N      . VAL C 3 552 ? 4.735   58.108 22.315  1.00 16.55  ?  848  VAL A N      1 
ATOM   4856 C  CA     . VAL C 3 552 ? 5.162   56.809 22.838  1.00 21.20  ?  848  VAL A CA     1 
ATOM   4857 C  C      . VAL C 3 552 ? 4.522   56.497 24.185  1.00 26.34  ?  848  VAL A C      1 
ATOM   4858 O  O      . VAL C 3 552 ? 4.004   55.381 24.353  1.00 24.48  ?  848  VAL A O      1 
ATOM   4859 C  CB     . VAL C 3 552 ? 6.701   56.738 22.896  1.00 21.89  ?  848  VAL A CB     1 
ATOM   4860 C  CG1    . VAL C 3 552 ? 7.130   55.440 23.573  1.00 14.94  ?  848  VAL A CG1    1 
ATOM   4861 C  CG2    . VAL C 3 552 ? 7.290   56.824 21.495  1.00 28.14  ?  848  VAL A CG2    1 
ATOM   4862 N  N      . PRO C 3 553 ? 4.529   57.398 25.171  1.00 26.14  ?  849  PRO A N      1 
ATOM   4863 C  CA     . PRO C 3 553 ? 3.901   57.061 26.460  1.00 24.73  ?  849  PRO A CA     1 
ATOM   4864 C  C      . PRO C 3 553 ? 2.408   56.823 26.340  1.00 26.92  ?  849  PRO A C      1 
ATOM   4865 O  O      . PRO C 3 553 ? 1.862   55.950 27.025  1.00 29.98  ?  849  PRO A O      1 
ATOM   4866 C  CB     . PRO C 3 553 ? 4.218   58.287 27.332  1.00 25.74  ?  849  PRO A CB     1 
ATOM   4867 C  CG     . PRO C 3 553 ? 5.364   58.979 26.640  1.00 27.73  ?  849  PRO A CG     1 
ATOM   4868 C  CD     . PRO C 3 553 ? 5.134   58.739 25.183  1.00 25.19  ?  849  PRO A CD     1 
ATOM   4869 N  N      . GLU C 3 554 ? 1.732   57.581 25.473  1.00 20.28  ?  850  GLU A N      1 
ATOM   4870 C  CA     . GLU C 3 554 ? 0.296   57.404 25.273  1.00 26.00  ?  850  GLU A CA     1 
ATOM   4871 C  C      . GLU C 3 554 ? -0.023  56.009 24.743  1.00 28.85  ?  850  GLU A C      1 
ATOM   4872 O  O      . GLU C 3 554 ? -0.939  55.335 25.233  1.00 23.68  ?  850  GLU A O      1 
ATOM   4873 C  CB     . GLU C 3 554 ? -0.222  58.479 24.313  1.00 28.29  ?  850  GLU A CB     1 
ATOM   4874 C  CG     . GLU C 3 554 ? -1.643  58.257 23.813  1.00 52.38  ?  850  GLU A CG     1 
ATOM   4875 C  CD     . GLU C 3 554 ? -2.675  58.377 24.916  1.00 76.03  ?  850  GLU A CD     1 
ATOM   4876 O  OE1    . GLU C 3 554 ? -3.753  57.759 24.794  1.00 83.00  ?  850  GLU A OE1    1 
ATOM   4877 O  OE2    . GLU C 3 554 ? -2.407  59.091 25.905  1.00 83.69  ?  850  GLU A OE2    1 
ATOM   4878 N  N      . VAL C 3 555 ? 0.719   55.566 23.726  1.00 22.01  ?  851  VAL A N      1 
ATOM   4879 C  CA     . VAL C 3 555 ? 0.509   54.236 23.159  1.00 16.70  ?  851  VAL A CA     1 
ATOM   4880 C  C      . VAL C 3 555 ? 0.789   53.162 24.200  1.00 16.26  ?  851  VAL A C      1 
ATOM   4881 O  O      . VAL C 3 555 ? 0.022   52.201 24.350  1.00 27.02  ?  851  VAL A O      1 
ATOM   4882 C  CB     . VAL C 3 555 ? 1.389   54.052 21.909  1.00 22.82  ?  851  VAL A CB     1 
ATOM   4883 C  CG1    . VAL C 3 555 ? 1.491   52.577 21.544  1.00 29.54  ?  851  VAL A CG1    1 
ATOM   4884 C  CG2    . VAL C 3 555 ? 0.835   54.861 20.747  1.00 28.56  ?  851  VAL A CG2    1 
ATOM   4885 N  N      . MET C 3 556 ? 1.889   53.311 24.939  1.00 18.22  ?  852  MET A N      1 
ATOM   4886 C  CA     . MET C 3 556 ? 2.233   52.346 25.976  1.00 18.31  ?  852  MET A CA     1 
ATOM   4887 C  C      . MET C 3 556 ? 1.219   52.361 27.117  1.00 20.17  ?  852  MET A C      1 
ATOM   4888 O  O      . MET C 3 556 ? 0.814   51.299 27.607  1.00 19.11  ?  852  MET A O      1 
ATOM   4889 C  CB     . MET C 3 556 ? 3.648   52.622 26.481  1.00 15.95  ?  852  MET A CB     1 
ATOM   4890 C  CG     . MET C 3 556 ? 4.704   52.333 25.413  1.00 19.38  ?  852  MET A CG     1 
ATOM   4891 S  SD     . MET C 3 556 ? 6.406   52.681 25.877  1.00 24.38  ?  852  MET A SD     1 
ATOM   4892 C  CE     . MET C 3 556 ? 6.627   51.555 27.257  1.00 29.19  ?  852  MET A CE     1 
ATOM   4893 N  N      . GLU C 3 557 ? 0.780   53.545 27.547  1.00 24.19  ?  853  GLU A N      1 
ATOM   4894 C  CA     . GLU C 3 557 ? -0.163  53.609 28.660  1.00 25.92  ?  853  GLU A CA     1 
ATOM   4895 C  C      . GLU C 3 557 ? -1.550  53.110 28.279  1.00 33.68  ?  853  GLU A C      1 
ATOM   4896 O  O      . GLU C 3 557 ? -2.334  52.757 29.166  1.00 31.35  ?  853  GLU A O      1 
ATOM   4897 C  CB     . GLU C 3 557 ? -0.259  55.039 29.196  1.00 33.78  ?  853  GLU A CB     1 
ATOM   4898 C  CG     . GLU C 3 557 ? 1.032   55.555 29.811  1.00 31.50  ?  853  GLU A CG     1 
ATOM   4899 C  CD     . GLU C 3 557 ? 0.991   57.046 30.099  1.00 47.58  ?  853  GLU A CD     1 
ATOM   4900 O  OE1    . GLU C 3 557 ? 0.081   57.733 29.587  1.00 45.45  ?  853  GLU A OE1    1 
ATOM   4901 O  OE2    . GLU C 3 557 ? 1.875   57.531 30.838  1.00 56.87  ?  853  GLU A OE2    1 
ATOM   4902 N  N      . GLN C 3 558 ? -1.872  53.073 26.988  1.00 23.75  ?  854  GLN A N      1 
ATOM   4903 C  CA     . GLN C 3 558 ? -3.177  52.628 26.527  1.00 25.71  ?  854  GLN A CA     1 
ATOM   4904 C  C      . GLN C 3 558 ? -3.141  51.221 25.941  1.00 25.44  ?  854  GLN A C      1 
ATOM   4905 O  O      . GLN C 3 558 ? -4.158  50.759 25.416  1.00 22.65  ?  854  GLN A O      1 
ATOM   4906 C  CB     . GLN C 3 558 ? -3.735  53.620 25.504  1.00 18.05  ?  854  GLN A CB     1 
ATOM   4907 C  CG     . GLN C 3 558 ? -3.800  55.065 26.020  1.00 38.72  ?  854  GLN A CG     1 
ATOM   4908 C  CD     . GLN C 3 558 ? -4.664  55.217 27.267  1.00 54.26  ?  854  GLN A CD     1 
ATOM   4909 O  OE1    . GLN C 3 558 ? -5.836  54.843 27.272  1.00 71.78  ?  854  GLN A OE1    1 
ATOM   4910 N  NE2    . GLN C 3 558 ? -4.084  55.767 28.329  1.00 52.60  ?  854  GLN A NE2    1 
ATOM   4911 N  N      . ALA C 3 559 ? -2.001  50.526 26.029  1.00 21.05  ?  855  ALA A N      1 
ATOM   4912 C  CA     . ALA C 3 559 ? -1.874  49.206 25.410  1.00 26.25  ?  855  ALA A CA     1 
ATOM   4913 C  C      . ALA C 3 559 ? -2.978  48.263 25.878  1.00 29.43  ?  855  ALA A C      1 
ATOM   4914 O  O      . ALA C 3 559 ? -3.556  47.513 25.083  1.00 25.10  ?  855  ALA A O      1 
ATOM   4915 C  CB     . ALA C 3 559 ? -0.493  48.616 25.711  1.00 25.50  ?  855  ALA A CB     1 
ATOM   4916 N  N      . VAL C 3 560 ? -3.271  48.280 27.178  1.00 23.87  ?  856  VAL A N      1 
ATOM   4917 C  CA     . VAL C 3 560 ? -4.394  47.554 27.757  1.00 31.11  ?  856  VAL A CA     1 
ATOM   4918 C  C      . VAL C 3 560 ? -5.011  48.450 28.820  1.00 26.77  ?  856  VAL A C      1 
ATOM   4919 O  O      . VAL C 3 560 ? -4.394  49.409 29.289  1.00 35.73  ?  856  VAL A O      1 
ATOM   4920 C  CB     . VAL C 3 560 ? -3.979  46.199 28.375  1.00 25.70  ?  856  VAL A CB     1 
ATOM   4921 C  CG1    . VAL C 3 560 ? -3.245  45.336 27.352  1.00 23.16  ?  856  VAL A CG1    1 
ATOM   4922 C  CG2    . VAL C 3 560 ? -3.121  46.430 29.608  1.00 35.49  ?  856  VAL A CG2    1 
ATOM   4923 N  N      . THR C 3 561 ? -6.245  48.129 29.202  1.00 26.52  ?  857  THR A N      1 
ATOM   4924 C  CA     . THR C 3 561 ? -6.958  48.860 30.245  1.00 28.37  ?  857  THR A CA     1 
ATOM   4925 C  C      . THR C 3 561 ? -6.991  47.993 31.498  1.00 28.62  ?  857  THR A C      1 
ATOM   4926 O  O      . THR C 3 561 ? -7.632  46.938 31.509  1.00 27.48  ?  857  THR A O      1 
ATOM   4927 C  CB     . THR C 3 561 ? -8.371  49.230 29.796  1.00 30.77  ?  857  THR A CB     1 
ATOM   4928 O  OG1    . THR C 3 561 ? -8.308  49.926 28.544  1.00 44.07  ?  857  THR A OG1    1 
ATOM   4929 C  CG2    . THR C 3 561 ? -9.039  50.129 30.830  1.00 30.76  ?  857  THR A CG2    1 
ATOM   4930 N  N      . LEU C 3 562 ? -6.296  48.436 32.541  1.00 24.39  ?  858  LEU A N      1 
ATOM   4931 C  CA     . LEU C 3 562 ? -6.277  47.768 33.834  1.00 17.88  ?  858  LEU A CA     1 
ATOM   4932 C  C      . LEU C 3 562 ? -7.090  48.569 34.843  1.00 21.17  ?  858  LEU A C      1 
ATOM   4933 O  O      . LEU C 3 562 ? -7.507  49.703 34.584  1.00 23.64  ?  858  LEU A O      1 
ATOM   4934 C  CB     . LEU C 3 562 ? -4.838  47.587 34.334  1.00 21.58  ?  858  LEU A CB     1 
ATOM   4935 C  CG     . LEU C 3 562 ? -3.861  46.814 33.445  1.00 26.15  ?  858  LEU A CG     1 
ATOM   4936 C  CD1    . LEU C 3 562 ? -2.499  46.733 34.117  1.00 20.50  ?  858  LEU A CD1    1 
ATOM   4937 C  CD2    . LEU C 3 562 ? -4.389  45.423 33.140  1.00 22.28  ?  858  LEU A CD2    1 
ATOM   4938 N  N      . ARG C 3 563 ? -7.309  47.962 36.013  1.00 28.12  ?  859  ARG A N      1 
ATOM   4939 C  CA     . ARG C 3 563 ? -7.972  48.656 37.111  1.00 22.31  ?  859  ARG A CA     1 
ATOM   4940 C  C      . ARG C 3 563 ? -7.089  49.725 37.737  1.00 27.22  ?  859  ARG A C      1 
ATOM   4941 O  O      . ARG C 3 563 ? -7.585  50.530 38.532  1.00 28.62  ?  859  ARG A O      1 
ATOM   4942 C  CB     . ARG C 3 563 ? -8.413  47.650 38.179  1.00 23.23  ?  859  ARG A CB     1 
ATOM   4943 C  CG     . ARG C 3 563 ? -9.359  46.593 37.644  1.00 34.10  ?  859  ARG A CG     1 
ATOM   4944 C  CD     . ARG C 3 563 ? -9.800  45.621 38.722  1.00 37.52  ?  859  ARG A CD     1 
ATOM   4945 N  NE     . ARG C 3 563 ? -10.902 44.784 38.257  1.00 40.47  ?  859  ARG A NE     1 
ATOM   4946 C  CZ     . ARG C 3 563 ? -10.747 43.624 37.625  1.00 49.73  ?  859  ARG A CZ     1 
ATOM   4947 N  NH1    . ARG C 3 563 ? -9.531  43.151 37.386  1.00 31.12  ?  859  ARG A NH1    1 
ATOM   4948 N  NH2    . ARG C 3 563 ? -11.809 42.934 37.233  1.00 62.17  ?  859  ARG A NH2    1 
ATOM   4949 N  N      . VAL C 3 564 ? -5.804  49.745 37.405  1.00 20.25  ?  860  VAL A N      1 
ATOM   4950 C  CA     . VAL C 3 564 ? -4.911  50.820 37.828  1.00 16.24  ?  860  VAL A CA     1 
ATOM   4951 C  C      . VAL C 3 564 ? -4.264  51.410 36.585  1.00 20.63  ?  860  VAL A C      1 
ATOM   4952 O  O      . VAL C 3 564 ? -4.196  50.760 35.529  1.00 22.43  ?  860  VAL A O      1 
ATOM   4953 C  CB     . VAL C 3 564 ? -3.845  50.320 38.829  1.00 21.71  ?  860  VAL A CB     1 
ATOM   4954 C  CG1    . VAL C 3 564 ? -4.520  49.767 40.076  1.00 26.94  ?  860  VAL A CG1    1 
ATOM   4955 C  CG2    . VAL C 3 564 ? -2.964  49.269 38.186  1.00 16.69  ?  860  VAL A CG2    1 
ATOM   4956 N  N      . PRO C 3 565 ? -3.780  52.642 36.680  1.00 21.71  ?  861  PRO A N      1 
ATOM   4957 C  CA     . PRO C 3 565 ? -3.098  53.252 35.539  1.00 26.87  ?  861  PRO A CA     1 
ATOM   4958 C  C      . PRO C 3 565 ? -1.798  52.539 35.222  1.00 22.12  ?  861  PRO A C      1 
ATOM   4959 O  O      . PRO C 3 565 ? -1.156  51.946 36.090  1.00 21.03  ?  861  PRO A O      1 
ATOM   4960 C  CB     . PRO C 3 565 ? -2.828  54.687 36.006  1.00 17.99  ?  861  PRO A CB     1 
ATOM   4961 C  CG     . PRO C 3 565 ? -3.729  54.905 37.171  1.00 25.65  ?  861  PRO A CG     1 
ATOM   4962 C  CD     . PRO C 3 565 ? -3.901  53.568 37.816  1.00 22.77  ?  861  PRO A CD     1 
ATOM   4963 N  N      . LEU C 3 566 ? -1.413  52.608 33.957  1.00 17.72  ?  862  LEU A N      1 
ATOM   4964 C  CA     . LEU C 3 566 ? -0.085  52.208 33.524  1.00 21.86  ?  862  LEU A CA     1 
ATOM   4965 C  C      . LEU C 3 566 ? 0.762   53.466 33.389  1.00 25.24  ?  862  LEU A C      1 
ATOM   4966 O  O      . LEU C 3 566 ? 0.384   54.398 32.673  1.00 33.81  ?  862  LEU A O      1 
ATOM   4967 C  CB     . LEU C 3 566 ? -0.144  51.438 32.204  1.00 24.63  ?  862  LEU A CB     1 
ATOM   4968 C  CG     . LEU C 3 566 ? -0.637  49.986 32.262  1.00 25.32  ?  862  LEU A CG     1 
ATOM   4969 C  CD1    . LEU C 3 566 ? -0.749  49.400 30.857  1.00 24.56  ?  862  LEU A CD1    1 
ATOM   4970 C  CD2    . LEU C 3 566 ? 0.280   49.133 33.120  1.00 25.70  ?  862  LEU A CD2    1 
ATOM   4971 N  N      . LYS C 3 567 ? 1.891   53.496 34.083  1.00 21.29  ?  863  LYS A N      1 
ATOM   4972 C  CA     . LYS C 3 567 ? 2.777   54.649 34.080  1.00 25.53  ?  863  LYS A CA     1 
ATOM   4973 C  C      . LYS C 3 567 ? 3.986   54.363 33.206  1.00 25.27  ?  863  LYS A C      1 
ATOM   4974 O  O      . LYS C 3 567 ? 4.540   53.260 33.235  1.00 24.17  ?  863  LYS A O      1 
ATOM   4975 C  CB     . LYS C 3 567 ? 3.233   54.987 35.498  1.00 29.99  ?  863  LYS A CB     1 
ATOM   4976 C  CG     . LYS C 3 567 ? 4.089   56.239 35.599  1.00 31.80  ?  863  LYS A CG     1 
ATOM   4977 C  CD     . LYS C 3 567 ? 4.834   56.237 36.923  1.00 45.69  ?  863  LYS A CD     1 
ATOM   4978 C  CE     . LYS C 3 567 ? 4.868   57.613 37.556  1.00 53.78  ?  863  LYS A CE     1 
ATOM   4979 N  NZ     . LYS C 3 567 ? 5.344   57.528 38.966  1.00 58.96  ?  863  LYS A NZ     1 
ATOM   4980 N  N      . VAL C 3 568 ? 4.389   55.358 32.425  1.00 21.50  ?  864  VAL A N      1 
ATOM   4981 C  CA     . VAL C 3 568 ? 5.527   55.232 31.530  1.00 23.82  ?  864  VAL A CA     1 
ATOM   4982 C  C      . VAL C 3 568 ? 6.490   56.370 31.820  1.00 20.76  ?  864  VAL A C      1 
ATOM   4983 O  O      . VAL C 3 568 ? 6.102   57.543 31.775  1.00 30.02  ?  864  VAL A O      1 
ATOM   4984 C  CB     . VAL C 3 568 ? 5.106   55.246 30.053  1.00 25.80  ?  864  VAL A CB     1 
ATOM   4985 C  CG1    . VAL C 3 568 ? 6.335   55.187 29.167  1.00 23.06  ?  864  VAL A CG1    1 
ATOM   4986 C  CG2    . VAL C 3 568 ? 4.182   54.064 29.757  1.00 31.08  ?  864  VAL A CG2    1 
ATOM   4987 N  N      . ASP C 3 569 ? 7.737   56.026 32.119  1.00 13.55  ?  865  ASP A N      1 
ATOM   4988 C  CA     . ASP C 3 569 ? 8.819   56.997 32.166  1.00 26.05  ?  865  ASP A CA     1 
ATOM   4989 C  C      . ASP C 3 569 ? 9.586   56.949 30.855  1.00 28.58  ?  865  ASP A C      1 
ATOM   4990 O  O      . ASP C 3 569 ? 9.856   55.871 30.318  1.00 28.55  ?  865  ASP A O      1 
ATOM   4991 C  CB     . ASP C 3 569 ? 9.769   56.722 33.330  1.00 32.19  ?  865  ASP A CB     1 
ATOM   4992 C  CG     . ASP C 3 569 ? 9.088   56.825 34.674  1.00 51.08  ?  865  ASP A CG     1 
ATOM   4993 O  OD1    . ASP C 3 569 ? 8.221   57.708 34.843  1.00 60.09  ?  865  ASP A OD1    1 
ATOM   4994 O  OD2    . ASP C 3 569 ? 9.425   56.017 35.564  1.00 64.04  ?  865  ASP A OD2    1 
ATOM   4995 N  N      . TYR C 3 570 ? 9.944   58.122 30.349  1.00 21.62  ?  866  TYR A N      1 
ATOM   4996 C  CA     . TYR C 3 570 ? 10.620  58.220 29.070  1.00 24.50  ?  866  TYR A CA     1 
ATOM   4997 C  C      . TYR C 3 570 ? 11.699  59.289 29.138  1.00 30.16  ?  866  TYR A C      1 
ATOM   4998 O  O      . TYR C 3 570 ? 11.549  60.300 29.832  1.00 29.80  ?  866  TYR A O      1 
ATOM   4999 C  CB     . TYR C 3 570 ? 9.624   58.538 27.953  1.00 20.47  ?  866  TYR A CB     1 
ATOM   5000 C  CG     . TYR C 3 570 ? 8.822   59.782 28.231  1.00 29.01  ?  866  TYR A CG     1 
ATOM   5001 C  CD1    . TYR C 3 570 ? 9.200   61.003 27.698  1.00 27.04  ?  866  TYR A CD1    1 
ATOM   5002 C  CD2    . TYR C 3 570 ? 7.696   59.739 29.043  1.00 34.52  ?  866  TYR A CD2    1 
ATOM   5003 C  CE1    . TYR C 3 570 ? 8.474   62.152 27.953  1.00 41.68  ?  866  TYR A CE1    1 
ATOM   5004 C  CE2    . TYR C 3 570 ? 6.962   60.882 29.307  1.00 38.75  ?  866  TYR A CE2    1 
ATOM   5005 C  CZ     . TYR C 3 570 ? 7.357   62.086 28.758  1.00 44.18  ?  866  TYR A CZ     1 
ATOM   5006 O  OH     . TYR C 3 570 ? 6.638   63.232 29.011  1.00 57.13  ?  866  TYR A OH     1 
ATOM   5007 N  N      . HIS C 3 571 ? 12.793  59.042 28.424  1.00 21.46  ?  867  HIS A N      1 
ATOM   5008 C  CA     . HIS C 3 571 ? 13.905  59.969 28.304  1.00 25.88  ?  867  HIS A CA     1 
ATOM   5009 C  C      . HIS C 3 571 ? 14.479  59.822 26.907  1.00 30.49  ?  867  HIS A C      1 
ATOM   5010 O  O      . HIS C 3 571 ? 14.204  58.848 26.203  1.00 24.73  ?  867  HIS A O      1 
ATOM   5011 C  CB     . HIS C 3 571 ? 14.992  59.707 29.357  1.00 24.75  ?  867  HIS A CB     1 
ATOM   5012 C  CG     . HIS C 3 571 ? 14.452  59.421 30.724  1.00 34.95  ?  867  HIS A CG     1 
ATOM   5013 N  ND1    . HIS C 3 571 ? 14.117  60.418 31.616  1.00 41.12  ?  867  HIS A ND1    1 
ATOM   5014 C  CD2    . HIS C 3 571 ? 14.195  58.250 31.354  1.00 38.15  ?  867  HIS A CD2    1 
ATOM   5015 C  CE1    . HIS C 3 571 ? 13.671  59.873 32.733  1.00 43.36  ?  867  HIS A CE1    1 
ATOM   5016 N  NE2    . HIS C 3 571 ? 13.709  58.559 32.601  1.00 40.99  ?  867  HIS A NE2    1 
ATOM   5017 N  N      . TYR C 3 572 ? 15.288  60.797 26.503  1.00 22.55  ?  868  TYR A N      1 
ATOM   5018 C  CA     . TYR C 3 572 ? 15.999  60.673 25.242  1.00 24.05  ?  868  TYR A CA     1 
ATOM   5019 C  C      . TYR C 3 572 ? 17.343  61.371 25.366  1.00 22.75  ?  868  TYR A C      1 
ATOM   5020 O  O      . TYR C 3 572 ? 17.557  62.203 26.248  1.00 28.59  ?  868  TYR A O      1 
ATOM   5021 C  CB     . TYR C 3 572 ? 15.180  61.231 24.067  1.00 16.56  ?  868  TYR A CB     1 
ATOM   5022 C  CG     . TYR C 3 572 ? 14.873  62.705 24.160  1.00 27.91  ?  868  TYR A CG     1 
ATOM   5023 C  CD1    . TYR C 3 572 ? 15.762  63.654 23.673  1.00 30.74  ?  868  TYR A CD1    1 
ATOM   5024 C  CD2    . TYR C 3 572 ? 13.688  63.148 24.727  1.00 28.61  ?  868  TYR A CD2    1 
ATOM   5025 C  CE1    . TYR C 3 572 ? 15.484  65.001 23.753  1.00 39.89  ?  868  TYR A CE1    1 
ATOM   5026 C  CE2    . TYR C 3 572 ? 13.399  64.498 24.811  1.00 31.33  ?  868  TYR A CE2    1 
ATOM   5027 C  CZ     . TYR C 3 572 ? 14.300  65.420 24.322  1.00 44.11  ?  868  TYR A CZ     1 
ATOM   5028 O  OH     . TYR C 3 572 ? 14.014  66.764 24.404  1.00 50.15  ?  868  TYR A OH     1 
ATOM   5029 N  N      . GLY C 3 573 ? 18.254  61.001 24.479  1.00 20.46  ?  869  GLY A N      1 
ATOM   5030 C  CA     . GLY C 3 573 ? 19.596  61.545 24.531  1.00 25.97  ?  869  GLY A CA     1 
ATOM   5031 C  C      . GLY C 3 573 ? 20.378  61.059 23.336  1.00 20.13  ?  869  GLY A C      1 
ATOM   5032 O  O      . GLY C 3 573 ? 19.870  60.315 22.492  1.00 19.71  ?  869  GLY A O      1 
ATOM   5033 N  N      . SER C 3 574 ? 21.633  61.488 23.272  1.00 24.48  ?  870  SER A N      1 
ATOM   5034 C  CA     . SER C 3 574 ? 22.476  61.114 22.147  1.00 26.10  ?  870  SER A CA     1 
ATOM   5035 C  C      . SER C 3 574 ? 22.971  59.677 22.234  1.00 28.50  ?  870  SER A C      1 
ATOM   5036 O  O      . SER C 3 574 ? 23.469  59.153 21.236  1.00 26.06  ?  870  SER A O      1 
ATOM   5037 C  CB     . SER C 3 574 ? 23.663  62.073 22.042  1.00 38.02  ?  870  SER A CB     1 
ATOM   5038 O  OG     . SER C 3 574 ? 24.410  62.082 23.246  1.00 41.73  ?  870  SER A OG     1 
ATOM   5039 N  N      . THR C 3 575 ? 22.850  59.032 23.394  1.00 25.04  ?  871  THR A N      1 
ATOM   5040 C  CA     . THR C 3 575 ? 23.231  57.635 23.549  1.00 28.96  ?  871  THR A CA     1 
ATOM   5041 C  C      . THR C 3 575 ? 22.187  56.928 24.396  1.00 27.51  ?  871  THR A C      1 
ATOM   5042 O  O      . THR C 3 575 ? 21.321  57.553 25.014  1.00 24.10  ?  871  THR A O      1 
ATOM   5043 C  CB     . THR C 3 575 ? 24.607  57.468 24.210  1.00 30.35  ?  871  THR A CB     1 
ATOM   5044 O  OG1    . THR C 3 575 ? 24.478  57.656 25.626  1.00 29.70  ?  871  THR A OG1    1 
ATOM   5045 C  CG2    . THR C 3 575 ? 25.602  58.470 23.657  1.00 26.02  ?  871  THR A CG2    1 
ATOM   5046 N  N      . TRP C 3 576 ? 22.288  55.600 24.427  1.00 23.52  ?  872  TRP A N      1 
ATOM   5047 C  CA     . TRP C 3 576 ? 21.422  54.815 25.299  1.00 30.90  ?  872  TRP A CA     1 
ATOM   5048 C  C      . TRP C 3 576 ? 21.611  55.219 26.756  1.00 26.95  ?  872  TRP A C      1 
ATOM   5049 O  O      . TRP C 3 576 ? 20.639  55.321 27.514  1.00 27.32  ?  872  TRP A O      1 
ATOM   5050 C  CB     . TRP C 3 576 ? 21.716  53.329 25.103  1.00 28.92  ?  872  TRP A CB     1 
ATOM   5051 C  CG     . TRP C 3 576 ? 20.726  52.407 25.731  1.00 31.14  ?  872  TRP A CG     1 
ATOM   5052 C  CD1    . TRP C 3 576 ? 19.533  52.737 26.303  1.00 27.92  ?  872  TRP A CD1    1 
ATOM   5053 C  CD2    . TRP C 3 576 ? 20.846  50.988 25.840  1.00 32.16  ?  872  TRP A CD2    1 
ATOM   5054 N  NE1    . TRP C 3 576 ? 18.902  51.606 26.767  1.00 27.48  ?  872  TRP A NE1    1 
ATOM   5055 C  CE2    . TRP C 3 576 ? 19.691  50.519 26.495  1.00 33.38  ?  872  TRP A CE2    1 
ATOM   5056 C  CE3    . TRP C 3 576 ? 21.823  50.067 25.451  1.00 35.67  ?  872  TRP A CE3    1 
ATOM   5057 C  CZ2    . TRP C 3 576 ? 19.485  49.167 26.766  1.00 34.47  ?  872  TRP A CZ2    1 
ATOM   5058 C  CZ3    . TRP C 3 576 ? 21.619  48.727 25.721  1.00 35.13  ?  872  TRP A CZ3    1 
ATOM   5059 C  CH2    . TRP C 3 576 ? 20.461  48.289 26.371  1.00 22.14  ?  872  TRP A CH2    1 
ATOM   5060 N  N      . TYR C 3 577 ? 22.858  55.454 27.162  1.00 28.16  ?  873  TYR A N      1 
ATOM   5061 C  CA     . TYR C 3 577 ? 23.130  55.940 28.511  1.00 34.02  ?  873  TYR A CA     1 
ATOM   5062 C  C      . TYR C 3 577 ? 22.386  57.240 28.786  1.00 37.92  ?  873  TYR A C      1 
ATOM   5063 O  O      . TYR C 3 577 ? 21.670  57.364 29.787  1.00 36.97  ?  873  TYR A O      1 
ATOM   5064 C  CB     . TYR C 3 577 ? 24.635  56.139 28.690  1.00 33.01  ?  873  TYR A CB     1 
ATOM   5065 C  CG     . TYR C 3 577 ? 25.027  56.718 30.029  1.00 37.16  ?  873  TYR A CG     1 
ATOM   5066 C  CD1    . TYR C 3 577 ? 24.889  55.976 31.195  1.00 43.87  ?  873  TYR A CD1    1 
ATOM   5067 C  CD2    . TYR C 3 577 ? 25.546  58.001 30.127  1.00 45.10  ?  873  TYR A CD2    1 
ATOM   5068 C  CE1    . TYR C 3 577 ? 25.250  56.498 32.422  1.00 50.06  ?  873  TYR A CE1    1 
ATOM   5069 C  CE2    . TYR C 3 577 ? 25.912  58.532 31.349  1.00 55.86  ?  873  TYR A CE2    1 
ATOM   5070 C  CZ     . TYR C 3 577 ? 25.762  57.776 32.493  1.00 60.68  ?  873  TYR A CZ     1 
ATOM   5071 O  OH     . TYR C 3 577 ? 26.126  58.303 33.711  1.00 67.06  ?  873  TYR A OH     1 
ATOM   5072 N  N      . ASP C 3 578 ? 22.549  58.224 27.903  1.00 34.12  ?  874  ASP A N      1 
ATOM   5073 C  CA     . ASP C 3 578 ? 21.964  59.537 28.131  1.00 33.51  ?  874  ASP A CA     1 
ATOM   5074 C  C      . ASP C 3 578 ? 20.452  59.531 28.027  1.00 36.85  ?  874  ASP A C      1 
ATOM   5075 O  O      . ASP C 3 578 ? 19.813  60.489 28.472  1.00 42.24  ?  874  ASP A O      1 
ATOM   5076 C  CB     . ASP C 3 578 ? 22.546  60.545 27.146  1.00 36.00  ?  874  ASP A CB     1 
ATOM   5077 C  CG     . ASP C 3 578 ? 24.002  60.809 27.399  1.00 52.28  ?  874  ASP A CG     1 
ATOM   5078 O  OD1    . ASP C 3 578 ? 24.322  61.339 28.482  1.00 54.33  ?  874  ASP A OD1    1 
ATOM   5079 O  OD2    . ASP C 3 578 ? 24.827  60.456 26.533  1.00 61.67  ?  874  ASP A OD2    1 
ATOM   5080 N  N      . ALA C 3 579 ? 19.860  58.488 27.452  1.00 24.67  ?  875  ALA A N      1 
ATOM   5081 C  CA     . ALA C 3 579 ? 18.407  58.392 27.441  1.00 25.16  ?  875  ALA A CA     1 
ATOM   5082 C  C      . ALA C 3 579 ? 17.926  57.995 28.835  1.00 41.34  ?  875  ALA A C      1 
ATOM   5083 O  O      . ALA C 3 579 ? 17.302  56.943 29.027  1.00 35.32  ?  875  ALA A O      1 
ATOM   5084 C  CB     . ALA C 3 579 ? 17.949  57.406 26.363  1.00 22.48  ?  875  ALA A CB     1 
ATOM   5085 N  N      . LYS C 3 580 ? 18.230  58.843 29.814  1.00 55.62  ?  876  LYS A N      1 
ATOM   5086 C  CA     . LYS C 3 580 ? 17.916  58.594 31.220  1.00 59.87  ?  876  LYS A CA     1 
ATOM   5087 C  C      . LYS C 3 580 ? 17.290  59.821 31.868  1.00 71.62  ?  876  LYS A C      1 
ATOM   5088 O  O      . LYS C 3 580 ? 17.485  60.940 31.402  1.00 72.56  ?  876  LYS A O      1 
ATOM   5089 C  CB     . LYS C 3 580 ? 19.178  58.210 31.985  1.00 54.75  ?  876  LYS A CB     1 
ATOM   5090 C  CG     . LYS C 3 580 ? 20.182  59.351 32.080  1.00 49.67  ?  876  LYS A CG     1 
ATOM   5091 C  CD     . LYS C 3 580 ? 21.485  58.951 32.750  1.00 40.39  ?  876  LYS A CD     1 
ATOM   5092 C  CE     . LYS C 3 580 ? 22.615  59.864 32.287  1.00 54.05  ?  876  LYS A CE     1 
ATOM   5093 N  NZ     . LYS C 3 580 ? 23.327  60.525 33.415  1.00 51.32  ?  876  LYS A NZ     1 
ATOM   5094 O  OXT    . LYS C 3 580 ? 16.600  59.729 32.881  1.00 76.06  ?  876  LYS A OXT    1 
HETATM 5095 MG MG     . MG  D 4 .   ? 9.608   50.023 37.543  1.00 38.01  ?  901  MG  A MG     1 
HETATM 5096 S  S      . SO4 E 5 .   ? -8.927  43.342 49.147  1.00 101.45 ?  902  SO4 A S      1 
HETATM 5097 O  O1     . SO4 E 5 .   ? -7.573  43.889 49.163  1.00 100.01 ?  902  SO4 A O1     1 
HETATM 5098 O  O2     . SO4 E 5 .   ? -9.596  43.736 47.911  1.00 102.53 ?  902  SO4 A O2     1 
HETATM 5099 O  O3     . SO4 E 5 .   ? -8.863  41.885 49.222  1.00 105.13 ?  902  SO4 A O3     1 
HETATM 5100 O  O4     . SO4 E 5 .   ? -9.675  43.855 50.292  1.00 104.89 ?  902  SO4 A O4     1 
HETATM 5101 S  S      . SO4 F 5 .   ? 1.909   10.683 -1.654  1.00 93.68  ?  903  SO4 A S      1 
HETATM 5102 O  O1     . SO4 F 5 .   ? 1.936   11.453 -2.894  1.00 94.90  ?  903  SO4 A O1     1 
HETATM 5103 O  O2     . SO4 F 5 .   ? 1.422   9.333  -1.926  1.00 97.01  ?  903  SO4 A O2     1 
HETATM 5104 O  O3     . SO4 F 5 .   ? 1.015   11.341 -0.706  1.00 91.15  ?  903  SO4 A O3     1 
HETATM 5105 O  O4     . SO4 F 5 .   ? 3.257   10.602 -1.097  1.00 89.28  ?  903  SO4 A O4     1 
HETATM 5106 S  S      . SO4 G 5 .   ? 17.941  30.570 59.734  1.00 117.99 ?  904  SO4 A S      1 
HETATM 5107 O  O1     . SO4 G 5 .   ? 17.080  30.535 58.555  1.00 119.08 ?  904  SO4 A O1     1 
HETATM 5108 O  O2     . SO4 G 5 .   ? 19.000  29.576 59.586  1.00 120.21 ?  904  SO4 A O2     1 
HETATM 5109 O  O3     . SO4 G 5 .   ? 18.539  31.895 59.869  1.00 120.56 ?  904  SO4 A O3     1 
HETATM 5110 O  O4     . SO4 G 5 .   ? 17.149  30.274 60.924  1.00 116.91 ?  904  SO4 A O4     1 
HETATM 5111 N  N1     . DZ4 H 6 .   ? 10.056  41.642 36.716  0.77 72.93  ?  905  DZ4 A N1     1 
HETATM 5112 C  C2     . DZ4 H 6 .   ? 10.831  41.947 35.678  1.00 76.05  ?  905  DZ4 A C2     1 
HETATM 5113 N  N3     . DZ4 H 6 .   ? 11.397  43.196 35.597  0.58 80.72  ?  905  DZ4 A N3     1 
HETATM 5114 C  C4     . DZ4 H 6 .   ? 11.178  44.121 36.575  0.37 82.80  ?  905  DZ4 A C4     1 
HETATM 5115 C  C5     . DZ4 H 6 .   ? 10.413  43.814 37.602  0.56 81.49  ?  905  DZ4 A C5     1 
HETATM 5116 C  C6     . DZ4 H 6 .   ? 9.839   42.541 37.676  0.38 73.64  ?  905  DZ4 A C6     1 
HETATM 5117 N  N6     . DZ4 H 6 .   ? 9.026   42.188 38.752  1.00 66.84  ?  905  DZ4 A N6     1 
HETATM 5118 N  N7     . DZ4 H 6 .   ? 10.369  44.901 38.423  1.00 82.28  ?  905  DZ4 A N7     1 
HETATM 5119 C  C8     . DZ4 H 6 .   ? 11.097  45.865 37.868  0.97 84.55  ?  905  DZ4 A C8     1 
HETATM 5120 N  N9     . DZ4 H 6 .   ? 11.643  45.402 36.714  0.25 84.58  ?  905  DZ4 A N9     1 
HETATM 5121 P  PA     . DZ4 H 6 .   ? 13.170  48.768 40.390  1.00 132.27 ?  905  DZ4 A PA     1 
HETATM 5122 P  PB     . DZ4 H 6 .   ? 11.112  50.464 41.561  1.00 117.60 ?  905  DZ4 A PB     1 
HETATM 5123 P  PG     . DZ4 H 6 .   ? 12.716  52.591 43.089  1.00 90.48  ?  905  DZ4 A PG     1 
HETATM 5124 C  "C1'"  . DZ4 H 6 .   ? 12.360  46.663 36.348  1.00 90.90  ?  905  DZ4 A "C1'"  1 
HETATM 5125 O  O1A    . DZ4 H 6 .   ? 13.316  47.255 40.122  1.00 136.20 -1 905  DZ4 A O1A    1 
HETATM 5126 O  O1B    . DZ4 H 6 .   ? 11.415  51.246 40.317  1.00 122.23 -1 905  DZ4 A O1B    1 
HETATM 5127 O  O1G    . DZ4 H 6 .   ? 13.553  52.651 41.901  1.00 96.22  -1 905  DZ4 A O1G    1 
HETATM 5128 C  "C2'"  . DZ4 H 6 .   ? 11.265  47.789 35.949  1.00 99.57  ?  905  DZ4 A "C2'"  1 
HETATM 5129 O  O2A    . DZ4 H 6 .   ? 14.425  49.394 40.915  1.00 130.38 ?  905  DZ4 A O2A    1 
HETATM 5130 O  O2B    . DZ4 H 6 .   ? 9.678   50.121 41.517  1.00 106.82 ?  905  DZ4 A O2B    1 
HETATM 5131 O  O2G    . DZ4 H 6 .   ? 13.676  52.373 44.307  1.00 79.23  -1 905  DZ4 A O2G    1 
HETATM 5132 C  "C3'"  . DZ4 H 6 .   ? 11.670  48.972 36.442  1.00 105.98 ?  905  DZ4 A "C3'"  1 
HETATM 5133 O  "O3'"  . DZ4 H 6 .   ? 11.510  49.982 35.386  1.00 101.67 ?  905  DZ4 A "O3'"  1 
HETATM 5134 N  N3A    . DZ4 H 6 .   ? 11.963  48.975 41.590  1.00 124.59 ?  905  DZ4 A N3A    1 
HETATM 5135 O  O3B    . DZ4 H 6 .   ? 11.562  51.388 42.952  1.00 106.60 ?  905  DZ4 A O3B    1 
HETATM 5136 O  O3G    . DZ4 H 6 .   ? 11.975  53.915 43.266  1.00 89.87  ?  905  DZ4 A O3G    1 
HETATM 5137 C  "C4'"  . DZ4 H 6 .   ? 13.143  48.755 36.831  1.00 111.19 ?  905  DZ4 A "C4'"  1 
HETATM 5138 O  "O4'"  . DZ4 H 6 .   ? 13.219  47.230 37.200  1.00 101.46 ?  905  DZ4 A "O4'"  1 
HETATM 5139 C  "C5'"  . DZ4 H 6 .   ? 13.532  49.571 37.890  1.00 122.58 ?  905  DZ4 A "C5'"  1 
HETATM 5140 O  "O5'"  . DZ4 H 6 .   ? 12.665  49.485 38.956  1.00 130.78 ?  905  DZ4 A "O5'"  1 
HETATM 5141 H  H2     . DZ4 H 6 .   ? 10.981  41.320 35.008  1.00 91.34  ?  905  DZ4 A H2     1 
HETATM 5142 H  HN6    . DZ4 H 6 .   ? 8.256   41.832 38.611  1.00 80.28  ?  905  DZ4 A HN6    1 
HETATM 5143 H  HN6A   . DZ4 H 6 .   ? 9.295   42.328 39.557  1.00 80.28  ?  905  DZ4 A HN6A   1 
HETATM 5144 H  H8     . DZ4 H 6 .   ? 11.233  46.712 38.228  1.00 101.54 ?  905  DZ4 A H8     1 
HETATM 5145 H  "H1'"  . DZ4 H 6 .   ? 12.865  46.469 35.543  1.00 109.16 ?  905  DZ4 A "H1'"  1 
HETATM 5146 H  "H2'"  . DZ4 H 6 .   ? 11.218  47.854 34.982  1.00 119.56 ?  905  DZ4 A "H2'"  1 
HETATM 5147 H  "H2'A" . DZ4 H 6 .   ? 10.386  47.574 36.296  1.00 119.56 ?  905  DZ4 A "H2'A" 1 
HETATM 5148 H  "H3'"  . DZ4 H 6 .   ? 11.149  49.205 37.226  1.00 127.25 ?  905  DZ4 A "H3'"  1 
HETATM 5149 H  "HO3'" . DZ4 H 6 .   ? 11.259  49.600 34.669  1.00 122.08 ?  905  DZ4 A "HO3'" 1 
HETATM 5150 H  HN3A   . DZ4 H 6 .   ? 11.619  48.289 41.979  1.00 149.58 ?  905  DZ4 A HN3A   1 
HETATM 5151 H  "H4'"  . DZ4 H 6 .   ? 13.708  48.927 36.062  1.00 133.51 ?  905  DZ4 A "H4'"  1 
HETATM 5152 H  "H5'"  . DZ4 H 6 .   ? 14.417  49.306 38.184  1.00 147.17 ?  905  DZ4 A "H5'"  1 
HETATM 5153 H  "H5'A" . DZ4 H 6 .   ? 13.564  50.491 37.583  1.00 147.17 ?  905  DZ4 A "H5'A" 1 
HETATM 5154 O  O      . HOH I 7 .   ? 30.981  35.753 35.494  1.00 37.22  ?  101  HOH P O      1 
HETATM 5155 O  O      . HOH I 7 .   ? 31.546  39.723 41.624  1.00 50.65  ?  102  HOH P O      1 
HETATM 5156 O  O      . HOH I 7 .   ? 26.796  35.643 41.815  1.00 45.97  ?  103  HOH P O      1 
HETATM 5157 O  O      . HOH I 7 .   ? 37.446  19.458 23.613  1.00 48.94  ?  104  HOH P O      1 
HETATM 5158 O  O      . HOH J 7 .   ? 10.550  34.960 37.625  1.00 58.76  ?  101  HOH T O      1 
HETATM 5159 O  O      . HOH J 7 .   ? 12.695  28.034 28.844  1.00 47.65  ?  102  HOH T O      1 
HETATM 5160 O  O      . HOH J 7 .   ? 36.412  31.502 27.681  1.00 37.57  ?  103  HOH T O      1 
HETATM 5161 O  O      . HOH J 7 .   ? 37.532  10.709 36.659  1.00 52.51  ?  104  HOH T O      1 
HETATM 5162 O  O      . HOH J 7 .   ? 32.366  35.210 33.096  1.00 43.88  ?  105  HOH T O      1 
HETATM 5163 O  O      . HOH J 7 .   ? 25.870  31.357 25.397  1.00 41.25  ?  106  HOH T O      1 
HETATM 5164 O  O      . HOH J 7 .   ? 18.041  29.557 29.765  1.00 56.40  ?  107  HOH T O      1 
HETATM 5165 O  O      . HOH J 7 .   ? 41.188  22.258 29.321  1.00 59.41  ?  108  HOH T O      1 
HETATM 5166 O  O      . HOH J 7 .   ? 19.554  30.274 36.620  1.00 58.92  ?  109  HOH T O      1 
HETATM 5167 O  O      . HOH J 7 .   ? 9.680   36.373 34.420  1.00 59.21  ?  110  HOH T O      1 
HETATM 5168 O  O      . HOH J 7 .   ? 16.753  30.201 37.945  1.00 55.71  ?  111  HOH T O      1 
HETATM 5169 O  O      . HOH J 7 .   ? 27.232  38.403 22.477  1.00 41.56  ?  112  HOH T O      1 
HETATM 5170 O  O      . HOH K 7 .   ? 7.917   49.396 14.592  1.00 52.61  ?  1001 HOH A O      1 
HETATM 5171 O  O      . HOH K 7 .   ? 31.935  55.868 12.985  1.00 49.87  ?  1002 HOH A O      1 
HETATM 5172 O  O      . HOH K 7 .   ? 44.803  44.154 32.045  1.00 30.89  ?  1003 HOH A O      1 
HETATM 5173 O  O      . HOH K 7 .   ? -6.075  45.364 50.192  1.00 31.43  ?  1004 HOH A O      1 
HETATM 5174 O  O      . HOH K 7 .   ? -3.867  38.899 -4.441  1.00 56.64  ?  1005 HOH A O      1 
HETATM 5175 O  O      . HOH K 7 .   ? 16.264  52.754 51.008  1.00 24.26  ?  1006 HOH A O      1 
HETATM 5176 O  O      . HOH K 7 .   ? 16.115  24.912 -8.425  1.00 37.19  ?  1007 HOH A O      1 
HETATM 5177 O  O      . HOH K 7 .   ? -2.736  36.930 56.340  1.00 60.50  ?  1008 HOH A O      1 
HETATM 5178 O  O      . HOH K 7 .   ? 41.304  24.093 50.570  1.00 47.11  ?  1009 HOH A O      1 
HETATM 5179 O  O      . HOH K 7 .   ? 14.663  25.005 14.102  1.00 41.12  ?  1010 HOH A O      1 
HETATM 5180 O  O      . HOH K 7 .   ? 8.160   17.322 20.688  1.00 35.25  ?  1011 HOH A O      1 
HETATM 5181 O  O      . HOH K 7 .   ? -3.324  29.999 8.638   1.00 42.80  ?  1012 HOH A O      1 
HETATM 5182 O  O      . HOH K 7 .   ? 25.102  41.656 27.498  1.00 41.20  ?  1013 HOH A O      1 
HETATM 5183 O  O      . HOH K 7 .   ? 1.362   54.204 57.743  1.00 39.65  ?  1014 HOH A O      1 
HETATM 5184 O  O      . HOH K 7 .   ? 29.265  57.186 22.640  1.00 32.99  ?  1015 HOH A O      1 
HETATM 5185 O  O      . HOH K 7 .   ? -6.639  37.612 52.180  1.00 47.58  ?  1016 HOH A O      1 
HETATM 5186 O  O      . HOH K 7 .   ? 18.347  43.086 55.418  1.00 44.66  ?  1017 HOH A O      1 
HETATM 5187 O  O      . HOH K 7 .   ? 33.782  51.808 33.046  1.00 54.93  ?  1018 HOH A O      1 
HETATM 5188 O  O      . HOH K 7 .   ? 35.314  37.913 25.909  1.00 47.66  ?  1019 HOH A O      1 
HETATM 5189 O  O      . HOH K 7 .   ? 29.769  36.566 31.546  1.00 44.94  ?  1020 HOH A O      1 
HETATM 5190 O  O      . HOH K 7 .   ? 8.386   56.105 37.828  1.00 36.47  ?  1021 HOH A O      1 
HETATM 5191 O  O      . HOH K 7 .   ? 25.699  36.306 11.006  1.00 38.95  ?  1022 HOH A O      1 
HETATM 5192 O  O      . HOH K 7 .   ? 14.904  51.459 48.692  1.00 37.32  ?  1023 HOH A O      1 
HETATM 5193 O  O      . HOH K 7 .   ? -9.085  52.652 44.810  1.00 36.50  ?  1024 HOH A O      1 
HETATM 5194 O  O      . HOH K 7 .   ? 18.159  62.232 29.361  1.00 47.55  ?  1025 HOH A O      1 
HETATM 5195 O  O      . HOH K 7 .   ? 5.038   41.039 -4.337  1.00 36.08  ?  1026 HOH A O      1 
HETATM 5196 O  O      . HOH K 7 .   ? 7.310   69.484 23.847  1.00 28.93  ?  1027 HOH A O      1 
HETATM 5197 O  O      . HOH K 7 .   ? 1.272   29.779 26.111  1.00 24.58  ?  1028 HOH A O      1 
HETATM 5198 O  O      . HOH K 7 .   ? -4.287  38.674 54.774  1.00 33.52  ?  1029 HOH A O      1 
HETATM 5199 O  O      . HOH K 7 .   ? 23.426  41.480 2.441   1.00 25.90  ?  1030 HOH A O      1 
HETATM 5200 O  O      . HOH K 7 .   ? 24.384  53.777 10.691  1.00 40.66  ?  1031 HOH A O      1 
HETATM 5201 O  O      . HOH K 7 .   ? 24.956  17.140 7.975   1.00 42.82  ?  1032 HOH A O      1 
HETATM 5202 O  O      . HOH K 7 .   ? 15.865  31.005 15.022  1.00 42.76  ?  1033 HOH A O      1 
HETATM 5203 O  O      . HOH K 7 .   ? 8.107   35.674 23.663  1.00 28.53  ?  1034 HOH A O      1 
HETATM 5204 O  O      . HOH K 7 .   ? 6.100   22.287 -11.619 1.00 48.49  ?  1035 HOH A O      1 
HETATM 5205 O  O      . HOH K 7 .   ? -3.902  27.499 47.378  1.00 32.21  ?  1036 HOH A O      1 
HETATM 5206 O  O      . HOH K 7 .   ? 3.949   62.076 27.504  1.00 43.21  ?  1037 HOH A O      1 
HETATM 5207 O  O      . HOH K 7 .   ? 13.563  26.587 7.872   1.00 29.19  ?  1038 HOH A O      1 
HETATM 5208 O  O      . HOH K 7 .   ? 10.426  27.156 25.474  1.00 45.24  ?  1039 HOH A O      1 
HETATM 5209 O  O      . HOH K 7 .   ? 11.980  67.535 18.543  1.00 25.19  ?  1040 HOH A O      1 
HETATM 5210 O  O      . HOH K 7 .   ? -2.090  23.661 25.289  1.00 20.36  ?  1041 HOH A O      1 
HETATM 5211 O  O      . HOH K 7 .   ? -3.158  31.188 11.217  1.00 40.39  ?  1042 HOH A O      1 
HETATM 5212 O  O      . HOH K 7 .   ? 22.812  37.667 2.748   1.00 23.32  ?  1043 HOH A O      1 
HETATM 5213 O  O      . HOH K 7 .   ? 2.583   54.579 41.941  1.00 30.85  ?  1044 HOH A O      1 
HETATM 5214 O  O      . HOH K 7 .   ? 7.008   15.107 6.508   1.00 20.36  ?  1045 HOH A O      1 
HETATM 5215 O  O      . HOH K 7 .   ? 2.836   63.300 19.392  1.00 25.46  ?  1046 HOH A O      1 
HETATM 5216 O  O      . HOH K 7 .   ? -7.580  46.373 27.843  1.00 40.26  ?  1047 HOH A O      1 
HETATM 5217 O  O      . HOH K 7 .   ? 5.669   67.423 22.903  1.00 27.30  ?  1048 HOH A O      1 
HETATM 5218 O  O      . HOH K 7 .   ? -4.568  29.667 27.381  1.00 37.58  ?  1049 HOH A O      1 
HETATM 5219 O  O      . HOH K 7 .   ? 1.603   22.580 48.994  1.00 52.50  ?  1050 HOH A O      1 
HETATM 5220 O  O      . HOH K 7 .   ? -3.099  40.098 12.888  1.00 39.28  ?  1051 HOH A O      1 
HETATM 5221 O  O      . HOH K 7 .   ? -2.506  42.878 15.836  1.00 25.64  ?  1052 HOH A O      1 
HETATM 5222 O  O      . HOH K 7 .   ? 5.172   53.062 39.583  1.00 27.01  ?  1053 HOH A O      1 
HETATM 5223 O  O      . HOH K 7 .   ? -8.573  19.939 35.165  1.00 27.03  ?  1054 HOH A O      1 
HETATM 5224 O  O      . HOH K 7 .   ? 10.351  13.192 14.025  1.00 26.17  ?  1055 HOH A O      1 
HETATM 5225 O  O      . HOH K 7 .   ? 1.252   61.557 39.571  1.00 41.70  ?  1056 HOH A O      1 
HETATM 5226 O  O      . HOH K 7 .   ? -1.808  51.423 22.665  1.00 22.09  ?  1057 HOH A O      1 
HETATM 5227 O  O      . HOH K 7 .   ? 25.806  34.143 10.349  1.00 53.63  ?  1058 HOH A O      1 
HETATM 5228 O  O      . HOH K 7 .   ? 5.447   23.149 32.011  1.00 55.88  ?  1059 HOH A O      1 
HETATM 5229 O  O      . HOH K 7 .   ? 26.910  41.332 7.374   1.00 21.22  ?  1060 HOH A O      1 
HETATM 5230 O  O      . HOH K 7 .   ? 15.869  45.872 48.383  1.00 36.17  ?  1061 HOH A O      1 
HETATM 5231 O  O      . HOH K 7 .   ? -6.181  56.740 49.946  1.00 49.00  ?  1062 HOH A O      1 
HETATM 5232 O  O      . HOH K 7 .   ? 7.512   6.962  14.495  1.00 37.28  ?  1063 HOH A O      1 
HETATM 5233 O  O      . HOH K 7 .   ? 10.740  42.384 4.941   1.00 47.18  ?  1064 HOH A O      1 
HETATM 5234 O  O      . HOH K 7 .   ? -5.666  19.715 17.705  1.00 36.62  ?  1065 HOH A O      1 
HETATM 5235 O  O      . HOH K 7 .   ? 13.020  22.769 12.311  1.00 37.12  ?  1066 HOH A O      1 
HETATM 5236 O  O      . HOH K 7 .   ? -8.332  23.800 25.963  1.00 38.33  ?  1067 HOH A O      1 
HETATM 5237 O  O      . HOH K 7 .   ? -0.792  17.657 -7.753  1.00 48.03  ?  1068 HOH A O      1 
HETATM 5238 O  O      . HOH K 7 .   ? 1.662   47.039 14.233  1.00 19.11  ?  1069 HOH A O      1 
HETATM 5239 O  O      . HOH K 7 .   ? -0.361  20.279 34.253  1.00 22.37  ?  1070 HOH A O      1 
HETATM 5240 O  O      . HOH K 7 .   ? 25.233  41.489 16.370  1.00 27.74  ?  1071 HOH A O      1 
HETATM 5241 O  O      . HOH K 7 .   ? 9.406   39.857 -2.069  1.00 33.68  ?  1072 HOH A O      1 
HETATM 5242 O  O      . HOH K 7 .   ? 22.810  29.087 6.212   1.00 26.28  ?  1073 HOH A O      1 
HETATM 5243 O  O      . HOH K 7 .   ? -2.468  42.631 19.272  1.00 46.61  ?  1074 HOH A O      1 
HETATM 5244 O  O      . HOH K 7 .   ? 10.749  40.006 61.061  1.00 62.31  ?  1075 HOH A O      1 
HETATM 5245 O  O      . HOH K 7 .   ? 4.484   35.889 -8.859  1.00 36.39  ?  1076 HOH A O      1 
HETATM 5246 O  O      . HOH K 7 .   ? 27.860  23.262 5.458   1.00 46.26  ?  1077 HOH A O      1 
HETATM 5247 O  O      . HOH K 7 .   ? -8.570  41.542 33.463  1.00 42.18  ?  1078 HOH A O      1 
HETATM 5248 O  O      . HOH K 7 .   ? -0.209  55.633 38.921  1.00 22.73  ?  1079 HOH A O      1 
HETATM 5249 O  O      . HOH K 7 .   ? 17.949  37.792 26.786  1.00 35.84  ?  1080 HOH A O      1 
HETATM 5250 O  O      . HOH K 7 .   ? 5.655   18.078 -6.992  1.00 43.02  ?  1081 HOH A O      1 
HETATM 5251 O  O      . HOH K 7 .   ? 13.697  17.747 17.299  1.00 34.44  ?  1082 HOH A O      1 
HETATM 5252 O  O      . HOH K 7 .   ? -0.054  24.498 6.558   1.00 44.38  ?  1083 HOH A O      1 
HETATM 5253 O  O      . HOH K 7 .   ? 12.930  27.794 10.411  1.00 38.12  ?  1084 HOH A O      1 
HETATM 5254 O  O      . HOH K 7 .   ? 26.848  15.911 14.863  1.00 43.89  ?  1085 HOH A O      1 
HETATM 5255 O  O      . HOH K 7 .   ? -8.802  29.141 42.894  1.00 41.24  ?  1086 HOH A O      1 
HETATM 5256 O  O      . HOH K 7 .   ? 1.443   17.245 4.276   1.00 23.08  ?  1087 HOH A O      1 
HETATM 5257 O  O      . HOH K 7 .   ? 18.219  25.174 -10.460 1.00 46.46  ?  1088 HOH A O      1 
HETATM 5258 O  O      . HOH K 7 .   ? 17.982  46.118 16.977  1.00 21.99  ?  1089 HOH A O      1 
HETATM 5259 O  O      . HOH K 7 .   ? 11.398  70.166 18.166  1.00 28.98  ?  1090 HOH A O      1 
HETATM 5260 O  O      . HOH K 7 .   ? -3.200  21.380 7.973   1.00 26.36  ?  1091 HOH A O      1 
HETATM 5261 O  O      . HOH K 7 .   ? 8.254   14.349 14.696  1.00 25.90  ?  1092 HOH A O      1 
HETATM 5262 O  O      . HOH K 7 .   ? 2.229   59.037 37.074  1.00 57.51  ?  1093 HOH A O      1 
HETATM 5263 O  O      . HOH K 7 .   ? 20.458  44.620 17.476  1.00 23.79  ?  1094 HOH A O      1 
HETATM 5264 O  O      . HOH K 7 .   ? 13.280  15.180 7.525   1.00 22.26  ?  1095 HOH A O      1 
HETATM 5265 O  O      . HOH K 7 .   ? 16.106  44.719 2.944   1.00 27.16  ?  1096 HOH A O      1 
HETATM 5266 O  O      . HOH K 7 .   ? 2.498   14.497 5.189   1.00 43.63  ?  1097 HOH A O      1 
HETATM 5267 O  O      . HOH K 7 .   ? 3.255   45.605 47.165  1.00 40.93  ?  1098 HOH A O      1 
HETATM 5268 O  O      . HOH K 7 .   ? 7.442   36.559 10.817  1.00 32.16  ?  1099 HOH A O      1 
HETATM 5269 O  O      . HOH K 7 .   ? -6.370  34.547 22.078  1.00 22.64  ?  1100 HOH A O      1 
HETATM 5270 O  O      . HOH K 7 .   ? 9.299   57.676 48.805  1.00 57.30  ?  1101 HOH A O      1 
HETATM 5271 O  O      . HOH K 7 .   ? 1.094   31.290 -0.936  1.00 42.81  ?  1102 HOH A O      1 
HETATM 5272 O  O      . HOH K 7 .   ? -0.852  36.797 11.696  1.00 31.01  ?  1103 HOH A O      1 
HETATM 5273 O  O      . HOH K 7 .   ? 3.604   50.897 34.442  1.00 18.84  ?  1104 HOH A O      1 
HETATM 5274 O  O      . HOH K 7 .   ? 9.262   27.308 7.448   1.00 18.70  ?  1105 HOH A O      1 
HETATM 5275 O  O      . HOH K 7 .   ? 22.683  24.378 -0.466  1.00 41.08  ?  1106 HOH A O      1 
HETATM 5276 O  O      . HOH K 7 .   ? 8.843   22.744 39.861  1.00 32.81  ?  1107 HOH A O      1 
HETATM 5277 O  O      . HOH K 7 .   ? -8.402  38.504 42.274  1.00 42.28  ?  1108 HOH A O      1 
HETATM 5278 O  O      . HOH K 7 .   ? 9.160   33.597 13.630  1.00 24.49  ?  1109 HOH A O      1 
HETATM 5279 O  O      . HOH K 7 .   ? 22.149  32.406 -0.015  1.00 27.61  ?  1110 HOH A O      1 
HETATM 5280 O  O      . HOH K 7 .   ? 40.737  43.006 26.185  1.00 58.87  ?  1111 HOH A O      1 
HETATM 5281 O  O      . HOH K 7 .   ? 20.115  45.728 29.339  1.00 40.80  ?  1112 HOH A O      1 
HETATM 5282 O  O      . HOH K 7 .   ? 11.982  39.527 4.291   1.00 23.96  ?  1113 HOH A O      1 
HETATM 5283 O  O      . HOH K 7 .   ? 2.287   17.171 1.480   1.00 35.33  ?  1114 HOH A O      1 
HETATM 5284 O  O      . HOH K 7 .   ? -1.748  52.004 17.352  1.00 34.25  ?  1115 HOH A O      1 
HETATM 5285 O  O      . HOH K 7 .   ? 14.172  33.824 14.967  1.00 30.06  ?  1116 HOH A O      1 
HETATM 5286 O  O      . HOH K 7 .   ? -1.596  40.234 -5.844  1.00 48.96  ?  1117 HOH A O      1 
HETATM 5287 O  O      . HOH K 7 .   ? 19.449  51.346 13.216  1.00 28.18  ?  1118 HOH A O      1 
HETATM 5288 O  O      . HOH K 7 .   ? 21.420  52.678 16.498  1.00 21.25  ?  1119 HOH A O      1 
HETATM 5289 O  O      . HOH K 7 .   ? 25.339  34.594 3.527   1.00 37.88  ?  1120 HOH A O      1 
HETATM 5290 O  O      . HOH K 7 .   ? -9.705  55.625 44.633  1.00 37.37  ?  1121 HOH A O      1 
HETATM 5291 O  O      . HOH K 7 .   ? 9.647   52.853 38.708  1.00 52.00  ?  1122 HOH A O      1 
HETATM 5292 O  O      . HOH K 7 .   ? 10.905  12.813 -5.283  1.00 49.48  ?  1123 HOH A O      1 
HETATM 5293 O  O      . HOH K 7 .   ? 4.282   11.170 18.179  1.00 34.01  ?  1124 HOH A O      1 
HETATM 5294 O  O      . HOH K 7 .   ? -0.893  29.756 4.734   1.00 46.09  ?  1125 HOH A O      1 
HETATM 5295 O  O      . HOH K 7 .   ? -7.366  22.912 43.471  1.00 43.55  ?  1126 HOH A O      1 
HETATM 5296 O  O      . HOH K 7 .   ? 6.630   50.124 63.917  1.00 52.18  ?  1127 HOH A O      1 
HETATM 5297 O  O      . HOH K 7 .   ? 6.547   17.238 50.682  1.00 55.68  ?  1128 HOH A O      1 
HETATM 5298 O  O      . HOH K 7 .   ? -4.049  20.932 31.993  1.00 25.48  ?  1129 HOH A O      1 
HETATM 5299 O  O      . HOH K 7 .   ? 19.672  63.586 27.362  1.00 51.99  ?  1130 HOH A O      1 
HETATM 5300 O  O      . HOH K 7 .   ? 23.735  21.058 -0.234  1.00 38.46  ?  1131 HOH A O      1 
HETATM 5301 O  O      . HOH K 7 .   ? 34.180  45.483 16.859  1.00 35.41  ?  1132 HOH A O      1 
HETATM 5302 O  O      . HOH K 7 .   ? -5.716  28.348 34.957  1.00 43.80  ?  1133 HOH A O      1 
HETATM 5303 O  O      . HOH K 7 .   ? 14.354  47.380 9.593   1.00 26.01  ?  1134 HOH A O      1 
HETATM 5304 O  O      . HOH K 7 .   ? 12.179  48.915 13.714  1.00 24.60  ?  1135 HOH A O      1 
HETATM 5305 O  O      . HOH K 7 .   ? -7.519  38.324 45.156  1.00 33.86  ?  1136 HOH A O      1 
HETATM 5306 O  O      . HOH K 7 .   ? -4.749  31.560 35.320  1.00 30.06  ?  1137 HOH A O      1 
HETATM 5307 O  O      . HOH K 7 .   ? 11.139  33.749 24.506  1.00 32.75  ?  1138 HOH A O      1 
HETATM 5308 O  O      . HOH K 7 .   ? 3.481   43.423 12.335  1.00 20.61  ?  1139 HOH A O      1 
HETATM 5309 O  O      . HOH K 7 .   ? 13.107  19.273 12.114  1.00 22.51  ?  1140 HOH A O      1 
HETATM 5310 O  O      . HOH K 7 .   ? 2.473   28.209 -3.433  1.00 37.14  ?  1141 HOH A O      1 
HETATM 5311 O  O      . HOH K 7 .   ? 20.337  48.594 8.831   1.00 52.44  ?  1142 HOH A O      1 
HETATM 5312 O  O      . HOH K 7 .   ? 21.028  36.626 4.312   1.00 21.26  ?  1143 HOH A O      1 
HETATM 5313 O  O      . HOH K 7 .   ? -4.237  31.595 6.137   1.00 39.29  ?  1144 HOH A O      1 
HETATM 5314 O  O      . HOH K 7 .   ? 9.775   50.887 14.236  1.00 30.29  ?  1145 HOH A O      1 
HETATM 5315 O  O      . HOH K 7 .   ? 17.245  62.347 9.264   1.00 47.06  ?  1146 HOH A O      1 
HETATM 5316 O  O      . HOH K 7 .   ? -5.269  36.856 23.260  1.00 37.18  ?  1147 HOH A O      1 
HETATM 5317 O  O      . HOH K 7 .   ? -4.809  51.012 32.808  1.00 22.46  ?  1148 HOH A O      1 
HETATM 5318 O  O      . HOH K 7 .   ? 9.564   40.560 -8.293  1.00 38.90  ?  1149 HOH A O      1 
HETATM 5319 O  O      . HOH K 7 .   ? -5.266  22.058 24.988  1.00 28.63  ?  1150 HOH A O      1 
HETATM 5320 O  O      . HOH K 7 .   ? 19.958  53.855 29.812  1.00 40.66  ?  1151 HOH A O      1 
HETATM 5321 O  O      . HOH K 7 .   ? 36.044  48.002 43.837  1.00 53.62  ?  1152 HOH A O      1 
HETATM 5322 O  O      . HOH K 7 .   ? 12.465  27.813 20.684  1.00 42.88  ?  1153 HOH A O      1 
HETATM 5323 O  O      . HOH K 7 .   ? 10.010  7.332  3.421   1.00 48.59  ?  1154 HOH A O      1 
HETATM 5324 O  O      . HOH K 7 .   ? 15.564  28.660 8.361   1.00 39.16  ?  1155 HOH A O      1 
HETATM 5325 O  O      . HOH K 7 .   ? 44.008  47.355 48.660  1.00 49.15  ?  1156 HOH A O      1 
HETATM 5326 O  O      . HOH K 7 .   ? 20.996  53.265 10.072  1.00 45.93  ?  1157 HOH A O      1 
HETATM 5327 O  O      . HOH K 7 .   ? 25.873  31.415 13.105  1.00 31.33  ?  1158 HOH A O      1 
HETATM 5328 O  O      . HOH K 7 .   ? 5.715   22.074 36.815  1.00 32.25  ?  1159 HOH A O      1 
HETATM 5329 O  O      . HOH K 7 .   ? 12.345  47.753 32.253  1.00 28.67  ?  1160 HOH A O      1 
HETATM 5330 O  O      . HOH K 7 .   ? 2.088   38.200 -6.402  1.00 52.21  ?  1161 HOH A O      1 
HETATM 5331 O  O      . HOH K 7 .   ? 6.780   38.019 7.225   1.00 57.98  ?  1162 HOH A O      1 
HETATM 5332 O  O      . HOH K 7 .   ? 25.730  58.461 15.835  1.00 44.07  ?  1163 HOH A O      1 
HETATM 5333 O  O      . HOH K 7 .   ? 30.372  37.870 21.811  1.00 52.74  ?  1164 HOH A O      1 
HETATM 5334 O  O      . HOH K 7 .   ? 23.205  28.721 -0.624  1.00 34.99  ?  1165 HOH A O      1 
HETATM 5335 O  O      . HOH K 7 .   ? 22.713  11.737 11.734  1.00 49.19  ?  1166 HOH A O      1 
HETATM 5336 O  O      . HOH K 7 .   ? 8.173   48.051 35.368  1.00 30.42  ?  1167 HOH A O      1 
HETATM 5337 O  O      . HOH K 7 .   ? -10.512 27.363 26.886  1.00 40.68  ?  1168 HOH A O      1 
HETATM 5338 O  O      . HOH K 7 .   ? 11.912  33.630 17.764  1.00 32.03  ?  1169 HOH A O      1 
HETATM 5339 O  O      . HOH K 7 .   ? 9.188   42.688 8.943   1.00 36.67  ?  1170 HOH A O      1 
HETATM 5340 O  O      . HOH K 7 .   ? 39.854  45.284 26.015  1.00 46.91  ?  1171 HOH A O      1 
HETATM 5341 O  O      . HOH K 7 .   ? 6.613   46.024 39.305  1.00 22.43  ?  1172 HOH A O      1 
HETATM 5342 O  O      . HOH K 7 .   ? -11.197 24.232 18.103  1.00 34.95  ?  1173 HOH A O      1 
HETATM 5343 O  O      . HOH K 7 .   ? 13.166  30.142 -12.097 1.00 54.07  ?  1174 HOH A O      1 
HETATM 5344 O  O      . HOH K 7 .   ? 33.609  45.113 14.248  1.00 61.74  ?  1175 HOH A O      1 
HETATM 5345 O  O      . HOH K 7 .   ? -0.613  60.852 8.636   1.00 51.43  ?  1176 HOH A O      1 
HETATM 5346 O  O      . HOH K 7 .   ? 27.587  35.666 6.618   1.00 42.18  ?  1177 HOH A O      1 
HETATM 5347 O  O      . HOH K 7 .   ? 4.134   25.142 30.074  1.00 24.74  ?  1178 HOH A O      1 
HETATM 5348 O  O      . HOH K 7 .   ? 13.857  39.742 47.294  1.00 52.03  ?  1179 HOH A O      1 
HETATM 5349 O  O      . HOH K 7 .   ? -11.019 34.897 17.259  1.00 62.89  ?  1180 HOH A O      1 
HETATM 5350 O  O      . HOH K 7 .   ? -3.331  45.555 19.091  1.00 57.63  ?  1181 HOH A O      1 
HETATM 5351 O  O      . HOH K 7 .   ? 25.821  59.889 19.697  1.00 34.50  ?  1182 HOH A O      1 
HETATM 5352 O  O      . HOH K 7 .   ? 11.641  28.258 6.822   1.00 21.11  ?  1183 HOH A O      1 
HETATM 5353 O  O      . HOH K 7 .   ? -3.768  20.556 4.016   1.00 54.35  ?  1184 HOH A O      1 
HETATM 5354 O  O      . HOH K 7 .   ? -8.493  18.783 38.971  1.00 28.48  ?  1185 HOH A O      1 
HETATM 5355 O  O      . HOH K 7 .   ? 0.658   60.417 49.749  1.00 41.76  ?  1186 HOH A O      1 
HETATM 5356 O  O      . HOH K 7 .   ? 27.217  61.260 23.204  1.00 41.37  ?  1187 HOH A O      1 
HETATM 5357 O  O      . HOH K 7 .   ? 9.720   60.154 32.442  1.00 26.33  ?  1188 HOH A O      1 
HETATM 5358 O  O      . HOH K 7 .   ? 2.992   37.628 9.820   1.00 37.47  ?  1189 HOH A O      1 
HETATM 5359 O  O      . HOH K 7 .   ? -3.178  53.919 32.012  1.00 43.10  ?  1190 HOH A O      1 
HETATM 5360 O  O      . HOH K 7 .   ? -2.672  48.979 16.883  1.00 43.09  ?  1191 HOH A O      1 
HETATM 5361 O  O      . HOH K 7 .   ? 14.140  57.737 54.494  1.00 47.09  ?  1192 HOH A O      1 
HETATM 5362 O  O      . HOH K 7 .   ? 1.474   44.623 59.375  1.00 57.29  ?  1193 HOH A O      1 
HETATM 5363 O  O      . HOH K 7 .   ? -0.681  21.368 24.662  1.00 53.76  ?  1194 HOH A O      1 
HETATM 5364 O  O      . HOH K 7 .   ? 19.088  36.859 29.495  1.00 61.49  ?  1195 HOH A O      1 
HETATM 5365 O  O      . HOH K 7 .   ? 10.684  62.709 31.305  1.00 43.38  ?  1196 HOH A O      1 
HETATM 5366 O  O      . HOH K 7 .   ? 16.762  13.794 4.543   1.00 25.49  ?  1197 HOH A O      1 
HETATM 5367 O  O      . HOH K 7 .   ? 2.938   34.054 -10.651 1.00 46.95  ?  1198 HOH A O      1 
HETATM 5368 O  O      . HOH K 7 .   ? 34.529  38.598 16.039  1.00 43.14  ?  1199 HOH A O      1 
HETATM 5369 O  O      . HOH K 7 .   ? 24.643  39.413 14.337  1.00 44.36  ?  1200 HOH A O      1 
HETATM 5370 O  O      . HOH K 7 .   ? 33.485  54.196 16.651  1.00 32.63  ?  1201 HOH A O      1 
HETATM 5371 O  O      . HOH K 7 .   ? 4.327   20.930 29.954  1.00 47.59  ?  1202 HOH A O      1 
HETATM 5372 O  O      . HOH K 7 .   ? 11.618  10.713 10.714  1.00 34.96  ?  1203 HOH A O      1 
HETATM 5373 O  O      . HOH K 7 .   ? -9.084  50.725 46.488  1.00 48.03  ?  1204 HOH A O      1 
HETATM 5374 O  O      . HOH K 7 .   ? 20.611  61.922 9.129   1.00 40.55  ?  1205 HOH A O      1 
HETATM 5375 O  O      . HOH K 7 .   ? -6.825  52.554 35.375  1.00 46.08  ?  1206 HOH A O      1 
HETATM 5376 O  O      . HOH K 7 .   ? 12.942  46.053 7.889   1.00 36.45  ?  1207 HOH A O      1 
HETATM 5377 O  O      . HOH K 7 .   ? 27.374  36.826 8.931   1.00 31.77  ?  1208 HOH A O      1 
HETATM 5378 O  O      . HOH K 7 .   ? -8.423  28.836 30.985  1.00 44.05  ?  1209 HOH A O      1 
HETATM 5379 O  O      . HOH K 7 .   ? 16.980  23.833 14.547  1.00 40.43  ?  1210 HOH A O      1 
HETATM 5380 O  O      . HOH K 7 .   ? 10.061  47.325 14.008  1.00 49.16  ?  1211 HOH A O      1 
HETATM 5381 O  O      . HOH K 7 .   ? 10.010  34.343 16.098  1.00 23.62  ?  1212 HOH A O      1 
HETATM 5382 O  O      . HOH K 7 .   ? 26.079  39.156 24.843  1.00 33.03  ?  1213 HOH A O      1 
HETATM 5383 O  O      . HOH K 7 .   ? 11.074  11.256 8.268   1.00 42.29  ?  1214 HOH A O      1 
HETATM 5384 O  O      . HOH K 7 .   ? 25.087  22.213 17.541  1.00 48.69  ?  1215 HOH A O      1 
HETATM 5385 O  O      . HOH K 7 .   ? 9.712   45.032 43.135  1.00 42.76  ?  1216 HOH A O      1 
HETATM 5386 O  O      . HOH K 7 .   ? 21.567  13.179 6.677   1.00 64.33  ?  1217 HOH A O      1 
HETATM 5387 O  O      . HOH K 7 .   ? -2.911  52.513 49.588  1.00 35.05  ?  1218 HOH A O      1 
HETATM 5388 O  O      . HOH K 7 .   ? 13.177  42.028 -4.074  1.00 38.60  ?  1219 HOH A O      1 
HETATM 5389 O  O      . HOH K 7 .   ? -2.991  28.229 -7.492  1.00 39.99  ?  1220 HOH A O      1 
HETATM 5390 O  O      . HOH K 7 .   ? -7.143  18.608 13.031  1.00 46.17  ?  1221 HOH A O      1 
HETATM 5391 O  O      . HOH K 7 .   ? -7.736  29.485 28.343  1.00 49.10  ?  1222 HOH A O      1 
HETATM 5392 O  O      . HOH K 7 .   ? -12.016 48.621 40.852  1.00 51.81  ?  1223 HOH A O      1 
HETATM 5393 O  O      . HOH K 7 .   ? 11.183  41.745 -2.509  1.00 41.16  ?  1224 HOH A O      1 
HETATM 5394 O  O      . HOH K 7 .   ? 10.938  67.226 24.476  1.00 52.39  ?  1225 HOH A O      1 
HETATM 5395 O  O      . HOH K 7 .   ? -1.178  65.889 20.101  1.00 35.43  ?  1226 HOH A O      1 
HETATM 5396 O  O      . HOH K 7 .   ? 24.144  60.727 16.145  1.00 48.17  ?  1227 HOH A O      1 
HETATM 5397 O  O      . HOH K 7 .   ? 18.125  44.468 49.308  1.00 45.16  ?  1228 HOH A O      1 
HETATM 5398 O  O      . HOH K 7 .   ? -8.279  32.745 49.209  1.00 50.41  ?  1229 HOH A O      1 
HETATM 5399 O  O      . HOH K 7 .   ? 15.198  63.290 28.383  1.00 34.95  ?  1230 HOH A O      1 
HETATM 5400 O  O      . HOH K 7 .   ? 18.250  51.278 10.587  1.00 31.57  ?  1231 HOH A O      1 
HETATM 5401 O  O      . HOH K 7 .   ? -7.022  20.974 23.781  1.00 38.04  ?  1232 HOH A O      1 
HETATM 5402 O  O      . HOH K 7 .   ? 8.347   32.075 -13.082 1.00 53.73  ?  1233 HOH A O      1 
HETATM 5403 O  O      . HOH K 7 .   ? -7.579  29.407 33.224  1.00 50.23  ?  1234 HOH A O      1 
HETATM 5404 O  O      . HOH K 7 .   ? 21.079  45.588 7.782   1.00 37.48  ?  1235 HOH A O      1 
HETATM 5405 O  O      . HOH K 7 .   ? 4.254   38.141 7.043   1.00 24.89  ?  1236 HOH A O      1 
HETATM 5406 O  O      . HOH K 7 .   ? -1.571  11.545 1.109   1.00 51.42  ?  1237 HOH A O      1 
HETATM 5407 O  O      . HOH K 7 .   ? 14.117  51.352 32.554  1.00 51.60  ?  1238 HOH A O      1 
HETATM 5408 O  O      . HOH K 7 .   ? 21.981  31.234 -2.477  1.00 34.41  ?  1239 HOH A O      1 
HETATM 5409 O  O      . HOH K 7 .   ? 2.590   62.911 16.729  1.00 50.41  ?  1240 HOH A O      1 
HETATM 5410 O  O      . HOH K 7 .   ? 19.510  50.254 53.059  1.00 36.17  ?  1241 HOH A O      1 
HETATM 5411 O  O      . HOH K 7 .   ? 11.339  56.677 51.661  1.00 56.98  ?  1242 HOH A O      1 
HETATM 5412 O  O      . HOH K 7 .   ? -7.228  43.952 30.362  1.00 41.17  ?  1243 HOH A O      1 
HETATM 5413 O  O      . HOH K 7 .   ? 28.137  59.842 36.058  1.00 49.50  ?  1244 HOH A O      1 
HETATM 5414 O  O      . HOH K 7 .   ? 1.028   38.694 11.338  1.00 25.17  ?  1245 HOH A O      1 
HETATM 5415 O  O      . HOH K 7 .   ? 17.540  11.671 3.113   1.00 41.48  ?  1246 HOH A O      1 
HETATM 5416 O  O      . HOH K 7 .   ? 4.890   45.063 10.728  1.00 48.02  ?  1247 HOH A O      1 
HETATM 5417 O  O      . HOH K 7 .   ? 29.588  56.923 17.432  1.00 44.26  ?  1248 HOH A O      1 
HETATM 5418 O  O      . HOH K 7 .   ? 18.467  65.393 25.943  1.00 47.16  ?  1249 HOH A O      1 
HETATM 5419 O  O      . HOH K 7 .   ? -4.498  20.514 27.062  1.00 39.13  ?  1250 HOH A O      1 
HETATM 5420 O  O      . HOH K 7 .   ? 15.991  41.369 46.881  1.00 49.86  ?  1251 HOH A O      1 
HETATM 5421 O  O      . HOH K 7 .   ? 3.617   30.917 25.497  1.00 40.02  ?  1252 HOH A O      1 
HETATM 5422 O  O      . HOH K 7 .   ? -8.180  18.801 16.493  1.00 51.60  ?  1253 HOH A O      1 
HETATM 5423 O  O      . HOH K 7 .   ? 2.690   41.640 9.768   1.00 49.91  ?  1254 HOH A O      1 
HETATM 5424 O  O      . HOH K 7 .   ? 2.482   65.861 19.687  1.00 28.63  ?  1255 HOH A O      1 
HETATM 5425 O  O      . HOH K 7 .   ? 14.021  10.935 6.091   1.00 43.97  ?  1256 HOH A O      1 
HETATM 5426 O  O      . HOH K 7 .   ? 26.886  28.636 12.902  1.00 41.05  ?  1257 HOH A O      1 
HETATM 5427 O  O      . HOH K 7 .   ? -10.364 33.623 49.893  1.00 45.92  ?  1258 HOH A O      1 
HETATM 5428 O  O      . HOH K 7 .   ? 25.138  27.853 5.277   1.00 30.06  ?  1259 HOH A O      1 
HETATM 5429 O  O      . HOH K 7 .   ? 12.851  63.597 29.822  1.00 39.59  ?  1260 HOH A O      1 
HETATM 5430 O  O      . HOH K 7 .   ? 11.684  25.232 8.958   1.00 49.29  ?  1261 HOH A O      1 
HETATM 5431 O  O      . HOH K 7 .   ? 14.261  27.888 46.792  1.00 46.12  ?  1262 HOH A O      1 
HETATM 5432 O  O      . HOH K 7 .   ? 19.812  44.862 1.813   1.00 46.23  ?  1263 HOH A O      1 
HETATM 5433 O  O      . HOH K 7 .   ? 13.625  25.593 10.938  1.00 78.60  ?  1264 HOH A O      1 
HETATM 5434 O  O      . HOH K 7 .   ? 9.524   22.447 -12.011 1.00 42.83  ?  1265 HOH A O      1 
HETATM 5435 O  O      . HOH K 7 .   ? 8.648   13.215 0.618   1.00 47.00  ?  1266 HOH A O      1 
HETATM 5436 O  O      . HOH K 7 .   ? 16.435  25.924 10.867  1.00 47.15  ?  1267 HOH A O      1 
HETATM 5437 O  O      . HOH K 7 .   ? 12.322  45.590 43.307  1.00 34.47  ?  1268 HOH A O      1 
HETATM 5438 O  O      . HOH K 7 .   ? 15.914  68.553 21.801  1.00 41.95  ?  1269 HOH A O      1 
HETATM 5439 O  O      . HOH K 7 .   ? 16.907  64.167 10.719  1.00 54.67  ?  1270 HOH A O      1 
HETATM 5440 O  O      . HOH K 7 .   ? 13.064  49.395 11.267  1.00 33.22  ?  1271 HOH A O      1 
HETATM 5441 O  O      . HOH K 7 .   ? 13.371  68.476 21.124  1.00 48.01  ?  1272 HOH A O      1 
HETATM 5442 O  O      . HOH K 7 .   ? 18.732  14.126 16.660  1.00 49.86  ?  1273 HOH A O      1 
HETATM 5443 O  O      . HOH K 7 .   ? 14.811  26.944 12.809  1.00 43.96  ?  1274 HOH A O      1 
HETATM 5444 O  O      . HOH K 7 .   ? 14.028  45.341 4.909   1.00 47.07  ?  1275 HOH A O      1 
HETATM 5445 O  O      . HOH K 7 .   ? 7.333   24.056 37.984  1.00 38.06  ?  1276 HOH A O      1 
HETATM 5446 O  O      . HOH K 7 .   ? 8.845   40.434 8.433   1.00 42.37  ?  1277 HOH A O      1 
HETATM 5447 O  O      . HOH K 7 .   ? 38.290  51.389 43.639  1.00 55.69  ?  1278 HOH A O      1 
HETATM 5448 O  O      . HOH K 7 .   ? 21.495  65.169 17.317  1.00 41.50  ?  1279 HOH A O      1 
HETATM 5449 O  O      . HOH K 7 .   ? 14.638  13.667 5.974   1.00 26.06  ?  1280 HOH A O      1 
HETATM 5450 O  O      . HOH K 7 .   ? 8.936   41.879 -6.342  1.00 46.04  ?  1281 HOH A O      1 
HETATM 5451 O  O      . HOH K 7 .   ? -12.920 25.387 19.615  1.00 39.45  ?  1282 HOH A O      1 
HETATM 5452 O  O      . HOH K 7 .   ? 16.839  50.138 47.566  1.00 46.08  ?  1283 HOH A O      1 
HETATM 5453 O  O      . HOH K 7 .   ? -9.785  23.503 42.941  1.00 48.21  ?  1284 HOH A O      1 
HETATM 5454 O  O      . HOH K 7 .   ? -0.862  19.099 36.427  1.00 35.78  ?  1285 HOH A O      1 
HETATM 5455 O  O      . HOH K 7 .   ? -9.020  51.740 49.016  1.00 50.49  ?  1286 HOH A O      1 
HETATM 5456 O  O      . HOH K 7 .   ? -0.722  46.688 13.657  1.00 35.45  ?  1287 HOH A O      1 
HETATM 5457 O  O      . HOH K 7 .   ? 23.085  47.119 8.075   1.00 38.85  ?  1288 HOH A O      1 
HETATM 5458 O  O      . HOH K 7 .   ? -2.382  36.356 9.740   1.00 36.28  ?  1289 HOH A O      1 
HETATM 5459 O  O      . HOH K 7 .   ? -2.622  48.329 12.576  1.00 46.60  ?  1290 HOH A O      1 
HETATM 5460 O  O      . HOH K 7 .   ? 24.887  32.035 -0.328  1.00 45.90  ?  1291 HOH A O      1 
HETATM 5461 O  O      . HOH K 7 .   ? 0.299   62.382 19.936  1.00 43.60  ?  1292 HOH A O      1 
HETATM 5462 O  O      . HOH K 7 .   ? 20.395  34.161 -6.810  1.00 55.96  ?  1293 HOH A O      1 
HETATM 5463 O  O      . HOH K 7 .   ? 12.341  51.267 10.094  1.00 45.44  ?  1294 HOH A O      1 
HETATM 5464 O  O      . HOH K 7 .   ? -11.826 53.866 45.421  1.00 47.17  ?  1295 HOH A O      1 
HETATM 5465 O  O      . HOH K 7 .   ? 17.264  32.047 18.053  1.00 36.26  ?  1296 HOH A O      1 
HETATM 5466 O  O      . HOH K 7 .   ? 23.552  26.497 -2.048  1.00 59.47  ?  1297 HOH A O      1 
HETATM 5467 O  O      . HOH K 7 .   ? 17.362  47.677 46.939  1.00 46.07  ?  1298 HOH A O      1 
HETATM 5468 O  O      . HOH K 7 .   ? 19.239  10.131 3.936   1.00 41.41  ?  1299 HOH A O      1 
HETATM 5469 O  O      . HOH K 7 .   ? 22.626  46.223 56.100  1.00 44.08  ?  1300 HOH A O      1 
HETATM 5470 O  O      . HOH K 7 .   ? 1.597   44.607 13.486  1.00 35.27  ?  1301 HOH A O      1 
HETATM 5471 O  O      . HOH K 7 .   ? 6.672   13.536 1.994   1.00 52.60  ?  1302 HOH A O      1 
HETATM 5472 O  O      . HOH K 7 .   ? 27.277  58.868 17.825  1.00 39.05  ?  1303 HOH A O      1 
HETATM 5473 O  O      . HOH K 7 .   ? 16.305  48.658 8.067   1.00 31.83  ?  1304 HOH A O      1 
HETATM 5474 O  O      . HOH K 7 .   ? 15.698  55.363 50.527  1.00 42.13  ?  1305 HOH A O      1 
HETATM 5475 O  O      . HOH K 7 .   ? 18.238  67.099 23.063  1.00 40.81  ?  1306 HOH A O      1 
HETATM 5476 O  O      . HOH K 7 .   ? -2.421  46.909 15.040  1.00 51.10  ?  1307 HOH A O      1 
HETATM 5477 O  O      . HOH K 7 .   ? -3.035  53.407 21.265  1.00 49.48  ?  1308 HOH A O      1 
HETATM 5478 O  O      . HOH K 7 .   ? 2.965   40.588 -7.794  1.00 53.65  ?  1309 HOH A O      1 
HETATM 5479 O  O      . HOH K 7 .   ? -5.145  39.745 22.044  1.00 56.41  ?  1310 HOH A O      1 
HETATM 5480 O  O      . HOH K 7 .   ? -3.687  49.379 14.432  1.00 49.19  ?  1311 HOH A O      1 
HETATM 5481 O  O      . HOH K 7 .   ? 21.942  10.747 5.185   1.00 50.99  ?  1312 HOH A O      1 
HETATM 5482 O  O      . HOH K 7 .   ? -6.527  37.967 54.866  1.00 42.47  ?  1313 HOH A O      1 
HETATM 5483 O  O      . HOH K 7 .   ? 0.450   41.273 10.578  1.00 43.16  ?  1314 HOH A O      1 
HETATM 5484 O  O      . HOH K 7 .   ? 21.467  69.879 17.116  1.00 41.96  ?  1315 HOH A O      1 
HETATM 5485 O  O      . HOH K 7 .   ? -1.129  43.926 13.757  1.00 34.44  ?  1316 HOH A O      1 
HETATM 5486 O  O      . HOH K 7 .   ? 4.553   38.422 -10.569 1.00 41.17  ?  1317 HOH A O      1 
HETATM 5487 O  O      . HOH K 7 .   ? 35.229  36.458 18.146  1.00 62.07  ?  1318 HOH A O      1 
HETATM 5488 O  O      . HOH K 7 .   ? -5.898  42.241 22.821  1.00 50.50  ?  1319 HOH A O      1 
HETATM 5489 O  O      . HOH K 7 .   ? 20.300  66.738 18.424  1.00 45.26  ?  1320 HOH A O      1 
HETATM 5490 O  O      . HOH K 7 .   ? -5.748  31.420 12.200  1.00 36.41  ?  1321 HOH A O      1 
HETATM 5491 O  O      . HOH K 7 .   ? 16.681  11.394 15.331  1.00 40.19  ?  1322 HOH A O      1 
HETATM 5492 O  O      . HOH K 7 .   ? 25.022  44.820 56.627  1.00 41.04  ?  1323 HOH A O      1 
HETATM 5493 O  O      . HOH K 7 .   ? 16.396  71.217 22.056  1.00 60.52  ?  1324 HOH A O      1 
HETATM 5494 O  O      . HOH K 7 .   ? -8.632  37.397 1.929   1.00 49.57  ?  1325 HOH A O      1 
HETATM 5495 O  O      . HOH K 7 .   ? 10.001  20.750 53.964  1.00 47.29  ?  1326 HOH A O      1 
HETATM 5496 O  O      . HOH K 7 .   ? 10.079  22.128 56.579  1.00 55.66  ?  1327 HOH A O      1 
# 
loop_
_atom_site_anisotrop.id 
_atom_site_anisotrop.type_symbol 
_atom_site_anisotrop.pdbx_label_atom_id 
_atom_site_anisotrop.pdbx_label_alt_id 
_atom_site_anisotrop.pdbx_label_comp_id 
_atom_site_anisotrop.pdbx_label_asym_id 
_atom_site_anisotrop.pdbx_label_seq_id 
_atom_site_anisotrop.pdbx_PDB_ins_code 
_atom_site_anisotrop.U[1][1] 
_atom_site_anisotrop.U[2][2] 
_atom_site_anisotrop.U[3][3] 
_atom_site_anisotrop.U[1][2] 
_atom_site_anisotrop.U[1][3] 
_atom_site_anisotrop.U[2][3] 
_atom_site_anisotrop.pdbx_auth_seq_id 
_atom_site_anisotrop.pdbx_auth_comp_id 
_atom_site_anisotrop.pdbx_auth_asym_id 
_atom_site_anisotrop.pdbx_auth_atom_id 
1    O "O5'" . DG  A 1   ? 1.2075 1.1814 0.6114 0.1663  -0.0566 -0.4175 1   DG  P "O5'" 
2    C "C5'" . DG  A 1   ? 1.3697 1.3666 0.8076 0.1444  -0.0850 -0.3970 1   DG  P "C5'" 
3    C "C4'" . DG  A 1   ? 1.4680 1.4009 0.9339 0.1207  -0.0862 -0.4116 1   DG  P "C4'" 
4    O "O4'" . DG  A 1   ? 1.5050 1.3874 1.0056 0.1449  -0.0699 -0.3870 1   DG  P "O4'" 
5    C "C3'" . DG  A 1   ? 1.4567 1.4110 0.9539 0.0887  -0.1072 -0.3988 1   DG  P "C3'" 
6    O "O3'" . DG  A 1   ? 1.5014 1.3913 0.9982 0.0540  -0.1046 -0.4273 1   DG  P "O3'" 
7    C "C2'" . DG  A 1   ? 1.3653 1.3171 0.9016 0.1085  -0.1026 -0.3483 1   DG  P "C2'" 
8    C "C1'" . DG  A 1   ? 1.4465 1.3335 0.9844 0.1366  -0.0825 -0.3484 1   DG  P "C1'" 
9    N N9    . DG  A 1   ? 1.4462 1.3566 1.0148 0.1699  -0.0750 -0.3113 1   DG  P N9    
10   C C8    . DG  A 1   ? 1.4264 1.3992 0.9920 0.1882  -0.0679 -0.2958 1   DG  P C8    
11   N N7    . DG  A 1   ? 1.3800 1.3614 0.9838 0.2107  -0.0591 -0.2665 1   DG  P N7    
12   C C5    . DG  A 1   ? 1.3771 1.3009 1.0088 0.2121  -0.0668 -0.2613 1   DG  P C5    
13   C C6    . DG  A 1   ? 1.3234 1.2330 1.0009 0.2336  -0.0700 -0.2359 1   DG  P C6    
14   O O6    . DG  A 1   ? 1.2475 1.2003 0.9608 0.2521  -0.0628 -0.2162 1   DG  P O6    
15   N N1    . DG  A 1   ? 1.3853 1.2188 1.0619 0.2303  -0.0846 -0.2354 1   DG  P N1    
16   C C2    . DG  A 1   ? 1.4871 1.2604 1.1244 0.2041  -0.0881 -0.2571 1   DG  P C2    
17   N N2    . DG  A 1   ? 1.5957 1.2823 1.2248 0.2032  -0.1001 -0.2484 1   DG  P N2    
18   N N3    . DG  A 1   ? 1.4815 1.2749 1.0865 0.1790  -0.0820 -0.2858 1   DG  P N3    
19   C C4    . DG  A 1   ? 1.4289 1.3011 1.0333 0.1871  -0.0747 -0.2861 1   DG  P C4    
20   P P     . DC  A 2   ? 1.4662 1.3715 0.9923 0.0074  -0.1160 -0.4288 2   DC  P P     
