data_6DSV
# 
_entry.id   6DSV 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.319 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   6DSV         
WWPDB D_1000234747 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.entry_id                        6DSV 
_pdbx_database_status.recvd_initial_deposition_date   2018-06-14 
_pdbx_database_status.SG_entry                        N 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
_audit_author.identifier_ORCID 
'Chim, N.'      1 0000-0003-2274-5305 
'Jackson, L.N.' 2 ?                   
'Chaput, J.C.'  3 0000-0003-1393-135X 
# 
_citation.abstract                  ? 
_citation.abstract_id_CAS           ? 
_citation.book_id_ISBN              ? 
_citation.book_publisher            ? 
_citation.book_publisher_city       ? 
_citation.book_title                ? 
_citation.coordinate_linkage        ? 
_citation.country                   US 
_citation.database_id_Medline       ? 
_citation.details                   ? 
_citation.id                        primary 
_citation.journal_abbrev            Elife 
_citation.journal_id_ASTM           ? 
_citation.journal_id_CSD            ? 
_citation.journal_id_ISSN           2050-084X 
_citation.journal_full              ? 
_citation.journal_issue             ? 
_citation.journal_volume            7 
_citation.language                  ? 
_citation.page_first                ? 
_citation.page_last                 ? 
_citation.title                     
'Crystal structures of DNA polymerase I capture novel intermediates in the DNA synthesis pathway.' 
_citation.year                      2018 
_citation.database_id_CSD           ? 
_citation.pdbx_database_id_DOI      10.7554/eLife.40444 
_citation.pdbx_database_id_PubMed   30338759 
_citation.unpublished_flag          ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Chim, N.'      1 0000-0003-2274-5305 
primary 'Jackson, L.N.' 2 ?                   
primary 'Trinh, A.M.'   3 ?                   
primary 'Chaput, J.C.'  4 0000-0003-1393-135X 
# 
_cell.angle_alpha                  90.00 
_cell.angle_alpha_esd              ? 
_cell.angle_beta                   90.00 
_cell.angle_beta_esd               ? 
_cell.angle_gamma                  90.00 
_cell.angle_gamma_esd              ? 
_cell.entry_id                     6DSV 
_cell.details                      ? 
_cell.formula_units_Z              ? 
_cell.length_a                     87.082 
_cell.length_a_esd                 ? 
_cell.length_b                     93.069 
_cell.length_b_esd                 ? 
_cell.length_c                     104.736 
_cell.length_c_esd                 ? 
_cell.volume                       ? 
_cell.volume_esd                   ? 
_cell.Z_PDB                        4 
_cell.reciprocal_angle_alpha       ? 
_cell.reciprocal_angle_beta        ? 
_cell.reciprocal_angle_gamma       ? 
_cell.reciprocal_angle_alpha_esd   ? 
_cell.reciprocal_angle_beta_esd    ? 
_cell.reciprocal_angle_gamma_esd   ? 
_cell.reciprocal_length_a          ? 
_cell.reciprocal_length_b          ? 
_cell.reciprocal_length_c          ? 
_cell.reciprocal_length_a_esd      ? 
_cell.reciprocal_length_b_esd      ? 
_cell.reciprocal_length_c_esd      ? 
_cell.pdbx_unique_axis             ? 
# 
_symmetry.entry_id                         6DSV 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                19 
_symmetry.space_group_name_Hall            ? 
_symmetry.space_group_name_H-M             'P 21 21 21' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     syn 
;DNA (5'-D(*GP*CP*GP*AP*TP*CP*AP*CP*GP*TP*A)-3')
;
3358.211  1   ?       ? ? ? 
2 polymer     man 'DNA polymerase I'                                    66233.938 1   2.7.7.7 ? ? ? 
3 polymer     syn 
;DNA (