21   O OP1   . DC  A 2   ? 1.5592 1.3998 1.0676 -0.0339 -0.1086 -0.4732 2   DC  P OP1   
22   O OP2   . DC  A 2   ? 1.4134 1.4251 0.9594 0.0074  -0.1383 -0.4242 2   DC  P OP2   
23   O "O5'" . DC  A 2   ? 1.3325 1.1931 0.8822 0.0155  -0.1072 -0.3804 2   DC  P "O5'" 
24   C "C5'" . DC  A 2   ? 1.3644 1.1211 0.8988 0.0263  -0.0942 -0.3711 2   DC  P "C5'" 
25   C "C4'" . DC  A 2   ? 1.3673 1.0877 0.9133 0.0224  -0.0946 -0.3283 2   DC  P "C4'" 
26   O "O4'" . DC  A 2   ? 1.3533 1.0942 0.9188 0.0692  -0.0990 -0.2917 2   DC  P "O4'" 
27   C "C3'" . DC  A 2   ? 1.3153 1.0950 0.8832 -0.0130 -0.0978 -0.3197 2   DC  P "C3'" 
28   O "O3'" . DC  A 2   ? 1.4283 1.1282 0.9773 -0.0462 -0.0875 -0.3064 2   DC  P "O3'" 
29   C "C2'" . DC  A 2   ? 1.2256 1.0742 0.8207 0.0233  -0.1065 -0.2828 2   DC  P "C2'" 
30   C "C1'" . DC  A 2   ? 1.2607 1.0462 0.8466 0.0617  -0.1053 -0.2597 2   DC  P "C1'" 
31   N N1    . DC  A 2   ? 1.1210 0.9657 0.7332 0.1023  -0.1089 -0.2345 2   DC  P N1    
32   C C2    . DC  A 2   ? 1.0762 0.8924 0.7025 0.1263  -0.1136 -0.2020 2   DC  P C2    
33   O O2    . DC  A 2   ? 1.1103 0.8480 0.7179 0.1178  -0.1191 -0.1911 2   DC  P O2    
34   N N3    . DC  A 2   ? 1.0075 0.8796 0.6637 0.1564  -0.1133 -0.1834 2   DC  P N3    
35   C C4    . DC  A 2   ? 1.0177 0.9583 0.6777 0.1635  -0.1060 -0.1915 2   DC  P C4    
36   N N4    . DC  A 2   ? 0.9391 0.9227 0.6233 0.1877  -0.1002 -0.1718 2   DC  P N4    
37   C C5    . DC  A 2   ? 1.0249 0.9898 0.6600 0.1444  -0.1060 -0.2205 2   DC  P C5    
38   C C6    . DC  A 2   ? 1.0496 0.9715 0.6677 0.1140  -0.1087 -0.2437 2   DC  P C6    
39   P P     . DG  A 3   ? 1.4460 1.1816 1.0120 -0.1026 -0.0768 -0.3170 3   DG  P P     
40   O OP1   . DG  A 3   ? 1.5202 1.1840 1.0603 -0.1540 -0.0601 -0.3518 3   DG  P OP1   
41   O OP2   . DG  A 3   ? 1.3868 1.2531 1.0027 -0.0930 -0.0894 -0.3268 3   DG  P OP2   
42   O "O5'" . DG  A 3   ? 1.4148 1.1008 0.9620 -0.1036 -0.0708 -0.2712 3   DG  P "O5'" 
43   C "C5'" . DG  A 3   ? 1.4860 1.0388 0.9744 -0.1113 -0.0645 -0.2512 3   DG  P "C5'" 
44   C "C4'" . DG  A 3   ? 1.4444 0.9707 0.9153 -0.0838 -0.0757 -0.2031 3   DG  P "C4'" 
45   O "O4'" . DG  A 3   ? 1.3528 0.9523 0.8653 -0.0279 -0.0953 -0.1899 3   DG  P "O4'" 
46   C "C3'" . DG  A 3   ? 1.3885 0.9483 0.8607 -0.1175 -0.0622 -0.1899 3   DG  P "C3'" 
47   O "O3'" . DG  A 3   ? 1.5029 0.9562 0.9078 -0.1245 -0.0627 -0.1548 3   DG  P "O3'" 
48   C "C2'" . DG  A 3   ? 1.1939 0.8687 0.7235 -0.0788 -0.0767 -0.1794 3   DG  P "C2'" 
49   C "C1'" . DG  A 3   ? 1.2374 0.8943 0.7696 -0.0236 -0.0986 -0.1652 3   DG  P "C1'" 
50   N N9    . DG  A 3   ? 1.1498 0.9091 0.7338 0.0122  -0.1074 -0.1675 3   DG  P N9    
51   C C8    . DG  A 3   ? 1.0964 0.9392 0.7122 0.0090  -0.1050 -0.1945 3   DG  P C8    
52   N N7    . DG  A 3   ? 1.0269 0.9342 0.6693 0.0451  -0.1132 -0.1848 3   DG  P N7    
53   C C5    . DG  A 3   ? 1.0482 0.9218 0.6881 0.0710  -0.1191 -0.1537 3   DG  P C5    
54   C C6    . DG  A 3   ? 0.9995 0.9140 0.6656 0.1074  -0.1242 -0.1343 3   DG  P C6    
55   O O6    . DG  A 3   ? 0.9547 0.9330 0.6399 0.1245  -0.1214 -0.1365 3   DG  P O6    
56   N N1    . DG  A 3   ? 1.0132 0.8831 0.6779 0.1223  -0.1339 -0.1105 3   DG  P N1    
57   C C2    . DG  A 3   ? 1.1546 0.9408 0.7832 0.1082  -0.1418 -0.1015 3   DG  P C2    
58   N N2    . DG  A 3   ? 1.2583 1.0139 0.8883 0.1305  -0.1599 -0.0780 3   DG  P N2    
59   N N3    . DG  A 3   ? 1.1929 0.9259 0.7832 0.0731  -0.1333 -0.1148 3   DG  P N3    
60   C C4    . DG  A 3   ? 1.1081 0.8936 0.7128 0.0541  -0.1201 -0.1429 3   DG  P C4    
61   P P     . DA  A 4   ? 1.5146 0.9571 0.8877 -0.1729 -0.0385 -0.1434 4   DA  P P     
62   O OP1   . DA  A 4   ? 1.6752 0.9655 0.9503 -0.2052 -0.0275 -0.1252 4   DA  P OP1   
63   O OP2   . DA  A 4   ? 1.5005 1.0546 0.9393 -0.2071 -0.0148 -0.1809 4   DA  P OP2   
64   O "O5'" . DA  A 4   ? 1.3363 0.8181 0.7188 -0.1320 -0.0611 -0.1094 4   DA  P "O5'" 
65   C "C5'" . DA  A 4   ? 1.3827 0.8012 0.7335 -0.0865 -0.0942 -0.0769 4   DA  P "C5'" 
66   C "C4'" . DA  A 4   ? 1.3007 0.7961 0.6909 -0.0522 -0.1128 -0.0589 4   DA  P "C4'" 
67   O "O4'" . DA  A 4   ? 1.1310 0.7331 0.6025 -0.0207 -0.1169 -0.0765 4   DA  P "O4'" 
68   C "C3'" . DA  A 4   ? 1.2223 0.7546 0.6057 -0.0863 -0.0920 -0.0574 4   DA  P "C3'" 
69   O "O3'" . DA  A 4   ? 1.2536 0.7230 0.5757 -0.0819 -0.1092 -0.0259 4   DA  P "O3'" 
70   C "C2'" . DA  A 4   ? 1.0633 0.7260 0.5349 -0.0627 -0.0917 -0.0710 4   DA  P "C2'" 
71   C "C1'" . DA  A 4   ? 1.0054 0.6930 0.5170 -0.0162 -0.1138 -0.0727 4   DA  P "C1'" 
72   N N9    . DA  A 4   ? 0.9990 0.7819 0.5724 -0.0080 -0.1057 -0.0974 4   DA  P N9    
73   C C8    . DA  A 4   ? 1.0333 0.8461 0.6220 -0.0365 -0.0891 -0.1285 4   DA  P C8    
74   N N7    . DA  A 4   ? 0.9818 0.8809 0.6202 -0.0167 -0.0936 -0.1442 4   DA  P N7    
75   C C5    . DA  A 4   ? 0.9340 0.8548 0.5872 0.0242  -0.1076 -0.1205 4   DA  P C5    
76   C C6    . DA  A 4   ? 0.8652 0.8549 0.5537 0.0572  -0.1145 -0.1187 4   DA  P C6    
77   N N6    . DA  A 4   ? 0.7531 0.8034 0.4625 0.0597  -0.1151 -0.1399 4   DA  P N6    
78   N N1    . DA  A 4   ? 0.9385 0.9298 0.6359 0.0859  -0.1215 -0.0946 4   DA  P N1    
79   C C2    . DA  A 4   ? 0.9993 0.9358 0.6773 0.0853  -0.1288 -0.0758 4   DA  P C2    
80   N N3    . DA  A 4   ? 0.9463 0.8116 0.5819 0.0609  -0.1299 -0.0724 4   DA  P N3    
81   C C4    . DA  A 4   ? 0.9593 0.8161 0.5813 0.0291  -0.1155 -0.0944 4   DA  P C4    
82   P P     . DT  A 5   ? 1.3492 0.8313 0.6414 -0.1183 -0.0863 -0.0233 5   DT  P P     
83   O OP1   . DT  A 5   ? 1.5867 0.9568 0.7746 -0.1252 -0.1046 0.0085  5   DT  P OP1   
84   O OP2   . DT  A 5   ? 1.3366 0.8563 0.6504 -0.1664 -0.0411 -0.0552 5   DT  P OP2   
85   O "O5'" . DT  A 5   ? 1.2367 0.8287 0.6084 -0.0823 -0.0996 -0.0244 5   DT  P "O5'" 
86   C "C5'" . DT  A 5   ? 1.1946 0.8016 0.5962 -0.0326 -0.1374 -0.0080 5   DT  P "C5'" 
87   C "C4'" . DT  A 5   ? 1.1201 0.8264 0.5934 -0.0120 -0.1371 -0.0129 5   DT  P "C4'" 
88   O "O4'" . DT  A 5   ? 1.0206 0.8025 0.5634 0.0041  -0.1267 -0.0317 5   DT  P "O4'" 
89   C "C3'" . DT  A 5   ? 1.1184 0.8501 0.5838 -0.0420 -0.1115 -0.0207 5   DT  P "C3'" 
90   O "O3'" . DT  A 5   ? 1.0764 0.8093 0.5344 -0.0294 -0.1302 -0.0062 5   DT  P "O3'" 
91   C "C2'" . DT  A 5   ? 0.9914 0.8190 0.5362 -0.0355 -0.0908 -0.0437 5   DT  P "C2'" 
92   C "C1'" . DT  A 5   ? 0.9425 0.7987 0.5299 0.0034  -0.1115 -0.0405 5   DT  P "C1'" 
93   N N1    . DT  A 5   ? 0.8762 0.7960 0.5122 0.0078  -0.0993 -0.0625 5   DT  P N1    
94   C C2    . DT  A 5   ? 0.7781 0.7624 0.4637 0.0400  -0.1052 -0.0616 5   DT  P C2    
95   O O2    . DT  A 5   ? 0.7950 0.7887 0.4937 0.0613  -0.1145 -0.0452 5   DT  P O2    
96   N N3    . DT  A 5   ? 0.7926 0.8276 0.5080 0.0438  -0.1003 -0.0814 5   DT  P N3    
97   C C4    . DT  A 5   ? 0.7422 0.7800 0.4557 0.0169  -0.0906 -0.1065 5   DT  P C4    
98   O O4    . DT  A 5   ? 0.6672 0.7589 0.4108 0.0230  -0.0931 -0.1264 5   DT  P O4    
99   C C5    . DT  A 5   ? 0.8080 0.7773 0.4761 -0.0213 -0.0781 -0.1083 5   DT  P C5    
100  C C7    . DT  A 5   ? 0.9636 0.9270 0.6283 -0.0608 -0.0605 -0.1375 5   DT  P C7    
101  C C6    . DT  A 5   ? 0.8866 0.7956 0.5118 -0.0227 -0.0830 -0.0840 5   DT  P C6    
102  P P     . DC  A 6   ? 1.1030 0.8483 0.5432 -0.0568 -0.1065 -0.0147 6   DC  P P     
103  O OP1   . DC  A 6   ? 1.2360 0.9347 0.6238 -0.0542 -0.1353 0.0032  6   DC  P OP1   
104  O OP2   . DC  A 6   ? 1.2003 0.9268 0.6091 -0.0994 -0.0672 -0.0325 6   DC  P OP2   
105  O "O5'" . DC  A 6   ? 0.9825 0.8240 0.5153 -0.0327 -0.0964 -0.0273 6   DC  P "O5'" 
106  C "C5'" . DC  A 6   ? 0.9048 0.7809 0.4858 0.0039  -0.1205 -0.0161 6   DC  P "C5'" 
107  C "C4'" . DC  A 6   ? 0.8482 0.7965 0.4969 0.0210  -0.1042 -0.0258 6   DC  P "C4'" 
108  O "O4'" . DC  A 6   ? 0.8280 0.8108 0.5072 0.0305  -0.0969 -0.0358 6   DC  P "O4'" 
109  C "C3'" . DC  A 6   ? 0.7740 0.7386 0.4273 0.0037  -0.0776 -0.0408 6   DC  P "C3'" 
110  O "O3'" . DC  A 6   ? 0.7170 0.6931 0.3906 0.0160  -0.0814 -0.0353 6   DC  P "O3'" 
111  C "C2'" . DC  A 6   ? 0.7492 0.7711 0.4531 0.0125  -0.0605 -0.0580 6   DC  P "C2'" 
112  C "C1'" . DC  A 6   ? 0.7712 0.8078 0.4929 0.0371  -0.0798 -0.0484 6   DC  P "C1'" 
113  N N1    . DC  A 6   ? 0.8086 0.8783 0.5508 0.0348  -0.0735 -0.0665 6   DC  P N1    
114  C C2    . DC  A 6   ? 0.8560 0.9750 0.6358 0.0642  -0.0817 -0.0677 6   DC  P C2    
115  O O2    . DC  A 6   ? 0.8679 0.9958 0.6596 0.0897  -0.0885 -0.0512 6   DC  P O2    
116  N N3    . DC  A 6   ? 0.8671 1.0199 0.6641 0.0607  -0.0818 -0.0881 6   DC  P N3    
117  C C4    . DC  A 6   ? 0.8628 1.0033 0.6493 0.0260  -0.0691 -0.1081 6   DC  P C4    
118  N N4    . DC  A 6   ? 0.8118 0.9925 0.6233 0.0195  -0.0704 -0.1328 6   DC  P N4    
119  C C5    . DC  A 6   ? 0.8620 0.9448 0.6055 -0.0068 -0.0541 -0.1044 6   DC  P C5    
120  C C6    . DC  A 6   ? 0.8339 0.8824 0.5525 0.0008  -0.0594 -0.0828 6   DC  P C6    
121  P P     . DA  A 7   ? 0.6899 0.6760 0.3728 0.0055  -0.0547 -0.0521 7   DA  P P     
122  O OP1   . DA  A 7   ? 0.6957 0.6654 0.3755 0.0080  -0.0649 -0.0449 7   DA  P OP1   
123  O OP2   . DA  A 7   ? 0.7140 0.6770 0.3555 -0.0284 -0.0318 -0.0697 7   DA  P OP2   
124  O "O5'" . DA  A 7   ? 0.6840 0.7286 0.4330 0.0343  -0.0440 -0.0584 7   DA  P "O5'" 
125  C "C5'" . DA  A 7   ? 0.5770 0.6420 0.3559 0.0645  -0.0590 -0.0412 7   DA  P "C5'" 
126  C "C4'" . DA  A 7   ? 0.6387 0.7455 0.4607 0.0913  -0.0512 -0.0460 7   DA  P "C4'" 
127  O "O4'" . DA  A 7   ? 0.6325 0.7727 0.4657 0.0955  -0.0568 -0.0552 7   DA  P "O4'" 
128  C "C3'" . DA  A 7   ? 0.6328 0.7489 0.4761 0.0902  -0.0304 -0.0658 7   DA  P "C3'" 
129  O "O3'" . DA  A 7   ? 0.5615 0.6926 0.4374 0.1249  -0.0317 -0.0583 7   DA  P "O3'" 
130  C "C2'" . DA  A 7   ? 0.6306 0.7823 0.4892 0.0777  -0.0220 -0.0896 7   DA  P "C2'" 
131  C "C1'" . DA  A 7   ? 0.6356 0.8130 0.5029 0.0974  -0.0440 -0.0784 7   DA  P "C1'" 
132  N N9    . DA  A 7   ? 0.6264 0.8287 0.4984 0.0790  -0.0432 -0.0977 7   DA  P N9    
133  C C8    . DA  A 7   ? 0.6236 0.8009 0.4665 0.0391  -0.0281 -0.1109 7   DA  P C8    
134  N N7    . DA  A 7   ? 0.5856 0.7896 0.4419 0.0254  -0.0272 -0.1292 7   DA  P N7    
135  C C5    . DA  A 7   ? 0.6291 0.8846 0.5258 0.0611  -0.0477 -0.1291 7   DA  P C5    
136  C C6    . DA  A 7   ? 0.8439 1.1492 0.7695 0.0661  -0.0611 -0.1475 7   DA  P C6    
137  N N6    . DA  A 7   ? 0.9395 1.2516 0.8666 0.0302  -0.0509 -0.1724 7   DA  P N6    
138  N N1    . DA  A 7   ? 0.9263 1.2684 0.8723 0.1068  -0.0855 -0.1399 7   DA  P N1    
139  C C2    . DA  A 7   ? 0.8842 1.2075 0.8217 0.1379  -0.0907 -0.1136 7   DA  P C2    
140  N N3    . DA  A 7   ? 0.6635 0.9419 0.5828 0.1335  -0.0760 -0.0969 7   DA  P N3    
141  C C4    . DA  A 7   ? 0.5826 0.8327 0.4832 0.0951  -0.0571 -0.1071 7   DA  P C4    
142  P P     . DC  A 8   ? 0.6135 0.7215 0.5037 0.1328  -0.0138 -0.0657 8   DC  P P     
143  O OP1   . DC  A 8   ? 0.5979 0.6653 0.4705 0.1367  -0.0181 -0.0416 8   DC  P OP1   
144  O OP2   . DC  A 8   ? 0.6086 0.7100 0.4903 0.1023  0.0082  -0.0938 8   DC  P OP2   
145  O "O5'" . DC  A 8   ? 0.6931 0.8387 0.6307 0.1745  -0.0174 -0.0714 8   DC  P "O5'" 
146  C "C5'" . DC  A 8   ? 0.8651 1.0098 0.8000 0.2087  -0.0367 -0.0451 8   DC  P "C5'" 
147  C "C4'" . DC  A 8   ? 0.9099 1.1114 0.8818 0.2402  -0.0542 -0.0563 8   DC  P "C4'" 
148  O "O4'" . DC  A 8   ? 0.8672 1.1104 0.8389 0.2187  -0.0625 -0.0693 8   DC  P "O4'" 
149  C "C3'" . DC  A 8   ? 0.8636 1.0992 0.8931 0.2534  -0.0432 -0.0887 8   DC  P "C3'" 
150  O "O3'" . DC  A 8   ? 0.7986 1.0047 0.8406 0.2960  -0.0473 -0.0767 8   DC  P "O3'" 
151  C "C2'" . DC  A 8   ? 0.8871 1.2013 0.9581 0.2618  -0.0621 -0.1103 8   DC  P "C2'" 
152  C "C1'" . DC  A 8   ? 0.8225 1.1310 0.8463 0.2350  -0.0725 -0.0959 8   DC  P "C1'" 
153  N N1    . DC  A 8   ? 0.7089 1.0496 0.7439 0.1932  -0.0599 -0.1247 8   DC  P N1    
154  C C2    . DC  A 8   ? 0.6776 1.0729 0.7334 0.1923  -0.0782 -0.1407 8   DC  P C2    
155  O O2    . DC  A 8   ? 0.6601 1.0798 0.7210 0.2287  -0.1086 -0.1309 8   DC  P O2    
156  N N3    . DC  A 8   ? 0.6801 1.0941 0.7427 0.1492  -0.0621 -0.1670 8   DC  P N3    
157  C C4    . DC  A 8   ? 0.7162 1.0919 0.7556 0.1104  -0.0303 -0.1735 8   DC  P C4    
158  N N4    . DC  A 8   ? 0.5445 0.9258 0.5782 0.0659  -0.0122 -0.1960 8   DC  P N4    
159  C C5    . DC  A 8   ? 0.6828 1.0059 0.6956 0.1129  -0.0154 -0.1578 8   DC  P C5    
160  C C6    . DC  A 8   ? 0.6626 0.9725 0.6795 0.1535  -0.0304 -0.1357 8   DC  P C6    
161  P P     . DG  A 9   ? 0.8633 1.0821 0.9657 0.3151  -0.0286 -0.1098 9   DG  P P     
162  O OP1   . DG  A 9   ? 0.9574 1.1046 1.0433 0.3487  -0.0280 -0.0869 9   DG  P OP1   
163  O OP2   . DG  A 9   ? 0.8262 1.0561 0.9343 0.2662  0.0055  -0.1428 9   DG  P OP2   
164  O "O5'" . DG  A 9   ? 0.7396 1.0458 0.9119 0.3532  -0.0550 -0.1318 9   DG  P "O5'" 
165  C "C5'" . DG  A 9   ? 0.7876 1.0937 0.9544 0.4062  -0.0955 -0.1056 9   DG  P "C5'" 
166  C "C4'" . DG  A 9   ? 0.7146 1.1216 0.9473 0.4277  -0.1260 -0.1338 9   DG  P "C4'" 
167  O "O4'" . DG  A 9   ? 0.6376 1.0819 0.8506 0.3821  -0.1263 -0.1414 9   DG  P "O4'" 
168  C "C3'" . DG  A 9   ? 0.6783 1.1593 1.0140 0.4330  -0.1082 -0.1871 9   DG  P "C3'" 
169  O "O3'" . DG  A 9   ? 0.7760 1.2570 1.1594 0.4996  -0.1297 -0.1879 9   DG  P "O3'" 
170  C "C2'" . DG  A 9   ? 0.6442 1.2271 1.0282 0.4158  -0.1266 -0.2178 9   DG  P "C2'" 
171  C "C1'" . DG  A 9   ? 0.6115 1.1516 0.9061 0.3687  -0.1237 -0.1901 9   DG  P "C1'" 
172  N N9    . DG  A 9   ? 0.5786 1.1122 0.8619 0.3039  -0.0799 -0.2103 9   DG  P N9    
173  C C8    . DG  A 9   ? 0.5833 1.0537 0.8323 0.2745  -0.0403 -0.2070 9   DG  P C8    
174  N N7    . DG  A 9   ? 0.5825 1.0532 0.8131 0.2181  -0.0109 -0.2247 9   DG  P N7    
175  C C5    . DG  A 9   ? 0.5486 1.0849 0.8084 0.2073  -0.0281 -0.2420 9   DG  P C5    
176  C C6    . DG  A 9   ? 0.5399 1.0936 0.7912 0.1519  -0.0082 -0.2637 9   DG  P C6    
177  O O6    . DG  A 9   ? 0.5525 1.0622 0.7599 0.1027  0.0275  -0.2682 9   DG  P O6    
178  N N1    . DG  A 9   ? 0.6172 1.2399 0.9086 0.1562  -0.0356 -0.2806 9   DG  P N1    
179  C C2    . DG  A 9   ? 0.6544 1.3262 0.9835 0.2097  -0.0816 -0.2765 9   DG  P C2    
180  N N2    . DG  A 9   ? 0.7005 1.4383 1.0613 0.2030  -0.1068 -0.2989 9   DG  P N2    
181  N N3    . DG  A 9   ? 0.6230 1.2731 0.9508 0.2648  -0.1029 -0.2517 9   DG  P N3    
182  C C4    . DG  A 9   ? 0.5846 1.1652 0.8796 0.2591  -0.0718 -0.2358 9   DG  P C4    
183  P P     . DT  A 10  ? 0.7452 1.2832 1.2392 0.5134  -0.1039 -0.2413 10  DT  P P     
184  O OP1   . DT  A 10  ? 0.9616 1.4840 1.4819 0.5668  -0.1389 -0.2246 10  DT  P OP1   
185  O OP2   . DT  A 10  ? 0.7400 1.2204 1.2099 0.4747  -0.0469 -0.2537 10  DT  P OP2   
186  O "O5'" . DT  A 10  ? 0.7027 1.3590 1.2685 0.4727  -0.0976 -0.2892 10  DT  P "O5'" 
187  C "C5'" . DT  A 10  ? 0.8108 1.5444 1.4733 0.4850  -0.1055 -0.3246 10  DT  P "C5'" 
188  C "C4'" . DT  A 10  ? 0.8270 1.6331 1.5058 0.4769  -0.1477 -0.3303 10  DT  P "C4'" 
189  O "O4'" . DT  A 10  ? 0.7796 1.5728 1.3868 0.4400  -0.1487 -0.3142 10  DT  P "O4'" 
190  C "C3'" . DT  A 10  ? 0.8077 1.7239 1.5931 0.4485  -0.1320 -0.3901 10  DT  P "C3'" 
191  O "O3'" . DT  A 10  ? 0.7680 1.7274 1.6118 0.4940  -0.1764 -0.3952 10  DT  P "O3'" 
192  C "C2'" . DT  A 10  ? 0.7471 1.7066 1.5109 0.3957  -0.1329 -0.4030 10  DT  P "C2'" 
193  C "C1'" . DT  A 10  ? 0.6800 1.5560 1.3373 0.3869  -0.1269 -0.3598 10  DT  P "C1'" 
194  N N1    . DT  A 10  ? 0.5994 1.4515 1.2389 0.3365  -0.0640 -0.3762 10  DT  P N1    
195  C C2    . DT  A 10  ? 0.6122 1.4932 1.2500 0.2669  -0.0316 -0.4030 10  DT  P C2    
196  O O2    . DT  A 10  ? 0.6159 1.5741 1.2988 0.2519  -0.0509 -0.4281 10  DT  P O2    
197  N N3    . DT  A 10  ? 0.6586 1.4685 1.2340 0.2134  0.0236  -0.4000 10  DT  P N3    
198  C C4    . DT  A 10  ? 0.7111 1.4343 1.2318 0.2205  0.0470  -0.3776 10  DT  P C4    
199  O O4    . DT  A 10  ? 0.7410 1.4052 1.2003 0.1696  0.0909  -0.3780 10  DT  P O4    
200  C C5    . DT  A 10  ? 0.6814 1.3812 1.2150 0.2908  0.0143  -0.3539 10  DT  P C5    
201  C C7    . DT  A 10  ? 0.6316 1.2355 1.1118 0.2998  0.0374  -0.3327 10  DT  P C7    
202  C C6    . DT  A 10  ? 0.6308 1.3903 1.2184 0.3454  -0.0383 -0.3517 10  DT  P C6    
203  P P     . DA  B 1   ? 1.7825 1.7129 1.7230 -0.1917 0.8171  -0.1012 4   DA  T P     
204  O OP1   . DA  B 1   ? 1.7638 1.6270 1.6630 -0.2257 0.7679  -0.0978 4   DA  T OP1   
205  O OP2   . DA  B 1   ? 1.8438 1.6761 1.6438 -0.1374 0.8186  -0.0943 4   DA  T OP2   
206  O "O5'" . DA  B 1   ? 1.6413 1.7532 1.7653 -0.1728 0.7767  -0.1229 4   DA  T "O5'" 
207  C "C5'" . DA  B 1   ? 1.6216 1.8644 1.8804 -0.1712 0.8341  -0.1301 4   DA  T "C5'" 
208  C "C4'" . DA  B 1   ? 1.4353 1.8432 1.8772 -0.1774 0.7837  -0.1494 4   DA  T "C4'" 
209  O "O4'" . DA  B 1   ? 1.3319 1.7926 1.7970 -0.1137 0.7404  -0.1598 4   DA  T "O4'" 
210  C "C3'" . DA  B 1   ? 1.3325 1.7267 1.7821 -0.2091 0.7087  -0.1556 4   DA  T "C3'" 
211  O "O3'" . DA  B 1   ? 1.2042 1.7455 1.8286 -0.2398 0.6885  -0.1716 4   DA  T "O3'" 
212  C "C2'" . DA  B 1   ? 1.2763 1.6276 1.6504 -0.1532 0.6335  -0.1590 4   DA  T "C2'" 
213  C "C1'" . DA  B 1   ? 1.2366 1.6500 1.6444 -0.0981 0.6535  -0.1634 4   DA  T "C1'" 
214  N N9    . DA  B 1   ? 1.2084 1.5063 1.4667 -0.0512 0.6423  -0.1547 4   DA  T N9    
215  C C8    . DA  B 1   ? 1.2768 1.4360 1.3839 -0.0506 0.6824  -0.1393 4   DA  T C8    
216  N N7    . DA  B 1   ? 1.2871 1.3650 1.2828 -0.0060 0.6524  -0.1362 4   DA  T N7    
217  C C5    . DA  B 1   ? 1.1544 1.3228 1.2346 0.0233  0.5935  -0.1491 4   DA  T C5    
218  C C6    . DA  B 1   ? 1.0673 1.2105 1.0983 0.0690  0.5411  -0.1520 4   DA  T C6    
219  N N6    . DA  B 1   ? 1.1207 1.1401 1.0056 0.0929  0.5351  -0.1433 4   DA  T N6    
220  N N1    . DA  B 1   ? 0.9662 1.2112 1.0999 0.0869  0.4930  -0.1637 4   DA  T N1    
221  C C2    . DA  B 1   ? 0.9405 1.3050 1.2149 0.0628  0.4921  -0.1734 4   DA  T C2    
222  N N3    . DA  B 1   ? 0.9615 1.3667 1.3015 0.0176  0.5336  -0.1736 4   DA  T N3    
223  C C4    . DA  B 1   ? 1.0863 1.3878 1.3235 -0.0015 0.5862  -0.1604 4   DA  T C4    
224  P P     . DC  B 2   ? 1.1505 1.6882 1.7995 -0.2818 0.6191  -0.1817 5   DC  T P     
225  O OP1   . DC  B 2   ? 1.1191 1.7410 1.8964 -0.3495 0.6496  -0.1877 5   DC  T OP1   
226  O OP2   . DC  B 2   ? 1.1554 1.5294 1.6342 -0.2779 0.5951  -0.1699 5   DC  T OP2   
227  O "O5'" . DC  B 2   ? 1.1632 1.7986 1.8891 -0.2370 0.5398  -0.1994 5   DC  T "O5'" 
228  C "C5'" . DC  B 2   ? 1.1882 1.8623 1.9174 -0.1730 0.5383  -0.2001 5   DC  T "C5'" 
229  C "C4'" . DC  B 2   ? 1.1126 1.8688 1.9103 -0.1407 0.4605  -0.2157 5   DC  T "C4'" 
230  O "O4'" . DC  B 2   ? 1.1349 1.8733 1.8784 -0.0750 0.4495  -0.2123 5   DC  T "O4'" 
231  C "C3'" . DC  B 2   ? 1.0326 1.7300 1.7744 -0.1541 0.3906  -0.2204 5   DC  T "C3'" 
232  O "O3'" . DC  B 2   ? 0.8857 1.6608 1.7341 -0.1990 0.3633  -0.2355 5   DC  T "O3'" 
233  C "C2'" . DC  B 2   ? 1.0227 1.7279 1.7370 -0.0942 0.3355  -0.2236 5   DC  T "C2'" 
234  C "C1'" . DC  B 2   ? 1.0992 1.7759 1.7633 -0.0534 0.3823  -0.2125 5   DC  T "C1'" 
235  N N1    . DC  B 2   ? 1.1544 1.6863 1.6613 -0.0464 0.3961  -0.1963 5   DC  T N1    
236  C C2    . DC  B 2   ? 1.1438 1.6218 1.5669 0.0018  0.3698  -0.1907 5   DC  T C2    
237  O O2    . DC  B 2   ? 1.1019 1.6443 1.5746 0.0377  0.3396  -0.1982 5   DC  T O2    
238  N N3    . DC  B 2   ? 1.1243 1.4771 1.4120 0.0068  0.3747  -0.1769 5   DC  T N3    
239  C C4    . DC  B 2   ? 1.1090 1.3855 1.3367 -0.0291 0.4055  -0.1679 5   DC  T C4    
240  N N4    . DC  B 2   ? 1.0715 1.2242 1.1633 -0.0188 0.4029  -0.1541 5   DC  T N4    
241  C C5    . DC  B 2   ? 1.1519 1.4718 1.4547 -0.0789 0.4374  -0.1721 5   DC  T C5    
242  C C6    . DC  B 2   ? 1.1527 1.6031 1.5977 -0.0881 0.4311  -0.1868 5   DC  T C6    
243  P P     . DG  B 3   ? 0.7225 1.4299 1.5155 -0.2254 0.3034  -0.2428 6   DG  T P     
244  O OP1   . DG  B 3   ? 0.7021 1.4931 1.6129 -0.2785 0.2867  -0.2594 6   DG  T OP1   
245  O OP2   . DG  B 3   ? 0.7638 1.3230 1.4119 -0.2334 0.3250  -0.2269 6   DG  T OP2   
246  O "O5'" . DG  B 3   ? 0.6318 1.3527 1.4012 -0.1684 0.2362  -0.2490 6   DG  T "O5'" 
247  C "C5'" . DG  B 3   ? 0.6212 1.2419 1.2774 -0.1532 0.1982  -0.2449 6   DG  T "C5'" 
248  C "C4'" . DG  B 3   ? 0.6528 1.2643 1.2605 -0.0925 0.1759  -0.2379 6   DG  T "C4'" 
249  O "O4'" . DG  B 3   ? 0.7174 1.2735 1.2604 -0.0750 0.2231  -0.2216 6   DG  T "O4'" 
250  C "C3'" . DG  B 3   ? 0.6251 1.1635 1.1435 -0.0728 0.1298  -0.2354 6   DG  T "C3'" 
251  O "O3'" . DG  B 3   ? 0.5953 1.1932 1.1621 -0.0627 0.0777  -0.2499 6   DG  T "O3'" 
252  C "C2'" . DG  B 3   ? 0.5700 1.0665 1.0183 -0.0279 0.1362  -0.2201 6   DG  T "C2'" 
253  C "C1'" . DG  B 3   ? 0.6919 1.1888 1.1476 -0.0334 0.1960  -0.2124 6   DG  T "C1'" 
254  N N9    . DG  B 3   ? 0.8339 1.2203 1.1804 -0.0367 0.2250  -0.1964 6   DG  T N9    
255  C C8    . DG  B 3   ? 0.9173 1.2391 1.2240 -0.0749 0.2603  -0.1905 6   DG  T C8    
256  N N7    . DG  B 3   ? 0.9517 1.1709 1.1479 -0.0638 0.2757  -0.1750 6   DG  T N7    
257  C C5    . DG  B 3   ? 0.9499 1.1713 1.1182 -0.0190 0.2480  -0.1715 6   DG  T C5    
258  C C6    . DG  B 3   ? 1.0082 1.1440 1.0717 0.0079  0.2422  -0.1578 6   DG  T C6    
259  O O6    . DG  B 3   ? 1.0399 1.0767 1.0072 0.0018  0.2591  -0.1453 6   DG  T O6    
260  N N1    . DG  B 3   ? 0.9921 1.1608 1.0651 0.0440  0.2096  -0.1591 6   DG  T N1    
261  C C2    . DG  B 3   ? 0.8954 1.1604 1.0588 0.0564  0.1874  -0.1709 6   DG  T C2    
262  N N2    . DG  B 3   ? 0.8276 1.0988 0.9765 0.0898  0.1592  -0.1686 6   DG  T N2    
263  N N3    . DG  B 3   ? 0.8570 1.2015 1.1143 0.0361  0.1895  -0.1837 6   DG  T N3    
264  C C4    . DG  B 3   ? 0.8852 1.2058 1.1432 -0.0028 0.2195  -0.1839 6   DG  T C4    
265  P P     . DT  B 4   ? 0.5677 1.1048 1.0646 -0.0561 0.0318  -0.2535 7   DT  T P     
266  O OP1   . DT  B 4   ? 0.6165 1.2219 1.1707 -0.0509 -0.0151 -0.2705 7   DT  T OP1   
267  O OP2   . DT  B 4   ? 0.6616 1.1118 1.0994 -0.0901 0.0487  -0.2511 7   DT  T OP2   
268  O "O5'" . DT  B 4   ? 0.5606 1.0544 0.9832 -0.0091 0.0258  -0.2371 7   DT  T "O5'" 
269  C "C5'" . DT  B 4   ? 0.4523 0.9983 0.9027 0.0264  0.0177  -0.2340 7   DT  T "C5'" 
270  C "C4'" . DT  B 4   ? 0.4229 0.9209 0.8004 0.0605  -0.0010 -0.2209 7   DT  T "C4'" 
271  O "O4'" . DT  B 4   ? 0.4450 0.8855 0.7662 0.0669  0.0282  -0.2052 7   DT  T "O4'" 
272  C "C3'" . DT  B 4   ? 0.4317 0.8809 0.7573 0.0588  -0.0260 -0.2213 7   DT  T "C3'" 
273  O "O3'" . DT  B 4   ? 0.4012 0.8547 0.7034 0.0906  -0.0525 -0.2152 7   DT  T "O3'" 
274  C "C2'" . DT  B 4   ? 0.5028 0.8727 0.7634 0.0501  -0.0016 -0.2084 7   DT  T "C2'" 
275  C "C1'" . DT  B 4   ? 0.5323 0.9001 0.7824 0.0657  0.0203  -0.1961 7   DT  T "C1'" 
276  N N1    . DT  B 4   ? 0.6781 0.9812 0.8804 0.0499  0.0556  -0.1867 7   DT  T N1    
277  C C2    . DT  B 4   ? 0.7074 0.9566 0.8451 0.0685  0.0597  -0.1714 7   DT  T C2    
278  O O2    . DT  B 4   ? 0.6897 0.9446 0.8141 0.0936  0.0367  -0.1650 7   DT  T O2    
279  N N3    . DT  B 4   ? 0.7011 0.8828 0.7847 0.0539  0.0905  -0.1634 7   DT  T N3    
280  C C4    . DT  B 4   ? 0.7077 0.8698 0.7962 0.0210  0.1222  -0.1674 7   DT  T C4    
281  O O4    . DT  B 4   ? 0.7319 0.8214 0.7572 0.0101  0.1514  -0.1576 7   DT  T O4    
282  C C5    . DT  B 4   ? 0.6924 0.9186 0.8594 -0.0020 0.1169  -0.1836 7   DT  T C5    
283  C C7    . DT  B 4   ? 0.7194 0.9302 0.9030 -0.0461 0.1485  -0.1890 7   DT  T C7    
284  C C6    . DT  B 4   ? 0.6848 0.9777 0.9032 0.0146  0.0816  -0.1931 7   DT  T C6    
285  P P     . DG  B 5   ? 0.4845 0.8976 0.7355 0.0999  -0.0745 -0.2137 8   DG  T P     
286  O OP1   . DG  B 5   ? 0.4453 0.8914 0.7008 0.1242  -0.1011 -0.2143 8   DG  T OP1   
287  O OP2   . DG  B 5   ? 0.5105 0.8936 0.7535 0.0732  -0.0735 -0.2263 8   DG  T OP2   
288  O "O5'" . DG  B 5   ? 0.4640 0.8240 0.6614 0.1126  -0.0621 -0.1939 8   DG  T "O5'" 
289  C "C5'" . DG  B 5   ? 0.3919 0.7581 0.5834 0.1296  -0.0594 -0.1805 8   DG  T "C5'" 
290  C "C4'" . DG  B 5   ? 0.4925 0.8043 0.6342 0.1345  -0.0541 -0.1644 8   DG  T "C4'" 
291  O "O4'" . DG  B 5   ? 0.4491 0.7218 0.5720 0.1170  -0.0298 -0.1640 8   DG  T "O4'" 
292  C "C3'" . DG  B 5   ? 0.5153 0.8016 0.6312 0.1417  -0.0658 -0.1610 8   DG  T "C3'" 
293  O "O3'" . DG  B 5   ? 0.5748 0.8759 0.6870 0.1614  -0.0809 -0.1486 8   DG  T "O3'" 
294  C "C2'" . DG  B 5   ? 0.5682 0.7926 0.6425 0.1344  -0.0539 -0.1538 8   DG  T "C2'" 
295  C "C1'" . DG  B 5   ? 0.6010 0.8151 0.6739 0.1191  -0.0319 -0.1540 8   DG  T "C1'" 
296  N N9    . DG  B 5   ? 0.5965 0.7676 0.6504 0.0960  -0.0094 -0.1590 8   DG  T N9    
297  C C8    . DG  B 5   ? 0.6279 0.8043 0.7034 0.0747  -0.0036 -0.1734 8   DG  T C8    
298  N N7    . DG  B 5   ? 0.6514 0.7759 0.6991 0.0512  0.0206  -0.1730 8   DG  T N7    
299  C C5    . DG  B 5   ? 0.6878 0.7679 0.6867 0.0612  0.0314  -0.1573 8   DG  T C5    
300  C C6    . DG  B 5   ? 0.7622 0.7675 0.7022 0.0469  0.0585  -0.1485 8   DG  T C6    
301  O O6    . DG  B 5   ? 0.8362 0.8000 0.7594 0.0189  0.0825  -0.1516 8   DG  T O6    
302  N N1    . DG  B 5   ? 0.9646 0.9349 0.8546 0.0659  0.0555  -0.1342 8   DG  T N1    
303  C C2    . DG  B 5   ? 0.9212 0.9270 0.8238 0.0910  0.0289  -0.1294 8   DG  T C2    
304  N N2    . DG  B 5   ? 0.9841 0.9407 0.8280 0.1027  0.0245  -0.1170 8   DG  T N2    
305  N N3    . DG  B 5   ? 0.6995 0.7759 0.6606 0.1018  0.0073  -0.1360 8   DG  T N3    
306  C C4    . DG  B 5   ? 0.6534 0.7625 0.6571 0.0880  0.0105  -0.1497 8   DG  T C4    
307  P P     . DA  B 6   ? 0.7502 1.0384 0.8457 0.1769  -0.0889 -0.1411 9   DA  T P     
308  O OP1   . DA  B 6   ? 0.8103 1.1355 0.9201 0.1909  -0.0986 -0.1326 9   DA  T OP1   
309  O OP2   . DA  B 6   ? 0.8748 1.1377 0.9567 0.1721  -0.0838 -0.1551 9   DA  T OP2   
310  O "O5'" . DA  B 6   ? 0.6841 0.9347 0.7548 0.1796  -0.0904 -0.1258 9   DA  T "O5'" 
311  C "C5'" . DA  B 6   ? 0.6181 0.8638 0.6825 0.1753  -0.0941 -0.1163 9   DA  T "C5'" 
312  C "C4'" . DA  B 6   ? 0.5457 0.7496 0.5786 0.1799  -0.1040 -0.1029 9   DA  T "C4'" 
313  O "O4'" . DA  B 6   ? 0.5030 0.6507 0.4960 0.1692  -0.0893 -0.1073 9   DA  T "O4'" 
314  C "C3'" . DA  B 6   ? 0.5369 0.7467 0.5777 0.1979  -0.1147 -0.0960 9   DA  T "C3'" 
315  O "O3'" . DA  B 6   ? 0.5543 0.7662 0.5974 0.2057  -0.1364 -0.0794 9   DA  T "O3'" 
316  C "C2'" . DA  B 6   ? 0.6074 0.7617 0.6115 0.1974  -0.1040 -0.1030 9   DA  T "C2'" 
317  C "C1'" . DA  B 6   ? 0.5884 0.6978 0.5558 0.1790  -0.0944 -0.1032 9   DA  T "C1'" 
318  N N9    . DA  B 6   ? 0.6628 0.7279 0.6034 0.1634  -0.0720 -0.1139 9   DA  T N9    
319  C C8    . DA  B 6   ? 0.6291 0.7108 0.5920 0.1520  -0.0591 -0.1297 9   DA  T C8    
320  N N7    . DA  B 6   ? 0.6856 0.7170 0.6194 0.1320  -0.0399 -0.1359 9   DA  T N7    
321  C C5    . DA  B 6   ? 0.7491 0.7223 0.6304 0.1335  -0.0370 -0.1224 9   DA  T C5    
322  C C6    . DA  B 6   ? 0.7539 0.6484 0.5760 0.1170  -0.0160 -0.1189 9   DA  T C6    
323  N N6    . DA  B 6   ? 0.7922 0.6594 0.6090 0.0903  0.0082  -0.1291 9   DA  T N6    
324  N N1    . DA  B 6   ? 0.8018 0.6413 0.5651 0.1265  -0.0219 -0.1040 9   DA  T N1    
325  C C2    . DA  B 6   ? 0.7777 0.6450 0.5502 0.1477  -0.0507 -0.0947 9   DA  T C2    
326  N N3    . DA  B 6   ? 0.7108 0.6551 0.5450 0.1602  -0.0705 -0.0962 9   DA  T N3    
327  C C4    . DA  B 6   ? 0.6834 0.6761 0.5671 0.1536  -0.0600 -0.1098 9   DA  T C4    
328  P P     . DT  B 7   ? 0.5828 0.8210 0.6537 0.2293  -0.1488 -0.0689 10  DT  T P     
329  O OP1   . DT  B 7   ? 0.6671 0.9548 0.7796 0.2278  -0.1670 -0.0540 10  DT  T OP1   
330  O OP2   . DT  B 7   ? 0.6026 0.8504 0.6801 0.2410  -0.1296 -0.0806 10  DT  T OP2   
331  O "O5'" . DT  B 7   ? 0.5288 0.7052 0.5558 0.2389  -0.1627 -0.0630 10  DT  T "O5'" 
332  C "C5'" . DT  B 7   ? 0.5629 0.6944 0.5488 0.2267  -0.1785 -0.0567 10  DT  T "C5'" 
333  C "C4'" . DT  B 7   ? 0.6397 0.7012 0.5709 0.2403  -0.1901 -0.0515 10  DT  T "C4'" 
334  O "O4'" . DT  B 7   ? 0.7217 0.7225 0.6021 0.2297  -0.1610 -0.0630 10  DT  T "O4'" 
335  C "C3'" . DT  B 7   ? 0.6471 0.7286 0.6061 0.2724  -0.2039 -0.0446 10  DT  T "C3'" 
336  O "O3'" . DT  B 7   ? 0.6913 0.7548 0.6378 0.2865  -0.2422 -0.0297 10  DT  T "O3'" 
337  C "C2'" . DT  B 7   ? 0.6931 0.7124 0.6047 0.2794  -0.1800 -0.0552 10  DT  T "C2'" 
338  C "C1'" . DT  B 7   ? 0.8104 0.7639 0.6598 0.2500  -0.1635 -0.0610 10  DT  T "C1'" 
339  N N1    . DT  B 7   ? 0.8364 0.7529 0.6611 0.2347  -0.1299 -0.0760 10  DT  T N1    
340  C C2    . DT  B 7   ? 0.9877 0.8106 0.7373 0.2258  -0.1177 -0.0755 10  DT  T C2    
341  O O2    . DT  B 7   ? 1.0767 0.8381 0.7686 0.2339  -0.1331 -0.0631 10  DT  T O2    
342  N N3    . DT  B 7   ? 1.0475 0.8464 0.7876 0.2048  -0.0881 -0.0897 10  DT  T N3    
343  C C4    . DT  B 7   ? 0.8384 0.6953 0.6324 0.1943  -0.0755 -0.1054 10  DT  T C4    
344  O O4    . DT  B 7   ? 0.8272 0.6571 0.6103 0.1716  -0.0549 -0.1186 10  DT  T O4    
345  C C5    . DT  B 7   ? 0.7458 0.6927 0.6059 0.2094  -0.0901 -0.1049 10  DT  T C5    
346  C C7    . DT  B 7   ? 0.8488 0.8522 0.7552 0.2027  -0.0810 -0.1204 10  DT  T C7    
347  C C6    . DT  B 7   ? 0.7358 0.7081 0.6095 0.2271  -0.1134 -0.0897 10  DT  T C6    
348  P P     . DC  B 8   ? 0.7121 0.8042 0.6969 0.3270  -0.2645 -0.0193 11  DC  T P     
349  O OP1   . DC  B 8   ? 0.8760 1.0044 0.8963 0.3277  -0.3085 -0.0038 11  DC  T OP1   
350  O OP2   . DC  B 8   ? 0.6733 0.8246 0.7134 0.3412  -0.2353 -0.0265 11  DC  T OP2   
351  O "O5'" . DC  B 8   ? 0.8070 0.7909 0.7012 0.3446  -0.2655 -0.0200 11  DC  T "O5'" 
352  C "C5'" . DC  B 8   ? 0.8728 0.7668 0.6789 0.3270  -0.2745 -0.0176 11  DC  T "C5'" 
353  C "C4'" . DC  B 8   ? 1.0395 0.8262 0.7566 0.3383  -0.2603 -0.0195 11  DC  T "C4'" 
354  O "O4'" . DC  B 8   ? 0.9440 0.7163 0.6519 0.3153  -0.2133 -0.0354 11  DC  T "O4'" 
355  C "C3'" . DC  B 8   ? 1.0120 0.7866 0.7332 0.3853  -0.2790 -0.0127 11  DC  T "C3'" 
356  O "O3'" . DC  B 8   ? 1.1261 0.7917 0.7500 0.4003  -0.3022 -0.0022 11  DC  T "O3'" 
357  C "C2'" . DC  B 8   ? 1.0034 0.7661 0.7243 0.3857  -0.2369 -0.0277 11  DC  T "C2'" 
358  C "C1'" . DC  B 8   ? 1.0013 0.7196 0.6761 0.3375  -0.2032 -0.0386 11  DC  T "C1'" 
359  N N1    . DC  B 8   ? 0.9564 0.7006 0.6598 0.3188  -0.1661 -0.0567 11  DC  T N1    
360  C C2    . DC  B 8   ? 1.0133 0.6763 0.6545 0.2930  -0.1363 -0.0668 11  DC  T C2    
361  O O2    . DC  B 8   ? 1.1025 0.6692 0.6615 0.2869  -0.1352 -0.0589 11  DC  T O2    
362  N N3    . DC  B 8   ? 0.9775 0.6670 0.6480 0.2734  -0.1105 -0.0846 11  DC  T N3    
363  C C4    . DC  B 8   ? 0.8947 0.6777 0.6399 0.2825  -0.1122 -0.0915 11  DC  T C4    
364  N N4    . DC  B 8   ? 0.9268 0.7247 0.6881 0.2640  -0.0922 -0.1096 11  DC  T N4    
365  C C5    . DC  B 8   ? 0.8384 0.7006 0.6427 0.3086  -0.1354 -0.0797 11  DC  T C5    
366  C C6    . DC  B 8   ? 0.9059 0.7501 0.6931 0.3239  -0.1625 -0.0628 11  DC  T C6    
367  P P     . DG  B 9   ? 1.1963 0.8457 0.8180 0.4573  -0.3451 0.0115  12  DG  T P     
368  O OP1   . DG  B 9   ? 1.2761 0.8662 0.8345 0.4510  -0.3817 0.0229  12  DG  T OP1   
369  O OP2   . DG  B 9   ? 1.1087 0.8933 0.8613 0.4701  -0.3432 0.0102  12  DG  T OP2   
370  O "O5'" . DG  B 9   ? 1.3616 0.9029 0.9009 0.4736  -0.3157 0.0058  12  DG  T "O5'" 
371  C "C5'" . DG  B 9   ? 1.4460 0.8605 0.8682 0.4433  -0.2912 0.0041  12  DG  T "C5'" 
372  C "C4'" . DG  B 9   ? 1.4982 0.8303 0.8666 0.4522  -0.2599 -0.0039 12  DG  T "C4'" 
373  O "O4'" . DG  B 9   ? 1.4263 0.8172 0.8518 0.4196  -0.2177 -0.0230 12  DG  T "O4'" 
374  C "C3'" . DG  B 9   ? 1.5672 0.8974 0.9504 0.5159  -0.2842 0.0011  12  DG  T "C3'" 
375  O "O3'" . DG  B 9   ? 1.8046 0.9901 1.0668 0.5383  -0.2957 0.0112  12  DG  T "O3'" 
376  C "C2'" . DG  B 9   ? 1.4817 0.8536 0.9149 0.5158  -0.2467 -0.0175 12  DG  T "C2'" 
377  C "C1'" . DG  B 9   ? 1.3670 0.7510 0.8037 0.4495  -0.2071 -0.0320 12  DG  T "C1'" 
378  N N9    . DG  B 9   ? 1.2566 0.7601 0.7947 0.4390  -0.1897 -0.0459 12  DG  T N9    
379  C C8    . DG  B 9   ? 1.1937 0.8218 0.8338 0.4619  -0.2062 -0.0419 12  DG  T C8    
380  N N7    . DG  B 9   ? 1.1115 0.8150 0.8126 0.4447  -0.1816 -0.0556 12  DG  T N7    
381  C C5    . DG  B 9   ? 1.1349 0.7653 0.7773 0.4085  -0.1521 -0.0711 12  DG  T C5    
382  C C6    . DG  B 9   ? 1.1127 0.7733 0.7791 0.3781  -0.1246 -0.0905 12  DG  T C6    
383  O O6    . DG  B 9   ? 1.0214 0.7730 0.7562 0.3798  -0.1183 -0.0973 12  DG  T O6    
384  N N1    . DG  B 9   ? 1.3000 0.8692 0.8985 0.3415  -0.1045 -0.1016 12  DG  T N1    
385  C C2    . DG  B 9   ? 1.4443 0.9005 0.9560 0.3340  -0.1043 -0.0932 12  DG  T C2    
386  N N2    . DG  B 9   ? 1.5169 0.8992 0.9784 0.2909  -0.0794 -0.1047 12  DG  T N2    
387  N N3    . DG  B 9   ? 1.4445 0.8606 0.9195 0.3651  -0.1284 -0.0743 12  DG  T N3    
388  C C4    . DG  B 9   ? 1.2840 0.7945 0.8308 0.4020  -0.1543 -0.0649 12  DG  T C4    
389  P P     . DC  B 10  ? 1.9862 1.1521 1.2441 0.5818  -0.2976 0.0083  13  DC  T P     
390  O OP1   . DC  B 10  ? 2.1729 1.2454 1.3399 0.5943  -0.3238 0.0205  13  DC  T OP1   
391  O OP2   . DC  B 10  ? 1.8591 1.1797 1.2561 0.6071  -0.3026 0.0037  13  DC  T OP2   
392  O "O5'" . DC  B 10  ? 2.0618 1.1198 1.2459 0.5692  -0.2538 -0.0052 13  DC  T "O5'" 
393  C "C5'" . DC  B 10  ? 2.0817 1.0108 1.1570 0.5222  -0.2278 -0.0046 13  DC  T "C5'" 
394  C "C4'" . DC  B 10  ? 2.0634 0.9207 1.0981 0.4981  -0.1863 -0.0223 13  DC  T "C4'" 
395  O "O4'" . DC  B 10  ? 1.8993 0.8747 1.0348 0.4604  -0.1597 -0.0423 13  DC  T "O4'" 
396  C "C3'" . DC  B 10  ? 2.0894 0.9061 1.1011 0.5493  -0.1926 -0.0264 13  DC  T "C3'" 
397  O "O3'" . DC  B 10  ? 2.3304 0.9940 1.2214 0.5246  -0.1700 -0.0283 13  DC  T "O3'" 
398  C "C2'" . DC  B 10  ? 1.9301 0.8470 1.0377 0.5582  -0.1762 -0.0470 13  DC  T "C2'" 
399  C "C1'" . DC  B 10  ? 1.8841 0.8455 1.0243 0.4812  -0.1467 -0.0588 13  DC  T "C1'" 
400  N N1    . DC  B 10  ? 1.7118 0.8228 0.9715 0.4733  -0.1376 -0.0738 13  DC  T N1    
401  C C2    . DC  B 10  ? 1.7227 0.8410 0.9942 0.4269  -0.1078 -0.0960 13  DC  T C2    
402  O O2    . DC  B 10  ? 1.9085 0.9163 1.1012 0.3886  -0.0889 -0.1035 13  DC  T O2    
403  N N3    . DC  B 10  ? 1.5143 0.7583 0.8815 0.4236  -0.1022 -0.1081 13  DC  T N3    
404  C C4    . DC  B 10  ? 1.4149 0.7729 0.8656 0.4602  -0.1197 -0.0979 13  DC  T C4    
405  N N4    . DC  B 10  ? 1.2796 0.7484 0.8127 0.4540  -0.1102 -0.1084 13  DC  T N4    
406  C C5    . DC  B 10  ? 1.4063 0.7673 0.8583 0.5029  -0.1499 -0.0759 13  DC  T C5    
407  C C6    . DC  B 10  ? 1.5297 0.7662 0.8842 0.5099  -0.1605 -0.0651 13  DC  T C6    
408  P P     . DA  B 11  ? 2.4992 1.1079 1.3505 0.5556  -0.1641 -0.0373 14  DA  T P     
409  O OP1   . DA  B 11  ? 2.6543 1.1010 1.3678 0.5315  -0.1534 -0.0290 14  DA  T OP1   
410  O OP2   . DA  B 11  ? 2.4363 1.1507 1.3661 0.6214  -0.1925 -0.0331 14  DA  T OP2   
411  O "O5'" . DA  B 11  ? 2.4392 1.0724 1.3316 0.5257  -0.1326 -0.0634 14  DA  T "O5'" 
412  C "C5'" . DA  B 11  ? 2.5328 1.0853 1.3670 0.5238  -0.1160 -0.0767 14  DA  T "C5'" 
413  C "C4'" . DA  B 11  ? 2.5169 1.0541 1.3579 0.4611  -0.0867 -0.1009 14  DA  T "C4'" 
414  O "O4'" . DA  B 11  ? 2.3715 1.0407 1.3213 0.4563  -0.0862 -0.1126 14  DA  T "O4'" 
415  C "C3'" . DA  B 11  ? 2.5531 1.0551 1.3708 0.4657  -0.0759 -0.1204 14  DA  T "C3'" 
416  O "O3'" . DA  B 11  ? 2.5313 0.9743 1.3199 0.3912  -0.0541 -0.1392 14  DA  T "O3'" 
417  C "C2'" . DA  B 11  ? 2.4538 1.0997 1.3791 0.5088  -0.0810 -0.1313 14  DA  T "C2'" 
418  C "C1'" . DA  B 11  ? 2.3425 1.0895 1.3505 0.4897  -0.0850 -0.1285 14  DA  T "C1'" 
419  N N9    . DA  B 11  ? 2.2626 1.1419 1.3643 0.5458  -0.1040 -0.1152 14  DA  T N9    
420  C C8    . DA  B 11  ? 2.2897 1.1872 1.3967 0.5891  -0.1288 -0.0912 14  DA  T C8    
421  N N7    . DA  B 11  ? 2.1850 1.2258 1.4003 0.6231  -0.1421 -0.0841 14  DA  T N7    
422  C C5    . DA  B 11  ? 2.0785 1.1948 1.3558 0.6049  -0.1225 -0.1028 14  DA  T C5    
423  C C6    . DA  B 11  ? 1.9175 1.1875 1.3107 0.6185  -0.1204 -0.1039 14  DA  T C6    
424  N N6    . DA  B 11  ? 1.8492 1.2320 1.3287 0.6483  -0.1381 -0.0852 14  DA  T N6    
425  N N1    . DA  B 11  ? 1.8506 1.1575 1.2694 0.5907  -0.0991 -0.1248 14  DA  T N1    
426  C C2    . DA  B 11  ? 1.8957 1.1102 1.2434 0.5418  -0.0840 -0.1433 14  DA  T C2    
427  N N3    . DA  B 11  ? 2.0188 1.0904 1.2643 0.5204  -0.0831 -0.1450 14  DA  T N3    
428  C C4    . DA  B 11  ? 2.1219 1.1399 1.3290 0.5594  -0.1013 -0.1240 14  DA  T C4    
429  N N     . ALA C 4   ? 0.9193 0.7491 0.8046 -0.0542 0.0628  -0.1474 300 ALA A N     
430  C CA    . ALA C 4   ? 0.9109 0.7500 0.7681 -0.0623 0.0588  -0.1555 300 ALA A CA    
431  C C     . ALA C 4   ? 0.7889 0.6481 0.6328 -0.0620 0.0483  -0.1450 300 ALA A C     
432  O O     . ALA C 4   ? 0.7292 0.5995 0.5744 -0.0665 0.0343  -0.1386 300 ALA A O     
433  C CB    . ALA C 4   ? 0.9689 0.8054 0.8166 -0.0760 0.0505  -0.1663 300 ALA A CB    
434  N N     . PHE C 5   ? 0.5989 0.4631 0.4316 -0.0567 0.0556  -0.1429 301 PHE A N     
435  C CA    . PHE C 5   ? 0.6306 0.5112 0.4494 -0.0560 0.0475  -0.1320 301 PHE A CA    
436  C C     . PHE C 5   ? 0.6403 0.5231 0.4365 -0.0569 0.0553  -0.1352 301 PHE A C     
437  O O     . PHE C 5   ? 0.6099 0.4825 0.4061 -0.0560 0.0692  -0.1454 301 PHE A O     
438  C CB    . PHE C 5   ? 0.5122 0.3971 0.3505 -0.0459 0.0497  -0.1197 301 PHE A CB    
439  C CG    . PHE C 5   ? 0.4626 0.3422 0.3160 -0.0354 0.0662  -0.1199 301 PHE A CG    
440  C CD1   . PHE C 5   ? 0.4966 0.3844 0.3408 -0.0326 0.0733  -0.1167 301 PHE A CD1   
441  C CD2   . PHE C 5   ? 0.5203 0.3878 0.3994 -0.0282 0.0741  -0.1220 301 PHE A CD2   
442  C CE1   . PHE C 5   ? 0.4720 0.3591 0.3350 -0.0233 0.0877  -0.1171 301 PHE A CE1   
443  C CE2   . PHE C 5   ? 0.4861 0.3524 0.3834 -0.0173 0.0872  -0.1211 301 PHE A CE2   
444  C CZ    . PHE C 5   ? 0.4952 0.3728 0.3857 -0.0151 0.0939  -0.1193 301 PHE A CZ    
445  N N     . THR C 6   ? 0.6097 0.5054 0.3874 -0.0587 0.0467  -0.1254 302 THR A N     
446  C CA    . THR C 6   ? 0.6626 0.5606 0.4152 -0.0610 0.0526  -0.1259 302 THR A CA    
447  C C     . THR C 6   ? 0.6439 0.5452 0.4062 -0.0528 0.0648  -0.1175 302 THR A C     
448  O O     . THR C 6   ? 0.6132 0.5227 0.3822 -0.0488 0.0587  -0.1045 302 THR A O     
449  C CB    . THR C 6   ? 0.7112 0.6200 0.4379 -0.0674 0.0354  -0.1182 302 THR A CB    
450  O OG1   . THR C 6   ? 0.7276 0.6362 0.4480 -0.0755 0.0234  -0.1271 302 THR A OG1   
451  C CG2   . THR C 6   ? 0.6619 0.5714 0.3603 -0.0701 0.0420  -0.1169 302 THR A CG2   
452  N N     . LEU C 7   ? 0.6787 0.5744 0.4430 -0.0507 0.0822  -0.1254 303 LEU A N     
453  C CA    . LEU C 7   ? 0.7710 0.6726 0.5432 -0.0450 0.0943  -0.1187 303 LEU A CA    
454  C C     . LEU C 7   ? 0.8126 0.7186 0.5523 -0.0519 0.0930  -0.1136 303 LEU A C     
455  O O     . LEU C 7   ? 0.7880 0.6896 0.5101 -0.0567 0.1030  -0.1223 303 LEU A O     
456  C CB    . LEU C 7   ? 0.8086 0.7046 0.6015 -0.0393 0.1130  -0.1290 303 LEU A CB    
457  C CG    . LEU C 7   ? 0.7931 0.6941 0.6234 -0.0277 0.1184  -0.1231 303 LEU A CG    
458  C CD1   . LEU C 7   ? 0.8748 0.7653 0.7303 -0.0211 0.1245  -0.1322 303 LEU A CD1   
459  C CD2   . LEU C 7   ? 0.7688 0.6797 0.6070 -0.0246 0.1313  -0.1194 303 LEU A CD2   
460  N N     . ALA C 8   ? 0.8081 0.7218 0.5394 -0.0523 0.0808  -0.0988 304 ALA A N     
461  C CA    . ALA C 8   ? 0.8805 0.7970 0.5798 -0.0583 0.0757  -0.0910 304 ALA A CA    
462  C C     . ALA C 8   ? 0.8636 0.7815 0.5609 -0.0576 0.0915  -0.0861 304 ALA A C     
463  O O     . ALA C 8   ? 0.8618 0.7842 0.5838 -0.0517 0.0984  -0.0805 304 ALA A O     
464  C CB    . ALA C 8   ? 0.8864 0.8096 0.5805 -0.0578 0.0559  -0.0757 304 ALA A CB    
465  N N     . ASP C 9   ? 0.8568 0.7715 0.5247 -0.0643 0.0972  -0.0888 305 ASP A N     
466  C CA    . ASP C 9   ? 0.9504 0.8663 0.6110 -0.0659 0.1113  -0.0830 305 ASP A CA    
467  C C     . ASP C 9   ? 0.9095 0.8273 0.5482 -0.0683 0.1006  -0.0645 305 ASP A C     
468  O O     . ASP C 9   ? 0.9214 0.8397 0.5572 -0.0696 0.1112  -0.0566 305 ASP A O     
469  C CB    . ASP C 9   ? 1.0047 0.9147 0.6442 -0.0722 0.1262  -0.0965 305 ASP A CB    
470  C CG    . ASP C 9   ? 1.1897 1.1019 0.8410 -0.0717 0.1479  -0.0978 305 ASP A CG    
471  O OD1   . ASP C 9   ? 1.1996 1.1154 0.8870 -0.0650 0.1582  -0.1039 305 ASP A OD1   
472  O OD2   . ASP C 9   ? 1.2664 1.1773 0.8918 -0.0779 0.1546  -0.0923 305 ASP A OD2   
473  N N     . ARG C 10  ? 0.8091 0.7283 0.4352 -0.0686 0.0798  -0.0573 306 ARG A N     
474  C CA    . ARG C 10  ? 0.8891 0.8096 0.4957 -0.0691 0.0676  -0.0387 306 ARG A CA    
475  C C     . ARG C 10  ? 0.7655 0.6912 0.3828 -0.0646 0.0457  -0.0310 306 ARG A C     
476  O O     . ARG C 10  ? 0.6510 0.5790 0.2758 -0.0648 0.0374  -0.0416 306 ARG A O     
477  C CB    . ARG C 10  ? 0.9962 0.9132 0.5613 -0.0763 0.0655  -0.0383 306 ARG A CB    
478  C CG    . ARG C 10  ? 1.1773 1.0939 0.7216 -0.0760 0.0558  -0.0172 306 ARG A CG    
479  C CD    . ARG C 10  ? 1.3241 1.2386 0.8253 -0.0823 0.0496  -0.0164 306 ARG A CD    
480  N NE    . ARG C 10  ? 1.3946 1.3154 0.8873 -0.0799 0.0241  -0.0093 306 ARG A NE    
481  C CZ    . ARG C 10  ? 1.3936 1.3176 0.8917 -0.0734 0.0091  0.0103  306 ARG A CZ    
482  N NH1   . ARG C 10  ? 1.3939 1.3134 0.9044 -0.0696 0.0174  0.0245  306 ARG A NH1   
483  N NH2   . ARG C 10  ? 1.3717 1.3038 0.8655 -0.0706 -0.0141 0.0154  306 ARG A NH2   
484  N N     . VAL C 11  ? 0.6808 0.6080 0.3002 -0.0609 0.0371  -0.0127 307 VAL A N     
485  C CA    . VAL C 11  ? 0.6299 0.5630 0.2612 -0.0558 0.0166  -0.0039 307 VAL A CA    
486  C C     . VAL C 11  ? 0.6615 0.5990 0.2681 -0.0582 -0.0013 -0.0015 307 VAL A C     
487  O O     . VAL C 11  ? 0.6760 0.6109 0.2546 -0.0604 -0.0028 0.0075  307 VAL A O     
488  C CB    . VAL C 11  ? 0.7039 0.6356 0.3472 -0.0503 0.0145  0.0148  307 VAL A CB    
489  C CG1   . VAL C 11  ? 0.6981 0.6360 0.3493 -0.0446 -0.0077 0.0258  307 VAL A CG1   
490  C CG2   . VAL C 11  ? 0.6136 0.5440 0.2861 -0.0478 0.0280  0.0109  307 VAL A CG2   
491  N N     . THR C 12  ? 0.6731 0.6179 0.2905 -0.0579 -0.0152 -0.0093 308 THR A N     
492  C CA    . THR C 12  ? 0.7471 0.6995 0.3468 -0.0601 -0.0343 -0.0084 308 THR A CA    
493  C C     . THR C 12  ? 0.7068 0.6701 0.3277 -0.0530 -0.0544 0.0039  308 THR A C     
494  O O     . THR C 12  ? 0.6734 0.6377 0.3231 -0.0478 -0.0532 0.0074  308 THR A O     
495  C CB    . THR C 12  ? 0.7134 0.6668 0.3092 -0.0673 -0.0344 -0.0295 308 THR A CB    
496  O OG1   . THR C 12  ? 0.7390 0.6943 0.3674 -0.0656 -0.0338 -0.0383 308 THR A OG1   
497  C CG2   . THR C 12  ? 0.7117 0.6540 0.2876 -0.0736 -0.0139 -0.0421 308 THR A CG2   
498  N N     . GLU C 13  ? 0.7238 0.6960 0.3304 -0.0525 -0.0731 0.0101  309 GLU A N     
499  C CA    . GLU C 13  ? 0.7266 0.7112 0.3551 -0.0444 -0.0925 0.0228  309 GLU A CA    
500  C C     . GLU C 13  ? 0.6674 0.6612 0.3303 -0.0443 -0.0975 0.0122  309 GLU A C     
501  O O     . GLU C 13  ? 0.7026 0.7025 0.3942 -0.0368 -0.1035 0.0213  309 GLU A O     
502  C CB    . GLU C 13  ? 0.9211 0.9157 0.5288 -0.0441 -0.1122 0.0289  309 GLU A CB    
503  C CG    . GLU C 13  ? 1.1075 1.1199 0.7430 -0.0365 -0.1340 0.0364  309 GLU A CG    
504  C CD    . GLU C 13  ? 1.2653 1.2758 0.9208 -0.0243 -0.1358 0.0568  309 GLU A CD    
505  O OE1   . GLU C 13  ? 1.3130 1.3077 0.9569 -0.0225 -0.1216 0.0665  309 GLU A OE1   
506  O OE2   . GLU C 13  ? 1.2993 1.3239 0.9841 -0.0167 -0.1504 0.0624  309 GLU A OE2   
507  N N     . GLU C 14  ? 0.5583 0.5524 0.2194 -0.0528 -0.0942 -0.0072 310 GLU A N     
508  C CA    . GLU C 14  ? 0.5995 0.6018 0.2921 -0.0540 -0.0990 -0.0171 310 GLU A CA    
509  C C     . GLU C 14  ? 0.6358 0.6307 0.3521 -0.0503 -0.0854 -0.0166 310 GLU A C     
510  O O     . GLU C 14  ? 0.5817 0.5840 0.3264 -0.0494 -0.0901 -0.0197 310 GLU A O     
511  C CB    . GLU C 14  ? 0.5964 0.5971 0.2807 -0.0645 -0.0973 -0.0380 310 GLU A CB    
512  C CG    . GLU C 14  ? 0.7705 0.7534 0.4423 -0.0692 -0.0750 -0.0509 310 GLU A CG    
513  C CD    . GLU C 14  ? 0.9198 0.8988 0.5886 -0.0788 -0.0728 -0.0717 310 GLU A CD    
514  O OE1   . GLU C 14  ? 0.9504 0.9410 0.6244 -0.0831 -0.0893 -0.0763 310 GLU A OE1   
515  O OE2   . GLU C 14  ? 0.9136 0.8780 0.5772 -0.0817 -0.0542 -0.0837 310 GLU A OE2   
516  N N     . MET C 15  ? 0.6127 0.5942 0.3186 -0.0486 -0.0686 -0.0129 311 MET A N     
517  C CA    . MET C 15  ? 0.5402 0.5159 0.2675 -0.0443 -0.0575 -0.0107 311 MET A CA    
518  C C     . MET C 15  ? 0.4752 0.4559 0.2197 -0.0357 -0.0663 0.0070  311 MET A C     
519  O O     . MET C 15  ? 0.5429 0.5202 0.3063 -0.0321 -0.0599 0.0091  311 MET A O     
520  C CB    . MET C 15  ? 0.6324 0.5945 0.3467 -0.0453 -0.0366 -0.0131 311 MET A CB    
521  C CG    . MET C 15  ? 0.7198 0.6757 0.4167 -0.0523 -0.0257 -0.0293 311 MET A CG    
522  S SD    . MET C 15  ? 0.6886 0.6329 0.3789 -0.0520 -0.0005 -0.0311 311 MET A SD    
523  C CE    . MET C 15  ? 0.7750 0.7135 0.4459 -0.0597 0.0090  -0.0507 311 MET A CE    
524  N N     . LEU C 16  ? 0.4852 0.4733 0.2240 -0.0317 -0.0805 0.0194  312 LEU A N     
525  C CA    . LEU C 16  ? 0.5665 0.5566 0.3215 -0.0220 -0.0875 0.0370  312 LEU A CA    
526  C C     . LEU C 16  ? 0.6013 0.6096 0.3816 -0.0171 -0.1063 0.0399  312 LEU A C     
527  O O     . LEU C 16  ? 0.6207 0.6343 0.4062 -0.0091 -0.1172 0.0538  312 LEU A O     
528  C CB    . LEU C 16  ? 0.6081 0.5900 0.3390 -0.0192 -0.0865 0.0514  312 LEU A CB    
529  C CG    . LEU C 16  ? 0.6217 0.5894 0.3260 -0.0256 -0.0679 0.0474  312 LEU A CG    
530  C CD1   . LEU C 16  ? 0.6749 0.6355 0.3541 -0.0239 -0.0683 0.0626  312 LEU A CD1   
531  C CD2   . LEU C 16  ? 0.5798 0.5380 0.2994 -0.0254 -0.0513 0.0451  312 LEU A CD2   
532  N N     . ALA C 17  ? 0.5846 0.6027 0.3829 -0.0218 -0.1092 0.0267  313 ALA A N     
533  C CA    . ALA C 17  ? 0.5363 0.5741 0.3655 -0.0182 -0.1243 0.0277  313 ALA A CA    
534  C C     . ALA C 17  ? 0.4229 0.4620 0.2819 -0.0076 -0.1238 0.0396  313 ALA A C     
535  O O     . ALA C 17  ? 0.5901 0.6142 0.4475 -0.0052 -0.1116 0.0438  313 ALA A O     
536  C CB    . ALA C 17  ? 0.5340 0.5794 0.3772 -0.0272 -0.1240 0.0105  313 ALA A CB    
537  N N     . ASP C 18  ? 0.3209 0.3784 0.2090 -0.0012 -0.1365 0.0440  314 ASP A N     
538  C CA    . ASP C 18  ? 0.4644 0.5235 0.3839 0.0101  -0.1352 0.0540  314 ASP A CA    
539  C C     . ASP C 18  ? 0.3618 0.4245 0.3096 0.0082  -0.1277 0.0457  314 ASP A C     
540  O O     . ASP C 18  ? 0.3393 0.4034 0.3151 0.0172  -0.1246 0.0514  314 ASP A O     
541  C CB    . ASP C 18  ? 0.7320 0.8100 0.6738 0.0193  -0.1497 0.0616  314 ASP A CB    
542  C CG    . ASP C 18  ? 0.9395 1.0411 0.8917 0.0125  -0.1616 0.0506  314 ASP A CG    
543  O OD1   . ASP C 18  ? 0.9839 1.0873 0.9370 0.0015  -0.1568 0.0365  314 ASP A OD1   
544  O OD2   . ASP C 18  ? 1.0229 1.1406 0.9823 0.0179  -0.1757 0.0559  314 ASP A OD2   
545  N N     . LYS C 19  ? 0.3401 0.4028 0.2813 -0.0030 -0.1238 0.0320  315 LYS A N     
546  C CA    . LYS C 19  ? 0.3937 0.4539 0.3567 -0.0039 -0.1084 0.0227  315 LYS A CA    
547  C C     . LYS C 19  ? 0.2891 0.3341 0.2282 -0.0127 -0.0961 0.0114  315 LYS A C     
548  O O     . LYS C 19  ? 0.3660 0.4114 0.2852 -0.0219 -0.1016 0.0038  315 LYS A O     
549  C CB    . LYS C 19  ? 0.4174 0.4990 0.4149 -0.0063 -0.1137 0.0160  315 LYS A CB    
550  C CG    . LYS C 19  ? 0.4908 0.5684 0.5086 -0.0067 -0.0966 0.0088  315 LYS A CG    
551  C CD    . LYS C 19  ? 0.5038 0.6031 0.5588 -0.0080 -0.0994 0.0046  315 LYS A CD    
552  C CE    . LYS C 19  ? 0.4592 0.5523 0.5279 -0.0096 -0.0814 -0.0012 315 LYS A CE    
553  N NZ    . LYS C 19  ? 0.4751 0.5587 0.5473 0.0003  -0.0708 0.0049  315 LYS A NZ    
554  N N     . ALA C 20  ? 0.2550 0.2872 0.1968 -0.0099 -0.0798 0.0099  316 ALA A N     
555  C CA    . ALA C 20  ? 0.3358 0.3540 0.2592 -0.0158 -0.0679 0.0006  316 ALA A CA    
556  C C     . ALA C 20  ? 0.4142 0.4255 0.3524 -0.0118 -0.0535 -0.0007 316 ALA A C     
557  O O     . ALA C 20  ? 0.2816 0.2933 0.2317 -0.0050 -0.0505 0.0065  316 ALA A O     
558  C CB    . ALA C 20  ? 0.2810 0.2874 0.1714 -0.0172 -0.0659 0.0037  316 ALA A CB    
559  N N     . ALA C 21  ? 0.2673 0.2717 0.2043 -0.0163 -0.0450 -0.0099 317 ALA A N     
560  C CA    . ALA C 21  ? 0.2989 0.2951 0.2419 -0.0125 -0.0324 -0.0099 317 ALA A CA    
561  C C     . ALA C 21  ? 0.3196 0.3062 0.2438 -0.0112 -0.0256 -0.0090 317 ALA A C     
562  O O     . ALA C 21  ? 0.2957 0.2769 0.2002 -0.0158 -0.0251 -0.0142 317 ALA A O     
563  C CB    . ALA C 21  ? 0.2029 0.1938 0.1530 -0.0162 -0.0263 -0.0178 317 ALA A CB    
564  N N     . LEU C 22  ? 0.2978 0.2830 0.2277 -0.0061 -0.0198 -0.0034 318 LEU A N     
565  C CA    . LEU C 22  ? 0.3118 0.2903 0.2280 -0.0057 -0.0123 -0.0020 318 LEU A CA    
566  C C     . LEU C 22  ? 0.3041 0.2817 0.2326 -0.0029 -0.0025 -0.0040 318 LEU A C     
567  O O     . LEU C 22  ? 0.2605 0.2424 0.2048 0.0001  -0.0030 -0.0016 318 LEU A O     
568  C CB    . LEU C 22  ? 0.3000 0.2779 0.2109 -0.0037 -0.0158 0.0080  318 LEU A CB    
569  C CG    . LEU C 22  ? 0.2953 0.2663 0.1966 -0.0043 -0.0061 0.0110  318 LEU A CG    
570  C CD1   . LEU C 22  ? 0.2346 0.1996 0.1104 -0.0095 -0.0013 0.0078  318 LEU A CD1   
571  C CD2   . LEU C 22  ? 0.3331 0.3008 0.2360 -0.0016 -0.0092 0.0217  318 LEU A CD2   
572  N N     . VAL C 23  ? 0.3060 0.2791 0.2272 -0.0038 0.0063  -0.0088 319 VAL A N     
573  C CA    . VAL C 23  ? 0.2813 0.2564 0.2162 -0.0004 0.0145  -0.0103 319 VAL A CA    
574  C C     . VAL C 23  ? 0.3311 0.3059 0.2591 -0.0020 0.0227  -0.0092 319 VAL A C     
575  O O     . VAL C 23  ? 0.2763 0.2461 0.1879 -0.0053 0.0284  -0.0131 319 VAL A O     
576  C CB    . VAL C 23  ? 0.3183 0.2893 0.2584 0.0011  0.0192  -0.0177 319 VAL A CB    
577  C CG1   . VAL C 23  ? 0.2539 0.2293 0.2092 0.0059  0.0270  -0.0182 319 VAL A CG1   
578  C CG2   . VAL C 23  ? 0.3653 0.3354 0.3142 0.0016  0.0129  -0.0172 319 VAL A CG2   
579  N N     . VAL C 24  ? 0.3481 0.3279 0.2872 -0.0009 0.0240  -0.0047 320 VAL A N     
580  C CA    . VAL C 24  ? 0.3171 0.2981 0.2555 -0.0036 0.0334  -0.0039 320 VAL A CA    
581  C C     . VAL C 24  ? 0.2708 0.2626 0.2325 -0.0006 0.0372  -0.0071 320 VAL A C     
582  O O     . VAL C 24  ? 0.3256 0.3235 0.2999 0.0000  0.0329  -0.0045 320 VAL A O     
583  C CB    . VAL C 24  ? 0.3371 0.3138 0.2701 -0.0064 0.0314  0.0041  320 VAL A CB    
584  C CG1   . VAL C 24  ? 0.2899 0.2666 0.2227 -0.0111 0.0429  0.0048  320 VAL A CG1   
585  C CG2   . VAL C 24  ? 0.2857 0.2536 0.1976 -0.0074 0.0242  0.0093  320 VAL A CG2   
586  N N     . GLU C 25  ? 0.3099 0.3046 0.2776 0.0016  0.0446  -0.0131 321 GLU A N     
587  C CA    . GLU C 25  ? 0.3106 0.3165 0.3025 0.0070  0.0449  -0.0150 321 GLU A CA    
588  C C     . GLU C 25  ? 0.3106 0.3295 0.3184 0.0046  0.0509  -0.0152 321 GLU A C     
589  O O     . GLU C 25  ? 0.2906 0.3107 0.2971 0.0013  0.0626  -0.0185 321 GLU A O     
590  C CB    . GLU C 25  ? 0.2473 0.2500 0.2437 0.0120  0.0509  -0.0214 321 GLU A CB    
591  C CG    . GLU C 25  ? 0.3049 0.3178 0.3274 0.0200  0.0489  -0.0208 321 GLU A CG    
592  C CD    . GLU C 25  ? 0.4532 0.4618 0.4758 0.0233  0.0374  -0.0155 321 GLU A CD    
593  O OE1   . GLU C 25  ? 0.3772 0.3803 0.3854 0.0188  0.0309  -0.0124 321 GLU A OE1   
594  O OE2   . GLU C 25  ? 0.3659 0.3761 0.4036 0.0307  0.0355  -0.0139 321 GLU A OE2   
595  N N     . VAL C 26  ? 0.2792 0.3083 0.3015 0.0050  0.0435  -0.0125 322 VAL A N     
596  C CA    . VAL C 26  ? 0.2199 0.2651 0.2625 0.0020  0.0467  -0.0139 322 VAL A CA    
597  C C     . VAL C 26  ? 0.2974 0.3577 0.3621 0.0093  0.0396  -0.0140 322 VAL A C     
598  O O     . VAL C 26  ? 0.2826 0.3428 0.3450 0.0114  0.0285  -0.0105 322 VAL A O     
599  C CB    . VAL C 26  ? 0.2385 0.2824 0.2775 -0.0054 0.0432  -0.0116 322 VAL A CB    
600  C CG1   . VAL C 26  ? 0.1957 0.2580 0.2580 -0.0103 0.0451  -0.0148 322 VAL A CG1   
601  C CG2   . VAL C 26  ? 0.2229 0.2501 0.2408 -0.0110 0.0496  -0.0087 322 VAL A CG2   
602  N N     . VAL C 27  ? 0.2641 0.3371 0.3501 0.0136  0.0462  -0.0175 323 VAL A N     
603  C CA    . VAL C 27  ? 0.3118 0.3978 0.4199 0.0231  0.0386  -0.0156 323 VAL A CA    
604  C C     . VAL C 27  ? 0.2675 0.3773 0.3974 0.0208  0.0300  -0.0145 323 VAL A C     
605  O O     . VAL C 27  ? 0.2206 0.3387 0.3578 0.0263  0.0170  -0.0096 323 VAL A O     
606  C CB    . VAL C 27  ? 0.3520 0.4403 0.4767 0.0312  0.0495  -0.0200 323 VAL A CB    
607  C CG1   . VAL C 27  ? 0.4016 0.5039 0.5536 0.0429  0.0408  -0.0160 323 VAL A CG1   
608  C CG2   . VAL C 27  ? 0.3701 0.4339 0.4707 0.0324  0.0560  -0.0226 323 VAL A CG2   
609  N N     . GLU C 28  ? 0.2360 0.3569 0.3755 0.0117  0.0367  -0.0189 324 GLU A N     
610  C CA    . GLU C 28  ? 0.2949 0.4386 0.4540 0.0064  0.0280  -0.0200 324 GLU A CA    
611  C C     . GLU C 28  ? 0.2612 0.3981 0.4013 0.0030  0.0142  -0.0167 324 GLU A C     
612  O O     . GLU C 28  ? 0.2881 0.4043 0.4029 -0.0017 0.0164  -0.0162 324 GLU A O     
613  C CB    . GLU C 28  ? 0.3534 0.5030 0.5201 -0.0062 0.0395  -0.0257 324 GLU A CB    
614  C CG    . GLU C 28  ? 0.5695 0.7197 0.7452 -0.0060 0.0578  -0.0295 324 GLU A CG    
615  C CD    . GLU C 28  ? 0.8060 0.9878 1.0238 -0.0033 0.0610  -0.0339 324 GLU A CD    
616  O OE1   . GLU C 28  ? 0.8949 1.0975 1.1343 0.0022  0.0458  -0.0321 324 GLU A OE1   
617  O OE2   . GLU C 28  ? 0.8541 1.0361 1.0765 -0.0065 0.0764  -0.0372 324 GLU A OE2   
618  N N     . GLU C 29  ? 0.3003 0.4560 0.4531 0.0054  -0.0001 -0.0147 325 GLU A N     
619  C CA    . GLU C 29  ? 0.3552 0.5054 0.4877 0.0017  -0.0121 -0.0126 325 GLU A CA    
620  C C     . GLU C 29  ? 0.3123 0.4545 0.4328 -0.0118 -0.0077 -0.0191 325 GLU A C     
621  O O     . GLU C 29  ? 0.2999 0.4223 0.3962 -0.0140 -0.0072 -0.0186 325 GLU A O     
622  C CB    . GLU C 29  ? 0.4476 0.6224 0.5944 0.0044  -0.0286 -0.0096 325 GLU A CB    
623  C CG    . GLU C 29  ? 0.7075 0.8838 0.8604 0.0193  -0.0357 0.0002  325 GLU A CG    
624  C CD    . GLU C 29  ? 0.9601 1.1391 1.0970 0.0208  -0.0524 0.0077  325 GLU A CD    
625  O OE1   . GLU C 29  ? 1.0385 1.2035 1.1473 0.0130  -0.0532 0.0059  325 GLU A OE1   
626  O OE2   . GLU C 29  ? 1.0372 1.2322 1.1895 0.0301  -0.0644 0.0157  325 GLU A OE2   
627  N N     . ASN C 30  ? 0.2773 0.4345 0.4170 -0.0209 -0.0038 -0.0256 326 ASN A N     
628  C CA    . ASN C 30  ? 0.2460 0.3919 0.3772 -0.0341 0.0029  -0.0318 326 ASN A CA    
629  C C     . ASN C 30  ? 0.2691 0.3944 0.3917 -0.0344 0.0189  -0.0298 326 ASN A C     
630  O O     . ASN C 30  ? 0.1740 0.3076 0.3127 -0.0353 0.0289  -0.0308 326 ASN A O     
631  C CB    . ASN C 30  ? 0.1861 0.3562 0.3423 -0.0456 0.0007  -0.0398 326 ASN A CB    
632  C CG    . ASN C 30  ? 0.3025 0.4582 0.4501 -0.0601 0.0071  -0.0470 326 ASN A CG    
633  O OD1   . ASN C 30  ? 0.2628 0.3938 0.3972 -0.0621 0.0197  -0.0450 326 ASN A OD1   
634  N ND2   . ASN C 30  ? 0.2774 0.4474 0.4315 -0.0706 -0.0021 -0.0554 326 ASN A ND2   
635  N N     . TYR C 31  ? 0.1599 0.2598 0.2572 -0.0334 0.0213  -0.0268 327 TYR A N     
636  C CA    . TYR C 31  ? 0.1795 0.2605 0.2644 -0.0320 0.0331  -0.0228 327 TYR A CA    
637  C C     . TYR C 31  ? 0.2563 0.3269 0.3408 -0.0431 0.0441  -0.0242 327 TYR A C     
638  O O     . TYR C 31  ? 0.1920 0.2454 0.2622 -0.0430 0.0532  -0.0193 327 TYR A O     
639  C CB    . TYR C 31  ? 0.1858 0.2466 0.2468 -0.0253 0.0295  -0.0177 327 TYR A CB    
640  C CG    . TYR C 31  ? 0.2017 0.2551 0.2537 -0.0279 0.0229  -0.0195 327 TYR A CG    
641  C CD1   . TYR C 31  ? 0.2065 0.2466 0.2548 -0.0357 0.0280  -0.0218 327 TYR A CD1   
642  C CD2   . TYR C 31  ? 0.2183 0.2759 0.2649 -0.0227 0.0133  -0.0190 327 TYR A CD2   
643  C CE1   . TYR C 31  ? 0.2478 0.2800 0.2891 -0.0376 0.0242  -0.0254 327 TYR A CE1   
644  C CE2   . TYR C 31  ? 0.2344 0.2853 0.2715 -0.0257 0.0098  -0.0220 327 TYR A CE2   
645  C CZ    . TYR C 31  ? 0.2575 0.2962 0.2929 -0.0328 0.0156  -0.0261 327 TYR A CZ    
646  O OH    . TYR C 31  ? 0.3087 0.3399 0.3360 -0.0353 0.0141  -0.0311 327 TYR A OH    
647  N N     . HIS C 32  ? 0.2355 0.3151 0.3340 -0.0536 0.0434  -0.0307 328 HIS A N     
648  C CA    . HIS C 32  ? 0.2074 0.2728 0.3054 -0.0652 0.0548  -0.0316 328 HIS A CA    
649  C C     . HIS C 32  ? 0.1864 0.2592 0.2960 -0.0693 0.0684  -0.0304 328 HIS A C     
650  O O     . HIS C 32  ? 0.1889 0.2885 0.3244 -0.0716 0.0687  -0.0357 328 HIS A O     
651  C CB    . HIS C 32  ? 0.1937 0.2660 0.3044 -0.0770 0.0510  -0.0411 328 HIS A CB    
652  C CG    . HIS C 32  ? 0.2131 0.2683 0.3070 -0.0760 0.0444  -0.0431 328 HIS A CG    
653  N ND1   . HIS C 32  ? 0.2698 0.2949 0.3484 -0.0767 0.0515  -0.0393 328 HIS A ND1   
654  C CD2   . HIS C 32  ? 0.2785 0.3423 0.3685 -0.0737 0.0323  -0.0482 328 HIS A CD2   
655  C CE1   . HIS C 32  ? 0.3584 0.3754 0.4279 -0.0746 0.0452  -0.0435 328 HIS A CE1   
656  N NE2   . HIS C 32  ? 0.2708 0.3106 0.3448 -0.0736 0.0342  -0.0493 328 HIS A NE2   
657  N N     . ASP C 33  ? 0.2023 0.2521 0.2927 -0.0702 0.0796  -0.0230 329 ASP A N     
658  C CA    . ASP C 33  ? 0.2016 0.2539 0.2957 -0.0753 0.0954  -0.0212 329 ASP A CA    
659  C C     . ASP C 33  ? 0.2776 0.3507 0.3824 -0.0661 0.0959  -0.0237 329 ASP A C     
660  O O     . ASP C 33  ? 0.1922 0.2802 0.3138 -0.0690 0.1054  -0.0269 329 ASP A O     
661  C CB    . ASP C 33  ? 0.1985 0.2593 0.3130 -0.0881 0.1019  -0.0264 329 ASP A CB    
662  C CG    . ASP C 33  ? 0.2990 0.3424 0.3996 -0.0934 0.1161  -0.0200 329 ASP A CG    
663  O OD1   . ASP C 33  ? 0.2591 0.3057 0.3729 -0.1030 0.1212  -0.0231 329 ASP A OD1   
664  O OD2   . ASP C 33  ? 0.3799 0.4061 0.4547 -0.0886 0.1216  -0.0118 329 ASP A OD2   
665  N N     . ALA C 34  ? 0.3351 0.4067 0.4295 -0.0537 0.0848  -0.0219 330 ALA A N     
666  C CA    . ALA C 34  ? 0.2816 0.3692 0.3871 -0.0434 0.0835  -0.0243 330 ALA A CA    
667  C C     . ALA C 34  ? 0.3289 0.3999 0.4101 -0.0388 0.0926  -0.0210 330 ALA A C     
668  O O     . ALA C 34  ? 0.2589 0.3066 0.3110 -0.0406 0.0931  -0.0149 330 ALA A O     
669  C CB    . ALA C 34  ? 0.1960 0.2898 0.3038 -0.0336 0.0659  -0.0241 330 ALA A CB    
670  N N     . PRO C 35  ? 0.3635 0.4464 0.4565 -0.0327 0.0995  -0.0254 331 PRO A N     
671  C CA    . PRO C 35  ? 0.3075 0.3746 0.3752 -0.0300 0.1091  -0.0250 331 PRO A CA    
672  C C     . PRO C 35  ? 0.2997 0.3508 0.3443 -0.0220 0.0963  -0.0215 331 PRO A C     
673  O O     . PRO C 35  ? 0.2027 0.2596 0.2577 -0.0150 0.0828  -0.0211 331 PRO A O     
674  C CB    . PRO C 35  ? 0.3671 0.4521 0.4593 -0.0242 0.1182  -0.0326 331 PRO A CB    
675  C CG    . PRO C 35  ? 0.3610 0.4705 0.4889 -0.0271 0.1155  -0.0348 331 PRO A CG    
676  C CD    . PRO C 35  ? 0.3544 0.4665 0.4861 -0.0293 0.1010  -0.0318 331 PRO A CD    
677  N N     . ILE C 36  ? 0.2276 0.2590 0.2399 -0.0242 0.1004  -0.0185 332 ILE A N     
678  C CA    . ILE C 36  ? 0.3447 0.3635 0.3369 -0.0178 0.0908  -0.0175 332 ILE A CA    
679  C C     . ILE C 36  ? 0.3563 0.3758 0.3468 -0.0142 0.1013  -0.0257 332 ILE A C     
680  O O     . ILE C 36  ? 0.3372 0.3516 0.3122 -0.0199 0.1158  -0.0284 332 ILE A O     
681  C CB    . ILE C 36  ? 0.3526 0.3519 0.3123 -0.0222 0.0862  -0.0095 332 ILE A CB    
682  C CG1   . ILE C 36  ? 0.2579 0.2551 0.2242 -0.0242 0.0773  -0.0028 332 ILE A CG1   
683  C CG2   . ILE C 36  ? 0.3867 0.3768 0.3285 -0.0171 0.0769  -0.0101 332 ILE A CG2   
684  C CD1   . ILE C 36  ? 0.3252 0.3037 0.2658 -0.0268 0.0728  0.0068  332 ILE A CD1   
685  N N     . VAL C 37  ? 0.3364 0.3610 0.3426 -0.0050 0.0955  -0.0299 333 VAL A N     
686  C CA    . VAL C 37  ? 0.3893 0.4147 0.4017 -0.0002 0.1072  -0.0394 333 VAL A CA    
687  C C     . VAL C 37  ? 0.4037 0.4098 0.3853 -0.0008 0.1071  -0.0433 333 VAL A C     
688  O O     . VAL C 37  ? 0.3477 0.3499 0.3280 0.0011  0.1181  -0.0526 333 VAL A O     
689  C CB    . VAL C 37  ? 0.3586 0.3973 0.4059 0.0110  0.1022  -0.0413 333 VAL A CB    
690  C CG1   . VAL C 37  ? 0.3004 0.3617 0.3785 0.0108  0.0991  -0.0380 333 VAL A CG1   
691  C CG2   . VAL C 37  ? 0.3118 0.3404 0.3521 0.0164  0.0861  -0.0367 333 VAL A CG2   
692  N N     . GLY C 38  ? 0.3008 0.2957 0.2594 -0.0038 0.0941  -0.0369 334 GLY A N     
693  C CA    . GLY C 38  ? 0.3225 0.3022 0.2540 -0.0056 0.0914  -0.0410 334 GLY A CA    
694  C C     . GLY C 38  ? 0.3128 0.2866 0.2304 -0.0072 0.0743  -0.0328 334 GLY A C     
695  O O     . GLY C 38  ? 0.3284 0.3085 0.2613 -0.0044 0.0647  -0.0255 334 GLY A O     
696  N N     . ILE C 39  ? 0.3385 0.3015 0.2277 -0.0119 0.0704  -0.0347 335 ILE A N     
697  C CA    . ILE C 39  ? 0.3220 0.2817 0.1996 -0.0134 0.0543  -0.0274 335 ILE A CA    
698  C C     . ILE C 39  ? 0.3500 0.3029 0.2173 -0.0149 0.0490  -0.0356 335 ILE A C     
699  O O     . ILE C 39  ? 0.3728 0.3188 0.2246 -0.0186 0.0579  -0.0461 335 ILE A O     
700  C CB    . ILE C 39  ? 0.3811 0.3363 0.2329 -0.0193 0.0519  -0.0185 335 ILE A CB    
701  C CG1   . ILE C 39  ? 0.4287 0.3883 0.2952 -0.0181 0.0535  -0.0090 335 ILE A CG1   
702  C CG2   . ILE C 39  ? 0.3474 0.2996 0.1838 -0.0207 0.0354  -0.0138 335 ILE A CG2   
703  C CD1   . ILE C 39  ? 0.4287 0.3825 0.2756 -0.0246 0.0636  -0.0037 335 ILE A CD1   
704  N N     . ALA C 40  ? 0.3454 0.3002 0.2218 -0.0130 0.0359  -0.0320 336 ALA A N     
705  C CA    . ALA C 40  ? 0.3529 0.3025 0.2220 -0.0164 0.0294  -0.0393 336 ALA A CA    
706  C C     . ALA C 40  ? 0.2823 0.2369 0.1461 -0.0187 0.0135  -0.0316 336 ALA A C     
707  O O     . ALA C 40  ? 0.3488 0.3100 0.2264 -0.0145 0.0079  -0.0217 336 ALA A O     
708  C CB    . ALA C 40  ? 0.2834 0.2305 0.1761 -0.0116 0.0315  -0.0439 336 ALA A CB    
709  N N     . VAL C 41  ? 0.3991 0.3515 0.2442 -0.0254 0.0063  -0.0370 337 VAL A N     
710  C CA    . VAL C 41  ? 0.4205 0.3810 0.2631 -0.0275 -0.0103 -0.0305 337 VAL A CA    
711  C C     . VAL C 41  ? 0.3819 0.3424 0.2265 -0.0337 -0.0164 -0.0411 337 VAL A C     
712  O O     . VAL C 41  ? 0.4126 0.3652 0.2387 -0.0406 -0.0123 -0.0532 337 VAL A O     
713  C CB    . VAL C 41  ? 0.4165 0.3771 0.2299 -0.0311 -0.0165 -0.0238 337 VAL A CB    
714  C CG1   . VAL C 41  ? 0.4522 0.4235 0.2662 -0.0323 -0.0359 -0.0174 337 VAL A CG1   
715  C CG2   . VAL C 41  ? 0.4000 0.3584 0.2135 -0.0263 -0.0097 -0.0125 337 VAL A CG2   
716  N N     . VAL C 42  ? 0.3660 0.3350 0.2336 -0.0322 -0.0248 -0.0378 338 VAL A N     
717  C CA    . VAL C 42  ? 0.3473 0.3190 0.2201 -0.0398 -0.0319 -0.0466 338 VAL A CA    
718  C C     . VAL C 42  ? 0.3495 0.3383 0.2290 -0.0406 -0.0489 -0.0391 338 VAL A C     
719  O O     . VAL C 42  ? 0.3542 0.3514 0.2528 -0.0333 -0.0515 -0.0285 338 VAL A O     
720  C CB    . VAL C 42  ? 0.3254 0.2919 0.2228 -0.0383 -0.0244 -0.0500 338 VAL A CB    
721  C CG1   . VAL C 42  ? 0.3048 0.2755 0.2109 -0.0476 -0.0320 -0.0577 338 VAL A CG1   
722  C CG2   . VAL C 42  ? 0.3236 0.2731 0.2167 -0.0363 -0.0091 -0.0575 338 VAL A CG2   
723  N N     . ASN C 43  ? 0.3468 0.3416 0.2118 -0.0495 -0.0605 -0.0453 339 ASN A N     
724  C CA    . ASN C 43  ? 0.4326 0.4469 0.3069 -0.0496 -0.0788 -0.0379 339 ASN A CA    
725  C C     . ASN C 43  ? 0.4293 0.4518 0.3024 -0.0623 -0.0892 -0.0506 339 ASN A C     
726  O O     . ASN C 43  ? 0.4240 0.4343 0.2945 -0.0696 -0.0799 -0.0646 339 ASN A O     
727  C CB    . ASN C 43  ? 0.3592 0.3758 0.2114 -0.0449 -0.0871 -0.0253 339 ASN A CB    
728  C CG    . ASN C 43  ? 0.4705 0.4783 0.2885 -0.0498 -0.0842 -0.0314 339 ASN A CG    
729  O OD1   . ASN C 43  ? 0.3647 0.3709 0.1763 -0.0578 -0.0839 -0.0451 339 ASN A OD1   
730  N ND2   . ASN C 43  ? 0.4675 0.4687 0.2658 -0.0447 -0.0803 -0.0211 339 ASN A ND2   
731  N N     . GLU C 44  ? 0.5032 0.5455 0.3859 -0.0608 -0.1058 -0.0451 340 GLU A N     
732  C CA    . GLU C 44  ? 0.4662 0.5187 0.3558 -0.0694 -0.1148 -0.0565 340 GLU A CA    
733  C C     . GLU C 44  ? 0.4868 0.5251 0.3446 -0.0762 -0.1110 -0.0683 340 GLU A C     
734  O O     . GLU C 44  ? 0.3971 0.4353 0.2585 -0.0857 -0.1132 -0.0817 340 GLU A O     
735  C CB    . GLU C 44  ? 0.7781 0.8559 0.6832 -0.0644 -0.1338 -0.0477 340 GLU A CB    
736  C CG    . GLU C 44  ? 1.0857 1.1761 1.0192 -0.0539 -0.1361 -0.0332 340 GLU A CG    
737  C CD    . GLU C 44  ? 1.2676 1.3847 1.2242 -0.0479 -0.1527 -0.0265 340 GLU A CD    
738  O OE1   . GLU C 44  ? 1.3002 1.4246 1.2417 -0.0496 -0.1649 -0.0287 340 GLU A OE1   
739  O OE2   . GLU C 44  ? 1.2754 1.4066 1.2659 -0.0412 -0.1530 -0.0194 340 GLU A OE2   
740  N N     . HIS C 45  ? 0.4242 0.4502 0.2521 -0.0720 -0.1042 -0.0640 341 HIS A N     
741  C CA    . HIS C 45  ? 0.4200 0.4353 0.2167 -0.0778 -0.1006 -0.0741 341 HIS A CA    
742  C C     . HIS C 45  ? 0.5182 0.5108 0.3062 -0.0811 -0.0798 -0.0864 341 HIS A C     
743  O O     . HIS C 45  ? 0.5936 0.5768 0.3621 -0.0875 -0.0752 -0.0986 341 HIS A O     
744  C CB    . HIS C 45  ? 0.5078 0.5240 0.2768 -0.0719 -0.1043 -0.0620 341 HIS A CB    
745  C CG    . HIS C 45  ? 0.6190 0.6555 0.3966 -0.0659 -0.1240 -0.0480 341 HIS A CG    
746  N ND1   . HIS C 45  ? 0.6377 0.6910 0.4203 -0.0700 -0.1416 -0.0524 341 HIS A ND1   
747  C CD2   . HIS C 45  ? 0.5746 0.6168 0.3587 -0.0553 -0.1284 -0.0297 341 HIS A CD2   
748  C CE1   . HIS C 45  ? 0.6326 0.7025 0.4257 -0.0611 -0.1562 -0.0372 341 HIS A CE1   
749  N NE2   . HIS C 45  ? 0.6445 0.7067 0.4385 -0.0520 -0.1479 -0.0231 341 HIS A NE2   
750  N N     . GLY C 46  ? 0.5588 0.5424 0.3611 -0.0764 -0.0672 -0.0836 342 GLY A N     
751  C CA    . GLY C 46  ? 0.4849 0.4482 0.2857 -0.0776 -0.0480 -0.0949 342 GLY A CA    
752  C C     . GLY C 46  ? 0.4991 0.4549 0.3079 -0.0691 -0.0358 -0.0872 342 GLY A C     
753  O O     . GLY C 46  ? 0.4578 0.4232 0.2771 -0.0643 -0.0423 -0.0748 342 GLY A O     
754  N N     . ARG C 47  ? 0.4536 0.3927 0.2591 -0.0669 -0.0179 -0.0951 343 ARG A N     
755  C CA    . ARG C 47  ? 0.5105 0.4420 0.3253 -0.0584 -0.0047 -0.0901 343 ARG A CA    
756  C C     . ARG C 47  ? 0.5521 0.4789 0.3492 -0.0550 0.0073  -0.0903 343 ARG A C     
757  O O     . ARG C 47  ? 0.5059 0.4259 0.2907 -0.0588 0.0138  -0.1007 343 ARG A O     
758  C CB    . ARG C 47  ? 0.4522 0.3696 0.2889 -0.0567 0.0064  -0.0981 343 ARG A CB    
759  C CG    . ARG C 47  ? 0.4752 0.3944 0.3271 -0.0640 -0.0027 -0.1020 343 ARG A CG    
760  C CD    . ARG C 47  ? 0.5124 0.4162 0.3881 -0.0603 0.0085  -0.1043 343 ARG A CD    
761  N NE    . ARG C 47  ? 0.6390 0.5443 0.5301 -0.0686 0.0015  -0.1067 343 ARG A NE    
762  C CZ    . ARG C 47  ? 0.6670 0.5639 0.5583 -0.0771 0.0021  -0.1180 343 ARG A CZ    
763  N NH1   . ARG C 47  ? 0.6279 0.5145 0.5043 -0.0775 0.0092  -0.1278 343 ARG A NH1   
764  N NH2   . ARG C 47  ? 0.6920 0.5921 0.6002 -0.0850 -0.0036 -0.1188 343 ARG A NH2   
765  N N     . PHE C 48  ? 0.4496 0.3801 0.2459 -0.0488 0.0107  -0.0791 344 PHE A N     
766  C CA    . PHE C 48  ? 0.4703 0.3991 0.2514 -0.0470 0.0217  -0.0773 344 PHE A CA    
767  C C     . PHE C 48  ? 0.4660 0.3928 0.2639 -0.0390 0.0357  -0.0737 344 PHE A C     
768  O O     . PHE C 48  ? 0.3960 0.3283 0.2131 -0.0333 0.0311  -0.0640 344 PHE A O     
769  C CB    . PHE C 48  ? 0.4924 0.4299 0.2525 -0.0490 0.0104  -0.0648 344 PHE A CB    
770  C CG    . PHE C 48  ? 0.4880 0.4319 0.2352 -0.0552 -0.0064 -0.0663 344 PHE A CG    
771  C CD1   . PHE C 48  ? 0.4277 0.3823 0.1868 -0.0548 -0.0237 -0.0590 344 PHE A CD1   
772  C CD2   . PHE C 48  ? 0.5336 0.4743 0.2589 -0.0613 -0.0049 -0.0755 344 PHE A CD2   
773  C CE1   . PHE C 48  ? 0.5086 0.4727 0.2609 -0.0599 -0.0398 -0.0606 344 PHE A CE1   
774  C CE2   . PHE C 48  ? 0.5605 0.5088 0.2747 -0.0671 -0.0213 -0.0774 344 PHE A CE2   
775  C CZ    . PHE C 48  ? 0.5632 0.5241 0.2924 -0.0661 -0.0391 -0.0698 344 PHE A CZ    
776  N N     . PHE C 49  ? 0.4502 0.3729 0.2485 -0.0371 0.0515  -0.0799 345 PHE A N     
777  C CA    . PHE C 49  ? 0.4615 0.3874 0.2759 -0.0303 0.0642  -0.0754 345 PHE A CA    
778  C C     . PHE C 49  ? 0.4869 0.4165 0.2822 -0.0338 0.0694  -0.0700 345 PHE A C     
779  O O     . PHE C 49  ? 0.5286 0.4545 0.3049 -0.0390 0.0735  -0.0766 345 PHE A O     
780  C CB    . PHE C 49  ? 0.4186 0.3398 0.2571 -0.0240 0.0784  -0.0855 345 PHE A CB    
781  C CG    . PHE C 49  ? 0.4568 0.3862 0.3159 -0.0170 0.0904  -0.0813 345 PHE A CG    
782  C CD1   . PHE C 49  ? 0.4004 0.3359 0.2845 -0.0095 0.0890  -0.0746 345 PHE A CD1   
783  C CD2   . PHE C 49  ? 0.4502 0.3825 0.3045 -0.0188 0.1027  -0.0842 345 PHE A CD2   
784  C CE1   . PHE C 49  ? 0.4738 0.4208 0.3803 -0.0038 0.0982  -0.0710 345 PHE A CE1   
785  C CE2   . PHE C 49  ? 0.4380 0.3808 0.3148 -0.0136 0.1129  -0.0808 345 PHE A CE2   
786  C CZ    . PHE C 49  ? 0.4469 0.3981 0.3510 -0.0062 0.1099  -0.0742 345 PHE A CZ    
787  N N     . LEU C 50  ? 0.4432 0.3787 0.2428 -0.0316 0.0696  -0.0580 346 LEU A N     
788  C CA    . LEU C 50  ? 0.4909 0.4282 0.2749 -0.0352 0.0752  -0.0507 346 LEU A CA    
789  C C     . LEU C 50  ? 0.4721 0.4155 0.2804 -0.0313 0.0900  -0.0499 346 LEU A C     
790  O O     . LEU C 50  ? 0.4355 0.3841 0.2666 -0.0261 0.0888  -0.0459 346 LEU A O     
791  C CB    . LEU C 50  ? 0.5387 0.4766 0.3069 -0.0373 0.0609  -0.0354 346 LEU A CB    
792  C CG    . LEU C 50  ? 0.6353 0.5718 0.3814 -0.0411 0.0444  -0.0346 346 LEU A CG    
793  C CD1   . LEU C 50  ? 0.6144 0.5540 0.3607 -0.0389 0.0276  -0.0198 346 LEU A CD1   
794  C CD2   . LEU C 50  ? 0.6909 0.6246 0.4087 -0.0469 0.0479  -0.0353 346 LEU A CD2   
795  N N     . ARG C 51  ? 0.4645 0.4086 0.2690 -0.0339 0.1038  -0.0543 347 ARG A N     
796  C CA    . ARG C 51  ? 0.4889 0.4418 0.3174 -0.0316 0.1169  -0.0528 347 ARG A CA    
797  C C     . ARG C 51  ? 0.4655 0.4204 0.2903 -0.0346 0.1129  -0.0383 347 ARG A C     
798  O O     . ARG C 51  ? 0.4650 0.4126 0.2614 -0.0398 0.1061  -0.0296 347 ARG A O     
799  C CB    . ARG C 51  ? 0.5639 0.5170 0.3872 -0.0351 0.1329  -0.0607 347 ARG A CB    
800  C CG    . ARG C 51  ? 0.5705 0.5248 0.4150 -0.0293 0.1418  -0.0749 347 ARG A CG    
801  C CD    . ARG C 51  ? 0.6890 0.6403 0.5210 -0.0339 0.1569  -0.0841 347 ARG A CD    
802  N NE    . ARG C 51  ? 0.8587 0.7980 0.6520 -0.0411 0.1520  -0.0878 347 ARG A NE    
803  C CZ    . ARG C 51  ? 0.8611 0.7922 0.6488 -0.0408 0.1517  -0.1001 347 ARG A CZ    
804  N NH1   . ARG C 51  ? 0.7244 0.6558 0.5428 -0.0329 0.1567  -0.1087 347 ARG A NH1   
805  N NH2   . ARG C 51  ? 0.8956 0.8181 0.6477 -0.0485 0.1459  -0.1033 347 ARG A NH2   
806  N N     . PRO C 52  ? 0.4587 0.4230 0.3126 -0.0313 0.1164  -0.0351 348 PRO A N     
807  C CA    . PRO C 52  ? 0.6049 0.5683 0.4567 -0.0346 0.1121  -0.0219 348 PRO A CA    
808  C C     . PRO C 52  ? 0.6079 0.5662 0.4410 -0.0423 0.1194  -0.0151 348 PRO A C     
809  O O     . PRO C 52  ? 0.5506 0.4994 0.3636 -0.0454 0.1115  -0.0029 348 PRO A O     
810  C CB    . PRO C 52  ? 0.6443 0.6218 0.5348 -0.0306 0.1164  -0.0236 348 PRO A CB    
811  C CG    . PRO C 52  ? 0.6393 0.6268 0.5511 -0.0264 0.1268  -0.0355 348 PRO A CG    
812  C CD    . PRO C 52  ? 0.5205 0.4976 0.4122 -0.0245 0.1240  -0.0429 348 PRO A CD    
813  N N     . GLU C 53  ? 0.5948 0.5588 0.4351 -0.0448 0.1345  -0.0221 349 GLU A N     
814  C CA    . GLU C 53  ? 0.6996 0.6585 0.5217 -0.0528 0.1436  -0.0161 349 GLU A CA    
815  C C     . GLU C 53  ? 0.7875 0.7348 0.5695 -0.0562 0.1402  -0.0153 349 GLU A C     
816  O O     . GLU C 53  ? 0.9450 0.8908 0.7128 -0.0611 0.1523  -0.0199 349 GLU A O     
817  C CB    . GLU C 53  ? 0.8181 0.7886 0.6638 -0.0547 0.1615  -0.0244 349 GLU A CB    
818  C CG    . GLU C 53  ? 1.0936 1.0771 0.9766 -0.0541 0.1638  -0.0224 349 GLU A CG    
819  C CD    . GLU C 53  ? 1.3705 1.3723 1.2894 -0.0509 0.1755  -0.0339 349 GLU A CD    
820  O OE1   . GLU C 53  ? 1.4689 1.4712 1.3842 -0.0485 0.1833  -0.0435 349 GLU A OE1   
821  O OE2   . GLU C 53  ? 1.4318 1.4481 1.3837 -0.0506 0.1763  -0.0334 349 GLU A OE2   
822  N N     . THR C 54  ? 0.7672 0.7077 0.5318 -0.0539 0.1234  -0.0099 350 THR A N     
823  C CA    . THR C 54  ? 0.7456 0.6778 0.4735 -0.0569 0.1156  -0.0079 350 THR A CA    
824  C C     . THR C 54  ? 0.6323 0.5597 0.3502 -0.0542 0.0958  0.0052  350 THR A C     
825  O O     . THR C 54  ? 0.5502 0.4708 0.2456 -0.0566 0.0897  0.0187  350 THR A O     
826  C CB    . THR C 54  ? 0.7742 0.7078 0.4985 -0.0556 0.1163  -0.0239 350 THR A CB    
827  O OG1   . THR C 54  ? 0.9712 0.9070 0.6987 -0.0585 0.1352  -0.0348 350 THR A OG1   
828  C CG2   . THR C 54  ? 0.6880 0.6153 0.3779 -0.0584 0.1024  -0.0219 350 THR A CG2   
829  N N     . ALA C 55  ? 0.5012 0.4324 0.2374 -0.0486 0.0859  0.0020  351 ALA A N     
830  C CA    . ALA C 55  ? 0.5805 0.5087 0.3127 -0.0452 0.0674  0.0136  351 ALA A CA    
831  C C     . ALA C 55  ? 0.5148 0.4379 0.2545 -0.0449 0.0679  0.0286  351 ALA A C     
832  O O     . ALA C 55  ? 0.5345 0.4512 0.2606 -0.0437 0.0566  0.0427  351 ALA A O     
833  C CB    . ALA C 55  ? 0.5804 0.5136 0.3323 -0.0400 0.0595  0.0060  351 ALA A CB    
834  N N     . LEU C 56  ? 0.5151 0.4414 0.2791 -0.0456 0.0808  0.0256  352 LEU A N     
835  C CA    . LEU C 56  ? 0.6060 0.5263 0.3808 -0.0465 0.0821  0.0376  352 LEU A CA    
836  C C     . LEU C 56  ? 0.6912 0.6027 0.4475 -0.0522 0.0886  0.0484  352 LEU A C     
837  O O     . LEU C 56  ? 0.7702 0.6727 0.5311 -0.0530 0.0874  0.0606  352 LEU A O     
838  C CB    . LEU C 56  ? 0.5454 0.4747 0.3534 -0.0469 0.0934  0.0297  352 LEU A CB    
839  C CG    . LEU C 56  ? 0.5694 0.5063 0.3968 -0.0407 0.0868  0.0224  352 LEU A CG    
840  C CD1   . LEU C 56  ? 0.5613 0.5100 0.4238 -0.0410 0.0954  0.0167  352 LEU A CD1   
841  C CD2   . LEU C 56  ? 0.4910 0.4207 0.3145 -0.0355 0.0688  0.0318  352 LEU A CD2   
842  N N     . ALA C 57  ? 0.6017 0.5143 0.3373 -0.0565 0.0960  0.0440  353 ALA A N     
843  C CA    . ALA C 57  ? 0.7112 0.6148 0.4229 -0.0621 0.1013  0.0553  353 ALA A CA    
844  C C     . ALA C 57  ? 0.7160 0.6143 0.3947 -0.0602 0.0867  0.0642  353 ALA A C     
845  O O     . ALA C 57  ? 0.7828 0.6739 0.4364 -0.0643 0.0898  0.0744  353 ALA A O     
846  C CB    . ALA C 57  ? 0.7328 0.6411 0.4421 -0.0690 0.1210  0.0452  353 ALA A CB    
847  N N     . ASP C 58  ? 0.6937 0.5966 0.3724 -0.0543 0.0706  0.0607  354 ASP A N     
848  C CA    . ASP C 58  ? 0.7792 0.6813 0.4309 -0.0522 0.0547  0.0675  354 ASP A CA    
849  C C     . ASP C 58  ? 0.6921 0.5889 0.3492 -0.0454 0.0389  0.0856  354 ASP A C     
850  O O     . ASP C 58  ? 0.5834 0.4831 0.2643 -0.0396 0.0303  0.0846  354 ASP A O     
851  C CB    . ASP C 58  ? 0.7676 0.6788 0.4190 -0.0506 0.0460  0.0523  354 ASP A CB    
852  C CG    . ASP C 58  ? 0.9041 0.8174 0.5300 -0.0493 0.0284  0.0572  354 ASP A CG    
853  O OD1   . ASP C 58  ? 1.0302 0.9428 0.6282 -0.0548 0.0323  0.0524  354 ASP A OD1   
854  O OD2   . ASP C 58  ? 0.9337 0.8501 0.5684 -0.0428 0.0106  0.0655  354 ASP A OD2   
855  N N     . PRO C 59  ? 0.6970 0.5857 0.3340 -0.0451 0.0352  0.1028  355 PRO A N     
856  C CA    . PRO C 59  ? 0.6588 0.5419 0.3059 -0.0366 0.0209  0.1207  355 PRO A CA    
857  C C     . PRO C 59  ? 0.6417 0.5349 0.2987 -0.0281 0.0005  0.1184  355 PRO A C     
858  O O     . PRO C 59  ? 0.6555 0.5471 0.3375 -0.0206 -0.0074 0.1248  355 PRO A O     
859  C CB    . PRO C 59  ? 0.7020 0.5765 0.3194 -0.0375 0.0197  0.1385  355 PRO A CB    
860  C CG    . PRO C 59  ? 0.7281 0.6065 0.3153 -0.0461 0.0287  0.1277  355 PRO A CG    
861  C CD    . PRO C 59  ? 0.7567 0.6402 0.3618 -0.0519 0.0446  0.1075  355 PRO A CD    
862  N N     . GLN C 60  ? 0.6553 0.5589 0.2952 -0.0297 -0.0078 0.1084  356 GLN A N     
863  C CA    . GLN C 60  ? 0.6427 0.5581 0.2942 -0.0231 -0.0275 0.1052  356 GLN A CA    
864  C C     . GLN C 60  ? 0.6174 0.5378 0.3004 -0.0217 -0.0258 0.0931  356 GLN A C     
865  O O     . GLN C 60  ? 0.6235 0.5494 0.3284 -0.0142 -0.0390 0.0964  356 GLN A O     
866  C CB    . GLN C 60  ? 0.6587 0.5835 0.2851 -0.0275 -0.0355 0.0949  356 GLN A CB    
867  C CG    . GLN C 60  ? 0.8669 0.7895 0.4607 -0.0269 -0.0437 0.1084  356 GLN A CG    
868  C CD    . GLN C 60  ? 1.0829 0.9937 0.6499 -0.0345 -0.0255 0.1120  356 GLN A CD    
869  O OE1   . GLN C 60  ? 1.0587 0.9667 0.6285 -0.0417 -0.0071 0.0991  356 GLN A OE1   
870  N NE2   . GLN C 60  ? 1.2315 1.1358 0.7735 -0.0324 -0.0302 0.1300  356 GLN A NE2   
871  N N     . PHE C 61  ? 0.5146 0.4338 0.2011 -0.0282 -0.0096 0.0790  357 PHE A N     
872  C CA    . PHE C 61  ? 0.4129 0.3360 0.1264 -0.0266 -0.0075 0.0685  357 PHE A CA    
873  C C     . PHE C 61  ? 0.5235 0.4388 0.2598 -0.0218 -0.0052 0.0785  357 PHE A C     
874  O O     . PHE C 61  ? 0.4000 0.3186 0.1579 -0.0163 -0.0138 0.0780  357 PHE A O     
875  C CB    . PHE C 61  ? 0.4870 0.4110 0.2003 -0.0331 0.0098  0.0517  357 PHE A CB    
876  C CG    . PHE C 61  ? 0.5295 0.4584 0.2670 -0.0310 0.0111  0.0406  357 PHE A CG    
877  C CD1   . PHE C 61  ? 0.5477 0.4843 0.2880 -0.0304 0.0008  0.0307  357 PHE A CD1   
878  C CD2   . PHE C 61  ? 0.4386 0.3643 0.1961 -0.0301 0.0224  0.0401  357 PHE A CD2   
879  C CE1   . PHE C 61  ? 0.5140 0.4537 0.2748 -0.0286 0.0022  0.0217  357 PHE A CE1   
880  C CE2   . PHE C 61  ? 0.4861 0.4181 0.2674 -0.0268 0.0229  0.0306  357 PHE A CE2   
881  C CZ    . PHE C 61  ? 0.3547 0.2943 0.1402 -0.0252 0.0129  0.0217  357 PHE A CZ    
882  N N     . VAL C 62  ? 0.5602 0.4647 0.2928 -0.0247 0.0070  0.0869  358 VAL A N     
883  C CA    . VAL C 62  ? 0.5798 0.4742 0.3338 -0.0215 0.0103  0.0955  358 VAL A CA    
884  C C     . VAL C 62  ? 0.5366 0.4288 0.2999 -0.0116 -0.0067 0.1091  358 VAL A C     
885  O O     . VAL C 62  ? 0.5327 0.4220 0.3205 -0.0059 -0.0102 0.1097  358 VAL A O     
886  C CB    . VAL C 62  ? 0.6224 0.5056 0.3704 -0.0280 0.0263  0.1019  358 VAL A CB    
887  C CG1   . VAL C 62  ? 0.5372 0.4075 0.3068 -0.0253 0.0282  0.1112  358 VAL A CG1   
888  C CG2   . VAL C 62  ? 0.6786 0.5675 0.4285 -0.0362 0.0440  0.0868  358 VAL A CG2   
889  N N     . ALA C 63  ? 0.5061 0.4000 0.2512 -0.0086 -0.0167 0.1197  359 ALA A N     
890  C CA    . ALA C 63  ? 0.4626 0.3575 0.2197 0.0029  -0.0330 0.1321  359 ALA A CA    
891  C C     . ALA C 63  ? 0.5480 0.4575 0.3261 0.0081  -0.0456 0.1219  359 ALA A C     
892  O O     . ALA C 63  ? 0.4572 0.3661 0.2616 0.0172  -0.0521 0.1262  359 ALA A O     
893  C CB    . ALA C 63  ? 0.5786 0.4752 0.3094 0.0055  -0.0425 0.1435  359 ALA A CB    
894  N N     . TRP C 64  ? 0.5038 0.4260 0.2723 0.0021  -0.0477 0.1075  360 TRP A N     
895  C CA    . TRP C 64  ? 0.4555 0.3920 0.2447 0.0047  -0.0580 0.0972  360 TRP A CA    
896  C C     . TRP C 64  ? 0.4791 0.4109 0.2930 0.0058  -0.0505 0.0919  360 TRP A C     
897  O O     . TRP C 64  ? 0.4377 0.3770 0.2782 0.0124  -0.0592 0.0915  360 TRP A O     
898  C CB    . TRP C 64  ? 0.4119 0.3589 0.1842 -0.0036 -0.0589 0.0823  360 TRP A CB    
899  C CG    . TRP C 64  ? 0.4941 0.4547 0.2865 -0.0035 -0.0669 0.0706  360 TRP A CG    
900  C CD1   . TRP C 64  ? 0.3939 0.3705 0.1998 0.0000  -0.0835 0.0699  360 TRP A CD1   
901  C CD2   . TRP C 64  ? 0.4765 0.4364 0.2788 -0.0075 -0.0580 0.0578  360 TRP A CD2   
902  N NE1   . TRP C 64  ? 0.4061 0.3918 0.2305 -0.0027 -0.0848 0.0576  360 TRP A NE1   
903  C CE2   . TRP C 64  ? 0.4509 0.4262 0.2738 -0.0065 -0.0688 0.0501  360 TRP A CE2   
904  C CE3   . TRP C 64  ? 0.4197 0.3718 0.2247 -0.0103 -0.0395 0.0505  360 TRP A CE3   
905  C CZ2   . TRP C 64  ? 0.3730 0.3534 0.2171 -0.0077 -0.0603 0.0362  360 TRP A CZ2   
906  C CZ3   . TRP C 64  ? 0.4609 0.4203 0.2885 -0.0102 -0.0332 0.0370  360 TRP A CZ3   
907  C CH2   . TRP C 64  ? 0.3783 0.3499 0.2233 -0.0089 -0.0433 0.0306  360 TRP A CH2   
908  N N     . LEU C 65  ? 0.4008 0.3215 0.2077 -0.0005 -0.0337 0.0872  361 LEU A N     
909  C CA    . LEU C 65  ? 0.3762 0.2993 0.2151 0.0017  -0.0237 0.0783  361 LEU A CA    
910  C C     . LEU C 65  ? 0.4480 0.3638 0.3095 0.0099  -0.0267 0.0877  361 LEU A C     
911  O O     . LEU C 65  ? 0.3417 0.2652 0.2321 0.0143  -0.0262 0.0801  361 LEU A O     
912  C CB    . LEU C 65  ? 0.3412 0.2577 0.1745 -0.0058 -0.0052 0.0724  361 LEU A CB    
913  C CG    . LEU C 65  ? 0.4412 0.3670 0.2669 -0.0116 0.0021  0.0581  361 LEU A CG    
914  C CD1   . LEU C 65  ? 0.4342 0.3556 0.2596 -0.0178 0.0205  0.0542  361 LEU A CD1   
915  C CD2   . LEU C 65  ? 0.2717 0.2118 0.1228 -0.0078 -0.0022 0.0462  361 LEU A CD2   
916  N N     . GLY C 66  ? 0.3956 0.2948 0.2434 0.0117  -0.0284 0.1041  362 GLY A N     
917  C CA    . GLY C 66  ? 0.5460 0.4328 0.4148 0.0195  -0.0285 0.1132  362 GLY A CA    
918  C C     . GLY C 66  ? 0.5393 0.4325 0.4227 0.0315  -0.0447 0.1221  362 GLY A C     
919  O O     . GLY C 66  ? 0.4604 0.3419 0.3630 0.0398  -0.0435 0.1278  362 GLY A O     
920  N N     . ASP C 67  ? 0.4608 0.3732 0.3382 0.0328  -0.0578 0.1195  363 ASP A N     
921  C CA    . ASP C 67  ? 0.4564 0.3803 0.3511 0.0441  -0.0724 0.1244  363 ASP A CA    
922  C C     . ASP C 67  ? 0.4958 0.4348 0.4270 0.0483  -0.0752 0.1142  363 ASP A C     
923  O O     . ASP C 67  ? 0.5303 0.4845 0.4636 0.0423  -0.0777 0.1033  363 ASP A O     
924  C CB    . ASP C 67  ? 0.4629 0.4019 0.3357 0.0419  -0.0850 0.1254  363 ASP A CB    
925  C CG    . ASP C 67  ? 0.5343 0.4860 0.4238 0.0533  -0.1010 0.1316  363 ASP A CG    
926  O OD1   . ASP C 67  ? 0.5910 0.5424 0.5126 0.0629  -0.1014 0.1327  363 ASP A OD1   
927  O OD2   . ASP C 67  ? 0.6280 0.5906 0.4992 0.0523  -0.1126 0.1344  363 ASP A OD2   
928  N N     . GLU C 68  ? 0.4282 0.3617 0.3878 0.0584  -0.0733 0.1169  364 GLU A N     
929  C CA    . GLU C 68  ? 0.4670 0.4157 0.4636 0.0630  -0.0726 0.1068  364 GLU A CA    
930  C C     . GLU C 68  ? 0.4462 0.4225 0.4543 0.0647  -0.0865 0.1024  364 GLU A C     
931  O O     . GLU C 68  ? 0.5027 0.4952 0.5339 0.0635  -0.0853 0.0917  364 GLU A O     
932  C CB    . GLU C 68  ? 0.6285 0.5654 0.6510 0.0736  -0.0664 0.1090  364 GLU A CB    
933  C CG    . GLU C 68  ? 0.8120 0.7682 0.8727 0.0809  -0.0673 0.0999  364 GLU A CG    
934  C CD    . GLU C 68  ? 0.9525 0.9147 1.0289 0.0757  -0.0556 0.0858  364 GLU A CD    
935  O OE1   . GLU C 68  ? 0.9981 0.9502 1.0533 0.0657  -0.0459 0.0800  364 GLU A OE1   
936  O OE2   . GLU C 68  ? 0.9844 0.9628 1.0896 0.0798  -0.0535 0.0767  364 GLU A OE2   
937  N N     . THR C 69  ? 0.5124 0.4948 0.5052 0.0669  -0.0993 0.1103  365 THR A N     
938  C CA    . THR C 69  ? 0.4301 0.4399 0.4358 0.0674  -0.1129 0.1056  365 THR A CA    
939  C C     . THR C 69  ? 0.4385 0.4599 0.4269 0.0544  -0.1157 0.0951  365 THR A C     
940  O O     . THR C 69  ? 0.4637 0.5079 0.4668 0.0521  -0.1245 0.0877  365 THR A O     
941  C CB    . THR C 69  ? 0.4740 0.4875 0.4700 0.0746  -0.1268 0.1174  365 THR A CB    
942  O OG1   . THR C 69  ? 0.6127 0.6179 0.5662 0.0666  -0.1297 0.1219  365 THR A OG1   
943  C CG2   . THR C 69  ? 0.4062 0.4013 0.4133 0.0873  -0.1231 0.1289  365 THR A CG2   
944  N N     . LYS C 70  ? 0.3939 0.3999 0.3527 0.0453  -0.1073 0.0934  366 LYS A N     
945  C CA    . LYS C 70  ? 0.4157 0.4281 0.3566 0.0331  -0.1073 0.0818  366 LYS A CA    
946  C C     . LYS C 70  ? 0.3821 0.3941 0.3415 0.0303  -0.0938 0.0696  366 LYS A C     
947  O O     . LYS C 70  ? 0.3163 0.3126 0.2706 0.0297  -0.0790 0.0682  366 LYS A O     
948  C CB    . LYS C 70  ? 0.4494 0.4463 0.3481 0.0254  -0.1020 0.0839  366 LYS A CB    
949  C CG    . LYS C 70  ? 0.4435 0.4394 0.3220 0.0288  -0.1106 0.0949  366 LYS A CG    
950  C CD    . LYS C 70  ? 0.4666 0.4830 0.3404 0.0252  -0.1252 0.0886  366 LYS A CD    
951  C CE    . LYS C 70  ? 0.5673 0.5834 0.4190 0.0292  -0.1356 0.1002  366 LYS A CE    
952  N NZ    . LYS C 70  ? 0.6386 0.6616 0.5164 0.0430  -0.1462 0.1121  366 LYS A NZ    
953  N N     . LYS C 71  ? 0.2831 0.3133 0.2645 0.0282  -0.0964 0.0592  367 LYS A N     
954  C CA    . LYS C 71  ? 0.3083 0.3397 0.3100 0.0270  -0.0821 0.0480  367 LYS A CA    
955  C C     . LYS C 71  ? 0.3751 0.3993 0.3568 0.0174  -0.0722 0.0374  367 LYS A C     
956  O O     . LYS C 71  ? 0.3964 0.4246 0.3630 0.0100  -0.0777 0.0322  367 LYS A O     
957  C CB    . LYS C 71  ? 0.3017 0.3546 0.3363 0.0284  -0.0872 0.0426  367 LYS A CB    
958  C CG    . LYS C 71  ? 0.2646 0.3281 0.3257 0.0397  -0.0973 0.0525  367 LYS A CG    
959  C CD    . LYS C 71  ? 0.3381 0.3846 0.4062 0.0488  -0.0867 0.0584  367 LYS A CD    
960  C CE    . LYS C 71  ? 0.4593 0.5131 0.5554 0.0617  -0.0947 0.0680  367 LYS A CE    
961  N NZ    . LYS C 71  ? 0.5492 0.5829 0.6528 0.0698  -0.0826 0.0719  367 LYS A NZ    
962  N N     . LYS C 72  ? 0.2906 0.3043 0.2734 0.0174  -0.0578 0.0338  368 LYS A N     
963  C CA    . LYS C 72  ? 0.3062 0.3137 0.2757 0.0108  -0.0482 0.0252  368 LYS A CA    
964  C C     . LYS C 72  ? 0.2865 0.2986 0.2749 0.0103  -0.0402 0.0179  368 LYS A C     
965  O O     . LYS C 72  ? 0.2702 0.2833 0.2747 0.0147  -0.0358 0.0191  368 LYS A O     
966  C CB    . LYS C 72  ? 0.3458 0.3388 0.2982 0.0103  -0.0391 0.0281  368 LYS A CB    
967  C CG    . LYS C 72  ? 0.3763 0.3618 0.3040 0.0091  -0.0439 0.0359  368 LYS A CG    
968  C CD    . LYS C 72  ? 0.3714 0.3505 0.3037 0.0156  -0.0473 0.0483  368 LYS A CD    
969  C CE    . LYS C 72  ? 0.3908 0.3601 0.2944 0.0139  -0.0519 0.0589  368 LYS A CE    
970  N NZ    . LYS C 72  ? 0.3380 0.2980 0.2478 0.0214  -0.0554 0.0731  368 LYS A NZ    
971  N N     . SER C 73  ? 0.2185 0.2315 0.2032 0.0045  -0.0376 0.0104  369 SER A N     
972  C CA    . SER C 73  ? 0.2041 0.2174 0.1994 0.0033  -0.0291 0.0055  369 SER A CA    
973  C C     . SER C 73  ? 0.2164 0.2193 0.1986 0.0024  -0.0211 0.0036  369 SER A C     
974  O O     . SER C 73  ? 0.2738 0.2710 0.2412 -0.0002 -0.0210 0.0015  369 SER A O     
975  C CB    . SER C 73  ? 0.3237 0.3438 0.3274 -0.0022 -0.0312 -0.0001 369 SER A CB    
976  O OG    . SER C 73  ? 0.3827 0.4168 0.4044 -0.0013 -0.0384 0.0012  369 SER A OG    
977  N N     . MET C 74  ? 0.2013 0.2029 0.1894 0.0044  -0.0144 0.0039  370 MET A N     
978  C CA    . MET C 74  ? 0.2188 0.2146 0.1994 0.0044  -0.0085 0.0030  370 MET A CA    
979  C C     . MET C 74  ? 0.1195 0.1171 0.1068 0.0045  -0.0043 0.0018  370 MET A C     
980  O O     . MET C 74  ? 0.3181 0.3197 0.3133 0.0038  -0.0040 0.0015  370 MET A O     
981  C CB    . MET C 74  ? 0.2075 0.2001 0.1841 0.0060  -0.0063 0.0061  370 MET A CB    
982  C CG    . MET C 74  ? 0.3083 0.2970 0.2742 0.0059  -0.0103 0.0101  370 MET A CG    
983  S SD    . MET C 74  ? 0.3086 0.2896 0.2691 0.0061  -0.0051 0.0151  370 MET A SD    
984  C CE    . MET C 74  ? 0.2335 0.2145 0.1884 0.0029  0.0034  0.0101  370 MET A CE    
985  N N     . PHE C 75  ? 0.2337 0.2292 0.2178 0.0052  -0.0011 0.0015  371 PHE A N     
986  C CA    . PHE C 75  ? 0.1902 0.1882 0.1774 0.0058  0.0008  0.0022  371 PHE A CA    
987  C C     . PHE C 75  ? 0.2801 0.2815 0.2682 0.0062  0.0022  0.0019  371 PHE A C     
988  O O     . PHE C 75  ? 0.2784 0.2796 0.2659 0.0068  0.0039  0.0015  371 PHE A O     
989  C CB    . PHE C 75  ? 0.1828 0.1771 0.1694 0.0071  0.0016  0.0030  371 PHE A CB    
990  C CG    . PHE C 75  ? 0.2893 0.2864 0.2770 0.0083  0.0012  0.0064  371 PHE A CG    
991  C CD1   . PHE C 75  ? 0.1744 0.1693 0.1597 0.0064  0.0016  0.0092  371 PHE A CD1   
992  C CD2   . PHE C 75  ? 0.2635 0.2667 0.2541 0.0107  0.0002  0.0072  371 PHE A CD2   
993  C CE1   . PHE C 75  ? 0.1697 0.1666 0.1510 0.0070  0.0002  0.0139  371 PHE A CE1   
994  C CE2   . PHE C 75  ? 0.3459 0.3537 0.3359 0.0117  -0.0029 0.0111  371 PHE A CE2   
995  C CZ    . PHE C 75  ? 0.2510 0.2548 0.2340 0.0100  -0.0033 0.0151  371 PHE A CZ    
996  N N     . ASP C 76  ? 0.3736 0.3782 0.3637 0.0047  0.0027  0.0009  372 ASP A N     
997  C CA    . ASP C 76  ? 0.4118 0.4193 0.4037 0.0028  0.0040  -0.0012 372 ASP A CA    
998  C C     . ASP C 76  ? 0.2694 0.2715 0.2615 0.0024  0.0062  -0.0006 372 ASP A C     
999  O O     . ASP C 76  ? 0.3392 0.3426 0.3321 0.0012  0.0084  -0.0007 372 ASP A O     
1000 C CB    . ASP C 76  ? 0.4045 0.4195 0.3987 0.0030  0.0023  -0.0009 372 ASP A CB    
1001 C CG    . ASP C 76  ? 0.4655 0.4873 0.4634 -0.0013 0.0023  -0.0047 372 ASP A CG    
1002 O OD1   . ASP C 76  ? 0.3109 0.3280 0.3086 -0.0046 0.0052  -0.0081 372 ASP A OD1   
1003 O OD2   . ASP C 76  ? 0.4080 0.4400 0.4108 -0.0013 -0.0011 -0.0046 372 ASP A OD2   
1004 N N     . SER C 77  ? 0.2840 0.2804 0.2762 0.0036  0.0059  0.0008  373 SER A N     
1005 C CA    . SER C 77  ? 0.3257 0.3147 0.3151 0.0039  0.0068  0.0044  373 SER A CA    
1006 C C     . SER C 77  ? 0.3269 0.3121 0.3187 0.0002  0.0116  0.0031  373 SER A C     
1007 O O     . SER C 77  ? 0.3328 0.3118 0.3200 -0.0014 0.0144  0.0067  373 SER A O     
1008 C CB    . SER C 77  ? 0.3269 0.3121 0.3197 0.0074  0.0037  0.0075  373 SER A CB    
1009 O OG    . SER C 77  ? 0.3861 0.3724 0.3884 0.0081  0.0061  0.0036  373 SER A OG    
1010 N N     . LYS C 78  ? 0.3039 0.2925 0.3015 -0.0025 0.0132  -0.0025 374 LYS A N     
1011 C CA    . LYS C 78  ? 0.2176 0.2025 0.2190 -0.0080 0.0178  -0.0058 374 LYS A CA    
1012 C C     . LYS C 78  ? 0.3160 0.3083 0.3189 -0.0118 0.0195  -0.0060 374 LYS A C     
1013 O O     . LYS C 78  ? 0.2398 0.2267 0.2449 -0.0166 0.0248  -0.0056 374 LYS A O     
1014 C CB    . LYS C 78  ? 0.2899 0.2783 0.2947 -0.0117 0.0185  -0.0141 374 LYS A CB    
1015 C CG    . LYS C 78  ? 0.2158 0.2034 0.2254 -0.0198 0.0222  -0.0202 374 LYS A CG    
1016 C CD    . LYS C 78  ? 0.2742 0.2595 0.2840 -0.0244 0.0243  -0.0302 374 LYS A CD    
1017 C CE    . LYS C 78  ? 0.2620 0.2628 0.2655 -0.0263 0.0186  -0.0346 374 LYS A CE    
1018 N NZ    . LYS C 78  ? 0.2311 0.2477 0.2377 -0.0307 0.0130  -0.0351 374 LYS A NZ    
1019 N N     . ARG C 79  ? 0.2350 0.2392 0.2388 -0.0097 0.0161  -0.0064 375 ARG A N     
1020 C CA    . ARG C 79  ? 0.2761 0.2891 0.2857 -0.0114 0.0186  -0.0068 375 ARG A CA    
1021 C C     . ARG C 79  ? 0.2409 0.2448 0.2439 -0.0118 0.0248  -0.0026 375 ARG A C     
1022 O O     . ARG C 79  ? 0.2020 0.2064 0.2092 -0.0171 0.0315  -0.0032 375 ARG A O     
1023 C CB    . ARG C 79  ? 0.3576 0.3810 0.3700 -0.0062 0.0141  -0.0063 375 ARG A CB    
1024 C CG    . ARG C 79  ? 0.2389 0.2698 0.2592 -0.0046 0.0182  -0.0065 375 ARG A CG    
1025 C CD    . ARG C 79  ? 0.2950 0.3343 0.3216 0.0019  0.0132  -0.0055 375 ARG A CD    
1026 N NE    . ARG C 79  ? 0.3367 0.3892 0.3717 0.0008  0.0059  -0.0063 375 ARG A NE    
1027 C CZ    . ARG C 79  ? 0.3439 0.4135 0.3960 -0.0001 0.0044  -0.0082 375 ARG A CZ    
1028 N NH1   . ARG C 79  ? 0.2117 0.2871 0.2766 0.0003  0.0119  -0.0100 375 ARG A NH1   
1029 N NH2   . ARG C 79  ? 0.3220 0.4045 0.3786 -0.0019 -0.0047 -0.0087 375 ARG A NH2   
1030 N N     . ALA C 80  ? 0.2215 0.2173 0.2128 -0.0074 0.0227  0.0015  376 ALA A N     
1031 C CA    . ALA C 80  ? 0.3190 0.3057 0.2979 -0.0083 0.0271  0.0060  376 ALA A CA    
1032 C C     . ALA C 80  ? 0.2694 0.2432 0.2439 -0.0116 0.0300  0.0111  376 ALA A C     
1033 O O     . ALA C 80  ? 0.2823 0.2501 0.2505 -0.0162 0.0373  0.0143  376 ALA A O     
1034 C CB    . ALA C 80  ? 0.2541 0.2371 0.2213 -0.0039 0.0216  0.0081  376 ALA A CB    
1035 N N     . ALA C 81  ? 0.2937 0.2616 0.2719 -0.0092 0.0255  0.0122  377 ALA A N     
1036 C CA    . ALA C 81  ? 0.3369 0.2894 0.3139 -0.0108 0.0285  0.0175  377 ALA A CA    
1037 C C     . ALA C 81  ? 0.2186 0.1686 0.2016 -0.0193 0.0376  0.0149  377 ALA A C     
1038 O O     . ALA C 81  ? 0.2571 0.1931 0.2331 -0.0229 0.0436  0.0218  377 ALA A O     
1039 C CB    . ALA C 81  ? 0.2654 0.2143 0.2517 -0.0066 0.0247  0.0155  377 ALA A CB    
1040 N N     . VAL C 82  ? 0.1850 0.1488 0.1810 -0.0233 0.0382  0.0056  378 VAL A N     
1041 C CA    . VAL C 82  ? 0.2417 0.2066 0.2478 -0.0329 0.0458  0.0013  378 VAL A CA    
1042 C C     . VAL C 82  ? 0.2547 0.2257 0.2594 -0.0370 0.0532  0.0035  378 VAL A C     
1043 O O     . VAL C 82  ? 0.2407 0.2036 0.2464 -0.0451 0.0628  0.0056  378 VAL A O     
1044 C CB    . VAL C 82  ? 0.2421 0.2231 0.2622 -0.0364 0.0418  -0.0095 378 VAL A CB    
1045 C CG1   . VAL C 82  ? 0.2174 0.2075 0.2514 -0.0473 0.0479  -0.0153 378 VAL A CG1   
1046 C CG2   . VAL C 82  ? 0.1636 0.1342 0.1836 -0.0358 0.0394  -0.0136 378 VAL A CG2   
1047 N N     . ALA C 83  ? 0.1876 0.1719 0.1909 -0.0321 0.0508  0.0023  379 ALA A N     
1048 C CA    . ALA C 83  ? 0.3208 0.3108 0.3236 -0.0355 0.0603  0.0027  379 ALA A CA    
1049 C C     . ALA C 83  ? 0.2663 0.2366 0.2471 -0.0378 0.0671  0.0120  379 ALA A C     
1050 O O     . ALA C 83  ? 0.3114 0.2796 0.2902 -0.0453 0.0791  0.0135  379 ALA A O     
1051 C CB    . ALA C 83  ? 0.1819 0.1856 0.1867 -0.0285 0.0574  -0.0008 379 ALA A CB    
1052 N N     . LEU C 84  ? 0.2740 0.2307 0.2381 -0.0317 0.0593  0.0190  380 LEU A N     
1053 C CA    . LEU C 84  ? 0.3869 0.3250 0.3280 -0.0332 0.0627  0.0301  380 LEU A CA    
1054 C C     . LEU C 84  ? 0.3609 0.2818 0.3044 -0.0392 0.0687  0.0363  380 LEU A C     
1055 O O     . LEU C 84  ? 0.3521 0.2595 0.2806 -0.0452 0.0778  0.0448  380 LEU A O     
1056 C CB    . LEU C 84  ? 0.2897 0.2220 0.2162 -0.0246 0.0503  0.0359  380 LEU A CB    
1057 C CG    . LEU C 84  ? 0.3389 0.2829 0.2579 -0.0211 0.0465  0.0305  380 LEU A CG    
1058 C CD1   . LEU C 84  ? 0.3062 0.2488 0.2195 -0.0139 0.0328  0.0336  380 LEU A CD1   
1059 C CD2   . LEU C 84  ? 0.3696 0.3100 0.2668 -0.0261 0.0556  0.0321  380 LEU A CD2   
1060 N N     . LYS C 85  ? 0.3365 0.2560 0.2975 -0.0387 0.0651  0.0319  381 LYS A N     
1061 C CA    . LYS C 85  ? 0.3236 0.2248 0.2899 -0.0455 0.0724  0.0353  381 LYS A CA    
1062 C C     . LYS C 85  ? 0.3519 0.2560 0.3234 -0.0583 0.0866  0.0329  381 LYS A C     
1063 O O     . LYS C 85  ? 0.3319 0.2156 0.2956 -0.0652 0.0962  0.0415  381 LYS A O     
1064 C CB    . LYS C 85  ? 0.4013 0.3036 0.3867 -0.0449 0.0683  0.0258  381 LYS A CB    
1065 C CG    . LYS C 85  ? 0.4516 0.3425 0.4349 -0.0343 0.0596  0.0300  381 LYS A CG    
1066 C CD    . LYS C 85  ? 0.4089 0.3023 0.4096 -0.0355 0.0586  0.0175  381 LYS A CD    
1067 C CE    . LYS C 85  ? 0.4577 0.3456 0.4604 -0.0243 0.0514  0.0188  381 LYS A CE    
1068 N NZ    . LYS C 85  ? 0.5138 0.3769 0.5129 -0.0182 0.0523  0.0320  381 LYS A NZ    
1069 N N     . TRP C 86  ? 0.3197 0.2491 0.3064 -0.0615 0.0884  0.0218  382 TRP A N     
1070 C CA    . TRP C 86  ? 0.3311 0.2686 0.3292 -0.0737 0.1023  0.0180  382 TRP A CA    
1071 C C     . TRP C 86  ? 0.3788 0.3091 0.3559 -0.0757 0.1124  0.0267  382 TRP A C     
1072 O O     . TRP C 86  ? 0.3193 0.2519 0.3019 -0.0834 0.1215  0.0259  382 TRP A O     
1073 C CB    . TRP C 86  ? 0.3441 0.3138 0.3673 -0.0742 0.0996  0.0048  382 TRP A CB    
1074 C CG    . TRP C 86  ? 0.2920 0.2712 0.3363 -0.0776 0.0922  -0.0051 382 TRP A CG    
1075 C CD1   . TRP C 86  ? 0.2113 0.1961 0.2569 -0.0697 0.0786  -0.0095 382 TRP A CD1   
1076 C CD2   . TRP C 86  ? 0.2350 0.2196 0.3002 -0.0914 0.0985  -0.0128 382 TRP A CD2   
1077 N NE1   . TRP C 86  ? 0.1898 0.1827 0.2525 -0.0775 0.0756  -0.0196 382 TRP A NE1   
1078 C CE2   . TRP C 86  ? 0.2046 0.1980 0.2806 -0.0911 0.0869  -0.0224 382 TRP A CE2   
1079 C CE3   . TRP C 86  ? 0.2535 0.2368 0.3252 -0.1005 0.1085  -0.0127 382 TRP A CE3   
1080 C CZ2   . TRP C 86  ? 0.2110 0.2119 0.3056 -0.1033 0.0874  -0.0331 382 TRP A CZ2   
1081 C CZ3   . TRP C 86  ? 0.2620 0.2530 0.3532 -0.1101 0.1073  -0.0224 382 TRP A CZ3   
1082 C CH2   . TRP C 86  ? 0.2508 0.2504 0.3523 -0.1113 0.0963  -0.0326 382 TRP A CH2   
1083 N N     . LYS C 87  ? 0.3496 0.2741 0.3024 -0.0675 0.1075  0.0335  383 LYS A N     
1084 C CA    . LYS C 87  ? 0.4319 0.3483 0.3588 -0.0682 0.1127  0.0415  383 LYS A CA    
1085 C C     . LYS C 87  ? 0.5000 0.3903 0.4039 -0.0661 0.1076  0.0570  383 LYS A C     
1086 O O     . LYS C 87  ? 0.4498 0.3337 0.3282 -0.0653 0.1077  0.0654  383 LYS A O     
1087 C CB    . LYS C 87  ? 0.3916 0.3183 0.3043 -0.0616 0.1097  0.0380  383 LYS A CB    
1088 C CG    . LYS C 87  ? 0.4303 0.3830 0.3674 -0.0614 0.1147  0.0237  383 LYS A CG    
1089 C CD    . LYS C 87  ? 0.4913 0.4502 0.4156 -0.0533 0.1098  0.0195  383 LYS A CD    
1090 C CE    . LYS C 87  ? 0.4701 0.4532 0.4216 -0.0505 0.1144  0.0065  383 LYS A CE    
1091 N NZ    . LYS C 87  ? 0.4957 0.4881 0.4574 -0.0566 0.1285  0.0022  383 LYS A NZ    
1092 N N     . GLY C 88  ? 0.4530 0.3292 0.3668 -0.0646 0.1026  0.0607  384 GLY A N     
1093 C CA    . GLY C 88  ? 0.5570 0.4096 0.4544 -0.0605 0.0967  0.0762  384 GLY A CA    
1094 C C     . GLY C 88  ? 0.4931 0.3422 0.3698 -0.0496 0.0830  0.0849  384 GLY A C     
1095 O O     . GLY C 88  ? 0.5168 0.3537 0.3745 -0.0466 0.0774  0.0990  384 GLY A O     
1096 N N     . ILE C 89  ? 0.4018 0.2628 0.2828 -0.0438 0.0767  0.0770  385 ILE A N     
1097 C CA    . ILE C 89  ? 0.4351 0.2988 0.3008 -0.0338 0.0617  0.0819  385 ILE A CA    
1098 C C     . ILE C 89  ? 0.4680 0.3365 0.3567 -0.0242 0.0497  0.0775  385 ILE A C     
1099 O O     . ILE C 89  ? 0.4496 0.3305 0.3618 -0.0251 0.0516  0.0644  385 ILE A O     
1100 C CB    . ILE C 89  ? 0.5299 0.4128 0.3859 -0.0345 0.0616  0.0721  385 ILE A CB    
1101 C CG1   . ILE C 89  ? 0.4918 0.3737 0.3282 -0.0430 0.0737  0.0740  385 ILE A CG1   
1102 C CG2   . ILE C 89  ? 0.4310 0.3185 0.2750 -0.0259 0.0452  0.0746  385 ILE A CG2   
1103 C CD1   . ILE C 89  ? 0.4209 0.3184 0.2489 -0.0439 0.0768  0.0627  385 ILE A CD1   
1104 N N     . GLU C 90  ? 0.4349 0.2947 0.3170 -0.0152 0.0375  0.0885  386 GLU A N     
1105 C CA    . GLU C 90  ? 0.3903 0.2540 0.2953 -0.0057 0.0280  0.0850  386 GLU A CA    
1106 C C     . GLU C 90  ? 0.4453 0.3292 0.3500 0.0001  0.0159  0.0793  386 GLU A C     
1107 O O     . GLU C 90  ? 0.4206 0.3067 0.3042 0.0012  0.0082  0.0860  386 GLU A O     
1108 C CB    . GLU C 90  ? 0.6173 0.4598 0.5232 0.0019  0.0229  0.1006  386 GLU A CB    
1109 C CG    . GLU C 90  ? 0.8965 0.7392 0.8318 0.0104  0.0194  0.0948  386 GLU A CG    
1110 C CD    . GLU C 90  ? 1.1405 0.9605 1.0813 0.0193  0.0159  0.1102  386 GLU A CD    
1111 O OE1   . GLU C 90  ? 1.2622 1.0716 1.1844 0.0168  0.0125  0.1231  386 GLU A OE1   
1112 O OE2   . GLU C 90  ? 1.1881 1.0071 1.1543 0.0272  0.0145  0.1050  386 GLU A OE2   
1113 N N     . LEU C 91  ? 0.4283 0.3263 0.3547 0.0024  0.0146  0.0665  387 LEU A N     
1114 C CA    . LEU C 91  ? 0.3581 0.2736 0.2882 0.0070  0.0047  0.0606  387 LEU A CA    
1115 C C     . LEU C 91  ? 0.4000 0.3163 0.3495 0.0161  -0.0030 0.0625  387 LEU A C     
1116 O O     . LEU C 91  ? 0.4014 0.3151 0.3696 0.0171  0.0025  0.0564  387 LEU A O     
1117 C CB    . LEU C 91  ? 0.2618 0.1921 0.2009 0.0029  0.0097  0.0463  387 LEU A CB    
1118 C CG    . LEU C 91  ? 0.3558 0.3014 0.3008 0.0064  0.0019  0.0397  387 LEU A CG    
1119 C CD1   . LEU C 91  ? 0.3108 0.2592 0.2367 0.0059  -0.0050 0.0428  387 LEU A CD1   
1120 C CD2   . LEU C 91  ? 0.3052 0.2615 0.2595 0.0033  0.0072  0.0284  387 LEU A CD2   
1121 N N     . CYS C 92  ? 0.3273 0.2480 0.2730 0.0221  -0.0154 0.0703  388 CYS A N     
1122 C CA    . CYS C 92  ? 0.3693 0.2945 0.3375 0.0318  -0.0231 0.0725  388 CYS A CA    
1123 C C     . CYS C 92  ? 0.3007 0.2468 0.2733 0.0332  -0.0337 0.0677  388 CYS A C     
1124 O O     . CYS C 92  ? 0.3308 0.2841 0.2860 0.0271  -0.0359 0.0639  388 CYS A O     
1125 C CB    . CYS C 92  ? 0.4415 0.3519 0.4079 0.0394  -0.0297 0.0896  388 CYS A CB    
1126 S SG    . CYS C 92  ? 0.5578 0.4387 0.5224 0.0373  -0.0160 0.0963  388 CYS A SG    
1127 N N     . GLY C 93  ? 0.3158 0.2713 0.3138 0.0409  -0.0388 0.0668  389 GLY A N     
1128 C CA    . GLY C 93  ? 0.3971 0.3732 0.4039 0.0417  -0.0492 0.0632  389 GLY A CA    
1129 C C     . GLY C 93  ? 0.2953 0.2829 0.3059 0.0351  -0.0431 0.0489  389 GLY A C     
1130 O O     . GLY C 93  ? 0.2777 0.2800 0.2908 0.0327  -0.0505 0.0453  389 GLY A O     
1131 N N     . VAL C 94  ? 0.3825 0.3638 0.3936 0.0314  -0.0305 0.0412  390 VAL A N     
1132 C CA    . VAL C 94  ? 0.2820 0.2729 0.2963 0.0263  -0.0255 0.0302  390 VAL A CA    
1133 C C     . VAL C 94  ? 0.3498 0.3522 0.3893 0.0300  -0.0249 0.0258  390 VAL A C     
1134 O O     . VAL C 94  ? 0.2730 0.2714 0.3252 0.0329  -0.0169 0.0226  390 VAL A O     
1135 C CB    . VAL C 94  ? 0.3969 0.3801 0.4039 0.0215  -0.0145 0.0244  390 VAL A CB    
1136 C CG1   . VAL C 94  ? 0.2920 0.2841 0.3012 0.0174  -0.0111 0.0159  390 VAL A CG1   
1137 C CG2   . VAL C 94  ? 0.3512 0.3256 0.3377 0.0175  -0.0132 0.0281  390 VAL A CG2   
1138 N N     . SER C 95  ? 0.2456 0.2625 0.2930 0.0291  -0.0321 0.0244  391 SER A N     
1139 C CA    . SER C 95  ? 0.2824 0.3133 0.3565 0.0317  -0.0306 0.0201  391 SER A CA    
1140 C C     . SER C 95  ? 0.2928 0.3286 0.3674 0.0247  -0.0218 0.0110  391 SER A C     
1141 O O     . SER C 95  ? 0.2472 0.2928 0.3417 0.0254  -0.0162 0.0064  391 SER A O     
1142 C CB    . SER C 95  ? 0.2944 0.3414 0.3822 0.0342  -0.0443 0.0243  391 SER A CB    
1143 O OG    . SER C 95  ? 0.3630 0.4143 0.4350 0.0260  -0.0508 0.0218  391 SER A OG    
1144 N N     . PHE C 96  ? 0.2111 0.2401 0.2650 0.0184  -0.0198 0.0089  392 PHE A N     
1145 C CA    . PHE C 96  ? 0.2142 0.2449 0.2665 0.0125  -0.0123 0.0030  392 PHE A CA    
1146 C C     . PHE C 96  ? 0.2688 0.2880 0.3010 0.0099  -0.0082 0.0026  392 PHE A C     
1147 O O     . PHE C 96  ? 0.2304 0.2442 0.2492 0.0090  -0.0122 0.0046  392 PHE A O     
1148 C CB    . PHE C 96  ? 0.2032 0.2422 0.2592 0.0071  -0.0168 0.0010  392 PHE A CB    
1149 C CG    . PHE C 96  ? 0.2973 0.3340 0.3497 0.0009  -0.0088 -0.0027 392 PHE A CG    
1150 C CD1   . PHE C 96  ? 0.2749 0.3182 0.3403 -0.0009 -0.0003 -0.0054 392 PHE A CD1   
1151 C CD2   . PHE C 96  ? 0.3113 0.3381 0.3470 -0.0028 -0.0087 -0.0028 392 PHE A CD2   
1152 C CE1   . PHE C 96  ? 0.2671 0.3061 0.3253 -0.0070 0.0072  -0.0065 392 PHE A CE1   
1153 C CE2   . PHE C 96  ? 0.3366 0.3588 0.3688 -0.0073 -0.0020 -0.0037 392 PHE A CE2   
1154 C CZ    . PHE C 96  ? 0.2569 0.2846 0.2985 -0.0098 0.0055  -0.0046 392 PHE A CZ    
1155 N N     . ASP C 97  ? 0.1580 0.1750 0.1885 0.0086  -0.0003 -0.0004 393 ASP A N     
1156 C CA    . ASP C 97  ? 0.2142 0.2246 0.2299 0.0065  0.0022  -0.0007 393 ASP A CA    
1157 C C     . ASP C 97  ? 0.2806 0.2927 0.2929 0.0025  0.0057  -0.0017 393 ASP A C     
1158 O O     . ASP C 97  ? 0.2392 0.2538 0.2530 0.0007  0.0115  -0.0041 393 ASP A O     
1159 C CB    . ASP C 97  ? 0.2564 0.2629 0.2708 0.0073  0.0063  -0.0027 393 ASP A CB    
1160 C CG    . ASP C 97  ? 0.3533 0.3570 0.3563 0.0051  0.0064  -0.0027 393 ASP A CG    
1161 O OD1   . ASP C 97  ? 0.3641 0.3697 0.3614 0.0035  0.0056  -0.0018 393 ASP A OD1   
1162 O OD2   . ASP C 97  ? 0.3215 0.3213 0.3236 0.0049  0.0074  -0.0033 393 ASP A OD2   
1163 N N     . LEU C 98  ? 0.2596 0.2683 0.2658 0.0010  0.0031  0.0001  394 LEU A N     
1164 C CA    . LEU C 98  ? 0.2655 0.2720 0.2684 -0.0025 0.0063  0.0013  394 LEU A CA    
1165 C C     . LEU C 98  ? 0.2829 0.2881 0.2761 -0.0026 0.0091  0.0031  394 LEU A C     
1166 O O     . LEU C 98  ? 0.2499 0.2543 0.2386 -0.0059 0.0132  0.0049  394 LEU A O     
1167 C CB    . LEU C 98  ? 0.2134 0.2129 0.2125 -0.0032 0.0037  0.0024  394 LEU A CB    
1168 C CG    . LEU C 98  ? 0.2381 0.2300 0.2337 -0.0059 0.0070  0.0054  394 LEU A CG    
1169 C CD1   . LEU C 98  ? 0.2201 0.2150 0.2236 -0.0120 0.0109  0.0044  394 LEU A CD1   
1170 C CD2   . LEU C 98  ? 0.2921 0.2738 0.2848 -0.0049 0.0055  0.0050  394 LEU A CD2   
1171 N N     . LEU C 99  ? 0.2225 0.2280 0.2117 -0.0002 0.0068  0.0027  395 LEU A N     
1172 C CA    . LEU C 99  ? 0.1607 0.1682 0.1412 -0.0013 0.0071  0.0034  395 LEU A CA    
1173 C C     . LEU C 99  ? 0.2676 0.2781 0.2455 -0.0049 0.0127  -0.0007 395 LEU A C     
1174 O O     . LEU C 99  ? 0.2855 0.2963 0.2524 -0.0082 0.0149  0.0010  395 LEU A O     
1175 C CB    . LEU C 99  ? 0.1801 0.1903 0.1612 0.0004  0.0039  0.0019  395 LEU A CB    
1176 C CG    . LEU C 99  ? 0.3276 0.3433 0.3010 -0.0023 0.0023  0.0008  395 LEU A CG    
1177 C CD1   . LEU C 99  ? 0.3288 0.3451 0.2939 -0.0016 -0.0012 0.0078  395 LEU A CD1   
1178 C CD2   . LEU C 99  ? 0.2746 0.2954 0.2527 -0.0026 -0.0003 -0.0023 395 LEU A CD2   
1179 N N     . LEU C 100 ? 0.1929 0.2046 0.1800 -0.0040 0.0156  -0.0059 396 LEU A N     
1180 C CA    . LEU C 100 ? 0.2698 0.2834 0.2575 -0.0066 0.0232  -0.0121 396 LEU A CA    
1181 C C     . LEU C 100 ? 0.1994 0.2158 0.1905 -0.0091 0.0293  -0.0115 396 LEU A C     
1182 O O     . LEU C 100 ? 0.1937 0.2115 0.1772 -0.0135 0.0372  -0.0151 396 LEU A O     
1183 C CB    . LEU C 100 ? 0.1954 0.2074 0.1963 -0.0032 0.0251  -0.0168 396 LEU A CB    
1184 C CG    . LEU C 100 ? 0.2409 0.2486 0.2383 -0.0029 0.0211  -0.0175 396 LEU A CG    
1185 C CD1   . LEU C 100 ? 0.2430 0.2448 0.2529 0.0009  0.0228  -0.0191 396 LEU A CD1   
1186 C CD2   . LEU C 100 ? 0.2620 0.2710 0.2465 -0.0086 0.0228  -0.0230 396 LEU A CD2   
1187 N N     . ALA C 101 ? 0.2277 0.2451 0.2293 -0.0078 0.0266  -0.0078 397 ALA A N     
1188 C CA    . ALA C 101 ? 0.2223 0.2433 0.2300 -0.0119 0.0328  -0.0075 397 ALA A CA    
1189 C C     . ALA C 101 ? 0.2121 0.2274 0.2011 -0.0172 0.0358  -0.0023 397 ALA A C     
1190 O O     . ALA C 101 ? 0.2112 0.2281 0.1958 -0.0226 0.0453  -0.0033 397 ALA A O     
1191 C CB    . ALA C 101 ? 0.2206 0.2443 0.2431 -0.0111 0.0274  -0.0056 397 ALA A CB    
1192 N N     . ALA C 102 ? 0.2005 0.2089 0.1789 -0.0154 0.0284  0.0040  398 ALA A N     
1193 C CA    . ALA C 102 ? 0.2898 0.2912 0.2509 -0.0186 0.0295  0.0117  398 ALA A CA    
1194 C C     . ALA C 102 ? 0.3572 0.3612 0.2999 -0.0214 0.0320  0.0106  398 ALA A C     
1195 O O     . ALA C 102 ? 0.3085 0.3093 0.2355 -0.0268 0.0377  0.0149  398 ALA A O     
1196 C CB    . ALA C 102 ? 0.2440 0.2381 0.2021 -0.0138 0.0207  0.0184  398 ALA A CB    
1197 N N     . TYR C 103 ? 0.2564 0.2653 0.1992 -0.0189 0.0282  0.0045  399 TYR A N     
1198 C CA    . TYR C 103 ? 0.2806 0.2925 0.2054 -0.0232 0.0301  0.0005  399 TYR A CA    
1199 C C     . TYR C 103 ? 0.2744 0.2878 0.1960 -0.0291 0.0438  -0.0066 399 TYR A C     
1200 O O     . TYR C 103 ? 0.2976 0.3102 0.1963 -0.0354 0.0485  -0.0061 399 TYR A O     
1201 C CB    . TYR C 103 ? 0.3464 0.3622 0.2766 -0.0209 0.0248  -0.0067 399 TYR A CB    
1202 C CG    . TYR C 103 ? 0.2920 0.3107 0.2069 -0.0269 0.0280  -0.0154 399 TYR A CG    
1203 C CD1   . TYR C 103 ? 0.2623 0.2842 0.1543 -0.0312 0.0215  -0.0119 399 TYR A CD1   
1204 C CD2   . TYR C 103 ? 0.3240 0.3419 0.2474 -0.0282 0.0368  -0.0275 399 TYR A CD2   
1205 C CE1   . TYR C 103 ? 0.3687 0.3938 0.2440 -0.0384 0.0236  -0.0218 399 TYR A CE1   
1206 C CE2   . TYR C 103 ? 0.3304 0.3488 0.2393 -0.0347 0.0410  -0.0381 399 TYR A CE2   
1207 C CZ    . TYR C 103 ? 0.3435 0.3660 0.2270 -0.0407 0.0344  -0.0361 399 TYR A CZ    
1208 O OH    . TYR C 103 ? 0.4554 0.4788 0.3216 -0.0490 0.0380  -0.0485 399 TYR A OH    
1209 N N     . LEU C 104 ? 0.2785 0.2949 0.2227 -0.0269 0.0504  -0.0131 400 LEU A N     
1210 C CA    . LEU C 104 ? 0.3021 0.3221 0.2495 -0.0314 0.0652  -0.0209 400 LEU A CA    
1211 C C     . LEU C 104 ? 0.3051 0.3239 0.2448 -0.0377 0.0731  -0.0144 400 LEU A C     
1212 O O     . LEU C 104 ? 0.3068 0.3266 0.2336 -0.0446 0.0860  -0.0185 400 LEU A O     
1213 C CB    . LEU C 104 ? 0.2359 0.2616 0.2149 -0.0257 0.0687  -0.0278 400 LEU A CB    
1214 C CG    . LEU C 104 ? 0.3065 0.3303 0.2929 -0.0206 0.0663  -0.0355 400 LEU A CG    
1215 C CD1   . LEU C 104 ? 0.2405 0.2689 0.2588 -0.0134 0.0681  -0.0385 400 LEU A CD1   
1216 C CD2   . LEU C 104 ? 0.3978 0.4190 0.3671 -0.0261 0.0761  -0.0462 400 LEU A CD2   
1217 N N     . LEU C 105 ? 0.2860 0.3012 0.2324 -0.0365 0.0668  -0.0048 401 LEU A N     
1218 C CA    . LEU C 105 ? 0.3265 0.3378 0.2679 -0.0435 0.0749  0.0021  401 LEU A CA    
1219 C C     . LEU C 105 ? 0.3830 0.3851 0.2894 -0.0488 0.0758  0.0111  401 LEU A C     
1220 O O     . LEU C 105 ? 0.3925 0.3912 0.2869 -0.0571 0.0879  0.0146  401 LEU A O     
1221 C CB    . LEU C 105 ? 0.3074 0.3142 0.2641 -0.0415 0.0676  0.0087  401 LEU A CB    
1222 C CG    . LEU C 105 ? 0.2771 0.2946 0.2665 -0.0405 0.0692  0.0016  401 LEU A CG    
1223 C CD1   . LEU C 105 ? 0.2583 0.2694 0.2563 -0.0419 0.0633  0.0070  401 LEU A CD1   
1224 C CD2   . LEU C 105 ? 0.2511 0.2789 0.2522 -0.0470 0.0852  -0.0046 401 LEU A CD2   
1225 N N     . ASP C 106 ? 0.3754 0.3741 0.2655 -0.0446 0.0631  0.0156  402 ASP A N     
1226 C CA    . ASP C 106 ? 0.4696 0.4618 0.3262 -0.0484 0.0601  0.0256  402 ASP A CA    
1227 C C     . ASP C 106 ? 0.3804 0.3763 0.2293 -0.0426 0.0443  0.0264  402 ASP A C     
1228 O O     . ASP C 106 ? 0.3915 0.3842 0.2483 -0.0356 0.0325  0.0348  402 ASP A O     
1229 C CB    . ASP C 106 ? 0.5695 0.5483 0.4200 -0.0497 0.0598  0.0415  402 ASP A CB    
1230 C CG    . ASP C 106 ? 0.5798 0.5514 0.3971 -0.0519 0.0556  0.0544  402 ASP A CG    
1231 O OD1   . ASP C 106 ? 0.6191 0.5985 0.4202 -0.0519 0.0514  0.0494  402 ASP A OD1   
1232 O OD2   . ASP C 106 ? 0.7384 0.6971 0.5512 -0.0514 0.0551  0.0686  402 ASP A OD2   
1233 N N     . PRO C 107 ? 0.4009 0.4040 0.2361 -0.0460 0.0446  0.0167  403 PRO A N     
1234 C CA    . PRO C 107 ? 0.4393 0.4488 0.2712 -0.0423 0.0296  0.0156  403 PRO A CA    
1235 C C     . PRO C 107 ? 0.5345 0.5425 0.3461 -0.0407 0.0161  0.0311  403 PRO A C     
1236 O O     . PRO C 107 ? 0.4982 0.5128 0.3178 -0.0349 0.0020  0.0336  403 PRO A O     
1237 C CB    . PRO C 107 ? 0.5013 0.5168 0.3199 -0.0494 0.0356  0.0001  403 PRO A CB    
1238 C CG    . PRO C 107 ? 0.5632 0.5756 0.3893 -0.0528 0.0539  -0.0081 403 PRO A CG    
1239 C CD    . PRO C 107 ? 0.4017 0.4075 0.2274 -0.0533 0.0588  0.0049  403 PRO A CD    
1240 N N     . ALA C 108 ? 0.5187 0.5184 0.3114 -0.0433 0.0200  0.0413  404 ALA A N     
1241 C CA    . ALA C 108 ? 0.5217 0.5184 0.3000 -0.0384 0.0067  0.0565  404 ALA A CA    
1242 C C     . ALA C 108 ? 0.5979 0.5882 0.3922 -0.0296 -0.0022 0.0701  404 ALA A C     
1243 O O     . ALA C 108 ? 0.6286 0.6196 0.4202 -0.0223 -0.0159 0.0808  404 ALA A O     
1244 C CB    . ALA C 108 ? 0.4145 0.4019 0.1700 -0.0424 0.0148  0.0645  404 ALA A CB    
1245 N N     . GLN C 109 ? 0.6079 0.5920 0.4235 -0.0287 0.0056  0.0681  405 GLN A N     
1246 C CA    . GLN C 109 ? 0.6529 0.6287 0.4890 -0.0191 -0.0007 0.0772  405 GLN A CA    
1247 C C     . GLN C 109 ? 0.6210 0.6088 0.4735 -0.0101 -0.0146 0.0749  405 GLN A C     
1248 O O     . GLN C 109 ? 0.5382 0.5205 0.4038 -0.0009 -0.0214 0.0841  405 GLN A O     
1249 C CB    . GLN C 109 ? 0.6920 0.6607 0.5517 -0.0197 0.0104  0.0699  405 GLN A CB    
1250 C CG    . GLN C 109 ? 0.7515 0.7071 0.6023 -0.0278 0.0236  0.0751  405 GLN A CG    
1251 C CD    . GLN C 109 ? 0.9192 0.8583 0.7509 -0.0269 0.0205  0.0947  405 GLN A CD    
1252 O OE1   . GLN C 109 ? 0.9405 0.8705 0.7823 -0.0179 0.0122  0.1039  405 GLN A OE1   
1253 N NE2   . GLN C 109 ? 0.9858 0.9225 0.7949 -0.0338 0.0280  0.0997  405 GLN A NE2   
1254 N N     . GLY C 110 ? 0.5878 0.5912 0.4417 -0.0127 -0.0176 0.0623  406 GLY A N     
1255 C CA    . GLY C 110 ? 0.5584 0.5744 0.4306 -0.0060 -0.0288 0.0592  406 GLY A CA    
1256 C C     . GLY C 110 ? 0.5403 0.5519 0.4409 0.0012  -0.0257 0.0561  406 GLY A C     
1257 O O     . GLY C 110 ? 0.4605 0.4786 0.3775 0.0088  -0.0337 0.0583  406 GLY A O     
1258 N N     . VAL C 111 ? 0.5434 0.5454 0.4505 -0.0015 -0.0144 0.0504  407 VAL A N     
1259 C CA    . VAL C 111 ? 0.5853 0.5827 0.5144 0.0034  -0.0115 0.0462  407 VAL A CA    
1260 C C     . VAL C 111 ? 0.5753 0.5853 0.5182 0.0062  -0.0158 0.0379  407 VAL A C     
1261 O O     . VAL C 111 ? 0.6930 0.7096 0.6357 0.0015  -0.0131 0.0283  407 VAL A O     
1262 C CB    . VAL C 111 ? 0.4762 0.4670 0.4093 -0.0018 -0.0008 0.0395  407 VAL A CB    
1263 C CG1   . VAL C 111 ? 0.4888 0.4775 0.4404 0.0020  0.0000  0.0337  407 VAL A CG1   
1264 C CG2   . VAL C 111 ? 0.4928 0.4707 0.4166 -0.0056 0.0051  0.0477  407 VAL A CG2   
1265 N N     . ASP C 112 ? 0.4408 0.4531 0.3973 0.0138  -0.0212 0.0415  408 ASP A N     
1266 C CA    . ASP C 112 ? 0.5615 0.5862 0.5328 0.0157  -0.0237 0.0343  408 ASP A CA    
1267 C C     . ASP C 112 ? 0.4809 0.4997 0.4679 0.0206  -0.0187 0.0311  408 ASP A C     
1268 O O     . ASP C 112 ? 0.5132 0.5410 0.5121 0.0216  -0.0183 0.0254  408 ASP A O     
1269 C CB    . ASP C 112 ? 0.7111 0.7509 0.6869 0.0194  -0.0347 0.0394  408 ASP A CB    
1270 C CG    . ASP C 112 ? 0.8013 0.8358 0.7825 0.0288  -0.0397 0.0519  408 ASP A CG    
1271 O OD1   . ASP C 112 ? 0.8462 0.8624 0.8241 0.0308  -0.0336 0.0563  408 ASP A OD1   
1272 O OD2   . ASP C 112 ? 0.8879 0.9364 0.8785 0.0343  -0.0500 0.0574  408 ASP A OD2   
1273 N N     . ASP C 113 ? 0.3169 0.3206 0.3034 0.0226  -0.0140 0.0338  409 ASP A N     
1274 C CA    . ASP C 113 ? 0.2749 0.2720 0.2717 0.0250  -0.0085 0.0282  409 ASP A CA    
1275 C C     . ASP C 113 ? 0.2858 0.2680 0.2763 0.0210  -0.0032 0.0269  409 ASP A C     
1276 O O     . ASP C 113 ? 0.2945 0.2713 0.2762 0.0173  -0.0027 0.0318  409 ASP A O     
1277 C CB    . ASP C 113 ? 0.3987 0.3951 0.4098 0.0342  -0.0094 0.0314  409 ASP A CB    
1278 C CG    . ASP C 113 ? 0.4790 0.4621 0.4890 0.0393  -0.0112 0.0418  409 ASP A CG    
1279 O OD1   . ASP C 113 ? 0.5789 0.5598 0.6034 0.0485  -0.0117 0.0453  409 ASP A OD1   
1280 O OD2   . ASP C 113 ? 0.6141 0.5882 0.6101 0.0342  -0.0109 0.0467  409 ASP A OD2   
1281 N N     . VAL C 114 ? 0.3077 0.2845 0.3026 0.0205  0.0012  0.0199  410 VAL A N     
1282 C CA    . VAL C 114 ? 0.2825 0.2484 0.2736 0.0152  0.0048  0.0166  410 VAL A CA    
1283 C C     . VAL C 114 ? 0.2045 0.1554 0.1953 0.0157  0.0068  0.0228  410 VAL A C     
1284 O O     . VAL C 114 ? 0.2819 0.2268 0.2690 0.0091  0.0092  0.0233  410 VAL A O     
1285 C CB    . VAL C 114 ? 0.2787 0.2417 0.2714 0.0143  0.0076  0.0077  410 VAL A CB    
1286 C CG1   . VAL C 114 ? 0.2906 0.2426 0.2810 0.0083  0.0098  0.0035  410 VAL A CG1   
1287 C CG2   . VAL C 114 ? 0.2290 0.2036 0.2188 0.0122  0.0059  0.0040  410 VAL A CG2   
1288 N N     . ALA C 115 ? 0.2090 0.1534 0.2058 0.0235  0.0064  0.0280  411 ALA A N     
1289 C CA    . ALA C 115 ? 0.2410 0.1663 0.2381 0.0249  0.0090  0.0352  411 ALA A CA    
1290 C C     . ALA C 115 ? 0.3449 0.2694 0.3307 0.0210  0.0070  0.0460  411 ALA A C     
1291 O O     . ALA C 115 ? 0.2780 0.1881 0.2594 0.0151  0.0118  0.0492  411 ALA A O     
1292 C CB    . ALA C 115 ? 0.2491 0.1682 0.2582 0.0365  0.0084  0.0400  411 ALA A CB    
1293 N N     . ALA C 116 ? 0.3648 0.3047 0.3447 0.0229  0.0007  0.0510  412 ALA A N     
1294 C CA    . ALA C 116 ? 0.3709 0.3102 0.3351 0.0181  -0.0003 0.0602  412 ALA A CA    
1295 C C     . ALA C 116 ? 0.3792 0.3200 0.3378 0.0072  0.0065  0.0535  412 ALA A C     
1296 O O     . ALA C 116 ? 0.2822 0.2144 0.2311 0.0011  0.0114  0.0595  412 ALA A O     
1297 C CB    . ALA C 116 ? 0.3737 0.3303 0.3308 0.0208  -0.0089 0.0641  412 ALA A CB    
1298 N N     . ALA C 117 ? 0.2966 0.2484 0.2624 0.0049  0.0073  0.0416  413 ALA A N     
1299 C CA    . ALA C 117 ? 0.3176 0.2735 0.2837 -0.0036 0.0127  0.0355  413 ALA A CA    
1300 C C     . ALA C 117 ? 0.3294 0.2728 0.3024 -0.0089 0.0180  0.0336  413 ALA A C     
1301 O O     . ALA C 117 ? 0.2825 0.2247 0.2549 -0.0168 0.0240  0.0342  413 ALA A O     
1302 C CB    . ALA C 117 ? 0.3053 0.2752 0.2782 -0.0033 0.0107  0.0256  413 ALA A CB    
1303 N N     . ALA C 118 ? 0.3727 0.3070 0.3528 -0.0057 0.0169  0.0300  414 ALA A N     
1304 C CA    . ALA C 118 ? 0.3755 0.2966 0.3616 -0.0121 0.0216  0.0259  414 ALA A CA    
1305 C C     . ALA C 118 ? 0.3231 0.2262 0.3047 -0.0153 0.0272  0.0362  414 ALA A C     
1306 O O     . ALA C 118 ? 0.3258 0.2217 0.3114 -0.0251 0.0333  0.0342  414 ALA A O     
1307 C CB    . ALA C 118 ? 0.3466 0.2594 0.3379 -0.0080 0.0205  0.0186  414 ALA A CB    
1308 N N     . LYS C 119 ? 0.2699 0.1655 0.2438 -0.0074 0.0249  0.0480  415 LYS A N     
1309 C CA    . LYS C 119 ? 0.3676 0.2440 0.3337 -0.0095 0.0295  0.0613  415 LYS A CA    
1310 C C     . LYS C 119 ? 0.4497 0.3322 0.4056 -0.0200 0.0352  0.0648  415 LYS A C     
1311 O O     . LYS C 119 ? 0.4359 0.3018 0.3867 -0.0269 0.0428  0.0729  415 LYS A O     
1312 C CB    . LYS C 119 ? 0.3843 0.2560 0.3441 0.0025  0.0227  0.0748  415 LYS A CB    
1313 C CG    . LYS C 119 ? 0.6843 0.5300 0.6376 0.0040  0.0258  0.0910  415 LYS A CG    
1314 C CD    . LYS C 119 ? 0.6995 0.5422 0.6546 0.0192  0.0167  0.1030  415 LYS A CD    
1315 C CE    . LYS C 119 ? 0.7651 0.5893 0.7083 0.0202  0.0151  0.1206  415 LYS A CE    
1316 N NZ    . LYS C 119 ? 0.8410 0.6389 0.7918 0.0152  0.0234  0.1192  415 LYS A NZ    
1317 N N     . MET C 120 ? 0.4724 0.3773 0.4262 -0.0217 0.0334  0.0584  416 MET A N     
1318 C CA    . MET C 120 ? 0.5111 0.4229 0.4587 -0.0318 0.0416  0.0586  416 MET A CA    
1319 C C     . MET C 120 ? 0.4557 0.3650 0.4187 -0.0426 0.0500  0.0514  416 MET A C     
1320 O O     . MET C 120 ? 0.4567 0.3662 0.4171 -0.0524 0.0600  0.0538  416 MET A O     
1321 C CB    . MET C 120 ? 0.5023 0.4371 0.4491 -0.0307 0.0394  0.0505  416 MET A CB    
1322 C CG    . MET C 120 ? 0.5545 0.4946 0.4846 -0.0240 0.0323  0.0563  416 MET A CG    
1323 S SD    . MET C 120 ? 0.6293 0.5921 0.5632 -0.0227 0.0300  0.0434  416 MET A SD    
1324 C CE    . MET C 120 ? 0.5932 0.5621 0.5220 -0.0334 0.0438  0.0397  416 MET A CE    
1325 N N     . LYS C 121 ? 0.4493 0.3569 0.4279 -0.0420 0.0465  0.0420  417 LYS A N     
1326 C CA    . LYS C 121 ? 0.2614 0.1701 0.2567 -0.0530 0.0514  0.0329  417 LYS A CA    
1327 C C     . LYS C 121 ? 0.4140 0.2987 0.4133 -0.0556 0.0529  0.0323  417 LYS A C     
1328 O O     . LYS C 121 ? 0.4039 0.2906 0.4170 -0.0624 0.0522  0.0205  417 LYS A O     
1329 C CB    . LYS C 121 ? 0.2909 0.2227 0.3005 -0.0524 0.0447  0.0197  417 LYS A CB    
1330 C CG    . LYS C 121 ? 0.3653 0.3187 0.3757 -0.0502 0.0450  0.0184  417 LYS A CG    
1331 C CD    . LYS C 121 ? 0.4248 0.3840 0.4406 -0.0604 0.0568  0.0198  417 LYS A CD    
1332 C CE    . LYS C 121 ? 0.5136 0.4923 0.5307 -0.0576 0.0594  0.0168  417 LYS A CE    
1333 N NZ    . LYS C 121 ? 0.5007 0.4868 0.5252 -0.0679 0.0735  0.0163  417 LYS A NZ    
1334 N N     . GLN C 122 ? 0.4258 0.2873 0.4136 -0.0500 0.0546  0.0445  418 GLN A N     
1335 C CA    . GLN C 122 ? 0.4196 0.2531 0.4120 -0.0518 0.0585  0.0448  418 GLN A CA    
1336 C C     . GLN C 122 ? 0.4228 0.2569 0.4245 -0.0478 0.0529  0.0302  418 GLN A C     
1337 O O     . GLN C 122 ? 0.4330 0.2494 0.4423 -0.0542 0.0571  0.0223  418 GLN A O     
1338 C CB    . GLN C 122 ? 0.5445 0.3669 0.5447 -0.0684 0.0694  0.0433  418 GLN A CB    
1339 C CG    . GLN C 122 ? 0.5489 0.3743 0.5388 -0.0734 0.0756  0.0560  418 GLN A CG    
1340 C CD    . GLN C 122 ? 0.7360 0.5490 0.7053 -0.0621 0.0725  0.0744  418 GLN A CD    
1341 O OE1   . GLN C 122 ? 0.9648 0.7887 0.9222 -0.0540 0.0678  0.0794  418 GLN A OE1   
1342 N NE2   . GLN C 122 ? 0.6550 0.4460 0.6203 -0.0619 0.0740  0.0845  418 GLN A NE2   
1343 N N     . TYR C 123 ? 0.4125 0.2660 0.4124 -0.0386 0.0444  0.0257  419 TYR A N     
1344 C CA    . TYR C 123 ? 0.4039 0.2584 0.4079 -0.0344 0.0402  0.0132  419 TYR A CA    
1345 C C     . TYR C 123 ? 0.4037 0.2485 0.4042 -0.0197 0.0385  0.0202  419 TYR A C     
1346 O O     . TYR C 123 ? 0.3012 0.1604 0.2968 -0.0113 0.0332  0.0276  419 TYR A O     
1347 C CB    . TYR C 123 ? 0.3236 0.2058 0.3289 -0.0351 0.0328  0.0041  419 TYR A CB    
1348 C CG    . TYR C 123 ? 0.3295 0.2131 0.3346 -0.0341 0.0291  -0.0090 419 TYR A CG    
1349 C CD1   . TYR C 123 ? 0.3260 0.2155 0.3352 -0.0450 0.0266  -0.0216 419 TYR A CD1   
1350 C CD2   . TYR C 123 ? 0.2726 0.1534 0.2732 -0.0230 0.0280  -0.0091 419 TYR A CD2   
1351 C CE1   . TYR C 123 ? 0.3854 0.2759 0.3890 -0.0451 0.0230  -0.0334 419 TYR A CE1   
1352 C CE2   . TYR C 123 ? 0.2678 0.1493 0.2648 -0.0231 0.0267  -0.0214 419 TYR A CE2   
1353 C CZ    . TYR C 123 ? 0.4117 0.2971 0.4076 -0.0344 0.0241  -0.0333 419 TYR A CZ    
1354 O OH    . TYR C 123 ? 0.3781 0.2636 0.3651 -0.0356 0.0227  -0.0453 419 TYR A OH    
1355 N N     . GLU C 124 ? 0.2792 0.1003 0.2844 -0.0167 0.0433  0.0174  420 GLU A N     
1356 C CA    . GLU C 124 ? 0.4025 0.2156 0.4102 -0.0014 0.0423  0.0244  420 GLU A CA    
1357 C C     . GLU C 124 ? 0.4823 0.2906 0.4962 0.0029  0.0451  0.0096  420 GLU A C     
1358 O O     . GLU C 124 ? 0.4927 0.2889 0.5145 0.0149  0.0478  0.0127  420 GLU A O     
1359 C CB    . GLU C 124 ? 0.4609 0.2468 0.4700 0.0027  0.0469  0.0396  420 GLU A CB    
1360 C CG    . GLU C 124 ? 0.5609 0.3502 0.5589 -0.0028 0.0458  0.0548  420 GLU A CG    
1361 C CD    . GLU C 124 ? 0.8009 0.5732 0.7953 0.0031  0.0448  0.0715  420 GLU A CD    
1362 O OE1   . GLU C 124 ? 0.8642 0.6275 0.8670 0.0150  0.0423  0.0732  420 GLU A OE1   
1363 O OE2   . GLU C 124 ? 0.8091 0.5792 0.7923 -0.0044 0.0462  0.0823  420 GLU A OE2   
1364 N N     . ALA C 125 ? 0.3923 0.2104 0.4026 -0.0064 0.0445  -0.0063 421 ALA A N     
1365 C CA    . ALA C 125 ? 0.4357 0.2493 0.4464 -0.0044 0.0482  -0.0215 421 ALA A CA    
1366 C C     . ALA C 125 ? 0.4130 0.2489 0.4213 0.0043  0.0440  -0.0222 421 ALA A C     
1367 O O     . ALA C 125 ? 0.3970 0.2409 0.3979 0.0006  0.0442  -0.0349 421 ALA A O     
1368 C CB    . ALA C 125 ? 0.3720 0.1844 0.3764 -0.0198 0.0487  -0.0380 421 ALA A CB    
1369 N N     . VAL C 126 ? 0.3775 0.2236 0.3907 0.0148  0.0400  -0.0085 422 VAL A N     
1370 C CA    . VAL C 126 ? 0.3705 0.2384 0.3843 0.0218  0.0363  -0.0081 422 VAL A CA    
1371 C C     . VAL C 126 ? 0.4270 0.2968 0.4524 0.0350  0.0340  0.0053  422 VAL A C     
1372 O O     . VAL C 126 ? 0.4427 0.3066 0.4679 0.0364  0.0306  0.0185  422 VAL A O     
1373 C CB    . VAL C 126 ? 0.3407 0.2305 0.3446 0.0149  0.0287  -0.0070 422 VAL A CB    
1374 C CG1   . VAL C 126 ? 0.2907 0.1839 0.2933 0.0133  0.0242  0.0057  422 VAL A CG1   
1375 C CG2   . VAL C 126 ? 0.2653 0.1741 0.2695 0.0202  0.0264  -0.0080 422 VAL A CG2   
1376 N N     . ARG C 127 ? 0.2775 0.1569 0.3133 0.0442  0.0360  0.0023  423 ARG A N     
1377 C CA    . ARG C 127 ? 0.2698 0.1545 0.3209 0.0573  0.0319  0.0150  423 ARG A CA    
1378 C C     . ARG C 127 ? 0.2266 0.1378 0.2745 0.0571  0.0218  0.0224  423 ARG A C     
1379 O O     . ARG C 127 ? 0.2401 0.1658 0.2796 0.0500  0.0211  0.0152  423 ARG A O     
1380 C CB    . ARG C 127 ? 0.3486 0.2325 0.4192 0.0682  0.0397  0.0081  423 ARG A CB    
1381 C CG    . ARG C 127 ? 0.4372 0.2936 0.5116 0.0687  0.0512  -0.0017 423 ARG A CG    
1382 C CD    . ARG C 127 ? 0.5691 0.4331 0.6541 0.0733  0.0598  -0.0148 423 ARG A CD    
1383 N NE    . ARG C 127 ? 0.6191 0.4968 0.7270 0.0870  0.0562  -0.0062 423 ARG A NE    
1384 C CZ    . ARG C 127 ? 0.6936 0.5866 0.8157 0.0922  0.0622  -0.0141 423 ARG A CZ    
1385 N NH1   . ARG C 127 ? 0.7467 0.6535 0.8917 0.1044  0.0575  -0.0060 423 ARG A NH1   
1386 N NH2   . ARG C 127 ? 0.5693 0.4647 0.6814 0.0845  0.0726  -0.0297 423 ARG A NH2   
1387 N N     . PRO C 128 ? 0.3093 0.2262 0.3630 0.0645  0.0136  0.0369  424 PRO A N     
1388 C CA    . PRO C 128 ? 0.2979 0.2406 0.3497 0.0640  0.0041  0.0415  424 PRO A CA    
1389 C C     . PRO C 128 ? 0.3438 0.3055 0.4124 0.0687  0.0061  0.0335  424 PRO A C     
1390 O O     . PRO C 128 ? 0.3050 0.2631 0.3926 0.0777  0.0122  0.0302  424 PRO A O     
1391 C CB    . PRO C 128 ? 0.3037 0.2459 0.3575 0.0717  -0.0055 0.0589  424 PRO A CB    
1392 C CG    . PRO C 128 ? 0.3686 0.2809 0.4200 0.0735  -0.0001 0.0649  424 PRO A CG    
1393 C CD    . PRO C 128 ? 0.3488 0.2476 0.4094 0.0733  0.0121  0.0501  424 PRO A CD    
1394 N N     . ASP C 129 ? 0.3193 0.3004 0.3821 0.0620  0.0025  0.0298  425 ASP A N     
1395 C CA    . ASP C 129 ? 0.3180 0.3172 0.3959 0.0638  0.0059  0.0223  425 ASP A CA    
1396 C C     . ASP C 129 ? 0.3748 0.3873 0.4798 0.0762  0.0019  0.0282  425 ASP A C     
1397 O O     . ASP C 129 ? 0.2695 0.2898 0.3948 0.0813  0.0098  0.0210  425 ASP A O     
1398 C CB    . ASP C 129 ? 0.3367 0.3526 0.4051 0.0546  0.0015  0.0198  425 ASP A CB    
1399 C CG    . ASP C 129 ? 0.4846 0.4907 0.5332 0.0445  0.0068  0.0126  425 ASP A CG    
1400 O OD1   . ASP C 129 ? 0.3919 0.3837 0.4360 0.0438  0.0145  0.0066  425 ASP A OD1   
1401 O OD2   . ASP C 129 ? 0.5029 0.5158 0.5412 0.0375  0.0028  0.0127  425 ASP A OD2   
1402 N N     . GLU C 130 ? 0.3739 0.3904 0.4803 0.0813  -0.0104 0.0416  426 GLU A N     
1403 C CA    . GLU C 130 ? 0.4187 0.4518 0.5532 0.0940  -0.0176 0.0490  426 GLU A CA    
1404 C C     . GLU C 130 ? 0.3520 0.3690 0.5047 0.1057  -0.0090 0.0479  426 GLU A C     
1405 O O     . GLU C 130 ? 0.4147 0.4460 0.5905 0.1131  -0.0088 0.0447  426 GLU A O     
1406 C CB    . GLU C 130 ? 0.5217 0.5616 0.6477 0.0961  -0.0345 0.0649  426 GLU A CB    
1407 C CG    . GLU C 130 ? 0.7387 0.7917 0.8843 0.1067  -0.0444 0.0706  426 GLU A CG    
1408 C CD    . GLU C 130 ? 0.8929 0.9573 1.0232 0.1044  -0.0623 0.0817  426 GLU A CD    
1409 O OE1   . GLU C 130 ? 0.8957 0.9727 1.0106 0.0936  -0.0673 0.0803  426 GLU A OE1   
1410 O OE2   . GLU C 130 ? 0.9462 1.0063 1.0781 0.1132  -0.0709 0.0914  426 GLU A OE2   
1411 N N     . ALA C 131 ? 0.3759 0.3627 0.5147 0.1046  -0.0015 0.0475  427 ALA A N     
1412 C CA    . ALA C 131 ? 0.4000 0.3687 0.5496 0.1116  0.0076  0.0422  427 ALA A CA    
1413 C C     . ALA C 131 ? 0.3763 0.3491 0.5367 0.1102  0.0227  0.0247  427 ALA A C     
1414 O O     . ALA C 131 ? 0.3840 0.3550 0.5611 0.1176  0.0293  0.0194  427 ALA A O     
1415 C CB    . ALA C 131 ? 0.4372 0.3727 0.5684 0.1078  0.0119  0.0448  427 ALA A CB    
1416 N N     . VAL C 132 ? 0.3442 0.3217 0.4934 0.1006  0.0290  0.0159  428 VAL A N     
1417 C CA    . VAL C 132 ? 0.3017 0.2813 0.4534 0.0969  0.0439  -0.0006 428 VAL A CA    
1418 C C     . VAL C 132 ? 0.3672 0.3771 0.5408 0.0997  0.0439  -0.0028 428 VAL A C     
1419 O O     . VAL C 132 ? 0.3793 0.3932 0.5669 0.1033  0.0536  -0.0111 428 VAL A O     
1420 C CB    . VAL C 132 ? 0.3589 0.3309 0.4811 0.0825  0.0483  -0.0089 428 VAL A CB    
1421 C CG1   . VAL C 132 ? 0.4450 0.4188 0.5653 0.0782  0.0637  -0.0244 428 VAL A CG1   
1422 C CG2   . VAL C 132 ? 0.4244 0.3693 0.5260 0.0774  0.0477  -0.0083 428 VAL A CG2   
1423 N N     . TYR C 133 ? 0.4058 0.4378 0.5832 0.0970  0.0334  0.0042  429 TYR A N     
1424 C CA    . TYR C 133 ? 0.3062 0.3682 0.5035 0.0958  0.0334  0.0008  429 TYR A CA    
1425 C C     . TYR C 133 ? 0.3592 0.4412 0.5803 0.1054  0.0205  0.0097  429 TYR A C     
1426 O O     . TYR C 133 ? 0.3779 0.4859 0.6193 0.1049  0.0208  0.0061  429 TYR A O     
1427 C CB    . TYR C 133 ? 0.3504 0.4244 0.5311 0.0826  0.0282  0.0006  429 TYR A CB    
1428 C CG    . TYR C 133 ? 0.3621 0.4163 0.5093 0.0707  0.0365  -0.0069 429 TYR A CG    
1429 C CD1   . TYR C 133 ? 0.3969 0.4394 0.5164 0.0631  0.0279  -0.0021 429 TYR A CD1   
1430 C CD2   . TYR C 133 ? 0.3509 0.3993 0.4946 0.0671  0.0529  -0.0185 429 TYR A CD2   
1431 C CE1   . TYR C 133 ? 0.3087 0.3363 0.4018 0.0535  0.0335  -0.0079 429 TYR A CE1   
1432 C CE2   . TYR C 133 ? 0.3338 0.3659 0.4459 0.0566  0.0579  -0.0238 429 TYR A CE2   
1433 C CZ    . TYR C 133 ? 0.3991 0.4217 0.4880 0.0504  0.0472  -0.0180 429 TYR A CZ    
1434 O OH    . TYR C 133 ? 0.3088 0.3181 0.3702 0.0412  0.0505  -0.0225 429 TYR A OH    
1435 N N     . GLY C 134 ? 0.3692 0.4394 0.5873 0.1136  0.0095  0.0212  430 GLY A N     
1436 C CA    . GLY C 134 ? 0.4190 0.5082 0.6548 0.1224  -0.0053 0.0308  430 GLY A CA    
1437 C C     . GLY C 134 ? 0.4660 0.5790 0.6975 0.1150  -0.0202 0.0362  430 GLY A C     
1438 O O     . GLY C 134 ? 0.3943 0.5079 0.6115 0.1039  -0.0178 0.0327  430 GLY A O     
1439 N N     . LYS C 135 ? 0.6392 0.7718 0.8819 0.1207  -0.0360 0.0442  431 LYS A N     
1440 C CA    . LYS C 135 ? 0.6710 0.8266 0.9076 0.1120  -0.0508 0.0470  431 LYS A CA    
1441 C C     . LYS C 135 ? 0.6542 0.8442 0.9197 0.1158  -0.0587 0.0446  431 LYS A C     
1442 O O     . LYS C 135 ? 0.6471 0.8412 0.9328 0.1289  -0.0597 0.0476  431 LYS A O     
1443 C CB    . LYS C 135 ? 0.6827 0.8252 0.8909 0.1112  -0.0661 0.0603  431 LYS A CB    
1444 C CG    . LYS C 135 ? 0.6975 0.8396 0.9106 0.1237  -0.0790 0.0718  431 LYS A CG    
1445 C CD    . LYS C 135 ? 0.7789 0.9107 0.9590 0.1194  -0.0935 0.0841  431 LYS A CD    
1446 C CE    . LYS C 135 ? 0.8713 0.9991 1.0525 0.1322  -0.1061 0.0973  431 LYS A CE    
1447 N NZ    . LYS C 135 ? 0.9174 1.0336 1.0616 0.1264  -0.1183 0.1090  431 LYS A NZ    
1448 N N     . GLY C 136 ? 0.6046 0.8197 0.8729 0.1041  -0.0641 0.0389  432 GLY A N     
1449 C CA    . GLY C 136 ? 0.5730 0.8241 0.8689 0.1049  -0.0715 0.0353  432 GLY A CA    
1450 C C     . GLY C 136 ? 0.6129 0.8778 0.9398 0.1073  -0.0543 0.0264  432 GLY A C     
1451 O O     . GLY C 136 ? 0.6041 0.8583 0.9278 0.0997  -0.0364 0.0180  432 GLY A O     
1452 N N     . ALA C 137 ? 0.5625 0.8508 0.9186 0.1177  -0.0593 0.0281  433 ALA A N     
1453 C CA    . ALA C 137 ? 0.4635 0.7654 0.8502 0.1201  -0.0423 0.0199  433 ALA A CA    
1454 C C     . ALA C 137 ? 0.5264 0.7955 0.9060 0.1250  -0.0220 0.0153  433 ALA A C     
1455 O O     . ALA C 137 ? 0.5934 0.8613 0.9783 0.1180  -0.0030 0.0048  433 ALA A O     
1456 C CB    . ALA C 137 ? 0.2717 0.6014 0.6917 0.1338  -0.0522 0.0243  433 ALA A CB    
1457 N N     . LYS C 138 ? 0.5080 0.7486 0.8730 0.1357  -0.0253 0.0226  434 LYS A N     
1458 C CA    . LYS C 138 ? 0.5680 0.7770 0.9253 0.1396  -0.0068 0.0172  434 LYS A CA    
1459 C C     . LYS C 138 ? 0.5509 0.7392 0.8800 0.1258  0.0050  0.0101  434 LYS A C     
1460 O O     . LYS C 138 ? 0.4905 0.6543 0.8103 0.1263  0.0211  0.0032  434 LYS A O     
1461 C CB    . LYS C 138 ? 0.6009 0.7837 0.9497 0.1527  -0.0139 0.0275  434 LYS A CB    
1462 C CG    . LYS C 138 ? 0.5953 0.7919 0.9735 0.1694  -0.0218 0.0340  434 LYS A CG    
1463 C CD    . LYS C 138 ? 0.6151 0.8426 1.0011 0.1709  -0.0447 0.0433  434 LYS A CD    
1464 C CE    . LYS C 138 ? 0.6178 0.8617 1.0356 0.1886  -0.0529 0.0498  434 LYS A CE    
1465 N NZ    . LYS C 138 ? 0.6224 0.8837 1.0754 0.1926  -0.0360 0.0384  434 LYS A NZ    
1466 N N     . ARG C 139 ? 0.5417 0.7388 0.8565 0.1136  -0.0027 0.0112  435 ARG A N     
1467 C CA    . ARG C 139 ? 0.4847 0.6627 0.7739 0.1018  0.0073  0.0056  435 ARG A CA    
1468 C C     . ARG C 139 ? 0.5179 0.6959 0.8118 0.0952  0.0286  -0.0074 435 ARG A C     
1469 O O     . ARG C 139 ? 0.6777 0.8802 0.9909 0.0903  0.0323  -0.0120 435 ARG A O     
1470 C CB    . ARG C 139 ? 0.4053 0.5955 0.6828 0.0901  -0.0050 0.0086  435 ARG A CB    
1471 C CG    . ARG C 139 ? 0.4639 0.6341 0.7156 0.0796  0.0025  0.0050  435 ARG A CG    
1472 C CD    . ARG C 139 ? 0.4818 0.6591 0.7169 0.0693  -0.0121 0.0093  435 ARG A CD    
1473 N NE    . ARG C 139 ? 0.4946 0.6493 0.6939 0.0568  -0.0043 0.0042  435 ARG A NE    
1474 C CZ    . ARG C 139 ? 0.5757 0.7052 0.7443 0.0561  -0.0066 0.0085  435 ARG A CZ    
1475 N NH1   . ARG C 139 ? 0.7427 0.8634 0.9086 0.0657  -0.0151 0.0182  435 ARG A NH1   
1476 N NH2   . ARG C 139 ? 0.5822 0.6954 0.7241 0.0458  -0.0002 0.0039  435 ARG A NH2   
1477 N N     . ALA C 140 ? 0.4188 0.5687 0.6930 0.0940  0.0425  -0.0133 436 ALA A N     
1478 C CA    . ALA C 140 ? 0.4073 0.5530 0.6778 0.0872  0.0628  -0.0253 436 ALA A CA    
1479 C C     . ALA C 140 ? 0.4622 0.5769 0.6995 0.0819  0.0723  -0.0303 436 ALA A C     
1480 O O     . ALA C 140 ? 0.3290 0.4233 0.5540 0.0872  0.0667  -0.0260 436 ALA A O     
1481 C CB    . ALA C 140 ? 0.4353 0.5865 0.7295 0.0967  0.0722  -0.0301 436 ALA A CB    
1482 N N     . VAL C 141 ? 0.4666 0.5774 0.6878 0.0705  0.0864  -0.0388 437 VAL A N     
1483 C CA    . VAL C 141 ? 0.4485 0.5316 0.6354 0.0645  0.0953  -0.0445 437 VAL A CA    
1484 C C     . VAL C 141 ? 0.3746 0.4418 0.5610 0.0707  0.1056  -0.0518 437 VAL A C     
1485 O O     . VAL C 141 ? 0.3539 0.4314 0.5573 0.0728  0.1157  -0.0574 437 VAL A O     
1486 C CB    . VAL C 141 ? 0.4115 0.4949 0.5774 0.0501  0.1055  -0.0493 437 VAL A CB    
1487 C CG1   . VAL C 141 ? 0.4182 0.4752 0.5450 0.0434  0.1101  -0.0531 437 VAL A CG1   
1488 C CG2   . VAL C 141 ? 0.4655 0.5666 0.6385 0.0437  0.0967  -0.0431 437 VAL A CG2   
1489 N N     . PRO C 142 ? 0.4190 0.4615 0.5883 0.0733  0.1041  -0.0527 438 PRO A N     
1490 C CA    . PRO C 142 ? 0.4450 0.4709 0.6144 0.0780  0.1139  -0.0607 438 PRO A CA    
1491 C C     . PRO C 142 ? 0.4612 0.4748 0.6022 0.0667  0.1286  -0.0729 438 PRO A C     
1492 O O     . PRO C 142 ? 0.4337 0.4474 0.5503 0.0555  0.1297  -0.0735 438 PRO A O     
1493 C CB    . PRO C 142 ? 0.4026 0.4066 0.5637 0.0828  0.1047  -0.0558 438 PRO A CB    
1494 C CG    . PRO C 142 ? 0.3888 0.3909 0.5287 0.0748  0.0964  -0.0507 438 PRO A CG    
1495 C CD    . PRO C 142 ? 0.3495 0.3785 0.5014 0.0718  0.0930  -0.0461 438 PRO A CD    
1496 N N     . ASP C 143 ? 0.5384 0.5406 0.6817 0.0698  0.1397  -0.0822 439 ASP A N     
1497 C CA    . ASP C 143 ? 0.5572 0.5474 0.6729 0.0593  0.1535  -0.0944 439 ASP A CA    
1498 C C     . ASP C 143 ? 0.5215 0.4949 0.5977 0.0481  0.1482  -0.0954 439 ASP A C     
1499 O O     . ASP C 143 ? 0.5397 0.5047 0.6121 0.0499  0.1364  -0.0894 439 ASP A O     
1500 C CB    . ASP C 143 ? 0.6218 0.5982 0.7457 0.0650  0.1644  -0.1046 439 ASP A CB    
1501 C CG    . ASP C 143 ? 0.8247 0.8187 0.9832 0.0737  0.1741  -0.1070 439 ASP A CG    
1502 O OD1   . ASP C 143 ? 0.8586 0.8768 1.0356 0.0747  0.1713  -0.1004 439 ASP A OD1   
1503 O OD2   . ASP C 143 ? 0.9511 0.9352 1.1196 0.0792  0.1848  -0.1159 439 ASP A OD2   
1504 N N     . GLU C 144 ? 0.4699 0.4388 0.5163 0.0364  0.1565  -0.1024 440 GLU A N     
1505 C CA    . GLU C 144 ? 0.4605 0.4174 0.4690 0.0255  0.1494  -0.1018 440 GLU A CA    
1506 C C     . GLU C 144 ? 0.4661 0.4032 0.4642 0.0257  0.1426  -0.1055 440 GLU A C     
1507 O O     . GLU C 144 ? 0.3877 0.3204 0.3714 0.0218  0.1308  -0.1001 440 GLU A O     
1508 C CB    . GLU C 144 ? 0.4957 0.4498 0.4729 0.0137  0.1589  -0.1083 440 GLU A CB    
1509 C CG    . GLU C 144 ? 0.4563 0.4001 0.3939 0.0028  0.1493  -0.1064 440 GLU A CG    
1510 C CD    . GLU C 144 ? 0.6777 0.6206 0.5837 -0.0081 0.1563  -0.1089 440 GLU A CD    
1511 O OE1   . GLU C 144 ? 0.7031 0.6346 0.5879 -0.0135 0.1614  -0.1191 440 GLU A OE1   
1512 O OE2   . GLU C 144 ? 0.6918 0.6447 0.5939 -0.0116 0.1570  -0.1004 440 GLU A OE2   
1513 N N     . PRO C 145 ? 0.4149 0.3390 0.4192 0.0289  0.1497  -0.1150 441 PRO A N     
1514 C CA    . PRO C 145 ? 0.4715 0.3757 0.4659 0.0272  0.1431  -0.1184 441 PRO A CA    
1515 C C     . PRO C 145 ? 0.4796 0.3831 0.4923 0.0348  0.1307  -0.1069 441 PRO A C     
1516 O O     . PRO C 145 ? 0.4828 0.3770 0.4795 0.0289  0.1210  -0.1049 441 PRO A O     
1517 C CB    . PRO C 145 ? 0.4802 0.3722 0.4858 0.0313  0.1553  -0.1297 441 PRO A CB    
1518 C CG    . PRO C 145 ? 0.4584 0.3617 0.4643 0.0300  0.1691  -0.1357 441 PRO A CG    
1519 C CD    . PRO C 145 ? 0.4621 0.3876 0.4807 0.0329  0.1652  -0.1240 441 PRO A CD    
1520 N N     . VAL C 146 ? 0.4130 0.3270 0.4590 0.0474  0.1303  -0.0989 442 VAL A N     
1521 C CA    . VAL C 146 ? 0.3547 0.2691 0.4166 0.0549  0.1178  -0.0860 442 VAL A CA    
1522 C C     . VAL C 146 ? 0.4035 0.3295 0.4534 0.0495  0.1088  -0.0783 442 VAL A C     
1523 O O     . VAL C 146 ? 0.3952 0.3132 0.4378 0.0477  0.0992  -0.0725 442 VAL A O     
1524 C CB    . VAL C 146 ? 0.4551 0.3814 0.5541 0.0697  0.1172  -0.0781 442 VAL A CB    
1525 C CG1   . VAL C 146 ? 0.4743 0.4037 0.5857 0.0765  0.1025  -0.0627 442 VAL A CG1   
1526 C CG2   . VAL C 146 ? 0.4882 0.3994 0.5996 0.0761  0.1256  -0.0849 442 VAL A CG2   
1527 N N     . LEU C 147 ? 0.4079 0.3519 0.4559 0.0463  0.1127  -0.0782 443 LEU A N     
1528 C CA    . LEU C 147 ? 0.3360 0.2900 0.3731 0.0411  0.1054  -0.0711 443 LEU A CA    
1529 C C     . LEU C 147 ? 0.3672 0.3067 0.3693 0.0300  0.1010  -0.0746 443 LEU A C     
1530 O O     . LEU C 147 ? 0.3156 0.2559 0.3121 0.0277  0.0869  -0.0652 443 LEU A O     
1531 C CB    . LEU C 147 ? 0.3205 0.2934 0.3598 0.0374  0.1121  -0.0709 443 LEU A CB    
1532 C CG    . LEU C 147 ? 0.3815 0.3616 0.4044 0.0297  0.1067  -0.0645 443 LEU A CG    
1533 C CD1   . LEU C 147 ? 0.2877 0.2780 0.3275 0.0345  0.0899  -0.0514 443 LEU A CD1   
1534 C CD2   . LEU C 147 ? 0.3135 0.3075 0.3350 0.0236  0.1151  -0.0646 443 LEU A CD2   
1535 N N     . ALA C 148 ? 0.4000 0.3307 0.3785 0.0216  0.1069  -0.0845 444 ALA A N     
1536 C CA    . ALA C 148 ? 0.4203 0.3414 0.3653 0.0102  0.1000  -0.0875 444 ALA A CA    
1537 C C     . ALA C 148 ? 0.5047 0.4115 0.4510 0.0099  0.0917  -0.0883 444 ALA A C     
1538 O O     . ALA C 148 ? 0.3576 0.2642 0.2881 0.0029  0.0796  -0.0843 444 ALA A O     
1539 C CB    . ALA C 148 ? 0.4553 0.3713 0.3768 0.0019  0.1070  -0.0976 444 ALA A CB    
1540 N N     . GLU C 149 ? 0.4652 0.3620 0.4320 0.0170  0.0956  -0.0908 445 GLU A N     
1541 C CA    . GLU C 149 ? 0.4639 0.3455 0.4333 0.0159  0.0887  -0.0899 445 GLU A CA    
1542 C C     . GLU C 149 ? 0.4141 0.3042 0.3954 0.0200  0.0768  -0.0744 445 GLU A C     
1543 O O     . GLU C 149 ? 0.4789 0.3662 0.4518 0.0133  0.0663  -0.0704 445 GLU A O     
1544 C CB    . GLU C 149 ? 0.4385 0.3065 0.4270 0.0228  0.0953  -0.0931 445 GLU A CB    
1545 C CG    . GLU C 149 ? 0.5081 0.3602 0.5033 0.0224  0.0888  -0.0884 445 GLU A CG    
1546 C CD    . GLU C 149 ? 0.7048 0.5381 0.7075 0.0235  0.0954  -0.0953 445 GLU A CD    
1547 O OE1   . GLU C 149 ? 0.7118 0.5448 0.7193 0.0274  0.1055  -0.1032 445 GLU A OE1   
1548 O OE2   . GLU C 149 ? 0.6499 0.4683 0.6542 0.0199  0.0912  -0.0929 445 GLU A OE2   
1549 N N     . HIS C 150 ? 0.4294 0.3342 0.4308 0.0299  0.0762  -0.0644 446 HIS A N     
1550 C CA    . HIS C 150 ? 0.3985 0.3147 0.4083 0.0325  0.0629  -0.0488 446 HIS A CA    
1551 C C     . HIS C 150 ? 0.3478 0.2748 0.3385 0.0230  0.0535  -0.0452 446 HIS A C     
1552 O O     . HIS C 150 ? 0.3083 0.2352 0.2957 0.0196  0.0438  -0.0385 446 HIS A O     
1553 C CB    . HIS C 150 ? 0.3171 0.2497 0.3508 0.0432  0.0632  -0.0409 446 HIS A CB    
1554 C CG    . HIS C 150 ? 0.3661 0.3102 0.4057 0.0452  0.0499  -0.0265 446 HIS A CG    
1555 N ND1   . HIS C 150 ? 0.3638 0.2975 0.4029 0.0459  0.0428  -0.0185 446 HIS A ND1   
1556 C CD2   . HIS C 150 ? 0.3470 0.3112 0.3913 0.0453  0.0436  -0.0197 446 HIS A CD2   
1557 C CE1   . HIS C 150 ? 0.3458 0.2931 0.3868 0.0466  0.0328  -0.0076 446 HIS A CE1   
1558 N NE2   . HIS C 150 ? 0.3361 0.3019 0.3808 0.0462  0.0327  -0.0088 446 HIS A NE2   
1559 N N     . LEU C 151 ? 0.2683 0.2038 0.2468 0.0189  0.0572  -0.0491 447 LEU A N     
1560 C CA    . LEU C 151 ? 0.3632 0.3074 0.3259 0.0118  0.0482  -0.0438 447 LEU A CA    
1561 C C     . LEU C 151 ? 0.3253 0.2612 0.2711 0.0036  0.0412  -0.0473 447 LEU A C     
1562 O O     . LEU C 151 ? 0.2996 0.2418 0.2439 0.0009  0.0308  -0.0403 447 LEU A O     
1563 C CB    . LEU C 151 ? 0.3098 0.2608 0.2608 0.0087  0.0549  -0.0462 447 LEU A CB    
1564 C CG    . LEU C 151 ? 0.3340 0.2971 0.3050 0.0148  0.0623  -0.0437 447 LEU A CG    
1565 C CD1   . LEU C 151 ? 0.2423 0.2125 0.2008 0.0091  0.0669  -0.0424 447 LEU A CD1   
1566 C CD2   . LEU C 151 ? 0.3779 0.3511 0.3703 0.0209  0.0532  -0.0337 447 LEU A CD2   
1567 N N     . VAL C 152 ? 0.3367 0.2595 0.2718 -0.0008 0.0471  -0.0593 448 VAL A N     
1568 C CA    . VAL C 152 ? 0.3535 0.2707 0.2741 -0.0103 0.0395  -0.0644 448 VAL A CA    
1569 C C     . VAL C 152 ? 0.3351 0.2473 0.2715 -0.0099 0.0342  -0.0603 448 VAL A C     
1570 O O     . VAL C 152 ? 0.2820 0.1992 0.2157 -0.0163 0.0244  -0.0582 448 VAL A O     
1571 C CB    . VAL C 152 ? 0.3478 0.2516 0.2503 -0.0169 0.0479  -0.0807 448 VAL A CB    
1572 C CG1   . VAL C 152 ? 0.3430 0.2422 0.2335 -0.0280 0.0388  -0.0876 448 VAL A CG1   
1573 C CG2   . VAL C 152 ? 0.3402 0.2495 0.2212 -0.0194 0.0533  -0.0834 448 VAL A CG2   
1574 N N     . ARG C 153 ? 0.2753 0.1783 0.2293 -0.0023 0.0408  -0.0584 449 ARG A N     
1575 C CA    . ARG C 153 ? 0.3101 0.2071 0.2767 -0.0020 0.0368  -0.0515 449 ARG A CA    
1576 C C     . ARG C 153 ? 0.3256 0.2389 0.2969 -0.0005 0.0276  -0.0384 449 ARG A C     
1577 O O     . ARG C 153 ? 0.2448 0.1588 0.2185 -0.0057 0.0224  -0.0348 449 ARG A O     
1578 C CB    . ARG C 153 ? 0.2933 0.1756 0.2763 0.0074  0.0449  -0.0493 449 ARG A CB    
1579 C CG    . ARG C 153 ? 0.4186 0.2784 0.4000 0.0045  0.0549  -0.0633 449 ARG A CG    
1580 C CD    . ARG C 153 ? 0.4204 0.2633 0.4216 0.0156  0.0626  -0.0591 449 ARG A CD    
1581 N NE    . ARG C 153 ? 0.5117 0.3330 0.5123 0.0121  0.0716  -0.0722 449 ARG A NE    
1582 C CZ    . ARG C 153 ? 0.5398 0.3466 0.5380 0.0030  0.0701  -0.0747 449 ARG A CZ    
1583 N NH1   . ARG C 153 ? 0.4582 0.2649 0.4555 -0.0035 0.0633  -0.0669 449 ARG A NH1   
1584 N NH2   . ARG C 153 ? 0.5461 0.3389 0.5438 -0.0003 0.0763  -0.0852 449 ARG A NH2   
1585 N N     . LYS C 154 ? 0.2529 0.1793 0.2263 0.0054  0.0268  -0.0325 450 LYS A N     
1586 C CA    . LYS C 154 ? 0.3172 0.2574 0.2936 0.0059  0.0194  -0.0226 450 LYS A CA    
1587 C C     . LYS C 154 ? 0.2584 0.2064 0.2252 -0.0014 0.0126  -0.0241 450 LYS A C     
1588 O O     . LYS C 154 ? 0.2792 0.2332 0.2506 -0.0035 0.0075  -0.0192 450 LYS A O     
1589 C CB    . LYS C 154 ? 0.2991 0.2508 0.2808 0.0123  0.0204  -0.0179 450 LYS A CB    
1590 C CG    . LYS C 154 ? 0.3484 0.2990 0.3448 0.0207  0.0224  -0.0125 450 LYS A CG    
1591 C CD    . LYS C 154 ? 0.4152 0.3820 0.4188 0.0244  0.0193  -0.0065 450 LYS A CD    
1592 C CE    . LYS C 154 ? 0.5217 0.4960 0.5252 0.0243  0.0247  -0.0118 450 LYS A CE    
1593 N NZ    . LYS C 154 ? 0.4092 0.3995 0.4223 0.0261  0.0219  -0.0073 450 LYS A NZ    
1594 N N     . ALA C 155 ? 0.3166 0.2647 0.2698 -0.0050 0.0127  -0.0305 451 ALA A N     
1595 C CA    . ALA C 155 ? 0.2537 0.2097 0.1981 -0.0108 0.0040  -0.0304 451 ALA A CA    
1596 C C     . ALA C 155 ? 0.2643 0.2183 0.2120 -0.0180 -0.0007 -0.0350 451 ALA A C     
1597 O O     . ALA C 155 ? 0.2216 0.1864 0.1749 -0.0207 -0.0087 -0.0316 451 ALA A O     
1598 C CB    . ALA C 155 ? 0.2539 0.2091 0.1785 -0.0136 0.0047  -0.0350 451 ALA A CB    
1599 N N     . ALA C 156 ? 0.2749 0.2151 0.2218 -0.0214 0.0049  -0.0434 452 ALA A N     
1600 C CA    . ALA C 156 ? 0.2982 0.2350 0.2499 -0.0302 0.0016  -0.0490 452 ALA A CA    
1601 C C     . ALA C 156 ? 0.3024 0.2417 0.2717 -0.0292 0.0019  -0.0407 452 ALA A C     
1602 O O     . ALA C 156 ? 0.2407 0.1877 0.2181 -0.0363 -0.0031 -0.0415 452 ALA A O     
1603 C CB    . ALA C 156 ? 0.2674 0.1845 0.2141 -0.0344 0.0097  -0.0610 452 ALA A CB    
1604 N N     . ALA C 157 ? 0.2709 0.2051 0.2459 -0.0210 0.0076  -0.0327 453 ALA A N     
1605 C CA    . ALA C 157 ? 0.2643 0.2008 0.2502 -0.0205 0.0084  -0.0239 453 ALA A CA    
1606 C C     . ALA C 157 ? 0.3040 0.2596 0.2937 -0.0206 0.0024  -0.0194 453 ALA A C     
1607 O O     . ALA C 157 ? 0.2728 0.2348 0.2720 -0.0256 0.0018  -0.0178 453 ALA A O     
1608 C CB    . ALA C 157 ? 0.1867 0.1153 0.1747 -0.0114 0.0134  -0.0157 453 ALA A CB    
1609 N N     . ILE C 158 ? 0.2590 0.2234 0.2432 -0.0152 -0.0008 -0.0175 454 ILE A N     
1610 C CA    . ILE C 158 ? 0.2352 0.2147 0.2244 -0.0142 -0.0057 -0.0137 454 ILE A CA    
1611 C C     . ILE C 158 ? 0.2342 0.2231 0.2291 -0.0206 -0.0126 -0.0178 454 ILE A C     
1612 O O     . ILE C 158 ? 0.2694 0.2696 0.2780 -0.0220 -0.0142 -0.0158 454 ILE A O     
1613 C CB    . ILE C 158 ? 0.2392 0.2220 0.2206 -0.0085 -0.0071 -0.0112 454 ILE A CB    
1614 C CG1   . ILE C 158 ? 0.3301 0.3090 0.3113 -0.0029 -0.0016 -0.0074 454 ILE A CG1   
1615 C CG2   . ILE C 158 ? 0.3386 0.3333 0.3260 -0.0070 -0.0121 -0.0076 454 ILE A CG2   
1616 C CD1   . ILE C 158 ? 0.2341 0.2145 0.2089 0.0006  -0.0007 -0.0069 454 ILE A CD1   
1617 N N     . TRP C 159 ? 0.2776 0.2635 0.2627 -0.0249 -0.0168 -0.0244 455 TRP A N     
1618 C CA    . TRP C 159 ? 0.2384 0.2349 0.2286 -0.0324 -0.0258 -0.0294 455 TRP A CA    
1619 C C     . TRP C 159 ? 0.3524 0.3516 0.3606 -0.0395 -0.0230 -0.0317 455 TRP A C     
1620 O O     . TRP C 159 ? 0.3457 0.3620 0.3708 -0.0422 -0.0284 -0.0311 455 TRP A O     
1621 C CB    . TRP C 159 ? 0.3552 0.3439 0.3272 -0.0380 -0.0287 -0.0383 455 TRP A CB    
1622 C CG    . TRP C 159 ? 0.4350 0.4368 0.4068 -0.0459 -0.0413 -0.0435 455 TRP A CG    
1623 C CD1   . TRP C 159 ? 0.4334 0.4340 0.4066 -0.0574 -0.0440 -0.0544 455 TRP A CD1   
1624 C CD2   . TRP C 159 ? 0.3845 0.4031 0.3552 -0.0431 -0.0540 -0.0378 455 TRP A CD2   
1625 N NE1   . TRP C 159 ? 0.4516 0.4704 0.4246 -0.0626 -0.0592 -0.0564 455 TRP A NE1   
1626 C CE2   . TRP C 159 ? 0.4445 0.4745 0.4161 -0.0529 -0.0660 -0.0451 455 TRP A CE2   
1627 C CE3   . TRP C 159 ? 0.3707 0.3948 0.3405 -0.0333 -0.0568 -0.0268 455 TRP A CE3   
1628 C CZ2   . TRP C 159 ? 0.4655 0.5142 0.4373 -0.0519 -0.0823 -0.0402 455 TRP A CZ2   
1629 C CZ3   . TRP C 159 ? 0.4216 0.4605 0.3915 -0.0319 -0.0712 -0.0216 455 TRP A CZ3   
1630 C CH2   . TRP C 159 ? 0.4382 0.4902 0.4091 -0.0405 -0.0846 -0.0275 455 TRP A CH2   
1631 N N     . ALA C 160 ? 0.2652 0.2474 0.2719 -0.0424 -0.0139 -0.0339 456 ALA A N     
1632 C CA    . ALA C 160 ? 0.2493 0.2300 0.2708 -0.0510 -0.0093 -0.0356 456 ALA A CA    
1633 C C     . ALA C 160 ? 0.3084 0.2960 0.3415 -0.0479 -0.0035 -0.0268 456 ALA A C     
1634 O O     . ALA C 160 ? 0.4183 0.4123 0.4667 -0.0556 -0.0003 -0.0277 456 ALA A O     
1636 N N     . LEU C 161 ? 0.2224 0.2093 0.2482 -0.0380 -0.0014 -0.0194 457 LEU A N     
1637 C CA    . LEU C 161 ? 0.2067 0.1965 0.2377 -0.0363 0.0056  -0.0125 457 LEU A CA    
1638 C C     . LEU C 161 ? 0.2252 0.2352 0.2688 -0.0339 0.0033  -0.0120 457 LEU A C     
1639 O O     . LEU C 161 ? 0.2572 0.2717 0.3072 -0.0350 0.0107  -0.0092 457 LEU A O     
1640 C CB    . LEU C 161 ? 0.2142 0.1927 0.2309 -0.0282 0.0091  -0.0058 457 LEU A CB    
1641 C CG    . LEU C 161 ? 0.3122 0.2699 0.3213 -0.0285 0.0134  -0.0038 457 LEU A CG    
1642 C CD1   . LEU C 161 ? 0.4117 0.3640 0.4111 -0.0193 0.0142  0.0037  457 LEU A CD1   
1643 C CD2   . LEU C 161 ? 0.2825 0.2320 0.2971 -0.0370 0.0205  -0.0013 457 LEU A CD2   
1644 N N     . GLU C 162 ? 0.2512 0.2726 0.2985 -0.0307 -0.0061 -0.0145 458 GLU A N     
1645 C CA    . GLU C 162 ? 0.2767 0.3147 0.3383 -0.0259 -0.0081 -0.0129 458 GLU A CA    
1646 C C     . GLU C 162 ? 0.3325 0.3849 0.4177 -0.0319 -0.0033 -0.0155 458 GLU A C     
1647 O O     . GLU C 162 ? 0.2635 0.3215 0.3570 -0.0296 0.0050  -0.0140 458 GLU A O     
1648 C CB    . GLU C 162 ? 0.2385 0.2847 0.3003 -0.0217 -0.0205 -0.0131 458 GLU A CB    
1649 C CG    . GLU C 162 ? 0.2878 0.3506 0.3695 -0.0155 -0.0235 -0.0107 458 GLU A CG    
1650 C CD    . GLU C 162 ? 0.4514 0.5175 0.5283 -0.0092 -0.0357 -0.0069 458 GLU A CD    
1651 O OE1   . GLU C 162 ? 0.4370 0.5175 0.5336 -0.0038 -0.0414 -0.0042 458 GLU A OE1   
1652 O OE2   . GLU C 162 ? 0.5447 0.5987 0.5985 -0.0094 -0.0390 -0.0060 458 GLU A OE2   
1653 N N     . ARG C 163 ? 0.2592 0.3184 0.3561 -0.0407 -0.0075 -0.0205 459 ARG A N     
1654 C CA    . ARG C 163 ? 0.2484 0.3256 0.3731 -0.0474 -0.0030 -0.0237 459 ARG A CA    
1655 C C     . ARG C 163 ? 0.2865 0.3553 0.4098 -0.0524 0.0136  -0.0215 459 ARG A C     
1656 O O     . ARG C 163 ? 0.2482 0.3301 0.3878 -0.0516 0.0220  -0.0217 459 ARG A O     
1657 C CB    . ARG C 163 ? 0.4834 0.5696 0.6205 -0.0581 -0.0115 -0.0306 459 ARG A CB    
1658 C CG    . ARG C 163 ? 0.7501 0.8493 0.8884 -0.0538 -0.0295 -0.0320 459 ARG A CG    
1659 C CD    . ARG C 163 ? 0.8608 0.9833 1.0246 -0.0636 -0.0397 -0.0390 459 ARG A CD    
1660 N NE    . ARG C 163 ? 0.8858 0.9967 1.0366 -0.0762 -0.0429 -0.0470 459 ARG A NE    
1661 C CZ    . ARG C 163 ? 0.8804 0.9790 1.0045 -0.0757 -0.0521 -0.0493 459 ARG A CZ    
1662 N NH1   . ARG C 163 ? 0.7968 0.8934 0.9041 -0.0636 -0.0588 -0.0426 459 ARG A NH1   
1663 N NH2   . ARG C 163 ? 0.9557 1.0425 1.0693 -0.0879 -0.0529 -0.0589 459 ARG A NH2   
1664 N N     . PRO C 164 ? 0.3461 0.3930 0.4507 -0.0577 0.0196  -0.0191 460 PRO A N     
1665 C CA    . PRO C 164 ? 0.3922 0.4303 0.4919 -0.0625 0.0348  -0.0144 460 PRO A CA    
1666 C C     . PRO C 164 ? 0.3020 0.3403 0.3902 -0.0541 0.0405  -0.0099 460 PRO A C     
1667 O O     . PRO C 164 ? 0.2379 0.2812 0.3302 -0.0579 0.0528  -0.0092 460 PRO A O     
1668 C CB    . PRO C 164 ? 0.3304 0.3419 0.4101 -0.0663 0.0368  -0.0105 460 PRO A CB    
1669 C CG    . PRO C 164 ? 0.2968 0.3034 0.3697 -0.0617 0.0242  -0.0146 460 PRO A CG    
1670 C CD    . PRO C 164 ? 0.3129 0.3432 0.4042 -0.0614 0.0140  -0.0213 460 PRO A CD    
1671 N N     . PHE C 165 ? 0.1748 0.2076 0.2480 -0.0440 0.0328  -0.0079 461 PHE A N     
1672 C CA    . PHE C 165 ? 0.1911 0.2245 0.2543 -0.0376 0.0375  -0.0058 461 PHE A CA    
1673 C C     . PHE C 165 ? 0.2173 0.2701 0.3028 -0.0350 0.0409  -0.0112 461 PHE A C     
1674 O O     . PHE C 165 ? 0.2104 0.2663 0.2953 -0.0362 0.0526  -0.0125 461 PHE A O     
1675 C CB    . PHE C 165 ? 0.2135 0.2382 0.2599 -0.0289 0.0288  -0.0034 461 PHE A CB    
1676 C CG    . PHE C 165 ? 0.3191 0.3266 0.3434 -0.0288 0.0298  0.0030  461 PHE A CG    
1677 C CD1   . PHE C 165 ? 0.3585 0.3534 0.3788 -0.0312 0.0272  0.0051  461 PHE A CD1   
1678 C CD2   . PHE C 165 ? 0.3792 0.3834 0.3877 -0.0263 0.0332  0.0066  461 PHE A CD2   
1679 C CE1   . PHE C 165 ? 0.3241 0.3034 0.3282 -0.0290 0.0278  0.0121  461 PHE A CE1   
1680 C CE2   . PHE C 165 ? 0.4606 0.4517 0.4512 -0.0251 0.0319  0.0140  461 PHE A CE2   
1681 C CZ    . PHE C 165 ? 0.3140 0.2927 0.3040 -0.0255 0.0292  0.0175  461 PHE A CZ    
1682 N N     . LEU C 166 ? 0.2748 0.3409 0.3803 -0.0313 0.0310  -0.0144 462 LEU A N     
1683 C CA    . LEU C 166 ? 0.2794 0.3645 0.4117 -0.0267 0.0333  -0.0185 462 LEU A CA    
1684 C C     . LEU C 166 ? 0.2589 0.3578 0.4131 -0.0350 0.0459  -0.0226 462 LEU A C     
1685 O O     . LEU C 166 ? 0.1619 0.2717 0.3319 -0.0323 0.0564  -0.0266 462 LEU A O     
1686 C CB    . LEU C 166 ? 0.1998 0.2968 0.3486 -0.0209 0.0176  -0.0186 462 LEU A CB    
1687 C CG    . LEU C 166 ? 0.3041 0.3916 0.4380 -0.0109 0.0082  -0.0147 462 LEU A CG    
1688 C CD1   . LEU C 166 ? 0.3241 0.4232 0.4710 -0.0067 -0.0078 -0.0129 462 LEU A CD1   
1689 C CD2   . LEU C 166 ? 0.2216 0.3067 0.3575 -0.0033 0.0166  -0.0156 462 LEU A CD2   
1690 N N     . ASP C 167 ? 0.1941 0.2920 0.3508 -0.0459 0.0467  -0.0225 463 ASP A N     
1691 C CA    . ASP C 167 ? 0.1946 0.3047 0.3721 -0.0562 0.0605  -0.0261 463 ASP A CA    
1692 C C     . ASP C 167 ? 0.2583 0.3579 0.4169 -0.0593 0.0789  -0.0242 463 ASP A C     
1693 O O     . ASP C 167 ? 0.2295 0.3416 0.4034 -0.0610 0.0917  -0.0284 463 ASP A O     
1694 C CB    . ASP C 167 ? 0.3723 0.4778 0.5522 -0.0690 0.0585  -0.0261 463 ASP A CB    
1695 C CG    . ASP C 167 ? 0.5468 0.6704 0.7516 -0.0698 0.0423  -0.0312 463 ASP A CG    
1696 O OD1   . ASP C 167 ? 0.6769 0.7920 0.8765 -0.0786 0.0364  -0.0326 463 ASP A OD1   
1697 O OD2   . ASP C 167 ? 0.6134 0.7588 0.8422 -0.0614 0.0351  -0.0337 463 ASP A OD2   
1698 N N     . GLU C 168 ? 0.1692 0.2451 0.2913 -0.0592 0.0788  -0.0174 464 GLU A N     
1699 C CA    . GLU C 168 ? 0.2674 0.3336 0.3667 -0.0631 0.0941  -0.0145 464 GLU A CA    
1700 C C     . GLU C 168 ? 0.1641 0.2363 0.2610 -0.0547 0.0981  -0.0198 464 GLU A C     
1701 O O     . GLU C 168 ? 0.2270 0.3019 0.3192 -0.0582 0.1133  -0.0232 464 GLU A O     
1702 C CB    . GLU C 168 ? 0.2130 0.2540 0.2760 -0.0646 0.0907  -0.0044 464 GLU A CB    
1703 C CG    . GLU C 168 ? 0.4110 0.4421 0.4475 -0.0711 0.1056  0.0008  464 GLU A CG    
1704 C CD    . GLU C 168 ? 0.6583 0.6661 0.6605 -0.0706 0.0999  0.0130  464 GLU A CD    
1705 O OE1   . GLU C 168 ? 0.7224 0.7214 0.7244 -0.0652 0.0864  0.0163  464 GLU A OE1   
1706 O OE2   . GLU C 168 ? 0.6199 0.6187 0.5952 -0.0753 0.1089  0.0194  464 GLU A OE2   
1707 N N     . LEU C 169 ? 0.1513 0.2234 0.2493 -0.0437 0.0848  -0.0209 465 LEU A N     
1708 C CA    . LEU C 169 ? 0.2040 0.2803 0.3045 -0.0360 0.0890  -0.0272 465 LEU A CA    
1709 C C     . LEU C 169 ? 0.2627 0.3591 0.3985 -0.0353 0.1006  -0.0357 465 LEU A C     
1710 O O     . LEU C 169 ? 0.1739 0.2691 0.3049 -0.0336 0.1113  -0.0415 465 LEU A O     
1711 C CB    . LEU C 169 ? 0.1880 0.2606 0.2887 -0.0253 0.0731  -0.0259 465 LEU A CB    
1712 C CG    . LEU C 169 ? 0.3011 0.3561 0.3698 -0.0241 0.0643  -0.0200 465 LEU A CG    
1713 C CD1   . LEU C 169 ? 0.1981 0.2519 0.2724 -0.0155 0.0499  -0.0185 465 LEU A CD1   
1714 C CD2   . LEU C 169 ? 0.3560 0.4034 0.4015 -0.0252 0.0726  -0.0229 465 LEU A CD2   
1715 N N     . ARG C 170 ? 0.1362 0.2490 0.3044 -0.0357 0.0946  -0.0361 466 ARG A N     
1716 C CA    . ARG C 170 ? 0.2321 0.3612 0.4296 -0.0323 0.0988  -0.0414 466 ARG A CA    
1717 C C     . ARG C 170 ? 0.2840 0.4118 0.4737 -0.0420 0.1151  -0.0433 466 ARG A C     
1718 O O     . ARG C 170 ? 0.1772 0.3104 0.3763 -0.0391 0.1255  -0.0494 466 ARG A O     
1719 C CB    . ARG C 170 ? 0.2779 0.4254 0.5080 -0.0305 0.0845  -0.0402 466 ARG A CB    
1720 C CG    . ARG C 170 ? 0.4412 0.6084 0.7044 -0.0274 0.0878  -0.0446 466 ARG A CG    
1721 C CD    . ARG C 170 ? 0.6643 0.8496 0.9566 -0.0203 0.0688  -0.0425 466 ARG A CD    
1722 N NE    . ARG C 170 ? 0.8640 1.0715 1.1881 -0.0225 0.0699  -0.0453 466 ARG A NE    
1723 C CZ    . ARG C 170 ? 0.9076 1.1265 1.2547 -0.0148 0.0772  -0.0491 466 ARG A CZ    
1724 N NH1   . ARG C 170 ? 0.9029 1.1444 1.2810 -0.0175 0.0778  -0.0515 466 ARG A NH1   
1725 N NH2   . ARG C 170 ? 0.9100 1.1173 1.2500 -0.0051 0.0843  -0.0512 466 ARG A NH2   
1726 N N     . ARG C 171 ? 0.2158 0.3347 0.3879 -0.0534 0.1179  -0.0378 467 ARG A N     
1727 C CA    . ARG C 171 ? 0.2391 0.3539 0.3993 -0.0628 0.1335  -0.0377 467 ARG A CA    
1728 C C     . ARG C 171 ? 0.2150 0.3174 0.3450 -0.0616 0.1441  -0.0398 467 ARG A C     
1729 O O     . ARG C 171 ? 0.3013 0.4065 0.4305 -0.0650 0.1578  -0.0443 467 ARG A O     
1730 C CB    . ARG C 171 ? 0.2287 0.3307 0.3716 -0.0744 0.1335  -0.0292 467 ARG A CB    
1731 C CG    . ARG C 171 ? 0.3259 0.4400 0.4981 -0.0800 0.1273  -0.0296 467 ARG A CG    
1732 C CD    . ARG C 171 ? 0.4789 0.5764 0.6333 -0.0925 0.1319  -0.0222 467 ARG A CD    
1733 N NE    . ARG C 171 ? 0.5676 0.6418 0.6909 -0.0925 0.1256  -0.0138 467 ARG A NE    
1734 C CZ    . ARG C 171 ? 0.4620 0.5307 0.5894 -0.0928 0.1132  -0.0123 467 ARG A CZ    
1735 N NH1   . ARG C 171 ? 0.4106 0.4962 0.5694 -0.0939 0.1040  -0.0188 467 ARG A NH1   
1736 N NH2   . ARG C 171 ? 0.3780 0.4242 0.4773 -0.0920 0.1091  -0.0045 467 ARG A NH2   
1737 N N     . ASN C 172 ? 0.3994 0.4355 0.4305 -0.1920 0.0714  0.1241  468 ASN A N     
1738 C CA    . ASN C 172 ? 0.4620 0.5102 0.4800 -0.1839 0.0840  0.1209  468 ASN A CA    
1739 C C     . ASN C 172 ? 0.4394 0.5227 0.4696 -0.1721 0.1004  0.1089  468 ASN A C     
1740 O O     . ASN C 172 ? 0.4272 0.5226 0.4466 -0.1636 0.1109  0.1044  468 ASN A O     
1741 C CB    . ASN C 172 ? 0.3983 0.4073 0.3953 -0.1752 0.0765  0.1176  468 ASN A CB    
1742 C CG    . ASN C 172 ? 0.4212 0.3983 0.4017 -0.1833 0.0616  0.1282  468 ASN A CG    
1743 O OD1   . ASN C 172 ? 0.4433 0.4254 0.4267 -0.1969 0.0562  0.1388  468 ASN A OD1   
1744 N ND2   . ASN C 172 ? 0.4222 0.3667 0.3851 -0.1746 0.0543  0.1252  468 ASN A ND2   
1745 N N     . GLU C 173 ? 0.4549 0.5537 0.5065 -0.1701 0.1018  0.1025  469 GLU A N     
1746 C CA    . GLU C 173 ? 0.3288 0.4569 0.3919 -0.1560 0.1150  0.0886  469 GLU A CA    
1747 C C     . GLU C 173 ? 0.4910 0.5972 0.5391 -0.1425 0.1168  0.0774  469 GLU A C     
1748 O O     . GLU C 173 ? 0.3667 0.4907 0.4122 -0.1293 0.1281  0.0663  469 GLU A O     
1749 C CB    . GLU C 173 ? 0.3813 0.5503 0.4474 -0.1529 0.1291  0.0880  469 GLU A CB    
1750 C CG    . GLU C 173 ? 0.5681 0.7651 0.6514 -0.1654 0.1296  0.0967  469 GLU A CG    
1751 C CD    . GLU C 173 ? 0.8077 1.0477 0.8956 -0.1594 0.1442  0.0931  469 GLU A CD    
1752 O OE1   . GLU C 173 ? 0.9074 1.1496 0.9791 -0.1489 0.1521  0.0876  469 GLU A OE1   
1753 O OE2   . GLU C 173 ? 0.8484 1.1196 0.9555 -0.1646 0.1472  0.0954  469 GLU A OE2   
1754 N N     . GLN C 174 ? 0.3152 0.3797 0.3525 -0.1442 0.1044  0.0788  470 GLN A N     
1755 C CA    . GLN C 174 ? 0.3043 0.3407 0.3283 -0.1261 0.1019  0.0668  470 GLN A CA    
1756 C C     . GLN C 174 ? 0.2895 0.3070 0.3235 -0.1142 0.0937  0.0562  470 GLN A C     
1757 O O     . GLN C 174 ? 0.2815 0.2750 0.3055 -0.1006 0.0901  0.0478  470 GLN A O     
1758 C CB    . GLN C 174 ? 0.3550 0.3572 0.3560 -0.1308 0.0930  0.0753  470 GLN A CB    
1759 C CG    . GLN C 174 ? 0.3757 0.3916 0.3628 -0.1388 0.0998  0.0844  470 GLN A CG    
1760 C CD    . GLN C 174 ? 0.4620 0.4420 0.4284 -0.1411 0.0878  0.0921  470 GLN A CD    
1761 O OE1   . GLN C 174 ? 0.3666 0.3199 0.3320 -0.1466 0.0733  0.0984  470 GLN A OE1   
1762 N NE2   . GLN C 174 ? 0.3806 0.3591 0.3302 -0.1351 0.0926  0.0902  470 GLN A NE2   
1763 N N     . ASP C 175 ? 0.3716 0.4007 0.4249 -0.1195 0.0904  0.0571  471 ASP A N     
1764 C CA    . ASP C 175 ? 0.3763 0.3878 0.4378 -0.1084 0.0821  0.0475  471 ASP A CA    
1765 C C     . ASP C 175 ? 0.2991 0.3176 0.3629 -0.0890 0.0897  0.0319  471 ASP A C     
1766 O O     . ASP C 175 ? 0.2854 0.2793 0.3439 -0.0772 0.0835  0.0243  471 ASP A O     
1767 C CB    . ASP C 175 ? 0.4972 0.5245 0.5802 -0.1181 0.0777  0.0511  471 ASP A CB    
1768 C CG    . ASP C 175 ? 0.7121 0.7874 0.8120 -0.1249 0.0906  0.0536  471 ASP A CG    
1769 O OD1   . ASP C 175 ? 0.7510 0.8437 0.8429 -0.1324 0.0995  0.0607  471 ASP A OD1   
1770 O OD2   . ASP C 175 ? 0.7345 0.8314 0.8552 -0.1223 0.0916  0.0484  471 ASP A OD2   
1771 N N     . ARG C 176 ? 0.2887 0.3406 0.3597 -0.0854 0.1023  0.0271  472 ARG A N     
1772 C CA    . ARG C 176 ? 0.2893 0.3447 0.3612 -0.0672 0.1074  0.0123  472 ARG A CA    
1773 C C     . ARG C 176 ? 0.2342 0.2697 0.2855 -0.0596 0.1085  0.0092  472 ARG A C     
1774 O O     . ARG C 176 ? 0.3208 0.3420 0.3688 -0.0464 0.1064  -0.0004 472 ARG A O     
1775 C CB    . ARG C 176 ? 0.3261 0.4224 0.4114 -0.0636 0.1190  0.0065  472 ARG A CB    
1776 C CG    . ARG C 176 ? 0.4727 0.5937 0.5816 -0.0697 0.1182  0.0084  472 ARG A CG    
1777 C CD    . ARG C 176 ? 0.5210 0.6851 0.6428 -0.0627 0.1301  0.0008  472 ARG A CD    
1778 N NE    . ARG C 176 ? 0.6392 0.7981 0.7597 -0.0424 0.1311  -0.0155 472 ARG A NE    
1779 C CZ    . ARG C 176 ? 0.7766 0.9607 0.8976 -0.0308 0.1404  -0.0255 472 ARG A CZ    
1780 N NH1   . ARG C 176 ? 0.7519 0.9720 0.8746 -0.0369 0.1513  -0.0212 472 ARG A NH1   
1781 N NH2   . ARG C 176 ? 0.8064 0.9794 0.9248 -0.0130 0.1382  -0.0397 472 ARG A NH2   
1782 N N     . LEU C 177 ? 0.3020 0.3368 0.3393 -0.0684 0.1112  0.0180  473 LEU A N     
1783 C CA    . LEU C 177 ? 0.2497 0.2644 0.2675 -0.0623 0.1105  0.0163  473 LEU A CA    
1784 C C     . LEU C 177 ? 0.3066 0.2877 0.3189 -0.0561 0.0996  0.0144  473 LEU A C     
1785 O O     . LEU C 177 ? 0.2890 0.2587 0.2943 -0.0449 0.0992  0.0069  473 LEU A O     
1786 C CB    . LEU C 177 ? 0.2657 0.2812 0.2692 -0.0748 0.1122  0.0283  473 LEU A CB    
1787 C CG    . LEU C 177 ? 0.2875 0.2854 0.2701 -0.0706 0.1114  0.0283  473 LEU A CG    
1788 C CD1   . LEU C 177 ? 0.3482 0.3578 0.3276 -0.0575 0.1192  0.0161  473 LEU A CD1   
1789 C CD2   . LEU C 177 ? 0.2912 0.2926 0.2610 -0.0851 0.1126  0.0419  473 LEU A CD2   
1790 N N     . LEU C 178 ? 0.2494 0.2152 0.2649 -0.0632 0.0902  0.0209  474 LEU A N     
1791 C CA    . LEU C 178 ? 0.2468 0.1833 0.2565 -0.0557 0.0799  0.0182  474 LEU A CA    
1792 C C     . LEU C 178 ? 0.2310 0.1690 0.2514 -0.0437 0.0798  0.0075  474 LEU A C     
1793 O O     . LEU C 178 ? 0.2605 0.1866 0.2744 -0.0331 0.0785  0.0015  474 LEU A O     
1794 C CB    . LEU C 178 ? 0.2613 0.1793 0.2698 -0.0654 0.0684  0.0270  474 LEU A CB    
1795 C CG    . LEU C 178 ? 0.3760 0.2646 0.3779 -0.0565 0.0569  0.0236  474 LEU A CG    
1796 C CD1   . LEU C 178 ? 0.3253 0.1973 0.3100 -0.0497 0.0551  0.0234  474 LEU A CD1   
1797 C CD2   . LEU C 178 ? 0.2951 0.1666 0.2976 -0.0657 0.0442  0.0306  474 LEU A CD2   
1798 N N     . VAL C 179 ? 0.4372 0.3908 0.4740 -0.0459 0.0807  0.0056  475 VAL A N     
1799 C CA    . VAL C 179 ? 0.3766 0.3267 0.4225 -0.0358 0.0774  -0.0031 475 VAL A CA    
1800 C C     . VAL C 179 ? 0.2513 0.2138 0.2999 -0.0249 0.0846  -0.0129 475 VAL A C     
1801 O O     . VAL C 179 ? 0.2936 0.2454 0.3421 -0.0151 0.0812  -0.0193 475 VAL A O     
1802 C CB    . VAL C 179 ? 0.3431 0.3034 0.4058 -0.0421 0.0735  -0.0013 475 VAL A CB    
1803 C CG1   . VAL C 179 ? 0.4236 0.3817 0.4952 -0.0312 0.0702  -0.0105 475 VAL A CG1   
1804 C CG2   . VAL C 179 ? 0.3491 0.2900 0.4072 -0.0523 0.0628  0.0077  475 VAL A CG2   
1805 N N     . GLU C 180 ? 0.2319 0.2160 0.2818 -0.0260 0.0937  -0.0142 476 GLU A N     
1806 C CA    . GLU C 180 ? 0.3113 0.3056 0.3631 -0.0149 0.0988  -0.0246 476 GLU A CA    
1807 C C     . GLU C 180 ? 0.3813 0.3679 0.4170 -0.0108 0.1017  -0.0264 476 GLU A C     
1808 O O     . GLU C 180 ? 0.3261 0.3134 0.3607 -0.0011 0.1028  -0.0352 476 GLU A O     
1809 C CB    . GLU C 180 ? 0.2878 0.3144 0.3528 -0.0154 0.1064  -0.0280 476 GLU A CB    
1810 C CG    . GLU C 180 ? 0.4245 0.4618 0.5085 -0.0168 0.1030  -0.0286 476 GLU A CG    
1811 C CD    . GLU C 180 ? 0.4767 0.5512 0.5754 -0.0181 0.1111  -0.0307 476 GLU A CD    
1812 O OE1   . GLU C 180 ? 0.5004 0.5890 0.6154 -0.0247 0.1090  -0.0271 476 GLU A OE1   
1813 O OE2   . GLU C 180 ? 0.5382 0.6288 0.6321 -0.0123 0.1192  -0.0362 476 GLU A OE2   
1814 N N     . LEU C 181 ? 0.3371 0.3151 0.3601 -0.0180 0.1017  -0.0185 477 LEU A N     
1815 C CA    . LEU C 181 ? 0.2228 0.1944 0.2309 -0.0146 0.1037  -0.0199 477 LEU A CA    
1816 C C     . LEU C 181 ? 0.3181 0.2652 0.3155 -0.0146 0.0966  -0.0153 477 LEU A C     
1817 O O     . LEU C 181 ? 0.3000 0.2366 0.2944 -0.0071 0.0936  -0.0200 477 LEU A O     
1818 C CB    . LEU C 181 ? 0.2473 0.2354 0.2483 -0.0214 0.1111  -0.0156 477 LEU A CB    
1819 C CG    . LEU C 181 ? 0.5022 0.4868 0.4878 -0.0168 0.1134  -0.0191 477 LEU A CG    
1820 C CD1   . LEU C 181 ? 0.3879 0.3843 0.3763 -0.0059 0.1171  -0.0314 477 LEU A CD1   
1821 C CD2   . LEU C 181 ? 0.5269 0.5192 0.5003 -0.0258 0.1179  -0.0110 477 LEU A CD2   
1822 N N     . GLU C 182 ? 0.3639 0.3021 0.3556 -0.0228 0.0931  -0.0062 478 GLU A N     
1823 C CA    . GLU C 182 ? 0.3586 0.2759 0.3387 -0.0209 0.0866  -0.0027 478 GLU A CA    
1824 C C     . GLU C 182 ? 0.3164 0.2207 0.3007 -0.0135 0.0801  -0.0061 478 GLU A C     
1825 O O     . GLU C 182 ? 0.2522 0.1475 0.2302 -0.0073 0.0774  -0.0076 478 GLU A O     
1826 C CB    . GLU C 182 ? 0.2882 0.1964 0.2605 -0.0305 0.0823  0.0074  478 GLU A CB    
1827 C CG    . GLU C 182 ? 0.3853 0.3047 0.3495 -0.0390 0.0880  0.0131  478 GLU A CG    
1828 C CD    . GLU C 182 ? 0.4763 0.3949 0.4283 -0.0340 0.0907  0.0103  478 GLU A CD    
1829 O OE1   . GLU C 182 ? 0.4559 0.3638 0.4059 -0.0253 0.0870  0.0057  478 GLU A OE1   
1830 O OE2   . GLU C 182 ? 0.5021 0.4321 0.4465 -0.0390 0.0964  0.0131  478 GLU A OE2   
1831 N N     . GLN C 183 ? 0.2352 0.1398 0.2299 -0.0143 0.0774  -0.0068 479 GLN A N     
1832 C CA    . GLN C 183 ? 0.2680 0.1602 0.2642 -0.0070 0.0711  -0.0097 479 GLN A CA    
1833 C C     . GLN C 183 ? 0.2735 0.1707 0.2740 0.0010  0.0735  -0.0167 479 GLN A C     
1834 O O     . GLN C 183 ? 0.2890 0.1777 0.2845 0.0071  0.0704  -0.0176 479 GLN A O     
1835 C CB    . GLN C 183 ? 0.2355 0.1238 0.2395 -0.0103 0.0655  -0.0082 479 GLN A CB    
1836 C CG    . GLN C 183 ? 0.3576 0.2297 0.3531 -0.0157 0.0578  -0.0013 479 GLN A CG    
1837 C CD    . GLN C 183 ? 0.3523 0.2201 0.3556 -0.0215 0.0510  0.0010  479 GLN A CD    
1838 O OE1   . GLN C 183 ? 0.3799 0.2340 0.3773 -0.0281 0.0434  0.0072  479 GLN A OE1   
1839 N NE2   . GLN C 183 ? 0.3904 0.2685 0.4066 -0.0193 0.0525  -0.0039 479 GLN A NE2   
1840 N N     . PRO C 184 ? 0.3025 0.2132 0.3116 0.0016  0.0783  -0.0216 480 PRO A N     
1841 C CA    . PRO C 184 ? 0.3026 0.2136 0.3128 0.0088  0.0786  -0.0278 480 PRO A CA    
1842 C C     . PRO C 184 ? 0.3077 0.2146 0.3072 0.0102  0.0794  -0.0272 480 PRO A C     
1843 O O     . PRO C 184 ? 0.2551 0.1578 0.2527 0.0140  0.0753  -0.0279 480 PRO A O     
1844 C CB    . PRO C 184 ? 0.2842 0.2107 0.3038 0.0097  0.0831  -0.0336 480 PRO A CB    
1845 C CG    . PRO C 184 ? 0.3563 0.2921 0.3845 0.0033  0.0841  -0.0302 480 PRO A CG    
1846 C CD    . PRO C 184 ? 0.3063 0.2333 0.3251 -0.0038 0.0826  -0.0219 480 PRO A CD    
1847 N N     . LEU C 185 ? 0.2746 0.1851 0.2670 0.0057  0.0829  -0.0243 481 LEU A N     
1848 C CA    . LEU C 185 ? 0.3104 0.2170 0.2927 0.0068  0.0826  -0.0238 481 LEU A CA    
1849 C C     . LEU C 185 ? 0.2800 0.1760 0.2573 0.0086  0.0776  -0.0194 481 LEU A C     
1850 O O     . LEU C 185 ? 0.2554 0.1492 0.2293 0.0112  0.0756  -0.0197 481 LEU A O     
1851 C CB    . LEU C 185 ? 0.2687 0.1814 0.2430 0.0017  0.0869  -0.0213 481 LEU A CB    
1852 C CG    . LEU C 185 ? 0.3055 0.2140 0.2683 0.0023  0.0860  -0.0206 481 LEU A CG    
1853 C CD1   . LEU C 185 ? 0.3486 0.2583 0.3117 0.0071  0.0855  -0.0279 481 LEU A CD1   
1854 C CD2   . LEU C 185 ? 0.2670 0.1805 0.2201 -0.0033 0.0897  -0.0169 481 LEU A CD2   
1855 N N     . SER C 186 ? 0.2497 0.1397 0.2267 0.0075  0.0747  -0.0153 482 SER A N     
1856 C CA    . SER C 186 ? 0.3518 0.2335 0.3238 0.0117  0.0696  -0.0125 482 SER A CA    
1857 C C     . SER C 186 ? 0.3487 0.2324 0.3248 0.0172  0.0677  -0.0149 482 SER A C     
1858 O O     . SER C 186 ? 0.2864 0.1709 0.2587 0.0205  0.0656  -0.0130 482 SER A O     
1859 C CB    . SER C 186 ? 0.2888 0.1613 0.2596 0.0110  0.0650  -0.0097 482 SER A CB    
1860 O OG    . SER C 186 ? 0.4487 0.3133 0.4128 0.0172  0.0596  -0.0082 482 SER A OG    
1861 N N     . SER C 187 ? 0.3336 0.2236 0.3180 0.0171  0.0659  -0.0173 483 SER A N     
1862 C CA    . SER C 187 ? 0.2964 0.1921 0.2838 0.0199  0.0612  -0.0173 483 SER A CA    
1863 C C     . SER C 187 ? 0.3244 0.2215 0.3107 0.0191  0.0627  -0.0181 483 SER A C     
1864 O O     . SER C 187 ? 0.2816 0.1784 0.2664 0.0208  0.0613  -0.0160 483 SER A O     
1865 C CB    . SER C 187 ? 0.3826 0.2818 0.3775 0.0202  0.0581  -0.0198 483 SER A CB    
1866 O OG    . SER C 187 ? 0.4558 0.3513 0.4517 0.0205  0.0560  -0.0194 483 SER A OG    
1867 N N     . ILE C 188 ? 0.2866 0.1839 0.2730 0.0170  0.0659  -0.0215 484 ILE A N     
1868 C CA    . ILE C 188 ? 0.2513 0.1467 0.2349 0.0165  0.0656  -0.0234 484 ILE A CA    
1869 C C     . ILE C 188 ? 0.3347 0.2257 0.3111 0.0160  0.0673  -0.0203 484 ILE A C     
1870 O O     . ILE C 188 ? 0.2921 0.1832 0.2678 0.0150  0.0639  -0.0182 484 ILE A O     
1871 C CB    . ILE C 188 ? 0.2047 0.1022 0.1880 0.0162  0.0683  -0.0292 484 ILE A CB    
1872 C CG1   . ILE C 188 ? 0.2932 0.1959 0.2849 0.0184  0.0655  -0.0330 484 ILE A CG1   
1873 C CG2   . ILE C 188 ? 0.3346 0.2265 0.3115 0.0161  0.0670  -0.0321 484 ILE A CG2   
1874 C CD1   . ILE C 188 ? 0.3546 0.2639 0.3477 0.0198  0.0701  -0.0392 484 ILE A CD1   
1875 N N     . LEU C 189 ? 0.2667 0.1585 0.2384 0.0151  0.0692  -0.0179 485 LEU A N     
1876 C CA    . LEU C 189 ? 0.3451 0.2383 0.3110 0.0147  0.0673  -0.0136 485 LEU A CA    
1877 C C     . LEU C 189 ? 0.2791 0.1758 0.2473 0.0182  0.0646  -0.0099 485 LEU A C     
1878 O O     . LEU C 189 ? 0.2424 0.1448 0.2098 0.0178  0.0624  -0.0067 485 LEU A O     
1879 C CB    . LEU C 189 ? 0.2853 0.1761 0.2447 0.0135  0.0686  -0.0115 485 LEU A CB    
1880 C CG    . LEU C 189 ? 0.3074 0.1988 0.2625 0.0093  0.0723  -0.0138 485 LEU A CG    
1881 C CD1   . LEU C 189 ? 0.3118 0.2000 0.2604 0.0065  0.0728  -0.0095 485 LEU A CD1   
1882 C CD2   . LEU C 189 ? 0.2506 0.1434 0.2003 0.0081  0.0715  -0.0156 485 LEU A CD2   
1883 N N     . ALA C 190 ? 0.2636 0.1589 0.2348 0.0219  0.0645  -0.0101 486 ALA A N     
1884 C CA    . ALA C 190 ? 0.2456 0.1469 0.2177 0.0267  0.0626  -0.0072 486 ALA A CA    
1885 C C     . ALA C 190 ? 0.1889 0.0968 0.1650 0.0240  0.0616  -0.0050 486 ALA A C     
1886 O O     . ALA C 190 ? 0.2592 0.1777 0.2359 0.0246  0.0605  -0.0006 486 ALA A O     
1887 C CB    . ALA C 190 ? 0.2241 0.1208 0.1968 0.0317  0.0619  -0.0090 486 ALA A CB    
1888 N N     . GLU C 191 ? 0.2642 0.1663 0.2434 0.0207  0.0613  -0.0078 487 GLU A N     
1889 C CA    . GLU C 191 ? 0.3852 0.2891 0.3668 0.0167  0.0582  -0.0051 487 GLU A CA    
1890 C C     . GLU C 191 ? 0.3277 0.2343 0.3076 0.0116  0.0558  -0.0026 487 GLU A C     
1891 O O     . GLU C 191 ? 0.2810 0.1944 0.2629 0.0075  0.0525  0.0031  487 GLU A O     
1892 C CB    . GLU C 191 ? 0.4644 0.3582 0.4483 0.0157  0.0564  -0.0097 487 GLU A CB    
1893 C CG    . GLU C 191 ? 0.7666 0.6570 0.7533 0.0201  0.0576  -0.0128 487 GLU A CG    
1894 C CD    . GLU C 191 ? 0.9436 0.8315 0.9340 0.0192  0.0534  -0.0179 487 GLU A CD    
1895 O OE1   . GLU C 191 ? 0.9542 0.8355 0.9434 0.0172  0.0510  -0.0202 487 GLU A OE1   
1896 O OE2   . GLU C 191 ? 0.9525 0.8456 0.9468 0.0210  0.0511  -0.0198 487 GLU A OE2   
1897 N N     . MET C 192 ? 0.2501 0.1520 0.2262 0.0109  0.0568  -0.0064 488 MET A N     
1898 C CA    . MET C 192 ? 0.4083 0.3113 0.3814 0.0064  0.0535  -0.0049 488 MET A CA    
1899 C C     . MET C 192 ? 0.2555 0.1714 0.2296 0.0067  0.0529  0.0014  488 MET A C     
1900 O O     . MET C 192 ? 0.2946 0.2171 0.2710 0.0017  0.0487  0.0062  488 MET A O     
1901 C CB    . MET C 192 ? 0.3252 0.2217 0.2920 0.0066  0.0553  -0.0104 488 MET A CB    
1902 C CG    . MET C 192 ? 0.4475 0.3355 0.4136 0.0076  0.0561  -0.0177 488 MET A CG    
1903 S SD    . MET C 192 ? 0.3655 0.2532 0.3244 0.0090  0.0615  -0.0228 488 MET A SD    
1904 C CE    . MET C 192 ? 0.2877 0.1744 0.2375 0.0057  0.0573  -0.0214 488 MET A CE    
1905 N N     . GLU C 193 ? 0.2091 0.1285 0.1815 0.0125  0.0561  0.0015  489 GLU A N     
1906 C CA    . GLU C 193 ? 0.2378 0.1704 0.2111 0.0156  0.0552  0.0061  489 GLU A CA    
1907 C C     . GLU C 193 ? 0.2848 0.2326 0.2647 0.0157  0.0546  0.0114  489 GLU A C     
1908 O O     . GLU C 193 ? 0.2505 0.2134 0.2343 0.0135  0.0525  0.0167  489 GLU A O     
1909 C CB    . GLU C 193 ? 0.2753 0.2048 0.2442 0.0234  0.0569  0.0042  489 GLU A CB    
1910 C CG    . GLU C 193 ? 0.3111 0.2275 0.2729 0.0219  0.0575  0.0011  489 GLU A CG    
1911 C CD    . GLU C 193 ? 0.2911 0.2017 0.2480 0.0282  0.0569  0.0006  489 GLU A CD    
1912 O OE1   . GLU C 193 ? 0.3247 0.2403 0.2835 0.0352  0.0559  0.0010  489 GLU A OE1   
1913 O OE2   . GLU C 193 ? 0.3603 0.2609 0.3107 0.0261  0.0567  0.0000  489 GLU A OE2   
1914 N N     . PHE C 194 ? 0.3279 0.2736 0.3091 0.0181  0.0566  0.0106  490 PHE A N     
1915 C CA    . PHE C 194 ? 0.3262 0.2872 0.3118 0.0181  0.0567  0.0163  490 PHE A CA    
1916 C C     . PHE C 194 ? 0.3089 0.2742 0.2989 0.0072  0.0527  0.0224  490 PHE A C     
1917 O O     . PHE C 194 ? 0.2887 0.2738 0.2835 0.0042  0.0520  0.0299  490 PHE A O     
1918 C CB    . PHE C 194 ? 0.2785 0.2328 0.2627 0.0222  0.0586  0.0138  490 PHE A CB    
1919 C CG    . PHE C 194 ? 0.2674 0.2378 0.2536 0.0228  0.0593  0.0198  490 PHE A CG    
1920 C CD1   . PHE C 194 ? 0.2342 0.2258 0.2209 0.0296  0.0614  0.0227  490 PHE A CD1   
1921 C CD2   . PHE C 194 ? 0.3438 0.3091 0.3307 0.0173  0.0576  0.0225  490 PHE A CD2   
1922 C CE1   . PHE C 194 ? 0.2123 0.2228 0.2002 0.0304  0.0632  0.0287  490 PHE A CE1   
1923 C CE2   . PHE C 194 ? 0.3664 0.3475 0.3537 0.0169  0.0584  0.0293  490 PHE A CE2   
1924 C CZ    . PHE C 194 ? 0.3408 0.3460 0.3285 0.0233  0.0619  0.0326  490 PHE A CZ    
1925 N N     . ALA C 195 ? 0.2666 0.2141 0.2548 0.0012  0.0494  0.0192  491 ALA A N     
1926 C CA    . ALA C 195 ? 0.3383 0.2842 0.3289 -0.0093 0.0429  0.0244  491 ALA A CA    
1927 C C     . ALA C 195 ? 0.3928 0.3504 0.3859 -0.0141 0.0398  0.0288  491 ALA A C     
1928 O O     . ALA C 195 ? 0.2822 0.2521 0.2806 -0.0226 0.0356  0.0375  491 ALA A O     
1929 C CB    . ALA C 195 ? 0.3202 0.2425 0.3065 -0.0118 0.0388  0.0177  491 ALA A CB    
1930 N N     . GLY C 196 ? 0.2590 0.2137 0.2484 -0.0096 0.0414  0.0238  492 GLY A N     
1931 C CA    . GLY C 196 ? 0.3387 0.3032 0.3298 -0.0131 0.0377  0.0271  492 GLY A CA    
1932 C C     . GLY C 196 ? 0.3290 0.2812 0.3185 -0.0233 0.0292  0.0276  492 GLY A C     
1933 O O     . GLY C 196 ? 0.3405 0.2762 0.3272 -0.0269 0.0257  0.0252  492 GLY A O     
1934 N N     . VAL C 197 ? 0.2987 0.2582 0.2893 -0.0272 0.0245  0.0303  493 VAL A N     
1935 C CA    . VAL C 197 ? 0.3470 0.2952 0.3355 -0.0371 0.0143  0.0310  493 VAL A CA    
1936 C C     . VAL C 197 ? 0.3241 0.2943 0.3232 -0.0463 0.0088  0.0422  493 VAL A C     
1937 O O     . VAL C 197 ? 0.3013 0.2934 0.3060 -0.0424 0.0119  0.0454  493 VAL A O     
1938 C CB    . VAL C 197 ? 0.3398 0.2737 0.3178 -0.0340 0.0124  0.0229  493 VAL A CB    
1939 C CG1   . VAL C 197 ? 0.3184 0.2373 0.2921 -0.0430 0.0005  0.0221  493 VAL A CG1   
1940 C CG2   . VAL C 197 ? 0.3381 0.2569 0.3073 -0.0252 0.0195  0.0133  493 VAL A CG2   
1941 N N     . LYS C 198 ? 0.3383 0.3032 0.3403 -0.0585 -0.0004 0.0482  494 LYS A N     
1942 C CA    . LYS C 198 ? 0.2658 0.2537 0.2793 -0.0700 -0.0064 0.0606  494 LYS A CA    
1943 C C     . LYS C 198 ? 0.3327 0.3212 0.3459 -0.0738 -0.0142 0.0599  494 LYS A C     
1944 O O     . LYS C 198 ? 0.2587 0.2212 0.2610 -0.0743 -0.0211 0.0521  494 LYS A O     
1945 C CB    . LYS C 198 ? 0.3404 0.3194 0.3562 -0.0841 -0.0156 0.0687  494 LYS A CB    
1946 C CG    . LYS C 198 ? 0.3301 0.3397 0.3601 -0.0973 -0.0193 0.0846  494 LYS A CG    
1947 C CD    . LYS C 198 ? 0.5600 0.5549 0.5898 -0.1138 -0.0314 0.0936  494 LYS A CD    
1948 C CE    . LYS C 198 ? 0.6753 0.6934 0.7179 -0.1315 -0.0408 0.1089  494 LYS A CE    
1949 N NZ    . LYS C 198 ? 0.7301 0.7243 0.7697 -0.1493 -0.0572 0.1167  494 LYS A NZ    
1950 N N     . VAL C 199 ? 0.2835 0.3032 0.3085 -0.0756 -0.0135 0.0678  495 VAL A N     
1951 C CA    . VAL C 199 ? 0.3546 0.3796 0.3814 -0.0792 -0.0215 0.0685  495 VAL A CA    
1952 C C     . VAL C 199 ? 0.3568 0.4011 0.3975 -0.0963 -0.0316 0.0821  495 VAL A C     
1953 O O     . VAL C 199 ? 0.2825 0.3567 0.3363 -0.1003 -0.0271 0.0927  495 VAL A O     
1954 C CB    . VAL C 199 ? 0.3024 0.3484 0.3321 -0.0662 -0.0138 0.0659  495 VAL A CB    
1955 C CG1   . VAL C 199 ? 0.2564 0.3110 0.2898 -0.0709 -0.0234 0.0681  495 VAL A CG1   
1956 C CG2   . VAL C 199 ? 0.3386 0.3626 0.3537 -0.0521 -0.0060 0.0538  495 VAL A CG2   
1957 N N     . ASP C 200 ? 0.3701 0.3981 0.4073 -0.1066 -0.0457 0.0822  496 ASP A N     
1958 C CA    . ASP C 200 ? 0.3626 0.4079 0.4133 -0.1246 -0.0580 0.0955  496 ASP A CA    
1959 C C     . ASP C 200 ? 0.4053 0.4844 0.4680 -0.1215 -0.0568 0.0989  496 ASP A C     
1960 O O     . ASP C 200 ? 0.4074 0.4773 0.4656 -0.1218 -0.0655 0.0946  496 ASP A O     
1961 C CB    . ASP C 200 ? 0.3869 0.3963 0.4270 -0.1362 -0.0756 0.0928  496 ASP A CB    
1962 C CG    . ASP C 200 ? 0.5116 0.5348 0.5653 -0.1576 -0.0907 0.1078  496 ASP A CG    
1963 O OD1   . ASP C 200 ? 0.5900 0.6556 0.6625 -0.1627 -0.0872 0.1196  496 ASP A OD1   
1964 O OD2   . ASP C 200 ? 0.6822 0.6740 0.7277 -0.1693 -0.1069 0.1077  496 ASP A OD2   
1965 N N     . THR C 201 ? 0.3626 0.4818 0.4400 -0.1170 -0.0462 0.1062  497 THR A N     
1966 C CA    . THR C 201 ? 0.3861 0.5388 0.4748 -0.1097 -0.0440 0.1076  497 THR A CA    
1967 C C     . THR C 201 ? 0.2775 0.4483 0.3800 -0.1262 -0.0582 0.1179  497 THR A C     
1968 O O     . THR C 201 ? 0.3582 0.5401 0.4642 -0.1213 -0.0622 0.1154  497 THR A O     
1969 C CB    . THR C 201 ? 0.3063 0.4993 0.4072 -0.0998 -0.0301 0.1123  497 THR A CB    
1970 O OG1   . THR C 201 ? 0.3696 0.5839 0.4824 -0.1146 -0.0304 0.1261  497 THR A OG1   
1971 C CG2   . THR C 201 ? 0.2956 0.4693 0.3822 -0.0821 -0.0177 0.1008  497 THR A CG2   
1972 N N     . LYS C 202 ? 0.3290 0.5029 0.4396 -0.1464 -0.0670 0.1303  498 LYS A N     
1973 C CA    . LYS C 202 ? 0.4474 0.6359 0.5712 -0.1645 -0.0826 0.1409  498 LYS A CA    
1974 C C     . LYS C 202 ? 0.3718 0.5229 0.4809 -0.1644 -0.0961 0.1304  498 LYS A C     
1975 O O     . LYS C 202 ? 0.3584 0.5249 0.4759 -0.1682 -0.1052 0.1329  498 LYS A O     
1976 C CB    . LYS C 202 ? 0.5290 0.7187 0.6606 -0.1880 -0.0919 0.1561  498 LYS A CB    
1977 C CG    . LYS C 202 ? 0.6166 0.8507 0.7629 -0.1893 -0.0798 0.1688  498 LYS A CG    
1978 C CD    . LYS C 202 ? 0.7873 1.0183 0.9324 -0.2050 -0.0899 0.1813  498 LYS A CD    
1979 C CE    . LYS C 202 ? 0.8231 1.0938 0.9762 -0.2026 -0.0775 0.1914  498 LYS A CE    
1980 N NZ    . LYS C 202 ? 0.7931 1.1165 0.9629 -0.1917 -0.0662 0.1931  498 LYS A NZ    
1981 N N     . ARG C 203 ? 0.3693 0.4727 0.4559 -0.1592 -0.0976 0.1184  499 ARG A N     
1982 C CA    . ARG C 203 ? 0.5240 0.5921 0.5935 -0.1568 -0.1091 0.1070  499 ARG A CA    
1983 C C     . ARG C 203 ? 0.5070 0.5844 0.5722 -0.1392 -0.1014 0.0980  499 ARG A C     
1984 O O     . ARG C 203 ? 0.6037 0.6793 0.6672 -0.1409 -0.1122 0.0961  499 ARG A O     
1985 C CB    . ARG C 203 ? 0.6120 0.6317 0.6587 -0.1531 -0.1107 0.0955  499 ARG A CB    
1986 C CG    . ARG C 203 ? 0.7421 0.7269 0.7678 -0.1465 -0.1193 0.0815  499 ARG A CG    
1987 C CD    . ARG C 203 ? 0.8293 0.7695 0.8370 -0.1500 -0.1293 0.0738  499 ARG A CD    
1988 N NE    . ARG C 203 ? 0.9931 0.9110 0.9930 -0.1606 -0.1508 0.0723  499 ARG A NE    
1989 C CZ    . ARG C 203 ? 1.1352 1.0134 1.1198 -0.1655 -0.1653 0.0661  499 ARG A CZ    
1990 N NH1   . ARG C 203 ? 1.1565 1.0143 1.1329 -0.1607 -0.1601 0.0613  499 ARG A NH1   
1991 N NH2   . ARG C 203 ? 1.2032 1.0610 1.1800 -0.1745 -0.1861 0.0643  499 ARG A NH2   
1992 N N     . LEU C 204 ? 0.4321 0.5182 0.4948 -0.1223 -0.0842 0.0926  500 LEU A N     
1993 C CA    . LEU C 204 ? 0.4937 0.5900 0.5533 -0.1061 -0.0779 0.0859  500 LEU A CA    
1994 C C     . LEU C 204 ? 0.4476 0.5852 0.5279 -0.1095 -0.0832 0.0951  500 LEU A C     
1995 O O     . LEU C 204 ? 0.4068 0.5431 0.4834 -0.1054 -0.0903 0.0914  500 LEU A O     
1996 C CB    . LEU C 204 ? 0.4125 0.5137 0.4686 -0.0893 -0.0603 0.0808  500 LEU A CB    
1997 C CG    . LEU C 204 ? 0.3747 0.4372 0.4089 -0.0806 -0.0537 0.0689  500 LEU A CG    
1998 C CD1   . LEU C 204 ? 0.3973 0.4694 0.4313 -0.0655 -0.0383 0.0657  500 LEU A CD1   
1999 C CD2   . LEU C 204 ? 0.3674 0.4024 0.3828 -0.0760 -0.0599 0.0592  500 LEU A CD2   
2000 N N     . GLU C 205 ? 0.3532 0.5297 0.4553 -0.1168 -0.0798 0.1075  501 GLU A N     
2001 C CA    . GLU C 205 ? 0.3558 0.5774 0.4805 -0.1209 -0.0848 0.1171  501 GLU A CA    
2002 C C     . GLU C 205 ? 0.4870 0.6987 0.6134 -0.1370 -0.1043 0.1207  501 GLU A C     
2003 O O     . GLU C 205 ? 0.5731 0.8023 0.7068 -0.1340 -0.1111 0.1208  501 GLU A O     
2004 C CB    . GLU C 205 ? 0.4610 0.7269 0.6082 -0.1293 -0.0784 0.1311  501 GLU A CB    
2005 C CG    . GLU C 205 ? 0.6102 0.9105 0.7649 -0.1099 -0.0617 0.1292  501 GLU A CG    
2006 C CD    . GLU C 205 ? 0.7056 1.0291 0.8695 -0.1151 -0.0514 0.1385  501 GLU A CD    
2007 O OE1   . GLU C 205 ? 0.7209 1.0381 0.8753 -0.0999 -0.0382 0.1315  501 GLU A OE1   
2008 O OE2   . GLU C 205 ? 0.7423 1.0897 0.9221 -0.1350 -0.0573 0.1532  501 GLU A OE2   
2009 N N     . GLN C 206 ? 0.5048 0.6866 0.6238 -0.1538 -0.1149 0.1232  502 GLN A N     
2010 C CA    . GLN C 206 ? 0.5505 0.7160 0.6678 -0.1690 -0.1356 0.1253  502 GLN A CA    
2011 C C     . GLN C 206 ? 0.5613 0.6982 0.6583 -0.1562 -0.1402 0.1111  502 GLN A C     
2012 O O     . GLN C 206 ? 0.5225 0.6690 0.6248 -0.1599 -0.1525 0.1127  502 GLN A O     
2013 C CB    . GLN C 206 ? 0.5675 0.6976 0.6755 -0.1859 -0.1465 0.1279  502 GLN A CB    
2014 C CG    . GLN C 206 ? 0.6972 0.8120 0.8059 -0.2051 -0.1706 0.1326  502 GLN A CG    
2015 C CD    . GLN C 206 ? 0.8211 0.8957 0.9175 -0.2189 -0.1820 0.1338  502 GLN A CD    
2016 O OE1   . GLN C 206 ? 0.8483 0.8981 0.9310 -0.2118 -0.1735 0.1269  502 GLN A OE1   
2017 N NE2   . GLN C 206 ? 0.8644 0.9278 0.9595 -0.2304 -0.1966 0.1406  502 GLN A NE2   
2018 N N     . MET C 207 ? 0.5803 0.6836 0.6539 -0.1412 -0.1305 0.0977  503 MET A N     
2019 C CA    . MET C 207 ? 0.6189 0.6975 0.6716 -0.1287 -0.1329 0.0852  503 MET A CA    
2020 C C     . MET C 207 ? 0.5941 0.7045 0.6569 -0.1168 -0.1287 0.0862  503 MET A C     
2021 O O     . MET C 207 ? 0.5592 0.6650 0.6162 -0.1154 -0.1395 0.0832  503 MET A O     
2022 C CB    . MET C 207 ? 0.6980 0.7423 0.7268 -0.1154 -0.1209 0.0726  503 MET A CB    
2023 C CG    . MET C 207 ? 0.7976 0.8019 0.8096 -0.1231 -0.1284 0.0669  503 MET A CG    
2024 S SD    . MET C 207 ? 0.8384 0.8141 0.8293 -0.1076 -0.1117 0.0541  503 MET A SD    
2025 C CE    . MET C 207 ? 0.8554 0.7859 0.8265 -0.1156 -0.1262 0.0460  503 MET A CE    
2026 N N     . GLY C 208 ? 0.6050 0.7470 0.6818 -0.1071 -0.1141 0.0899  504 GLY A N     
2027 C CA    . GLY C 208 ? 0.5615 0.7327 0.6472 -0.0933 -0.1108 0.0897  504 GLY A CA    
2028 C C     . GLY C 208 ? 0.5451 0.7470 0.6503 -0.1026 -0.1251 0.0981  504 GLY A C     
2029 O O     . GLY C 208 ? 0.5186 0.7228 0.6203 -0.0942 -0.1314 0.0943  504 GLY A O     
2030 N N     . GLU C 209 ? 0.5639 0.7900 0.6899 -0.1210 -0.1312 0.1103  505 GLU A N     
2031 C CA    . GLU C 209 ? 0.6645 0.9220 0.8113 -0.1326 -0.1459 0.1196  505 GLU A CA    
2032 C C     . GLU C 209 ? 0.6661 0.8882 0.7958 -0.1383 -0.1639 0.1136  505 GLU A C     
2033 O O     . GLU C 209 ? 0.5989 0.8381 0.7365 -0.1370 -0.1744 0.1148  505 GLU A O     
2039 N N     . GLU C 210 ? 0.6944 0.8672 0.7997 -0.1435 -0.1682 0.1063  506 GLU A N     
2040 C CA    . GLU C 210 ? 0.6353 0.7726 0.7213 -0.1481 -0.1856 0.0994  506 GLU A CA    
2041 C C     . GLU C 210 ? 0.6045 0.7277 0.6709 -0.1287 -0.1822 0.0881  506 GLU A C     
2042 O O     . GLU C 210 ? 0.6434 0.7650 0.7064 -0.1294 -0.1961 0.0867  506 GLU A O     
2043 C CB    . GLU C 210 ? 0.7339 0.8235 0.7979 -0.1561 -0.1906 0.0933  506 GLU A CB    
2044 C CG    . GLU C 210 ? 0.8682 0.9606 0.9469 -0.1798 -0.2042 0.1048  506 GLU A CG    
2045 C CD    . GLU C 210 ? 0.9884 1.0306 1.0439 -0.1852 -0.2104 0.0973  506 GLU A CD    
2046 O OE1   . GLU C 210 ? 1.0043 1.0173 1.0363 -0.1699 -0.1994 0.0842  506 GLU A OE1   
2047 O OE2   . GLU C 210 ? 1.0354 1.0677 1.0965 -0.2048 -0.2272 0.1047  506 GLU A OE2   
2048 N N     . LEU C 211 ? 0.4850 0.5967 0.5375 -0.1122 -0.1648 0.0804  507 LEU A N     
2049 C CA    . LEU C 211 ? 0.5242 0.6234 0.5583 -0.0949 -0.1615 0.0717  507 LEU A CA    
2050 C C     . LEU C 211 ? 0.5179 0.6558 0.5713 -0.0881 -0.1654 0.0770  507 LEU A C     
2051 O O     . LEU C 211 ? 0.4928 0.6233 0.5364 -0.0838 -0.1761 0.0737  507 LEU A O     
2052 C CB    . LEU C 211 ? 0.5307 0.6153 0.5507 -0.0804 -0.1425 0.0650  507 LEU A CB    
2053 C CG    . LEU C 211 ? 0.5636 0.6057 0.5585 -0.0822 -0.1389 0.0563  507 LEU A CG    
2054 C CD1   . LEU C 211 ? 0.5614 0.5983 0.5504 -0.0706 -0.1199 0.0525  507 LEU A CD1   
2055 C CD2   . LEU C 211 ? 0.5288 0.5386 0.4957 -0.0787 -0.1479 0.0474  507 LEU A CD2   
2056 N N     . ALA C 212 ? 0.4655 0.6464 0.5462 -0.0865 -0.1572 0.0851  508 ALA A N     
2057 C CA    . ALA C 212 ? 0.4654 0.6886 0.5675 -0.0792 -0.1612 0.0900  508 ALA A CA    
2058 C C     . ALA C 212 ? 0.5132 0.7476 0.6262 -0.0930 -0.1816 0.0955  508 ALA A C     
2059 O O     . ALA C 212 ? 0.6016 0.8604 0.7251 -0.0853 -0.1887 0.0966  508 ALA A O     
2060 C CB    . ALA C 212 ? 0.4160 0.6873 0.5466 -0.0772 -0.1495 0.0982  508 ALA A CB    
2061 N N     . GLU C 213 ? 0.6074 0.8233 0.7179 -0.1130 -0.1924 0.0987  509 GLU A N     
2062 C CA    . GLU C 213 ? 0.7179 0.9385 0.8362 -0.1274 -0.2140 0.1034  509 GLU A CA    
2063 C C     . GLU C 213 ? 0.7363 0.9146 0.8236 -0.1211 -0.2250 0.0923  509 GLU A C     
2064 O O     . GLU C 213 ? 0.6851 0.8751 0.7764 -0.1188 -0.2379 0.0928  509 GLU A O     
2065 C CB    . GLU C 213 ? 0.8017 1.0161 0.9283 -0.1518 -0.2236 0.1114  509 GLU A CB    
2066 C CG    . GLU C 213 ? 0.8656 1.0913 1.0061 -0.1696 -0.2468 0.1189  509 GLU A CG    
2067 C CD    . GLU C 213 ? 0.9999 1.2781 1.1757 -0.1770 -0.2408 0.1323  509 GLU A CD    
2068 O OE1   . GLU C 213 ? 1.0246 1.3203 1.2131 -0.1829 -0.2285 0.1400  509 GLU A OE1   
2069 O OE2   . GLU C 213 ? 1.0723 1.3744 1.2619 -0.1764 -0.2482 0.1350  509 GLU A OE2   
2070 N N     . GLN C 214 ? 0.7565 0.8871 0.8124 -0.1180 -0.2203 0.0823  510 GLN A N     
2071 C CA    . GLN C 214 ? 0.7599 0.8519 0.7835 -0.1106 -0.2283 0.0716  510 GLN A CA    
2072 C C     . GLN C 214 ? 0.7122 0.8126 0.7293 -0.0911 -0.2220 0.0681  510 GLN A C     
2073 O O     . GLN C 214 ? 0.7325 0.8186 0.7334 -0.0868 -0.2338 0.0639  510 GLN A O     
2074 C CB    . GLN C 214 ? 0.8266 0.8723 0.8195 -0.1090 -0.2214 0.0615  510 GLN A CB    
2075 C CG    . GLN C 214 ? 0.9238 0.9530 0.9181 -0.1265 -0.2301 0.0630  510 GLN A CG    
2076 C CD    . GLN C 214 ? 1.0468 1.0308 1.0097 -0.1220 -0.2245 0.0512  510 GLN A CD    
2077 O OE1   . GLN C 214 ? 1.0896 1.0681 1.0550 -0.1240 -0.2139 0.0513  510 GLN A OE1   
2078 N NE2   . GLN C 214 ? 1.0896 1.0425 1.0222 -0.1154 -0.2316 0.0407  510 GLN A NE2   
2079 N N     . LEU C 215 ? 0.6436 0.7648 0.6715 -0.0790 -0.2048 0.0697  511 LEU A N     
2080 C CA    . LEU C 215 ? 0.6322 0.7607 0.6551 -0.0602 -0.2007 0.0669  511 LEU A CA    
2081 C C     . LEU C 215 ? 0.6717 0.8370 0.7174 -0.0593 -0.2145 0.0729  511 LEU A C     
2082 O O     . LEU C 215 ? 0.7345 0.8913 0.7674 -0.0497 -0.2233 0.0695  511 LEU A O     
2083 C CB    . LEU C 215 ? 0.6323 0.7742 0.6623 -0.0477 -0.1810 0.0669  511 LEU A CB    
2084 C CG    . LEU C 215 ? 0.7292 0.8321 0.7312 -0.0419 -0.1674 0.0592  511 LEU A CG    
2085 C CD1   . LEU C 215 ? 0.6684 0.7873 0.6819 -0.0331 -0.1498 0.0603  511 LEU A CD1   
2086 C CD2   . LEU C 215 ? 0.7437 0.8170 0.7161 -0.0307 -0.1704 0.0527  511 LEU A CD2   
2087 N N     . ARG C 216 ? 0.6116 0.8198 0.6916 -0.0694 -0.2167 0.0824  512 ARG A N     
2088 C CA    . ARG C 216 ? 0.5031 0.7511 0.6080 -0.0699 -0.2304 0.0886  512 ARG A CA    
2089 C C     . ARG C 216 ? 0.5737 0.7998 0.6651 -0.0782 -0.2517 0.0866  512 ARG A C     
2090 O O     . ARG C 216 ? 0.5860 0.8307 0.6853 -0.0716 -0.2635 0.0876  512 ARG A O     
2098 N N     . THR C 217 ? 0.6327 0.8184 0.7023 -0.0914 -0.2577 0.0830  513 THR A N     
2099 C CA    . THR C 217 ? 0.7438 0.9045 0.7966 -0.0991 -0.2788 0.0798  513 THR A CA    
2100 C C     . THR C 217 ? 0.7118 0.8363 0.7283 -0.0829 -0.2787 0.0696  513 THR A C     
2101 O O     . THR C 217 ? 0.6295 0.7596 0.6438 -0.0767 -0.2915 0.0693  513 THR A O     
2102 C CB    . THR C 217 ? 0.7543 0.8841 0.7959 -0.1178 -0.2865 0.0786  513 THR A CB    
2103 O OG1   . THR C 217 ? 0.6726 0.8361 0.7484 -0.1357 -0.2912 0.0902  513 THR A OG1   
2104 C CG2   . THR C 217 ? 0.6728 0.7680 0.6888 -0.1222 -0.3071 0.0721  513 THR A CG2   
2105 N N     . VAL C 218 ? 0.6898 0.7779 0.6776 -0.0767 -0.2648 0.0619  514 VAL A N     
2106 C CA    . VAL C 218 ? 0.6780 0.7325 0.6300 -0.0631 -0.2634 0.0538  514 VAL A CA    
2107 C C     . VAL C 218 ? 0.6341 0.7103 0.5939 -0.0470 -0.2626 0.0561  514 VAL A C     
2108 O O     . VAL C 218 ? 0.7370 0.7970 0.6762 -0.0393 -0.2725 0.0532  514 VAL A O     
2109 C CB    . VAL C 218 ? 0.6348 0.6578 0.5620 -0.0584 -0.2450 0.0471  514 VAL A CB    
2110 C CG1   . VAL C 218 ? 0.6178 0.6064 0.5064 -0.0477 -0.2446 0.0400  514 VAL A CG1   
2111 C CG2   . VAL C 218 ? 0.7285 0.7332 0.6517 -0.0728 -0.2462 0.0445  514 VAL A CG2   
2112 N N     . GLU C 219 ? 0.4949 0.6073 0.4833 -0.0407 -0.2516 0.0612  515 GLU A N     
2113 C CA    . GLU C 219 ? 0.5764 0.7096 0.5729 -0.0230 -0.2515 0.0624  515 GLU A CA    
2114 C C     . GLU C 219 ? 0.6275 0.7805 0.6357 -0.0234 -0.2724 0.0653  515 GLU A C     
2115 O O     . GLU C 219 ? 0.6068 0.7461 0.5975 -0.0115 -0.2807 0.0626  515 GLU A O     
2116 C CB    . GLU C 219 ? 0.6129 0.7856 0.6401 -0.0166 -0.2373 0.0666  515 GLU A CB    
2117 C CG    . GLU C 219 ? 0.8046 0.9880 0.8327 0.0056  -0.2328 0.0647  515 GLU A CG    
2118 C CD    . GLU C 219 ? 0.9217 1.1445 0.9784 0.0130  -0.2190 0.0676  515 GLU A CD    
2119 O OE1   . GLU C 219 ? 0.9334 1.2045 1.0228 0.0141  -0.2242 0.0728  515 GLU A OE1   
2120 O OE2   . GLU C 219 ? 0.9297 1.1368 0.9763 0.0177  -0.2030 0.0647  515 GLU A OE2   
2121 N N     . GLN C 220 ? 0.6858 0.8710 0.7236 -0.0380 -0.2821 0.0718  516 GLN A N     
2122 C CA    . GLN C 220 ? 0.6345 0.8414 0.6864 -0.0403 -0.3032 0.0752  516 GLN A CA    
2123 C C     . GLN C 220 ? 0.6532 0.8160 0.6693 -0.0423 -0.3187 0.0693  516 GLN A C     
2124 O O     . GLN C 220 ? 0.8179 0.9824 0.8292 -0.0325 -0.3283 0.0675  516 GLN A O     
2125 C CB    . GLN C 220 ? 0.6882 0.9315 0.7751 -0.0593 -0.3091 0.0832  516 GLN A CB    
2126 C CG    . GLN C 220 ? 0.7523 1.0511 0.8787 -0.0561 -0.2969 0.0905  516 GLN A CG    
2127 C CD    . GLN C 220 ? 0.7666 1.1018 0.9107 -0.0363 -0.2985 0.0899  516 GLN A CD    
2128 O OE1   . GLN C 220 ? 0.7848 1.1320 0.9371 -0.0359 -0.3109 0.0892  516 GLN A OE1   
2129 N NE2   . GLN C 220 ? 0.7424 1.0941 0.8916 -0.0187 -0.2864 0.0895  516 GLN A NE2   
2130 N N     . ARG C 221 ? 0.6283 0.7509 0.6179 -0.0531 -0.3171 0.0646  517 ARG A N     
2131 C CA    . ARG C 221 ? 0.6407 0.7208 0.5930 -0.0533 -0.3277 0.0574  517 ARG A CA    
2132 C C     . ARG C 221 ? 0.6523 0.7112 0.5759 -0.0351 -0.3249 0.0536  517 ARG A C     
2133 O O     . ARG C 221 ? 0.7436 0.7897 0.6510 -0.0300 -0.3343 0.0509  517 ARG A O     
2134 C CB    . ARG C 221 ? 0.6876 0.7299 0.6154 -0.0649 -0.3249 0.0518  517 ARG A CB    
2135 C CG    . ARG C 221 ? 0.7137 0.7141 0.6032 -0.0645 -0.3327 0.0432  517 ARG A CG    
2136 C CD    . ARG C 221 ? 0.8314 0.8429 0.7324 -0.0695 -0.3489 0.0444  517 ARG A CD    
2137 N NE    . ARG C 221 ? 0.8831 0.8561 0.7472 -0.0678 -0.3565 0.0362  517 ARG A NE    
2138 C CZ    . ARG C 221 ? 0.9719 0.9463 0.8361 -0.0689 -0.3708 0.0358  517 ARG A CZ    
2139 N NH1   . ARG C 221 ? 0.9769 0.9901 0.8767 -0.0717 -0.3790 0.0429  517 ARG A NH1   
2140 N NH2   . ARG C 221 ? 1.0411 0.9800 0.8698 -0.0667 -0.3766 0.0282  517 ARG A NH2   
2141 N N     . ILE C 222 ? 0.6136 0.6679 0.5319 -0.0248 -0.3054 0.0527  518 ILE A N     
2142 C CA    . ILE C 222 ? 0.5829 0.6155 0.4744 -0.0086 -0.3014 0.0502  518 ILE A CA    
2143 C C     . ILE C 222 ? 0.6705 0.7297 0.5790 0.0039  -0.3136 0.0539  518 ILE A C     
2144 O O     . ILE C 222 ? 0.6710 0.7102 0.5559 0.0133  -0.3208 0.0523  518 ILE A O     
2145 C CB    . ILE C 222 ? 0.6075 0.6316 0.4937 -0.0015 -0.2785 0.0489  518 ILE A CB    
2146 C CG1   . ILE C 222 ? 0.6924 0.6838 0.5538 -0.0112 -0.2681 0.0439  518 ILE A CG1   
2147 C CG2   . ILE C 222 ? 0.6902 0.6991 0.5566 0.0152  -0.2763 0.0487  518 ILE A CG2   
2148 C CD1   . ILE C 222 ? 0.6961 0.6837 0.5579 -0.0073 -0.2459 0.0431  518 ILE A CD1   
2149 N N     . TYR C 223 ? 0.6808 0.7870 0.6309 0.0048  -0.3137 0.0587  519 TYR A N     
2150 C CA    . TYR C 223 ? 0.7473 0.8840 0.7170 0.0181  -0.3246 0.0611  519 TYR A CA    
2151 C C     . TYR C 223 ? 0.7774 0.9121 0.7433 0.0127  -0.3396 0.0600  519 TYR A C     
2152 O O     . TYR C 223 ? 0.7696 0.9123 0.7363 0.0252  -0.3471 0.0597  519 TYR A O     
2153 C CB    . TYR C 223 ? 0.7856 0.9785 0.8019 0.0195  -0.3200 0.0662  519 TYR A CB    
2154 C CG    . TYR C 223 ? 0.8573 1.0550 0.8783 0.0291  -0.2981 0.0650  519 TYR A CG    
2155 C CD1   . TYR C 223 ? 0.9011 1.0660 0.8939 0.0443  -0.2904 0.0606  519 TYR A CD1   
2156 C CD2   . TYR C 223 ? 0.8555 1.0894 0.9079 0.0222  -0.2859 0.0689  519 TYR A CD2   
2157 C CE1   . TYR C 223 ? 0.9190 1.0864 0.9154 0.0529  -0.2720 0.0592  519 TYR A CE1   
2158 C CE2   . TYR C 223 ? 0.8767 1.1141 0.9318 0.0315  -0.2666 0.0673  519 TYR A CE2   
2159 C CZ    . TYR C 223 ? 0.8998 1.1033 0.9270 0.0471  -0.2601 0.0620  519 TYR A CZ    
2160 O OH    . TYR C 223 ? 0.8830 1.0885 0.9127 0.0561  -0.2424 0.0602  519 TYR A OH    
2161 N N     . GLU C 224 ? 0.7987 0.9211 0.7599 -0.0054 -0.3447 0.0591  520 GLU A N     
2162 C CA    . GLU C 224 ? 0.8556 0.9712 0.8100 -0.0107 -0.3596 0.0574  520 GLU A CA    
2163 C C     . GLU C 224 ? 0.8363 0.9030 0.7444 -0.0055 -0.3619 0.0519  520 GLU A C     
2164 O O     . GLU C 224 ? 0.9144 0.9778 0.8142 0.0012  -0.3721 0.0512  520 GLU A O     
2165 C CB    . GLU C 224 ? 0.9261 1.0452 0.8928 -0.0314 -0.3651 0.0581  520 GLU A CB    
2166 C CG    . GLU C 224 ? 1.0192 1.1919 1.0339 -0.0384 -0.3663 0.0650  520 GLU A CG    
2167 C CD    . GLU C 224 ? 1.1020 1.3108 1.1386 -0.0277 -0.3756 0.0669  520 GLU A CD    
2168 O OE1   . GLU C 224 ? 1.1421 1.3354 1.1636 -0.0272 -0.3886 0.0641  520 GLU A OE1   
2169 O OE2   . GLU C 224 ? 1.1031 1.3563 1.1714 -0.0188 -0.3698 0.0707  520 GLU A OE2   
2170 N N     . LEU C 225 ? 0.7291 0.7593 0.6068 -0.0085 -0.3519 0.0482  521 LEU A N     
2171 C CA    . LEU C 225 ? 0.8004 0.7875 0.6337 -0.0038 -0.3514 0.0437  521 LEU A CA    
2172 C C     . LEU C 225 ? 0.8425 0.8257 0.6657 0.0130  -0.3488 0.0458  521 LEU A C     
2173 O O     . LEU C 225 ? 0.9519 0.9102 0.7469 0.0174  -0.3533 0.0444  521 LEU A O     
2174 C CB    . LEU C 225 ? 0.7546 0.7095 0.5603 -0.0098 -0.3393 0.0393  521 LEU A CB    
2175 C CG    . LEU C 225 ? 0.8139 0.7649 0.6245 -0.0256 -0.3430 0.0359  521 LEU A CG    
2176 C CD1   . LEU C 225 ? 0.8771 0.7920 0.6536 -0.0286 -0.3322 0.0294  521 LEU A CD1   
2177 C CD2   . LEU C 225 ? 0.8950 0.8452 0.7062 -0.0317 -0.3596 0.0341  521 LEU A CD2   
2178 N N     . ALA C 226 ? 0.8196 0.8262 0.6649 0.0225  -0.3418 0.0492  522 ALA A N     
2179 C CA    . ALA C 226 ? 0.8413 0.8458 0.6812 0.0394  -0.3408 0.0510  522 ALA A CA    
2180 C C     . ALA C 226 ? 0.9014 0.9396 0.7686 0.0479  -0.3533 0.0532  522 ALA A C     
2181 O O     . ALA C 226 ? 0.9169 0.9506 0.7779 0.0622  -0.3553 0.0541  522 ALA A O     
2182 C CB    . ALA C 226 ? 0.7270 0.7375 0.5753 0.0479  -0.3273 0.0523  522 ALA A CB    
2183 N N     . GLY C 227 ? 0.9049 0.9761 0.8016 0.0390  -0.3618 0.0542  523 GLY A N     
2184 C CA    . GLY C 227 ? 0.9179 1.0285 0.8447 0.0469  -0.3726 0.0565  523 GLY A CA    
2185 C C     . GLY C 227 ? 0.9416 1.0782 0.8884 0.0649  -0.3667 0.0582  523 GLY A C     
2186 O O     . GLY C 227 ? 0.9725 1.1161 0.9214 0.0786  -0.3737 0.0586  523 GLY A O     
2187 N N     . GLN C 228 ? 0.8854 1.0336 0.8450 0.0659  -0.3539 0.0588  524 GLN A N     
2188 C CA    . GLN C 228 ? 0.8330 0.9993 0.8066 0.0843  -0.3467 0.0590  524 GLN A CA    
2189 C C     . GLN C 228 ? 0.8689 1.0420 0.8521 0.0814  -0.3324 0.0591  524 GLN A C     
2190 O O     . GLN C 228 ? 0.8795 1.0287 0.8472 0.0669  -0.3274 0.0588  524 GLN A O     
2191 C CB    . GLN C 228 ? 0.8766 1.0015 0.8167 0.0978  -0.3464 0.0571  524 GLN A CB    
2192 C CG    . GLN C 228 ? 0.8916 1.0214 0.8385 0.1156  -0.3372 0.0559  524 GLN A CG    
2193 C CD    . GLN C 228 ? 0.9350 1.0138 0.8433 0.1232  -0.3350 0.0546  524 GLN A CD    
2194 O OE1   . GLN C 228 ? 1.0090 1.0554 0.8888 0.1177  -0.3420 0.0552  524 GLN A OE1   
2195 N NE2   . GLN C 228 ? 0.9019 0.9735 0.8092 0.1352  -0.3253 0.0529  524 GLN A NE2   
2196 N N     . GLU C 229 ? 0.8872 1.0926 0.8954 0.0958  -0.3256 0.0593  525 GLU A N     
2197 C CA    . GLU C 229 ? 0.8510 1.0650 0.8690 0.0971  -0.3116 0.0587  525 GLU A CA    
2198 C C     . GLU C 229 ? 0.8564 1.0328 0.8468 0.1118  -0.3027 0.0549  525 GLU A C     
2199 O O     . GLU C 229 ? 0.8931 1.0547 0.8715 0.1252  -0.3071 0.0535  525 GLU A O     
2200 C CB    . GLU C 229 ? 0.9415 1.2184 1.0055 0.1040  -0.3076 0.0608  525 GLU A CB    
2201 C CG    . GLU C 229 ? 1.0338 1.3551 1.1295 0.0896  -0.3168 0.0662  525 GLU A CG    
2202 C CD    . GLU C 229 ? 1.1248 1.4631 1.2385 0.0692  -0.3098 0.0704  525 GLU A CD    
2203 O OE1   . GLU C 229 ? 1.1590 1.5269 1.2966 0.0550  -0.3137 0.0733  525 GLU A OE1   
2204 O OE2   . GLU C 229 ? 1.1568 1.4726 1.2569 0.0663  -0.2924 0.0688  525 GLU A OE2   
2205 N N     . PHE C 230 ? 0.8040 0.9640 0.7850 0.1074  -0.2891 0.0537  526 PHE A N     
2206 C CA    . PHE C 230 ? 0.7245 0.8496 0.6805 0.1189  -0.2799 0.0509  526 PHE A CA    
2207 C C     . PHE C 230 ? 0.7174 0.8395 0.6758 0.1085  -0.2584 0.0505  526 PHE A C     
2208 O O     . PHE C 230 ? 0.7374 0.8761 0.7104 0.0916  -0.2522 0.0526  526 PHE A O     
2209 C CB    . PHE C 230 ? 0.6443 0.7159 0.5578 0.1160  -0.2859 0.0513  526 PHE A CB    
2210 C CG    . PHE C 230 ? 0.6522 0.6966 0.5430 0.0957  -0.2833 0.0526  526 PHE A CG    
2211 C CD1   . PHE C 230 ? 0.7396 0.7920 0.6338 0.0830  -0.2947 0.0538  526 PHE A CD1   
2212 C CD2   . PHE C 230 ? 0.5848 0.5962 0.4514 0.0891  -0.2679 0.0519  526 PHE A CD2   
2213 C CE1   . PHE C 230 ? 0.5892 0.6154 0.4614 0.0656  -0.2910 0.0533  526 PHE A CE1   
2214 C CE2   . PHE C 230 ? 0.6512 0.6400 0.4976 0.0719  -0.2632 0.0518  526 PHE A CE2   
2215 C CZ    . PHE C 230 ? 0.6042 0.5995 0.4525 0.0609  -0.2749 0.0519  526 PHE A CZ    
2216 N N     . ASN C 231 ? 0.6760 0.7756 0.6198 0.1185  -0.2484 0.0481  527 ASN A N     
2217 C CA    . ASN C 231 ? 0.6716 0.7657 0.6158 0.1106  -0.2284 0.0473  527 ASN A CA    
2218 C C     . ASN C 231 ? 0.6364 0.6866 0.5479 0.0945  -0.2234 0.0482  527 ASN A C     
2219 O O     . ASN C 231 ? 0.7161 0.7278 0.5975 0.0983  -0.2236 0.0481  527 ASN A O     
2220 C CB    . ASN C 231 ? 0.6747 0.7639 0.6176 0.1284  -0.2212 0.0440  527 ASN A CB    
2221 C CG    . ASN C 231 ? 0.6959 0.7850 0.6432 0.1212  -0.2013 0.0431  527 ASN A CG    
2222 O OD1   . ASN C 231 ? 0.6336 0.7322 0.5894 0.1040  -0.1929 0.0451  527 ASN A OD1   
2223 N ND2   . ASN C 231 ? 0.7540 0.8308 0.6948 0.1345  -0.1951 0.0400  527 ASN A ND2   
2224 N N     . ILE C 232 ? 0.5966 0.6534 0.5141 0.0765  -0.2194 0.0493  528 ILE A N     
2225 C CA    . ILE C 232 ? 0.5795 0.5986 0.4669 0.0626  -0.2150 0.0487  528 ILE A CA    
2226 C C     . ILE C 232 ? 0.6972 0.6921 0.5689 0.0636  -0.1984 0.0473  528 ILE A C     
2227 O O     . ILE C 232 ? 0.7217 0.6812 0.5623 0.0586  -0.1957 0.0471  528 ILE A O     
2228 C CB    . ILE C 232 ? 0.6597 0.6913 0.5590 0.0449  -0.2145 0.0489  528 ILE A CB    
2229 C CG1   . ILE C 232 ? 0.5038 0.5607 0.4203 0.0429  -0.2326 0.0511  528 ILE A CG1   
2230 C CG2   . ILE C 232 ? 0.7095 0.7031 0.5765 0.0331  -0.2107 0.0465  528 ILE A CG2   
2231 C CD1   . ILE C 232 ? 0.4966 0.5675 0.4281 0.0249  -0.2351 0.0524  528 ILE A CD1   
2232 N N     . ASN C 233 ? 0.6581 0.6731 0.5509 0.0699  -0.1873 0.0464  529 ASN A N     
2233 C CA    . ASN C 233 ? 0.6805 0.6753 0.5618 0.0704  -0.1720 0.0450  529 ASN A CA    
2234 C C     . ASN C 233 ? 0.6991 0.6688 0.5609 0.0839  -0.1753 0.0452  529 ASN A C     
2235 O O     . ASN C 233 ? 0.6766 0.6283 0.5285 0.0845  -0.1643 0.0446  529 ASN A O     
2236 C CB    . ASN C 233 ? 0.6680 0.6934 0.5781 0.0716  -0.1597 0.0440  529 ASN A CB    
2237 C CG    . ASN C 233 ? 0.7748 0.8208 0.7025 0.0561  -0.1566 0.0453  529 ASN A CG    
2238 O OD1   . ASN C 233 ? 0.8816 0.9624 0.8346 0.0553  -0.1632 0.0475  529 ASN A OD1   
2239 N ND2   . ASN C 233 ? 0.7735 0.7981 0.6877 0.0434  -0.1474 0.0440  529 ASN A ND2   
2240 N N     . SER C 234 ? 0.6948 0.6619 0.5509 0.0945  -0.1913 0.0463  530 SER A N     
2241 C CA    . SER C 234 ? 0.7184 0.6558 0.5523 0.1062  -0.1978 0.0474  530 SER A CA    
2242 C C     . SER C 234 ? 0.8602 0.7600 0.6583 0.0963  -0.2030 0.0513  530 SER A C     
2243 O O     . SER C 234 ? 0.8027 0.7006 0.5928 0.0959  -0.2171 0.0528  530 SER A O     
2244 C CB    . SER C 234 ? 0.6042 0.5585 0.4509 0.1254  -0.2135 0.0460  530 SER A CB    
2245 O OG    . SER C 234 ? 0.6955 0.6145 0.5162 0.1353  -0.2238 0.0478  530 SER A OG    
2246 N N     . PRO C 235 ? 0.9254 0.7964 0.7009 0.0880  -0.1924 0.0532  531 PRO A N     
2247 C CA    . PRO C 235 ? 0.8715 0.7096 0.6114 0.0792  -0.1969 0.0579  531 PRO A CA    
2248 C C     . PRO C 235 ? 0.9460 0.7666 0.6692 0.0895  -0.2161 0.0618  531 PRO A C     
2249 O O     . PRO C 235 ? 0.9884 0.7958 0.6919 0.0829  -0.2229 0.0644  531 PRO A O     
2250 C CB    . PRO C 235 ? 0.8734 0.6890 0.5975 0.0725  -0.1825 0.0600  531 PRO A CB    
2251 C CG    . PRO C 235 ? 0.8003 0.6392 0.5521 0.0726  -0.1681 0.0551  531 PRO A CG    
2252 C CD    . PRO C 235 ? 0.7905 0.6596 0.5719 0.0862  -0.1760 0.0517  531 PRO A CD    
2253 N N     . LYS C 236 ? 0.9575 0.7811 0.6932 0.1046  -0.2213 0.0604  532 LYS A N     
2254 C CA    . LYS C 236 ? 0.9913 0.8056 0.7231 0.1131  -0.2337 0.0611  532 LYS A CA    
2255 C C     . LYS C 236 ? 0.9804 0.8169 0.7236 0.1151  -0.2454 0.0596  532 LYS A C     
2256 O O     . LYS C 236 ? 1.0326 0.8537 0.7574 0.1094  -0.2528 0.0625  532 LYS A O     
2257 C CB    . LYS C 236 ? 1.0073 0.8263 0.7554 0.1300  -0.2356 0.0571  532 LYS A CB    
2258 C CG    . LYS C 236 ? 1.0766 0.8739 0.8136 0.1377  -0.2472 0.0578  532 LYS A CG    
2259 C CD    . LYS C 236 ? 1.1736 0.9349 0.8904 0.1338  -0.2431 0.0609  532 LYS A CD    
2260 C CE    . LYS C 236 ? 1.2659 1.0198 0.9896 0.1503  -0.2515 0.0560  532 LYS A CE    
2261 N NZ    . LYS C 236 ? 1.2593 1.0420 1.0108 0.1649  -0.2466 0.0478  532 LYS A NZ    
2262 N N     . GLN C 237 ? 0.9362 0.8111 0.7108 0.1225  -0.2472 0.0553  533 GLN A N     
2263 C CA    . GLN C 237 ? 0.8966 0.7967 0.6864 0.1239  -0.2589 0.0543  533 GLN A CA    
2264 C C     . GLN C 237 ? 0.8737 0.7643 0.6461 0.1071  -0.2607 0.0566  533 GLN A C     
2265 O O     . GLN C 237 ? 0.8985 0.7860 0.6638 0.1053  -0.2715 0.0576  533 GLN A O     
2266 C CB    . GLN C 237 ? 0.8909 0.8385 0.7196 0.1317  -0.2584 0.0505  533 GLN A CB    
2267 C CG    . GLN C 237 ? 0.9349 0.8993 0.7837 0.1508  -0.2575 0.0465  533 GLN A CG    
2268 C CD    . GLN C 237 ? 0.9445 0.9629 0.8333 0.1577  -0.2565 0.0435  533 GLN A CD    
2269 O OE1   . GLN C 237 ? 0.9402 0.9841 0.8434 0.1481  -0.2603 0.0452  533 GLN A OE1   
2270 N NE2   . GLN C 237 ? 0.9647 1.0013 0.8714 0.1735  -0.2513 0.0390  533 GLN A NE2   
2271 N N     . LEU C 238 ? 0.7374 0.6230 0.5024 0.0951  -0.2504 0.0567  534 LEU A N     
2272 C CA    . LEU C 238 ? 0.7735 0.6504 0.5220 0.0797  -0.2512 0.0570  534 LEU A CA    
2273 C C     . LEU C 238 ? 0.8396 0.6831 0.5538 0.0750  -0.2536 0.0601  534 LEU A C     
2274 O O     . LEU C 238 ? 0.8514 0.6922 0.5554 0.0686  -0.2611 0.0597  534 LEU A O     
2275 C CB    . LEU C 238 ? 0.6089 0.4868 0.3602 0.0668  -0.2314 0.0545  534 LEU A CB    
2276 C CG    . LEU C 238 ? 0.6935 0.5618 0.4278 0.0521  -0.2310 0.0528  534 LEU A CG    
2277 C CD1   . LEU C 238 ? 0.7422 0.6351 0.4967 0.0497  -0.2446 0.0509  534 LEU A CD1   
2278 C CD2   . LEU C 238 ? 0.7529 0.6194 0.4882 0.0418  -0.2120 0.0496  534 LEU A CD2   
2279 N N     . GLY C 239 ? 0.8606 0.6793 0.5573 0.0776  -0.2474 0.0635  535 GLY A N     
2280 C CA    . GLY C 239 ? 0.7899 0.5798 0.4563 0.0727  -0.2499 0.0677  535 GLY A CA    
2281 C C     . GLY C 239 ? 0.8438 0.6368 0.5126 0.0796  -0.2659 0.0680  535 GLY A C     
2282 O O     . GLY C 239 ? 0.8811 0.6587 0.5275 0.0732  -0.2706 0.0701  535 GLY A O     
2283 N N     . VAL C 240 ? 0.8991 0.7134 0.5951 0.0933  -0.2743 0.0655  536 VAL A N     
2284 C CA    . VAL C 240 ? 1.0001 0.8204 0.7012 0.1010  -0.2898 0.0653  536 VAL A CA    
2285 C C     . VAL C 240 ? 0.9611 0.7981 0.6670 0.0935  -0.2968 0.0634  536 VAL A C     
2286 O O     . VAL C 240 ? 0.9500 0.7760 0.6406 0.0913  -0.3065 0.0648  536 VAL A O     
2287 C CB    . VAL C 240 ? 0.9988 0.8431 0.7303 0.1184  -0.2954 0.0621  536 VAL A CB    
2288 C CG1   . VAL C 240 ? 0.8687 0.7206 0.6061 0.1268  -0.3114 0.0616  536 VAL A CG1   
2289 C CG2   . VAL C 240 ? 1.0295 0.8535 0.7546 0.1259  -0.2896 0.0627  536 VAL A CG2   
2290 N N     . ILE C 241 ? 0.8440 0.7072 0.5711 0.0890  -0.2928 0.0603  537 ILE A N     
2291 C CA    . ILE C 241 ? 0.8397 0.7182 0.5731 0.0803  -0.3004 0.0582  537 ILE A CA    
2292 C C     . ILE C 241 ? 0.7354 0.5842 0.4333 0.0674  -0.2976 0.0586  537 ILE A C     
2293 O O     . ILE C 241 ? 0.7796 0.6243 0.4676 0.0640  -0.3077 0.0580  537 ILE A O     
2294 C CB    . ILE C 241 ? 0.8163 0.7266 0.5795 0.0761  -0.2966 0.0556  537 ILE A CB    
2295 C CG1   . ILE C 241 ? 0.7217 0.6692 0.5226 0.0897  -0.3005 0.0551  537 ILE A CG1   
2296 C CG2   . ILE C 241 ? 0.7150 0.6342 0.4808 0.0634  -0.3040 0.0535  537 ILE A CG2   
2297 C CD1   . ILE C 241 ? 0.7538 0.7172 0.5668 0.0978  -0.3152 0.0554  537 ILE A CD1   
2298 N N     . LEU C 242 ? 0.7772 0.6064 0.4555 0.0608  -0.2833 0.0593  538 LEU A N     
2299 C CA    . LEU C 242 ? 0.7950 0.6015 0.4413 0.0493  -0.2782 0.0586  538 LEU A CA    
2300 C C     . LEU C 242 ? 0.8592 0.6403 0.4766 0.0503  -0.2816 0.0631  538 LEU A C     
2301 O O     . LEU C 242 ? 0.8677 0.6430 0.4712 0.0473  -0.2903 0.0623  538 LEU A O     
2302 C CB    . LEU C 242 ? 0.7335 0.5312 0.3699 0.0425  -0.2610 0.0579  538 LEU A CB    
2303 C CG    . LEU C 242 ? 0.7574 0.5755 0.4161 0.0383  -0.2574 0.0532  538 LEU A CG    
2304 C CD1   . LEU C 242 ? 0.8199 0.6252 0.4630 0.0312  -0.2405 0.0520  538 LEU A CD1   
2305 C CD2   . LEU C 242 ? 0.7082 0.5376 0.3737 0.0319  -0.2684 0.0486  538 LEU A CD2   
2306 N N     . PHE C 243 ? 0.9251 0.6905 0.5333 0.0540  -0.2754 0.0682  539 PHE A N     
2307 C CA    . PHE C 243 ? 0.9666 0.7057 0.5448 0.0517  -0.2761 0.0740  539 PHE A CA    
2308 C C     . PHE C 243 ? 1.1163 0.8516 0.6988 0.0618  -0.2915 0.0768  539 PHE A C     
2309 O O     . PHE C 243 ? 1.2965 1.0089 0.8586 0.0616  -0.2928 0.0828  539 PHE A O     
2310 C CB    . PHE C 243 ? 0.9429 0.6654 0.5080 0.0477  -0.2617 0.0789  539 PHE A CB    
2311 C CG    . PHE C 243 ? 0.9868 0.7137 0.5486 0.0390  -0.2459 0.0760  539 PHE A CG    
2312 C CD1   . PHE C 243 ? 0.9942 0.7160 0.5334 0.0295  -0.2398 0.0741  539 PHE A CD1   
2313 C CD2   . PHE C 243 ? 0.8876 0.6242 0.4686 0.0413  -0.2372 0.0744  539 PHE A CD2   
2314 C CE1   . PHE C 243 ? 0.8540 0.5800 0.3902 0.0227  -0.2255 0.0703  539 PHE A CE1   
2315 C CE2   . PHE C 243 ? 0.8342 0.5741 0.4119 0.0335  -0.2230 0.0715  539 PHE A CE2   
2316 C CZ    . PHE C 243 ? 0.9235 0.6582 0.4791 0.0243  -0.2172 0.0692  539 PHE A CZ    
2317 N N     . GLU C 244 ? 1.0392 0.7973 0.6481 0.0702  -0.3034 0.0728  540 GLU A N     
2318 C CA    . GLU C 244 ? 1.0674 0.8245 0.6816 0.0809  -0.3184 0.0744  540 GLU A CA    
2319 C C     . GLU C 244 ? 1.0407 0.8217 0.6729 0.0835  -0.3316 0.0703  540 GLU A C     
2320 O O     . GLU C 244 ? 1.0810 0.8529 0.6996 0.0833  -0.3429 0.0716  540 GLU A O     
2321 C CB    . GLU C 244 ? 1.0826 0.8457 0.7175 0.0939  -0.3187 0.0743  540 GLU A CB    
2322 C CG    . GLU C 244 ? 1.1194 0.9044 0.7799 0.1080  -0.3335 0.0713  540 GLU A CG    
2323 C CD    . GLU C 244 ? 1.1386 0.9221 0.8117 0.1225  -0.3351 0.0706  540 GLU A CD    
2324 O OE1   . GLU C 244 ? 1.0718 0.8346 0.7330 0.1207  -0.3257 0.0728  540 GLU A OE1   
2325 O OE2   . GLU C 244 ? 1.1256 0.9291 0.8205 0.1358  -0.3460 0.0674  540 GLU A OE2   
2326 N N     . LYS C 245 ? 1.0306 0.8433 0.6941 0.0850  -0.3305 0.0659  541 LYS A N     
2327 C CA    . LYS C 245 ? 1.0266 0.8661 0.7114 0.0856  -0.3430 0.0628  541 LYS A CA    
2328 C C     . LYS C 245 ? 1.0222 0.8536 0.6891 0.0721  -0.3442 0.0607  541 LYS A C     
2329 O O     . LYS C 245 ? 1.0916 0.9262 0.7569 0.0712  -0.3571 0.0598  541 LYS A O     
2330 C CB    . LYS C 245 ? 1.0323 0.9108 0.7574 0.0900  -0.3411 0.0600  541 LYS A CB    
2331 C CG    . LYS C 245 ? 1.0840 0.9968 0.8373 0.0911  -0.3543 0.0581  541 LYS A CG    
2332 C CD    . LYS C 245 ? 1.0799 1.0348 0.8741 0.0949  -0.3508 0.0567  541 LYS A CD    
2333 C CE    . LYS C 245 ? 1.0704 1.0644 0.8957 0.0952  -0.3637 0.0562  541 LYS A CE    
2334 N NZ    . LYS C 245 ? 1.0868 1.0740 0.9017 0.0799  -0.3704 0.0551  541 LYS A NZ    
2335 N N     . LEU C 246 ? 0.8955 0.7159 0.5484 0.0621  -0.3310 0.0594  542 LEU A N     
2336 C CA    . LEU C 246 ? 0.8766 0.6872 0.5103 0.0504  -0.3308 0.0559  542 LEU A CA    
2337 C C     . LEU C 246 ? 0.8643 0.6425 0.4568 0.0464  -0.3265 0.0583  542 LEU A C     
2338 O O     . LEU C 246 ? 0.9489 0.7182 0.5224 0.0392  -0.3282 0.0549  542 LEU A O     
2339 C CB    . LEU C 246 ? 0.8300 0.6486 0.4719 0.0423  -0.3194 0.0519  542 LEU A CB    
2340 C CG    . LEU C 246 ? 0.8627 0.7158 0.5450 0.0425  -0.3243 0.0498  542 LEU A CG    
2341 C CD1   . LEU C 246 ? 0.8170 0.6729 0.5032 0.0328  -0.3141 0.0461  542 LEU A CD1   
2342 C CD2   . LEU C 246 ? 0.7874 0.6567 0.4839 0.0411  -0.3413 0.0482  542 LEU A CD2   
2343 N N     . GLN C 247 ? 0.8744 0.6355 0.4528 0.0507  -0.3212 0.0642  543 GLN A N     
2344 C CA    . GLN C 247 ? 0.9740 0.7075 0.5150 0.0464  -0.3180 0.0685  543 GLN A CA    
2345 C C     . GLN C 247 ? 1.0014 0.7255 0.5198 0.0362  -0.3029 0.0665  543 GLN A C     
2346 O O     . GLN C 247 ? 0.9342 0.6439 0.4233 0.0313  -0.3020 0.0671  543 GLN A O     
2347 C CB    . GLN C 247 ? 0.9519 0.6798 0.4807 0.0476  -0.3337 0.0685  543 GLN A CB    
2348 C CG    . GLN C 247 ? 1.0462 0.7797 0.5915 0.0585  -0.3486 0.0713  543 GLN A CG    
2349 C CD    . GLN C 247 ? 1.0848 0.7979 0.6170 0.0631  -0.3464 0.0786  543 GLN A CD    
2350 O OE1   . GLN C 247 ? 1.0771 0.7666 0.5780 0.0585  -0.3454 0.0838  543 GLN A OE1   
2351 N NE2   . GLN C 247 ? 0.9680 0.6904 0.5241 0.0721  -0.3460 0.0790  543 GLN A NE2   
2352 N N     . LEU C 248 ? 0.8758 0.6092 0.4074 0.0337  -0.2907 0.0637  544 LEU A N     
2353 C CA    . LEU C 248 ? 0.8742 0.6004 0.3861 0.0252  -0.2756 0.0610  544 LEU A CA    
2354 C C     . LEU C 248 ? 0.9816 0.6906 0.4694 0.0225  -0.2634 0.0686  544 LEU A C     
2355 O O     . LEU C 248 ? 0.8956 0.5990 0.3893 0.0266  -0.2643 0.0752  544 LEU A O     
2356 C CB    . LEU C 248 ? 0.8383 0.5792 0.3721 0.0235  -0.2670 0.0559  544 LEU A CB    
2357 C CG    . LEU C 248 ? 0.8227 0.5833 0.3832 0.0238  -0.2785 0.0496  544 LEU A CG    
2358 C CD1   . LEU C 248 ? 0.7901 0.5629 0.3688 0.0204  -0.2691 0.0455  544 LEU A CD1   
2359 C CD2   . LEU C 248 ? 0.8470 0.6022 0.3918 0.0193  -0.2872 0.0441  544 LEU A CD2   
2360 N N     . PRO C 249 ? 1.0095 0.7111 0.4710 0.0155  -0.2524 0.0676  545 PRO A N     
2361 C CA    . PRO C 249 ? 0.9808 0.6701 0.4205 0.0111  -0.2407 0.0760  545 PRO A CA    
2362 C C     . PRO C 249 ? 1.0446 0.7362 0.4982 0.0101  -0.2280 0.0792  545 PRO A C     
2363 O O     . PRO C 249 ? 0.9209 0.6240 0.3932 0.0107  -0.2224 0.0731  545 PRO A O     
2364 C CB    . PRO C 249 ? 0.9334 0.6225 0.3466 0.0050  -0.2308 0.0720  545 PRO A CB    
2365 C CG    . PRO C 249 ? 0.9915 0.6858 0.4077 0.0074  -0.2425 0.0622  545 PRO A CG    
2366 C CD    . PRO C 249 ? 1.0364 0.7416 0.4868 0.0117  -0.2511 0.0586  545 PRO A CD    
2367 N N     . VAL C 250 ? 1.1019 0.7815 0.5456 0.0078  -0.2241 0.0890  546 VAL A N     
2368 C CA    . VAL C 250 ? 1.0158 0.6946 0.4702 0.0061  -0.2128 0.0931  546 VAL A CA    
2369 C C     . VAL C 250 ? 1.1286 0.8074 0.5623 -0.0038 -0.1953 0.0964  546 VAL A C     
2370 O O     . VAL C 250 ? 1.2032 0.8723 0.6172 -0.0092 -0.1933 0.1055  546 VAL A O     
2371 C CB    . VAL C 250 ? 1.0392 0.7044 0.4991 0.0102  -0.2217 0.1013  546 VAL A CB    
2372 C CG1   . VAL C 250 ? 0.9023 0.5674 0.3777 0.0100  -0.2123 0.1034  546 VAL A CG1   
2373 C CG2   . VAL C 250 ? 1.0062 0.6739 0.4828 0.0212  -0.2402 0.0978  546 VAL A CG2   
2374 N N     . LEU C 251 ? 1.2562 0.9475 0.6952 -0.0061 -0.1826 0.0892  547 LEU A N     
2375 C CA    . LEU C 251 ? 1.3492 1.0458 0.7714 -0.0139 -0.1649 0.0906  547 LEU A CA    
2376 C C     . LEU C 251 ? 1.4314 1.1280 0.8627 -0.0185 -0.1526 0.0971  547 LEU A C     
2377 O O     . LEU C 251 ? 1.4844 1.1851 0.9019 -0.0260 -0.1394 0.1022  547 LEU A O     
2378 C CB    . LEU C 251 ? 1.2681 0.9776 0.6901 -0.0132 -0.1578 0.0781  547 LEU A CB    
2379 C CG    . LEU C 251 ? 1.2564 0.9660 0.6685 -0.0096 -0.1694 0.0701  547 LEU A CG    
2380 C CD1   . LEU C 251 ? 1.2720 0.9917 0.6846 -0.0089 -0.1625 0.0571  547 LEU A CD1   
2381 C CD2   . LEU C 251 ? 1.1022 0.8061 0.4860 -0.0121 -0.1717 0.0760  547 LEU A CD2   
2382 N N     . LYS C 252 ? 1.4049 1.0987 0.8596 -0.0139 -0.1569 0.0969  548 LYS A N     
2383 C CA    . LYS C 252 ? 1.3811 1.0737 0.8464 -0.0175 -0.1467 0.1020  548 LYS A CA    
2384 C C     . LYS C 252 ? 1.3138 0.9964 0.7979 -0.0100 -0.1591 0.1044  548 LYS A C     
2385 O O     . LYS C 252 ? 1.2343 0.9198 0.7317 -0.0009 -0.1712 0.0987  548 LYS A O     
2386 C CB    . LYS C 252 ? 1.3550 1.0618 0.8311 -0.0188 -0.1322 0.0943  548 LYS A CB    
2387 C CG    . LYS C 252 ? 1.3434 1.0496 0.8416 -0.0168 -0.1286 0.0952  548 LYS A CG    
2388 C CD    . LYS C 252 ? 1.3274 1.0392 0.8238 -0.0254 -0.1108 0.0987  548 LYS A CD    
2389 C CE    . LYS C 252 ? 1.3615 1.0853 0.8392 -0.0312 -0.0991 0.0960  548 LYS A CE    
2390 N NZ    . LYS C 252 ? 1.3385 1.0762 0.8226 -0.0352 -0.0812 0.0923  548 LYS A NZ    
2391 N N     . LYS C 253 ? 1.3104 0.9828 0.7964 -0.0135 -0.1565 0.1125  549 LYS A N     
2392 C CA    . LYS C 253 ? 1.3530 1.0131 0.8535 -0.0056 -0.1689 0.1146  549 LYS A CA    
2393 C C     . LYS C 253 ? 1.4275 1.0873 0.9427 -0.0070 -0.1599 0.1156  549 LYS A C     
2394 O O     . LYS C 253 ? 1.4689 1.1236 0.9758 -0.0172 -0.1510 0.1229  549 LYS A O     
2395 C CB    . LYS C 253 ? 1.3629 1.0038 0.8475 -0.0078 -0.1801 0.1238  549 LYS A CB    
2396 C CG    . LYS C 253 ? 1.3907 1.0262 0.8551 -0.0220 -0.1703 0.1341  549 LYS A CG    
2397 C CD    . LYS C 253 ? 1.4149 1.0624 0.8593 -0.0282 -0.1622 0.1336  549 LYS A CD    
2398 C CE    . LYS C 253 ? 1.4565 1.1095 0.8870 -0.0415 -0.1471 0.1420  549 LYS A CE    
2399 N NZ    . LYS C 253 ? 1.4350 1.1095 0.8582 -0.0440 -0.1323 0.1357  549 LYS A NZ    
2400 N N     . THR C 254 ? 1.4894 1.1563 1.0271 0.0031  -0.1625 0.1085  550 THR A N     
2401 C CA    . THR C 254 ? 1.5020 1.1670 1.0547 0.0042  -0.1565 0.1087  550 THR A CA    
2402 C C     . THR C 254 ? 1.6134 1.2573 1.1627 0.0040  -0.1653 0.1158  550 THR A C     
2403 O O     . THR C 254 ? 1.6948 1.3261 1.2306 0.0036  -0.1762 0.1206  550 THR A O     
2407 N N     . LYS C 255 ? 1.5994 1.2382 1.1603 0.0045  -0.1617 0.1163  551 LYS A N     
2408 C CA    . LYS C 255 ? 1.5951 1.2119 1.1514 0.0026  -0.1703 0.1226  551 LYS A CA    
2409 C C     . LYS C 255 ? 1.5610 1.1660 1.1217 0.0169  -0.1892 0.1193  551 LYS A C     
2410 O O     . LYS C 255 ? 1.5435 1.1269 1.0943 0.0150  -0.1997 0.1248  551 LYS A O     
2411 C CB    . LYS C 255 ? 1.6089 1.2234 1.1780 0.0007  -0.1632 0.1222  551 LYS A CB    
2412 C CG    . LYS C 255 ? 1.6411 1.2344 1.2011 -0.0088 -0.1677 0.1309  551 LYS A CG    
2413 C CD    . LYS C 255 ? 1.5780 1.1699 1.1516 -0.0106 -0.1614 0.1296  551 LYS A CD    
2414 C CE    . LYS C 255 ? 1.5811 1.1525 1.1454 -0.0222 -0.1668 0.1388  551 LYS A CE    
2415 N NZ    . LYS C 255 ? 1.5260 1.0946 1.1043 -0.0228 -0.1634 0.1365  551 LYS A NZ    
2416 N N     . THR C 256 ? 1.5300 1.1497 1.1056 0.0311  -0.1942 0.1106  552 THR A N     
2417 C CA    . THR C 256 ? 1.5195 1.1336 1.1038 0.0470  -0.2111 0.1059  552 THR A CA    
2418 C C     . THR C 256 ? 1.4953 1.1240 1.0818 0.0542  -0.2184 0.1021  552 THR A C     
2419 O O     . THR C 256 ? 1.4841 1.1220 1.0870 0.0698  -0.2286 0.0953  552 THR A O     
2420 C CB    . THR C 256 ? 1.5169 1.1382 1.1245 0.0610  -0.2117 0.0977  552 THR A CB    
2421 O OG1   . THR C 256 ? 1.4909 1.1403 1.1164 0.0680  -0.2055 0.0908  552 THR A OG1   
2422 C CG2   . THR C 256 ? 1.5071 1.1177 1.1140 0.0524  -0.2023 0.1007  552 THR A CG2   
2423 N N     . GLY C 257 ? 1.4730 1.1058 1.0440 0.0434  -0.2136 0.1058  553 GLY A N     
2424 C CA    . GLY C 257 ? 1.4344 1.0790 1.0061 0.0490  -0.2220 0.1023  553 GLY A CA    
2425 C C     . GLY C 257 ? 1.3618 1.0193 0.9237 0.0383  -0.2113 0.1020  553 GLY A C     
2426 O O     . GLY C 257 ? 1.4167 1.0686 0.9623 0.0252  -0.1995 0.1072  553 GLY A O     
2427 N N     . TYR C 258 ? 1.2161 0.8923 0.7888 0.0443  -0.2160 0.0956  554 TYR A N     
2428 C CA    . TYR C 258 ? 1.1172 0.8045 0.6807 0.0357  -0.2085 0.0932  554 TYR A CA    
2429 C C     . TYR C 258 ? 1.0054 0.7066 0.5807 0.0328  -0.1946 0.0888  554 TYR A C     
2430 O O     . TYR C 258 ? 0.9963 0.7093 0.5949 0.0416  -0.1957 0.0846  554 TYR A O     
2431 C CB    . TYR C 258 ? 1.0120 0.7128 0.5827 0.0419  -0.2209 0.0880  554 TYR A CB    
2432 C CG    . TYR C 258 ? 0.9701 0.6611 0.5364 0.0486  -0.2371 0.0906  554 TYR A CG    
2433 C CD1   . TYR C 258 ? 0.9039 0.6058 0.4933 0.0628  -0.2494 0.0868  554 TYR A CD1   
2434 C CD2   . TYR C 258 ? 0.9687 0.6415 0.5079 0.0414  -0.2399 0.0968  554 TYR A CD2   
2435 C CE1   . TYR C 258 ? 0.9246 0.6179 0.5102 0.0698  -0.2645 0.0885  554 TYR A CE1   
2436 C CE2   . TYR C 258 ? 1.0640 0.7265 0.5983 0.0476  -0.2555 0.0993  554 TYR A CE2   
2437 C CZ    . TYR C 258 ? 1.0452 0.7172 0.6027 0.0620  -0.2679 0.0948  554 TYR A CZ    
2438 O OH    . TYR C 258 ? 1.1653 0.8271 0.7180 0.0690  -0.2836 0.0965  554 TYR A OH    
2439 N N     . SER C 259 ? 0.9906 0.6918 0.5501 0.0213  -0.1815 0.0893  555 SER A N     
2440 C CA    . SER C 259 ? 1.0153 0.7296 0.5839 0.0184  -0.1691 0.0839  555 SER A CA    
2441 C C     . SER C 259 ? 1.0000 0.7304 0.5774 0.0211  -0.1751 0.0759  555 SER A C     
2442 O O     . SER C 259 ? 0.9773 0.7068 0.5432 0.0196  -0.1828 0.0746  555 SER A O     
2443 C CB    . SER C 259 ? 1.0170 0.7276 0.5665 0.0062  -0.1527 0.0862  555 SER A CB    
2444 O OG    . SER C 259 ? 1.0508 0.7733 0.6087 0.0040  -0.1409 0.0800  555 SER A OG    
2445 N N     . THR C 260 ? 0.8465 0.5913 0.4446 0.0246  -0.1726 0.0709  556 THR A N     
2446 C CA    . THR C 260 ? 0.7728 0.5372 0.3873 0.0239  -0.1746 0.0626  556 THR A CA    
2447 C C     . THR C 260 ? 0.8296 0.6039 0.4533 0.0167  -0.1569 0.0563  556 THR A C     
2448 O O     . THR C 260 ? 0.8279 0.6214 0.4775 0.0168  -0.1552 0.0499  556 THR A O     
2449 C CB    . THR C 260 ? 0.8242 0.6095 0.4723 0.0336  -0.1846 0.0601  556 THR A CB    
2450 O OG1   . THR C 260 ? 0.8020 0.5938 0.4705 0.0395  -0.1765 0.0607  556 THR A OG1   
2451 C CG2   . THR C 260 ? 0.7765 0.5545 0.4156 0.0415  -0.2047 0.0643  556 THR A CG2   
2452 N N     . SER C 261 ? 0.8855 0.6477 0.4883 0.0103  -0.1441 0.0586  557 SER A N     
2453 C CA    . SER C 261 ? 0.9209 0.6917 0.5306 0.0047  -0.1276 0.0522  557 SER A CA    
2454 C C     . SER C 261 ? 0.9570 0.7332 0.5623 0.0016  -0.1305 0.0436  557 SER A C     
2455 O O     . SER C 261 ? 0.8854 0.6532 0.4691 0.0011  -0.1416 0.0436  557 SER A O     
2456 C CB    . SER C 261 ? 0.9892 0.7483 0.5755 -0.0015 -0.1145 0.0570  557 SER A CB    
2457 O OG    . SER C 261 ? 1.0586 0.8273 0.6513 -0.0055 -0.0990 0.0500  557 SER A OG    
2458 N N     . ALA C 262 ? 1.0015 0.7900 0.6263 -0.0004 -0.1218 0.0361  558 ALA A N     
2459 C CA    . ALA C 262 ? 1.0311 0.8203 0.6489 -0.0037 -0.1243 0.0271  558 ALA A CA    
2460 C C     . ALA C 262 ? 1.1212 0.8966 0.7010 -0.0061 -0.1204 0.0257  558 ALA A C     
2461 O O     . ALA C 262 ? 1.1388 0.9090 0.7021 -0.0066 -0.1286 0.0195  558 ALA A O     
2462 C CB    . ALA C 262 ? 0.9305 0.7307 0.5709 -0.0057 -0.1140 0.0201  558 ALA A CB    
2463 N N     . ASP C 263 ? 1.2250 0.9953 0.7903 -0.0077 -0.1084 0.0318  559 ASP A N     
2464 C CA    . ASP C 263 ? 1.2871 1.0476 0.8150 -0.0104 -0.1046 0.0334  559 ASP A CA    
2465 C C     . ASP C 263 ? 1.1267 0.8780 0.6367 -0.0092 -0.1203 0.0372  559 ASP A C     
2466 O O     . ASP C 263 ? 1.1267 0.8771 0.6209 -0.0090 -0.1234 0.0311  559 ASP A O     
2467 C CB    . ASP C 263 ? 1.4544 1.2129 0.9745 -0.0143 -0.0914 0.0429  559 ASP A CB    
2468 C CG    . ASP C 263 ? 1.6062 1.3717 1.1102 -0.0176 -0.0753 0.0392  559 ASP A CG    
2469 O OD1   . ASP C 263 ? 1.6244 1.3981 1.1388 -0.0173 -0.0641 0.0321  559 ASP A OD1   
2470 O OD2   . ASP C 263 ? 1.6806 1.4472 1.1663 -0.0198 -0.0733 0.0432  559 ASP A OD2   
2471 N N     . VAL C 264 ? 1.0453 0.7922 0.5636 -0.0071 -0.1298 0.0463  560 VAL A N     
2472 C CA    . VAL C 264 ? 1.0351 0.7759 0.5435 -0.0053 -0.1434 0.0501  560 VAL A CA    
2473 C C     . VAL C 264 ? 1.0106 0.7548 0.5256 -0.0026 -0.1585 0.0421  560 VAL A C     
2474 O O     . VAL C 264 ? 1.0132 0.7534 0.5128 -0.0026 -0.1661 0.0399  560 VAL A O     
2475 C CB    . VAL C 264 ? 0.9414 0.6764 0.4594 -0.0022 -0.1506 0.0604  560 VAL A CB    
2476 C CG1   . VAL C 264 ? 1.0108 0.7398 0.5215 0.0009  -0.1666 0.0632  560 VAL A CG1   
2477 C CG2   . VAL C 264 ? 0.9730 0.7021 0.4825 -0.0069 -0.1378 0.0690  560 VAL A CG2   
2478 N N     . LEU C 265 ? 0.8491 0.6018 0.3879 -0.0008 -0.1637 0.0382  561 LEU A N     
2479 C CA    . LEU C 265 ? 0.8965 0.6552 0.4470 0.0002  -0.1798 0.0324  561 LEU A CA    
2480 C C     . LEU C 265 ? 0.9337 0.6887 0.4693 -0.0031 -0.1792 0.0219  561 LEU A C     
2481 O O     . LEU C 265 ? 0.8841 0.6375 0.4162 -0.0031 -0.1926 0.0183  561 LEU A O     
2482 C CB    . LEU C 265 ? 0.8072 0.5857 0.4005 0.0013  -0.1793 0.0310  561 LEU A CB    
2483 C CG    . LEU C 265 ? 0.7855 0.5714 0.3987 0.0074  -0.1812 0.0391  561 LEU A CG    
2484 C CD1   . LEU C 265 ? 0.8370 0.6473 0.4915 0.0090  -0.1830 0.0370  561 LEU A CD1   
2485 C CD2   . LEU C 265 ? 0.8367 0.6127 0.4337 0.0121  -0.1979 0.0452  561 LEU A CD2   
2486 N N     . GLU C 266 ? 0.9620 0.7157 0.4894 -0.0051 -0.1643 0.0164  562 GLU A N     
2487 C CA    . GLU C 266 ? 1.0444 0.7938 0.5558 -0.0058 -0.1628 0.0052  562 GLU A CA    
2488 C C     . GLU C 266 ? 1.1283 0.8714 0.6156 -0.0044 -0.1673 0.0058  562 GLU A C     
2489 O O     . GLU C 266 ? 1.1735 0.9127 0.6552 -0.0037 -0.1790 -0.0014 562 GLU A O     
2490 C CB    . GLU C 266 ? 1.1657 0.9167 0.6695 -0.0060 -0.1434 0.0005  562 GLU A CB    
2491 C CG    . GLU C 266 ? 1.2604 1.0189 0.7916 -0.0071 -0.1386 -0.0060 562 GLU A CG    
2492 C CD    . GLU C 266 ? 1.3771 1.1290 0.9014 -0.0066 -0.1461 -0.0195 562 GLU A CD    
2493 O OE1   . GLU C 266 ? 1.4615 1.2056 0.9660 -0.0049 -0.1558 -0.0238 562 GLU A OE1   
2494 O OE2   . GLU C 266 ? 1.3272 1.0836 0.8717 -0.0075 -0.1412 -0.0255 562 GLU A OE2   
2495 N N     . LYS C 267 ? 1.1664 0.9081 0.6394 -0.0045 -0.1588 0.0148  563 LYS A N     
2496 C CA    . LYS C 267 ? 1.1073 0.8438 0.5563 -0.0038 -0.1629 0.0169  563 LYS A CA    
2497 C C     . LYS C 267 ? 1.0064 0.7385 0.4613 -0.0023 -0.1828 0.0200  563 LYS A C     
2498 O O     . LYS C 267 ? 0.9329 0.6597 0.3688 -0.0014 -0.1896 0.0193  563 LYS A O     
2499 C CB    . LYS C 267 ? 1.1559 0.8928 0.5909 -0.0061 -0.1500 0.0278  563 LYS A CB    
2500 C CG    . LYS C 267 ? 1.1931 0.9383 0.6226 -0.0080 -0.1297 0.0256  563 LYS A CG    
2501 C CD    . LYS C 267 ? 1.2094 0.9568 0.6310 -0.0124 -0.1185 0.0386  563 LYS A CD    
2502 C CE    . LYS C 267 ? 1.1818 0.9420 0.5992 -0.0147 -0.0982 0.0365  563 LYS A CE    
2503 N NZ    . LYS C 267 ? 1.0071 0.7709 0.4458 -0.0137 -0.0917 0.0302  563 LYS A NZ    
2504 N N     . LEU C 268 ? 0.9591 0.6956 0.4406 -0.0015 -0.1923 0.0231  564 LEU A N     
2505 C CA    . LEU C 268 ? 0.9438 0.6805 0.4349 0.0007  -0.2109 0.0263  564 LEU A CA    
2506 C C     . LEU C 268 ? 0.9702 0.7112 0.4742 -0.0003 -0.2253 0.0176  564 LEU A C     
2507 O O     . LEU C 268 ? 0.8203 0.5623 0.3292 0.0010  -0.2410 0.0190  564 LEU A O     
2508 C CB    . LEU C 268 ? 0.9054 0.6487 0.4204 0.0037  -0.2142 0.0348  564 LEU A CB    
2509 C CG    . LEU C 268 ? 0.9767 0.7121 0.4814 0.0056  -0.2095 0.0454  564 LEU A CG    
2510 C CD1   . LEU C 268 ? 0.8443 0.5862 0.3747 0.0114  -0.2182 0.0512  564 LEU A CD1   
2511 C CD2   . LEU C 268 ? 0.8328 0.5576 0.3118 0.0053  -0.2152 0.0482  564 LEU A CD2   
2512 N N     . ALA C 269 ? 0.9200 0.6632 0.4305 -0.0030 -0.2211 0.0091  565 ALA A N     
2513 C CA    . ALA C 269 ? 0.8951 0.6421 0.4221 -0.0060 -0.2353 0.0019  565 ALA A CA    
2514 C C     . ALA C 269 ? 0.9742 0.7129 0.4858 -0.0057 -0.2487 -0.0026 565 ALA A C     
2515 O O     . ALA C 269 ? 0.9086 0.6527 0.4380 -0.0081 -0.2653 -0.0034 565 ALA A O     
2516 C CB    . ALA C 269 ? 0.9756 0.7211 0.5056 -0.0088 -0.2275 -0.0072 565 ALA A CB    
2517 N N     . PRO C 270 ? 1.0134 0.7410 0.4931 -0.0031 -0.2420 -0.0054 566 PRO A N     
2518 C CA    . PRO C 270 ? 1.0079 0.7270 0.4713 -0.0021 -0.2552 -0.0102 566 PRO A CA    
2519 C C     . PRO C 270 ? 0.8946 0.6166 0.3668 -0.0016 -0.2710 -0.0028 566 PRO A C     
2520 O O     . PRO C 270 ? 0.9157 0.6334 0.3851 -0.0022 -0.2860 -0.0070 566 PRO A O     
2521 C CB    . PRO C 270 ? 1.0857 0.7973 0.5138 0.0012  -0.2419 -0.0118 566 PRO A CB    
2522 C CG    . PRO C 270 ? 1.0300 0.7464 0.4591 0.0010  -0.2224 -0.0124 566 PRO A CG    
2523 C CD    . PRO C 270 ? 1.0601 0.7848 0.5182 -0.0013 -0.2221 -0.0046 566 PRO A CD    
2524 N N     . TYR C 271 ? 0.8997 0.6286 0.3833 0.0001  -0.2688 0.0077  567 TYR A N     
2525 C CA    . TYR C 271 ? 0.9238 0.6547 0.4125 0.0027  -0.2829 0.0144  567 TYR A CA    
2526 C C     . TYR C 271 ? 0.8726 0.6202 0.3978 0.0017  -0.2976 0.0156  567 TYR A C     
2527 O O     . TYR C 271 ? 0.8868 0.6378 0.4176 0.0035  -0.3124 0.0181  567 TYR A O     
2528 C CB    . TYR C 271 ? 0.9278 0.6561 0.4090 0.0063  -0.2748 0.0250  567 TYR A CB    
2529 C CG    . TYR C 271 ? 0.9487 0.6646 0.3952 0.0058  -0.2614 0.0263  567 TYR A CG    
2530 C CD1   . TYR C 271 ? 0.9949 0.7113 0.4359 0.0041  -0.2426 0.0271  567 TYR A CD1   
2531 C CD2   . TYR C 271 ? 0.9949 0.7008 0.4149 0.0067  -0.2672 0.0269  567 TYR A CD2   
2532 C CE1   . TYR C 271 ? 1.0102 0.7205 0.4220 0.0029  -0.2297 0.0291  567 TYR A CE1   
2533 C CE2   . TYR C 271 ? 1.0165 0.7155 0.4056 0.0057  -0.2545 0.0290  567 TYR A CE2   
2534 C CZ    . TYR C 271 ? 1.0155 0.7182 0.4017 0.0036  -0.2355 0.0303  567 TYR A CZ    
2535 O OH    . TYR C 271 ? 1.0566 0.7577 0.4149 0.0020  -0.2222 0.0331  567 TYR A OH    
2536 N N     . HIS C 272 ? 0.9184 0.6787 0.4693 -0.0013 -0.2939 0.0143  568 HIS A N     
2537 C CA    . HIS C 272 ? 0.9459 0.7277 0.5340 -0.0029 -0.3068 0.0167  568 HIS A CA    
2538 C C     . HIS C 272 ? 0.8844 0.6761 0.4939 -0.0093 -0.3029 0.0129  568 HIS A C     
2539 O O     . HIS C 272 ? 0.7812 0.5683 0.3847 -0.0093 -0.2879 0.0120  568 HIS A O     
2540 C CB    . HIS C 272 ? 0.8611 0.6565 0.4664 0.0042  -0.3071 0.0258  568 HIS A CB    
2541 C CG    . HIS C 272 ? 0.8008 0.6202 0.4389 0.0052  -0.3230 0.0286  568 HIS A CG    
2542 N ND1   . HIS C 272 ? 0.9001 0.7451 0.5744 0.0013  -0.3258 0.0291  568 HIS A ND1   
2543 C CD2   . HIS C 272 ? 0.8404 0.6646 0.4817 0.0095  -0.3367 0.0313  568 HIS A CD2   
2544 C CE1   . HIS C 272 ? 0.7726 0.6398 0.4719 0.0031  -0.3398 0.0321  568 HIS A CE1   
2545 N NE2   . HIS C 272 ? 0.8922 0.7466 0.5719 0.0086  -0.3469 0.0330  568 HIS A NE2   
2546 N N     . GLU C 273 ? 0.7921 0.5977 0.4270 -0.0155 -0.3167 0.0115  569 GLU A N     
2547 C CA    . GLU C 273 ? 0.8212 0.6366 0.4785 -0.0235 -0.3151 0.0090  569 GLU A CA    
2548 C C     . GLU C 273 ? 0.8237 0.6605 0.5073 -0.0218 -0.3067 0.0157  569 GLU A C     
2549 O O     . GLU C 273 ? 0.7839 0.6260 0.4810 -0.0277 -0.3012 0.0143  569 GLU A O     
2550 C CB    . GLU C 273 ? 1.0019 0.8292 0.6826 -0.0322 -0.3327 0.0082  569 GLU A CB    
2551 C CG    . GLU C 273 ? 1.0925 0.9242 0.7925 -0.0428 -0.3330 0.0055  569 GLU A CG    
2552 C CD    . GLU C 273 ? 1.2124 1.0583 0.9388 -0.0530 -0.3505 0.0073  569 GLU A CD    
2553 O OE1   . GLU C 273 ? 1.2461 1.1112 0.9884 -0.0513 -0.3605 0.0128  569 GLU A OE1   
2554 O OE2   . GLU C 273 ? 1.2538 1.0916 0.9853 -0.0625 -0.3544 0.0033  569 GLU A OE2   
2555 N N     . ILE C 274 ? 0.7271 0.5755 0.4179 -0.0132 -0.3060 0.0227  570 ILE A N     
2556 C CA    . ILE C 274 ? 0.6953 0.5644 0.4108 -0.0094 -0.2985 0.0284  570 ILE A CA    
2557 C C     . ILE C 274 ? 0.7438 0.5967 0.4413 -0.0086 -0.2809 0.0267  570 ILE A C     
2558 O O     . ILE C 274 ? 0.6551 0.5245 0.3780 -0.0098 -0.2686 0.0281  570 ILE A O     
2559 C CB    . ILE C 274 ? 0.8005 0.6816 0.5245 0.0022  -0.3020 0.0348  570 ILE A CB    
2560 C CG1   . ILE C 274 ? 0.6629 0.5736 0.4213 0.0070  -0.2985 0.0398  570 ILE A CG1   
2561 C CG2   . ILE C 274 ? 0.8084 0.6625 0.4979 0.0095  -0.2926 0.0358  570 ILE A CG2   
2562 C CD1   . ILE C 274 ? 0.8030 0.7222 0.5675 0.0213  -0.3000 0.0444  570 ILE A CD1   
2563 N N     . VAL C 275 ? 0.7653 0.5912 0.4261 -0.0066 -0.2727 0.0234  571 VAL A N     
2564 C CA    . VAL C 275 ? 0.6977 0.5110 0.3417 -0.0051 -0.2546 0.0228  571 VAL A CA    
2565 C C     . VAL C 275 ? 0.7309 0.5494 0.3904 -0.0122 -0.2443 0.0170  571 VAL A C     
2566 O O     . VAL C 275 ? 0.6772 0.5058 0.3549 -0.0114 -0.2284 0.0187  571 VAL A O     
2567 C CB    . VAL C 275 ? 0.7260 0.5151 0.3309 -0.0032 -0.2469 0.0206  571 VAL A CB    
2568 C CG1   . VAL C 275 ? 0.9371 0.7171 0.5274 -0.0023 -0.2275 0.0213  571 VAL A CG1   
2569 C CG2   . VAL C 275 ? 0.7454 0.5313 0.3419 0.0027  -0.2542 0.0267  571 VAL A CG2   
2570 N N     . GLU C 276 ? 0.6933 0.5029 0.3449 -0.0189 -0.2545 0.0098  572 GLU A N     
2571 C CA    . GLU C 276 ? 0.8185 0.6291 0.4826 -0.0255 -0.2472 0.0041  572 GLU A CA    
2572 C C     . GLU C 276 ? 0.6442 0.4834 0.3529 -0.0293 -0.2442 0.0100  572 GLU A C     
2573 O O     . GLU C 276 ? 0.6986 0.5421 0.4202 -0.0314 -0.2300 0.0089  572 GLU A O     
2574 C CB    . GLU C 276 ? 0.8406 0.6355 0.4902 -0.0318 -0.2637 -0.0044 572 GLU A CB    
2575 C CG    . GLU C 276 ? 0.9441 0.7517 0.6140 -0.0365 -0.2830 -0.0011 572 GLU A CG    
2576 C CD    . GLU C 276 ? 1.0395 0.8315 0.7009 -0.0422 -0.2941 -0.0095 572 GLU A CD    
2577 O OE1   . GLU C 276 ? 1.0749 0.8535 0.7298 -0.0452 -0.2896 -0.0169 572 GLU A OE1   
2578 O OE2   . GLU C 276 ? 0.9808 0.7730 0.6419 -0.0430 -0.3078 -0.0089 572 GLU A OE2   
2579 N N     . ASN C 277 ? 0.6395 0.5002 0.3720 -0.0297 -0.2573 0.0164  573 ASN A N     
2580 C CA    . ASN C 277 ? 0.6821 0.5751 0.4570 -0.0329 -0.2543 0.0226  573 ASN A CA    
2581 C C     . ASN C 277 ? 0.6905 0.5947 0.4756 -0.0236 -0.2360 0.0268  573 ASN A C     
2582 O O     . ASN C 277 ? 0.7033 0.6237 0.5121 -0.0259 -0.2244 0.0286  573 ASN A O     
2583 C CB    . ASN C 277 ? 0.6489 0.5660 0.4469 -0.0351 -0.2733 0.0281  573 ASN A CB    
2584 C CG    . ASN C 277 ? 0.7553 0.6650 0.5512 -0.0471 -0.2925 0.0250  573 ASN A CG    
2585 O OD1   . ASN C 277 ? 0.7822 0.7009 0.5983 -0.0584 -0.2946 0.0257  573 ASN A OD1   
2586 N ND2   . ASN C 277 ? 0.6762 0.5679 0.4467 -0.0450 -0.3068 0.0217  573 ASN A ND2   
2587 N N     . ILE C 278 ? 0.7036 0.5980 0.4699 -0.0134 -0.2343 0.0287  574 ILE A N     
2588 C CA    . ILE C 278 ? 0.6417 0.5410 0.4137 -0.0046 -0.2185 0.0320  574 ILE A CA    
2589 C C     . ILE C 278 ? 0.6016 0.4877 0.3646 -0.0077 -0.2000 0.0281  574 ILE A C     
2590 O O     . ILE C 278 ? 0.5874 0.4863 0.3696 -0.0055 -0.1869 0.0299  574 ILE A O     
2591 C CB    . ILE C 278 ? 0.6674 0.5517 0.4158 0.0054  -0.2223 0.0351  574 ILE A CB    
2592 C CG1   . ILE C 278 ? 0.7276 0.6311 0.4930 0.0115  -0.2394 0.0393  574 ILE A CG1   
2593 C CG2   . ILE C 278 ? 0.5818 0.4605 0.3272 0.0123  -0.2059 0.0375  574 ILE A CG2   
2594 C CD1   . ILE C 278 ? 0.7799 0.6655 0.5204 0.0212  -0.2471 0.0425  574 ILE A CD1   
2595 N N     . LEU C 279 ? 0.6827 0.5443 0.4161 -0.0119 -0.1988 0.0222  575 LEU A N     
2596 C CA    . LEU C 279 ? 0.7669 0.6181 0.4928 -0.0144 -0.1823 0.0175  575 LEU A CA    
2597 C C     . LEU C 279 ? 0.7164 0.5830 0.4715 -0.0214 -0.1799 0.0160  575 LEU A C     
2598 O O     . LEU C 279 ? 0.6983 0.5713 0.4664 -0.0207 -0.1652 0.0166  575 LEU A O     
2599 C CB    . LEU C 279 ? 0.7082 0.5340 0.3975 -0.0162 -0.1834 0.0102  575 LEU A CB    
2600 C CG    . LEU C 279 ? 0.7886 0.5986 0.4452 -0.0107 -0.1829 0.0127  575 LEU A CG    
2601 C CD1   . LEU C 279 ? 0.8525 0.6426 0.4742 -0.0122 -0.1904 0.0056  575 LEU A CD1   
2602 C CD2   . LEU C 279 ? 0.7773 0.5836 0.4272 -0.0076 -0.1636 0.0155  575 LEU A CD2   
2603 N N     . HIS C 280 ? 0.7567 0.6283 0.5216 -0.0289 -0.1953 0.0148  576 HIS A N     
2604 C CA    . HIS C 280 ? 0.6866 0.5731 0.4798 -0.0376 -0.1957 0.0157  576 HIS A CA    
2605 C C     . HIS C 280 ? 0.6113 0.5288 0.4383 -0.0350 -0.1880 0.0237  576 HIS A C     
2606 O O     . HIS C 280 ? 0.5652 0.4916 0.4089 -0.0381 -0.1771 0.0246  576 HIS A O     
2607 C CB    . HIS C 280 ? 0.7290 0.6166 0.5278 -0.0472 -0.2167 0.0152  576 HIS A CB    
2608 C CG    . HIS C 280 ? 0.7752 0.6728 0.5983 -0.0590 -0.2199 0.0167  576 HIS A CG    
2609 N ND1   . HIS C 280 ? 0.8162 0.7066 0.6411 -0.0609 -0.2068 0.0137  576 HIS A ND1   
2610 C CD2   . HIS C 280 ? 0.7586 0.6720 0.6047 -0.0704 -0.2357 0.0217  576 HIS A CD2   
2611 C CE1   . HIS C 280 ? 0.7961 0.6958 0.6429 -0.0729 -0.2147 0.0170  576 HIS A CE1   
2612 N NE2   . HIS C 280 ? 0.8378 0.7522 0.6982 -0.0797 -0.2321 0.0224  576 HIS A NE2   
2613 N N     . TYR C 281 ? 0.5802 0.5142 0.4162 -0.0283 -0.1939 0.0290  577 TYR A N     
2614 C CA    . TYR C 281 ? 0.4850 0.4503 0.3516 -0.0231 -0.1874 0.0353  577 TYR A CA    
2615 C C     . TYR C 281 ? 0.5979 0.5573 0.4605 -0.0155 -0.1683 0.0344  577 TYR A C     
2616 O O     . TYR C 281 ? 0.5959 0.5773 0.4828 -0.0141 -0.1594 0.0375  577 TYR A O     
2617 C CB    . TYR C 281 ? 0.5424 0.5232 0.4153 -0.0144 -0.1988 0.0393  577 TYR A CB    
2618 C CG    . TYR C 281 ? 0.5099 0.5224 0.4105 -0.0047 -0.1926 0.0441  577 TYR A CG    
2619 C CD1   . TYR C 281 ? 0.5943 0.6458 0.5296 -0.0080 -0.1984 0.0492  577 TYR A CD1   
2620 C CD2   . TYR C 281 ? 0.5725 0.5766 0.4639 0.0080  -0.1818 0.0435  577 TYR A CD2   
2621 C CE1   . TYR C 281 ? 0.6269 0.7103 0.5865 0.0028  -0.1924 0.0524  577 TYR A CE1   
2622 C CE2   . TYR C 281 ? 0.6110 0.6424 0.5256 0.0189  -0.1773 0.0463  577 TYR A CE2   
2623 C CZ    . TYR C 281 ? 0.6461 0.7180 0.5943 0.0172  -0.1822 0.0502  577 TYR A CZ    
2624 O OH    . TYR C 281 ? 0.7046 0.8068 0.6751 0.0298  -0.1773 0.0519  577 TYR A OH    
2625 N N     . ARG C 282 ? 0.6291 0.5602 0.4611 -0.0111 -0.1621 0.0307  578 ARG A N     
2626 C CA    . ARG C 282 ? 0.6090 0.5342 0.4370 -0.0045 -0.1457 0.0308  578 ARG A CA    
2627 C C     . ARG C 282 ? 0.5907 0.5121 0.4229 -0.0107 -0.1328 0.0273  578 ARG A C     
2628 O O     . ARG C 282 ? 0.6234 0.5543 0.4694 -0.0073 -0.1210 0.0288  578 ARG A O     
2629 C CB    . ARG C 282 ? 0.6153 0.5142 0.4103 0.0006  -0.1440 0.0300  578 ARG A CB    
2630 C CG    . ARG C 282 ? 0.6906 0.5932 0.4867 0.0115  -0.1476 0.0350  578 ARG A CG    
2631 C CD    . ARG C 282 ? 0.7355 0.6106 0.4983 0.0142  -0.1460 0.0362  578 ARG A CD    
2632 N NE    . ARG C 282 ? 0.6476 0.5215 0.4078 0.0241  -0.1554 0.0410  578 ARG A NE    
2633 C CZ    . ARG C 282 ? 0.6609 0.5112 0.3924 0.0265  -0.1585 0.0444  578 ARG A CZ    
2634 N NH1   . ARG C 282 ? 0.7266 0.5568 0.4306 0.0195  -0.1515 0.0435  578 ARG A NH1   
2635 N NH2   . ARG C 282 ? 0.7237 0.5713 0.4536 0.0362  -0.1691 0.0487  578 ARG A NH2   
2636 N N     . GLN C 283 ? 0.6991 0.6054 0.5185 -0.0188 -0.1359 0.0220  579 GLN A N     
2637 C CA    . GLN C 283 ? 0.8252 0.7282 0.6503 -0.0241 -0.1260 0.0184  579 GLN A CA    
2638 C C     . GLN C 283 ? 0.6955 0.6241 0.5539 -0.0294 -0.1271 0.0232  579 GLN A C     
2639 O O     . GLN C 283 ? 0.7181 0.6547 0.5896 -0.0285 -0.1150 0.0243  579 GLN A O     
2640 C CB    . GLN C 283 ? 1.0486 0.9294 0.8525 -0.0299 -0.1318 0.0106  579 GLN A CB    
2641 C CG    . GLN C 283 ? 1.2316 1.1139 1.0391 -0.0373 -0.1510 0.0106  579 GLN A CG    
2642 C CD    . GLN C 283 ? 1.3777 1.2395 1.1717 -0.0437 -0.1571 0.0023  579 GLN A CD    
2643 O OE1   . GLN C 283 ? 1.3803 1.2377 1.1793 -0.0459 -0.1491 -0.0008 579 GLN A OE1   
2644 N NE2   . GLN C 283 ? 1.4386 1.2864 1.2145 -0.0458 -0.1725 -0.0019 579 GLN A NE2   
2645 N N     . LEU C 284 ? 0.6661 0.6092 0.5387 -0.0356 -0.1419 0.0267  580 LEU A N     
2646 C CA    . LEU C 284 ? 0.6599 0.6331 0.5655 -0.0416 -0.1433 0.0335  580 LEU A CA    
2647 C C     . LEU C 284 ? 0.6055 0.6023 0.5282 -0.0316 -0.1320 0.0380  580 LEU A C     
2648 O O     . LEU C 284 ? 0.6428 0.6546 0.5832 -0.0333 -0.1226 0.0406  580 LEU A O     
2649 C CB    . LEU C 284 ? 0.6679 0.6572 0.5866 -0.0489 -0.1616 0.0379  580 LEU A CB    
2650 C CG    . LEU C 284 ? 0.7038 0.6722 0.6095 -0.0602 -0.1769 0.0340  580 LEU A CG    
2651 C CD1   . LEU C 284 ? 0.5906 0.5811 0.5155 -0.0685 -0.1951 0.0404  580 LEU A CD1   
2652 C CD2   . LEU C 284 ? 0.7979 0.7534 0.7045 -0.0696 -0.1734 0.0316  580 LEU A CD2   
2653 N N     . GLY C 285 ? 0.4812 0.4799 0.3974 -0.0204 -0.1339 0.0385  581 GLY A N     
2654 C CA    . GLY C 285 ? 0.4662 0.4838 0.3958 -0.0086 -0.1253 0.0413  581 GLY A CA    
2655 C C     . GLY C 285 ? 0.5487 0.5518 0.4699 -0.0044 -0.1091 0.0384  581 GLY A C     
2656 O O     . GLY C 285 ? 0.5005 0.5220 0.4384 0.0011  -0.1004 0.0404  581 GLY A O     
2657 N N     . LYS C 286 ? 0.5208 0.4927 0.4160 -0.0066 -0.1048 0.0335  582 LYS A N     
2658 C CA    . LYS C 286 ? 0.5514 0.5105 0.4394 -0.0040 -0.0899 0.0309  582 LYS A CA    
2659 C C     . LYS C 286 ? 0.4926 0.4629 0.3986 -0.0108 -0.0830 0.0311  582 LYS A C     
2660 O O     . LYS C 286 ? 0.4536 0.4316 0.3693 -0.0064 -0.0724 0.0319  582 LYS A O     
2661 C CB    . LYS C 286 ? 0.6236 0.5521 0.4815 -0.0058 -0.0872 0.0260  582 LYS A CB    
2662 C CG    . LYS C 286 ? 0.6768 0.5929 0.5265 -0.0036 -0.0724 0.0237  582 LYS A CG    
2663 C CD    . LYS C 286 ? 0.6861 0.5999 0.5320 0.0059  -0.0686 0.0269  582 LYS A CD    
2664 C CE    . LYS C 286 ? 0.6093 0.5074 0.4429 0.0060  -0.0558 0.0251  582 LYS A CE    
2665 N NZ    . LYS C 286 ? 0.6891 0.5801 0.5163 0.0138  -0.0546 0.0288  582 LYS A NZ    
2666 N N     . LEU C 287 ? 0.5243 0.4938 0.4338 -0.0219 -0.0902 0.0305  583 LEU A N     
2667 C CA    . LEU C 287 ? 0.5013 0.4799 0.4272 -0.0298 -0.0860 0.0320  583 LEU A CA    
2668 C C     . LEU C 287 ? 0.5396 0.5534 0.4939 -0.0284 -0.0843 0.0394  583 LEU A C     
2669 O O     . LEU C 287 ? 0.5700 0.5928 0.5346 -0.0265 -0.0737 0.0407  583 LEU A O     
2670 C CB    . LEU C 287 ? 0.5526 0.5214 0.4761 -0.0423 -0.0978 0.0307  583 LEU A CB    
2671 C CG    . LEU C 287 ? 0.6058 0.5411 0.5015 -0.0432 -0.0991 0.0217  583 LEU A CG    
2672 C CD1   . LEU C 287 ? 0.6789 0.6047 0.5718 -0.0540 -0.1152 0.0201  583 LEU A CD1   
2673 C CD2   . LEU C 287 ? 0.5349 0.4582 0.4259 -0.0415 -0.0858 0.0173  583 LEU A CD2   
2674 N N     . GLN C 288 ? 0.4415 0.4773 0.4086 -0.0286 -0.0949 0.0441  584 GLN A N     
2675 C CA    . GLN C 288 ? 0.5377 0.6129 0.5334 -0.0281 -0.0940 0.0514  584 GLN A CA    
2676 C C     . GLN C 288 ? 0.5354 0.6218 0.5352 -0.0132 -0.0820 0.0506  584 GLN A C     
2677 O O     . GLN C 288 ? 0.5407 0.6490 0.5572 -0.0129 -0.0740 0.0540  584 GLN A O     
2678 C CB    . GLN C 288 ? 0.5702 0.6680 0.5779 -0.0292 -0.1080 0.0558  584 GLN A CB    
2679 C CG    . GLN C 288 ? 0.5639 0.7088 0.6020 -0.0264 -0.1069 0.0631  584 GLN A CG    
2680 C CD    . GLN C 288 ? 0.6322 0.7983 0.6908 -0.0425 -0.1069 0.0709  584 GLN A CD    
2681 O OE1   . GLN C 288 ? 0.6696 0.8229 0.7246 -0.0477 -0.0983 0.0705  584 GLN A OE1   
2682 N NE2   . GLN C 288 ? 0.5293 0.7280 0.6098 -0.0511 -0.1174 0.0788  584 GLN A NE2   
2683 N N     . SER C 289 ? 0.5575 0.6277 0.5406 -0.0009 -0.0815 0.0462  585 SER A N     
2684 C CA    . SER C 289 ? 0.5690 0.6474 0.5549 0.0145  -0.0739 0.0451  585 SER A CA    
2685 C C     . SER C 289 ? 0.6079 0.6643 0.5818 0.0166  -0.0612 0.0412  585 SER A C     
2686 O O     . SER C 289 ? 0.5570 0.6258 0.5396 0.0253  -0.0534 0.0411  585 SER A O     
2687 C CB    . SER C 289 ? 0.6533 0.7225 0.6267 0.0265  -0.0818 0.0431  585 SER A CB    
2688 O OG    . SER C 289 ? 0.6729 0.7645 0.6587 0.0257  -0.0942 0.0464  585 SER A OG    
2689 N N     . THR C 290 ? 0.5222 0.5475 0.4764 0.0095  -0.0593 0.0377  586 THR A N     
2690 C CA    . THR C 290 ? 0.5954 0.6010 0.5387 0.0114  -0.0478 0.0341  586 THR A CA    
2691 C C     . THR C 290 ? 0.6248 0.6330 0.5770 0.0022  -0.0410 0.0342  586 THR A C     
2692 O O     . THR C 290 ? 0.6616 0.6706 0.6175 0.0060  -0.0314 0.0333  586 THR A O     
2693 C CB    . THR C 290 ? 0.6138 0.5873 0.5306 0.0100  -0.0481 0.0304  586 THR A CB    
2694 O OG1   . THR C 290 ? 0.6565 0.6226 0.5626 0.0201  -0.0517 0.0310  586 THR A OG1   
2695 C CG2   . THR C 290 ? 0.5129 0.4693 0.4213 0.0074  -0.0367 0.0269  586 THR A CG2   
2696 N N     . TYR C 291 ? 0.5561 0.5639 0.5111 -0.0097 -0.0472 0.0351  587 TYR A N     
2697 C CA    . TYR C 291 ? 0.5897 0.5912 0.5477 -0.0187 -0.0428 0.0344  587 TYR A CA    
2698 C C     . TYR C 291 ? 0.5574 0.5850 0.5382 -0.0270 -0.0457 0.0413  587 TYR A C     
2699 O O     . TYR C 291 ? 0.6329 0.6608 0.6195 -0.0313 -0.0398 0.0423  587 TYR A O     
2700 C CB    . TYR C 291 ? 0.5923 0.5669 0.5323 -0.0260 -0.0480 0.0291  587 TYR A CB    
2701 C CG    . TYR C 291 ? 0.5521 0.5032 0.4690 -0.0194 -0.0427 0.0229  587 TYR A CG    
2702 C CD1   . TYR C 291 ? 0.6403 0.5815 0.5413 -0.0173 -0.0496 0.0215  587 TYR A CD1   
2703 C CD2   . TYR C 291 ? 0.5553 0.4956 0.4665 -0.0158 -0.0311 0.0195  587 TYR A CD2   
2704 C CE1   . TYR C 291 ? 0.6881 0.6099 0.5674 -0.0128 -0.0445 0.0176  587 TYR A CE1   
2705 C CE2   . TYR C 291 ? 0.6601 0.5823 0.5515 -0.0115 -0.0261 0.0155  587 TYR A CE2   
2706 C CZ    . TYR C 291 ? 0.7980 0.7114 0.6731 -0.0104 -0.0325 0.0150  587 TYR A CZ    
2707 O OH    . TYR C 291 ? 0.8985 0.7959 0.7533 -0.0075 -0.0274 0.0126  587 TYR A OH    
2708 N N     . ILE C 292 ? 0.5181 0.5688 0.5122 -0.0300 -0.0549 0.0469  588 ILE A N     
2709 C CA    . ILE C 292 ? 0.4537 0.5355 0.4715 -0.0386 -0.0570 0.0555  588 ILE A CA    
2710 C C     . ILE C 292 ? 0.4409 0.5531 0.4730 -0.0270 -0.0480 0.0584  588 ILE A C     
2711 O O     . ILE C 292 ? 0.3905 0.5109 0.4293 -0.0269 -0.0389 0.0603  588 ILE A O     
2712 C CB    . ILE C 292 ? 0.4267 0.5232 0.4544 -0.0485 -0.0716 0.0609  588 ILE A CB    
2713 C CG1   . ILE C 292 ? 0.5662 0.6301 0.5779 -0.0595 -0.0818 0.0570  588 ILE A CG1   
2714 C CG2   . ILE C 292 ? 0.4437 0.5786 0.4982 -0.0579 -0.0729 0.0718  588 ILE A CG2   
2715 C CD1   . ILE C 292 ? 0.5745 0.6171 0.5801 -0.0668 -0.0779 0.0549  588 ILE A CD1   
2716 N N     . GLU C 293 ? 0.4187 0.5470 0.4544 -0.0160 -0.0511 0.0581  589 GLU A N     
2717 C CA    . GLU C 293 ? 0.3801 0.5371 0.4279 -0.0019 -0.0441 0.0591  589 GLU A CA    
2718 C C     . GLU C 293 ? 0.3999 0.5361 0.4343 0.0089  -0.0330 0.0528  589 GLU A C     
2719 O O     . GLU C 293 ? 0.4714 0.6263 0.5149 0.0154  -0.0248 0.0538  589 GLU A O     
2720 C CB    . GLU C 293 ? 0.3809 0.5531 0.4318 0.0099  -0.0516 0.0582  589 GLU A CB    
2721 C CG    . GLU C 293 ? 0.6060 0.8087 0.6757 0.0005  -0.0624 0.0654  589 GLU A CG    
2722 C CD    . GLU C 293 ? 0.8137 1.0390 0.8907 0.0148  -0.0692 0.0645  589 GLU A CD    
2723 O OE1   . GLU C 293 ? 0.8693 1.0842 0.9401 0.0123  -0.0808 0.0639  589 GLU A OE1   
2724 O OE2   . GLU C 293 ? 0.8966 1.1497 0.9847 0.0295  -0.0635 0.0639  589 GLU A OE2   
2725 N N     . GLY C 294 ? 0.2995 0.3982 0.3119 0.0105  -0.0330 0.0466  590 GLY A N     
2726 C CA    . GLY C 294 ? 0.3745 0.4533 0.3748 0.0191  -0.0237 0.0414  590 GLY A CA    
2727 C C     . GLY C 294 ? 0.4643 0.5413 0.4686 0.0124  -0.0150 0.0421  590 GLY A C     
2728 O O     . GLY C 294 ? 0.4550 0.5368 0.4614 0.0207  -0.0072 0.0406  590 GLY A O     
2729 N N     . LEU C 295 ? 0.3541 0.4224 0.3584 -0.0021 -0.0175 0.0439  591 LEU A N     
2730 C CA    . LEU C 295 ? 0.3932 0.4589 0.4014 -0.0089 -0.0112 0.0451  591 LEU A CA    
2731 C C     . LEU C 295 ? 0.4043 0.5059 0.4326 -0.0097 -0.0083 0.0524  591 LEU A C     
2732 O O     . LEU C 295 ? 0.3896 0.4954 0.4202 -0.0060 0.0001  0.0524  591 LEU A O     
2733 C CB    . LEU C 295 ? 0.5130 0.5596 0.5158 -0.0233 -0.0172 0.0449  591 LEU A CB    
2734 C CG    . LEU C 295 ? 0.5892 0.6010 0.5731 -0.0231 -0.0138 0.0370  591 LEU A CG    
2735 C CD1   . LEU C 295 ? 0.6263 0.6221 0.6058 -0.0354 -0.0218 0.0361  591 LEU A CD1   
2736 C CD2   . LEU C 295 ? 0.5462 0.5541 0.5302 -0.0179 -0.0031 0.0349  591 LEU A CD2   
2737 N N     . LEU C 296 ? 0.3706 0.5002 0.4135 -0.0146 -0.0152 0.0591  592 LEU A N     
2738 C CA    . LEU C 296 ? 0.3346 0.5037 0.3975 -0.0169 -0.0120 0.0675  592 LEU A CA    
2739 C C     . LEU C 296 ? 0.3647 0.5517 0.4299 0.0011  -0.0029 0.0644  592 LEU A C     
2740 O O     . LEU C 296 ? 0.3495 0.5618 0.4253 0.0015  0.0037  0.0692  592 LEU A O     
2741 C CB    . LEU C 296 ? 0.2949 0.4945 0.3744 -0.0245 -0.0214 0.0753  592 LEU A CB    
2742 C CG    . LEU C 296 ? 0.3659 0.5495 0.4445 -0.0439 -0.0326 0.0794  592 LEU A CG    
2743 C CD1   . LEU C 296 ? 0.2816 0.4968 0.3777 -0.0518 -0.0431 0.0875  592 LEU A CD1   
2744 C CD2   . LEU C 296 ? 0.3448 0.5205 0.4249 -0.0578 -0.0308 0.0845  592 LEU A CD2   
2745 N N     . LYS C 297 ? 0.3524 0.5252 0.4063 0.0162  -0.0032 0.0566  593 LYS A N     
2746 C CA    . LYS C 297 ? 0.3624 0.5482 0.4165 0.0349  0.0028  0.0524  593 LYS A CA    
2747 C C     . LYS C 297 ? 0.3572 0.5247 0.4021 0.0378  0.0118  0.0486  593 LYS A C     
2748 O O     . LYS C 297 ? 0.3778 0.5633 0.4265 0.0498  0.0176  0.0472  593 LYS A O     
2749 C CB    . LYS C 297 ? 0.3840 0.5544 0.4268 0.0492  -0.0026 0.0455  593 LYS A CB    
2750 C CG    . LYS C 297 ? 0.5652 0.7621 0.6192 0.0532  -0.0111 0.0482  593 LYS A CG    
2751 C CD    . LYS C 297 ? 0.7167 0.8905 0.7558 0.0660  -0.0180 0.0417  593 LYS A CD    
2752 C CE    . LYS C 297 ? 0.7102 0.9084 0.7600 0.0701  -0.0280 0.0440  593 LYS A CE    
2753 N NZ    . LYS C 297 ? 0.7054 0.8722 0.7374 0.0747  -0.0371 0.0399  593 LYS A NZ    
2754 N N     . VAL C 298 ? 0.3197 0.4528 0.3526 0.0283  0.0127  0.0463  594 VAL A N     
2755 C CA    . VAL C 298 ? 0.3088 0.4227 0.3327 0.0316  0.0201  0.0421  594 VAL A CA    
2756 C C     . VAL C 298 ? 0.4089 0.5259 0.4387 0.0185  0.0237  0.0472  594 VAL A C     
2757 O O     . VAL C 298 ? 0.3501 0.4510 0.3733 0.0197  0.0292  0.0441  594 VAL A O     
2758 C CB    . VAL C 298 ? 0.3944 0.4689 0.4002 0.0329  0.0194  0.0352  594 VAL A CB    
2759 C CG1   . VAL C 298 ? 0.4301 0.4991 0.4283 0.0454  0.0147  0.0314  594 VAL A CG1   
2760 C CG2   . VAL C 298 ? 0.3017 0.3573 0.3024 0.0183  0.0157  0.0359  594 VAL A CG2   
2761 N N     . VAL C 299 ? 0.3781 0.5146 0.4201 0.0056  0.0196  0.0554  595 VAL A N     
2762 C CA    . VAL C 299 ? 0.3293 0.4693 0.3768 -0.0073 0.0214  0.0618  595 VAL A CA    
2763 C C     . VAL C 299 ? 0.2447 0.4169 0.3014 -0.0008 0.0288  0.0663  595 VAL A C     
2764 O O     . VAL C 299 ? 0.2466 0.4550 0.3151 0.0045  0.0292  0.0704  595 VAL A O     
2765 C CB    . VAL C 299 ? 0.3249 0.4723 0.3813 -0.0250 0.0124  0.0702  595 VAL A CB    
2766 C CG1   . VAL C 299 ? 0.2652 0.4162 0.3270 -0.0387 0.0127  0.0784  595 VAL A CG1   
2767 C CG2   . VAL C 299 ? 0.3159 0.4296 0.3603 -0.0302 0.0048  0.0645  595 VAL A CG2   
2768 N N     . ARG C 300 ? 0.2633 0.4242 0.3145 -0.0006 0.0345  0.0652  596 ARG A N     
2769 C CA    . ARG C 300 ? 0.2387 0.4292 0.2962 0.0049  0.0416  0.0695  596 ARG A CA    
2770 C C     . ARG C 300 ? 0.3143 0.5370 0.3868 -0.0106 0.0397  0.0832  596 ARG A C     
2771 O O     . ARG C 300 ? 0.3685 0.5759 0.4407 -0.0273 0.0352  0.0891  596 ARG A O     
2772 C CB    . ARG C 300 ? 0.2361 0.4042 0.2833 0.0071  0.0468  0.0656  596 ARG A CB    
2773 C CG    . ARG C 300 ? 0.3914 0.5245 0.4245 0.0176  0.0474  0.0537  596 ARG A CG    
2774 C CD    . ARG C 300 ? 0.4913 0.6283 0.5188 0.0339  0.0533  0.0480  596 ARG A CD    
2775 N NE    . ARG C 300 ? 0.5368 0.6514 0.5541 0.0462  0.0517  0.0382  596 ARG A NE    
2776 C CZ    . ARG C 300 ? 0.4775 0.5945 0.4892 0.0629  0.0535  0.0320  596 ARG A CZ    
2777 N NH1   . ARG C 300 ? 0.3511 0.4939 0.3661 0.0708  0.0580  0.0335  596 ARG A NH1   
2778 N NH2   . ARG C 300 ? 0.5475 0.6406 0.5493 0.0716  0.0501  0.0245  596 ARG A NH2   
2779 N N     . PRO C 301 ? 0.3158 0.5833 0.4015 -0.0059 0.0421  0.0890  597 PRO A N     
2780 C CA    . PRO C 301 ? 0.3746 0.6762 0.4761 -0.0232 0.0399  0.1041  597 PRO A CA    
2781 C C     . PRO C 301 ? 0.3358 0.6402 0.4358 -0.0331 0.0441  0.1123  597 PRO A C     
2782 O O     . PRO C 301 ? 0.4095 0.7256 0.5183 -0.0530 0.0393  0.1256  597 PRO A O     
2783 C CB    . PRO C 301 ? 0.4081 0.7608 0.5234 -0.0110 0.0439  0.1062  597 PRO A CB    
2784 C CG    . PRO C 301 ? 0.3161 0.6610 0.4198 0.0139  0.0503  0.0927  597 PRO A CG    
2785 C CD    . PRO C 301 ? 0.2819 0.5719 0.3688 0.0157  0.0464  0.0821  597 PRO A CD    
2786 N N     . ASP C 302 ? 0.3957 0.6880 0.4840 -0.0204 0.0516  0.1051  598 ASP A N     
2787 C CA    . ASP C 302 ? 0.4848 0.7785 0.5699 -0.0287 0.0552  0.1127  598 ASP A CA    
2788 C C     . ASP C 302 ? 0.6225 0.8743 0.7006 -0.0457 0.0472  0.1148  598 ASP A C     
2789 O O     . ASP C 302 ? 0.7683 1.0246 0.8490 -0.0619 0.0445  0.1268  598 ASP A O     
2790 C CB    . ASP C 302 ? 0.3774 0.6670 0.4508 -0.0093 0.0639  0.1031  598 ASP A CB    
2791 C CG    . ASP C 302 ? 0.4957 0.7518 0.5580 0.0069  0.0632  0.0870  598 ASP A CG    
2792 O OD1   . ASP C 302 ? 0.6124 0.8361 0.6620 0.0115  0.0645  0.0795  598 ASP A OD1   
2793 O OD2   . ASP C 302 ? 0.5725 0.8349 0.6388 0.0141  0.0606  0.0826  598 ASP A OD2   
2794 N N     . THR C 303 ? 0.5035 0.7149 0.5722 -0.0421 0.0428  0.1034  599 THR A N     
2795 C CA    . THR C 303 ? 0.4543 0.6256 0.5151 -0.0543 0.0354  0.1026  599 THR A CA    
2796 C C     . THR C 303 ? 0.3672 0.5186 0.4285 -0.0629 0.0252  0.1006  599 THR A C     
2797 O O     . THR C 303 ? 0.4005 0.5196 0.4551 -0.0728 0.0175  0.0996  599 THR A O     
2798 C CB    . THR C 303 ? 0.4815 0.6198 0.5283 -0.0421 0.0397  0.0901  599 THR A CB    
2799 O OG1   . THR C 303 ? 0.5998 0.7297 0.6420 -0.0273 0.0424  0.0784  599 THR A OG1   
2800 C CG2   . THR C 303 ? 0.5392 0.6929 0.5836 -0.0350 0.0479  0.0923  599 THR A CG2   
2801 N N     . LYS C 304 ? 0.3159 0.4850 0.3839 -0.0586 0.0241  0.0993  600 LYS A N     
2802 C CA    . LYS C 304 ? 0.3765 0.5264 0.4429 -0.0649 0.0143  0.0962  600 LYS A CA    
2803 C C     . LYS C 304 ? 0.2824 0.3882 0.3326 -0.0588 0.0134  0.0831  600 LYS A C     
2804 O O     . LYS C 304 ? 0.3462 0.4270 0.3909 -0.0667 0.0043  0.0804  600 LYS A O     
2805 C CB    . LYS C 304 ? 0.5503 0.7023 0.6244 -0.0867 0.0028  0.1083  600 LYS A CB    
2806 C CG    . LYS C 304 ? 0.6389 0.8377 0.7314 -0.0943 0.0016  0.1212  600 LYS A CG    
2807 C CD    . LYS C 304 ? 0.8473 1.0487 0.9477 -0.1185 -0.0102 0.1358  600 LYS A CD    
2808 C CE    . LYS C 304 ? 0.9490 1.1455 1.0460 -0.1268 -0.0082 0.1436  600 LYS A CE    
2809 N NZ    . LYS C 304 ? 0.9556 1.1499 1.0572 -0.1491 -0.0216 0.1571  600 LYS A NZ    
2810 N N     . LYS C 305 ? 0.2415 0.3385 0.2838 -0.0444 0.0223  0.0746  601 LYS A N     
2811 C CA    . LYS C 305 ? 0.3444 0.4061 0.3731 -0.0376 0.0230  0.0627  601 LYS A CA    
2812 C C     . LYS C 305 ? 0.3340 0.3975 0.3585 -0.0234 0.0271  0.0552  601 LYS A C     
2813 O O     . LYS C 305 ? 0.3041 0.3926 0.3343 -0.0142 0.0314  0.0568  601 LYS A O     
2814 C CB    . LYS C 305 ? 0.3545 0.4012 0.3770 -0.0337 0.0285  0.0592  601 LYS A CB    
2815 C CG    . LYS C 305 ? 0.3637 0.3981 0.3863 -0.0467 0.0227  0.0647  601 LYS A CG    
2816 C CD    . LYS C 305 ? 0.3366 0.3601 0.3540 -0.0411 0.0282  0.0614  601 LYS A CD    
2817 C CE    . LYS C 305 ? 0.4430 0.4445 0.4570 -0.0518 0.0208  0.0638  601 LYS A CE    
2818 N NZ    . LYS C 305 ? 0.5082 0.4974 0.5168 -0.0447 0.0257  0.0591  601 LYS A NZ    
2819 N N     . VAL C 306 ? 0.2694 0.3060 0.2830 -0.0215 0.0249  0.0470  602 VAL A N     
2820 C CA    . VAL C 306 ? 0.3229 0.3526 0.3288 -0.0089 0.0286  0.0398  602 VAL A CA    
2821 C C     . VAL C 306 ? 0.3304 0.3402 0.3279 -0.0030 0.0347  0.0332  602 VAL A C     
2822 O O     . VAL C 306 ? 0.3532 0.3447 0.3467 -0.0088 0.0340  0.0307  602 VAL A O     
2823 C CB    . VAL C 306 ? 0.2893 0.3046 0.2875 -0.0112 0.0227  0.0362  602 VAL A CB    
2824 C CG1   . VAL C 306 ? 0.3346 0.3708 0.3422 -0.0168 0.0156  0.0427  602 VAL A CG1   
2825 C CG2   . VAL C 306 ? 0.2253 0.2137 0.2145 -0.0184 0.0200  0.0315  602 VAL A CG2   
2826 N N     . HIS C 307 ? 0.2972 0.3107 0.2925 0.0088  0.0395  0.0302  603 HIS A N     
2827 C CA    . HIS C 307 ? 0.2145 0.2107 0.2028 0.0145  0.0443  0.0244  603 HIS A CA    
2828 C C     . HIS C 307 ? 0.2488 0.2310 0.2276 0.0212  0.0440  0.0193  603 HIS A C     
2829 O O     . HIS C 307 ? 0.2854 0.2735 0.2628 0.0312  0.0440  0.0185  603 HIS A O     
2830 C CB    . HIS C 307 ? 0.1818 0.1919 0.1741 0.0218  0.0486  0.0258  603 HIS A CB    
2831 C CG    . HIS C 307 ? 0.2941 0.3187 0.2944 0.0140  0.0489  0.0325  603 HIS A CG    
2832 N ND1   . HIS C 307 ? 0.2364 0.2485 0.2352 0.0093  0.0501  0.0321  603 HIS A ND1   
2833 C CD2   . HIS C 307 ? 0.2883 0.3394 0.2983 0.0091  0.0475  0.0407  603 HIS A CD2   
2834 C CE1   . HIS C 307 ? 0.2579 0.2856 0.2635 0.0017  0.0490  0.0401  603 HIS A CE1   
2835 N NE2   . HIS C 307 ? 0.2751 0.3277 0.2880 0.0007  0.0478  0.0460  603 HIS A NE2   
2836 N N     . THR C 308 ? 0.2794 0.2433 0.2507 0.0157  0.0429  0.0162  604 THR A N     
2837 C CA    . THR C 308 ? 0.2332 0.1837 0.1943 0.0198  0.0426  0.0130  604 THR A CA    
2838 C C     . THR C 308 ? 0.2959 0.2364 0.2534 0.0259  0.0464  0.0099  604 THR A C     
2839 O O     . THR C 308 ? 0.3465 0.2886 0.3087 0.0267  0.0496  0.0092  604 THR A O     
2840 C CB    . THR C 308 ? 0.2862 0.2223 0.2392 0.0125  0.0416  0.0104  604 THR A CB    
2841 O OG1   . THR C 308 ? 0.3333 0.2593 0.2754 0.0151  0.0408  0.0093  604 THR A OG1   
2842 C CG2   . THR C 308 ? 0.3205 0.2460 0.2730 0.0092  0.0457  0.0064  604 THR A CG2   
2843 N N     . ILE C 309 ? 0.2906 0.2199 0.2392 0.0296  0.0450  0.0088  605 ILE A N     
2844 C CA    . ILE C 309 ? 0.3442 0.2602 0.2880 0.0330  0.0467  0.0065  605 ILE A CA    
2845 C C     . ILE C 309 ? 0.3198 0.2212 0.2548 0.0263  0.0479  0.0058  605 ILE A C     
2846 O O     . ILE C 309 ? 0.3275 0.2244 0.2543 0.0251  0.0447  0.0076  605 ILE A O     
2847 C CB    . ILE C 309 ? 0.3720 0.2868 0.3124 0.0437  0.0421  0.0067  605 ILE A CB    
2848 C CG1   . ILE C 309 ? 0.3246 0.2579 0.2737 0.0516  0.0426  0.0065  605 ILE A CG1   
2849 C CG2   . ILE C 309 ? 0.3313 0.2273 0.2646 0.0450  0.0412  0.0051  605 ILE A CG2   
2850 C CD1   . ILE C 309 ? 0.4266 0.3598 0.3718 0.0652  0.0378  0.0046  605 ILE A CD1   
2851 N N     . PHE C 310 ? 0.3230 0.2189 0.2595 0.0221  0.0526  0.0034  606 PHE A N     
2852 C CA    . PHE C 310 ? 0.3679 0.2546 0.2967 0.0161  0.0551  0.0029  606 PHE A CA    
2853 C C     . PHE C 310 ? 0.4493 0.3250 0.3724 0.0172  0.0531  0.0052  606 PHE A C     
2854 O O     . PHE C 310 ? 0.4427 0.3152 0.3701 0.0205  0.0527  0.0042  606 PHE A O     
2855 C CB    . PHE C 310 ? 0.4204 0.3087 0.3543 0.0120  0.0604  -0.0011 606 PHE A CB    
2856 C CG    . PHE C 310 ? 0.4469 0.3405 0.3828 0.0097  0.0603  -0.0036 606 PHE A CG    
2857 C CD1   . PHE C 310 ? 0.3315 0.2301 0.2764 0.0106  0.0595  -0.0046 606 PHE A CD1   
2858 C CD2   . PHE C 310 ? 0.4901 0.3822 0.4174 0.0063  0.0596  -0.0045 606 PHE A CD2   
2859 C CE1   . PHE C 310 ? 0.3970 0.2970 0.3429 0.0073  0.0570  -0.0061 606 PHE A CE1   
2860 C CE2   . PHE C 310 ? 0.3688 0.2625 0.2966 0.0044  0.0573  -0.0073 606 PHE A CE2   
2861 C CZ    . PHE C 310 ? 0.3568 0.2535 0.2941 0.0045  0.0554  -0.0079 606 PHE A CZ    
2862 N N     . ASN C 311 ? 0.3474 0.2157 0.2596 0.0142  0.0506  0.0086  607 ASN A N     
2863 C CA    . ASN C 311 ? 0.3515 0.2063 0.2565 0.0125  0.0473  0.0122  607 ASN A CA    
2864 C C     . ASN C 311 ? 0.4116 0.2671 0.3158 0.0031  0.0537  0.0129  607 ASN A C     
2865 O O     . ASN C 311 ? 0.4893 0.3487 0.3870 -0.0023 0.0572  0.0138  607 ASN A O     
2866 C CB    . ASN C 311 ? 0.3382 0.1835 0.2309 0.0137  0.0400  0.0168  607 ASN A CB    
2867 C CG    . ASN C 311 ? 0.5308 0.3581 0.4160 0.0135  0.0331  0.0209  607 ASN A CG    
2868 O OD1   . ASN C 311 ? 0.4348 0.2573 0.3226 0.0085  0.0349  0.0217  607 ASN A OD1   
2869 N ND2   . ASN C 311 ? 0.5419 0.3584 0.4178 0.0189  0.0237  0.0236  607 ASN A ND2   
2870 N N     . GLN C 312 ? 0.3479 0.2017 0.2591 0.0019  0.0553  0.0120  608 GLN A N     
2871 C CA    . GLN C 312 ? 0.4122 0.2718 0.3265 -0.0061 0.0618  0.0121  608 GLN A CA    
2872 C C     . GLN C 312 ? 0.3550 0.2060 0.2614 -0.0146 0.0594  0.0195  608 GLN A C     
2873 O O     . GLN C 312 ? 0.4595 0.3195 0.3669 -0.0227 0.0656  0.0214  608 GLN A O     
2874 C CB    . GLN C 312 ? 0.3813 0.2453 0.3088 -0.0035 0.0642  0.0074  608 GLN A CB    
2875 C CG    . GLN C 312 ? 0.3724 0.2475 0.3067 -0.0091 0.0715  0.0053  608 GLN A CG    
2876 C CD    . GLN C 312 ? 0.3816 0.2596 0.3287 -0.0056 0.0721  0.0007  608 GLN A CD    
2877 O OE1   . GLN C 312 ? 0.4136 0.2865 0.3633 0.0012  0.0681  -0.0013 608 GLN A OE1   
2878 N NE2   . GLN C 312 ? 0.2630 0.1508 0.2179 -0.0097 0.0770  -0.0010 608 GLN A NE2   
2879 N N     . ALA C 313 ? 0.3576 0.1920 0.2559 -0.0130 0.0501  0.0242  609 ALA A N     
2880 C CA    . ALA C 313 ? 0.3977 0.2194 0.2875 -0.0222 0.0450  0.0327  609 ALA A CA    
2881 C C     . ALA C 313 ? 0.3898 0.1983 0.2639 -0.0220 0.0373  0.0383  609 ALA A C     
2882 O O     . ALA C 313 ? 0.5506 0.3390 0.4170 -0.0206 0.0261  0.0423  609 ALA A O     
2883 C CB    . ALA C 313 ? 0.4924 0.3004 0.3868 -0.0207 0.0373  0.0329  609 ALA A CB    
2884 N N     . LEU C 314 ? 0.4128 0.2309 0.2809 -0.0229 0.0422  0.0381  610 LEU A N     
2885 C CA    . LEU C 314 ? 0.4469 0.2538 0.2998 -0.0223 0.0349  0.0431  610 LEU A CA    
2886 C C     . LEU C 314 ? 0.4342 0.2462 0.2749 -0.0336 0.0396  0.0497  610 LEU A C     
2887 O O     . LEU C 314 ? 0.4594 0.2570 0.2865 -0.0407 0.0328  0.0590  610 LEU A O     
2888 C CB    . LEU C 314 ? 0.4991 0.3118 0.3545 -0.0109 0.0335  0.0366  610 LEU A CB    
2889 C CG    . LEU C 314 ? 0.6071 0.4106 0.4479 -0.0094 0.0258  0.0410  610 LEU A CG    
2890 C CD1   . LEU C 314 ? 0.5912 0.3723 0.4240 -0.0053 0.0124  0.0454  610 LEU A CD1   
2891 C CD2   . LEU C 314 ? 0.6465 0.4618 0.4922 -0.0008 0.0261  0.0351  610 LEU A CD2   
2892 N N     . THR C 315 ? 0.4072 0.2385 0.2507 -0.0352 0.0504  0.0452  611 THR A N     
2893 C CA    . THR C 315 ? 0.4374 0.2753 0.2668 -0.0437 0.0549  0.0503  611 THR A CA    
2894 C C     . THR C 315 ? 0.4933 0.3361 0.3209 -0.0569 0.0593  0.0587  611 THR A C     
2895 O O     . THR C 315 ? 0.3980 0.2451 0.2390 -0.0593 0.0617  0.0580  611 THR A O     
2896 C CB    . THR C 315 ? 0.4557 0.3119 0.2872 -0.0398 0.0640  0.0415  611 THR A CB    
2897 O OG1   . THR C 315 ? 0.4043 0.2762 0.2495 -0.0407 0.0733  0.0363  611 THR A OG1   
2898 C CG2   . THR C 315 ? 0.5626 0.4162 0.3999 -0.0287 0.0594  0.0339  611 THR A CG2   
2899 N N     . GLN C 316 ? 0.3952 0.2387 0.2060 -0.0662 0.0601  0.0675  612 GLN A N     
2900 C CA    . GLN C 316 ? 0.5087 0.3615 0.3169 -0.0808 0.0650  0.0776  612 GLN A CA    
2901 C C     . GLN C 316 ? 0.4843 0.3682 0.2992 -0.0823 0.0803  0.0720  612 GLN A C     
2902 O O     . GLN C 316 ? 0.5163 0.4155 0.3325 -0.0939 0.0864  0.0794  612 GLN A O     
2903 C CB    . GLN C 316 ? 0.5232 0.3659 0.3102 -0.0906 0.0590  0.0905  612 GLN A CB    
2904 C CG    . GLN C 316 ? 0.8952 0.7069 0.6736 -0.0865 0.0425  0.0946  612 GLN A CG    
2905 C CD    . GLN C 316 ? 0.9681 0.7648 0.7567 -0.0897 0.0320  0.0991  612 GLN A CD    
2906 O OE1   . GLN C 316 ? 0.9827 0.7861 0.7756 -0.1011 0.0310  0.1075  612 GLN A OE1   
2907 N NE2   . GLN C 316 ? 0.9252 0.7021 0.7177 -0.0787 0.0237  0.0931  612 GLN A NE2   
2908 N N     . THR C 317 ? 0.4390 0.3328 0.2579 -0.0707 0.0855  0.0592  613 THR A N     
2909 C CA    . THR C 317 ? 0.5429 0.4637 0.3665 -0.0686 0.0983  0.0514  613 THR A CA    
2910 C C     . THR C 317 ? 0.4507 0.3799 0.2961 -0.0614 0.1020  0.0411  613 THR A C     
2911 O O     . THR C 317 ? 0.4915 0.4435 0.3434 -0.0596 0.1118  0.0348  613 THR A O     
2912 C CB    . THR C 317 ? 0.4962 0.4195 0.3068 -0.0604 0.0998  0.0434  613 THR A CB    
2913 O OG1   . THR C 317 ? 0.4215 0.3281 0.2372 -0.0504 0.0914  0.0366  613 THR A OG1   
2914 C CG2   . THR C 317 ? 0.6285 0.5471 0.4158 -0.0677 0.0975  0.0533  613 THR A CG2   
2915 N N     . GLY C 318 ? 0.3695 0.2817 0.2253 -0.0561 0.0941  0.0388  614 GLY A N     
2916 C CA    . GLY C 318 ? 0.3310 0.2486 0.2052 -0.0484 0.0962  0.0291  614 GLY A CA    
2917 C C     . GLY C 318 ? 0.3140 0.2288 0.1898 -0.0367 0.0950  0.0182  614 GLY A C     
2918 O O     . GLY C 318 ? 0.3366 0.2533 0.2265 -0.0304 0.0954  0.0108  614 GLY A O     
2919 N N     . ARG C 319 ? 0.3804 0.2902 0.2421 -0.0345 0.0925  0.0176  615 ARG A N     
2920 C CA    . ARG C 319 ? 0.3356 0.2411 0.1993 -0.0253 0.0891  0.0088  615 ARG A CA    
2921 C C     . ARG C 319 ? 0.4183 0.3103 0.2911 -0.0212 0.0811  0.0099  615 ARG A C     
2922 O O     . ARG C 319 ? 0.3368 0.2178 0.2072 -0.0238 0.0757  0.0173  615 ARG A O     
2923 C CB    . ARG C 319 ? 0.4244 0.3271 0.2707 -0.0246 0.0867  0.0086  615 ARG A CB    
2924 C CG    . ARG C 319 ? 0.5818 0.4997 0.4173 -0.0257 0.0948  0.0049  615 ARG A CG    
2925 C CD    . ARG C 319 ? 0.7067 0.6207 0.5273 -0.0214 0.0911  -0.0001 615 ARG A CD    
2926 N NE    . ARG C 319 ? 0.7386 0.6675 0.5470 -0.0202 0.0986  -0.0054 615 ARG A NE    
2927 C CZ    . ARG C 319 ? 0.8348 0.7728 0.6470 -0.0126 0.1023  -0.0174 615 ARG A CZ    
2928 N NH1   . ARG C 319 ? 0.8268 0.7590 0.6548 -0.0071 0.0988  -0.0241 615 ARG A NH1   
2929 N NH2   . ARG C 319 ? 0.8484 0.8011 0.6475 -0.0099 0.1090  -0.0228 615 ARG A NH2   
2930 N N     . LEU C 320 ? 0.4355 0.3284 0.3181 -0.0145 0.0799  0.0025  616 LEU A N     
2931 C CA    . LEU C 320 ? 0.4195 0.3041 0.3097 -0.0098 0.0732  0.0032  616 LEU A CA    
2932 C C     . LEU C 320 ? 0.4832 0.3615 0.3639 -0.0083 0.0664  0.0061  616 LEU A C     
2933 O O     . LEU C 320 ? 0.4690 0.3490 0.3398 -0.0093 0.0662  0.0045  616 LEU A O     
2934 C CB    . LEU C 320 ? 0.4321 0.3210 0.3343 -0.0049 0.0737  -0.0040 616 LEU A CB    
2935 C CG    . LEU C 320 ? 0.4125 0.3073 0.3256 -0.0045 0.0789  -0.0081 616 LEU A CG    
2936 C CD1   . LEU C 320 ? 0.3932 0.2892 0.3151 0.0001  0.0775  -0.0146 616 LEU A CD1   
2937 C CD2   . LEU C 320 ? 0.4218 0.3123 0.3413 -0.0056 0.0777  -0.0033 616 LEU A CD2   
2938 N N     . SER C 321 ? 0.3442 0.2157 0.2278 -0.0050 0.0601  0.0099  617 SER A N     
2939 C CA    . SER C 321 ? 0.4411 0.3101 0.3202 -0.0015 0.0530  0.0116  617 SER A CA    
2940 C C     . SER C 321 ? 0.4511 0.3259 0.3439 0.0048  0.0504  0.0091  617 SER A C     
2941 O O     . SER C 321 ? 0.3748 0.2514 0.2777 0.0068  0.0529  0.0073  617 SER A O     
2942 C CB    . SER C 321 ? 0.4946 0.3522 0.3632 -0.0015 0.0466  0.0185  617 SER A CB    
2943 O OG    . SER C 321 ? 0.5974 0.4486 0.4721 0.0025  0.0435  0.0200  617 SER A OG    
2944 N N     . SER C 322 ? 0.3332 0.2122 0.2261 0.0073  0.0451  0.0095  618 SER A N     
2945 C CA    . SER C 322 ? 0.4249 0.3143 0.3308 0.0113  0.0431  0.0082  618 SER A CA    
2946 C C     . SER C 322 ? 0.3832 0.2768 0.2894 0.0168  0.0359  0.0116  618 SER A C     
2947 O O     . SER C 322 ? 0.4653 0.3550 0.3618 0.0159  0.0313  0.0136  618 SER A O     
2948 C CB    . SER C 322 ? 0.4481 0.3429 0.3574 0.0071  0.0436  0.0049  618 SER A CB    
2949 O OG    . SER C 322 ? 0.5867 0.4928 0.5070 0.0085  0.0397  0.0063  618 SER A OG    
2950 N N     . THR C 323 ? 0.3089 0.2118 0.2256 0.0234  0.0348  0.0119  619 THR A N     
2951 C CA    . THR C 323 ? 0.4022 0.3136 0.3210 0.0309  0.0282  0.0141  619 THR A CA    
2952 C C     . THR C 323 ? 0.3002 0.2327 0.2342 0.0340  0.0289  0.0144  619 THR A C     
2953 O O     . THR C 323 ? 0.3150 0.2516 0.2562 0.0328  0.0339  0.0131  619 THR A O     
2954 C CB    . THR C 323 ? 0.4567 0.3573 0.3691 0.0395  0.0242  0.0146  619 THR A CB    
2955 O OG1   . THR C 323 ? 0.4876 0.3878 0.4057 0.0433  0.0279  0.0123  619 THR A OG1   
2956 C CG2   . THR C 323 ? 0.5088 0.3887 0.4055 0.0344  0.0225  0.0167  619 THR A CG2   
2957 N N     . GLU C 324 ? 0.3330 0.2803 0.2718 0.0375  0.0235  0.0166  620 GLU A N     
2958 C CA    . GLU C 324 ? 0.4298 0.4026 0.3834 0.0416  0.0236  0.0184  620 GLU A CA    
2959 C C     . GLU C 324 ? 0.4161 0.3977 0.3791 0.0321  0.0279  0.0198  620 GLU A C     
2960 O O     . GLU C 324 ? 0.4895 0.4796 0.4594 0.0343  0.0323  0.0200  620 GLU A O     
2961 C CB    . GLU C 324 ? 0.5385 0.5158 0.4937 0.0544  0.0246  0.0164  620 GLU A CB    
2962 C CG    . GLU C 324 ? 0.7396 0.7038 0.6842 0.0645  0.0181  0.0147  620 GLU A CG    
2963 C CD    . GLU C 324 ? 0.9031 0.8746 0.8497 0.0799  0.0167  0.0116  620 GLU A CD    
2964 O OE1   . GLU C 324 ? 0.9250 0.9245 0.8832 0.0866  0.0173  0.0121  620 GLU A OE1   
2965 O OE2   . GLU C 324 ? 0.9507 0.9005 0.8868 0.0854  0.0143  0.0087  620 GLU A OE2   
2966 N N     . PRO C 325 ? 0.3967 0.3751 0.3590 0.0217  0.0254  0.0209  621 PRO A N     
2967 C CA    . PRO C 325 ? 0.4750 0.4432 0.4273 0.0193  0.0199  0.0205  621 PRO A CA    
2968 C C     . PRO C 325 ? 0.4112 0.3553 0.3490 0.0156  0.0229  0.0165  621 PRO A C     
2969 O O     . PRO C 325 ? 0.3286 0.2659 0.2669 0.0131  0.0286  0.0140  621 PRO A O     
2970 C CB    . PRO C 325 ? 0.4100 0.3893 0.3698 0.0101  0.0148  0.0234  621 PRO A CB    
2971 C CG    . PRO C 325 ? 0.3536 0.3335 0.3202 0.0039  0.0189  0.0236  621 PRO A CG    
2972 C CD    . PRO C 325 ? 0.3864 0.3714 0.3570 0.0119  0.0257  0.0231  621 PRO A CD    
2973 N N     . ASN C 326 ? 0.2990 0.2322 0.2241 0.0155  0.0192  0.0163  622 ASN A N     
2974 C CA    . ASN C 326 ? 0.3825 0.2980 0.2935 0.0106  0.0222  0.0133  622 ASN A CA    
2975 C C     . ASN C 326 ? 0.5148 0.4300 0.4255 0.0032  0.0201  0.0108  622 ASN A C     
2976 O O     . ASN C 326 ? 0.5782 0.4940 0.4843 0.0006  0.0132  0.0115  622 ASN A O     
2977 C CB    . ASN C 326 ? 0.5167 0.4214 0.4125 0.0124  0.0185  0.0150  622 ASN A CB    
2978 C CG    . ASN C 326 ? 0.5624 0.4536 0.4427 0.0066  0.0219  0.0127  622 ASN A CG    
2979 O OD1   . ASN C 326 ? 0.4890 0.3786 0.3704 0.0032  0.0278  0.0087  622 ASN A OD1   
2980 N ND2   . ASN C 326 ? 0.5652 0.4479 0.4303 0.0062  0.0180  0.0151  622 ASN A ND2   
2981 N N     . LEU C 327 ? 0.4887 0.4016 0.4039 0.0001  0.0246  0.0077  623 LEU A N     
2982 C CA    . LEU C 327 ? 0.4330 0.3420 0.3472 -0.0060 0.0208  0.0045  623 LEU A CA    
2983 C C     . LEU C 327 ? 0.5206 0.4157 0.4181 -0.0070 0.0221  -0.0014 623 LEU A C     
2984 O O     . LEU C 327 ? 0.7048 0.5934 0.5982 -0.0102 0.0180  -0.0060 623 LEU A O     
2985 C CB    . LEU C 327 ? 0.4604 0.3715 0.3857 -0.0080 0.0234  0.0035  623 LEU A CB    
2986 C CG    . LEU C 327 ? 0.5558 0.4839 0.4971 -0.0085 0.0217  0.0099  623 LEU A CG    
2987 C CD1   . LEU C 327 ? 0.6183 0.5463 0.5678 -0.0107 0.0245  0.0096  623 LEU A CD1   
2988 C CD2   . LEU C 327 ? 0.6385 0.5763 0.5847 -0.0140 0.0124  0.0142  623 LEU A CD2   
2989 N N     . GLN C 328 ? 0.4766 0.3670 0.3633 -0.0043 0.0270  -0.0012 624 GLN A N     
2990 C CA    . GLN C 328 ? 0.6205 0.5021 0.4908 -0.0051 0.0300  -0.0059 624 GLN A CA    
2991 C C     . GLN C 328 ? 0.6715 0.5492 0.5271 -0.0062 0.0235  -0.0049 624 GLN A C     
2992 O O     . GLN C 328 ? 0.8528 0.7253 0.6920 -0.0064 0.0266  -0.0067 624 GLN A O     
2993 C CB    . GLN C 328 ? 0.7632 0.6435 0.6299 -0.0038 0.0389  -0.0047 624 GLN A CB    
2994 C CG    . GLN C 328 ? 0.8851 0.7683 0.7648 -0.0026 0.0449  -0.0067 624 GLN A CG    
2995 C CD    . GLN C 328 ? 0.9957 0.8783 0.8745 -0.0024 0.0518  -0.0041 624 GLN A CD    
2996 O OE1   . GLN C 328 ? 1.0221 0.9012 0.8928 -0.0031 0.0508  0.0012  624 GLN A OE1   
2997 N NE2   . GLN C 328 ? 1.0074 0.8922 0.8943 -0.0019 0.0576  -0.0074 624 GLN A NE2   
2998 N N     . ASN C 329 ? 0.6047 0.4867 0.4658 -0.0071 0.0144  -0.0017 625 ASN A N     
2999 C CA    . ASN C 329 ? 0.6479 0.5255 0.4955 -0.0084 0.0064  -0.0017 625 ASN A CA    
3000 C C     . ASN C 329 ? 0.6527 0.5351 0.5096 -0.0119 -0.0044 -0.0013 625 ASN A C     
3001 O O     . ASN C 329 ? 0.6456 0.5288 0.4976 -0.0127 -0.0131 0.0011  625 ASN A O     
3002 C CB    . ASN C 329 ? 0.6100 0.4872 0.4502 -0.0059 0.0049  0.0044  625 ASN A CB    
3003 C CG    . ASN C 329 ? 0.6452 0.5330 0.5020 -0.0023 0.0022  0.0100  625 ASN A CG    
3004 O OD1   . ASN C 329 ? 0.5527 0.4504 0.4268 -0.0022 0.0037  0.0101  625 ASN A OD1   
3005 N ND2   . ASN C 329 ? 0.6781 0.5642 0.5287 0.0013  -0.0022 0.0146  625 ASN A ND2   
3006 N N     . ILE C 330 ? 0.6943 0.5797 0.5646 -0.0147 -0.0049 -0.0027 626 ILE A N     
3007 C CA    . ILE C 330 ? 0.6444 0.5327 0.5226 -0.0206 -0.0163 -0.0015 626 ILE A CA    
3008 C C     . ILE C 330 ? 0.6618 0.5356 0.5217 -0.0224 -0.0245 -0.0078 626 ILE A C     
3009 O O     . ILE C 330 ? 0.6568 0.5182 0.5024 -0.0197 -0.0204 -0.0157 626 ILE A O     
3010 C CB    . ILE C 330 ? 0.6315 0.5215 0.5239 -0.0244 -0.0157 -0.0017 626 ILE A CB    
3011 C CG1   . ILE C 330 ? 0.6190 0.5232 0.5268 -0.0214 -0.0069 0.0037  626 ILE A CG1   
3012 C CG2   . ILE C 330 ? 0.5089 0.4021 0.4101 -0.0329 -0.0286 0.0017  626 ILE A CG2   
3013 C CD1   . ILE C 330 ? 0.3708 0.2948 0.2916 -0.0209 -0.0099 0.0117  626 ILE A CD1   
3014 N N     . PRO C 331 ? 0.7406 0.6163 0.5999 -0.0262 -0.0364 -0.0052 627 PRO A N     
3015 C CA    . PRO C 331 ? 0.8090 0.6698 0.6474 -0.0265 -0.0448 -0.0116 627 PRO A CA    
3016 C C     . PRO C 331 ? 0.8546 0.6992 0.6850 -0.0277 -0.0486 -0.0208 627 PRO A C     
3017 O O     . PRO C 331 ? 0.7458 0.5896 0.5895 -0.0330 -0.0539 -0.0198 627 PRO A O     
3018 C CB    . PRO C 331 ? 0.7459 0.6144 0.5916 -0.0318 -0.0586 -0.0060 627 PRO A CB    
3019 C CG    . PRO C 331 ? 0.6899 0.5801 0.5563 -0.0309 -0.0542 0.0033  627 PRO A CG    
3020 C CD    . PRO C 331 ? 0.7196 0.6135 0.5973 -0.0296 -0.0429 0.0035  627 PRO A CD    
3021 N N     . ILE C 332 ? 0.9040 0.7357 0.7112 -0.0224 -0.0467 -0.0297 628 ILE A N     
3022 C CA    . ILE C 332 ? 0.9972 0.8123 0.7930 -0.0202 -0.0510 -0.0408 628 ILE A CA    
3023 C C     . ILE C 332 ? 1.0781 0.8802 0.8484 -0.0173 -0.0598 -0.0485 628 ILE A C     
3024 O O     . ILE C 332 ? 1.0905 0.8761 0.8514 -0.0174 -0.0720 -0.0569 628 ILE A O     
3025 C CB    . ILE C 332 ? 1.0221 0.8379 0.8155 -0.0133 -0.0364 -0.0465 628 ILE A CB    
3026 C CG1   . ILE C 332 ? 1.0391 0.8386 0.8251 -0.0099 -0.0425 -0.0583 628 ILE A CG1   
3027 C CG2   . ILE C 332 ? 1.0849 0.9051 0.8602 -0.0074 -0.0254 -0.0483 628 ILE A CG2   
3028 C CD1   . ILE C 332 ? 1.0741 0.8670 0.8772 -0.0172 -0.0537 -0.0552 628 ILE A CD1   
3029 N N     . ARG C 333 ? 1.0805 0.8882 0.8379 -0.0147 -0.0549 -0.0457 629 ARG A N     
3030 C CA    . ARG C 333 ? 1.0486 0.8453 0.7785 -0.0109 -0.0613 -0.0530 629 ARG A CA    
3031 C C     . ARG C 333 ? 1.0084 0.7947 0.7372 -0.0165 -0.0813 -0.0536 629 ARG A C     
3032 O O     . ARG C 333 ? 1.0805 0.8496 0.7947 -0.0145 -0.0921 -0.0641 629 ARG A O     
3033 C CB    . ARG C 333 ? 1.0801 0.8853 0.7979 -0.0089 -0.0530 -0.0469 629 ARG A CB    
3034 C CG    . ARG C 333 ? 1.2137 1.0098 0.9000 -0.0045 -0.0568 -0.0536 629 ARG A CG    
3035 C CD    . ARG C 333 ? 1.3027 1.1070 0.9771 -0.0038 -0.0474 -0.0457 629 ARG A CD    
3036 N NE    . ARG C 333 ? 1.3981 1.1949 1.0415 -0.0006 -0.0520 -0.0502 629 ARG A NE    
3037 C CZ    . ARG C 333 ? 1.3932 1.1837 1.0277 -0.0029 -0.0657 -0.0472 629 ARG A CZ    
3038 N NH1   . ARG C 333 ? 1.3563 1.1496 1.0124 -0.0083 -0.0757 -0.0397 629 ARG A NH1   
3039 N NH2   . ARG C 333 ? 1.3993 1.1825 1.0032 0.0005  -0.0694 -0.0517 629 ARG A NH2   
3040 N N     . LEU C 334 ? 0.9908 0.7877 0.7350 -0.0231 -0.0875 -0.0428 630 LEU A N     
3041 C CA    . LEU C 334 ? 0.9665 0.7576 0.7134 -0.0300 -0.1070 -0.0416 630 LEU A CA    
3042 C C     . LEU C 334 ? 0.9841 0.7747 0.7536 -0.0384 -0.1149 -0.0391 630 LEU A C     
3043 O O     . LEU C 334 ? 0.8845 0.6892 0.6759 -0.0407 -0.1057 -0.0322 630 LEU A O     
3044 C CB    . LEU C 334 ? 0.8965 0.7025 0.6516 -0.0329 -0.1105 -0.0310 630 LEU A CB    
3045 C CG    . LEU C 334 ? 0.9360 0.7420 0.6695 -0.0260 -0.1032 -0.0306 630 LEU A CG    
3046 C CD1   . LEU C 334 ? 0.8877 0.7087 0.6332 -0.0277 -0.1067 -0.0196 630 LEU A CD1   
3047 C CD2   . LEU C 334 ? 0.8873 0.6750 0.5891 -0.0225 -0.1118 -0.0405 630 LEU A CD2   
3048 N N     . GLU C 335 ? 0.7278 0.8542 1.0131 -0.0380 -0.0801 -0.0370 631 GLU A N     
3049 C CA    . GLU C 335 ? 0.8267 0.9523 1.1211 -0.0445 -0.0688 -0.0402 631 GLU A CA    
3050 C C     . GLU C 335 ? 0.8439 0.9823 1.1606 -0.0422 -0.0622 -0.0392 631 GLU A C     
3051 O O     . GLU C 335 ? 0.8898 1.0250 1.2112 -0.0425 -0.0493 -0.0390 631 GLU A O     
3052 C CB    . GLU C 335 ? 0.9080 1.0331 1.2001 -0.0550 -0.0736 -0.0454 631 GLU A CB    
3053 C CG    . GLU C 335 ? 1.0166 1.1424 1.3206 -0.0626 -0.0630 -0.0485 631 GLU A CG    
3054 C CD    . GLU C 335 ? 1.1579 1.2684 1.4530 -0.0629 -0.0495 -0.0478 631 GLU A CD    
3055 O OE1   . GLU C 335 ? 1.2095 1.3067 1.4864 -0.0612 -0.0502 -0.0475 631 GLU A OE1   
3056 O OE2   . GLU C 335 ? 1.2043 1.3160 1.5101 -0.0648 -0.0381 -0.0475 631 GLU A OE2   
3057 N N     . GLU C 336 ? 0.7586 0.9117 1.0888 -0.0400 -0.0708 -0.0385 632 GLU A N     
3058 C CA    . GLU C 336 ? 0.7045 0.8707 1.0570 -0.0381 -0.0647 -0.0381 632 GLU A CA    
3059 C C     . GLU C 336 ? 0.5948 0.7564 0.9477 -0.0298 -0.0543 -0.0349 632 GLU A C     
3060 O O     . GLU C 336 ? 0.5614 0.7286 0.9285 -0.0295 -0.0443 -0.0354 632 GLU A O     
3061 C CB    . GLU C 336 ? 0.7976 0.9807 1.1644 -0.0360 -0.0767 -0.0375 632 GLU A CB    
3062 C CG    . GLU C 336 ? 0.9125 1.1036 1.2824 -0.0455 -0.0861 -0.0414 632 GLU A CG    
3063 C CD    . GLU C 336 ? 1.0029 1.2137 1.3902 -0.0435 -0.0972 -0.0407 632 GLU A CD    
3064 O OE1   . GLU C 336 ? 1.0335 1.2498 1.4281 -0.0338 -0.0987 -0.0365 632 GLU A OE1   
3065 O OE2   . GLU C 336 ? 1.0541 1.2749 1.4476 -0.0518 -0.1044 -0.0442 632 GLU A OE2   
3066 N N     . GLY C 337 ? 0.5527 0.7039 0.8897 -0.0235 -0.0565 -0.0318 633 GLY A N     
3067 C CA    . GLY C 337 ? 0.5823 0.7277 0.9167 -0.0164 -0.0471 -0.0291 633 GLY A CA    
3068 C C     . GLY C 337 ? 0.5742 0.7056 0.8937 -0.0185 -0.0372 -0.0294 633 GLY A C     
3069 O O     . GLY C 337 ? 0.4532 0.5803 0.7715 -0.0152 -0.0265 -0.0283 633 GLY A O     
3070 N N     . ARG C 338 ? 0.6277 0.7518 0.9351 -0.0242 -0.0408 -0.0310 634 ARG A N     
3071 C CA    . ARG C 338 ? 0.5190 0.6304 0.8136 -0.0266 -0.0315 -0.0312 634 ARG A CA    
3072 C C     . ARG C 338 ? 0.3359 0.4477 0.6392 -0.0311 -0.0183 -0.0326 634 ARG A C     
3073 O O     . ARG C 338 ? 0.3851 0.4880 0.6801 -0.0305 -0.0079 -0.0314 634 ARG A O     
3074 C CB    . ARG C 338 ? 0.7084 0.8117 0.9894 -0.0321 -0.0382 -0.0333 634 ARG A CB    
3075 C CG    . ARG C 338 ? 0.7987 0.8882 1.0658 -0.0338 -0.0300 -0.0332 634 ARG A CG    
3076 C CD    . ARG C 338 ? 0.8879 0.9687 1.1428 -0.0399 -0.0364 -0.0364 634 ARG A CD    
3077 N NE    . ARG C 338 ? 0.9723 1.0396 1.2120 -0.0395 -0.0312 -0.0357 634 ARG A NE    
3078 C CZ    . ARG C 338 ? 1.0783 1.1334 1.3015 -0.0431 -0.0342 -0.0382 634 ARG A CZ    
3079 N NH1   . ARG C 338 ? 1.1182 1.1747 1.3423 -0.0493 -0.0433 -0.0427 634 ARG A NH1   
3080 N NH2   . ARG C 338 ? 1.0784 1.1191 1.2806 -0.0396 -0.0273 -0.0358 634 ARG A NH2   
3081 N N     . LYS C 339 ? 0.1595 0.2818 0.4790 -0.0356 -0.0187 -0.0349 635 LYS A N     
3082 C CA    . LYS C 339 ? 0.3468 0.4692 0.6742 -0.0406 -0.0062 -0.0361 635 LYS A CA    
3083 C C     . LYS C 339 ? 0.4696 0.5931 0.8009 -0.0352 0.0048  -0.0342 635 LYS A C     
3084 O O     . LYS C 339 ? 0.5444 0.6649 0.8772 -0.0387 0.0168  -0.0344 635 LYS A O     
3085 C CB    . LYS C 339 ? 0.3645 0.4994 0.7095 -0.0471 -0.0099 -0.0393 635 LYS A CB    
3086 C CG    . LYS C 339 ? 0.4827 0.6149 0.8223 -0.0547 -0.0190 -0.0423 635 LYS A CG    
3087 C CD    . LYS C 339 ? 0.5582 0.7007 0.9141 -0.0633 -0.0191 -0.0457 635 LYS A CD    
3088 C CE    . LYS C 339 ? 0.5811 0.7192 0.9293 -0.0717 -0.0279 -0.0494 635 LYS A CE    
3089 N NZ    . LYS C 339 ? 0.5578 0.7044 0.9206 -0.0816 -0.0269 -0.0530 635 LYS A NZ    
3090 N N     . ILE C 340 ? 0.5019 0.6286 0.8336 -0.0270 0.0014  -0.0323 636 ILE A N     
3091 C CA    . ILE C 340 ? 0.4232 0.5489 0.7556 -0.0221 0.0119  -0.0311 636 ILE A CA    
3092 C C     . ILE C 340 ? 0.3395 0.4517 0.6545 -0.0227 0.0220  -0.0295 636 ILE A C     
3093 O O     . ILE C 340 ? 0.2666 0.3767 0.5807 -0.0221 0.0336  -0.0292 636 ILE A O     
3094 C CB    . ILE C 340 ? 0.4387 0.5674 0.7721 -0.0135 0.0056  -0.0294 636 ILE A CB    
3095 C CG1   . ILE C 340 ? 0.3947 0.5383 0.7495 -0.0118 0.0015  -0.0305 636 ILE A CG1   
3096 C CG2   . ILE C 340 ? 0.4069 0.5278 0.7304 -0.0085 0.0154  -0.0281 636 ILE A CG2   
3097 C CD1   . ILE C 340 ? 0.5971 0.7433 0.9534 -0.0036 -0.0068 -0.0283 636 ILE A CD1   
3098 N N     . ARG C 341 ? 0.3868 0.4899 0.6872 -0.0238 0.0178  -0.0286 637 ARG A N     
3099 C CA    . ARG C 341 ? 0.3680 0.4593 0.6526 -0.0243 0.0269  -0.0266 637 ARG A CA    
3100 C C     . ARG C 341 ? 0.2625 0.3496 0.5479 -0.0311 0.0374  -0.0269 637 ARG A C     
3101 O O     . ARG C 341 ? 0.3321 0.4099 0.6051 -0.0312 0.0469  -0.0246 637 ARG A O     
3102 C CB    . ARG C 341 ? 0.2888 0.3723 0.5597 -0.0239 0.0197  -0.0257 637 ARG A CB    
3103 C CG    . ARG C 341 ? 0.3623 0.4465 0.6273 -0.0169 0.0121  -0.0243 637 ARG A CG    
3104 C CD    . ARG C 341 ? 0.4017 0.4824 0.6588 -0.0178 0.0012  -0.0245 637 ARG A CD    
3105 N NE    . ARG C 341 ? 0.4128 0.4928 0.6623 -0.0114 -0.0052 -0.0226 637 ARG A NE    
3106 C CZ    . ARG C 341 ? 0.4127 0.4856 0.6483 -0.0089 -0.0037 -0.0208 637 ARG A CZ    
3107 N NH1   . ARG C 341 ? 0.3972 0.4603 0.6186 -0.0112 0.0037  -0.0200 637 ARG A NH1   
3108 N NH2   . ARG C 341 ? 0.5182 0.5900 0.7468 -0.0034 -0.0095 -0.0191 637 ARG A NH2   
3109 N N     . GLN C 342 ? 0.2554 0.3489 0.5543 -0.0369 0.0358  -0.0294 638 GLN A N     
3110 C CA    . GLN C 342 ? 0.2590 0.3482 0.5593 -0.0436 0.0465  -0.0295 638 GLN A CA    
3111 C C     . GLN C 342 ? 0.3402 0.4309 0.6424 -0.0418 0.0588  -0.0284 638 GLN A C     
3112 O O     . GLN C 342 ? 0.2412 0.3250 0.5385 -0.0463 0.0695  -0.0271 638 GLN A O     
3113 C CB    . GLN C 342 ? 0.2874 0.3848 0.6032 -0.0506 0.0419  -0.0329 638 GLN A CB    
3114 C CG    . GLN C 342 ? 0.4156 0.5087 0.7268 -0.0550 0.0318  -0.0347 638 GLN A CG    
3115 C CD    . GLN C 342 ? 0.4549 0.5577 0.7814 -0.0623 0.0265  -0.0385 638 GLN A CD    
3116 O OE1   . GLN C 342 ? 0.5159 0.6321 0.8595 -0.0624 0.0275  -0.0396 638 GLN A OE1   
3117 N NE2   . GLN C 342 ? 0.4955 0.5914 0.8158 -0.0685 0.0208  -0.0407 638 GLN A NE2   
3118 N N     . ALA C 343 ? 0.3388 0.4373 0.6469 -0.0354 0.0575  -0.0288 639 ALA A N     
3119 C CA    . ALA C 343 ? 0.3710 0.4710 0.6806 -0.0336 0.0688  -0.0287 639 ALA A CA    
3120 C C     . ALA C 343 ? 0.2191 0.3076 0.5081 -0.0303 0.0763  -0.0259 639 ALA A C     
3121 O O     . ALA C 343 ? 0.2514 0.3386 0.5372 -0.0299 0.0868  -0.0256 639 ALA A O     
3122 C CB    . ALA C 343 ? 0.4035 0.5155 0.7279 -0.0281 0.0647  -0.0306 639 ALA A CB    
3123 N N     . PHE C 344 ? 0.1708 0.2515 0.4456 -0.0283 0.0710  -0.0238 640 PHE A N     
3124 C CA    . PHE C 344 ? 0.2315 0.3026 0.4866 -0.0253 0.0769  -0.0210 640 PHE A CA    
3125 C C     . PHE C 344 ? 0.2136 0.2737 0.4567 -0.0303 0.0836  -0.0178 640 PHE A C     
3126 O O     . PHE C 344 ? 0.1888 0.2440 0.4287 -0.0323 0.0783  -0.0168 640 PHE A O     
3127 C CB    . PHE C 344 ? 0.2993 0.3691 0.5468 -0.0198 0.0676  -0.0204 640 PHE A CB    
3128 C CG    . PHE C 344 ? 0.3640 0.4417 0.6205 -0.0145 0.0618  -0.0226 640 PHE A CG    
3129 C CD1   . PHE C 344 ? 0.3809 0.4564 0.6293 -0.0098 0.0662  -0.0227 640 PHE A CD1   
3130 C CD2   . PHE C 344 ? 0.3990 0.4853 0.6712 -0.0142 0.0520  -0.0244 640 PHE A CD2   
3131 C CE1   . PHE C 344 ? 0.3134 0.3942 0.5700 -0.0049 0.0615  -0.0244 640 PHE A CE1   
3132 C CE2   . PHE C 344 ? 0.3487 0.4410 0.6288 -0.0088 0.0469  -0.0254 640 PHE A CE2   
3133 C CZ    . PHE C 344 ? 0.2985 0.3875 0.5710 -0.0041 0.0520  -0.0254 640 PHE A CZ    
3134 N N     . VAL C 345 ? 0.2522 0.3075 0.4878 -0.0322 0.0954  -0.0160 641 VAL A N     
3135 C CA    . VAL C 345 ? 0.2382 0.2824 0.4635 -0.0374 0.1029  -0.0124 641 VAL A CA    
3136 C C     . VAL C 345 ? 0.2758 0.3099 0.4784 -0.0347 0.1102  -0.0078 641 VAL A C     
3137 O O     . VAL C 345 ? 0.2828 0.3202 0.4795 -0.0299 0.1107  -0.0086 641 VAL A O     
3138 C CB    . VAL C 345 ? 0.2249 0.2717 0.4611 -0.0433 0.1106  -0.0136 641 VAL A CB    
3139 C CG1   . VAL C 345 ? 0.2264 0.2834 0.4843 -0.0466 0.1026  -0.0179 641 VAL A CG1   
3140 C CG2   . VAL C 345 ? 0.2467 0.2991 0.4843 -0.0410 0.1182  -0.0150 641 VAL A CG2   
3141 N N     . PRO C 346 ? 0.3387 0.3601 0.5272 -0.0375 0.1156  -0.0027 642 PRO A N     
3142 C CA    . PRO C 346 ? 0.3110 0.3234 0.4767 -0.0351 0.1228  0.0024  642 PRO A CA    
3143 C C     . PRO C 346 ? 0.2543 0.2689 0.4174 -0.0362 0.1321  0.0016  642 PRO A C     
3144 O O     . PRO C 346 ? 0.1986 0.2176 0.3753 -0.0404 0.1362  -0.0010 642 PRO A O     
3145 C CB    . PRO C 346 ? 0.3214 0.3187 0.4752 -0.0382 0.1262  0.0085  642 PRO A CB    
3146 C CG    . PRO C 346 ? 0.2543 0.2528 0.4234 -0.0413 0.1187  0.0055  642 PRO A CG    
3147 C CD    . PRO C 346 ? 0.2488 0.2625 0.4402 -0.0429 0.1149  -0.0014 642 PRO A CD    
3148 N N     . SER C 347 ? 0.2272 0.2391 0.3724 -0.0326 0.1357  0.0035  643 SER A N     
3149 C CA    . SER C 347 ? 0.2665 0.2803 0.4077 -0.0336 0.1445  0.0020  643 SER A CA    
3150 C C     . SER C 347 ? 0.4187 0.4216 0.5455 -0.0380 0.1545  0.0074  643 SER A C     
3151 O O     . SER C 347 ? 0.3140 0.3174 0.4353 -0.0394 0.1628  0.0066  643 SER A O     
3152 C CB    . SER C 347 ? 0.2805 0.2961 0.4078 -0.0286 0.1438  0.0007  643 SER A CB    
3153 O OG    . SER C 347 ? 0.2875 0.2940 0.3919 -0.0265 0.1431  0.0065  643 SER A OG    
3154 N N     . GLU C 348 ? 0.3731 0.3652 0.4933 -0.0401 0.1542  0.0130  644 GLU A N     
3155 C CA    . GLU C 348 ? 0.4178 0.3973 0.5229 -0.0439 0.1630  0.0191  644 GLU A CA    
3156 C C     . GLU C 348 ? 0.4055 0.3777 0.5194 -0.0484 0.1622  0.0211  644 GLU A C     
3157 O O     . GLU C 348 ? 0.4585 0.4316 0.5816 -0.0474 0.1540  0.0197  644 GLU A O     
3158 C CB    . GLU C 348 ? 0.4591 0.4276 0.5350 -0.0400 0.1639  0.0265  644 GLU A CB    
3159 C CG    . GLU C 348 ? 0.7210 0.6969 0.7875 -0.0352 0.1617  0.0239  644 GLU A CG    
3160 C CD    . GLU C 348 ? 0.9032 0.8699 0.9398 -0.0332 0.1652  0.0305  644 GLU A CD    
3161 O OE1   . GLU C 348 ? 0.9840 0.9404 1.0085 -0.0363 0.1719  0.0362  644 GLU A OE1   
3162 O OE2   . GLU C 348 ? 0.9352 0.9051 0.9599 -0.0287 0.1607  0.0300  644 GLU A OE2   
3163 N N     . SER C 349 ? 0.4597 0.4239 0.5697 -0.0537 0.1708  0.0241  645 SER A N     
3164 C CA    . SER C 349 ? 0.4639 0.4191 0.5803 -0.0587 0.1710  0.0258  645 SER A CA    
3165 C C     . SER C 349 ? 0.4650 0.4040 0.5630 -0.0553 0.1675  0.0331  645 SER A C     
3166 O O     . SER C 349 ? 0.4128 0.3441 0.4882 -0.0506 0.1688  0.0395  645 SER A O     
3167 C CB    . SER C 349 ? 0.5518 0.5018 0.6673 -0.0653 0.1819  0.0276  645 SER A CB    
3168 O OG    . SER C 349 ? 0.7399 0.6823 0.8320 -0.0635 0.1891  0.0334  645 SER A OG    
3169 N N     . ASP C 350 ? 0.3777 0.3118 0.4853 -0.0574 0.1626  0.0320  646 ASP A N     
3170 C CA    . ASP C 350 ? 0.4580 0.3763 0.5510 -0.0538 0.1588  0.0381  646 ASP A CA    
3171 C C     . ASP C 350 ? 0.4054 0.3278 0.4914 -0.0460 0.1513  0.0390  646 ASP A C     
3172 O O     . ASP C 350 ? 0.3916 0.3015 0.4607 -0.0408 0.1491  0.0457  646 ASP A O     
3173 C CB    . ASP C 350 ? 0.6516 0.5519 0.7215 -0.0533 0.1661  0.0475  646 ASP A CB    
3174 C CG    . ASP C 350 ? 0.8294 0.7237 0.9053 -0.0614 0.1740  0.0472  646 ASP A CG    
3175 O OD1   . ASP C 350 ? 0.8638 0.7626 0.9598 -0.0671 0.1721  0.0409  646 ASP A OD1   
3176 O OD2   . ASP C 350 ? 0.9230 0.8083 0.9833 -0.0624 0.1820  0.0533  646 ASP A OD2   
3177 N N     . TRP C 351 ? 0.3844 0.3240 0.4829 -0.0446 0.1473  0.0327  647 TRP A N     
3178 C CA    . TRP C 351 ? 0.3104 0.2558 0.4071 -0.0385 0.1394  0.0320  647 TRP A CA    
3179 C C     . TRP C 351 ? 0.2426 0.1961 0.3607 -0.0404 0.1310  0.0251  647 TRP A C     
3180 O O     . TRP C 351 ? 0.3892 0.3481 0.5249 -0.0460 0.1307  0.0197  647 TRP A O     
3181 C CB    . TRP C 351 ? 0.3268 0.2848 0.4202 -0.0350 0.1400  0.0297  647 TRP A CB    
3182 C CG    . TRP C 351 ? 0.3355 0.2860 0.4034 -0.0319 0.1454  0.0365  647 TRP A CG    
3183 C CD1   . TRP C 351 ? 0.4039 0.3420 0.4570 -0.0341 0.1527  0.0427  647 TRP A CD1   
3184 C CD2   . TRP C 351 ? 0.2453 0.2006 0.2986 -0.0263 0.1431  0.0377  647 TRP A CD2   
3185 N NE1   . TRP C 351 ? 0.3283 0.2634 0.3580 -0.0301 0.1544  0.0479  647 TRP A NE1   
3186 C CE2   . TRP C 351 ? 0.3187 0.2645 0.3480 -0.0254 0.1486  0.0446  647 TRP A CE2   
3187 C CE3   . TRP C 351 ? 0.3215 0.2883 0.3791 -0.0220 0.1360  0.0332  647 TRP A CE3   
3188 C CZ2   . TRP C 351 ? 0.3778 0.3258 0.3873 -0.0208 0.1472  0.0470  647 TRP A CZ2   
3189 C CZ3   . TRP C 351 ? 0.3871 0.3556 0.4252 -0.0173 0.1340  0.0348  647 TRP A CZ3   
3190 C CH2   . TRP C 351 ? 0.4284 0.3879 0.4430 -0.0172 0.1410  0.0420  647 TRP A CH2   
3191 N N     . LEU C 352 ? 0.2807 0.2357 0.3955 -0.0350 0.1224  0.0249  648 LEU A N     
3192 C CA    . LEU C 352 ? 0.2456 0.2078 0.3757 -0.0354 0.1118  0.0183  648 LEU A CA    
3193 C C     . LEU C 352 ? 0.2241 0.1983 0.3526 -0.0286 0.1024  0.0151  648 LEU A C     
3194 O O     . LEU C 352 ? 0.2946 0.2687 0.4072 -0.0229 0.1024  0.0185  648 LEU A O     
3195 C CB    . LEU C 352 ? 0.2124 0.1599 0.3355 -0.0349 0.1073  0.0199  648 LEU A CB    
3196 C CG    . LEU C 352 ? 0.2822 0.2147 0.4069 -0.0423 0.1162  0.0226  648 LEU A CG    
3197 C CD1   . LEU C 352 ? 0.3846 0.3007 0.5003 -0.0404 0.1118  0.0239  648 LEU A CD1   
3198 C CD2   . LEU C 352 ? 0.3141 0.2574 0.4603 -0.0502 0.1164  0.0154  648 LEU A CD2   
3199 N N     . ILE C 353 ? 0.2096 0.1942 0.3548 -0.0297 0.0943  0.0087  649 ILE A N     
3200 C CA    . ILE C 353 ? 0.1674 0.1614 0.3119 -0.0239 0.0845  0.0057  649 ILE A CA    
3201 C C     . ILE C 353 ? 0.2954 0.2814 0.4278 -0.0199 0.0760  0.0067  649 ILE A C     
3202 O O     . ILE C 353 ? 0.2361 0.2157 0.3723 -0.0231 0.0733  0.0051  649 ILE A O     
3203 C CB    . ILE C 353 ? 0.2525 0.2609 0.4199 -0.0265 0.0795  -0.0008 649 ILE A CB    
3204 C CG1   . ILE C 353 ? 0.2041 0.2215 0.3854 -0.0297 0.0891  -0.0021 649 ILE A CG1   
3205 C CG2   . ILE C 353 ? 0.2790 0.2945 0.4441 -0.0205 0.0693  -0.0031 649 ILE A CG2   
3206 C CD1   . ILE C 353 ? 0.1966 0.2147 0.3650 -0.0252 0.0949  0.0001  649 ILE A CD1   
3207 N N     . PHE C 354 ? 0.2572 0.2438 0.3752 -0.0132 0.0722  0.0088  650 PHE A N     
3208 C CA    . PHE C 354 ? 0.2556 0.2373 0.3632 -0.0087 0.0645  0.0094  650 PHE A CA    
3209 C C     . PHE C 354 ? 0.2021 0.1946 0.3128 -0.0057 0.0561  0.0055  650 PHE A C     
3210 O O     . PHE C 354 ? 0.2352 0.2351 0.3447 -0.0037 0.0570  0.0054  650 PHE A O     
3211 C CB    . PHE C 354 ? 0.3108 0.2845 0.3994 -0.0034 0.0673  0.0159  650 PHE A CB    
3212 C CG    . PHE C 354 ? 0.2371 0.2057 0.3166 0.0015  0.0611  0.0168  650 PHE A CG    
3213 C CD1   . PHE C 354 ? 0.2990 0.2540 0.3739 0.0019  0.0632  0.0193  650 PHE A CD1   
3214 C CD2   . PHE C 354 ? 0.3307 0.3075 0.4066 0.0058  0.0541  0.0150  650 PHE A CD2   
3215 C CE1   . PHE C 354 ? 0.1731 0.1236 0.2404 0.0070  0.0585  0.0197  650 PHE A CE1   
3216 C CE2   . PHE C 354 ? 0.2856 0.2587 0.3541 0.0103  0.0495  0.0155  650 PHE A CE2   
3217 C CZ    . PHE C 354 ? 0.2733 0.2337 0.3378 0.0112  0.0518  0.0177  650 PHE A CZ    
3218 N N     . ALA C 355 ? 0.1829 0.1752 0.2965 -0.0059 0.0483  0.0023  651 ALA A N     
3219 C CA    . ALA C 355 ? 0.1811 0.1821 0.2973 -0.0037 0.0403  -0.0009 651 ALA A CA    
3220 C C     . ALA C 355 ? 0.2860 0.2821 0.3908 -0.0004 0.0345  -0.0009 651 ALA A C     
3221 O O     . ALA C 355 ? 0.3253 0.3138 0.4291 -0.0023 0.0331  -0.0022 651 ALA A O     
3222 C CB    . ALA C 355 ? 0.1975 0.2059 0.3313 -0.0079 0.0359  -0.0056 651 ALA A CB    
3223 N N     . ALA C 356 ? 0.2512 0.2514 0.3477 0.0040  0.0316  0.0000  652 ALA A N     
3224 C CA    . ALA C 356 ? 0.2599 0.2576 0.3464 0.0072  0.0270  -0.0001 652 ALA A CA    
3225 C C     . ALA C 356 ? 0.2785 0.2836 0.3666 0.0077  0.0206  -0.0026 652 ALA A C     
3226 O O     . ALA C 356 ? 0.2327 0.2441 0.3229 0.0085  0.0211  -0.0024 652 ALA A O     
3227 C CB    . ALA C 356 ? 0.1636 0.1592 0.2380 0.0120  0.0302  0.0043  652 ALA A CB    
3228 N N     . ASP C 357 ? 0.2468 0.2499 0.3327 0.0071  0.0150  -0.0050 653 ASP A N     
3229 C CA    . ASP C 357 ? 0.2838 0.2919 0.3697 0.0073  0.0088  -0.0066 653 ASP A CA    
3230 C C     . ASP C 357 ? 0.2590 0.2642 0.3331 0.0093  0.0064  -0.0068 653 ASP A C     
3231 O O     . ASP C 357 ? 0.2496 0.2482 0.3189 0.0092  0.0070  -0.0078 653 ASP A O     
3232 C CB    . ASP C 357 ? 0.3982 0.4081 0.4944 0.0037  0.0033  -0.0096 653 ASP A CB    
3233 C CG    . ASP C 357 ? 0.8745 0.8779 0.9679 0.0009  0.0004  -0.0121 653 ASP A CG    
3234 O OD1   . ASP C 357 ? 1.0777 1.0748 1.1703 -0.0002 0.0052  -0.0121 653 ASP A OD1   
3235 O OD2   . ASP C 357 ? 1.0333 1.0367 1.1239 -0.0003 -0.0065 -0.0142 653 ASP A OD2   
3236 N N     . TYR C 358 ? 0.1423 0.1520 0.2119 0.0110  0.0045  -0.0062 654 TYR A N     
3237 C CA    . TYR C 358 ? 0.1640 0.1721 0.2237 0.0120  0.0023  -0.0068 654 TYR A CA    
3238 C C     . TYR C 358 ? 0.2496 0.2536 0.3081 0.0091  -0.0032 -0.0095 654 TYR A C     
3239 O O     . TYR C 358 ? 0.2753 0.2812 0.3408 0.0069  -0.0077 -0.0103 654 TYR A O     
3240 C CB    . TYR C 358 ? 0.1401 0.1537 0.1965 0.0128  0.0013  -0.0057 654 TYR A CB    
3241 C CG    . TYR C 358 ? 0.1764 0.1945 0.2307 0.0153  0.0058  -0.0036 654 TYR A CG    
3242 C CD1   . TYR C 358 ? 0.1646 0.1868 0.2229 0.0150  0.0073  -0.0030 654 TYR A CD1   
3243 C CD2   . TYR C 358 ? 0.1595 0.1780 0.2080 0.0181  0.0083  -0.0025 654 TYR A CD2   
3244 C CE1   . TYR C 358 ? 0.2595 0.2862 0.3143 0.0167  0.0105  -0.0014 654 TYR A CE1   
3245 C CE2   . TYR C 358 ? 0.1143 0.1385 0.1612 0.0205  0.0111  -0.0002 654 TYR A CE2   
3246 C CZ    . TYR C 358 ? 0.2250 0.2531 0.2742 0.0194  0.0118  0.0002  654 TYR A CZ    
3247 O OH    . TYR C 358 ? 0.2221 0.2560 0.2680 0.0211  0.0137  0.0022  654 TYR A OH    
3248 N N     . SER C 359 ? 0.2014 0.2001 0.2511 0.0094  -0.0027 -0.0110 655 SER A N     
3249 C CA    . SER C 359 ? 0.2557 0.2498 0.3000 0.0065  -0.0078 -0.0140 655 SER A CA    
3250 C C     . SER C 359 ? 0.1500 0.1458 0.1850 0.0068  -0.0101 -0.0133 655 SER A C     
3251 O O     . SER C 359 ? 0.2096 0.2055 0.2372 0.0089  -0.0061 -0.0130 655 SER A O     
3252 C CB    . SER C 359 ? 0.3498 0.3355 0.3883 0.0062  -0.0050 -0.0170 655 SER A CB    
3253 O OG    . SER C 359 ? 0.4029 0.3837 0.4348 0.0025  -0.0102 -0.0207 655 SER A OG    
3254 N N     . GLN C 360 ? 0.1755 0.1728 0.2117 0.0048  -0.0163 -0.0127 656 GLN A N     
3255 C CA    . GLN C 360 ? 0.2875 0.2840 0.3136 0.0042  -0.0192 -0.0116 656 GLN A CA    
3256 C C     . GLN C 360 ? 0.2899 0.2904 0.3137 0.0062  -0.0141 -0.0094 656 GLN A C     
3257 O O     . GLN C 360 ? 0.2143 0.2136 0.2279 0.0059  -0.0122 -0.0095 656 GLN A O     
3258 C CB    . GLN C 360 ? 0.4596 0.4494 0.4722 0.0022  -0.0205 -0.0144 656 GLN A CB    
3259 C CG    . GLN C 360 ? 0.7121 0.6978 0.7274 0.0001  -0.0226 -0.0180 656 GLN A CG    
3260 C CD    . GLN C 360 ? 1.0744 1.0539 1.0772 -0.0035 -0.0282 -0.0209 656 GLN A CD    
3261 O OE1   . GLN C 360 ? 1.1923 1.1661 1.1823 -0.0039 -0.0246 -0.0236 656 GLN A OE1   
3262 N NE2   . GLN C 360 ? 1.3115 1.2925 1.3181 -0.0061 -0.0371 -0.0207 656 GLN A NE2   
3263 N N     . ILE C 361 ? 0.2440 0.2497 0.2772 0.0078  -0.0118 -0.0079 657 ILE A N     
3264 C CA    . ILE C 361 ? 0.3143 0.3247 0.3459 0.0090  -0.0075 -0.0064 657 ILE A CA    
3265 C C     . ILE C 361 ? 0.1449 0.1543 0.1702 0.0070  -0.0097 -0.0052 657 ILE A C     
3266 O O     . ILE C 361 ? 0.1748 0.1865 0.1943 0.0065  -0.0064 -0.0049 657 ILE A O     
3267 C CB    . ILE C 361 ? 0.1540 0.1692 0.1949 0.0104  -0.0050 -0.0056 657 ILE A CB    
3268 C CG1   . ILE C 361 ? 0.2132 0.2344 0.2517 0.0112  -0.0011 -0.0048 657 ILE A CG1   
3269 C CG2   . ILE C 361 ? 0.1754 0.1903 0.2238 0.0096  -0.0083 -0.0051 657 ILE A CG2   
3270 C CD1   . ILE C 361 ? 0.2446 0.2702 0.2889 0.0126  0.0018  -0.0042 657 ILE A CD1   
3271 N N     . GLU C 362 ? 0.1620 0.1677 0.1888 0.0059  -0.0150 -0.0041 658 GLU A N     
3272 C CA    . GLU C 362 ? 0.2109 0.2132 0.2308 0.0042  -0.0170 -0.0020 658 GLU A CA    
3273 C C     . GLU C 362 ? 0.2165 0.2152 0.2224 0.0022  -0.0163 -0.0021 658 GLU A C     
3274 O O     . GLU C 362 ? 0.2412 0.2400 0.2408 0.0004  -0.0131 -0.0011 658 GLU A O     
3275 C CB    . GLU C 362 ? 0.2148 0.2133 0.2391 0.0045  -0.0237 -0.0001 658 GLU A CB    
3276 C CG    . GLU C 362 ? 0.2900 0.2921 0.3288 0.0066  -0.0232 -0.0003 658 GLU A CG    
3277 C CD    . GLU C 362 ? 0.4266 0.4329 0.4755 0.0077  -0.0229 -0.0024 658 GLU A CD    
3278 O OE1   . GLU C 362 ? 0.4279 0.4377 0.4885 0.0091  -0.0211 -0.0029 658 GLU A OE1   
3279 O OE2   . GLU C 362 ? 0.3899 0.3953 0.4347 0.0067  -0.0238 -0.0039 658 GLU A OE2   
3280 N N     . LEU C 363 ? 0.2457 0.2409 0.2463 0.0018  -0.0188 -0.0038 659 LEU A N     
3281 C CA    . LEU C 363 ? 0.2634 0.2544 0.2493 -0.0002 -0.0172 -0.0047 659 LEU A CA    
3282 C C     . LEU C 363 ? 0.2309 0.2269 0.2160 0.0009  -0.0091 -0.0066 659 LEU A C     
3283 O O     . LEU C 363 ? 0.2030 0.1984 0.1785 -0.0008 -0.0054 -0.0066 659 LEU A O     
3284 C CB    . LEU C 363 ? 0.1859 0.1713 0.1656 -0.0012 -0.0219 -0.0070 659 LEU A CB    
3285 C CG    . LEU C 363 ? 0.3219 0.3024 0.2975 -0.0029 -0.0312 -0.0048 659 LEU A CG    
3286 C CD1   . LEU C 363 ? 0.3098 0.2870 0.2816 -0.0044 -0.0362 -0.0083 659 LEU A CD1   
3287 C CD2   . LEU C 363 ? 0.4348 0.4096 0.3949 -0.0051 -0.0316 -0.0016 659 LEU A CD2   
3288 N N     . ARG C 364 ? 0.1826 0.1839 0.1780 0.0039  -0.0061 -0.0079 660 ARG A N     
3289 C CA    . ARG C 364 ? 0.2338 0.2414 0.2305 0.0060  0.0007  -0.0088 660 ARG A CA    
3290 C C     . ARG C 364 ? 0.2064 0.2210 0.2055 0.0047  0.0030  -0.0069 660 ARG A C     
3291 O O     . ARG C 364 ? 0.2008 0.2199 0.1966 0.0041  0.0077  -0.0074 660 ARG A O     
3292 C CB    . ARG C 364 ? 0.1888 0.1992 0.1949 0.0098  0.0025  -0.0095 660 ARG A CB    
3293 C CG    . ARG C 364 ? 0.2370 0.2398 0.2405 0.0104  0.0017  -0.0121 660 ARG A CG    
3294 C CD    . ARG C 364 ? 0.2308 0.2341 0.2431 0.0136  0.0037  -0.0120 660 ARG A CD    
3295 N NE    . ARG C 364 ? 0.2817 0.2763 0.2921 0.0128  0.0027  -0.0149 660 ARG A NE    
3296 C CZ    . ARG C 364 ? 0.2809 0.2702 0.2866 0.0147  0.0068  -0.0175 660 ARG A CZ    
3297 N NH1   . ARG C 364 ? 0.2493 0.2425 0.2532 0.0183  0.0123  -0.0172 660 ARG A NH1   
3298 N NH2   . ARG C 364 ? 0.2746 0.2548 0.2783 0.0129  0.0057  -0.0208 660 ARG A NH2   
3299 N N     . VAL C 365 ? 0.1739 0.1893 0.1789 0.0039  0.0002  -0.0052 661 VAL A N     
3300 C CA    . VAL C 365 ? 0.1890 0.2090 0.1951 0.0015  0.0021  -0.0041 661 VAL A CA    
3301 C C     . VAL C 365 ? 0.1746 0.1897 0.1702 -0.0025 0.0027  -0.0031 661 VAL A C     
3302 O O     . VAL C 365 ? 0.2155 0.2358 0.2098 -0.0051 0.0070  -0.0032 661 VAL A O     
3303 C CB    . VAL C 365 ? 0.2139 0.2329 0.2269 0.0013  -0.0006 -0.0031 661 VAL A CB    
3304 C CG1   . VAL C 365 ? 0.1921 0.2109 0.2031 -0.0026 0.0005  -0.0023 661 VAL A CG1   
3305 C CG2   . VAL C 365 ? 0.2493 0.2753 0.2711 0.0042  0.0011  -0.0040 661 VAL A CG2   
3306 N N     . LEU C 366 ? 0.1831 0.1885 0.1707 -0.0035 -0.0016 -0.0019 662 LEU A N     
3307 C CA    . LEU C 366 ? 0.3440 0.3430 0.3189 -0.0074 -0.0011 -0.0001 662 LEU A CA    
3308 C C     . LEU C 366 ? 0.3191 0.3217 0.2872 -0.0083 0.0053  -0.0022 662 LEU A C     
3309 O O     . LEU C 366 ? 0.2398 0.2439 0.2031 -0.0119 0.0100  -0.0015 662 LEU A O     
3310 C CB    . LEU C 366 ? 0.3459 0.3343 0.3124 -0.0076 -0.0081 0.0019  662 LEU A CB    
3311 C CG    . LEU C 366 ? 0.3193 0.2992 0.2689 -0.0115 -0.0080 0.0044  662 LEU A CG    
3312 C CD1   . LEU C 366 ? 0.3138 0.2915 0.2620 -0.0149 -0.0052 0.0076  662 LEU A CD1   
3313 C CD2   . LEU C 366 ? 0.2345 0.2053 0.1761 -0.0111 -0.0166 0.0065  662 LEU A CD2   
3314 N N     . ALA C 367 ? 0.2269 0.2304 0.1951 -0.0052 0.0062  -0.0051 663 ALA A N     
3315 C CA    . ALA C 367 ? 0.2591 0.2662 0.2228 -0.0047 0.0131  -0.0078 663 ALA A CA    
3316 C C     . ALA C 367 ? 0.2231 0.2426 0.1959 -0.0048 0.0191  -0.0079 663 ALA A C     
3317 O O     . ALA C 367 ? 0.2985 0.3215 0.2669 -0.0073 0.0251  -0.0086 663 ALA A O     
3318 C CB    . ALA C 367 ? 0.1668 0.1733 0.1334 -0.0003 0.0135  -0.0111 663 ALA A CB    
3319 N N     . HIS C 368 ? 0.2453 0.2725 0.2309 -0.0023 0.0176  -0.0075 664 HIS A N     
3320 C CA    . HIS C 368 ? 0.2516 0.2923 0.2467 -0.0022 0.0217  -0.0079 664 HIS A CA    
3321 C C     . HIS C 368 ? 0.2349 0.2767 0.2278 -0.0086 0.0230  -0.0065 664 HIS A C     
3322 O O     . HIS C 368 ? 0.2766 0.3269 0.2710 -0.0112 0.0285  -0.0074 664 HIS A O     
3323 C CB    . HIS C 368 ? 0.2243 0.2710 0.2306 0.0016  0.0189  -0.0075 664 HIS A CB    
3324 C CG    . HIS C 368 ? 0.2455 0.3057 0.2606 0.0005  0.0206  -0.0075 664 HIS A CG    
3325 N ND1   . HIS C 368 ? 0.2515 0.3247 0.2739 0.0037  0.0241  -0.0084 664 HIS A ND1   
3326 C CD2   . HIS C 368 ? 0.2920 0.3548 0.3100 -0.0036 0.0188  -0.0070 664 HIS A CD2   
3327 C CE1   . HIS C 368 ? 0.2928 0.3775 0.3224 0.0012  0.0238  -0.0084 664 HIS A CE1   
3328 N NE2   . HIS C 368 ? 0.2687 0.3466 0.2950 -0.0036 0.0208  -0.0079 664 HIS A NE2   
3329 N N     . ILE C 369 ? 0.1898 0.2228 0.1797 -0.0112 0.0184  -0.0045 665 ILE A N     
3330 C CA    . ILE C 369 ? 0.2087 0.2404 0.1967 -0.0174 0.0197  -0.0031 665 ILE A CA    
3331 C C     . ILE C 369 ? 0.3537 0.3788 0.3290 -0.0219 0.0236  -0.0019 665 ILE A C     
3332 O O     . ILE C 369 ? 0.2777 0.3071 0.2529 -0.0273 0.0286  -0.0018 665 ILE A O     
3333 C CB    . ILE C 369 ? 0.2924 0.3145 0.2808 -0.0179 0.0142  -0.0012 665 ILE A CB    
3334 C CG1   . ILE C 369 ? 0.2848 0.3146 0.2851 -0.0147 0.0123  -0.0029 665 ILE A CG1   
3335 C CG2   . ILE C 369 ? 0.5169 0.5331 0.5008 -0.0243 0.0159  0.0006  665 ILE A CG2   
3336 C CD1   . ILE C 369 ? 0.5041 0.5254 0.5063 -0.0145 0.0081  -0.0018 665 ILE A CD1   
3337 N N     . ALA C 370 ? 0.3625 0.3773 0.3265 -0.0204 0.0214  -0.0009 666 ALA A N     
3338 C CA    . ALA C 370 ? 0.4323 0.4396 0.3811 -0.0248 0.0252  0.0005  666 ALA A CA    
3339 C C     . ALA C 370 ? 0.4257 0.4419 0.3741 -0.0246 0.0333  -0.0028 666 ALA A C     
3340 O O     . ALA C 370 ? 0.4072 0.4204 0.3449 -0.0293 0.0390  -0.0022 666 ALA A O     
3341 C CB    . ALA C 370 ? 0.2786 0.2714 0.2136 -0.0238 0.0189  0.0027  666 ALA A CB    
3342 N N     . GLU C 371 ? 0.3185 0.3453 0.2783 -0.0190 0.0344  -0.0061 667 GLU A N     
3343 C CA    . GLU C 371 ? 0.3415 0.3764 0.3024 -0.0170 0.0421  -0.0095 667 GLU A CA    
3344 C C     . GLU C 371 ? 0.3778 0.4008 0.3202 -0.0188 0.0448  -0.0102 667 GLU A C     
3345 O O     . GLU C 371 ? 0.3594 0.3851 0.2963 -0.0215 0.0532  -0.0118 667 GLU A O     
3346 C CB    . GLU C 371 ? 0.3923 0.4420 0.3631 -0.0204 0.0491  -0.0102 667 GLU A CB    
3347 C CG    . GLU C 371 ? 0.4103 0.4740 0.3992 -0.0180 0.0463  -0.0105 667 GLU A CG    
3348 C CD    . GLU C 371 ? 0.6437 0.7236 0.6433 -0.0223 0.0520  -0.0115 667 GLU A CD    
3349 O OE1   . GLU C 371 ? 0.7476 0.8261 0.7464 -0.0294 0.0516  -0.0101 667 GLU A OE1   
3350 O OE2   . GLU C 371 ? 0.6841 0.7782 0.6938 -0.0186 0.0570  -0.0139 667 GLU A OE2   
3351 N N     . ASP C 372 ? 0.3099 0.3199 0.2423 -0.0178 0.0376  -0.0093 668 ASP A N     
3352 C CA    . ASP C 372 ? 0.3370 0.3348 0.2499 -0.0195 0.0382  -0.0103 668 ASP A CA    
3353 C C     . ASP C 372 ? 0.4159 0.4157 0.3302 -0.0145 0.0422  -0.0158 668 ASP A C     
3354 O O     . ASP C 372 ? 0.2852 0.2851 0.2079 -0.0097 0.0376  -0.0173 668 ASP A O     
3355 C CB    . ASP C 372 ? 0.3585 0.3434 0.2620 -0.0204 0.0276  -0.0071 668 ASP A CB    
3356 C CG    . ASP C 372 ? 0.4457 0.4182 0.3276 -0.0226 0.0265  -0.0081 668 ASP A CG    
3357 O OD1   . ASP C 372 ? 0.4469 0.4177 0.3264 -0.0198 0.0268  -0.0129 668 ASP A OD1   
3358 O OD2   . ASP C 372 ? 0.4938 0.4574 0.3600 -0.0274 0.0254  -0.0041 668 ASP A OD2   
3359 N N     . ASP C 373 ? 0.4048 0.4058 0.3114 -0.0157 0.0517  -0.0189 669 ASP A N     
3360 C CA    . ASP C 373 ? 0.4343 0.4369 0.3433 -0.0104 0.0573  -0.0247 669 ASP A CA    
3361 C C     . ASP C 373 ? 0.4018 0.3911 0.3008 -0.0089 0.0507  -0.0271 669 ASP A C     
3362 O O     . ASP C 373 ? 0.3961 0.3863 0.3048 -0.0034 0.0499  -0.0299 669 ASP A O     
3363 C CB    . ASP C 373 ? 0.4800 0.4837 0.3793 -0.0126 0.0692  -0.0280 669 ASP A CB    
3364 C CG    . ASP C 373 ? 0.5937 0.6125 0.5049 -0.0149 0.0765  -0.0261 669 ASP A CG    
3365 O OD1   . ASP C 373 ? 0.6168 0.6474 0.5468 -0.0129 0.0732  -0.0238 669 ASP A OD1   
3366 O OD2   . ASP C 373 ? 0.6358 0.6547 0.5373 -0.0193 0.0857  -0.0273 669 ASP A OD2   
3367 N N     . ASN C 374 ? 0.3554 0.3321 0.2349 -0.0140 0.0455  -0.0258 670 ASN A N     
3368 C CA    . ASN C 374 ? 0.4418 0.4068 0.3113 -0.0137 0.0384  -0.0287 670 ASN A CA    
3369 C C     . ASN C 374 ? 0.3763 0.3437 0.2618 -0.0104 0.0293  -0.0269 670 ASN A C     
3370 O O     . ASN C 374 ? 0.3033 0.2669 0.1919 -0.0077 0.0273  -0.0309 670 ASN A O     
3371 C CB    . ASN C 374 ? 0.4633 0.4162 0.3093 -0.0198 0.0329  -0.0264 670 ASN A CB    
3372 C CG    . ASN C 374 ? 0.8611 0.8022 0.6900 -0.0211 0.0305  -0.0322 670 ASN A CG    
3373 O OD1   . ASN C 374 ? 1.0014 0.9416 0.8307 -0.0185 0.0377  -0.0388 670 ASN A OD1   
3374 N ND2   . ASN C 374 ? 0.9808 0.9127 0.7945 -0.0251 0.0201  -0.0297 670 ASN A ND2   
3375 N N     . LEU C 375 ? 0.3422 0.3151 0.2378 -0.0109 0.0243  -0.0213 671 LEU A N     
3376 C CA    . LEU C 375 ? 0.3004 0.2758 0.2109 -0.0080 0.0167  -0.0197 671 LEU A CA    
3377 C C     . LEU C 375 ? 0.2568 0.2414 0.1849 -0.0024 0.0215  -0.0216 671 LEU A C     
3378 O O     . LEU C 375 ? 0.3190 0.3021 0.2550 0.0004  0.0180  -0.0229 671 LEU A O     
3379 C CB    . LEU C 375 ? 0.3033 0.2809 0.2188 -0.0099 0.0110  -0.0138 671 LEU A CB    
3380 C CG    . LEU C 375 ? 0.3333 0.3111 0.2607 -0.0080 0.0023  -0.0120 671 LEU A CG    
3381 C CD1   . LEU C 375 ? 0.3995 0.3692 0.3199 -0.0086 -0.0045 -0.0144 671 LEU A CD1   
3382 C CD2   . LEU C 375 ? 0.4231 0.4004 0.3522 -0.0099 -0.0023 -0.0065 671 LEU A CD2   
3383 N N     . MET C 376 ? 0.2673 0.2618 0.2021 -0.0009 0.0293  -0.0214 672 MET A N     
3384 C CA    . MET C 376 ? 0.2659 0.2698 0.2169 0.0052  0.0331  -0.0225 672 MET A CA    
3385 C C     . MET C 376 ? 0.2907 0.2881 0.2389 0.0091  0.0370  -0.0274 672 MET A C     
3386 O O     . MET C 376 ? 0.2801 0.2778 0.2384 0.0138  0.0360  -0.0278 672 MET A O     
3387 C CB    . MET C 376 ? 0.2434 0.2610 0.2030 0.0059  0.0401  -0.0215 672 MET A CB    
3388 C CG    . MET C 376 ? 0.3267 0.3508 0.2910 0.0019  0.0370  -0.0173 672 MET A CG    
3389 S SD    . MET C 376 ? 0.4361 0.4789 0.4137 0.0024  0.0446  -0.0172 672 MET A SD    
3390 C CE    . MET C 376 ? 0.5176 0.5581 0.4824 -0.0009 0.0542  -0.0201 672 MET A CE    
3391 N N     . GLU C 377 ? 0.3345 0.3249 0.2680 0.0070  0.0419  -0.0314 673 GLU A N     
3392 C CA    . GLU C 377 ? 0.3612 0.3435 0.2904 0.0103  0.0466  -0.0372 673 GLU A CA    
3393 C C     . GLU C 377 ? 0.3202 0.2909 0.2458 0.0090  0.0389  -0.0388 673 GLU A C     
3394 O O     . GLU C 377 ? 0.3177 0.2836 0.2485 0.0131  0.0408  -0.0418 673 GLU A O     
3395 C CB    . GLU C 377 ? 0.3746 0.3511 0.2865 0.0074  0.0540  -0.0416 673 GLU A CB    
3396 C CG    . GLU C 377 ? 0.4588 0.4244 0.3633 0.0101  0.0597  -0.0490 673 GLU A CG    
3397 C CD    . GLU C 377 ? 0.5525 0.5251 0.4726 0.0186  0.0688  -0.0508 673 GLU A CD    
3398 O OE1   . GLU C 377 ? 0.5293 0.5169 0.4661 0.0222  0.0700  -0.0463 673 GLU A OE1   
3399 O OE2   . GLU C 377 ? 0.4442 0.4071 0.3598 0.0217  0.0745  -0.0569 673 GLU A OE2   
3400 N N     . ALA C 378 ? 0.3317 0.2978 0.2490 0.0035  0.0301  -0.0367 674 ALA A N     
3401 C CA    . ALA C 378 ? 0.3227 0.2805 0.2393 0.0018  0.0221  -0.0382 674 ALA A CA    
3402 C C     . ALA C 378 ? 0.3458 0.3085 0.2815 0.0062  0.0206  -0.0361 674 ALA A C     
3403 O O     . ALA C 378 ? 0.3423 0.2979 0.2805 0.0071  0.0200  -0.0393 674 ALA A O     
3404 C CB    . ALA C 378 ? 0.3501 0.3055 0.2586 -0.0037 0.0120  -0.0351 674 ALA A CB    
3405 N N     . PHE C 379 ? 0.2338 0.2077 0.1820 0.0085  0.0205  -0.0308 675 PHE A N     
3406 C CA    . PHE C 379 ? 0.2869 0.2652 0.2509 0.0124  0.0195  -0.0284 675 PHE A CA    
3407 C C     . PHE C 379 ? 0.3019 0.2820 0.2728 0.0188  0.0273  -0.0297 675 PHE A C     
3408 O O     . PHE C 379 ? 0.3526 0.3296 0.3313 0.0219  0.0272  -0.0293 675 PHE A O     
3409 C CB    . PHE C 379 ? 0.2410 0.2299 0.2144 0.0122  0.0163  -0.0230 675 PHE A CB    
3410 C CG    . PHE C 379 ? 0.2949 0.2812 0.2666 0.0077  0.0080  -0.0210 675 PHE A CG    
3411 C CD1   . PHE C 379 ? 0.2829 0.2716 0.2496 0.0046  0.0056  -0.0182 675 PHE A CD1   
3412 C CD2   . PHE C 379 ? 0.1897 0.1712 0.1656 0.0067  0.0027  -0.0218 675 PHE A CD2   
3413 C CE1   . PHE C 379 ? 0.2205 0.2064 0.1865 0.0017  -0.0022 -0.0160 675 PHE A CE1   
3414 C CE2   . PHE C 379 ? 0.2606 0.2414 0.2373 0.0035  -0.0052 -0.0200 675 PHE A CE2   
3415 C CZ    . PHE C 379 ? 0.2267 0.2095 0.1985 0.0015  -0.0078 -0.0169 675 PHE A CZ    
3416 N N     . ARG C 380 ? 0.2695 0.2545 0.2382 0.0212  0.0343  -0.0308 676 ARG A N     
3417 C CA    . ARG C 380 ? 0.3750 0.3614 0.3508 0.0284  0.0417  -0.0321 676 ARG A CA    
3418 C C     . ARG C 380 ? 0.3604 0.3314 0.3296 0.0294  0.0443  -0.0375 676 ARG A C     
3419 O O     . ARG C 380 ? 0.3738 0.3416 0.3507 0.0355  0.0479  -0.0374 676 ARG A O     
3420 C CB    . ARG C 380 ? 0.2378 0.2339 0.2138 0.0304  0.0491  -0.0329 676 ARG A CB    
3421 C CG    . ARG C 380 ? 0.3238 0.3358 0.3094 0.0297  0.0471  -0.0279 676 ARG A CG    
3422 C CD    . ARG C 380 ? 0.3180 0.3400 0.3029 0.0289  0.0537  -0.0289 676 ARG A CD    
3423 N NE    . ARG C 380 ? 0.3106 0.3487 0.3073 0.0285  0.0520  -0.0246 676 ARG A NE    
3424 C CZ    . ARG C 380 ? 0.4755 0.5241 0.4732 0.0254  0.0561  -0.0245 676 ARG A CZ    
3425 N NH1   . ARG C 380 ? 0.4607 0.5053 0.4479 0.0226  0.0626  -0.0281 676 ARG A NH1   
3426 N NH2   . ARG C 380 ? 0.4278 0.4907 0.4366 0.0243  0.0540  -0.0213 676 ARG A NH2   
3427 N N     . ARG C 381 ? 0.2517 0.2122 0.2060 0.0234  0.0421  -0.0421 677 ARG A N     
3428 C CA    . ARG C 381 ? 0.3081 0.2529 0.2550 0.0226  0.0434  -0.0482 677 ARG A CA    
3429 C C     . ARG C 381 ? 0.2154 0.1545 0.1666 0.0192  0.0356  -0.0472 677 ARG A C     
3430 O O     . ARG C 381 ? 0.3603 0.2863 0.3060 0.0169  0.0356  -0.0524 677 ARG A O     
3431 C CB    . ARG C 381 ? 0.3166 0.2527 0.2439 0.0169  0.0444  -0.0543 677 ARG A CB    
3432 C CG    . ARG C 381 ? 0.3517 0.2925 0.2732 0.0192  0.0535  -0.0561 677 ARG A CG    
3433 C CD    . ARG C 381 ? 0.4379 0.3706 0.3373 0.0121  0.0530  -0.0607 677 ARG A CD    
3434 N NE    . ARG C 381 ? 0.6010 0.5174 0.4884 0.0088  0.0514  -0.0679 677 ARG A NE    
3435 C CZ    . ARG C 381 ? 0.6393 0.5463 0.5056 0.0019  0.0486  -0.0726 677 ARG A CZ    
3436 N NH1   . ARG C 381 ? 0.4992 0.4105 0.3533 -0.0021 0.0475  -0.0701 677 ARG A NH1   
3437 N NH2   . ARG C 381 ? 0.5843 0.4769 0.4408 -0.0015 0.0469  -0.0798 677 ARG A NH2   
3438 N N     . ASP C 382 ? 0.2705 0.2191 0.2316 0.0184  0.0296  -0.0412 678 ASP A N     
3439 C CA    . ASP C 382 ? 0.3216 0.2674 0.2887 0.0149  0.0225  -0.0399 678 ASP A CA    
3440 C C     . ASP C 382 ? 0.4844 0.4208 0.4401 0.0076  0.0167  -0.0451 678 ASP A C     
3441 O O     . ASP C 382 ? 0.3871 0.3155 0.3451 0.0048  0.0144  -0.0481 678 ASP A O     
3442 C CB    . ASP C 382 ? 0.4094 0.3502 0.3867 0.0192  0.0263  -0.0390 678 ASP A CB    
3443 C CG    . ASP C 382 ? 0.5526 0.4958 0.5402 0.0166  0.0207  -0.0354 678 ASP A CG    
3444 O OD1   . ASP C 382 ? 0.6134 0.5658 0.6039 0.0139  0.0149  -0.0323 678 ASP A OD1   
3445 O OD2   . ASP C 382 ? 0.6381 0.5735 0.6310 0.0172  0.0227  -0.0358 678 ASP A OD2   
3446 N N     . LEU C 383 ? 0.5374 0.4750 0.4806 0.0041  0.0140  -0.0461 679 LEU A N     
3447 C CA    . LEU C 383 ? 0.4382 0.3683 0.3687 -0.0028 0.0069  -0.0504 679 LEU A CA    
3448 C C     . LEU C 383 ? 0.3923 0.3278 0.3317 -0.0064 -0.0035 -0.0468 679 LEU A C     
3449 O O     . LEU C 383 ? 0.3478 0.2927 0.3006 -0.0038 -0.0047 -0.0410 679 LEU A O     
3450 C CB    . LEU C 383 ? 0.4251 0.3544 0.3377 -0.0053 0.0073  -0.0514 679 LEU A CB    
3451 C CG    . LEU C 383 ? 0.5158 0.4412 0.4197 -0.0020 0.0186  -0.0553 679 LEU A CG    
3452 C CD1   . LEU C 383 ? 0.5364 0.4618 0.4224 -0.0054 0.0192  -0.0554 679 LEU A CD1   
3453 C CD2   . LEU C 383 ? 0.5315 0.4433 0.4294 -0.0024 0.0228  -0.0634 679 LEU A CD2   
3454 N N     . ASP C 384 ? 0.3177 0.2476 0.2498 -0.0124 -0.0112 -0.0507 680 ASP A N     
3455 C CA    . ASP C 384 ? 0.3911 0.3277 0.3306 -0.0157 -0.0221 -0.0473 680 ASP A CA    
3456 C C     . ASP C 384 ? 0.2245 0.1654 0.1539 -0.0159 -0.0261 -0.0429 680 ASP A C     
3457 O O     . ASP C 384 ? 0.3007 0.2355 0.2112 -0.0192 -0.0280 -0.0455 680 ASP A O     
3458 C CB    . ASP C 384 ? 0.5213 0.4522 0.4575 -0.0223 -0.0299 -0.0530 680 ASP A CB    
3459 C CG    . ASP C 384 ? 0.6117 0.5517 0.5594 -0.0248 -0.0412 -0.0494 680 ASP A CG    
3460 O OD1   . ASP C 384 ? 0.7253 0.6678 0.6886 -0.0266 -0.0433 -0.0506 680 ASP A OD1   
3461 O OD2   . ASP C 384 ? 0.6273 0.5718 0.5690 -0.0248 -0.0476 -0.0452 680 ASP A OD2   
3462 N N     . ILE C 385 ? 0.2624 0.2125 0.2031 -0.0128 -0.0268 -0.0363 681 ILE A N     
3463 C CA    . ILE C 385 ? 0.2673 0.2196 0.1986 -0.0125 -0.0279 -0.0317 681 ILE A CA    
3464 C C     . ILE C 385 ? 0.3386 0.2880 0.2584 -0.0168 -0.0388 -0.0309 681 ILE A C     
3465 O O     . ILE C 385 ? 0.4019 0.3466 0.3033 -0.0187 -0.0391 -0.0300 681 ILE A O     
3466 C CB    . ILE C 385 ? 0.3136 0.2752 0.2597 -0.0088 -0.0264 -0.0256 681 ILE A CB    
3467 C CG1   . ILE C 385 ? 0.4607 0.4229 0.3966 -0.0089 -0.0252 -0.0213 681 ILE A CG1   
3468 C CG2   . ILE C 385 ? 0.3802 0.3467 0.3409 -0.0091 -0.0346 -0.0230 681 ILE A CG2   
3469 C CD1   . ILE C 385 ? 0.5218 0.4813 0.4452 -0.0087 -0.0159 -0.0237 681 ILE A CD1   
3470 N N     . HIS C 386 ? 0.3118 0.2642 0.2421 -0.0186 -0.0479 -0.0310 682 HIS A N     
3471 C CA    . HIS C 386 ? 0.3665 0.3175 0.2873 -0.0221 -0.0599 -0.0298 682 HIS A CA    
3472 C C     . HIS C 386 ? 0.4018 0.3431 0.2999 -0.0270 -0.0611 -0.0358 682 HIS A C     
3473 O O     . HIS C 386 ? 0.3457 0.2827 0.2249 -0.0292 -0.0660 -0.0338 682 HIS A O     
3474 C CB    . HIS C 386 ? 0.3105 0.2690 0.2505 -0.0228 -0.0689 -0.0294 682 HIS A CB    
3475 C CG    . HIS C 386 ? 0.3129 0.2802 0.2737 -0.0182 -0.0672 -0.0240 682 HIS A CG    
3476 N ND1   . HIS C 386 ? 0.3455 0.3139 0.3044 -0.0147 -0.0644 -0.0180 682 HIS A ND1   
3477 C CD2   . HIS C 386 ? 0.3983 0.3731 0.3813 -0.0169 -0.0670 -0.0240 682 HIS A CD2   
3478 C CE1   . HIS C 386 ? 0.2874 0.2631 0.2657 -0.0113 -0.0629 -0.0151 682 HIS A CE1   
3479 N NE2   . HIS C 386 ? 0.3790 0.3589 0.3720 -0.0124 -0.0643 -0.0185 682 HIS A NE2   
3480 N N     . THR C 387 ? 0.3643 0.3007 0.2626 -0.0288 -0.0560 -0.0432 683 THR A N     
3481 C CA    . THR C 387 ? 0.4432 0.3690 0.3191 -0.0336 -0.0557 -0.0503 683 THR A CA    
3482 C C     . THR C 387 ? 0.4218 0.3418 0.2784 -0.0322 -0.0466 -0.0498 683 THR A C     
3483 O O     . THR C 387 ? 0.4030 0.3158 0.2362 -0.0361 -0.0493 -0.0517 683 THR A O     
3484 C CB    . THR C 387 ? 0.3917 0.3116 0.2730 -0.0353 -0.0505 -0.0585 683 THR A CB    
3485 O OG1   . THR C 387 ? 0.4223 0.3476 0.3202 -0.0383 -0.0593 -0.0595 683 THR A OG1   
3486 C CG2   . THR C 387 ? 0.4446 0.3518 0.3013 -0.0402 -0.0485 -0.0669 683 THR A CG2   
3487 N N     . LYS C 388 ? 0.3795 0.3030 0.2456 -0.0269 -0.0356 -0.0473 684 LYS A N     
3488 C CA    . LYS C 388 ? 0.4423 0.3629 0.2937 -0.0257 -0.0263 -0.0466 684 LYS A CA    
3489 C C     . LYS C 388 ? 0.3686 0.2903 0.2086 -0.0273 -0.0319 -0.0397 684 LYS A C     
3490 O O     . LYS C 388 ? 0.3961 0.3112 0.2139 -0.0300 -0.0289 -0.0404 684 LYS A O     
3491 C CB    . LYS C 388 ? 0.3803 0.3072 0.2474 -0.0197 -0.0150 -0.0449 684 LYS A CB    
3492 C CG    . LYS C 388 ? 0.3742 0.3006 0.2296 -0.0186 -0.0046 -0.0447 684 LYS A CG    
3493 C CD    . LYS C 388 ? 0.5797 0.4952 0.4159 -0.0210 0.0015  -0.0529 684 LYS A CD    
3494 C CE    . LYS C 388 ? 0.6746 0.5906 0.5014 -0.0196 0.0137  -0.0534 684 LYS A CE    
3495 N NZ    . LYS C 388 ? 0.7369 0.6421 0.5468 -0.0210 0.0214  -0.0625 684 LYS A NZ    
3496 N N     . THR C 389 ? 0.3126 0.2417 0.1669 -0.0255 -0.0394 -0.0328 685 THR A N     
3497 C CA    . THR C 389 ? 0.3198 0.2481 0.1636 -0.0266 -0.0451 -0.0255 685 THR A CA    
3498 C C     . THR C 389 ? 0.4098 0.3302 0.2311 -0.0316 -0.0550 -0.0266 685 THR A C     
3499 O O     . THR C 389 ? 0.4583 0.3725 0.2587 -0.0337 -0.0551 -0.0230 685 THR A O     
3500 C CB    . THR C 389 ? 0.3013 0.2378 0.1657 -0.0233 -0.0517 -0.0188 685 THR A CB    
3501 O OG1   . THR C 389 ? 0.3739 0.3175 0.2574 -0.0193 -0.0429 -0.0186 685 THR A OG1   
3502 C CG2   . THR C 389 ? 0.4055 0.3391 0.2597 -0.0236 -0.0557 -0.0108 685 THR A CG2   
3503 N N     . ALA C 390 ? 0.3282 0.2485 0.1527 -0.0340 -0.0634 -0.0316 686 ALA A N     
3504 C CA    . ALA C 390 ? 0.3955 0.3093 0.1981 -0.0393 -0.0740 -0.0333 686 ALA A CA    
3505 C C     . ALA C 390 ? 0.4450 0.3476 0.2199 -0.0431 -0.0658 -0.0394 686 ALA A C     
3506 O O     . ALA C 390 ? 0.4472 0.3426 0.1965 -0.0469 -0.0707 -0.0378 686 ALA A O     
3507 C CB    . ALA C 390 ? 0.3722 0.2898 0.1865 -0.0419 -0.0844 -0.0384 686 ALA A CB    
3508 N N     . MET C 391 ? 0.5022 0.4026 0.2813 -0.0421 -0.0533 -0.0466 687 MET A N     
3509 C CA    . MET C 391 ? 0.5366 0.4264 0.2911 -0.0450 -0.0437 -0.0534 687 MET A CA    
3510 C C     . MET C 391 ? 0.5280 0.4153 0.2655 -0.0450 -0.0375 -0.0475 687 MET A C     
3511 O O     . MET C 391 ? 0.5193 0.3976 0.2297 -0.0492 -0.0359 -0.0498 687 MET A O     
3512 C CB    . MET C 391 ? 0.4466 0.3355 0.2129 -0.0419 -0.0303 -0.0606 687 MET A CB    
3513 C CG    . MET C 391 ? 0.5211 0.4080 0.2981 -0.0435 -0.0345 -0.0679 687 MET A CG    
3514 S SD    . MET C 391 ? 0.5921 0.4788 0.3888 -0.0376 -0.0195 -0.0728 687 MET A SD    
3515 C CE    . MET C 391 ? 0.5874 0.4665 0.3631 -0.0364 -0.0038 -0.0771 687 MET A CE    
3516 N N     . ASP C 392 ? 0.4911 0.3864 0.2448 -0.0406 -0.0337 -0.0399 688 ASP A N     
3517 C CA    . ASP C 392 ? 0.6326 0.5258 0.3729 -0.0412 -0.0265 -0.0342 688 ASP A CA    
3518 C C     . ASP C 392 ? 0.5955 0.4840 0.3192 -0.0441 -0.0383 -0.0261 688 ASP A C     
3519 O O     . ASP C 392 ? 0.6231 0.5034 0.3213 -0.0478 -0.0354 -0.0245 688 ASP A O     
3520 C CB    . ASP C 392 ? 0.5887 0.4921 0.3527 -0.0362 -0.0183 -0.0298 688 ASP A CB    
3521 C CG    . ASP C 392 ? 0.7576 0.6661 0.5381 -0.0324 -0.0074 -0.0366 688 ASP A CG    
3522 O OD1   . ASP C 392 ? 0.8014 0.7194 0.6068 -0.0279 -0.0069 -0.0344 688 ASP A OD1   
3523 O OD2   . ASP C 392 ? 0.7472 0.6497 0.5151 -0.0336 0.0006  -0.0441 688 ASP A OD2   
3524 N N     . ILE C 393 ? 0.5223 0.4163 0.2617 -0.0419 -0.0509 -0.0204 689 ILE A N     
3525 C CA    . ILE C 393 ? 0.5437 0.4334 0.2696 -0.0433 -0.0630 -0.0117 689 ILE A CA    
3526 C C     . ILE C 393 ? 0.5954 0.4791 0.2992 -0.0474 -0.0686 -0.0145 689 ILE A C     
3527 O O     . ILE C 393 ? 0.5966 0.4750 0.2832 -0.0488 -0.0685 -0.0089 689 ILE A O     
3528 C CB    . ILE C 393 ? 0.5250 0.4234 0.2757 -0.0393 -0.0755 -0.0066 689 ILE A CB    
3529 C CG1   . ILE C 393 ? 0.4398 0.3447 0.2130 -0.0345 -0.0689 -0.0012 689 ILE A CG1   
3530 C CG2   . ILE C 393 ? 0.6265 0.5209 0.3639 -0.0401 -0.0906 0.0008  689 ILE A CG2   
3531 C CD1   . ILE C 393 ? 0.5143 0.4273 0.3118 -0.0303 -0.0794 0.0030  689 ILE A CD1   
3532 N N     . PHE C 394 ? 0.5184 0.4037 0.2255 -0.0491 -0.0727 -0.0231 690 PHE A N     
3533 C CA    . PHE C 394 ? 0.6023 0.4848 0.2937 -0.0527 -0.0787 -0.0263 690 PHE A CA    
3534 C C     . PHE C 394 ? 0.5890 0.4644 0.2631 -0.0558 -0.0660 -0.0351 690 PHE A C     
3535 O O     . PHE C 394 ? 0.7065 0.5783 0.3648 -0.0592 -0.0696 -0.0387 690 PHE A O     
3536 C CB    . PHE C 394 ? 0.4533 0.3425 0.1593 -0.0535 -0.0916 -0.0306 690 PHE A CB    
3537 C CG    . PHE C 394 ? 0.4693 0.3674 0.1959 -0.0499 -0.1039 -0.0225 690 PHE A CG    
3538 C CD1   . PHE C 394 ? 0.5860 0.4854 0.3077 -0.0482 -0.1138 -0.0131 690 PHE A CD1   
3539 C CD2   . PHE C 394 ? 0.4905 0.3954 0.2420 -0.0475 -0.1051 -0.0243 690 PHE A CD2   
3540 C CE1   . PHE C 394 ? 0.5526 0.4602 0.2952 -0.0438 -0.1241 -0.0059 690 PHE A CE1   
3541 C CE2   . PHE C 394 ? 0.5145 0.4282 0.2869 -0.0436 -0.1154 -0.0172 690 PHE A CE2   
3542 C CZ    . PHE C 394 ? 0.6206 0.5358 0.3891 -0.0415 -0.1247 -0.0081 690 PHE A CZ    
3543 N N     . GLN C 395 ? 0.6540 0.5278 0.3312 -0.0544 -0.0510 -0.0388 691 GLN A N     
3544 C CA    . GLN C 395 ? 0.7041 0.5720 0.3674 -0.0560 -0.0373 -0.0465 691 GLN A CA    
3545 C C     . GLN C 395 ? 0.6713 0.5361 0.3310 -0.0588 -0.0406 -0.0568 691 GLN A C     
3546 O O     . GLN C 395 ? 0.7006 0.5601 0.3414 -0.0622 -0.0407 -0.0602 691 GLN A O     
3547 C CB    . GLN C 395 ? 0.7553 0.6183 0.3970 -0.0581 -0.0331 -0.0412 691 GLN A CB    
3548 C CG    . GLN C 395 ? 0.8687 0.7335 0.5133 -0.0563 -0.0301 -0.0306 691 GLN A CG    
3549 C CD    . GLN C 395 ? 1.1086 0.9682 0.7339 -0.0587 -0.0351 -0.0222 691 GLN A CD    
3550 O OE1   . GLN C 395 ? 1.1640 1.0193 0.7725 -0.0615 -0.0405 -0.0244 691 GLN A OE1   
3551 N NE2   . GLN C 395 ? 1.1372 0.9968 0.7647 -0.0576 -0.0332 -0.0126 691 GLN A NE2   
3552 N N     . VAL C 396 ? 0.5913 0.4592 0.2696 -0.0577 -0.0436 -0.0617 692 VAL A N     
3553 C CA    . VAL C 396 ? 0.6362 0.5009 0.3148 -0.0606 -0.0460 -0.0719 692 VAL A CA    
3554 C C     . VAL C 396 ? 0.5617 0.4249 0.2566 -0.0578 -0.0357 -0.0788 692 VAL A C     
3555 O O     . VAL C 396 ? 0.6476 0.5147 0.3565 -0.0537 -0.0311 -0.0750 692 VAL A O     
3556 C CB    . VAL C 396 ? 0.6628 0.5333 0.3491 -0.0634 -0.0639 -0.0706 692 VAL A CB    
3557 C CG1   . VAL C 396 ? 0.6428 0.5153 0.3147 -0.0647 -0.0744 -0.0623 692 VAL A CG1   
3558 C CG2   . VAL C 396 ? 0.5824 0.4606 0.2945 -0.0606 -0.0695 -0.0671 692 VAL A CG2   
3559 N N     . SER C 397 ? 0.5701 0.4271 0.2627 -0.0598 -0.0319 -0.0891 693 SER A N     
3560 C CA    . SER C 397 ? 0.5923 0.4461 0.3006 -0.0567 -0.0224 -0.0956 693 SER A CA    
3561 C C     . SER C 397 ? 0.6070 0.4655 0.3360 -0.0574 -0.0326 -0.0948 693 SER A C     
3562 O O     . SER C 397 ? 0.6511 0.5157 0.3827 -0.0607 -0.0472 -0.0911 693 SER A O     
3563 C CB    . SER C 397 ? 0.7445 0.5886 0.4441 -0.0585 -0.0150 -0.1064 693 SER A CB    
3564 O OG    . SER C 397 ? 0.7820 0.6248 0.4806 -0.0642 -0.0269 -0.1111 693 SER A OG    
3565 N N     . GLU C 398 ? 0.6315 0.4876 0.3767 -0.0539 -0.0243 -0.0981 694 GLU A N     
3566 C CA    . GLU C 398 ? 0.6132 0.4741 0.3805 -0.0542 -0.0321 -0.0968 694 GLU A CA    
3567 C C     . GLU C 398 ? 0.6886 0.5489 0.4565 -0.0611 -0.0439 -0.1021 694 GLU A C     
3568 O O     . GLU C 398 ? 0.6841 0.5527 0.4666 -0.0633 -0.0558 -0.0985 694 GLU A O     
3569 C CB    . GLU C 398 ? 0.7012 0.5613 0.4893 -0.0479 -0.0196 -0.0984 694 GLU A CB    
3570 C CG    . GLU C 398 ? 0.6377 0.5066 0.4541 -0.0463 -0.0251 -0.0942 694 GLU A CG    
3571 C CD    . GLU C 398 ? 0.7256 0.5926 0.5599 -0.0397 -0.0129 -0.0946 694 GLU A CD    
3572 O OE1   . GLU C 398 ? 0.7112 0.5818 0.5659 -0.0393 -0.0155 -0.0928 694 GLU A OE1   
3573 O OE2   . GLU C 398 ? 0.7522 0.6145 0.5804 -0.0347 -0.0005 -0.0962 694 GLU A OE2   
3574 N N     . ASP C 399 ? 0.7169 0.5694 0.4716 -0.0643 -0.0407 -0.1102 695 ASP A N     
3575 C CA    . ASP C 399 ? 0.7771 0.6300 0.5334 -0.0709 -0.0509 -0.1160 695 ASP A CA    
3576 C C     . ASP C 399 ? 0.7518 0.6140 0.4990 -0.0747 -0.0660 -0.1114 695 ASP A C     
3577 O O     . ASP C 399 ? 0.6531 0.5205 0.4070 -0.0799 -0.0772 -0.1143 695 ASP A O     
3578 C CB    . ASP C 399 ? 0.9694 0.8096 0.7133 -0.0729 -0.0423 -0.1266 695 ASP A CB    
3579 C CG    . ASP C 399 ? 1.1609 0.9914 0.9145 -0.0678 -0.0269 -0.1306 695 ASP A CG    
3580 O OD1   . ASP C 399 ? 1.1958 1.0286 0.9695 -0.0655 -0.0260 -0.1278 695 ASP A OD1   
3581 O OD2   . ASP C 399 ? 1.2054 1.0262 0.9472 -0.0657 -0.0156 -0.1360 695 ASP A OD2   
3582 N N     . GLU C 400 ? 0.7225 0.5872 0.4557 -0.0722 -0.0663 -0.1040 696 GLU A N     
3583 C CA    . GLU C 400 ? 0.6693 0.5419 0.3937 -0.0745 -0.0801 -0.0979 696 GLU A CA    
3584 C C     . GLU C 400 ? 0.6697 0.5544 0.4116 -0.0717 -0.0901 -0.0874 696 GLU A C     
3585 O O     . GLU C 400 ? 0.5679 0.4596 0.3051 -0.0720 -0.1014 -0.0808 696 GLU A O     
3586 C CB    . GLU C 400 ? 0.6604 0.5276 0.3588 -0.0736 -0.0748 -0.0950 696 GLU A CB    
3587 C CG    . GLU C 400 ? 0.8303 0.6856 0.5112 -0.0754 -0.0631 -0.1048 696 GLU A CG    
3588 C CD    . GLU C 400 ? 1.0358 0.8868 0.6920 -0.0749 -0.0576 -0.1014 696 GLU A CD    
3589 O OE1   . GLU C 400 ? 1.1255 0.9761 0.7644 -0.0789 -0.0659 -0.1016 696 GLU A OE1   
3590 O OE2   . GLU C 400 ? 1.0493 0.8979 0.7039 -0.0707 -0.0451 -0.0984 696 GLU A OE2   
3591 N N     . VAL C 401 ? 0.5384 0.4252 0.3003 -0.0684 -0.0861 -0.0856 697 VAL A N     
3592 C CA    . VAL C 401 ? 0.4744 0.3724 0.2542 -0.0651 -0.0950 -0.0759 697 VAL A CA    
3593 C C     . VAL C 401 ? 0.5152 0.4239 0.3144 -0.0685 -0.1077 -0.0774 697 VAL A C     
3594 O O     . VAL C 401 ? 0.4543 0.3623 0.2682 -0.0712 -0.1053 -0.0841 697 VAL A O     
3595 C CB    . VAL C 401 ? 0.4948 0.3916 0.2886 -0.0602 -0.0858 -0.0735 697 VAL A CB    
3596 C CG1   . VAL C 401 ? 0.5414 0.4525 0.3596 -0.0556 -0.0936 -0.0635 697 VAL A CG1   
3597 C CG2   . VAL C 401 ? 0.5513 0.4419 0.3298 -0.0562 -0.0725 -0.0712 697 VAL A CG2   
3598 N N     . THR C 402 ? 0.4391 0.3578 0.2392 -0.0684 -0.1205 -0.0710 698 THR A N     
3599 C CA    . THR C 402 ? 0.4146 0.3462 0.2355 -0.0711 -0.1321 -0.0719 698 THR A CA    
3600 C C     . THR C 402 ? 0.3859 0.3280 0.2352 -0.0665 -0.1348 -0.0651 698 THR A C     
3601 O O     . THR C 402 ? 0.3952 0.3353 0.2453 -0.0610 -0.1305 -0.0582 698 THR A O     
3602 C CB    . THR C 402 ? 0.5300 0.4687 0.3407 -0.0724 -0.1447 -0.0683 698 THR A CB    
3603 O OG1   . THR C 402 ? 0.5245 0.4639 0.3280 -0.0665 -0.1472 -0.0569 698 THR A OG1   
3604 C CG2   . THR C 402 ? 0.4651 0.3941 0.2491 -0.0776 -0.1426 -0.0764 698 THR A CG2   
3605 N N     . PRO C 403 ? 0.3776 0.3312 0.2513 -0.0690 -0.1410 -0.0673 699 PRO A N     
3606 C CA    . PRO C 403 ? 0.3515 0.3166 0.2539 -0.0642 -0.1432 -0.0608 699 PRO A CA    
3607 C C     . PRO C 403 ? 0.3468 0.3186 0.2501 -0.0574 -0.1496 -0.0493 699 PRO A C     
3608 O O     . PRO C 403 ? 0.3261 0.3003 0.2434 -0.0517 -0.1465 -0.0434 699 PRO A O     
3609 C CB    . PRO C 403 ? 0.3512 0.3292 0.2759 -0.0691 -0.1496 -0.0653 699 PRO A CB    
3610 C CG    . PRO C 403 ? 0.4821 0.4503 0.3921 -0.0770 -0.1459 -0.0766 699 PRO A CG    
3611 C CD    . PRO C 403 ? 0.3915 0.3474 0.2685 -0.0766 -0.1440 -0.0770 699 PRO A CD    
3612 N N     . ASN C 404 ? 0.4579 0.4316 0.3462 -0.0576 -0.1582 -0.0460 700 ASN A N     
3613 C CA    . ASN C 404 ? 0.4428 0.4204 0.3311 -0.0508 -0.1638 -0.0346 700 ASN A CA    
3614 C C     . ASN C 404 ? 0.3649 0.3292 0.2333 -0.0475 -0.1553 -0.0301 700 ASN A C     
3615 O O     . ASN C 404 ? 0.3606 0.3262 0.2361 -0.0414 -0.1553 -0.0215 700 ASN A O     
3616 C CB    . ASN C 404 ? 0.4203 0.4029 0.2973 -0.0519 -0.1755 -0.0320 700 ASN A CB    
3617 C CG    . ASN C 404 ? 0.4037 0.3923 0.2880 -0.0443 -0.1825 -0.0201 700 ASN A CG    
3618 O OD1   . ASN C 404 ? 0.3712 0.3674 0.2803 -0.0391 -0.1820 -0.0157 700 ASN A OD1   
3619 N ND2   . ASN C 404 ? 0.4786 0.4628 0.3410 -0.0435 -0.1884 -0.0150 700 ASN A ND2   
3620 N N     . MET C 405 ? 0.4071 0.3584 0.2507 -0.0515 -0.1473 -0.0360 701 MET A N     
3621 C CA    . MET C 405 ? 0.4043 0.3441 0.2307 -0.0490 -0.1372 -0.0327 701 MET A CA    
3622 C C     . MET C 405 ? 0.3703 0.3107 0.2145 -0.0455 -0.1299 -0.0321 701 MET A C     
3623 O O     . MET C 405 ? 0.3743 0.3137 0.2196 -0.0404 -0.1244 -0.0249 701 MET A O     
3624 C CB    . MET C 405 ? 0.4715 0.3987 0.2713 -0.0537 -0.1281 -0.0405 701 MET A CB    
3625 C CG    . MET C 405 ? 0.5788 0.5024 0.3544 -0.0562 -0.1329 -0.0394 701 MET A CG    
3626 S SD    . MET C 405 ? 0.5654 0.4758 0.3148 -0.0619 -0.1216 -0.0510 701 MET A SD    
3627 C CE    . MET C 405 ? 0.5267 0.4283 0.2737 -0.0586 -0.1042 -0.0511 701 MET A CE    
3628 N N     . ARG C 406 ? 0.3375 0.2814 0.1997 -0.0472 -0.1258 -0.0393 702 ARG A N     
3629 C CA    . ARG C 406 ? 0.3101 0.2585 0.1952 -0.0419 -0.1141 -0.0375 702 ARG A CA    
3630 C C     . ARG C 406 ? 0.2927 0.2530 0.2013 -0.0366 -0.1202 -0.0293 702 ARG A C     
3631 O O     . ARG C 406 ? 0.2789 0.2410 0.1977 -0.0312 -0.1118 -0.0245 702 ARG A O     
3632 C CB    . ARG C 406 ? 0.3029 0.2513 0.2014 -0.0448 -0.1080 -0.0460 702 ARG A CB    
3633 C CG    . ARG C 406 ? 0.2797 0.2307 0.1968 -0.0394 -0.0948 -0.0442 702 ARG A CG    
3634 C CD    . ARG C 406 ? 0.4067 0.3576 0.3388 -0.0421 -0.0902 -0.0510 702 ARG A CD    
3635 N NE    . ARG C 406 ? 0.4192 0.3720 0.3667 -0.0368 -0.0781 -0.0486 702 ARG A NE    
3636 C CZ    . ARG C 406 ? 0.3920 0.3549 0.3624 -0.0335 -0.0783 -0.0439 702 ARG A CZ    
3637 N NH1   . ARG C 406 ? 0.3880 0.3609 0.3711 -0.0344 -0.0894 -0.0413 702 ARG A NH1   
3638 N NH2   . ARG C 406 ? 0.4058 0.3694 0.3866 -0.0290 -0.0674 -0.0420 702 ARG A NH2   
3639 N N     . ARG C 407 ? 0.3033 0.2721 0.2209 -0.0381 -0.1348 -0.0280 703 ARG A N     
3640 C CA    . ARG C 407 ? 0.3659 0.3459 0.3068 -0.0323 -0.1404 -0.0205 703 ARG A CA    
3641 C C     . ARG C 407 ? 0.3941 0.3692 0.3232 -0.0270 -0.1408 -0.0111 703 ARG A C     
3642 O O     . ARG C 407 ? 0.2922 0.2717 0.2379 -0.0211 -0.1375 -0.0054 703 ARG A O     
3643 C CB    . ARG C 407 ? 0.5088 0.5010 0.4637 -0.0339 -0.1528 -0.0207 703 ARG A CB    
3644 C CG    . ARG C 407 ? 0.4150 0.4195 0.3959 -0.0270 -0.1568 -0.0133 703 ARG A CG    
3645 C CD    . ARG C 407 ? 0.4082 0.4251 0.3998 -0.0276 -0.1673 -0.0126 703 ARG A CD    
3646 N NE    . ARG C 407 ? 0.6194 0.6314 0.5870 -0.0281 -0.1751 -0.0090 703 ARG A NE    
3647 C CZ    . ARG C 407 ? 0.6051 0.6153 0.5676 -0.0219 -0.1794 0.0003  703 ARG A CZ    
3648 N NH1   . ARG C 407 ? 0.5908 0.6036 0.5709 -0.0149 -0.1764 0.0063  703 ARG A NH1   
3649 N NH2   . ARG C 407 ? 0.5904 0.5955 0.5299 -0.0229 -0.1861 0.0033  703 ARG A NH2   
3650 N N     . GLN C 408 ? 0.3724 0.3373 0.2719 -0.0296 -0.1441 -0.0096 704 GLN A N     
3651 C CA    . GLN C 408 ? 0.3543 0.3124 0.2406 -0.0255 -0.1437 -0.0004 704 GLN A CA    
3652 C C     . GLN C 408 ? 0.3763 0.3277 0.2579 -0.0239 -0.1268 -0.0003 704 GLN A C     
3653 O O     . GLN C 408 ? 0.3832 0.3333 0.2692 -0.0194 -0.1231 0.0067  704 GLN A O     
3654 C CB    . GLN C 408 ? 0.3673 0.3188 0.2270 -0.0282 -0.1484 0.0017  704 GLN A CB    
3655 C CG    . GLN C 408 ? 0.5032 0.4652 0.3733 -0.0277 -0.1609 0.0031  704 GLN A CG    
3656 C CD    . GLN C 408 ? 0.7095 0.6658 0.5561 -0.0279 -0.1667 0.0085  704 GLN A CD    
3657 O OE1   . GLN C 408 ? 0.8355 0.7976 0.6897 -0.0237 -0.1759 0.0154  704 GLN A OE1   
3658 N NE2   . GLN C 408 ? 0.7200 0.6647 0.5378 -0.0326 -0.1609 0.0055  704 GLN A NE2   
3659 N N     . ALA C 409 ? 0.3412 0.2885 0.2151 -0.0275 -0.1166 -0.0081 705 ALA A N     
3660 C CA    . ALA C 409 ? 0.3717 0.3159 0.2462 -0.0255 -0.1010 -0.0085 705 ALA A CA    
3661 C C     . ALA C 409 ? 0.4225 0.3759 0.3259 -0.0207 -0.0963 -0.0068 705 ALA A C     
3662 O O     . ALA C 409 ? 0.3011 0.2540 0.2078 -0.0176 -0.0879 -0.0031 705 ALA A O     
3663 C CB    . ALA C 409 ? 0.3155 0.2544 0.1793 -0.0292 -0.0916 -0.0175 705 ALA A CB    
3664 N N     . LYS C 410 ? 0.3520 0.3140 0.2760 -0.0206 -0.1013 -0.0098 706 LYS A N     
3665 C CA    . LYS C 410 ? 0.3176 0.2883 0.2681 -0.0164 -0.0967 -0.0086 706 LYS A CA    
3666 C C     . LYS C 410 ? 0.3554 0.3289 0.3146 -0.0116 -0.1012 -0.0005 706 LYS A C     
3667 O O     . LYS C 410 ? 0.3504 0.3265 0.3223 -0.0079 -0.0937 0.0017  706 LYS A O     
3668 C CB    . LYS C 410 ? 0.2511 0.2298 0.2204 -0.0184 -0.1009 -0.0137 706 LYS A CB    
3669 C CG    . LYS C 410 ? 0.3254 0.3131 0.3215 -0.0147 -0.0959 -0.0127 706 LYS A CG    
3670 C CD    . LYS C 410 ? 0.3896 0.3840 0.4023 -0.0180 -0.0983 -0.0183 706 LYS A CD    
3671 C CE    . LYS C 410 ? 0.4169 0.4184 0.4528 -0.0150 -0.0903 -0.0180 706 LYS A CE    
3672 N NZ    . LYS C 410 ? 0.6140 0.6205 0.6646 -0.0193 -0.0906 -0.0235 706 LYS A NZ    
3673 N N     . ALA C 411 ? 0.3149 0.2875 0.2673 -0.0113 -0.1135 0.0039  707 ALA A N     
3674 C CA    . ALA C 411 ? 0.2659 0.2391 0.2257 -0.0060 -0.1179 0.0121  707 ALA A CA    
3675 C C     . ALA C 411 ? 0.3882 0.3510 0.3321 -0.0051 -0.1096 0.0167  707 ALA A C     
3676 O O     . ALA C 411 ? 0.2913 0.2541 0.2460 -0.0010 -0.1055 0.0208  707 ALA A O     
3677 C CB    . ALA C 411 ? 0.3363 0.3107 0.2919 -0.0054 -0.1340 0.0164  707 ALA A CB    
3678 N N     . VAL C 412 ? 0.3826 0.3363 0.3008 -0.0093 -0.1065 0.0156  708 VAL A N     
3679 C CA    . VAL C 412 ? 0.4053 0.3504 0.3095 -0.0096 -0.0970 0.0191  708 VAL A CA    
3680 C C     . VAL C 412 ? 0.4479 0.3978 0.3670 -0.0083 -0.0841 0.0159  708 VAL A C     
3681 O O     . VAL C 412 ? 0.3609 0.3084 0.2829 -0.0066 -0.0785 0.0198  708 VAL A O     
3682 C CB    . VAL C 412 ? 0.4558 0.3916 0.3307 -0.0148 -0.0945 0.0173  708 VAL A CB    
3683 C CG1   . VAL C 412 ? 0.4317 0.3609 0.2954 -0.0159 -0.0825 0.0197  708 VAL A CG1   
3684 C CG2   . VAL C 412 ? 0.5019 0.4317 0.3588 -0.0160 -0.1078 0.0221  708 VAL A CG2   
3685 N N     . ASN C 413 ? 0.3719 0.3280 0.3002 -0.0094 -0.0796 0.0088  709 ASN A N     
3686 C CA    . ASN C 413 ? 0.3913 0.3525 0.3331 -0.0078 -0.0685 0.0061  709 ASN A CA    
3687 C C     . ASN C 413 ? 0.4494 0.4168 0.4132 -0.0036 -0.0695 0.0088  709 ASN A C     
3688 O O     . ASN C 413 ? 0.3893 0.3576 0.3588 -0.0021 -0.0620 0.0100  709 ASN A O     
3689 C CB    . ASN C 413 ? 0.4226 0.3873 0.3685 -0.0093 -0.0641 -0.0012 709 ASN A CB    
3690 C CG    . ASN C 413 ? 0.3235 0.2820 0.2497 -0.0124 -0.0576 -0.0048 709 ASN A CG    
3691 O OD1   . ASN C 413 ? 0.3408 0.2945 0.2531 -0.0133 -0.0532 -0.0022 709 ASN A OD1   
3692 N ND2   . ASN C 413 ? 0.3016 0.2599 0.2272 -0.0140 -0.0561 -0.0112 709 ASN A ND2   
3693 N N     . PHE C 414 ? 0.5412 0.5137 0.5184 -0.0019 -0.0784 0.0091  710 PHE A N     
3694 C CA    . PHE C 414 ? 0.4477 0.4258 0.4458 0.0024  -0.0793 0.0116  710 PHE A CA    
3695 C C     . PHE C 414 ? 0.5420 0.5130 0.5346 0.0048  -0.0795 0.0181  710 PHE A C     
3696 O O     . PHE C 414 ? 0.5487 0.5207 0.5526 0.0075  -0.0740 0.0191  710 PHE A O     
3697 C CB    . PHE C 414 ? 0.5415 0.5269 0.5543 0.0037  -0.0898 0.0113  710 PHE A CB    
3698 C CG    . PHE C 414 ? 0.7005 0.6929 0.7370 0.0086  -0.0900 0.0131  710 PHE A CG    
3699 C CD1   . PHE C 414 ? 0.7653 0.7662 0.8203 0.0088  -0.0841 0.0086  710 PHE A CD1   
3700 C CD2   . PHE C 414 ? 0.8091 0.7987 0.8489 0.0130  -0.0956 0.0192  710 PHE A CD2   
3701 C CE1   . PHE C 414 ? 0.7483 0.7556 0.8246 0.0131  -0.0830 0.0096  710 PHE A CE1   
3702 C CE2   . PHE C 414 ? 0.7663 0.7619 0.8286 0.0180  -0.0947 0.0201  710 PHE A CE2   
3703 C CZ    . PHE C 414 ? 0.7241 0.7289 0.8045 0.0178  -0.0882 0.0150  710 PHE A CZ    
3704 N N     . GLY C 415 ? 0.5471 0.5096 0.5211 0.0036  -0.0856 0.0226  711 GLY A N     
3705 C CA    . GLY C 415 ? 0.6164 0.5696 0.5831 0.0054  -0.0853 0.0293  711 GLY A CA    
3706 C C     . GLY C 415 ? 0.6791 0.6271 0.6356 0.0023  -0.0735 0.0287  711 GLY A C     
3707 O O     . GLY C 415 ? 0.5923 0.5362 0.5530 0.0037  -0.0690 0.0315  711 GLY A O     
3708 N N     . ILE C 416 ? 0.7248 0.6732 0.6686 -0.0019 -0.0681 0.0245  712 ILE A N     
3709 C CA    . ILE C 416 ? 0.6803 0.6257 0.6153 -0.0050 -0.0571 0.0238  712 ILE A CA    
3710 C C     . ILE C 416 ? 0.6645 0.6163 0.6171 -0.0034 -0.0498 0.0216  712 ILE A C     
3711 O O     . ILE C 416 ? 0.6625 0.6113 0.6121 -0.0053 -0.0430 0.0229  712 ILE A O     
3712 C CB    . ILE C 416 ? 0.6288 0.5758 0.5515 -0.0087 -0.0520 0.0187  712 ILE A CB    
3713 C CG1   . ILE C 416 ? 0.7611 0.6982 0.6590 -0.0120 -0.0556 0.0216  712 ILE A CG1   
3714 C CG2   . ILE C 416 ? 0.6005 0.5513 0.5251 -0.0103 -0.0401 0.0161  712 ILE A CG2   
3715 C CD1   . ILE C 416 ? 0.8509 0.7789 0.7353 -0.0145 -0.0509 0.0272  712 ILE A CD1   
3716 N N     . VAL C 417 ? 0.5635 0.5241 0.5341 -0.0004 -0.0509 0.0181  713 VAL A N     
3717 C CA    . VAL C 417 ? 0.4332 0.3999 0.4186 0.0009  -0.0440 0.0156  713 VAL A CA    
3718 C C     . VAL C 417 ? 0.5935 0.5579 0.5907 0.0042  -0.0461 0.0185  713 VAL A C     
3719 O O     . VAL C 417 ? 0.7117 0.6802 0.7199 0.0050  -0.0404 0.0163  713 VAL A O     
3720 C CB    . VAL C 417 ? 0.5225 0.4988 0.5198 0.0021  -0.0423 0.0105  713 VAL A CB    
3721 C CG1   . VAL C 417 ? 0.5418 0.5192 0.5284 -0.0005 -0.0383 0.0071  713 VAL A CG1   
3722 C CG2   . VAL C 417 ? 0.5487 0.5275 0.5559 0.0043  -0.0508 0.0106  713 VAL A CG2   
3723 N N     A TYR C 418 ? 0.5295 0.4877 0.5250 0.0064  -0.0543 0.0234  714 TYR A N     
3724 N N     B TYR C 418 ? 0.5306 0.4882 0.5251 0.0063  -0.0541 0.0236  714 TYR A N     
3725 C CA    A TYR C 418 ? 0.5655 0.5219 0.5749 0.0110  -0.0566 0.0259  714 TYR A CA    
3726 C CA    B TYR C 418 ? 0.5679 0.5215 0.5732 0.0103  -0.0559 0.0268  714 TYR A CA    
3727 C C     A TYR C 418 ? 0.5874 0.5302 0.5856 0.0111  -0.0581 0.0323  714 TYR A C     
3728 C C     B TYR C 418 ? 0.5916 0.5312 0.5830 0.0095  -0.0572 0.0332  714 TYR A C     
3729 O O     A TYR C 418 ? 0.6116 0.5470 0.5910 0.0071  -0.0572 0.0349  714 TYR A O     
3730 O O     B TYR C 418 ? 0.6043 0.5376 0.6028 0.0136  -0.0599 0.0370  714 TYR A O     
3731 C CB    A TYR C 418 ? 0.5997 0.5625 0.6229 0.0152  -0.0656 0.0262  714 TYR A CB    
3732 C CB    B TYR C 418 ? 0.5940 0.5530 0.6143 0.0152  -0.0648 0.0276  714 TYR A CB    
3733 C CG    A TYR C 418 ? 0.5962 0.5711 0.6372 0.0160  -0.0622 0.0204  714 TYR A CG    
3734 C CG    B TYR C 418 ? 0.6022 0.5738 0.6400 0.0161  -0.0619 0.0217  714 TYR A CG    
3735 C CD1   A TYR C 418 ? 0.6112 0.5943 0.6639 0.0175  -0.0690 0.0190  714 TYR A CD1   
3736 C CD1   B TYR C 418 ? 0.6538 0.6290 0.6978 0.0151  -0.0522 0.0176  714 TYR A CD1   
3737 C CD2   A TYR C 418 ? 0.6562 0.6342 0.7017 0.0148  -0.0522 0.0164  714 TYR A CD2   
3738 C CD2   B TYR C 418 ? 0.6059 0.5855 0.6536 0.0174  -0.0690 0.0204  714 TYR A CD2   
3739 C CE1   A TYR C 418 ? 0.6369 0.6299 0.7053 0.0176  -0.0649 0.0141  714 TYR A CE1   
3740 C CE1   B TYR C 418 ? 0.6634 0.6487 0.7215 0.0158  -0.0491 0.0130  714 TYR A CE1   
3741 C CE2   A TYR C 418 ? 0.6541 0.6417 0.7137 0.0155  -0.0487 0.0119  714 TYR A CE2   
3742 C CE2   B TYR C 418 ? 0.6218 0.6117 0.6851 0.0175  -0.0654 0.0154  714 TYR A CE2   
3743 C CZ    A TYR C 418 ? 0.6576 0.6522 0.7287 0.0168  -0.0546 0.0109  714 TYR A CZ    
3744 C CZ    B TYR C 418 ? 0.6526 0.6447 0.7204 0.0169  -0.0552 0.0121  714 TYR A CZ    
3745 O OH    A TYR C 418 ? 0.6710 0.6742 0.7557 0.0167  -0.0502 0.0068  714 TYR A OH    
3746 O OH    B TYR C 418 ? 0.6572 0.6582 0.7385 0.0168  -0.0513 0.0079  714 TYR A OH    
3747 N N     A GLY C 419 ? 0.6273 0.5661 0.6373 0.0157  -0.0598 0.0348  715 GLY A N     
3748 N N     B GLY C 419 ? 0.6190 0.5529 0.5908 0.0046  -0.0546 0.0347  715 GLY A N     
3749 C CA    A GLY C 419 ? 0.6239 0.5479 0.6251 0.0171  -0.0621 0.0417  715 GLY A CA    
3750 C CA    B GLY C 419 ? 0.6303 0.5498 0.5872 0.0028  -0.0545 0.0411  715 GLY A CA    
3751 C C     A GLY C 419 ? 0.5875 0.5079 0.5852 0.0212  -0.0744 0.0483  715 GLY A C     
3752 C C     B GLY C 419 ? 0.5585 0.4708 0.4945 0.0009  -0.0606 0.0459  715 GLY A C     
3753 O O     A GLY C 419 ? 0.6361 0.5466 0.6357 0.0259  -0.0786 0.0544  715 GLY A O     
3754 O O     B GLY C 419 ? 0.7064 0.6109 0.6244 -0.0042 -0.0557 0.0480  715 GLY A O     
3755 N N     A ILE C 420 ? 0.6171 0.5453 0.6099 0.0197  -0.0805 0.0469  716 ILE A N     
3756 N N     B ILE C 420 ? 0.5606 0.4762 0.4987 0.0044  -0.0713 0.0472  716 ILE A N     
3757 C CA    A ILE C 420 ? 0.5493 0.4751 0.5355 0.0224  -0.0934 0.0528  716 ILE A CA    
3758 C CA    B ILE C 420 ? 0.5225 0.4318 0.4403 0.0030  -0.0793 0.0517  716 ILE A CA    
3759 C C     A ILE C 420 ? 0.5247 0.4365 0.4827 0.0182  -0.0940 0.0585  716 ILE A C     
3760 C C     B ILE C 420 ? 0.6121 0.5045 0.5134 0.0026  -0.0804 0.0607  716 ILE A C     
3761 O O     A ILE C 420 ? 0.5085 0.4177 0.4527 0.0120  -0.0852 0.0557  716 ILE A O     
3762 O O     B ILE C 420 ? 0.6434 0.5279 0.5316 -0.0025 -0.0712 0.0617  716 ILE A O     
3763 C CB    A ILE C 420 ? 0.5613 0.5012 0.5539 0.0215  -0.0996 0.0478  716 ILE A CB    
3764 C CB    B ILE C 420 ? 0.5109 0.4238 0.4137 -0.0028 -0.0746 0.0463  716 ILE A CB    
3765 C CG1   A ILE C 420 ? 0.5318 0.4848 0.5532 0.0258  -0.0991 0.0434  716 ILE A CG1   
3766 C CG1   B ILE C 420 ? 0.4922 0.3923 0.3672 -0.0078 -0.0721 0.0510  716 ILE A CG1   
3767 C CG2   A ILE C 420 ? 0.5890 0.5267 0.5701 0.0225  -0.1134 0.0532  716 ILE A CG2   
3768 C CG2   B ILE C 420 ? 0.6129 0.5350 0.5266 -0.0049 -0.0631 0.0390  716 ILE A CG2   
3769 C CD1   A ILE C 420 ? 0.4587 0.4241 0.4868 0.0221  -0.0958 0.0354  716 ILE A CD1   
3770 C CD1   B ILE C 420 ? 0.5066 0.4046 0.3775 -0.0126 -0.0583 0.0492  716 ILE A CD1   
3771 N N     A SER C 421 ? 0.6258 0.5288 0.5753 0.0218  -0.1043 0.0670  717 SER A N     
3772 N N     B SER C 421 ? 0.7014 0.5883 0.6045 0.0082  -0.0914 0.0677  717 SER A N     
3773 C CA    A SER C 421 ? 0.7217 0.6093 0.6428 0.0182  -0.1055 0.0740  717 SER A CA    
3774 C CA    B SER C 421 ? 0.7292 0.5984 0.6133 0.0085  -0.0950 0.0779  717 SER A CA    
3775 C C     A SER C 421 ? 0.7867 0.6765 0.6935 0.0177  -0.1181 0.0765  717 SER A C     
3776 C C     B SER C 421 ? 0.7629 0.6300 0.6285 0.0086  -0.1073 0.0824  717 SER A C     
3777 O O     A SER C 421 ? 0.7780 0.6816 0.6979 0.0195  -0.1255 0.0723  717 SER A O     
3778 O O     B SER C 421 ? 0.7476 0.6061 0.5868 0.0028  -0.1050 0.0847  717 SER A O     
3779 C CB    A SER C 421 ? 0.7755 0.6469 0.6946 0.0225  -0.1065 0.0831  717 SER A CB    
3780 C CB    B SER C 421 ? 0.7785 0.6406 0.6781 0.0157  -0.0979 0.0835  717 SER A CB    
3781 O OG    A SER C 421 ? 0.7602 0.6356 0.6940 0.0308  -0.1171 0.0871  717 SER A OG    
3782 O OG    B SER C 421 ? 0.7344 0.5888 0.6372 0.0130  -0.0856 0.0824  717 SER A OG    
3783 N N     . ASP C 422 ? 0.7976 0.6735 0.6766 0.0145  -0.1200 0.0833  718 ASP A N     
3784 C CA    . ASP C 422 ? 0.8900 0.7697 0.7563 0.0139  -0.1291 0.0842  718 ASP A CA    
3785 C C     . ASP C 422 ? 0.8427 0.7346 0.7314 0.0212  -0.1396 0.0848  718 ASP A C     
3786 O O     . ASP C 422 ? 0.7810 0.6858 0.6748 0.0203  -0.1467 0.0799  718 ASP A O     
3787 C CB    . ASP C 422 ? 0.9981 0.8623 0.8378 0.0116  -0.1277 0.0921  718 ASP A CB    
3788 C CG    . ASP C 422 ? 1.2300 1.0912 1.0423 0.0035  -0.1245 0.0891  718 ASP A CG    
3789 O OD1   . ASP C 422 ? 1.3088 1.1789 1.1225 -0.0001 -0.1230 0.0809  718 ASP A OD1   
3790 O OD2   . ASP C 422 ? 1.3509 1.2005 1.1404 0.0010  -0.1227 0.0948  718 ASP A OD2   
3791 N N     . TYR C 423 ? 0.7798 0.6678 0.6824 0.0281  -0.1400 0.0904  719 TYR A N     
3792 C CA    . TYR C 423 ? 0.7838 0.6841 0.7091 0.0356  -0.1487 0.0911  719 TYR A CA    
3793 C C     . TYR C 423 ? 0.7487 0.6672 0.6993 0.0359  -0.1492 0.0820  719 TYR A C     
3794 O O     . TYR C 423 ? 0.7440 0.6766 0.7072 0.0379  -0.1574 0.0798  719 TYR A O     
3795 C CB    . TYR C 423 ? 0.8626 0.7548 0.8001 0.0433  -0.1463 0.0974  719 TYR A CB    
3796 C CG    . TYR C 423 ? 0.9608 0.8642 0.9178 0.0516  -0.1553 0.0998  719 TYR A CG    
3797 C CD1   . TYR C 423 ? 1.0233 0.9231 0.9680 0.0548  -0.1641 0.1077  719 TYR A CD1   
3798 C CD2   . TYR C 423 ? 0.9596 0.8778 0.9472 0.0561  -0.1546 0.0943  719 TYR A CD2   
3799 C CE1   . TYR C 423 ? 1.1013 1.0123 1.0643 0.0628  -0.1727 0.1102  719 TYR A CE1   
3800 C CE2   . TYR C 423 ? 1.0027 0.9321 1.0087 0.0636  -0.1621 0.0963  719 TYR A CE2   
3801 C CZ    . TYR C 423 ? 1.0899 1.0160 1.0839 0.0671  -0.1715 0.1044  719 TYR A CZ    
3802 O OH    . TYR C 423 ? 1.1102 1.0485 1.1231 0.0749  -0.1794 0.1067  719 TYR A OH    
3803 N N     . GLY C 424 ? 0.7244 0.6429 0.6824 0.0335  -0.1403 0.0769  720 GLY A N     
3804 C CA    . GLY C 424 ? 0.6867 0.6217 0.6675 0.0333  -0.1396 0.0685  720 GLY A CA    
3805 C C     . GLY C 424 ? 0.6193 0.5620 0.5901 0.0269  -0.1438 0.0628  720 GLY A C     
3806 O O     . GLY C 424 ? 0.6523 0.6099 0.6399 0.0272  -0.1484 0.0577  720 GLY A O     
3807 N N     . LEU C 425 ? 0.6609 0.5933 0.6041 0.0207  -0.1413 0.0631  721 LEU A N     
3808 C CA    . LEU C 425 ? 0.5675 0.5049 0.4976 0.0145  -0.1446 0.0573  721 LEU A CA    
3809 C C     . LEU C 425 ? 0.5483 0.4910 0.4750 0.0152  -0.1556 0.0591  721 LEU A C     
3810 O O     . LEU C 425 ? 0.5025 0.4583 0.4414 0.0140  -0.1610 0.0535  721 LEU A O     
3811 C CB    . LEU C 425 ? 0.5119 0.4361 0.4116 0.0080  -0.1380 0.0574  721 LEU A CB    
3812 C CG    . LEU C 425 ? 0.4784 0.4062 0.3637 0.0014  -0.1389 0.0500  721 LEU A CG    
3813 C CD1   . LEU C 425 ? 0.4628 0.4039 0.3703 0.0004  -0.1329 0.0401  721 LEU A CD1   
3814 C CD2   . LEU C 425 ? 0.5939 0.5096 0.4501 -0.0045 -0.1293 0.0496  721 LEU A CD2   
3815 N N     . ALA C 426 ? 0.5503 0.4826 0.4602 0.0170  -0.1589 0.0672  722 ALA A N     
3816 C CA    . ALA C 426 ? 0.6038 0.5416 0.5111 0.0189  -0.1702 0.0702  722 ALA A CA    
3817 C C     . ALA C 426 ? 0.5809 0.5357 0.5201 0.0242  -0.1763 0.0681  722 ALA A C     
3818 O O     . ALA C 426 ? 0.6720 0.6385 0.6154 0.0226  -0.1847 0.0648  722 ALA A O     
3819 C CB    . ALA C 426 ? 0.6835 0.6079 0.5743 0.0224  -0.1721 0.0807  722 ALA A CB    
3820 N N     . GLN C 427 ? 0.5987 0.5556 0.5609 0.0299  -0.1713 0.0691  723 GLN A N     
3821 C CA    . GLN C 427 ? 0.5863 0.5596 0.5797 0.0350  -0.1750 0.0669  723 GLN A CA    
3822 C C     . GLN C 427 ? 0.4966 0.4840 0.5035 0.0299  -0.1743 0.0570  723 GLN A C     
3823 O O     . GLN C 427 ? 0.5299 0.5310 0.5485 0.0295  -0.1817 0.0543  723 GLN A O     
3824 C CB    . GLN C 427 ? 0.7803 0.7510 0.7932 0.0418  -0.1677 0.0693  723 GLN A CB    
3825 C CG    . GLN C 427 ? 0.8766 0.8631 0.9212 0.0481  -0.1699 0.0677  723 GLN A CG    
3826 C CD    . GLN C 427 ? 0.9535 0.9497 1.0205 0.0467  -0.1613 0.0596  723 GLN A CD    
3827 O OE1   . GLN C 427 ? 0.9543 0.9439 1.0151 0.0429  -0.1531 0.0563  723 GLN A OE1   
3828 N NE2   . GLN C 427 ? 0.9969 1.0092 1.0899 0.0496  -0.1630 0.0564  723 GLN A NE2   
3829 N N     . ASN C 428 ? 0.4786 0.4626 0.4839 0.0258  -0.1653 0.0518  724 ASN A N     
3830 C CA    . ASN C 428 ? 0.4791 0.4750 0.4974 0.0212  -0.1635 0.0427  724 ASN A CA    
3831 C C     . ASN C 428 ? 0.4381 0.4363 0.4400 0.0144  -0.1704 0.0386  724 ASN A C     
3832 O O     . ASN C 428 ? 0.4756 0.4863 0.4917 0.0113  -0.1729 0.0323  724 ASN A O     
3833 C CB    . ASN C 428 ? 0.5907 0.5816 0.6087 0.0188  -0.1527 0.0387  724 ASN A CB    
3834 C CG    . ASN C 428 ? 0.6512 0.6436 0.6908 0.0248  -0.1452 0.0402  724 ASN A CG    
3835 O OD1   . ASN C 428 ? 0.5533 0.5542 0.6139 0.0300  -0.1469 0.0414  724 ASN A OD1   
3836 N ND2   . ASN C 428 ? 0.6506 0.6351 0.6848 0.0240  -0.1366 0.0396  724 ASN A ND2   
3837 N N     . LEU C 429 ? 0.4490 0.4349 0.4209 0.0115  -0.1726 0.0418  725 LEU A N     
3838 C CA    . LEU C 429 ? 0.5235 0.5098 0.4768 0.0048  -0.1782 0.0375  725 LEU A CA    
3839 C C     . LEU C 429 ? 0.5899 0.5818 0.5407 0.0068  -0.1901 0.0418  725 LEU A C     
3840 O O     . LEU C 429 ? 0.6350 0.6282 0.5703 0.0014  -0.1957 0.0382  725 LEU A O     
3841 C CB    . LEU C 429 ? 0.4471 0.4174 0.3677 -0.0001 -0.1725 0.0375  725 LEU A CB    
3842 C CG    . LEU C 429 ? 0.5225 0.4899 0.4438 -0.0037 -0.1620 0.0309  725 LEU A CG    
3843 C CD1   . LEU C 429 ? 0.5046 0.4575 0.3938 -0.0088 -0.1555 0.0302  725 LEU A CD1   
3844 C CD2   . LEU C 429 ? 0.5087 0.4879 0.4460 -0.0076 -0.1630 0.0215  725 LEU A CD2   
3845 N N     . ASN C 430 ? 0.5914 0.5870 0.5572 0.0145  -0.1939 0.0489  726 ASN A N     
3846 C CA    . ASN C 430 ? 0.6079 0.6098 0.5730 0.0178  -0.2058 0.0540  726 ASN A CA    
3847 C C     . ASN C 430 ? 0.5104 0.5001 0.4406 0.0143  -0.2099 0.0577  726 ASN A C     
3848 O O     . ASN C 430 ? 0.5688 0.5643 0.4894 0.0112  -0.2191 0.0561  726 ASN A O     
3849 C CB    . ASN C 430 ? 0.6630 0.6840 0.6479 0.0154  -0.2130 0.0474  726 ASN A CB    
3850 C CG    . ASN C 430 ? 0.7801 0.8113 0.7713 0.0203  -0.2255 0.0530  726 ASN A CG    
3851 O OD1   . ASN C 430 ? 0.7475 0.7733 0.7370 0.0277  -0.2278 0.0621  726 ASN A OD1   
3852 N ND2   . ASN C 430 ? 0.8809 0.9270 0.8794 0.0162  -0.2337 0.0475  726 ASN A ND2   
3853 N N     . ILE C 431 ? 0.4849 0.4575 0.3953 0.0144  -0.2024 0.0624  727 ILE A N     
3854 C CA    . ILE C 431 ? 0.5764 0.5353 0.4520 0.0105  -0.2032 0.0658  727 ILE A CA    
3855 C C     . ILE C 431 ? 0.6260 0.5710 0.4919 0.0160  -0.2007 0.0768  727 ILE A C     
3856 O O     . ILE C 431 ? 0.7567 0.7015 0.6419 0.0224  -0.1977 0.0808  727 ILE A O     
3857 C CB    . ILE C 431 ? 0.5787 0.5291 0.4343 0.0022  -0.1937 0.0585  727 ILE A CB    
3858 C CG1   . ILE C 431 ? 0.6164 0.5590 0.4779 0.0032  -0.1815 0.0586  727 ILE A CG1   
3859 C CG2   . ILE C 431 ? 0.5125 0.4748 0.3764 -0.0034 -0.1960 0.0476  727 ILE A CG2   
3860 C CD1   . ILE C 431 ? 0.5673 0.5016 0.4094 -0.0041 -0.1714 0.0522  727 ILE A CD1   
3861 N N     . SER C 432 ? 0.6271 0.5597 0.4621 0.0131  -0.2013 0.0813  728 SER A N     
3862 C CA    . SER C 432 ? 0.6026 0.5201 0.4244 0.0171  -0.1985 0.0920  728 SER A CA    
3863 C C     . SER C 432 ? 0.6882 0.5931 0.5064 0.0150  -0.1844 0.0917  728 SER A C     
3864 O O     . SER C 432 ? 0.6230 0.5291 0.4407 0.0095  -0.1769 0.0837  728 SER A O     
3865 C CB    . SER C 432 ? 0.6924 0.6005 0.4810 0.0136  -0.2024 0.0965  728 SER A CB    
3866 O OG    . SER C 432 ? 0.9597 0.8524 0.7351 0.0172  -0.1994 0.1073  728 SER A OG    
3867 N N     . ARG C 433 ? 0.7643 0.6571 0.5801 0.0196  -0.1809 0.1008  729 ARG A N     
3868 C CA    . ARG C 433 ? 0.7636 0.6436 0.5739 0.0169  -0.1676 0.1012  729 ARG A CA    
3869 C C     . ARG C 433 ? 0.7809 0.6499 0.5594 0.0083  -0.1601 0.0997  729 ARG A C     
3870 O O     . ARG C 433 ? 0.8573 0.7235 0.6326 0.0032  -0.1495 0.0942  729 ARG A O     
3871 C CB    . ARG C 433 ? 0.8591 0.7277 0.6741 0.0233  -0.1653 0.1110  729 ARG A CB    
3872 C CG    . ARG C 433 ? 1.0080 0.8867 0.8557 0.0323  -0.1701 0.1119  729 ARG A CG    
3873 C CD    . ARG C 433 ? 1.1640 1.0293 1.0176 0.0376  -0.1636 0.1191  729 ARG A CD    
3874 N NE    . ARG C 433 ? 1.2419 1.1000 1.0971 0.0333  -0.1510 0.1150  729 ARG A NE    
3875 C CZ    . ARG C 433 ? 1.2605 1.1102 1.1280 0.0370  -0.1439 0.1175  729 ARG A CZ    
3876 N NH1   . ARG C 433 ? 1.1936 1.0405 1.0734 0.0456  -0.1475 0.1240  729 ARG A NH1   
3877 N NH2   . ARG C 433 ? 1.2934 1.1377 1.1611 0.0321  -0.1329 0.1133  729 ARG A NH2   
3878 N N     . LYS C 434 ? 0.8274 0.6906 0.5823 0.0068  -0.1649 0.1044  730 LYS A N     
3879 C CA    . LYS C 434 ? 0.9040 0.7578 0.6290 -0.0015 -0.1569 0.1022  730 LYS A CA    
3880 C C     . LYS C 434 ? 0.8565 0.7196 0.5809 -0.0074 -0.1545 0.0901  730 LYS A C     
3881 O O     . LYS C 434 ? 0.7851 0.6427 0.4967 -0.0135 -0.1428 0.0853  730 LYS A O     
3882 C CB    . LYS C 434 ? 1.0101 0.8573 0.7105 -0.0017 -0.1636 0.1091  730 LYS A CB    
3883 C CG    . LYS C 434 ? 1.1580 0.9941 0.8268 -0.0100 -0.1538 0.1075  730 LYS A CG    
3884 C CD    . LYS C 434 ? 1.3453 1.1695 1.0107 -0.0129 -0.1385 0.1094  730 LYS A CD    
3885 C CE    . LYS C 434 ? 1.4566 1.2727 1.0946 -0.0215 -0.1269 0.1060  730 LYS A CE    
3886 N NZ    . LYS C 434 ? 1.4734 1.2810 1.1113 -0.0251 -0.1114 0.1065  730 LYS A NZ    
3887 N N     . GLU C 435 ? 0.7419 0.6195 0.4809 -0.0057 -0.1649 0.0850  731 GLU A N     
3888 C CA    . GLU C 435 ? 0.6611 0.5471 0.4020 -0.0111 -0.1626 0.0733  731 GLU A CA    
3889 C C     . GLU C 435 ? 0.6775 0.5664 0.4369 -0.0112 -0.1535 0.0681  731 GLU A C     
3890 O O     . GLU C 435 ? 0.7386 0.6259 0.4894 -0.0167 -0.1444 0.0607  731 GLU A O     
3891 C CB    . GLU C 435 ? 0.8083 0.7093 0.5625 -0.0096 -0.1759 0.0693  731 GLU A CB    
3892 C CG    . GLU C 435 ? 0.9690 0.8687 0.7025 -0.0106 -0.1855 0.0729  731 GLU A CG    
3893 C CD    . GLU C 435 ? 1.1497 1.0658 0.8988 -0.0089 -0.1993 0.0696  731 GLU A CD    
3894 O OE1   . GLU C 435 ? 1.1545 1.0822 0.9338 -0.0040 -0.2033 0.0691  731 GLU A OE1   
3895 O OE2   . GLU C 435 ? 1.2539 1.1716 0.9853 -0.0127 -0.2058 0.0671  731 GLU A OE2   
3896 N N     . ALA C 436 ? 0.5572 0.4502 0.3417 -0.0049 -0.1555 0.0719  732 ALA A N     
3897 C CA    . ALA C 436 ? 0.6531 0.5481 0.4541 -0.0047 -0.1469 0.0680  732 ALA A CA    
3898 C C     . ALA C 436 ? 0.6722 0.5534 0.4552 -0.0085 -0.1338 0.0702  732 ALA A C     
3899 O O     . ALA C 436 ? 0.6476 0.5296 0.4313 -0.0120 -0.1247 0.0642  732 ALA A O     
3900 C CB    . ALA C 436 ? 0.5678 0.4690 0.3983 0.0031  -0.1509 0.0718  732 ALA A CB    
3901 N N     . ALA C 437 ? 0.5587 0.4276 0.3256 -0.0081 -0.1324 0.0788  733 ALA A N     
3902 C CA    . ALA C 437 ? 0.6615 0.5177 0.4099 -0.0131 -0.1192 0.0808  733 ALA A CA    
3903 C C     . ALA C 437 ? 0.6781 0.5339 0.4056 -0.0205 -0.1120 0.0734  733 ALA A C     
3904 O O     . ALA C 437 ? 0.7400 0.5926 0.4615 -0.0250 -0.0993 0.0701  733 ALA A O     
3905 C CB    . ALA C 437 ? 0.5994 0.4424 0.3339 -0.0116 -0.1196 0.0914  733 ALA A CB    
3906 N N     . GLU C 438 ? 0.6864 0.5459 0.4032 -0.0219 -0.1195 0.0704  734 GLU A N     
3907 C CA    . GLU C 438 ? 0.7041 0.5631 0.4022 -0.0284 -0.1123 0.0623  734 GLU A CA    
3908 C C     . GLU C 438 ? 0.5734 0.4412 0.2852 -0.0299 -0.1071 0.0522  734 GLU A C     
3909 O O     . GLU C 438 ? 0.6175 0.4830 0.3190 -0.0345 -0.0948 0.0464  734 GLU A O     
3910 C CB    . GLU C 438 ? 0.8290 0.6901 0.5136 -0.0295 -0.1223 0.0609  734 GLU A CB    
3911 C CG    . GLU C 438 ? 1.0270 0.8790 0.6945 -0.0282 -0.1274 0.0712  734 GLU A CG    
3912 C CD    . GLU C 438 ? 1.1776 1.0333 0.8330 -0.0289 -0.1390 0.0700  734 GLU A CD    
3913 O OE1   . GLU C 438 ? 1.2125 1.0779 0.8743 -0.0306 -0.1433 0.0610  734 GLU A OE1   
3914 O OE2   . GLU C 438 ? 1.1724 1.0210 0.8114 -0.0279 -0.1438 0.0782  734 GLU A OE2   
3915 N N     . PHE C 439 ? 0.5683 0.4467 0.3044 -0.0258 -0.1157 0.0498  735 PHE A N     
3916 C CA    . PHE C 439 ? 0.5205 0.4066 0.2705 -0.0268 -0.1110 0.0409  735 PHE A CA    
3917 C C     . PHE C 439 ? 0.6210 0.5037 0.3739 -0.0274 -0.0983 0.0415  735 PHE A C     
3918 O O     . PHE C 439 ? 0.5917 0.4781 0.3460 -0.0301 -0.0863 0.0335  735 PHE A O     
3919 C CB    . PHE C 439 ? 0.6442 0.5425 0.4224 -0.0221 -0.1219 0.0395  735 PHE A CB    
3920 C CG    . PHE C 439 ? 0.7513 0.6571 0.5309 -0.0232 -0.1320 0.0347  735 PHE A CG    
3921 C CD1   . PHE C 439 ? 0.8434 0.7615 0.6490 -0.0194 -0.1420 0.0340  735 PHE A CD1   
3922 C CD2   . PHE C 439 ? 0.7855 0.6867 0.5414 -0.0284 -0.1311 0.0307  735 PHE A CD2   
3923 C CE1   . PHE C 439 ? 0.7997 0.7257 0.6075 -0.0213 -0.1511 0.0294  735 PHE A CE1   
3924 C CE2   . PHE C 439 ? 0.8940 0.8022 0.6509 -0.0300 -0.1407 0.0260  735 PHE A CE2   
3925 C CZ    . PHE C 439 ? 0.8365 0.7572 0.6194 -0.0267 -0.1509 0.0254  735 PHE A CZ    
3926 N N     . ILE C 440 ? 0.6171 0.4961 0.3787 -0.0240 -0.0978 0.0497  736 ILE A N     
3927 C CA    . ILE C 440 ? 0.5582 0.4385 0.3321 -0.0242 -0.0835 0.0490  736 ILE A CA    
3928 C C     . ILE C 440 ? 0.5143 0.3878 0.2658 -0.0304 -0.0704 0.0472  736 ILE A C     
3929 O O     . ILE C 440 ? 0.5924 0.4726 0.3534 -0.0320 -0.0579 0.0409  736 ILE A O     
3930 C CB    . ILE C 440 ? 0.5482 0.4226 0.3314 -0.0202 -0.0859 0.0582  736 ILE A CB    
3931 C CG1   . ILE C 440 ? 0.5472 0.4285 0.3520 -0.0134 -0.0992 0.0601  736 ILE A CG1   
3932 C CG2   . ILE C 440 ? 0.6489 0.5258 0.4463 -0.0211 -0.0720 0.0562  736 ILE A CG2   
3933 C CD1   . ILE C 440 ? 0.5941 0.4901 0.4294 -0.0105 -0.0954 0.0526  736 ILE A CD1   
3934 N N     . GLU C 441 ? 0.6380 0.4985 0.3598 -0.0340 -0.0729 0.0529  737 GLU A N     
3935 C CA    . GLU C 441 ? 0.6978 0.5531 0.4015 -0.0399 -0.0585 0.0511  737 GLU A CA    
3936 C C     . GLU C 441 ? 0.6921 0.5534 0.3900 -0.0428 -0.0522 0.0402  737 GLU A C     
3937 O O     . GLU C 441 ? 0.5934 0.4565 0.2889 -0.0461 -0.0381 0.0358  737 GLU A O     
3938 C CB    . GLU C 441 ? 0.8591 0.7038 0.5428 -0.0416 -0.0598 0.0582  737 GLU A CB    
3939 C CG    . GLU C 441 ? 0.9999 0.8389 0.6694 -0.0475 -0.0440 0.0582  737 GLU A CG    
3940 C CD    . GLU C 441 ? 1.1141 0.9571 0.7979 -0.0491 -0.0323 0.0566  737 GLU A CD    
3941 O OE1   . GLU C 441 ? 1.1268 0.9676 0.8237 -0.0467 -0.0354 0.0622  737 GLU A OE1   
3942 O OE2   . GLU C 441 ? 1.0781 0.9272 0.7612 -0.0526 -0.0199 0.0493  737 GLU A OE2   
3943 N N     . ARG C 442 ? 0.6801 0.5453 0.3777 -0.0415 -0.0621 0.0355  738 ARG A N     
3944 C CA    . ARG C 442 ? 0.6592 0.5292 0.3543 -0.0437 -0.0562 0.0244  738 ARG A CA    
3945 C C     . ARG C 442 ? 0.5515 0.4323 0.2721 -0.0411 -0.0479 0.0185  738 ARG A C     
3946 O O     . ARG C 442 ? 0.5728 0.4567 0.2932 -0.0427 -0.0355 0.0114  738 ARG A O     
3947 C CB    . ARG C 442 ? 0.6201 0.4933 0.3155 -0.0429 -0.0690 0.0201  738 ARG A CB    
3948 C CG    . ARG C 442 ? 0.7100 0.5773 0.3848 -0.0451 -0.0744 0.0225  738 ARG A CG    
3949 C CD    . ARG C 442 ? 0.8368 0.6975 0.4902 -0.0496 -0.0608 0.0197  738 ARG A CD    
3950 N NE    . ARG C 442 ? 1.0147 0.8680 0.6586 -0.0504 -0.0559 0.0291  738 ARG A NE    
3951 C CZ    . ARG C 442 ? 1.1026 0.9493 0.7342 -0.0501 -0.0641 0.0374  738 ARG A CZ    
3952 N NH1   . ARG C 442 ? 1.1405 0.9888 0.7684 -0.0489 -0.0779 0.0375  738 ARG A NH1   
3953 N NH2   . ARG C 442 ? 1.0743 0.9131 0.6978 -0.0512 -0.0585 0.0457  738 ARG A NH2   
3954 N N     . TYR C 443 ? 0.4551 0.3435 0.2021 -0.0362 -0.0538 0.0213  739 TYR A N     
3955 C CA    . TYR C 443 ? 0.4632 0.3634 0.2375 -0.0331 -0.0460 0.0162  739 TYR A CA    
3956 C C     . TYR C 443 ? 0.5506 0.4521 0.3261 -0.0349 -0.0314 0.0168  739 TYR A C     
3957 O O     . TYR C 443 ? 0.4442 0.3532 0.2290 -0.0345 -0.0212 0.0102  739 TYR A O     
3958 C CB    . TYR C 443 ? 0.4492 0.3560 0.2488 -0.0281 -0.0545 0.0197  739 TYR A CB    
3959 C CG    . TYR C 443 ? 0.4810 0.3992 0.3063 -0.0252 -0.0470 0.0150  739 TYR A CG    
3960 C CD1   . TYR C 443 ? 0.4217 0.3475 0.2611 -0.0232 -0.0488 0.0083  739 TYR A CD1   
3961 C CD2   . TYR C 443 ? 0.4744 0.3953 0.3088 -0.0249 -0.0380 0.0172  739 TYR A CD2   
3962 C CE1   . TYR C 443 ? 0.4076 0.3429 0.2687 -0.0203 -0.0420 0.0049  739 TYR A CE1   
3963 C CE2   . TYR C 443 ? 0.4708 0.4024 0.3270 -0.0223 -0.0318 0.0132  739 TYR A CE2   
3964 C CZ    . TYR C 443 ? 0.3924 0.3309 0.2612 -0.0197 -0.0339 0.0074  739 TYR A CZ    
3965 O OH    . TYR C 443 ? 0.3615 0.3097 0.2500 -0.0170 -0.0280 0.0043  739 TYR A OH    
3966 N N     . PHE C 444 ? 0.4282 0.3223 0.1953 -0.0367 -0.0304 0.0248  740 PHE A N     
3967 C CA    . PHE C 444 ? 0.5140 0.4100 0.2832 -0.0396 -0.0167 0.0252  740 PHE A CA    
3968 C C     . PHE C 444 ? 0.5426 0.4360 0.2921 -0.0443 -0.0057 0.0208  740 PHE A C     
3969 O O     . PHE C 444 ? 0.6438 0.5447 0.4014 -0.0457 0.0069  0.0174  740 PHE A O     
3970 C CB    . PHE C 444 ? 0.4678 0.3544 0.2321 -0.0412 -0.0182 0.0348  740 PHE A CB    
3971 C CG    . PHE C 444 ? 0.4040 0.2947 0.1922 -0.0365 -0.0244 0.0377  740 PHE A CG    
3972 C CD1   . PHE C 444 ? 0.4283 0.3327 0.2420 -0.0332 -0.0214 0.0318  740 PHE A CD1   
3973 C CD2   . PHE C 444 ? 0.5881 0.4683 0.3725 -0.0349 -0.0331 0.0464  740 PHE A CD2   
3974 C CE1   . PHE C 444 ? 0.4180 0.3258 0.2521 -0.0292 -0.0261 0.0337  740 PHE A CE1   
3975 C CE2   . PHE C 444 ? 0.4694 0.3530 0.2761 -0.0302 -0.0377 0.0482  740 PHE A CE2   
3976 C CZ    . PHE C 444 ? 0.4257 0.3232 0.2568 -0.0277 -0.0338 0.0415  740 PHE A CZ    
3977 N N     . GLU C 445 ? 0.5341 0.4179 0.2582 -0.0467 -0.0102 0.0205  741 GLU A N     
3978 C CA    . GLU C 445 ? 0.6111 0.4928 0.3171 -0.0506 0.0008  0.0143  741 GLU A CA    
3979 C C     . GLU C 445 ? 0.6422 0.5355 0.3660 -0.0472 0.0068  0.0041  741 GLU A C     
3980 O O     . GLU C 445 ? 0.5772 0.4747 0.3003 -0.0485 0.0204  -0.0011 741 GLU A O     
3981 C CB    . GLU C 445 ? 0.8056 0.6771 0.4866 -0.0527 -0.0066 0.0146  741 GLU A CB    
3982 C CG    . GLU C 445 ? 1.0125 0.8745 0.6775 -0.0555 -0.0076 0.0234  741 GLU A CG    
3983 C CD    . GLU C 445 ? 1.2672 1.1227 0.9112 -0.0571 -0.0122 0.0220  741 GLU A CD    
3984 O OE1   . GLU C 445 ? 1.3224 1.1809 0.9633 -0.0574 -0.0097 0.0129  741 GLU A OE1   
3985 O OE2   . GLU C 445 ? 1.3556 1.2027 0.9861 -0.0582 -0.0182 0.0300  741 GLU A OE2   
3986 N N     . SER C 446 ? 0.5594 0.4578 0.2995 -0.0428 -0.0028 0.0013  742 SER A N     
3987 C CA    . SER C 446 ? 0.5144 0.4215 0.2704 -0.0394 0.0022  -0.0076 742 SER A CA    
3988 C C     . SER C 446 ? 0.4895 0.4096 0.2735 -0.0356 0.0088  -0.0076 742 SER A C     
3989 O O     . SER C 446 ? 0.4399 0.3673 0.2344 -0.0331 0.0176  -0.0138 742 SER A O     
3990 C CB    . SER C 446 ? 0.6072 0.5136 0.3684 -0.0372 -0.0101 -0.0107 742 SER A CB    
3991 O OG    . SER C 446 ? 0.7744 0.6703 0.5097 -0.0411 -0.0154 -0.0132 742 SER A OG    
3992 N N     . PHE C 447 ? 0.4070 0.3298 0.2029 -0.0348 0.0046  -0.0008 743 PHE A N     
3993 C CA    . PHE C 447 ? 0.4010 0.3359 0.2222 -0.0318 0.0093  -0.0008 743 PHE A CA    
3994 C C     . PHE C 447 ? 0.4812 0.4156 0.3007 -0.0355 0.0147  0.0049  743 PHE A C     
3995 O O     . PHE C 447 ? 0.4316 0.3661 0.2611 -0.0349 0.0098  0.0100  743 PHE A O     
3996 C CB    . PHE C 447 ? 0.3681 0.3073 0.2084 -0.0274 -0.0007 0.0002  743 PHE A CB    
3997 C CG    . PHE C 447 ? 0.3665 0.3059 0.2095 -0.0248 -0.0053 -0.0055 743 PHE A CG    
3998 C CD1   . PHE C 447 ? 0.4069 0.3383 0.2377 -0.0261 -0.0158 -0.0051 743 PHE A CD1   
3999 C CD2   . PHE C 447 ? 0.4288 0.3763 0.2861 -0.0214 0.0009  -0.0112 743 PHE A CD2   
4000 C CE1   . PHE C 447 ? 0.4129 0.3444 0.2464 -0.0249 -0.0197 -0.0110 743 PHE A CE1   
4001 C CE2   . PHE C 447 ? 0.4889 0.4347 0.3481 -0.0196 -0.0025 -0.0165 743 PHE A CE2   
4002 C CZ    . PHE C 447 ? 0.5423 0.4802 0.3899 -0.0219 -0.0126 -0.0168 743 PHE A CZ    
4003 N N     . PRO C 448 ? 0.4819 0.4155 0.2891 -0.0397 0.0256  0.0038  744 PRO A N     
4004 C CA    . PRO C 448 ? 0.5115 0.4435 0.3158 -0.0447 0.0315  0.0093  744 PRO A CA    
4005 C C     . PRO C 448 ? 0.3549 0.2992 0.1844 -0.0435 0.0341  0.0095  744 PRO A C     
4006 O O     . PRO C 448 ? 0.3428 0.2835 0.1728 -0.0471 0.0347  0.0147  744 PRO A O     
4007 C CB    . PRO C 448 ? 0.4798 0.4118 0.2696 -0.0490 0.0446  0.0060  744 PRO A CB    
4008 C CG    . PRO C 448 ? 0.4551 0.3944 0.2510 -0.0443 0.0476  -0.0025 744 PRO A CG    
4009 C CD    . PRO C 448 ? 0.4293 0.3632 0.2254 -0.0403 0.0342  -0.0028 744 PRO A CD    
4010 N N     . GLY C 449 ? 0.3518 0.3095 0.2012 -0.0386 0.0357  0.0040  745 GLY A N     
4011 C CA    . GLY C 449 ? 0.3581 0.3277 0.2300 -0.0375 0.0369  0.0041  745 GLY A CA    
4012 C C     . GLY C 449 ? 0.3314 0.2966 0.2110 -0.0354 0.0264  0.0080  745 GLY A C     
4013 O O     . GLY C 449 ? 0.3087 0.2772 0.1990 -0.0371 0.0271  0.0100  745 GLY A O     
4014 N N     . VAL C 450 ? 0.4090 0.3670 0.2839 -0.0319 0.0170  0.0086  746 VAL A N     
4015 C CA    . VAL C 450 ? 0.3539 0.3074 0.2361 -0.0297 0.0076  0.0125  746 VAL A CA    
4016 C C     . VAL C 450 ? 0.2936 0.2346 0.1633 -0.0339 0.0060  0.0194  746 VAL A C     
4017 O O     . VAL C 450 ? 0.3112 0.2505 0.1901 -0.0338 0.0040  0.0224  746 VAL A O     
4018 C CB    . VAL C 450 ? 0.3125 0.2630 0.1942 -0.0254 -0.0021 0.0113  746 VAL A CB    
4019 C CG1   . VAL C 450 ? 0.2496 0.1969 0.1409 -0.0227 -0.0112 0.0154  746 VAL A CG1   
4020 C CG2   . VAL C 450 ? 0.2927 0.2537 0.1871 -0.0216 0.0004  0.0049  746 VAL A CG2   
4021 N N     . LYS C 451 ? 0.3036 0.2345 0.1511 -0.0376 0.0073  0.0220  747 LYS A N     
4022 C CA    . LYS C 451 ? 0.3918 0.3088 0.2250 -0.0416 0.0064  0.0295  747 LYS A CA    
4023 C C     . LYS C 451 ? 0.4324 0.3525 0.2729 -0.0466 0.0159  0.0303  747 LYS A C     
4024 O O     . LYS C 451 ? 0.3874 0.2993 0.2297 -0.0480 0.0140  0.0353  747 LYS A O     
4025 C CB    . LYS C 451 ? 0.3737 0.2796 0.1794 -0.0452 0.0073  0.0320  747 LYS A CB    
4026 C CG    . LYS C 451 ? 0.4275 0.3172 0.2156 -0.0497 0.0070  0.0409  747 LYS A CG    
4027 C CD    . LYS C 451 ? 0.5716 0.4502 0.3299 -0.0537 0.0086  0.0434  747 LYS A CD    
4028 C CE    . LYS C 451 ? 0.6435 0.5045 0.3831 -0.0582 0.0087  0.0534  747 LYS A CE    
4029 N NZ    . LYS C 451 ? 0.7059 0.5564 0.4145 -0.0634 0.0129  0.0558  747 LYS A NZ    
4030 N N     . ARG C 452 ? 0.3843 0.3162 0.2298 -0.0493 0.0263  0.0250  748 ARG A N     
4031 C CA    . ARG C 452 ? 0.4132 0.3516 0.2689 -0.0545 0.0350  0.0246  748 ARG A CA    
4032 C C     . ARG C 452 ? 0.4608 0.4052 0.3374 -0.0518 0.0307  0.0235  748 ARG A C     
4033 O O     . ARG C 452 ? 0.4021 0.3420 0.2820 -0.0561 0.0327  0.0261  748 ARG A O     
4034 C CB    . ARG C 452 ? 0.3945 0.3483 0.2559 -0.0563 0.0457  0.0185  748 ARG A CB    
4035 C CG    . ARG C 452 ? 0.5595 0.5281 0.4407 -0.0593 0.0521  0.0155  748 ARG A CG    
4036 C CD    . ARG C 452 ? 0.7804 0.7656 0.6688 -0.0599 0.0620  0.0099  748 ARG A CD    
4037 N NE    . ARG C 452 ? 0.8597 0.8629 0.7708 -0.0607 0.0651  0.0063  748 ARG A NE    
4038 C CZ    . ARG C 452 ? 0.8249 0.8331 0.7415 -0.0686 0.0716  0.0067  748 ARG A CZ    
4039 N NH1   . ARG C 452 ? 0.8157 0.8108 0.7164 -0.0763 0.0768  0.0110  748 ARG A NH1   
4040 N NH2   . ARG C 452 ? 0.7014 0.7273 0.6389 -0.0691 0.0728  0.0030  748 ARG A NH2   
4041 N N     . TYR C 453 ? 0.3389 0.2921 0.2288 -0.0450 0.0250  0.0197  749 TYR A N     
4042 C CA    . TYR C 453 ? 0.3614 0.3200 0.2694 -0.0424 0.0215  0.0184  749 TYR A CA    
4043 C C     . TYR C 453 ? 0.3841 0.3277 0.2888 -0.0416 0.0144  0.0239  749 TYR A C     
4044 O O     . TYR C 453 ? 0.3598 0.3020 0.2733 -0.0433 0.0152  0.0242  749 TYR A O     
4045 C CB    . TYR C 453 ? 0.2660 0.2359 0.1871 -0.0356 0.0176  0.0138  749 TYR A CB    
4046 C CG    . TYR C 453 ? 0.3577 0.3283 0.2926 -0.0322 0.0120  0.0137  749 TYR A CG    
4047 C CD1   . TYR C 453 ? 0.3143 0.2940 0.2625 -0.0338 0.0153  0.0110  749 TYR A CD1   
4048 C CD2   . TYR C 453 ? 0.3574 0.3196 0.2915 -0.0277 0.0034  0.0162  749 TYR A CD2   
4049 C CE1   . TYR C 453 ? 0.3921 0.3713 0.3510 -0.0311 0.0111  0.0105  749 TYR A CE1   
4050 C CE2   . TYR C 453 ? 0.3857 0.3486 0.3328 -0.0245 -0.0004 0.0159  749 TYR A CE2   
4051 C CZ    . TYR C 453 ? 0.3852 0.3559 0.3437 -0.0263 0.0038  0.0129  749 TYR A CZ    
4052 O OH    . TYR C 453 ? 0.4433 0.4137 0.4130 -0.0233 0.0009  0.0120  749 TYR A OH    
4053 N N     . MET C 454 ? 0.2855 0.2180 0.1780 -0.0386 0.0072  0.0279  750 MET A N     
4054 C CA    . MET C 454 ? 0.3091 0.2277 0.1993 -0.0365 -0.0002 0.0338  750 MET A CA    
4055 C C     . MET C 454 ? 0.3847 0.2903 0.2653 -0.0426 0.0047  0.0390  750 MET A C     
4056 O O     . MET C 454 ? 0.3663 0.2641 0.2533 -0.0421 0.0030  0.0414  750 MET A O     
4057 C CB    . MET C 454 ? 0.3342 0.2449 0.2122 -0.0325 -0.0095 0.0376  750 MET A CB    
4058 C CG    . MET C 454 ? 0.5241 0.4456 0.4120 -0.0270 -0.0150 0.0327  750 MET A CG    
4059 S SD    . MET C 454 ? 0.5967 0.5262 0.5103 -0.0213 -0.0189 0.0299  750 MET A SD    
4060 C CE    . MET C 454 ? 0.6619 0.6023 0.5825 -0.0169 -0.0236 0.0246  750 MET A CE    
4061 N N     . GLU C 455 ? 0.3778 0.2801 0.2427 -0.0487 0.0115  0.0405  751 GLU A N     
4062 C CA    . GLU C 455 ? 0.5098 0.3995 0.3656 -0.0558 0.0175  0.0454  751 GLU A CA    
4063 C C     . GLU C 455 ? 0.4366 0.3354 0.3089 -0.0606 0.0250  0.0406  751 GLU A C     
4064 O O     . GLU C 455 ? 0.4066 0.2943 0.2802 -0.0638 0.0263  0.0434  751 GLU A O     
4065 C CB    . GLU C 455 ? 0.5314 0.4157 0.3658 -0.0618 0.0241  0.0481  751 GLU A CB    
4066 C CG    . GLU C 455 ? 0.5873 0.4647 0.4037 -0.0577 0.0166  0.0513  751 GLU A CG    
4067 C CD    . GLU C 455 ? 0.7454 0.6195 0.5402 -0.0637 0.0244  0.0522  751 GLU A CD    
4068 O OE1   . GLU C 455 ? 0.7776 0.6350 0.5492 -0.0652 0.0214  0.0596  751 GLU A OE1   
4069 O OE2   . GLU C 455 ? 0.6892 0.5774 0.4901 -0.0666 0.0338  0.0457  751 GLU A OE2   
4070 N N     . ASN C 456 ? 0.3939 0.3125 0.2791 -0.0609 0.0295  0.0333  752 ASN A N     
4071 C CA    . ASN C 456 ? 0.4179 0.3470 0.3177 -0.0663 0.0361  0.0286  752 ASN A CA    
4072 C C     . ASN C 456 ? 0.4037 0.3324 0.3180 -0.0629 0.0309  0.0266  752 ASN A C     
4073 O O     . ASN C 456 ? 0.3894 0.3165 0.3099 -0.0686 0.0348  0.0251  752 ASN A O     
4074 C CB    . ASN C 456 ? 0.4211 0.3725 0.3316 -0.0664 0.0412  0.0219  752 ASN A CB    
4075 C CG    . ASN C 456 ? 0.4030 0.3566 0.3024 -0.0721 0.0501  0.0224  752 ASN A CG    
4076 O OD1   . ASN C 456 ? 0.4999 0.4385 0.3833 -0.0777 0.0535  0.0277  752 ASN A OD1   
4077 N ND2   . ASN C 456 ? 0.5089 0.4808 0.4168 -0.0705 0.0544  0.0171  752 ASN A ND2   
4078 N N     . ILE C 457 ? 0.2919 0.2225 0.2119 -0.0543 0.0229  0.0260  753 ILE A N     
4079 C CA    . ILE C 457 ? 0.3432 0.2746 0.2772 -0.0509 0.0192  0.0234  753 ILE A CA    
4080 C C     . ILE C 457 ? 0.3842 0.2952 0.3131 -0.0512 0.0169  0.0286  753 ILE A C     
4081 O O     . ILE C 457 ? 0.3224 0.2302 0.2599 -0.0525 0.0181  0.0262  753 ILE A O     
4082 C CB    . ILE C 457 ? 0.2529 0.1930 0.1954 -0.0421 0.0124  0.0211  753 ILE A CB    
4083 C CG1   . ILE C 457 ? 0.3470 0.2916 0.3046 -0.0395 0.0110  0.0170  753 ILE A CG1   
4084 C CG2   . ILE C 457 ? 0.3477 0.2757 0.2812 -0.0368 0.0049  0.0266  753 ILE A CG2   
4085 C CD1   . ILE C 457 ? 0.3750 0.3339 0.3418 -0.0443 0.0167  0.0111  753 ILE A CD1   
4086 N N     . VAL C 458 ? 0.4100 0.3061 0.3239 -0.0497 0.0133  0.0358  754 VAL A N     
4087 C CA    . VAL C 458 ? 0.3254 0.2004 0.2331 -0.0496 0.0114  0.0421  754 VAL A CA    
4088 C C     . VAL C 458 ? 0.3872 0.2543 0.2914 -0.0595 0.0204  0.0421  754 VAL A C     
4089 O O     . VAL C 458 ? 0.3574 0.2127 0.2661 -0.0606 0.0214  0.0424  754 VAL A O     
4090 C CB    . VAL C 458 ? 0.4250 0.2864 0.3153 -0.0463 0.0053  0.0507  754 VAL A CB    
4091 C CG1   . VAL C 458 ? 0.4181 0.2559 0.2977 -0.0484 0.0058  0.0586  754 VAL A CG1   
4092 C CG2   . VAL C 458 ? 0.4104 0.2764 0.3075 -0.0364 -0.0052 0.0510  754 VAL A CG2   
4093 N N     . GLN C 459 ? 0.3652 0.2385 0.2618 -0.0671 0.0275  0.0414  755 GLN A N     
4094 C CA    . GLN C 459 ? 0.3580 0.2253 0.2524 -0.0777 0.0366  0.0410  755 GLN A CA    
4095 C C     . GLN C 459 ? 0.3445 0.2249 0.2572 -0.0811 0.0397  0.0324  755 GLN A C     
4096 O O     . GLN C 459 ? 0.3759 0.2466 0.2903 -0.0881 0.0443  0.0314  755 GLN A O     
4097 C CB    . GLN C 459 ? 0.4508 0.3239 0.3344 -0.0851 0.0443  0.0419  755 GLN A CB    
4098 C CG    . GLN C 459 ? 0.7753 0.6300 0.6358 -0.0849 0.0432  0.0513  755 GLN A CG    
4099 C CD    . GLN C 459 ? 0.9173 0.7454 0.7681 -0.0861 0.0419  0.0592  755 GLN A CD    
4100 O OE1   . GLN C 459 ? 0.9297 0.7492 0.7811 -0.0947 0.0493  0.0591  755 GLN A OE1   
4101 N NE2   . GLN C 459 ? 0.9338 0.7485 0.7763 -0.0773 0.0322  0.0659  755 GLN A NE2   
4102 N N     . GLU C 460 ? 0.3131 0.2147 0.2388 -0.0765 0.0371  0.0260  756 GLU A N     
4103 C CA    . GLU C 460 ? 0.4043 0.3186 0.3458 -0.0788 0.0385  0.0181  756 GLU A CA    
4104 C C     . GLU C 460 ? 0.3073 0.2087 0.2537 -0.0746 0.0345  0.0176  756 GLU A C     
4105 O O     . GLU C 460 ? 0.3860 0.2861 0.3390 -0.0800 0.0377  0.0127  756 GLU A O     
4106 C CB    . GLU C 460 ? 0.3365 0.2747 0.2887 -0.0738 0.0363  0.0129  756 GLU A CB    
4107 C CG    . GLU C 460 ? 0.4625 0.4152 0.4293 -0.0757 0.0368  0.0053  756 GLU A CG    
4108 C CD    . GLU C 460 ? 0.7147 0.6892 0.6909 -0.0698 0.0342  0.0015  756 GLU A CD    
4109 O OE1   . GLU C 460 ? 0.6871 0.6634 0.6593 -0.0634 0.0315  0.0043  756 GLU A OE1   
4110 O OE2   . GLU C 460 ? 0.7733 0.7623 0.7602 -0.0718 0.0347  -0.0042 756 GLU A OE2   
4111 N N     . ALA C 461 ? 0.3595 0.2520 0.3035 -0.0651 0.0276  0.0220  757 ALA A N     
4112 C CA    . ALA C 461 ? 0.3707 0.2504 0.3203 -0.0603 0.0245  0.0219  757 ALA A CA    
4113 C C     . ALA C 461 ? 0.3823 0.2393 0.3247 -0.0663 0.0288  0.0251  757 ALA A C     
4114 O O     . ALA C 461 ? 0.3201 0.1697 0.2691 -0.0677 0.0308  0.0210  757 ALA A O     
4115 C CB    . ALA C 461 ? 0.3631 0.2383 0.3122 -0.0492 0.0161  0.0268  757 ALA A CB    
4116 N N     . LYS C 462 ? 0.3409 0.1856 0.2686 -0.0702 0.0308  0.0324  758 LYS A N     
4117 C CA    . LYS C 462 ? 0.4669 0.2877 0.3860 -0.0763 0.0355  0.0367  758 LYS A CA    
4118 C C     . LYS C 462 ? 0.4313 0.2562 0.3549 -0.0888 0.0443  0.0298  758 LYS A C     
4119 O O     . LYS C 462 ? 0.4182 0.2261 0.3423 -0.0932 0.0479  0.0286  758 LYS A O     
4120 C CB    . LYS C 462 ? 0.5242 0.3312 0.4244 -0.0780 0.0358  0.0468  758 LYS A CB    
4121 C CG    . LYS C 462 ? 0.6140 0.4154 0.5071 -0.0668 0.0262  0.0545  758 LYS A CG    
4122 C CD    . LYS C 462 ? 0.7629 0.5475 0.6340 -0.0697 0.0269  0.0649  758 LYS A CD    
4123 C CE    . LYS C 462 ? 0.7747 0.5606 0.6374 -0.0602 0.0169  0.0710  758 LYS A CE    
4124 N NZ    . LYS C 462 ? 0.7410 0.5181 0.6107 -0.0487 0.0071  0.0746  758 LYS A NZ    
4125 N N     . GLN C 463 ? 0.3363 0.1832 0.2636 -0.0948 0.0478  0.0250  759 GLN A N     
4126 C CA    . GLN C 463 ? 0.4317 0.2852 0.3644 -0.1075 0.0556  0.0186  759 GLN A CA    
4127 C C     . GLN C 463 ? 0.3693 0.2323 0.3162 -0.1076 0.0543  0.0090  759 GLN A C     
4128 O O     . GLN C 463 ? 0.3985 0.2518 0.3474 -0.1158 0.0587  0.0048  759 GLN A O     
4129 C CB    . GLN C 463 ? 0.4125 0.2882 0.3464 -0.1130 0.0596  0.0169  759 GLN A CB    
4130 C CG    . GLN C 463 ? 0.4936 0.3815 0.4363 -0.1262 0.0669  0.0097  759 GLN A CG    
4131 C CD    . GLN C 463 ? 0.5337 0.4503 0.4928 -0.1249 0.0642  0.0007  759 GLN A CD    
4132 O OE1   . GLN C 463 ? 0.5995 0.5348 0.5624 -0.1186 0.0615  0.0005  759 GLN A OE1   
4133 N NE2   . GLN C 463 ? 0.4731 0.3923 0.4410 -0.1310 0.0649  -0.0067 759 GLN A NE2   
4134 N N     . LYS C 464 ? 0.3628 0.2440 0.3187 -0.0992 0.0486  0.0053  760 LYS A N     
4135 C CA    . LYS C 464 ? 0.3806 0.2719 0.3480 -0.0995 0.0476  -0.0036 760 LYS A CA    
4136 C C     . LYS C 464 ? 0.3250 0.1988 0.2935 -0.0923 0.0447  -0.0039 760 LYS A C     
4137 O O     . LYS C 464 ? 0.3448 0.2169 0.3186 -0.0957 0.0465  -0.0112 760 LYS A O     
4138 C CB    . LYS C 464 ? 0.3830 0.3016 0.3592 -0.0943 0.0437  -0.0073 760 LYS A CB    
4139 C CG    . LYS C 464 ? 0.5067 0.4453 0.4855 -0.1013 0.0471  -0.0089 760 LYS A CG    
4140 C CD    . LYS C 464 ? 0.6117 0.5760 0.6001 -0.0957 0.0433  -0.0127 760 LYS A CD    
4141 C CE    . LYS C 464 ? 0.6960 0.6812 0.6897 -0.1024 0.0472  -0.0148 760 LYS A CE    
4142 N NZ    . LYS C 464 ? 0.7364 0.7442 0.7380 -0.0950 0.0435  -0.0163 760 LYS A NZ    
4143 N N     . GLY C 465 ? 0.3294 0.1903 0.2931 -0.0826 0.0404  0.0036  761 GLY A N     
4144 C CA    . GLY C 465 ? 0.3393 0.1860 0.3066 -0.0742 0.0376  0.0037  761 GLY A CA    
4145 C C     . GLY C 465 ? 0.3602 0.2220 0.3368 -0.0639 0.0319  0.0014  761 GLY A C     
4146 O O     . GLY C 465 ? 0.3578 0.2100 0.3392 -0.0561 0.0297  0.0015  761 GLY A O     
4147 N N     . TYR C 466 ? 0.2484 0.1328 0.2280 -0.0635 0.0300  -0.0004 762 TYR A N     
4148 C CA    . TYR C 466 ? 0.2796 0.1787 0.2675 -0.0549 0.0254  -0.0027 762 TYR A CA    
4149 C C     . TYR C 466 ? 0.2778 0.1947 0.2645 -0.0539 0.0232  -0.0007 762 TYR A C     
4150 O O     . TYR C 466 ? 0.3406 0.2613 0.3216 -0.0604 0.0260  0.0007  762 TYR A O     
4151 C CB    . TYR C 466 ? 0.3472 0.2555 0.3428 -0.0570 0.0276  -0.0118 762 TYR A CB    
4152 C CG    . TYR C 466 ? 0.2243 0.1475 0.2200 -0.0669 0.0308  -0.0171 762 TYR A CG    
4153 C CD1   . TYR C 466 ? 0.2897 0.2357 0.2894 -0.0657 0.0288  -0.0187 762 TYR A CD1   
4154 C CD2   . TYR C 466 ? 0.3390 0.2537 0.3317 -0.0773 0.0358  -0.0205 762 TYR A CD2   
4155 C CE1   . TYR C 466 ? 0.2970 0.2586 0.2988 -0.0740 0.0310  -0.0233 762 TYR A CE1   
4156 C CE2   . TYR C 466 ? 0.3957 0.3264 0.3905 -0.0868 0.0381  -0.0256 762 TYR A CE2   
4157 C CZ    . TYR C 466 ? 0.3909 0.3457 0.3907 -0.0847 0.0353  -0.0269 762 TYR A CZ    
4158 O OH    . TYR C 466 ? 0.3587 0.3310 0.3624 -0.0934 0.0369  -0.0316 762 TYR A OH    
4159 N N     . VAL C 467 ? 0.2745 0.2018 0.2669 -0.0457 0.0187  -0.0008 763 VAL A N     
4160 C CA    . VAL C 467 ? 0.2595 0.2044 0.2526 -0.0440 0.0170  -0.0007 763 VAL A CA    
4161 C C     . VAL C 467 ? 0.2924 0.2528 0.2948 -0.0416 0.0165  -0.0066 763 VAL A C     
4162 O O     . VAL C 467 ? 0.2821 0.2385 0.2893 -0.0397 0.0168  -0.0100 763 VAL A O     
4163 C CB    . VAL C 467 ? 0.2753 0.2170 0.2646 -0.0370 0.0118  0.0053  763 VAL A CB    
4164 C CG1   . VAL C 467 ? 0.2562 0.1832 0.2333 -0.0399 0.0121  0.0117  763 VAL A CG1   
4165 C CG2   . VAL C 467 ? 0.2114 0.1479 0.2078 -0.0288 0.0073  0.0059  763 VAL A CG2   
4166 N N     . THR C 468 ? 0.2186 0.1959 0.2227 -0.0415 0.0164  -0.0077 764 THR A N     
4167 C CA    . THR C 468 ? 0.2883 0.2804 0.2995 -0.0394 0.0159  -0.0123 764 THR A CA    
4168 C C     . THR C 468 ? 0.2947 0.2964 0.3079 -0.0327 0.0130  -0.0101 764 THR A C     
4169 O O     . THR C 468 ? 0.2925 0.2929 0.3013 -0.0315 0.0121  -0.0064 764 THR A O     
4170 C CB    . THR C 468 ? 0.3148 0.3200 0.3277 -0.0467 0.0188  -0.0168 764 THR A CB    
4171 O OG1   . THR C 468 ? 0.4397 0.4547 0.4515 -0.0486 0.0199  -0.0147 764 THR A OG1   
4172 C CG2   . THR C 468 ? 0.2834 0.2777 0.2937 -0.0549 0.0221  -0.0194 764 THR A CG2   
4173 N N     . THR C 469 ? 0.3411 0.3510 0.3598 -0.0286 0.0118  -0.0126 765 THR A N     
4174 C CA    . THR C 469 ? 0.2756 0.2942 0.2968 -0.0228 0.0098  -0.0110 765 THR A CA    
4175 C C     . THR C 469 ? 0.2993 0.3342 0.3225 -0.0241 0.0111  -0.0129 765 THR A C     
4176 O O     . THR C 469 ? 0.2700 0.3112 0.2935 -0.0298 0.0129  -0.0156 765 THR A O     
4177 C CB    . THR C 469 ? 0.2393 0.2562 0.2654 -0.0173 0.0082  -0.0117 765 THR A CB    
4178 O OG1   . THR C 469 ? 0.2418 0.2647 0.2700 -0.0190 0.0101  -0.0158 765 THR A OG1   
4179 C CG2   . THR C 469 ? 0.1975 0.2001 0.2245 -0.0154 0.0068  -0.0100 765 THR A CG2   
4180 N N     . LEU C 470 ? 0.2228 0.2647 0.2480 -0.0187 0.0098  -0.0115 766 LEU A N     
4181 C CA    . LEU C 470 ? 0.2902 0.3474 0.3182 -0.0180 0.0106  -0.0123 766 LEU A CA    
4182 C C     . LEU C 470 ? 0.2496 0.3159 0.2803 -0.0204 0.0105  -0.0154 766 LEU A C     
4183 O O     . LEU C 470 ? 0.3228 0.4022 0.3560 -0.0230 0.0108  -0.0168 766 LEU A O     
4184 C CB    . LEU C 470 ? 0.3702 0.4298 0.3998 -0.0111 0.0095  -0.0101 766 LEU A CB    
4185 C CG    . LEU C 470 ? 0.6589 0.7296 0.6903 -0.0089 0.0109  -0.0094 766 LEU A CG    
4186 C CD1   . LEU C 470 ? 0.6189 0.6848 0.6460 -0.0108 0.0128  -0.0084 766 LEU A CD1   
4187 C CD2   . LEU C 470 ? 0.7488 0.8214 0.7823 -0.0019 0.0100  -0.0078 766 LEU A CD2   
4188 N N     . LEU C 471 ? 0.2353 0.2955 0.2654 -0.0194 0.0099  -0.0169 767 LEU A N     
4189 C CA    . LEU C 471 ? 0.3856 0.4529 0.4155 -0.0216 0.0097  -0.0203 767 LEU A CA    
4190 C C     . LEU C 471 ? 0.2904 0.3508 0.3179 -0.0286 0.0113  -0.0245 767 LEU A C     
4191 O O     . LEU C 471 ? 0.2677 0.3297 0.2932 -0.0307 0.0115  -0.0283 767 LEU A O     
4192 C CB    . LEU C 471 ? 0.3477 0.4133 0.3774 -0.0162 0.0094  -0.0196 767 LEU A CB    
4193 C CG    . LEU C 471 ? 0.3746 0.4469 0.4061 -0.0098 0.0083  -0.0158 767 LEU A CG    
4194 C CD1   . LEU C 471 ? 0.3890 0.4602 0.4192 -0.0061 0.0087  -0.0152 767 LEU A CD1   
4195 C CD2   . LEU C 471 ? 0.2968 0.3840 0.3299 -0.0101 0.0069  -0.0151 767 LEU A CD2   
4196 N N     . HIS C 472 ? 0.2015 0.2530 0.2280 -0.0324 0.0126  -0.0240 768 HIS A N     
4197 C CA    . HIS C 472 ? 0.2101 0.2542 0.2343 -0.0401 0.0147  -0.0277 768 HIS A CA    
4198 C C     . HIS C 472 ? 0.2482 0.2759 0.2709 -0.0388 0.0161  -0.0293 768 HIS A C     
4199 O O     . HIS C 472 ? 0.2203 0.2408 0.2408 -0.0446 0.0182  -0.0336 768 HIS A O     
4200 C CB    . HIS C 472 ? 0.2813 0.3383 0.3057 -0.0463 0.0144  -0.0327 768 HIS A CB    
4201 C CG    . HIS C 472 ? 0.4947 0.5698 0.5232 -0.0474 0.0130  -0.0315 768 HIS A CG    
4202 N ND1   . HIS C 472 ? 0.5232 0.5998 0.5538 -0.0454 0.0139  -0.0273 768 HIS A ND1   
4203 C CD2   . HIS C 472 ? 0.5117 0.6049 0.5432 -0.0497 0.0107  -0.0339 768 HIS A CD2   
4204 C CE1   . HIS C 472 ? 0.4909 0.5856 0.5268 -0.0462 0.0131  -0.0274 768 HIS A CE1   
4205 N NE2   . HIS C 472 ? 0.5478 0.6534 0.5850 -0.0486 0.0106  -0.0311 768 HIS A NE2   
4206 N N     . ARG C 473 ? 0.1628 0.1845 0.1875 -0.0315 0.0151  -0.0263 769 ARG A N     
4207 C CA    . ARG C 473 ? 0.2184 0.2243 0.2440 -0.0297 0.0165  -0.0267 769 ARG A CA    
4208 C C     . ARG C 473 ? 0.1793 0.1730 0.2023 -0.0327 0.0168  -0.0241 769 ARG A C     
4209 O O     . ARG C 473 ? 0.2648 0.2612 0.2858 -0.0335 0.0154  -0.0202 769 ARG A O     
4210 C CB    . ARG C 473 ? 0.2392 0.2435 0.2696 -0.0216 0.0149  -0.0237 769 ARG A CB    
4211 C CG    . ARG C 473 ? 0.4072 0.3987 0.4417 -0.0185 0.0165  -0.0248 769 ARG A CG    
4212 C CD    . ARG C 473 ? 0.4680 0.4617 0.5094 -0.0113 0.0149  -0.0221 769 ARG A CD    
4213 N NE    . ARG C 473 ? 0.4130 0.4196 0.4538 -0.0102 0.0147  -0.0223 769 ARG A NE    
4214 C CZ    . ARG C 473 ? 0.2990 0.3100 0.3403 -0.0095 0.0177  -0.0255 769 ARG A CZ    
4215 N NH1   . ARG C 473 ? 0.3101 0.3140 0.3526 -0.0100 0.0216  -0.0297 769 ARG A NH1   
4216 N NH2   . ARG C 473 ? 0.2308 0.2521 0.2704 -0.0082 0.0172  -0.0244 769 ARG A NH2   
4217 N N     . ARG C 474 ? 0.2342 0.2136 0.2566 -0.0348 0.0192  -0.0262 770 ARG A N     
4218 C CA    . ARG C 474 ? 0.3249 0.2905 0.3436 -0.0375 0.0196  -0.0227 770 ARG A CA    
4219 C C     . ARG C 474 ? 0.3767 0.3260 0.3982 -0.0315 0.0190  -0.0202 770 ARG A C     
4220 O O     . ARG C 474 ? 0.2291 0.1772 0.2563 -0.0270 0.0200  -0.0231 770 ARG A O     
4221 C CB    . ARG C 474 ? 0.2750 0.2368 0.2893 -0.0474 0.0232  -0.0267 770 ARG A CB    
4222 C CG    . ARG C 474 ? 0.4332 0.3882 0.4476 -0.0509 0.0267  -0.0338 770 ARG A CG    
4223 C CD    . ARG C 474 ? 0.4795 0.4276 0.4892 -0.0617 0.0302  -0.0371 770 ARG A CD    
4224 N NE    . ARG C 474 ? 0.3822 0.3488 0.3917 -0.0688 0.0296  -0.0392 770 ARG A NE    
4225 C CZ    . ARG C 474 ? 0.3291 0.2953 0.3366 -0.0794 0.0323  -0.0426 770 ARG A CZ    
4226 N NH1   . ARG C 474 ? 0.3345 0.2804 0.3383 -0.0846 0.0362  -0.0441 770 ARG A NH1   
4227 N NH2   . ARG C 474 ? 0.3617 0.3476 0.3716 -0.0850 0.0312  -0.0444 770 ARG A NH2   
4228 N N     . ARG C 475 ? 0.2766 0.2143 0.2944 -0.0311 0.0174  -0.0144 771 ARG A N     
4229 C CA    . ARG C 475 ? 0.2624 0.1841 0.2830 -0.0251 0.0159  -0.0108 771 ARG A CA    
4230 C C     . ARG C 475 ? 0.2598 0.1643 0.2725 -0.0298 0.0175  -0.0073 771 ARG A C     
4231 O O     . ARG C 475 ? 0.2855 0.1898 0.2906 -0.0327 0.0160  -0.0024 771 ARG A O     
4232 C CB    . ARG C 475 ? 0.2201 0.1460 0.2442 -0.0173 0.0099  -0.0051 771 ARG A CB    
4233 C CG    . ARG C 475 ? 0.2160 0.1275 0.2443 -0.0104 0.0069  -0.0005 771 ARG A CG    
4234 C CD    . ARG C 475 ? 0.3502 0.2683 0.3824 -0.0038 0.0001  0.0044  771 ARG A CD    
4235 N NE    . ARG C 475 ? 0.3163 0.2239 0.3556 0.0037  -0.0037 0.0085  771 ARG A NE    
4236 C CZ    . ARG C 475 ? 0.3519 0.2653 0.3985 0.0102  -0.0102 0.0118  771 ARG A CZ    
4237 N NH1   . ARG C 475 ? 0.3146 0.2421 0.3611 0.0097  -0.0129 0.0113  771 ARG A NH1   
4238 N NH2   . ARG C 475 ? 0.3393 0.2444 0.3942 0.0173  -0.0140 0.0156  771 ARG A NH2   
4239 N N     . TYR C 476 ? 0.2398 0.1290 0.2536 -0.0309 0.0213  -0.0100 772 TYR A N     
4240 C CA    . TYR C 476 ? 0.3901 0.2596 0.3962 -0.0353 0.0235  -0.0065 772 TYR A CA    
4241 C C     . TYR C 476 ? 0.3361 0.1933 0.3410 -0.0275 0.0184  0.0029  772 TYR A C     
4242 O O     . TYR C 476 ? 0.3098 0.1676 0.3236 -0.0181 0.0147  0.0043  772 TYR A O     
4243 C CB    . TYR C 476 ? 0.3008 0.1562 0.3084 -0.0387 0.0295  -0.0129 772 TYR A CB    
4244 C CG    . TYR C 476 ? 0.3939 0.2609 0.3998 -0.0486 0.0337  -0.0218 772 TYR A CG    
4245 C CD1   . TYR C 476 ? 0.4177 0.2981 0.4292 -0.0471 0.0345  -0.0291 772 TYR A CD1   
4246 C CD2   . TYR C 476 ? 0.3411 0.2067 0.3398 -0.0597 0.0367  -0.0226 772 TYR A CD2   
4247 C CE1   . TYR C 476 ? 0.3463 0.2382 0.3553 -0.0558 0.0369  -0.0366 772 TYR A CE1   
4248 C CE2   . TYR C 476 ? 0.3567 0.2353 0.3552 -0.0688 0.0393  -0.0307 772 TYR A CE2   
4249 C CZ    . TYR C 476 ? 0.2980 0.1899 0.3014 -0.0665 0.0388  -0.0376 772 TYR A CZ    
4250 O OH    . TYR C 476 ? 0.3642 0.2697 0.3665 -0.0753 0.0402  -0.0453 772 TYR A OH    
4251 N N     . LEU C 477 ? 0.2788 0.1259 0.2726 -0.0316 0.0180  0.0095  773 LEU A N     
4252 C CA    . LEU C 477 ? 0.3398 0.1757 0.3288 -0.0251 0.0120  0.0194  773 LEU A CA    
4253 C C     . LEU C 477 ? 0.3809 0.1914 0.3610 -0.0283 0.0151  0.0244  773 LEU A C     
4254 O O     . LEU C 477 ? 0.4153 0.2183 0.3822 -0.0331 0.0151  0.0308  773 LEU A O     
4255 C CB    . LEU C 477 ? 0.3886 0.2365 0.3696 -0.0262 0.0079  0.0238  773 LEU A CB    
4256 C CG    . LEU C 477 ? 0.4092 0.2786 0.3991 -0.0212 0.0039  0.0205  773 LEU A CG    
4257 C CD1   . LEU C 477 ? 0.3837 0.2647 0.3650 -0.0239 0.0019  0.0228  773 LEU A CD1   
4258 C CD2   . LEU C 477 ? 0.3929 0.2603 0.3925 -0.0103 -0.0027 0.0235  773 LEU A CD2   
4259 N N     . PRO C 478 ? 0.3587 0.1543 0.3450 -0.0256 0.0182  0.0218  774 PRO A N     
4260 C CA    . PRO C 478 ? 0.5452 0.3139 0.5232 -0.0286 0.0219  0.0265  774 PRO A CA    
4261 C C     . PRO C 478 ? 0.5235 0.2778 0.4934 -0.0220 0.0154  0.0392  774 PRO A C     
4262 O O     . PRO C 478 ? 0.4720 0.2066 0.4289 -0.0271 0.0181  0.0453  774 PRO A O     
4263 C CB    . PRO C 478 ? 0.3978 0.1556 0.3868 -0.0245 0.0261  0.0201  774 PRO A CB    
4264 C CG    . PRO C 478 ? 0.4872 0.2633 0.4904 -0.0149 0.0217  0.0168  774 PRO A CG    
4265 C CD    . PRO C 478 ? 0.5109 0.3121 0.5121 -0.0191 0.0191  0.0148  774 PRO A CD    
4266 N N     . ASP C 479 ? 0.4576 0.2209 0.4342 -0.0111 0.0068  0.0434  775 ASP A N     
4267 C CA    . ASP C 479 ? 0.4467 0.1980 0.4152 -0.0045 -0.0010 0.0556  775 ASP A CA    
4268 C C     . ASP C 479 ? 0.5059 0.2615 0.4567 -0.0109 -0.0032 0.0613  775 ASP A C     
4269 O O     . ASP C 479 ? 0.5197 0.2656 0.4601 -0.0066 -0.0100 0.0717  775 ASP A O     
4270 C CB    . ASP C 479 ? 0.5666 0.3284 0.5493 0.0085  -0.0102 0.0577  775 ASP A CB    
4271 C CG    . ASP C 479 ? 0.6890 0.4457 0.6898 0.0160  -0.0075 0.0528  775 ASP A CG    
4272 O OD1   . ASP C 479 ? 0.7237 0.4973 0.7405 0.0229  -0.0107 0.0486  775 ASP A OD1   
4273 O OD2   . ASP C 479 ? 0.8006 0.5358 0.7995 0.0148  -0.0014 0.0527  775 ASP A OD2   
4274 N N     . ILE C 480 ? 0.4178 0.1881 0.3650 -0.0208 0.0023  0.0548  776 ILE A N     
4275 C CA    . ILE C 480 ? 0.4245 0.2004 0.3561 -0.0266 0.0014  0.0591  776 ILE A CA    
4276 C C     . ILE C 480 ? 0.5789 0.3311 0.4921 -0.0322 0.0046  0.0679  776 ILE A C     
4277 O O     . ILE C 480 ? 0.6943 0.4453 0.5916 -0.0344 0.0023  0.0746  776 ILE A O     
4278 C CB    . ILE C 480 ? 0.5243 0.3213 0.4587 -0.0354 0.0075  0.0499  776 ILE A CB    
4279 C CG1   . ILE C 480 ? 0.6182 0.4273 0.5417 -0.0372 0.0049  0.0528  776 ILE A CG1   
4280 C CG2   . ILE C 480 ? 0.4602 0.2490 0.3906 -0.0470 0.0175  0.0462  776 ILE A CG2   
4281 C CD1   . ILE C 480 ? 0.5754 0.4098 0.5097 -0.0349 0.0029  0.0455  776 ILE A CD1   
4282 N N     . THR C 481 ? 0.6486 0.3807 0.5625 -0.0349 0.0103  0.0680  777 THR A N     
4283 C CA    . THR C 481 ? 0.8039 0.5129 0.7021 -0.0398 0.0139  0.0765  777 THR A CA    
4284 C C     . THR C 481 ? 0.9007 0.5954 0.8008 -0.0282 0.0071  0.0858  777 THR A C     
4285 O O     . THR C 481 ? 0.9893 0.6712 0.8786 -0.0300 0.0083  0.0938  777 THR A O     
4286 C CB    . THR C 481 ? 0.7748 0.4789 0.6774 -0.0501 0.0245  0.0694  777 THR A CB    
4287 O OG1   . THR C 481 ? 0.8315 0.5314 0.7502 -0.0447 0.0251  0.0631  777 THR A OG1   
4288 C CG2   . THR C 481 ? 0.7872 0.5086 0.6893 -0.0621 0.0313  0.0607  777 THR A CG2   
4289 N N     . SER C 482 ? 0.7649 0.4628 0.6794 -0.0164 0.0002  0.0851  778 SER A N     
4290 C CA    . SER C 482 ? 0.7300 0.4172 0.6511 -0.0048 -0.0054 0.0931  778 SER A CA    
4291 C C     . SER C 482 ? 0.8028 0.4851 0.7071 -0.0027 -0.0112 0.1052  778 SER A C     
4292 O O     . SER C 482 ? 0.8359 0.5279 0.7268 -0.0061 -0.0149 0.1071  778 SER A O     
4293 C CB    . SER C 482 ? 0.7084 0.4067 0.6475 0.0077  -0.0126 0.0904  778 SER A CB    
4294 O OG    . SER C 482 ? 0.7656 0.4562 0.7119 0.0196  -0.0172 0.0982  778 SER A OG    
4295 N N     . ARG C 483 ? 0.8508 0.5176 0.7556 0.0028  -0.0120 0.1134  779 ARG A N     
4296 C CA    . ARG C 483 ? 0.9138 0.5744 0.8023 0.0054  -0.0174 0.1256  779 ARG A CA    
4297 C C     . ARG C 483 ? 0.8969 0.5665 0.7907 0.0191  -0.0295 0.1313  779 ARG A C     
4298 O O     . ARG C 483 ? 0.8453 0.5120 0.7247 0.0218  -0.0357 0.1410  779 ARG A O     
4299 C CB    . ARG C 483 ? 0.9233 0.5621 0.8083 0.0039  -0.0124 0.1326  779 ARG A CB    
4300 C CG    . ARG C 483 ? 1.0035 0.6342 0.8773 -0.0113 -0.0016 0.1289  779 ARG A CG    
4301 C CD    . ARG C 483 ? 1.2700 0.8831 1.1276 -0.0137 -0.0001 0.1402  779 ARG A CD    
4302 N NE    . ARG C 483 ? 1.3419 0.9371 1.2047 -0.0188 0.0076  0.1391  779 ARG A NE    
4303 C CZ    . ARG C 483 ? 1.3350 0.9109 1.1895 -0.0184 0.0085  0.1493  779 ARG A CZ    
4304 N NH1   . ARG C 483 ? 1.3514 0.9241 1.1919 -0.0129 0.0022  0.1615  779 ARG A NH1   
4305 N NH2   . ARG C 483 ? 1.2906 0.8501 1.1500 -0.0237 0.0154  0.1469  779 ARG A NH2   
4306 N N     . ASN C 484 ? 0.8531 0.5343 0.7666 0.0274  -0.0329 0.1251  780 ASN A N     
4307 C CA    . ASN C 484 ? 0.7452 0.4399 0.6651 0.0390  -0.0447 0.1284  780 ASN A CA    
4308 C C     . ASN C 484 ? 0.7449 0.4584 0.6574 0.0344  -0.0511 0.1247  780 ASN A C     
4309 O O     . ASN C 484 ? 0.7593 0.4827 0.6782 0.0291  -0.0478 0.1154  780 ASN A O     
4310 C CB    . ASN C 484 ? 0.7381 0.4387 0.6827 0.0494  -0.0447 0.1225  780 ASN A CB    
4311 C CG    . ASN C 484 ? 0.7510 0.4686 0.7048 0.0607  -0.0571 0.1249  780 ASN A CG    
4312 O OD1   . ASN C 484 ? 0.7644 0.5019 0.7246 0.0599  -0.0628 0.1192  780 ASN A OD1   
4313 N ND2   . ASN C 484 ? 0.8042 0.5144 0.7597 0.0709  -0.0613 0.1334  780 ASN A ND2   
4314 N N     . PHE C 485 ? 0.6613 0.3792 0.5598 0.0362  -0.0602 0.1320  781 PHE A N     
4315 C CA    . PHE C 485 ? 0.7149 0.4482 0.6034 0.0309  -0.0654 0.1288  781 PHE A CA    
4316 C C     . PHE C 485 ? 0.7302 0.4834 0.6392 0.0346  -0.0697 0.1198  781 PHE A C     
4317 O O     . PHE C 485 ? 0.6879 0.4508 0.5942 0.0278  -0.0680 0.1133  781 PHE A O     
4318 C CB    . PHE C 485 ? 0.6425 0.3780 0.5151 0.0339  -0.0755 0.1373  781 PHE A CB    
4319 C CG    . PHE C 485 ? 0.7700 0.5186 0.6290 0.0275  -0.0795 0.1339  781 PHE A CG    
4320 C CD1   . PHE C 485 ? 0.8277 0.5692 0.6635 0.0166  -0.0726 0.1346  781 PHE A CD1   
4321 C CD2   . PHE C 485 ? 0.7546 0.5227 0.6246 0.0320  -0.0893 0.1296  781 PHE A CD2   
4322 C CE1   . PHE C 485 ? 0.8111 0.5640 0.6339 0.0111  -0.0751 0.1309  781 PHE A CE1   
4323 C CE2   . PHE C 485 ? 0.7563 0.5351 0.6134 0.0259  -0.0924 0.1260  781 PHE A CE2   
4324 C CZ    . PHE C 485 ? 0.7256 0.4963 0.5587 0.0158  -0.0851 0.1266  781 PHE A CZ    
4325 N N     . ASN C 486 ? 0.6844 0.4446 0.6146 0.0455  -0.0746 0.1193  782 ASN A N     
4326 C CA    . ASN C 486 ? 0.7169 0.4978 0.6678 0.0490  -0.0785 0.1109  782 ASN A CA    
4327 C C     . ASN C 486 ? 0.6517 0.4327 0.6144 0.0446  -0.0686 0.1015  782 ASN A C     
4328 O O     . ASN C 486 ? 0.6357 0.4308 0.6043 0.0409  -0.0690 0.0946  782 ASN A O     
4329 C CB    . ASN C 486 ? 0.8781 0.6675 0.8487 0.0613  -0.0853 0.1126  782 ASN A CB    
4330 C CG    . ASN C 486 ? 0.9765 0.7689 0.9367 0.0655  -0.0967 0.1213  782 ASN A CG    
4331 O OD1   . ASN C 486 ? 0.9665 0.7650 0.9112 0.0600  -0.1023 0.1223  782 ASN A OD1   
4332 N ND2   . ASN C 486 ? 1.0238 0.8114 0.9916 0.0754  -0.0999 0.1274  782 ASN A ND2   
4333 N N     . VAL C 487 ? 0.6797 0.4446 0.6458 0.0447  -0.0595 0.1010  783 VAL A N     
4334 C CA    . VAL C 487 ? 0.6877 0.4521 0.6638 0.0397  -0.0499 0.0914  783 VAL A CA    
4335 C C     . VAL C 487 ? 0.6363 0.3997 0.5962 0.0269  -0.0454 0.0885  783 VAL A C     
4336 O O     . VAL C 487 ? 0.4889 0.2693 0.4580 0.0224  -0.0396 0.0781  783 VAL A O     
4337 C CB    . VAL C 487 ? 0.6104 0.3559 0.5909 0.0417  -0.0408 0.0909  783 VAL A CB    
4338 C CG1   . VAL C 487 ? 0.6378 0.3827 0.6266 0.0352  -0.0309 0.0800  783 VAL A CG1   
4339 C CG2   . VAL C 487 ? 0.6407 0.3882 0.6367 0.0551  -0.0446 0.0930  783 VAL A CG2   
4340 N N     . ARG C 488 ? 0.6683 0.4201 0.6052 0.0207  -0.0446 0.0955  784 ARG A N     
4341 C CA    . ARG C 488 ? 0.5826 0.3392 0.5050 0.0084  -0.0374 0.0914  784 ARG A CA    
4342 C C     . ARG C 488 ? 0.6137 0.3933 0.5354 0.0077  -0.0426 0.0877  784 ARG A C     
4343 O O     . ARG C 488 ? 0.5495 0.3438 0.4729 0.0008  -0.0360 0.0793  784 ARG A O     
4344 C CB    . ARG C 488 ? 0.4860 0.2222 0.3839 0.0019  -0.0344 0.1003  784 ARG A CB    
4345 C CG    . ARG C 488 ? 0.5708 0.3118 0.4560 -0.0113 -0.0246 0.0955  784 ARG A CG    
4346 C CD    . ARG C 488 ? 0.7663 0.4898 0.6296 -0.0181 -0.0200 0.1036  784 ARG A CD    
4347 N NE    . ARG C 488 ? 0.9210 0.6445 0.7704 -0.0134 -0.0287 0.1124  784 ARG A NE    
4348 C CZ    . ARG C 488 ? 0.9838 0.6959 0.8301 -0.0067 -0.0331 0.1212  784 ARG A CZ    
4349 N NH1   . ARG C 488 ? 1.0290 0.7278 0.8858 -0.0037 -0.0291 0.1228  784 ARG A NH1   
4350 N NH2   . ARG C 488 ? 0.8925 0.6063 0.7249 -0.0032 -0.0413 0.1283  784 ARG A NH2   
4351 N N     . SER C 489 ? 0.6211 0.4040 0.5404 0.0147  -0.0545 0.0939  785 SER A N     
4352 C CA    . SER C 489 ? 0.5754 0.3783 0.4935 0.0137  -0.0596 0.0901  785 SER A CA    
4353 C C     . SER C 489 ? 0.4876 0.3111 0.4284 0.0152  -0.0568 0.0791  785 SER A C     
4354 O O     . SER C 489 ? 0.4931 0.3309 0.4328 0.0095  -0.0524 0.0721  785 SER A O     
4355 C CB    . SER C 489 ? 0.7026 0.5052 0.6161 0.0212  -0.0740 0.0981  785 SER A CB    
4356 O OG    . SER C 489 ? 0.8097 0.5960 0.7025 0.0202  -0.0751 0.1076  785 SER A OG    
4357 N N     . PHE C 490 ? 0.5342 0.3591 0.4960 0.0230  -0.0586 0.0775  786 PHE A N     
4358 C CA    . PHE C 490 ? 0.5030 0.3461 0.4854 0.0243  -0.0551 0.0676  786 PHE A CA    
4359 C C     . PHE C 490 ? 0.4519 0.2981 0.4326 0.0156  -0.0429 0.0595  786 PHE A C     
4360 O O     . PHE C 490 ? 0.4170 0.2800 0.4028 0.0127  -0.0402 0.0524  786 PHE A O     
4361 C CB    . PHE C 490 ? 0.4877 0.3290 0.4917 0.0337  -0.0571 0.0674  786 PHE A CB    
4362 C CG    . PHE C 490 ? 0.5103 0.3696 0.5349 0.0353  -0.0532 0.0577  786 PHE A CG    
4363 C CD1   . PHE C 490 ? 0.4544 0.3111 0.4881 0.0339  -0.0432 0.0510  786 PHE A CD1   
4364 C CD2   . PHE C 490 ? 0.6500 0.5278 0.6834 0.0374  -0.0593 0.0553  786 PHE A CD2   
4365 C CE1   . PHE C 490 ? 0.4545 0.3269 0.5047 0.0351  -0.0392 0.0425  786 PHE A CE1   
4366 C CE2   . PHE C 490 ? 0.6667 0.5597 0.7178 0.0383  -0.0550 0.0470  786 PHE A CE2   
4367 C CZ    . PHE C 490 ? 0.6466 0.5368 0.7055 0.0374  -0.0449 0.0410  786 PHE A CZ    
4368 N N     . ALA C 491 ? 0.3808 0.2106 0.3541 0.0113  -0.0358 0.0609  787 ALA A N     
4369 C CA    . ALA C 491 ? 0.4894 0.3231 0.4613 0.0024  -0.0251 0.0533  787 ALA A CA    
4370 C C     . ALA C 491 ? 0.3386 0.1828 0.2976 -0.0051 -0.0233 0.0519  787 ALA A C     
4371 O O     . ALA C 491 ? 0.3425 0.2013 0.3066 -0.0096 -0.0179 0.0442  787 ALA A O     
4372 C CB    . ALA C 491 ? 0.4175 0.2303 0.3827 -0.0020 -0.0183 0.0553  787 ALA A CB    
4373 N N     . GLU C 492 ? 0.4270 0.2639 0.3688 -0.0064 -0.0274 0.0594  788 GLU A N     
4374 C CA    . GLU C 492 ? 0.4751 0.3219 0.4048 -0.0129 -0.0250 0.0576  788 GLU A CA    
4375 C C     . GLU C 492 ? 0.4222 0.2891 0.3615 -0.0094 -0.0291 0.0521  788 GLU A C     
4376 O O     . GLU C 492 ? 0.3706 0.2505 0.3101 -0.0139 -0.0240 0.0463  788 GLU A O     
4377 C CB    . GLU C 492 ? 0.4273 0.2611 0.3347 -0.0147 -0.0286 0.0666  788 GLU A CB    
4378 C CG    . GLU C 492 ? 0.4731 0.2862 0.3676 -0.0202 -0.0227 0.0724  788 GLU A CG    
4379 C CD    . GLU C 492 ? 0.6954 0.4953 0.5653 -0.0224 -0.0258 0.0819  788 GLU A CD    
4380 O OE1   . GLU C 492 ? 0.7045 0.5112 0.5674 -0.0192 -0.0335 0.0837  788 GLU A OE1   
4381 O OE2   . GLU C 492 ? 0.7525 0.5347 0.6091 -0.0280 -0.0202 0.0874  788 GLU A OE2   
4382 N N     . ARG C 493 ? 0.3582 0.2278 0.3066 -0.0014 -0.0381 0.0540  789 ARG A N     
4383 C CA    . ARG C 493 ? 0.4207 0.3081 0.3786 0.0011  -0.0416 0.0488  789 ARG A CA    
4384 C C     . ARG C 493 ? 0.3206 0.2202 0.2957 0.0011  -0.0353 0.0405  789 ARG A C     
4385 O O     . ARG C 493 ? 0.2746 0.1883 0.2538 0.0001  -0.0341 0.0353  789 ARG A O     
4386 C CB    . ARG C 493 ? 0.5131 0.4014 0.4775 0.0089  -0.0531 0.0528  789 ARG A CB    
4387 C CG    . ARG C 493 ? 0.5854 0.4621 0.5310 0.0091  -0.0608 0.0615  789 ARG A CG    
4388 C CD    . ARG C 493 ? 0.5864 0.4697 0.5377 0.0153  -0.0733 0.0639  789 ARG A CD    
4389 N NE    . ARG C 493 ? 0.6477 0.5325 0.6204 0.0234  -0.0778 0.0649  789 ARG A NE    
4390 C CZ    . ARG C 493 ? 0.7507 0.6230 0.7238 0.0293  -0.0836 0.0729  789 ARG A CZ    
4391 N NH1   . ARG C 493 ? 0.8286 0.6847 0.7799 0.0274  -0.0859 0.0812  789 ARG A NH1   
4392 N NH2   . ARG C 493 ? 0.7939 0.6696 0.7892 0.0372  -0.0867 0.0728  789 ARG A NH2   
4393 N N     . MET C 494 ? 0.3242 0.2176 0.3085 0.0021  -0.0311 0.0391  790 MET A N     
4394 C CA    . MET C 494 ? 0.2617 0.1658 0.2589 0.0010  -0.0247 0.0311  790 MET A CA    
4395 C C     . MET C 494 ? 0.2928 0.2020 0.2822 -0.0072 -0.0171 0.0271  790 MET A C     
4396 O O     . MET C 494 ? 0.3681 0.2910 0.3644 -0.0084 -0.0137 0.0211  790 MET A O     
4397 C CB    . MET C 494 ? 0.3844 0.2796 0.3922 0.0041  -0.0220 0.0299  790 MET A CB    
4398 C CG    . MET C 494 ? 0.5090 0.4022 0.5291 0.0132  -0.0289 0.0331  790 MET A CG    
4399 S SD    . MET C 494 ? 0.5929 0.5066 0.6268 0.0174  -0.0335 0.0293  790 MET A SD    
4400 C CE    . MET C 494 ? 0.7786 0.6931 0.7984 0.0168  -0.0428 0.0354  790 MET A CE    
4401 N N     . ALA C 495 ? 0.3576 0.2563 0.3329 -0.0128 -0.0143 0.0308  791 ALA A N     
4402 C CA    . ALA C 495 ? 0.3229 0.2283 0.2918 -0.0208 -0.0073 0.0274  791 ALA A CA    
4403 C C     . ALA C 495 ? 0.2795 0.1995 0.2461 -0.0206 -0.0085 0.0255  791 ALA A C     
4404 O O     . ALA C 495 ? 0.3183 0.2515 0.2893 -0.0234 -0.0039 0.0202  791 ALA A O     
4405 C CB    . ALA C 495 ? 0.3336 0.2244 0.2876 -0.0270 -0.0039 0.0324  791 ALA A CB    
4406 N N     . MET C 496 ? 0.2975 0.2148 0.2571 -0.0171 -0.0149 0.0297  792 MET A N     
4407 C CA    . MET C 496 ? 0.3398 0.2686 0.2961 -0.0170 -0.0157 0.0274  792 MET A CA    
4408 C C     . MET C 496 ? 0.2798 0.2214 0.2511 -0.0122 -0.0177 0.0225  792 MET A C     
4409 O O     . MET C 496 ? 0.4048 0.3581 0.3783 -0.0131 -0.0146 0.0183  792 MET A O     
4410 C CB    . MET C 496 ? 0.2836 0.2044 0.2258 -0.0157 -0.0222 0.0329  792 MET A CB    
4411 C CG    . MET C 496 ? 0.3751 0.2816 0.2996 -0.0204 -0.0201 0.0388  792 MET A CG    
4412 S SD    . MET C 496 ? 0.5221 0.4185 0.4281 -0.0183 -0.0294 0.0458  792 MET A SD    
4413 C CE    . MET C 496 ? 0.5577 0.4435 0.4725 -0.0110 -0.0387 0.0518  792 MET A CE    
4414 N N     . ASN C 497 ? 0.3166 0.2561 0.2988 -0.0070 -0.0224 0.0232  793 ASN A N     
4415 C CA    . ASN C 497 ? 0.3140 0.2645 0.3097 -0.0027 -0.0247 0.0194  793 ASN A CA    
4416 C C     . ASN C 497 ? 0.3187 0.2775 0.3252 -0.0033 -0.0184 0.0140  793 ASN A C     
4417 O O     . ASN C 497 ? 0.2323 0.2017 0.2456 -0.0018 -0.0175 0.0105  793 ASN A O     
4418 C CB    . ASN C 497 ? 0.2966 0.2428 0.3006 0.0032  -0.0322 0.0225  793 ASN A CB    
4419 C CG    . ASN C 497 ? 0.5609 0.5160 0.5830 0.0071  -0.0315 0.0183  793 ASN A CG    
4420 O OD1   . ASN C 497 ? 0.6039 0.5672 0.6325 0.0092  -0.0348 0.0167  793 ASN A OD1   
4421 N ND2   . ASN C 497 ? 0.6536 0.6061 0.6835 0.0077  -0.0268 0.0164  793 ASN A ND2   
4422 N N     . THR C 498 ? 0.2773 0.2306 0.2844 -0.0058 -0.0141 0.0133  794 THR A N     
4423 C CA    . THR C 498 ? 0.2964 0.2566 0.3133 -0.0060 -0.0094 0.0080  794 THR A CA    
4424 C C     . THR C 498 ? 0.2841 0.2570 0.2994 -0.0093 -0.0053 0.0043  794 THR A C     
4425 O O     . THR C 498 ? 0.2924 0.2747 0.3154 -0.0072 -0.0041 0.0010  794 THR A O     
4426 C CB    . THR C 498 ? 0.3156 0.2655 0.3327 -0.0084 -0.0059 0.0074  794 THR A CB    
4427 O OG1   . THR C 498 ? 0.2952 0.2349 0.3177 -0.0031 -0.0097 0.0104  794 THR A OG1   
4428 C CG2   . THR C 498 ? 0.2105 0.1676 0.2342 -0.0102 -0.0006 0.0011  794 THR A CG2   
4429 N N     . PRO C 499 ? 0.2735 0.2475 0.2796 -0.0140 -0.0029 0.0051  795 PRO A N     
4430 C CA    . PRO C 499 ? 0.2925 0.2801 0.2992 -0.0157 0.0005  0.0019  795 PRO A CA    
4431 C C     . PRO C 499 ? 0.3415 0.3362 0.3511 -0.0111 -0.0020 0.0016  795 PRO A C     
4432 O O     . PRO C 499 ? 0.3486 0.3541 0.3623 -0.0102 0.0003  -0.0010 795 PRO A O     
4433 C CB    . PRO C 499 ? 0.2364 0.2226 0.2333 -0.0211 0.0035  0.0035  795 PRO A CB    
4434 C CG    . PRO C 499 ? 0.3488 0.3205 0.3407 -0.0242 0.0035  0.0063  795 PRO A CG    
4435 C CD    . PRO C 499 ? 0.2803 0.2433 0.2757 -0.0183 -0.0021 0.0088  795 PRO A CD    
4436 N N     . ILE C 500 ? 0.2265 0.2150 0.2339 -0.0081 -0.0068 0.0043  796 ILE A N     
4437 C CA    . ILE C 500 ? 0.2246 0.2182 0.2345 -0.0046 -0.0092 0.0035  796 ILE A CA    
4438 C C     . ILE C 500 ? 0.1954 0.1925 0.2175 -0.0009 -0.0103 0.0018  796 ILE A C     
4439 O O     . ILE C 500 ? 0.2339 0.2390 0.2608 0.0004  -0.0078 -0.0005 796 ILE A O     
4440 C CB    . ILE C 500 ? 0.2686 0.2547 0.2703 -0.0040 -0.0145 0.0065  796 ILE A CB    
4441 C CG1   . ILE C 500 ? 0.3114 0.2946 0.2993 -0.0080 -0.0119 0.0077  796 ILE A CG1   
4442 C CG2   . ILE C 500 ? 0.2660 0.2559 0.2716 -0.0010 -0.0177 0.0049  796 ILE A CG2   
4443 C CD1   . ILE C 500 ? 0.3347 0.3085 0.3106 -0.0083 -0.0171 0.0111  796 ILE A CD1   
4444 N N     . GLN C 501 ? 0.1839 0.1749 0.2114 0.0011  -0.0136 0.0032  797 GLN A N     
4445 C CA    . GLN C 501 ? 0.2572 0.2518 0.2972 0.0044  -0.0136 0.0014  797 GLN A CA    
4446 C C     . GLN C 501 ? 0.2467 0.2462 0.2903 0.0034  -0.0077 -0.0018 797 GLN A C     
4447 O O     . GLN C 501 ? 0.2205 0.2264 0.2701 0.0050  -0.0056 -0.0038 797 GLN A O     
4448 C CB    . GLN C 501 ? 0.3149 0.3027 0.3615 0.0072  -0.0178 0.0035  797 GLN A CB    
4449 C CG    . GLN C 501 ? 0.4333 0.4165 0.4755 0.0083  -0.0252 0.0073  797 GLN A CG    
4450 C CD    . GLN C 501 ? 0.5972 0.5867 0.6436 0.0094  -0.0285 0.0061  797 GLN A CD    
4451 O OE1   . GLN C 501 ? 0.6554 0.6516 0.7129 0.0109  -0.0263 0.0034  797 GLN A OE1   
4452 N NE2   . GLN C 501 ? 0.6472 0.6340 0.6837 0.0082  -0.0335 0.0079  797 GLN A NE2   
4453 N N     . GLY C 502 ? 0.2408 0.2369 0.2797 0.0001  -0.0050 -0.0024 798 GLY A N     
4454 C CA    . GLY C 502 ? 0.2200 0.2208 0.2608 -0.0017 -0.0002 -0.0061 798 GLY A CA    
4455 C C     . GLY C 502 ? 0.2328 0.2444 0.2710 -0.0027 0.0019  -0.0074 798 GLY A C     
4456 O O     . GLY C 502 ? 0.1717 0.1893 0.2125 -0.0024 0.0045  -0.0098 798 GLY A O     
4457 N N     . SER C 503 ? 0.2615 0.2757 0.2941 -0.0038 0.0010  -0.0057 799 SER A N     
4458 C CA    . SER C 503 ? 0.2131 0.2378 0.2448 -0.0034 0.0029  -0.0066 799 SER A CA    
4459 C C     . SER C 503 ? 0.2347 0.2619 0.2708 0.0010  0.0022  -0.0062 799 SER A C     
4460 O O     . SER C 503 ? 0.1943 0.2286 0.2321 0.0024  0.0042  -0.0070 799 SER A O     
4461 C CB    . SER C 503 ? 0.2261 0.2524 0.2516 -0.0053 0.0033  -0.0054 799 SER A CB    
4462 O OG    . SER C 503 ? 0.1836 0.2099 0.2058 -0.0104 0.0053  -0.0061 799 SER A OG    
4463 N N     . ALA C 504 ? 0.2002 0.2215 0.2380 0.0030  -0.0008 -0.0048 800 ALA A N     
4464 C CA    . ALA C 504 ? 0.2691 0.2918 0.3125 0.0062  -0.0011 -0.0049 800 ALA A CA    
4465 C C     . ALA C 504 ? 0.1641 0.1888 0.2140 0.0071  0.0014  -0.0062 800 ALA A C     
4466 O O     . ALA C 504 ? 0.1722 0.2007 0.2242 0.0087  0.0037  -0.0063 800 ALA A O     
4467 C CB    . ALA C 504 ? 0.1930 0.2098 0.2382 0.0070  -0.0057 -0.0038 800 ALA A CB    
4468 N N     . ALA C 505 ? 0.1620 0.1831 0.2146 0.0061  0.0016  -0.0072 801 ALA A N     
4469 C CA    . ALA C 505 ? 0.2605 0.2828 0.3178 0.0066  0.0052  -0.0094 801 ALA A CA    
4470 C C     . ALA C 505 ? 0.2599 0.2887 0.3115 0.0051  0.0085  -0.0107 801 ALA A C     
4471 O O     . ALA C 505 ? 0.2067 0.2386 0.2596 0.0062  0.0115  -0.0113 801 ALA A O     
4472 C CB    . ALA C 505 ? 0.3134 0.3292 0.3737 0.0059  0.0054  -0.0107 801 ALA A CB    
4473 N N     . ASP C 506 ? 0.2336 0.2649 0.2790 0.0023  0.0080  -0.0110 802 ASP A N     
4474 C CA    . ASP C 506 ? 0.2216 0.2614 0.2625 0.0009  0.0097  -0.0121 802 ASP A CA    
4475 C C     . ASP C 506 ? 0.1471 0.1925 0.1878 0.0044  0.0098  -0.0097 802 ASP A C     
4476 O O     . ASP C 506 ? 0.1795 0.2297 0.2181 0.0052  0.0115  -0.0097 802 ASP A O     
4477 C CB    . ASP C 506 ? 0.2074 0.2509 0.2442 -0.0029 0.0088  -0.0126 802 ASP A CB    
4478 C CG    . ASP C 506 ? 0.4327 0.4690 0.4685 -0.0071 0.0093  -0.0148 802 ASP A CG    
4479 O OD1   . ASP C 506 ? 0.4673 0.4974 0.5050 -0.0071 0.0108  -0.0169 802 ASP A OD1   
4480 O OD2   . ASP C 506 ? 0.3767 0.4128 0.4096 -0.0105 0.0088  -0.0144 802 ASP A OD2   
4481 N N     . ILE C 507 ? 0.1607 0.2047 0.2023 0.0065  0.0082  -0.0075 803 ILE A N     
4482 C CA    . ILE C 507 ? 0.1893 0.2366 0.2307 0.0100  0.0087  -0.0052 803 ILE A CA    
4483 C C     . ILE C 507 ? 0.1667 0.2109 0.2111 0.0120  0.0107  -0.0045 803 ILE A C     
4484 O O     . ILE C 507 ? 0.1303 0.1776 0.1726 0.0141  0.0124  -0.0027 803 ILE A O     
4485 C CB    . ILE C 507 ? 0.2011 0.2453 0.2420 0.0113  0.0072  -0.0042 803 ILE A CB    
4486 C CG1   . ILE C 507 ? 0.2218 0.2704 0.2592 0.0094  0.0068  -0.0046 803 ILE A CG1   
4487 C CG2   . ILE C 507 ? 0.2265 0.2706 0.2679 0.0152  0.0085  -0.0023 803 ILE A CG2   
4488 C CD1   . ILE C 507 ? 0.1800 0.2230 0.2148 0.0093  0.0057  -0.0044 803 ILE A CD1   
4489 N N     . ILE C 508 ? 0.1891 0.2273 0.2388 0.0113  0.0106  -0.0056 804 ILE A N     
4490 C CA    . ILE C 508 ? 0.2487 0.2850 0.3031 0.0124  0.0134  -0.0052 804 ILE A CA    
4491 C C     . ILE C 508 ? 0.1795 0.2187 0.2304 0.0117  0.0171  -0.0061 804 ILE A C     
4492 O O     . ILE C 508 ? 0.1811 0.2209 0.2303 0.0130  0.0203  -0.0043 804 ILE A O     
4493 C CB    . ILE C 508 ? 0.2113 0.2430 0.2747 0.0119  0.0121  -0.0064 804 ILE A CB    
4494 C CG1   . ILE C 508 ? 0.3239 0.3525 0.3882 0.0121  0.0076  -0.0056 804 ILE A CG1   
4495 C CG2   . ILE C 508 ? 0.2699 0.3011 0.3401 0.0124  0.0161  -0.0065 804 ILE A CG2   
4496 C CD1   . ILE C 508 ? 0.3909 0.4164 0.4637 0.0118  0.0043  -0.0064 804 ILE A CD1   
4497 N N     . LYS C 509 ? 0.1586 0.1988 0.2072 0.0094  0.0172  -0.0089 805 LYS A N     
4498 C CA    . LYS C 509 ? 0.1234 0.1660 0.1669 0.0080  0.0206  -0.0108 805 LYS A CA    
4499 C C     . LYS C 509 ? 0.0974 0.1467 0.1323 0.0088  0.0200  -0.0084 805 LYS A C     
4500 O O     . LYS C 509 ? 0.1924 0.2429 0.2220 0.0092  0.0228  -0.0076 805 LYS A O     
4501 C CB    . LYS C 509 ? 0.1574 0.1985 0.1995 0.0047  0.0206  -0.0149 805 LYS A CB    
4502 C CG    . LYS C 509 ? 0.1597 0.1935 0.2103 0.0050  0.0215  -0.0168 805 LYS A CG    
4503 C CD    . LYS C 509 ? 0.2470 0.2772 0.2953 0.0019  0.0221  -0.0208 805 LYS A CD    
4504 C CE    . LYS C 509 ? 0.2356 0.2581 0.2930 0.0034  0.0239  -0.0226 805 LYS A CE    
4505 N NZ    . LYS C 509 ? 0.2980 0.3145 0.3524 0.0005  0.0257  -0.0268 805 LYS A NZ    
4506 N N     . LYS C 510 ? 0.2037 0.2579 0.2372 0.0091  0.0163  -0.0072 806 LYS A N     
4507 C CA    . LYS C 510 ? 0.2778 0.3400 0.3055 0.0109  0.0149  -0.0045 806 LYS A CA    
4508 C C     . LYS C 510 ? 0.2456 0.3051 0.2731 0.0154  0.0164  0.0001  806 LYS A C     
4509 O O     . LYS C 510 ? 0.1672 0.2298 0.1884 0.0172  0.0170  0.0029  806 LYS A O     
4510 C CB    . LYS C 510 ? 0.2477 0.3166 0.2767 0.0107  0.0114  -0.0043 806 LYS A CB    
4511 C CG    . LYS C 510 ? 0.4114 0.4908 0.4370 0.0132  0.0093  -0.0016 806 LYS A CG    
4512 C CD    . LYS C 510 ? 0.6373 0.7264 0.6651 0.0110  0.0066  -0.0032 806 LYS A CD    
4513 C CE    . LYS C 510 ? 0.6241 0.7265 0.6506 0.0137  0.0038  -0.0006 806 LYS A CE    
4514 N NZ    . LYS C 510 ? 0.7001 0.8007 0.7271 0.0211  0.0043  0.0048  806 LYS A NZ    
4515 N N     . ALA C 511 ? 0.1858 0.2388 0.2194 0.0169  0.0169  0.0010  807 ALA A N     
4516 C CA    . ALA C 511 ? 0.2935 0.3417 0.3273 0.0202  0.0191  0.0048  807 ALA A CA    
4517 C C     . ALA C 511 ? 0.2768 0.3218 0.3080 0.0192  0.0235  0.0055  807 ALA A C     
4518 O O     . ALA C 511 ? 0.1487 0.1924 0.1745 0.0216  0.0255  0.0096  807 ALA A O     
4519 C CB    . ALA C 511 ? 0.1570 0.1985 0.1977 0.0204  0.0187  0.0042  807 ALA A CB    
4520 N N     . MET C 512 ? 0.1823 0.2255 0.2171 0.0160  0.0256  0.0017  808 MET A N     
4521 C CA    . MET C 512 ? 0.1983 0.2389 0.2309 0.0149  0.0312  0.0016  808 MET A CA    
4522 C C     . MET C 512 ? 0.1491 0.1938 0.1688 0.0150  0.0319  0.0032  808 MET A C     
4523 O O     . MET C 512 ? 0.2319 0.2739 0.2454 0.0157  0.0358  0.0065  808 MET A O     
4524 C CB    . MET C 512 ? 0.2109 0.2499 0.2504 0.0121  0.0336  -0.0034 808 MET A CB    
4525 C CG    . MET C 512 ? 0.2318 0.2674 0.2846 0.0122  0.0325  -0.0045 808 MET A CG    
4526 S SD    . MET C 512 ? 0.3252 0.3597 0.3872 0.0105  0.0344  -0.0098 808 MET A SD    
4527 C CE    . MET C 512 ? 0.1926 0.2263 0.2543 0.0096  0.0436  -0.0108 808 MET A CE    
4528 N N     . ILE C 513 ? 0.2117 0.2630 0.2269 0.0137  0.0279  0.0009  809 ILE A N     
4529 C CA    . ILE C 513 ? 0.2512 0.3082 0.2540 0.0132  0.0270  0.0018  809 ILE A CA    
4530 C C     . ILE C 513 ? 0.2550 0.3146 0.2528 0.0179  0.0245  0.0086  809 ILE A C     
4531 O O     . ILE C 513 ? 0.2362 0.2962 0.2232 0.0190  0.0257  0.0122  809 ILE A O     
4532 C CB    . ILE C 513 ? 0.2481 0.3123 0.2492 0.0098  0.0229  -0.0029 809 ILE A CB    
4533 C CG1   . ILE C 513 ? 0.3298 0.3890 0.3334 0.0055  0.0264  -0.0094 809 ILE A CG1   
4534 C CG2   . ILE C 513 ? 0.2838 0.3567 0.2730 0.0095  0.0196  -0.0015 809 ILE A CG2   
4535 C CD1   . ILE C 513 ? 0.2260 0.2888 0.2310 0.0018  0.0229  -0.0140 809 ILE A CD1   
4536 N N     . ASP C 514 ? 0.1776 0.2387 0.1825 0.0210  0.0212  0.0106  810 ASP A N     
4537 C CA    . ASP C 514 ? 0.2520 0.3145 0.2545 0.0266  0.0193  0.0170  810 ASP A CA    
4538 C C     . ASP C 514 ? 0.2048 0.2565 0.2052 0.0288  0.0243  0.0216  810 ASP A C     
4539 O O     . ASP C 514 ? 0.2487 0.2995 0.2412 0.0326  0.0243  0.0277  810 ASP A O     
4540 C CB    . ASP C 514 ? 0.1643 0.2292 0.1756 0.0292  0.0163  0.0167  810 ASP A CB    
4541 C CG    . ASP C 514 ? 0.5140 0.5908 0.5271 0.0272  0.0117  0.0134  810 ASP A CG    
4542 O OD1   . ASP C 514 ? 0.5784 0.6623 0.5855 0.0242  0.0099  0.0116  810 ASP A OD1   
4543 O OD2   . ASP C 514 ? 0.5148 0.5935 0.5347 0.0281  0.0103  0.0123  810 ASP A OD2   
4544 N N     . LEU C 515 ? 0.2002 0.2438 0.2082 0.0264  0.0283  0.0192  811 LEU A N     
4545 C CA    . LEU C 515 ? 0.2858 0.3193 0.2935 0.0270  0.0338  0.0229  811 LEU A CA    
4546 C C     . LEU C 515 ? 0.3485 0.3804 0.3453 0.0254  0.0383  0.0249  811 LEU A C     
4547 O O     . LEU C 515 ? 0.2785 0.3043 0.2677 0.0276  0.0412  0.0311  811 LEU A O     
4548 C CB    . LEU C 515 ? 0.2442 0.2720 0.2639 0.0239  0.0364  0.0189  811 LEU A CB    
4549 C CG    . LEU C 515 ? 0.2824 0.3005 0.3045 0.0229  0.0425  0.0216  811 LEU A CG    
4550 C CD1   . LEU C 515 ? 0.2928 0.3042 0.3119 0.0272  0.0421  0.0272  811 LEU A CD1   
4551 C CD2   . LEU C 515 ? 0.4194 0.4353 0.4553 0.0192  0.0438  0.0168  811 LEU A CD2   
4552 N N     . ASN C 516 ? 0.2648 0.3009 0.2596 0.0213  0.0394  0.0197  812 ASN A N     
4553 C CA    . ASN C 516 ? 0.2448 0.2793 0.2276 0.0191  0.0445  0.0204  812 ASN A CA    
4554 C C     . ASN C 516 ? 0.1775 0.2155 0.1447 0.0222  0.0409  0.0264  812 ASN A C     
4555 O O     . ASN C 516 ? 0.2939 0.3265 0.2491 0.0224  0.0452  0.0312  812 ASN A O     
4556 C CB    . ASN C 516 ? 0.2934 0.3318 0.2770 0.0146  0.0459  0.0127  812 ASN A CB    
4557 C CG    . ASN C 516 ? 0.4514 0.4883 0.4207 0.0119  0.0514  0.0121  812 ASN A CG    
4558 O OD1   . ASN C 516 ? 0.4873 0.5181 0.4576 0.0099  0.0596  0.0116  812 ASN A OD1   
4559 N ND2   . ASN C 516 ? 0.4151 0.4582 0.3708 0.0113  0.0470  0.0117  812 ASN A ND2   
4560 N N     . ALA C 517 ? 0.2263 0.2735 0.1933 0.0246  0.0330  0.0264  813 ALA A N     
4561 C CA    . ALA C 517 ? 0.3587 0.4114 0.3131 0.0283  0.0282  0.0325  813 ALA A CA    
4562 C C     . ALA C 517 ? 0.3308 0.3760 0.2843 0.0346  0.0289  0.0414  813 ALA A C     
4563 O O     . ALA C 517 ? 0.2914 0.3334 0.2313 0.0371  0.0295  0.0483  813 ALA A O     
4564 C CB    . ALA C 517 ? 0.2941 0.3606 0.2518 0.0291  0.0198  0.0299  813 ALA A CB    
4565 N N     . ARG C 518 ? 0.2708 0.3119 0.2376 0.0370  0.0291  0.0413  814 ARG A N     
4566 C CA    . ARG C 518 ? 0.3423 0.3743 0.3090 0.0429  0.0304  0.0489  814 ARG A CA    
4567 C C     . ARG C 518 ? 0.2820 0.3002 0.2419 0.0410  0.0385  0.0530  814 ARG A C     
4568 O O     . ARG C 518 ? 0.2875 0.2984 0.2378 0.0453  0.0396  0.0614  814 ARG A O     
4569 C CB    . ARG C 518 ? 0.3512 0.3803 0.3326 0.0446  0.0299  0.0463  814 ARG A CB    
4570 C CG    . ARG C 518 ? 0.5239 0.5643 0.5106 0.0490  0.0230  0.0457  814 ARG A CG    
4571 C CD    . ARG C 518 ? 0.5617 0.6050 0.5412 0.0567  0.0194  0.0540  814 ARG A CD    
4572 N NE    . ARG C 518 ? 0.7129 0.7415 0.6916 0.0619  0.0234  0.0605  814 ARG A NE    
4573 C CZ    . ARG C 518 ? 0.7135 0.7366 0.7016 0.0658  0.0243  0.0602  814 ARG A CZ    
4574 N NH1   . ARG C 518 ? 0.6322 0.6637 0.6307 0.0650  0.0216  0.0538  814 ARG A NH1   
4575 N NH2   . ARG C 518 ? 0.7283 0.7363 0.7147 0.0700  0.0284  0.0659  814 ARG A NH2   
4576 N N     . LEU C 519 ? 0.2146 0.2289 0.1799 0.0346  0.0445  0.0474  815 LEU A N     
4577 C CA    . LEU C 519 ? 0.2538 0.2563 0.2143 0.0319  0.0532  0.0508  815 LEU A CA    
4578 C C     . LEU C 519 ? 0.3139 0.3159 0.2546 0.0322  0.0548  0.0562  815 LEU A C     
4579 O O     . LEU C 519 ? 0.3144 0.3053 0.2457 0.0329  0.0602  0.0635  815 LEU A O     
4580 C CB    . LEU C 519 ? 0.2398 0.2418 0.2113 0.0252  0.0590  0.0432  815 LEU A CB    
4581 C CG    . LEU C 519 ? 0.2688 0.2701 0.2587 0.0243  0.0575  0.0384  815 LEU A CG    
4582 C CD1   . LEU C 519 ? 0.2426 0.2455 0.2435 0.0186  0.0622  0.0316  815 LEU A CD1   
4583 C CD2   . LEU C 519 ? 0.3239 0.3135 0.3168 0.0264  0.0598  0.0435  815 LEU A CD2   
4584 N N     . LYS C 520 ? 0.2962 0.3094 0.2293 0.0309  0.0503  0.0527  816 LYS A N     
4585 C CA    . LYS C 520 ? 0.3766 0.3903 0.2886 0.0308  0.0505  0.0572  816 LYS A CA    
4586 C C     . LYS C 520 ? 0.2817 0.2963 0.1842 0.0384  0.0434  0.0670  816 LYS A C     
4587 O O     . LYS C 520 ? 0.3662 0.3731 0.2522 0.0403  0.0458  0.0754  816 LYS A O     
4588 C CB    . LYS C 520 ? 0.4353 0.4604 0.3425 0.0264  0.0476  0.0492  816 LYS A CB    
4589 C CG    . LYS C 520 ? 0.6261 0.6569 0.5120 0.0270  0.0429  0.0527  816 LYS A CG    
4590 C CD    . LYS C 520 ? 0.8583 0.9021 0.7440 0.0231  0.0371  0.0437  816 LYS A CD    
4591 C CE    . LYS C 520 ? 0.9613 1.0141 0.8661 0.0253  0.0301  0.0401  816 LYS A CE    
4592 N NZ    . LYS C 520 ? 0.8925 0.9562 0.7995 0.0204  0.0259  0.0308  816 LYS A NZ    
4593 N N     . GLU C 521 ? 0.3031 0.3269 0.2160 0.0432  0.0350  0.0664  817 GLU A N     
4594 C CA    . GLU C 521 ? 0.3251 0.3503 0.2338 0.0519  0.0286  0.0756  817 GLU A CA    
4595 C C     . GLU C 521 ? 0.3896 0.3970 0.2957 0.0559  0.0346  0.0844  817 GLU A C     
4596 O O     . GLU C 521 ? 0.3853 0.3878 0.2779 0.0614  0.0328  0.0945  817 GLU A O     
4597 C CB    . GLU C 521 ? 0.4716 0.5080 0.3965 0.0560  0.0214  0.0723  817 GLU A CB    
4598 C CG    . GLU C 521 ? 0.8147 0.8702 0.7400 0.0542  0.0131  0.0669  817 GLU A CG    
4599 C CD    . GLU C 521 ? 1.0885 1.1540 1.0313 0.0573  0.0082  0.0633  817 GLU A CD    
4600 O OE1   . GLU C 521 ? 1.1411 1.2105 1.0940 0.0518  0.0092  0.0545  817 GLU A OE1   
4601 O OE2   . GLU C 521 ? 1.1759 1.2449 1.1224 0.0654  0.0038  0.0694  817 GLU A OE2   
4602 N N     . GLU C 522 ? 0.3866 0.3838 0.3057 0.0531  0.0413  0.0810  818 GLU A N     
4603 C CA    . GLU C 522 ? 0.3945 0.3737 0.3130 0.0557  0.0475  0.0881  818 GLU A CA    
4604 C C     . GLU C 522 ? 0.4313 0.3982 0.3371 0.0504  0.0570  0.0918  818 GLU A C     
4605 O O     . GLU C 522 ? 0.5420 0.4924 0.4455 0.0514  0.0631  0.0983  818 GLU A O     
4606 C CB    . GLU C 522 ? 0.3354 0.3092 0.2731 0.0541  0.0503  0.0822  818 GLU A CB    
4607 C CG    . GLU C 522 ? 0.3558 0.3407 0.3059 0.0585  0.0426  0.0779  818 GLU A CG    
4608 C CD    . GLU C 522 ? 0.6470 0.6290 0.5952 0.0686  0.0386  0.0860  818 GLU A CD    
4609 O OE1   . GLU C 522 ? 0.7607 0.7265 0.7025 0.0718  0.0432  0.0939  818 GLU A OE1   
4610 O OE2   . GLU C 522 ? 0.6850 0.6805 0.6387 0.0735  0.0312  0.0846  818 GLU A OE2   
4611 N N     . ARG C 523 ? 0.4168 0.3904 0.3140 0.0443  0.0591  0.0875  819 ARG A N     
4612 C CA    . ARG C 523 ? 0.4239 0.3871 0.3089 0.0386  0.0693  0.0900  819 ARG A CA    
4613 C C     . ARG C 523 ? 0.4026 0.3543 0.3019 0.0335  0.0792  0.0873  819 ARG A C     
4614 O O     . ARG C 523 ? 0.4722 0.4097 0.3638 0.0311  0.0881  0.0933  819 ARG A O     
4615 C CB    . ARG C 523 ? 0.5372 0.4907 0.3997 0.0432  0.0695  0.1027  819 ARG A CB    
4616 C CG    . ARG C 523 ? 0.5578 0.5226 0.4011 0.0446  0.0624  0.1045  819 ARG A CG    
4617 C CD    . ARG C 523 ? 0.5700 0.5479 0.4178 0.0526  0.0491  0.1060  819 ARG A CD    
4618 N NE    . ARG C 523 ? 0.5451 0.5324 0.3726 0.0545  0.0415  0.1101  819 ARG A NE    
4619 C CZ    . ARG C 523 ? 0.4951 0.4987 0.3204 0.0508  0.0356  0.1021  819 ARG A CZ    
4620 N NH1   . ARG C 523 ? 0.4711 0.4826 0.3134 0.0456  0.0367  0.0901  819 ARG A NH1   
4621 N NH2   . ARG C 523 ? 0.5429 0.5544 0.3484 0.0522  0.0282  0.1061  819 ARG A NH2   
4622 N N     . LEU C 524 ? 0.3887 0.3466 0.3086 0.0314  0.0775  0.0783  820 LEU A N     
4623 C CA    . LEU C 524 ? 0.3855 0.3356 0.3207 0.0258  0.0854  0.0745  820 LEU A CA    
4624 C C     . LEU C 524 ? 0.4518 0.4064 0.3896 0.0181  0.0932  0.0679  820 LEU A C     
4625 O O     . LEU C 524 ? 0.3929 0.3585 0.3264 0.0171  0.0908  0.0630  820 LEU A O     
4626 C CB    . LEU C 524 ? 0.3232 0.2781 0.2783 0.0269  0.0797  0.0679  820 LEU A CB    
4627 C CG    . LEU C 524 ? 0.3288 0.2771 0.2854 0.0339  0.0746  0.0728  820 LEU A CG    
4628 C CD1   . LEU C 524 ? 0.3824 0.3395 0.3545 0.0351  0.0677  0.0652  820 LEU A CD1   
4629 C CD2   . LEU C 524 ? 0.4000 0.3300 0.3583 0.0321  0.0823  0.0775  820 LEU A CD2   
4630 N N     . GLN C 525 ? 0.3707 0.3164 0.3162 0.0125  0.1031  0.0678  821 GLN A N     
4631 C CA    . GLN C 525 ? 0.4335 0.3844 0.3864 0.0055  0.1114  0.0610  821 GLN A CA    
4632 C C     . GLN C 525 ? 0.4562 0.4177 0.4326 0.0035  0.1077  0.0508  821 GLN A C     
4633 O O     . GLN C 525 ? 0.5133 0.4825 0.4969 -0.0004 0.1121  0.0441  821 GLN A O     
4634 C CB    . GLN C 525 ? 0.4058 0.3446 0.3592 -0.0003 0.1239  0.0649  821 GLN A CB    
4635 C CG    . GLN C 525 ? 0.4555 0.3806 0.3849 0.0016  0.1282  0.0764  821 GLN A CG    
4636 C CD    . GLN C 525 ? 0.5164 0.4322 0.4455 -0.0055 0.1404  0.0781  821 GLN A CD    
4637 O OE1   . GLN C 525 ? 0.5470 0.4702 0.4827 -0.0111 0.1462  0.0710  821 GLN A OE1   
4638 N NE2   . GLN C 525 ? 0.5702 0.4708 0.4939 -0.0050 0.1420  0.0857  821 GLN A NE2   
4639 N N     . ALA C 526 ? 0.4071 0.3686 0.3949 0.0063  0.1002  0.0497  822 ALA A N     
4640 C CA    . ALA C 526 ? 0.3182 0.2890 0.3262 0.0048  0.0956  0.0410  822 ALA A CA    
4641 C C     . ALA C 526 ? 0.3969 0.3800 0.4040 0.0054  0.0921  0.0351  822 ALA A C     
4642 O O     . ALA C 526 ? 0.3063 0.2921 0.2978 0.0086  0.0884  0.0372  822 ALA A O     
4643 C CB    . ALA C 526 ? 0.2973 0.2663 0.3107 0.0089  0.0867  0.0413  822 ALA A CB    
4644 N N     . ARG C 527 ? 0.3141 0.3043 0.3382 0.0022  0.0932  0.0276  823 ARG A N     
4645 C CA    . ARG C 527 ? 0.3987 0.3986 0.4230 0.0030  0.0898  0.0217  823 ARG A CA    
4646 C C     . ARG C 527 ? 0.2422 0.2485 0.2870 0.0025  0.0849  0.0152  823 ARG A C     
4647 O O     . ARG C 527 ? 0.2583 0.2635 0.3185 0.0001  0.0864  0.0141  823 ARG A O     
4655 N N     . LEU C 528 ? 0.2288 0.2414 0.2725 0.0047  0.0783  0.0114  824 LEU A N     
4656 C CA    . LEU C 528 ? 0.2522 0.2703 0.3127 0.0046  0.0734  0.0058  824 LEU A CA    
4657 C C     . LEU C 528 ? 0.2221 0.2439 0.2966 0.0020  0.0803  0.0010  824 LEU A C     
4658 O O     . LEU C 528 ? 0.3195 0.3415 0.3875 0.0008  0.0878  -0.0004 824 LEU A O     
4659 C CB    . LEU C 528 ? 0.2499 0.2725 0.3045 0.0070  0.0661  0.0032  824 LEU A CB    
4660 C CG    . LEU C 528 ? 0.4195 0.4421 0.4699 0.0099  0.0573  0.0056  824 LEU A CG    
4661 C CD1   . LEU C 528 ? 0.4154 0.4430 0.4587 0.0109  0.0525  0.0028  824 LEU A CD1   
4662 C CD2   . LEU C 528 ? 0.3634 0.3856 0.4285 0.0097  0.0529  0.0040  824 LEU A CD2   
4663 N N     . LEU C 529 ? 0.1959 0.2209 0.2898 0.0011  0.0778  -0.0016 825 LEU A N     
4664 C CA    . LEU C 529 ? 0.2103 0.2411 0.3220 -0.0003 0.0827  -0.0064 825 LEU A CA    
4665 C C     . LEU C 529 ? 0.2621 0.2981 0.3847 0.0023  0.0751  -0.0105 825 LEU A C     
4666 O O     . LEU C 529 ? 0.2892 0.3284 0.4177 0.0034  0.0786  -0.0147 825 LEU A O     
4667 C CB    . LEU C 529 ? 0.2746 0.3065 0.4027 -0.0039 0.0862  -0.0057 825 LEU A CB    
4668 C CG    . LEU C 529 ? 0.3000 0.3253 0.4195 -0.0073 0.0953  -0.0013 825 LEU A CG    
4669 C CD1   . LEU C 529 ? 0.4216 0.4484 0.5598 -0.0118 0.0980  -0.0017 825 LEU A CD1   
4670 C CD2   . LEU C 529 ? 0.2662 0.2915 0.3770 -0.0082 0.1062  -0.0021 825 LEU A CD2   
4671 N N     . LEU C 530 ? 0.2558 0.2914 0.3804 0.0035  0.0653  -0.0094 826 LEU A N     
4672 C CA    . LEU C 530 ? 0.2275 0.2668 0.3623 0.0058  0.0578  -0.0123 826 LEU A CA    
4673 C C     . LEU C 530 ? 0.2308 0.2669 0.3541 0.0074  0.0487  -0.0105 826 LEU A C     
4674 O O     . LEU C 530 ? 0.1728 0.2054 0.2880 0.0068  0.0467  -0.0074 826 LEU A O     
4675 C CB    . LEU C 530 ? 0.2128 0.2575 0.3693 0.0046  0.0552  -0.0137 826 LEU A CB    
4676 C CG    . LEU C 530 ? 0.3027 0.3520 0.4735 0.0027  0.0636  -0.0157 826 LEU A CG    
4677 C CD1   . LEU C 530 ? 0.3990 0.4534 0.5881 0.0013  0.0576  -0.0168 826 LEU A CD1   
4678 C CD2   . LEU C 530 ? 0.2907 0.3400 0.4593 0.0050  0.0674  -0.0188 826 LEU A CD2   
4679 N N     . GLN C 531 ? 0.1874 0.2244 0.3104 0.0094  0.0440  -0.0125 827 GLN A N     
4680 C CA    . GLN C 531 ? 0.2226 0.2578 0.3397 0.0106  0.0352  -0.0113 827 GLN A CA    
4681 C C     . GLN C 531 ? 0.2271 0.2646 0.3586 0.0117  0.0295  -0.0129 827 GLN A C     
4682 O O     . GLN C 531 ? 0.2219 0.2607 0.3606 0.0134  0.0311  -0.0152 827 GLN A O     
4683 C CB    . GLN C 531 ? 0.2233 0.2567 0.3258 0.0113  0.0344  -0.0116 827 GLN A CB    
4684 C CG    . GLN C 531 ? 0.3221 0.3540 0.4176 0.0119  0.0267  -0.0102 827 GLN A CG    
4685 C CD    . GLN C 531 ? 0.3492 0.3800 0.4476 0.0126  0.0226  -0.0120 827 GLN A CD    
4686 O OE1   . GLN C 531 ? 0.5038 0.5349 0.6146 0.0137  0.0210  -0.0130 827 GLN A OE1   
4687 N NE2   . GLN C 531 ? 0.4419 0.4715 0.5294 0.0121  0.0209  -0.0121 827 GLN A NE2   
4688 N N     . VAL C 532 ? 0.2403 0.2780 0.3761 0.0110  0.0232  -0.0117 828 VAL A N     
4689 C CA    . VAL C 532 ? 0.3962 0.4368 0.5450 0.0120  0.0163  -0.0125 828 VAL A CA    
4690 C C     . VAL C 532 ? 0.2680 0.3045 0.4060 0.0120  0.0080  -0.0109 828 VAL A C     
4691 O O     . VAL C 532 ? 0.4159 0.4506 0.5490 0.0101  0.0058  -0.0101 828 VAL A O     
4692 C CB    . VAL C 532 ? 0.5178 0.5639 0.6836 0.0100  0.0164  -0.0134 828 VAL A CB    
4693 C CG1   . VAL C 532 ? 0.5213 0.5720 0.7010 0.0116  0.0079  -0.0139 828 VAL A CG1   
4694 C CG2   . VAL C 532 ? 0.5417 0.5916 0.7169 0.0093  0.0266  -0.0149 828 VAL A CG2   
4695 N N     . HIS C 533 ? 0.3168 0.3509 0.4503 0.0140  0.0043  -0.0105 829 HIS A N     
4696 C CA    . HIS C 533 ? 0.3535 0.3839 0.4773 0.0137  -0.0032 -0.0089 829 HIS A CA    
4697 C C     . HIS C 533 ? 0.3029 0.3302 0.4109 0.0124  -0.0010 -0.0081 829 HIS A C     
4698 O O     . HIS C 533 ? 0.4645 0.4910 0.5643 0.0127  0.0026  -0.0081 829 HIS A O     
4699 C CB    . HIS C 533 ? 0.3345 0.3670 0.4662 0.0126  -0.0100 -0.0088 829 HIS A CB    
4700 C CG    . HIS C 533 ? 0.6306 0.6689 0.7812 0.0142  -0.0125 -0.0095 829 HIS A CG    
4701 N ND1   . HIS C 533 ? 0.6975 0.7418 0.8618 0.0122  -0.0146 -0.0107 829 HIS A ND1   
4702 C CD2   . HIS C 533 ? 0.7364 0.7758 0.8956 0.0177  -0.0132 -0.0092 829 HIS A CD2   
4703 C CE1   . HIS C 533 ? 0.7153 0.7661 0.8973 0.0147  -0.0168 -0.0110 829 HIS A CE1   
4704 N NE2   . HIS C 533 ? 0.6906 0.7378 0.8696 0.0186  -0.0159 -0.0100 829 HIS A NE2   
4705 N N     . ASP C 534 ? 0.3814 0.4073 0.4856 0.0110  -0.0034 -0.0077 830 ASP A N     
4706 C CA    . ASP C 534 ? 0.2412 0.2645 0.3326 0.0107  -0.0012 -0.0069 830 ASP A CA    
4707 C C     . ASP C 534 ? 0.2610 0.2840 0.3541 0.0101  0.0039  -0.0068 830 ASP A C     
4708 O O     . ASP C 534 ? 0.3390 0.3588 0.4237 0.0104  0.0049  -0.0060 830 ASP A O     
4709 C CB    . ASP C 534 ? 0.3651 0.3847 0.4482 0.0099  -0.0068 -0.0068 830 ASP A CB    
4710 C CG    . ASP C 534 ? 0.4944 0.5127 0.5736 0.0102  -0.0115 -0.0061 830 ASP A CG    
4711 O OD1   . ASP C 534 ? 0.5754 0.5945 0.6539 0.0110  -0.0093 -0.0056 830 ASP A OD1   
4712 O OD2   . ASP C 534 ? 0.6082 0.6236 0.6838 0.0092  -0.0174 -0.0059 830 ASP A OD2   
4713 N N     . GLU C 535 ? 0.2023 0.2278 0.3063 0.0093  0.0075  -0.0073 831 GLU A N     
4714 C CA    . GLU C 535 ? 0.2500 0.2739 0.3562 0.0080  0.0130  -0.0067 831 GLU A CA    
4715 C C     . GLU C 535 ? 0.2340 0.2598 0.3390 0.0088  0.0204  -0.0057 831 GLU A C     
4716 O O     . GLU C 535 ? 0.1987 0.2280 0.3079 0.0095  0.0217  -0.0070 831 GLU A O     
4717 C CB    . GLU C 535 ? 0.3584 0.3841 0.4792 0.0050  0.0115  -0.0085 831 GLU A CB    
4718 C CG    . GLU C 535 ? 0.5750 0.5973 0.6980 0.0025  0.0173  -0.0079 831 GLU A CG    
4719 C CD    . GLU C 535 ? 0.7382 0.7621 0.8750 -0.0017 0.0145  -0.0104 831 GLU A CD    
4720 O OE1   . GLU C 535 ? 0.7874 0.8190 0.9386 -0.0024 0.0118  -0.0122 831 GLU A OE1   
4721 O OE2   . GLU C 535 ? 0.7810 0.7986 0.9148 -0.0044 0.0148  -0.0109 831 GLU A OE2   
4722 N N     . LEU C 536 ? 0.2021 0.2244 0.3002 0.0088  0.0253  -0.0034 832 LEU A N     
4723 C CA    . LEU C 536 ? 0.1839 0.2067 0.2793 0.0089  0.0328  -0.0019 832 LEU A CA    
4724 C C     . LEU C 536 ? 0.1695 0.1892 0.2722 0.0060  0.0380  -0.0010 832 LEU A C     
4725 O O     . LEU C 536 ? 0.2398 0.2538 0.3407 0.0052  0.0373  0.0003  832 LEU A O     
4726 C CB    . LEU C 536 ? 0.2081 0.2290 0.2880 0.0114  0.0341  0.0014  832 LEU A CB    
4727 C CG    . LEU C 536 ? 0.2708 0.2954 0.3428 0.0133  0.0297  0.0007  832 LEU A CG    
4728 C CD1   . LEU C 536 ? 0.2325 0.2575 0.2917 0.0158  0.0308  0.0041  832 LEU A CD1   
4729 C CD2   . LEU C 536 ? 0.2858 0.3143 0.3614 0.0124  0.0306  -0.0024 832 LEU A CD2   
4730 N N     . ILE C 537 ? 0.1993 0.2224 0.3104 0.0043  0.0440  -0.0021 833 ILE A N     
4731 C CA    . ILE C 537 ? 0.1960 0.2170 0.3152 0.0006  0.0504  -0.0015 833 ILE A CA    
4732 C C     . ILE C 537 ? 0.2336 0.2516 0.3423 0.0007  0.0594  0.0016  833 ILE A C     
4733 O O     . ILE C 537 ? 0.2672 0.2888 0.3717 0.0019  0.0622  0.0005  833 ILE A O     
4734 C CB    . ILE C 537 ? 0.2476 0.2763 0.3875 -0.0019 0.0507  -0.0054 833 ILE A CB    
4735 C CG1   . ILE C 537 ? 0.3562 0.3876 0.5044 -0.0019 0.0405  -0.0078 833 ILE A CG1   
4736 C CG2   . ILE C 537 ? 0.2193 0.2472 0.3690 -0.0067 0.0584  -0.0050 833 ILE A CG2   
4737 C CD1   . ILE C 537 ? 0.5011 0.5371 0.6500 0.0017  0.0346  -0.0094 833 ILE A CD1   
4738 N N     . LEU C 538 ? 0.2012 0.2114 0.3039 -0.0008 0.0637  0.0056  834 LEU A N     
4739 C CA    . LEU C 538 ? 0.2296 0.2353 0.3206 -0.0011 0.0723  0.0097  834 LEU A CA    
4740 C C     . LEU C 538 ? 0.1701 0.1714 0.2698 -0.0062 0.0804  0.0108  834 LEU A C     
4741 O O     . LEU C 538 ? 0.2430 0.2434 0.3555 -0.0094 0.0783  0.0089  834 LEU A O     
4742 C CB    . LEU C 538 ? 0.2706 0.2691 0.3429 0.0029  0.0702  0.0153  834 LEU A CB    
4743 C CG    . LEU C 538 ? 0.3516 0.3543 0.4151 0.0076  0.0622  0.0149  834 LEU A CG    
4744 C CD1   . LEU C 538 ? 0.3994 0.4024 0.4702 0.0085  0.0544  0.0124  834 LEU A CD1   
4745 C CD2   . LEU C 538 ? 0.4348 0.4330 0.4806 0.0115  0.0624  0.0211  834 LEU A CD2   
4746 N N     . GLU C 539 ? 0.1817 0.1804 0.2739 -0.0078 0.0899  0.0137  835 GLU A N     
4747 C CA    . GLU C 539 ? 0.2550 0.2464 0.3498 -0.0127 0.0990  0.0167  835 GLU A CA    
4748 C C     . GLU C 539 ? 0.2309 0.2110 0.3031 -0.0105 0.1030  0.0245  835 GLU A C     
4749 O O     . GLU C 539 ? 0.2680 0.2495 0.3245 -0.0064 0.1013  0.0264  835 GLU A O     
4750 C CB    . GLU C 539 ? 0.2652 0.2635 0.3733 -0.0174 0.1086  0.0134  835 GLU A CB    
4751 C CG    . GLU C 539 ? 0.2563 0.2566 0.3515 -0.0160 0.1153  0.0138  835 GLU A CG    
4752 C CD    . GLU C 539 ? 0.4383 0.4445 0.5460 -0.0200 0.1239  0.0097  835 GLU A CD    
4753 O OE1   . GLU C 539 ? 0.3680 0.3775 0.4946 -0.0236 0.1232  0.0068  835 GLU A OE1   
4754 O OE2   . GLU C 539 ? 0.3581 0.3651 0.4547 -0.0192 0.1287  0.0087  835 GLU A OE2   
4755 N N     . ALA C 540 ? 0.2565 0.2250 0.3269 -0.0134 0.1079  0.0290  836 ALA A N     
4756 C CA    . ALA C 540 ? 0.2858 0.2417 0.3348 -0.0104 0.1108  0.0376  836 ALA A CA    
4757 C C     . ALA C 540 ? 0.3615 0.3042 0.4125 -0.0159 0.1197  0.0417  836 ALA A C     
4758 O O     . ALA C 540 ? 0.2807 0.2240 0.3501 -0.0214 0.1207  0.0373  836 ALA A O     
4759 C CB    . ALA C 540 ? 0.2062 0.1588 0.2460 -0.0033 0.1007  0.0401  836 ALA A CB    
4760 N N     . PRO C 541 ? 0.3951 0.3255 0.4274 -0.0149 0.1262  0.0503  837 PRO A N     
4761 C CA    . PRO C 541 ? 0.3807 0.2955 0.4130 -0.0200 0.1349  0.0552  837 PRO A CA    
4762 C C     . PRO C 541 ? 0.2957 0.2016 0.3353 -0.0192 0.1292  0.0544  837 PRO A C     
4763 O O     . PRO C 541 ? 0.3103 0.2178 0.3464 -0.0124 0.1192  0.0538  837 PRO A O     
4764 C CB    . PRO C 541 ? 0.3910 0.2936 0.3971 -0.0162 0.1396  0.0659  837 PRO A CB    
4765 C CG    . PRO C 541 ? 0.4915 0.4071 0.4876 -0.0127 0.1369  0.0643  837 PRO A CG    
4766 C CD    . PRO C 541 ? 0.3195 0.2499 0.3293 -0.0096 0.1258  0.0559  837 PRO A CD    
4767 N N     . LYS C 542 ? 0.3370 0.2335 0.3869 -0.0268 0.1358  0.0539  838 LYS A N     
4768 C CA    . LYS C 542 ? 0.3477 0.2342 0.4040 -0.0271 0.1312  0.0520  838 LYS A CA    
4769 C C     . LYS C 542 ? 0.4455 0.3159 0.4823 -0.0186 0.1287  0.0603  838 LYS A C     
4770 O O     . LYS C 542 ? 0.3652 0.2319 0.4039 -0.0146 0.1213  0.0579  838 LYS A O     
4771 C CB    . LYS C 542 ? 0.3193 0.2014 0.3879 -0.0360 0.1356  0.0477  838 LYS A CB    
4772 C CG    . LYS C 542 ? 0.5932 0.4615 0.6484 -0.0377 0.1438  0.0543  838 LYS A CG    
4773 C CD    . LYS C 542 ? 0.7526 0.6246 0.8231 -0.0477 0.1493  0.0488  838 LYS A CD    
4774 C CE    . LYS C 542 ? 0.8352 0.6891 0.8939 -0.0503 0.1566  0.0550  838 LYS A CE    
4775 N NZ    . LYS C 542 ? 0.8691 0.7122 0.9029 -0.0428 0.1589  0.0656  838 LYS A NZ    
4776 N N     . GLU C 543 ? 0.3150 0.1778 0.3328 -0.0150 0.1334  0.0694  839 GLU A N     
4777 C CA    . GLU C 543 ? 0.4751 0.3244 0.4750 -0.0057 0.1302  0.0782  839 GLU A CA    
4778 C C     . GLU C 543 ? 0.3689 0.2294 0.3641 0.0040  0.1194  0.0777  839 GLU A C     
4779 O O     . GLU C 543 ? 0.5562 0.4078 0.5414 0.0124  0.1153  0.0835  839 GLU A O     
4780 C CB    . GLU C 543 ? 0.6085 0.4506 0.5891 -0.0042 0.1353  0.0869  839 GLU A CB    
4781 C CG    . GLU C 543 ? 0.8863 0.7192 0.8699 -0.0128 0.1438  0.0863  839 GLU A CG    
4782 C CD    . GLU C 543 ? 1.2057 1.0292 1.1684 -0.0110 0.1484  0.0958  839 GLU A CD    
4783 O OE1   . GLU C 543 ? 1.2877 1.1153 1.2342 -0.0041 0.1448  0.1016  839 GLU A OE1   
4784 O OE2   . GLU C 543 ? 1.2842 1.0965 1.2462 -0.0167 0.1551  0.0974  839 GLU A OE2   
4785 N N     . GLU C 544 ? 0.2824 0.1630 0.2853 0.0033  0.1140  0.0704  840 GLU A N     
4786 C CA    . GLU C 544 ? 0.2975 0.1905 0.2974 0.0113  0.1033  0.0685  840 GLU A CA    
4787 C C     . GLU C 544 ? 0.3165 0.2156 0.3315 0.0112  0.0960  0.0598  840 GLU A C     
4788 O O     . GLU C 544 ? 0.2938 0.2031 0.3077 0.0170  0.0877  0.0576  840 GLU A O     
4789 C CB    . GLU C 544 ? 0.3551 0.2649 0.3515 0.0110  0.1017  0.0661  840 GLU A CB    
4790 C CG    . GLU C 544 ? 0.4734 0.3790 0.4504 0.0122  0.1072  0.0745  840 GLU A CG    
4791 C CD    . GLU C 544 ? 0.6230 0.5447 0.5951 0.0121  0.1049  0.0709  840 GLU A CD    
4792 O OE1   . GLU C 544 ? 0.6268 0.5467 0.5809 0.0131  0.1081  0.0768  840 GLU A OE1   
4793 O OE2   . GLU C 544 ? 0.5712 0.5063 0.5562 0.0110  0.0998  0.0622  840 GLU A OE2   
4794 N N     . MET C 545 ? 0.2977 0.1908 0.3262 0.0043  0.0989  0.0547  841 MET A N     
4795 C CA    . MET C 545 ? 0.3032 0.2031 0.3446 0.0033  0.0916  0.0459  841 MET A CA    
4796 C C     . MET C 545 ? 0.2795 0.1727 0.3144 0.0112  0.0860  0.0472  841 MET A C     
4797 O O     . MET C 545 ? 0.3627 0.2667 0.4006 0.0145  0.0782  0.0423  841 MET A O     
4798 C CB    . MET C 545 ? 0.3583 0.2530 0.4146 -0.0063 0.0953  0.0402  841 MET A CB    
4799 C CG    . MET C 545 ? 0.4374 0.3448 0.5065 -0.0140 0.0988  0.0361  841 MET A CG    
4800 S SD    . MET C 545 ? 0.4281 0.3585 0.5056 -0.0117 0.0896  0.0292  841 MET A SD    
4801 C CE    . MET C 545 ? 0.3288 0.2654 0.3927 -0.0076 0.0937  0.0348  841 MET A CE    
4802 N N     . GLU C 546 ? 0.3135 0.1885 0.3400 0.0145  0.0903  0.0536  842 GLU A N     
4803 C CA    . GLU C 546 ? 0.3893 0.2573 0.4117 0.0225  0.0862  0.0543  842 GLU A CA    
4804 C C     . GLU C 546 ? 0.3741 0.2552 0.3890 0.0319  0.0795  0.0574  842 GLU A C     
4805 O O     . GLU C 546 ? 0.2731 0.1597 0.2905 0.0366  0.0737  0.0535  842 GLU A O     
4806 C CB    . GLU C 546 ? 0.3669 0.2113 0.3814 0.0251  0.0928  0.0615  842 GLU A CB    
4807 C CG    . GLU C 546 ? 0.3856 0.2148 0.4075 0.0149  0.1000  0.0583  842 GLU A CG    
4808 C CD    . GLU C 546 ? 0.4292 0.2376 0.4445 0.0180  0.1035  0.0616  842 GLU A CD    
4809 O OE1   . GLU C 546 ? 0.5704 0.3755 0.5851 0.0242  0.0994  0.0588  842 GLU A OE1   
4810 O OE2   . GLU C 546 ? 0.5112 0.3094 0.5217 0.0143  0.1096  0.0660  842 GLU A OE2   
4811 N N     . ARG C 547 ? 0.2518 0.1386 0.2574 0.0341  0.0804  0.0640  843 ARG A N     
4812 C CA    . ARG C 547 ? 0.2649 0.1661 0.2643 0.0416  0.0735  0.0661  843 ARG A CA    
4813 C C     . ARG C 547 ? 0.2326 0.1525 0.2408 0.0385  0.0676  0.0573  843 ARG A C     
4814 O O     . ARG C 547 ? 0.2623 0.1924 0.2710 0.0437  0.0611  0.0554  843 ARG A O     
4815 C CB    . ARG C 547 ? 0.2756 0.1779 0.2613 0.0436  0.0757  0.0747  843 ARG A CB    
4816 C CG    . ARG C 547 ? 0.5027 0.3878 0.4766 0.0498  0.0792  0.0856  843 ARG A CG    
4817 C CD    . ARG C 547 ? 0.5072 0.4002 0.4668 0.0567  0.0752  0.0937  843 ARG A CD    
4818 N NE    . ARG C 547 ? 0.7415 0.6348 0.6906 0.0511  0.0801  0.0970  843 ARG A NE    
4819 C CZ    . ARG C 547 ? 0.7087 0.6137 0.6459 0.0532  0.0763  0.1002  843 ARG A CZ    
4820 N NH1   . ARG C 547 ? 0.5182 0.4369 0.4544 0.0605  0.0669  0.1005  843 ARG A NH1   
4821 N NH2   . ARG C 547 ? 0.7087 0.6123 0.6352 0.0476  0.0821  0.1025  843 ARG A NH2   
4822 N N     . LEU C 548 ? 0.2661 0.1906 0.2821 0.0300  0.0700  0.0519  844 LEU A N     
4823 C CA    . LEU C 548 ? 0.2884 0.2287 0.3129 0.0273  0.0645  0.0440  844 LEU A CA    
4824 C C     . LEU C 548 ? 0.2751 0.2154 0.3075 0.0277  0.0597  0.0379  844 LEU A C     
4825 O O     . LEU C 548 ? 0.2286 0.1808 0.2636 0.0290  0.0537  0.0336  844 LEU A O     
4826 C CB    . LEU C 548 ? 0.2207 0.1652 0.2537 0.0190  0.0685  0.0399  844 LEU A CB    
4827 C CG    . LEU C 548 ? 0.2883 0.2367 0.3139 0.0176  0.0733  0.0435  844 LEU A CG    
4828 C CD1   . LEU C 548 ? 0.3992 0.3532 0.4371 0.0100  0.0773  0.0379  844 LEU A CD1   
4829 C CD2   . LEU C 548 ? 0.2762 0.2364 0.2931 0.0226  0.0676  0.0442  844 LEU A CD2   
4830 N N     . CYS C 549 ? 0.2686 0.1949 0.3040 0.0260  0.0626  0.0371  845 CYS A N     
4831 C CA    . CYS C 549 ? 0.2591 0.1840 0.2999 0.0258  0.0586  0.0307  845 CYS A CA    
4832 C C     . CYS C 549 ? 0.3577 0.2872 0.3929 0.0343  0.0542  0.0318  845 CYS A C     
4833 O O     . CYS C 549 ? 0.3344 0.2698 0.3730 0.0342  0.0497  0.0260  845 CYS A O     
4834 C CB    . CYS C 549 ? 0.3404 0.2472 0.3832 0.0226  0.0632  0.0297  845 CYS A CB    
4835 S SG    . CYS C 549 ? 0.4703 0.3758 0.5254 0.0105  0.0663  0.0245  845 CYS A SG    
4836 N N     . ARG C 550 ? 0.2565 0.1840 0.2835 0.0415  0.0555  0.0395  846 ARG A N     
4837 C CA    . ARG C 550 ? 0.2624 0.1974 0.2862 0.0499  0.0513  0.0411  846 ARG A CA    
4838 C C     . ARG C 550 ? 0.3372 0.2907 0.3594 0.0506  0.0465  0.0414  846 ARG A C     
4839 O O     . ARG C 550 ? 0.3247 0.2894 0.3491 0.0530  0.0419  0.0383  846 ARG A O     
4840 C CB    . ARG C 550 ? 0.3486 0.2727 0.3656 0.0583  0.0542  0.0495  846 ARG A CB    
4841 C CG    . ARG C 550 ? 0.3958 0.3013 0.4143 0.0596  0.0585  0.0481  846 ARG A CG    
4842 C CD    . ARG C 550 ? 0.3326 0.2240 0.3442 0.0677  0.0623  0.0576  846 ARG A CD    
4843 N NE    . ARG C 550 ? 0.5126 0.4141 0.5219 0.0785  0.0582  0.0628  846 ARG A NE    
4844 C CZ    . ARG C 550 ? 0.4806 0.3829 0.4940 0.0857  0.0571  0.0606  846 ARG A CZ    
4845 N NH1   . ARG C 550 ? 0.3834 0.2758 0.4012 0.0828  0.0599  0.0528  846 ARG A NH1   
4846 N NH2   . ARG C 550 ? 0.4957 0.4097 0.5089 0.0950  0.0531  0.0654  846 ARG A NH2   
4847 N N     . LEU C 551 ? 0.3420 0.2984 0.3601 0.0477  0.0482  0.0447  847 LEU A N     
4848 C CA    . LEU C 551 ? 0.4054 0.3775 0.4200 0.0482  0.0441  0.0451  847 LEU A CA    
4849 C C     . LEU C 551 ? 0.3195 0.3024 0.3414 0.0427  0.0408  0.0370  847 LEU A C     
4850 O O     . LEU C 551 ? 0.2778 0.2724 0.3003 0.0446  0.0359  0.0348  847 LEU A O     
4851 C CB    . LEU C 551 ? 0.3972 0.3674 0.4035 0.0463  0.0479  0.0502  847 LEU A CB    
4852 C CG    . LEU C 551 ? 0.4525 0.4368 0.4519 0.0468  0.0442  0.0510  847 LEU A CG    
4853 C CD1   . LEU C 551 ? 0.4417 0.4355 0.4394 0.0540  0.0378  0.0531  847 LEU A CD1   
4854 C CD2   . LEU C 551 ? 0.2813 0.2602 0.2686 0.0463  0.0485  0.0576  847 LEU A CD2   
4855 N N     . VAL C 552 ? 0.2070 0.1865 0.2352 0.0360  0.0433  0.0329  848 VAL A N     
4856 C CA    . VAL C 552 ? 0.2605 0.2498 0.2952 0.0314  0.0400  0.0265  848 VAL A CA    
4857 C C     . VAL C 552 ? 0.3231 0.3162 0.3614 0.0326  0.0351  0.0221  848 VAL A C     
4858 O O     . VAL C 552 ? 0.2961 0.2996 0.3345 0.0324  0.0312  0.0197  848 VAL A O     
4859 C CB    . VAL C 552 ? 0.2677 0.2533 0.3106 0.0247  0.0435  0.0233  848 VAL A CB    
4860 C CG1   . VAL C 552 ? 0.1741 0.1688 0.2248 0.0213  0.0394  0.0172  848 VAL A CG1   
4861 C CG2   . VAL C 552 ? 0.3489 0.3327 0.3876 0.0231  0.0495  0.0271  848 VAL A CG2   
4862 N N     . PRO C 553 ? 0.3227 0.3071 0.3633 0.0332  0.0354  0.0206  849 PRO A N     
4863 C CA    . PRO C 553 ? 0.3033 0.2911 0.3453 0.0340  0.0314  0.0162  849 PRO A CA    
4864 C C     . PRO C 553 ? 0.3297 0.3258 0.3674 0.0399  0.0294  0.0184  849 PRO A C     
4865 O O     . PRO C 553 ? 0.3653 0.3697 0.4040 0.0392  0.0260  0.0151  849 PRO A O     
4866 C CB    . PRO C 553 ? 0.3202 0.2947 0.3632 0.0336  0.0335  0.0144  849 PRO A CB    
4867 C CG    . PRO C 553 ? 0.3476 0.3131 0.3930 0.0300  0.0379  0.0163  849 PRO A CG    
4868 C CD    . PRO C 553 ? 0.3153 0.2854 0.3564 0.0325  0.0400  0.0223  849 PRO A CD    
4869 N N     . GLU C 554 ? 0.2476 0.2420 0.2811 0.0456  0.0313  0.0242  850 GLU A N     
4870 C CA    . GLU C 554 ? 0.3171 0.3219 0.3488 0.0517  0.0289  0.0267  850 GLU A CA    
4871 C C     . GLU C 554 ? 0.3486 0.3680 0.3796 0.0490  0.0252  0.0256  850 GLU A C     
4872 O O     . GLU C 554 ? 0.2791 0.3089 0.3120 0.0497  0.0223  0.0233  850 GLU A O     
4873 C CB    . GLU C 554 ? 0.3491 0.3492 0.3764 0.0587  0.0309  0.0342  850 GLU A CB    
4874 C CG    . GLU C 554 ? 0.6501 0.6636 0.6764 0.0651  0.0273  0.0378  850 GLU A CG    
4875 C CD    . GLU C 554 ? 0.9460 0.9647 0.9781 0.0693  0.0265  0.0348  850 GLU A CD    
4876 O OE1   . GLU C 554 ? 1.0282 1.0625 1.0628 0.0716  0.0230  0.0350  850 GLU A OE1   
4877 O OE2   . GLU C 554 ? 1.0462 1.0534 1.0802 0.0696  0.0298  0.0319  850 GLU A OE2   
4878 N N     . VAL C 555 ? 0.2628 0.2826 0.2909 0.0456  0.0260  0.0269  851 VAL A N     
4879 C CA    . VAL C 555 ? 0.1922 0.2237 0.2187 0.0424  0.0232  0.0250  851 VAL A CA    
4880 C C     . VAL C 555 ? 0.1838 0.2184 0.2156 0.0375  0.0212  0.0186  851 VAL A C     
4881 O O     . VAL C 555 ? 0.3167 0.3613 0.3487 0.0365  0.0182  0.0165  851 VAL A O     
4882 C CB    . VAL C 555 ? 0.2722 0.3011 0.2937 0.0396  0.0259  0.0268  851 VAL A CB    
4883 C CG1   . VAL C 555 ? 0.3546 0.3923 0.3755 0.0348  0.0241  0.0226  851 VAL A CG1   
4884 C CG2   . VAL C 555 ? 0.3479 0.3761 0.3609 0.0445  0.0265  0.0340  851 VAL A CG2   
4885 N N     . MET C 556 ? 0.2100 0.2362 0.2462 0.0342  0.0226  0.0158  852 MET A N     
4886 C CA    . MET C 556 ? 0.2092 0.2370 0.2495 0.0301  0.0201  0.0108  852 MET A CA    
4887 C C     . MET C 556 ? 0.2320 0.2625 0.2720 0.0319  0.0180  0.0092  852 MET A C     
4888 O O     . MET C 556 ? 0.2164 0.2530 0.2566 0.0296  0.0156  0.0066  852 MET A O     
4889 C CB    . MET C 556 ? 0.1803 0.1997 0.2259 0.0267  0.0212  0.0087  852 MET A CB    
4890 C CG    . MET C 556 ? 0.2233 0.2421 0.2711 0.0241  0.0240  0.0093  852 MET A CG    
4891 S SD    . MET C 556 ? 0.2855 0.2975 0.3431 0.0197  0.0255  0.0068  852 MET A SD    
4892 C CE    . MET C 556 ? 0.3437 0.3591 0.4062 0.0173  0.0194  0.0022  852 MET A CE    
4893 N N     . GLU C 557 ? 0.2848 0.3101 0.3240 0.0360  0.0197  0.0106  853 GLU A N     
4894 C CA    . GLU C 557 ? 0.3062 0.3337 0.3451 0.0377  0.0190  0.0085  853 GLU A CA    
4895 C C     . GLU C 557 ? 0.4001 0.4407 0.4390 0.0405  0.0179  0.0099  853 GLU A C     
4896 O O     . GLU C 557 ? 0.3687 0.4142 0.4082 0.0403  0.0176  0.0075  853 GLU A O     
4897 C CB    . GLU C 557 ? 0.4092 0.4267 0.4475 0.0417  0.0220  0.0089  853 GLU A CB    
4898 C CG    . GLU C 557 ? 0.3844 0.3893 0.4231 0.0377  0.0227  0.0062  853 GLU A CG    
4899 C CD    . GLU C 557 ? 0.5925 0.5853 0.6300 0.0412  0.0264  0.0066  853 GLU A CD    
4900 O OE1   . GLU C 557 ? 0.5656 0.5589 0.6024 0.0477  0.0288  0.0103  853 GLU A OE1   
4901 O OE2   . GLU C 557 ? 0.7135 0.6962 0.7510 0.0373  0.0268  0.0031  853 GLU A OE2   
4902 N N     . GLN C 558 ? 0.2725 0.3195 0.3105 0.0426  0.0173  0.0136  854 GLN A N     
4903 C CA    . GLN C 558 ? 0.2922 0.3535 0.3312 0.0449  0.0152  0.0148  854 GLN A CA    
4904 C C     . GLN C 558 ? 0.2864 0.3559 0.3241 0.0392  0.0126  0.0128  854 GLN A C     
4905 O O     . GLN C 558 ? 0.2467 0.3289 0.2851 0.0397  0.0103  0.0134  854 GLN A O     
4906 C CB    . GLN C 558 ? 0.1948 0.2583 0.2327 0.0518  0.0153  0.0207  854 GLN A CB    
4907 C CG    . GLN C 558 ? 0.4597 0.5128 0.4988 0.0581  0.0186  0.0229  854 GLN A CG    
4908 C CD    . GLN C 558 ? 0.6539 0.7101 0.6977 0.0604  0.0199  0.0197  854 GLN A CD    
4909 O OE1   . GLN C 558 ? 0.8695 0.9400 0.9177 0.0626  0.0184  0.0197  854 GLN A OE1   
4910 N NE2   . GLN C 558 ? 0.6375 0.6809 0.6804 0.0593  0.0230  0.0165  854 GLN A NE2   
4911 N N     . ALA C 559 ? 0.2334 0.2962 0.2701 0.0339  0.0129  0.0102  855 ALA A N     
4912 C CA    . ALA C 559 ? 0.2981 0.3661 0.3332 0.0289  0.0114  0.0079  855 ALA A CA    
4913 C C     . ALA C 559 ? 0.3343 0.4126 0.3712 0.0263  0.0094  0.0054  855 ALA A C     
4914 O O     . ALA C 559 ? 0.2770 0.3643 0.3125 0.0239  0.0076  0.0045  855 ALA A O     
4915 C CB    . ALA C 559 ? 0.2913 0.3500 0.3275 0.0247  0.0123  0.0052  855 ALA A CB    
4916 N N     . VAL C 560 ? 0.2637 0.3403 0.3029 0.0260  0.0100  0.0038  856 VAL A N     
4917 C CA    . VAL C 560 ? 0.3516 0.4375 0.3928 0.0235  0.0095  0.0018  856 VAL A CA    
4918 C C     . VAL C 560 ? 0.2960 0.3818 0.3394 0.0275  0.0116  0.0022  856 VAL A C     
4919 O O     . VAL C 560 ? 0.4132 0.4890 0.4553 0.0307  0.0131  0.0030  856 VAL A O     
4920 C CB    . VAL C 560 ? 0.2851 0.3666 0.3247 0.0168  0.0091  -0.0015 856 VAL A CB    
4921 C CG1   . VAL C 560 ? 0.2544 0.3337 0.2920 0.0134  0.0081  -0.0026 856 VAL A CG1   
4922 C CG2   . VAL C 560 ? 0.4137 0.4831 0.4515 0.0166  0.0099  -0.0021 856 VAL A CG2   
4923 N N     . THR C 561 ? 0.2879 0.3850 0.3348 0.0269  0.0122  0.0012  857 THR A N     
4924 C CA    . THR C 561 ? 0.3101 0.4084 0.3595 0.0304  0.0155  0.0007  857 THR A CA    
4925 C C     . THR C 561 ? 0.3155 0.4102 0.3616 0.0245  0.0173  -0.0024 857 THR A C     
4926 O O     . THR C 561 ? 0.2978 0.4007 0.3455 0.0193  0.0171  -0.0038 857 THR A O     
4927 C CB    . THR C 561 ? 0.3323 0.4473 0.3896 0.0349  0.0157  0.0021  857 THR A CB    
4928 O OG1   . THR C 561 ? 0.4995 0.6173 0.5578 0.0402  0.0129  0.0060  857 THR A OG1   
4929 C CG2   . THR C 561 ? 0.3309 0.4461 0.3916 0.0399  0.0203  0.0014  857 THR A CG2   
4930 N N     . LEU C 562 ? 0.2681 0.3499 0.3088 0.0247  0.0189  -0.0035 858 LEU A N     
4931 C CA    . LEU C 562 ? 0.1894 0.2656 0.2242 0.0197  0.0205  -0.0057 858 LEU A CA    
4932 C C     . LEU C 562 ? 0.2308 0.3082 0.2652 0.0228  0.0255  -0.0073 858 LEU A C     
4933 O O     . LEU C 562 ? 0.2598 0.3399 0.2987 0.0294  0.0275  -0.0067 858 LEU A O     
4934 C CB    . LEU C 562 ? 0.2436 0.3048 0.2715 0.0171  0.0177  -0.0060 858 LEU A CB    
4935 C CG    . LEU C 562 ? 0.3021 0.3605 0.3311 0.0146  0.0137  -0.0050 858 LEU A CG    
4936 C CD1   . LEU C 562 ? 0.2363 0.2818 0.2609 0.0129  0.0110  -0.0053 858 LEU A CD1   
4937 C CD2   . LEU C 562 ? 0.2507 0.3154 0.2805 0.0095  0.0133  -0.0054 858 LEU A CD2   
4938 N N     . ARG C 563 ? 0.3221 0.3962 0.3500 0.0180  0.0279  -0.0091 859 ARG A N     
4939 C CA    . ARG C 563 ? 0.2500 0.3230 0.2749 0.0200  0.0337  -0.0114 859 ARG A CA    
4940 C C     . ARG C 563 ? 0.3195 0.3777 0.3371 0.0230  0.0337  -0.0129 859 ARG A C     
4941 O O     . ARG C 563 ? 0.3390 0.3947 0.3538 0.0258  0.0390  -0.0155 859 ARG A O     
4942 C CB    . ARG C 563 ? 0.2642 0.3367 0.2819 0.0132  0.0368  -0.0127 859 ARG A CB    
4943 C CG    . ARG C 563 ? 0.3945 0.4813 0.4199 0.0090  0.0376  -0.0120 859 ARG A CG    
4944 C CD    . ARG C 563 ? 0.4410 0.5257 0.4587 0.0017  0.0417  -0.0128 859 ARG A CD    
4945 N NE    . ARG C 563 ? 0.4702 0.5703 0.4973 -0.0026 0.0440  -0.0130 859 ARG A NE    
4946 C CZ    . ARG C 563 ? 0.5866 0.6879 0.6150 -0.0083 0.0405  -0.0119 859 ARG A CZ    
4947 N NH1   . ARG C 563 ? 0.3576 0.4457 0.3792 -0.0096 0.0349  -0.0103 859 ARG A NH1   
4948 N NH2   . ARG C 563 ? 0.7363 0.8522 0.7738 -0.0129 0.0428  -0.0128 859 ARG A NH2   
4949 N N     . VAL C 564 ? 0.2354 0.2839 0.2501 0.0220  0.0284  -0.0118 860 VAL A N     
4950 C CA    . VAL C 564 ? 0.1905 0.2262 0.2004 0.0241  0.0278  -0.0135 860 VAL A CA    
4951 C C     . VAL C 564 ? 0.2439 0.2789 0.2611 0.0277  0.0250  -0.0110 860 VAL A C     
4952 O O     . VAL C 564 ? 0.2623 0.3046 0.2852 0.0271  0.0223  -0.0083 860 VAL A O     
4953 C CB    . VAL C 564 ? 0.2674 0.2913 0.2662 0.0184  0.0239  -0.0148 860 VAL A CB    
4954 C CG1   . VAL C 564 ? 0.3372 0.3602 0.3261 0.0147  0.0272  -0.0165 860 VAL A CG1   
4955 C CG2   . VAL C 564 ? 0.2027 0.2271 0.2043 0.0150  0.0179  -0.0120 860 VAL A CG2   
4956 N N     . PRO C 565 ? 0.2610 0.2866 0.2773 0.0310  0.0262  -0.0122 861 PRO A N     
4957 C CA    . PRO C 565 ? 0.3253 0.3484 0.3473 0.0338  0.0244  -0.0095 861 PRO A CA    
4958 C C     . PRO C 565 ? 0.2663 0.2860 0.2882 0.0288  0.0191  -0.0087 861 PRO A C     
4959 O O     . PRO C 565 ? 0.2559 0.2708 0.2725 0.0240  0.0162  -0.0106 861 PRO A O     
4960 C CB    . PRO C 565 ? 0.2177 0.2286 0.2372 0.0369  0.0275  -0.0117 861 PRO A CB    
4961 C CG    . PRO C 565 ? 0.3168 0.3270 0.3310 0.0379  0.0321  -0.0155 861 PRO A CG    
4962 C CD    . PRO C 565 ? 0.2799 0.2959 0.2893 0.0321  0.0301  -0.0162 861 PRO A CD    
4963 N N     . LEU C 566 ? 0.2078 0.2302 0.2355 0.0304  0.0180  -0.0056 862 LEU A N     
4964 C CA    . LEU C 566 ? 0.2608 0.2794 0.2906 0.0268  0.0145  -0.0051 862 LEU A CA    
4965 C C     . LEU C 566 ? 0.3065 0.3150 0.3376 0.0279  0.0157  -0.0053 862 LEU A C     
4966 O O     . LEU C 566 ? 0.4148 0.4220 0.4477 0.0325  0.0189  -0.0030 862 LEU A O     
4967 C CB    . LEU C 566 ? 0.2915 0.3186 0.3257 0.0269  0.0136  -0.0022 862 LEU A CB    
4968 C CG    . LEU C 566 ? 0.2978 0.3329 0.3313 0.0236  0.0118  -0.0026 862 LEU A CG    
4969 C CD1   . LEU C 566 ? 0.2846 0.3272 0.3214 0.0237  0.0115  -0.0006 862 LEU A CD1   
4970 C CD2   . LEU C 566 ? 0.3053 0.3346 0.3365 0.0189  0.0085  -0.0044 862 LEU A CD2   
4971 N N     . LYS C 567 ? 0.2592 0.2604 0.2895 0.0237  0.0129  -0.0079 863 LYS A N     
4972 C CA    . LYS C 567 ? 0.3156 0.3070 0.3477 0.0230  0.0139  -0.0090 863 LYS A CA    
4973 C C     . LYS C 567 ? 0.3094 0.3019 0.3490 0.0203  0.0122  -0.0074 863 LYS A C     
4974 O O     . LYS C 567 ? 0.2928 0.2905 0.3352 0.0175  0.0085  -0.0076 863 LYS A O     
4975 C CB    . LYS C 567 ? 0.3766 0.3598 0.4031 0.0193  0.0116  -0.0139 863 LYS A CB    
4976 C CG    . LYS C 567 ? 0.4026 0.3749 0.4307 0.0175  0.0127  -0.0162 863 LYS A CG    
4977 C CD    . LYS C 567 ? 0.5819 0.5488 0.6052 0.0119  0.0079  -0.0213 863 LYS A CD    
4978 C CE    . LYS C 567 ? 0.6903 0.6443 0.7086 0.0111  0.0109  -0.0258 863 LYS A CE    
4979 N NZ    . LYS C 567 ? 0.7603 0.7098 0.7702 0.0056  0.0058  -0.0314 863 LYS A NZ    
4980 N N     . VAL C 568 ? 0.2622 0.2495 0.3052 0.0214  0.0157  -0.0058 864 VAL A N     
4981 C CA    . VAL C 568 ? 0.2888 0.2770 0.3393 0.0188  0.0159  -0.0043 864 VAL A CA    
4982 C C     . VAL C 568 ? 0.2524 0.2305 0.3060 0.0155  0.0172  -0.0064 864 VAL A C     
4983 O O     . VAL C 568 ? 0.3738 0.3428 0.4241 0.0177  0.0213  -0.0059 864 VAL A O     
4984 C CB    . VAL C 568 ? 0.3125 0.3045 0.3632 0.0223  0.0198  0.0006  864 VAL A CB    
4985 C CG1   . VAL C 568 ? 0.2755 0.2674 0.3331 0.0191  0.0215  0.0016  864 VAL A CG1   
4986 C CG2   . VAL C 568 ? 0.3768 0.3795 0.4248 0.0243  0.0180  0.0018  864 VAL A CG2   
4987 N N     . ASP C 569 ? 0.1581 0.1377 0.2190 0.0102  0.0138  -0.0089 865 ASP A N     
4988 C CA    . ASP C 569 ? 0.3167 0.2892 0.3838 0.0057  0.0151  -0.0109 865 ASP A CA    
4989 C C     . ASP C 569 ? 0.3448 0.3204 0.4205 0.0047  0.0192  -0.0077 865 ASP A C     
4990 O O     . ASP C 569 ? 0.3398 0.3248 0.4201 0.0050  0.0181  -0.0064 865 ASP A O     
4991 C CB    . ASP C 569 ? 0.3926 0.3664 0.4639 0.0002  0.0083  -0.0159 865 ASP A CB    
4992 C CG    . ASP C 569 ? 0.6371 0.6064 0.6974 0.0004  0.0047  -0.0194 865 ASP A CG    
4993 O OD1   . ASP C 569 ? 0.7568 0.7175 0.8089 0.0030  0.0090  -0.0199 865 ASP A OD1   
4994 O OD2   . ASP C 569 ? 0.7999 0.7739 0.8595 -0.0019 -0.0021 -0.0215 865 ASP A OD2   
4995 N N     . TYR C 570 ? 0.2592 0.2258 0.3364 0.0032  0.0247  -0.0066 866 TYR A N     
4996 C CA    . TYR C 570 ? 0.2932 0.2611 0.3766 0.0018  0.0302  -0.0032 866 TYR A CA    
4997 C C     . TYR C 570 ? 0.3651 0.3249 0.4561 -0.0044 0.0334  -0.0051 866 TYR A C     
4998 O O     . TYR C 570 ? 0.3654 0.3141 0.4527 -0.0059 0.0337  -0.0075 866 TYR A O     
4999 C CB    . TYR C 570 ? 0.2464 0.2110 0.3205 0.0077  0.0356  0.0030  866 TYR A CB    
5000 C CG    . TYR C 570 ? 0.3615 0.3133 0.4275 0.0110  0.0382  0.0044  866 TYR A CG    
5001 C CD1   . TYR C 570 ? 0.3409 0.2800 0.4065 0.0096  0.0445  0.0070  866 TYR A CD1   
5002 C CD2   . TYR C 570 ? 0.4337 0.3853 0.4926 0.0156  0.0352  0.0030  866 TYR A CD2   
5003 C CE1   . TYR C 570 ? 0.5332 0.4588 0.5918 0.0134  0.0474  0.0083  866 TYR A CE1   
5004 C CE2   . TYR C 570 ? 0.4933 0.4330 0.5459 0.0195  0.0383  0.0039  866 TYR A CE2   
5005 C CZ    . TYR C 570 ? 0.5666 0.4929 0.6192 0.0187  0.0442  0.0066  866 TYR A CZ    
5006 O OH    . TYR C 570 ? 0.7371 0.6498 0.7838 0.0232  0.0478  0.0076  866 TYR A OH    
5007 N N     . HIS C 571 ? 0.2492 0.2146 0.3514 -0.0085 0.0362  -0.0047 867 HIS A N     
5008 C CA    . HIS C 571 ? 0.3040 0.2637 0.4157 -0.0155 0.0404  -0.0063 867 HIS A CA    
5009 C C     . HIS C 571 ? 0.3594 0.3226 0.4763 -0.0165 0.0482  -0.0022 867 HIS A C     
5010 O O     . HIS C 571 ? 0.2844 0.2560 0.3992 -0.0126 0.0487  0.0003  867 HIS A O     
5011 C CB    . HIS C 571 ? 0.2826 0.2497 0.4079 -0.0220 0.0335  -0.0128 867 HIS A CB    
5012 C CG    . HIS C 571 ? 0.4140 0.3813 0.5326 -0.0206 0.0246  -0.0167 867 HIS A CG    
5013 N ND1   . HIS C 571 ? 0.4988 0.4540 0.6097 -0.0226 0.0234  -0.0201 867 HIS A ND1   
5014 C CD2   . HIS C 571 ? 0.4517 0.4286 0.5691 -0.0177 0.0171  -0.0178 867 HIS A CD2   
5015 C CE1   . HIS C 571 ? 0.5283 0.4864 0.6328 -0.0210 0.0157  -0.0232 867 HIS A CE1   
5016 N NE2   . HIS C 571 ? 0.4926 0.4637 0.6009 -0.0181 0.0117  -0.0215 867 HIS A NE2   
5017 N N     . TYR C 572 ? 0.2593 0.2151 0.3823 -0.0225 0.0548  -0.0018 868 TYR A N     
5018 C CA    . TYR C 572 ? 0.2752 0.2346 0.4040 -0.0248 0.0631  0.0015  868 TYR A CA    
5019 C C     . TYR C 572 ? 0.2537 0.2122 0.3985 -0.0343 0.0669  -0.0018 868 TYR A C     
5020 O O     . TYR C 572 ? 0.3292 0.2803 0.4768 -0.0389 0.0643  -0.0056 868 TYR A O     
5021 C CB    . TYR C 572 ? 0.1894 0.1376 0.3021 -0.0203 0.0708  0.0092  868 TYR A CB    
5022 C CG    . TYR C 572 ? 0.3420 0.2715 0.4471 -0.0213 0.0750  0.0118  868 TYR A CG    
5023 C CD1   . TYR C 572 ? 0.3792 0.2993 0.4896 -0.0284 0.0835  0.0132  868 TYR A CD1   
5024 C CD2   . TYR C 572 ? 0.3580 0.2784 0.4508 -0.0152 0.0712  0.0129  868 TYR A CD2   
5025 C CE1   . TYR C 572 ? 0.5040 0.4046 0.6070 -0.0294 0.0878  0.0157  868 TYR A CE1   
5026 C CE2   . TYR C 572 ? 0.4009 0.3026 0.4869 -0.0153 0.0756  0.0152  868 TYR A CE2   
5027 C CZ    . TYR C 572 ? 0.5648 0.4558 0.6555 -0.0224 0.0838  0.0167  868 TYR A CZ    
5028 O OH    . TYR C 572 ? 0.6505 0.5206 0.7341 -0.0226 0.0886  0.0191  868 TYR A OH    
5029 N N     . GLY C 573 ? 0.2183 0.1851 0.3741 -0.0376 0.0734  -0.0010 869 GLY A N     
5030 C CA    . GLY C 573 ? 0.2809 0.2505 0.4552 -0.0472 0.0776  -0.0044 869 GLY A CA    
5031 C C     . GLY C 573 ? 0.2010 0.1795 0.3843 -0.0491 0.0870  -0.0024 869 GLY A C     
5032 O O     . GLY C 573 ? 0.1981 0.1793 0.3716 -0.0430 0.0898  0.0012  869 GLY A O     
5033 N N     . SER C 574 ? 0.2499 0.2332 0.4468 -0.0556 0.0897  -0.0056 870 SER A N     
5034 C CA    . SER C 574 ? 0.2662 0.2574 0.4679 -0.0561 0.0978  -0.0047 870 SER A CA    
5035 C C     . SER C 574 ? 0.2862 0.2961 0.5007 -0.0523 0.0930  -0.0083 870 SER A C     
5036 O O     . SER C 574 ? 0.2530 0.2684 0.4687 -0.0510 0.0998  -0.0076 870 SER A O     
5037 C CB    . SER C 574 ? 0.4145 0.4046 0.6256 -0.0640 0.1021  -0.0068 870 SER A CB    
5038 O OG    . SER C 574 ? 0.4526 0.4527 0.6803 -0.0680 0.0926  -0.0133 870 SER A OG    
5039 N N     . THR C 575 ? 0.2366 0.2552 0.4595 -0.0502 0.0815  -0.0122 871 THR A N     
5040 C CA    . THR C 575 ? 0.2778 0.3118 0.5109 -0.0453 0.0760  -0.0150 871 THR A CA    
5041 C C     . THR C 575 ? 0.2608 0.2957 0.4886 -0.0403 0.0666  -0.0151 871 THR A C     
5042 O O     . THR C 575 ? 0.2243 0.2492 0.4422 -0.0410 0.0631  -0.0141 871 THR A O     
5043 C CB    . THR C 575 ? 0.2842 0.3315 0.5376 -0.0484 0.0700  -0.0201 871 THR A CB    
5044 O OG1   . THR C 575 ? 0.2741 0.3230 0.5313 -0.0500 0.0580  -0.0231 871 THR A OG1   
5045 C CG2   . THR C 575 ? 0.2277 0.2734 0.4875 -0.0555 0.0782  -0.0205 871 THR A CG2   
5046 N N     . TRP C 576 ? 0.2052 0.2507 0.4377 -0.0346 0.0624  -0.0164 872 TRP A N     
5047 C CA    . TRP C 576 ? 0.2992 0.3469 0.5280 -0.0298 0.0527  -0.0168 872 TRP A CA    
5048 C C     . TRP C 576 ? 0.2467 0.2957 0.4814 -0.0330 0.0412  -0.0200 872 TRP A C     
5049 O O     . TRP C 576 ? 0.2596 0.3005 0.4781 -0.0303 0.0342  -0.0194 872 TRP A O     
5050 C CB    . TRP C 576 ? 0.2695 0.3267 0.5025 -0.0236 0.0502  -0.0178 872 TRP A CB    
5051 C CG    . TRP C 576 ? 0.3001 0.3576 0.5254 -0.0179 0.0423  -0.0173 872 TRP A CG    
5052 C CD1   . TRP C 576 ? 0.2694 0.3166 0.4747 -0.0162 0.0369  -0.0154 872 TRP A CD1   
5053 C CD2   . TRP C 576 ? 0.3104 0.3737 0.5379 -0.0121 0.0378  -0.0181 872 TRP A CD2   
5054 N NE1   . TRP C 576 ? 0.2655 0.3143 0.4642 -0.0107 0.0301  -0.0153 872 TRP A NE1   
5055 C CE2   . TRP C 576 ? 0.3318 0.3907 0.5457 -0.0083 0.0308  -0.0168 872 TRP A CE2   
5056 C CE3   . TRP C 576 ? 0.3497 0.4193 0.5862 -0.0097 0.0391  -0.0196 872 TRP A CE3   
5057 C CZ2   . TRP C 576 ? 0.3445 0.4066 0.5585 -0.0030 0.0259  -0.0171 872 TRP A CZ2   
5058 C CZ3   . TRP C 576 ? 0.3430 0.4141 0.5778 -0.0040 0.0340  -0.0198 872 TRP A CZ3   
5059 C CH2   . TRP C 576 ? 0.1834 0.2506 0.4072 -0.0009 0.0276  -0.0184 872 TRP A CH2   
5060 N N     . TYR C 577 ? 0.2547 0.3112 0.5039 -0.0369 0.0379  -0.0232 873 TYR A N     
5061 C CA    . TYR C 577 ? 0.3272 0.3849 0.5807 -0.0410 0.0271  -0.0267 873 TYR A CA    
5062 C C     . TYR C 577 ? 0.3853 0.4279 0.6274 -0.0462 0.0292  -0.0268 873 TYR A C     
5063 O O     . TYR C 577 ? 0.3791 0.4155 0.6099 -0.0454 0.0209  -0.0281 873 TYR A O     
5064 C CB    . TYR C 577 ? 0.3052 0.3735 0.5756 -0.0452 0.0253  -0.0297 873 TYR A CB    
5065 C CG    . TYR C 577 ? 0.3559 0.4260 0.6298 -0.0505 0.0143  -0.0336 873 TYR A CG    
5066 C CD1   . TYR C 577 ? 0.4393 0.5151 0.7125 -0.0473 0.0011  -0.0348 873 TYR A CD1   
5067 C CD2   . TYR C 577 ? 0.4573 0.5227 0.7336 -0.0589 0.0171  -0.0361 873 TYR A CD2   
5068 C CE1   . TYR C 577 ? 0.5170 0.5943 0.7909 -0.0524 -0.0093 -0.0385 873 TYR A CE1   
5069 C CE2   . TYR C 577 ? 0.5926 0.6594 0.8704 -0.0644 0.0069  -0.0403 873 TYR A CE2   
5070 C CZ    . TYR C 577 ? 0.6521 0.7252 0.9283 -0.0611 -0.0064 -0.0416 873 TYR A CZ    
5071 O OH    . TYR C 577 ? 0.7328 0.8070 1.0081 -0.0669 -0.0166 -0.0459 873 TYR A OH    
5072 N N     . ASP C 578 ? 0.3410 0.3749 0.5803 -0.0503 0.0402  -0.0251 874 ASP A N     
5073 C CA    . ASP C 578 ? 0.3428 0.3596 0.5707 -0.0549 0.0430  -0.0249 874 ASP A CA    
5074 C C     . ASP C 578 ? 0.3979 0.4014 0.6008 -0.0475 0.0433  -0.0208 874 ASP A C     
5075 O O     . ASP C 578 ? 0.4754 0.4643 0.6653 -0.0485 0.0430  -0.0209 874 ASP A O     
5076 C CB    . ASP C 578 ? 0.3767 0.3864 0.6046 -0.0597 0.0546  -0.0229 874 ASP A CB    
5077 C CG    . ASP C 578 ? 0.5738 0.5943 0.8182 -0.0657 0.0526  -0.0271 874 ASP A CG    
5078 O OD1   . ASP C 578 ? 0.5989 0.6191 0.8463 -0.0707 0.0446  -0.0317 874 ASP A OD1   
5079 O OD2   . ASP C 578 ? 0.6866 0.7161 0.9406 -0.0656 0.0588  -0.0261 874 ASP A OD2   
5080 N N     . ALA C 579 ? 0.2444 0.2527 0.4404 -0.0398 0.0441  -0.0173 875 ALA A N     
5081 C CA    . ALA C 579 ? 0.2612 0.2598 0.4350 -0.0326 0.0429  -0.0138 875 ALA A CA    
5082 C C     . ALA C 579 ? 0.4673 0.4673 0.6361 -0.0305 0.0311  -0.0171 875 ALA A C     
5083 O O     . ALA C 579 ? 0.3914 0.3965 0.5541 -0.0247 0.0263  -0.0162 875 ALA A O     
5084 C CB    . ALA C 579 ? 0.2275 0.2310 0.3955 -0.0265 0.0473  -0.0098 875 ALA A CB    
5085 N N     . LYS C 580 ? 0.6493 0.6440 0.8200 -0.0360 0.0268  -0.0213 876 LYS A N     
5086 C CA    . LYS C 580 ? 0.7047 0.7000 0.8699 -0.0355 0.0158  -0.0251 876 LYS A CA    
5087 C C     . LYS C 580 ? 0.8634 0.8425 1.0152 -0.0377 0.0163  -0.0273 876 LYS A C     
5088 O O     . LYS C 580 ? 0.8787 0.8474 1.0310 -0.0418 0.0237  -0.0270 876 LYS A O     
5089 C CB    . LYS C 580 ? 0.6294 0.6379 0.8130 -0.0409 0.0074  -0.0298 876 LYS A CB    
5090 C CG    . LYS C 580 ? 0.5616 0.5679 0.7577 -0.0506 0.0097  -0.0338 876 LYS A CG    
5091 C CD    . LYS C 580 ? 0.4315 0.4541 0.6489 -0.0560 0.0008  -0.0384 876 LYS A CD    
5092 C CE    . LYS C 580 ? 0.5993 0.6237 0.8307 -0.0640 0.0069  -0.0403 876 LYS A CE    
5093 N NZ    . LYS C 580 ? 0.5637 0.5893 0.7971 -0.0711 -0.0017 -0.0460 876 LYS A NZ    
5094 O OXT   . LYS C 580 ? 0.9248 0.9001 1.0648 -0.0356 0.0100  -0.0294 876 LYS A OXT   
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   DG  1   1   1   DG  DG  P . n 
A 1 2   DC  2   2   2   DC  DC  P . n 
A 1 3   DG  3   3   3   DG  DG  P . n 
A 1 4   DA  4   4   4   DA  DA  P . n 
A 1 5   DT  5   5   5   DT  DT  P . n 
A 1 6   DC  6   6   6   DC  DC  P . n 
A 1 7   DA  7   7   7   DA  DA  P . n 
A 1 8   DC  8   8   8   DC  DC  P . n 
A 1 9   DG  9   9   9   DG  DG  P . n 
A 1 10  DT  10  10  10  DT  DT  P . n 
B 2 1   DA  1   4   4   DA  DA  T . n 
B 2 2   DC  2   5   5   DC  DC  T . n 
B 2 3   DG  3   6   6   DG  DG  T . n 
B 2 4   DT  4   7   7   DT  DT  T . n 
B 2 5   DG  5   8   8   DG  DG  T . n 
B 2 6   DA  6   9   9   DA  DA  T . n 
B 2 7   DT  7   10  10  DT  DT  T . n 
B 2 8   DC  8   11  11  DC  DC  T . n 
B 2 9   DG  9   12  12  DG  DG  T . n 
B 2 10  DC  10  13  13  DC  DC  T . n 
B 2 11  DA  11  14  14  DA  DA  T . n 
C 3 1   ALA 1   297 ?   ?   ?   A . n 
C 3 2   LYS 2   298 ?   ?   ?   A . n 
C 3 3   MET 3   299 ?   ?   ?   A . n 
C 3 4   ALA 4   300 300 ALA ALA A . n 
C 3 5   PHE 5   301 301 PHE PHE A . n 
C 3 6   THR 6   302 302 THR THR A . n 
C 3 7   LEU 7   303 303 LEU LEU A . n 
C 3 8   ALA 8   304 304 ALA ALA A . n 
C 3 9   ASP 9   305 305 ASP ASP A . n 
C 3 10  ARG 10  306 306 ARG ARG A . n 
C 3 11  VAL 11  307 307 VAL VAL A . n 
C 3 12  THR 12  308 308 THR THR A . n 
C 3 13  GLU 13  309 309 GLU GLU A . n 
C 3 14  GLU 14  310 310 GLU GLU A . n 
C 3 15  MET 15  311 311 MET MET A . n 
C 3 16  LEU 16  312 312 LEU LEU A . n 
C 3 17  ALA 17  313 313 ALA ALA A . n 
C 3 18  ASP 18  314 314 ASP ASP A . n 
C 3 19  LYS 19  315 315 LYS LYS A . n 
C 3 20  ALA 20  316 316 ALA ALA A . n 
C 3 21  ALA 21  317 317 ALA ALA A . n 
C 3 22  LEU 22  318 318 LEU LEU A . n 
C 3 23  VAL 23  319 319 VAL VAL A . n 
C 3 24  VAL 24  320 320 VAL VAL A . n 
C 3 25  GLU 25  321 321 GLU GLU A . n 
C 3 26  VAL 26  322 322 VAL VAL A . n 
C 3 27  VAL 27  323 323 VAL VAL A . n 
C 3 28  GLU 28  324 324 GLU GLU A . n 
C 3 29  GLU 29  325 325 GLU GLU A . n 
C 3 30  ASN 30  326 326 ASN ASN A . n 
C 3 31  TYR 31  327 327 TYR TYR A . n 
C 3 32  HIS 32  328 328 HIS HIS A . n 
C 3 33  ASP 33  329 329 ASP ASP A . n 
C 3 34  ALA 34  330 330 ALA ALA A . n 
C 3 35  PRO 35  331 331 PRO PRO A . n 
C 3 36  ILE 36  332 332 ILE ILE A . n 
C 3 37  VAL 37  333 333 VAL VAL A . n 
C 3 38  GLY 38  334 334 GLY GLY A . n 
C 3 39  ILE 39  335 335 ILE ILE A . n 
C 3 40  ALA 40  336 336 ALA ALA A . n 
C 3 41  VAL 41  337 337 VAL VAL A . n 
C 3 42  VAL 42  338 338 VAL VAL A . n 
C 3 43  ASN 43  339 339 ASN ASN A . n 
C 3 44  GLU 44  340 340 GLU GLU A . n 
C 3 45  HIS 45  341 341 HIS HIS A . n 
C 3 46  GLY 46  342 342 GLY GLY A . n 
C 3 47  ARG 47  343 343 ARG ARG A . n 
C 3 48  PHE 48  344 344 PHE PHE A . n 
C 3 49  PHE 49  345 345 PHE PHE A . n 
C 3 50  LEU 50  346 346 LEU LEU A . n 
C 3 51  ARG 51  347 347 ARG ARG A . n 
C 3 52  PRO 52  348 348 PRO PRO A . n 
C 3 53  GLU 53  349 349 GLU GLU A . n 
C 3 54  THR 54  350 350 THR THR A . n 
C 3 55  ALA 55  351 351 ALA ALA A . n 
C 3 56  LEU 56  352 352 LEU LEU A . n 
C 3 57  ALA 57  353 353 ALA ALA A . n 
C 3 58  ASP 58  354 354 ASP ASP A . n 
C 3 59  PRO 59  355 355 PRO PRO A . n 
C 3 60  GLN 60  356 356 GLN GLN A . n 
C 3 61  PHE 61  357 357 PHE PHE A . n 
C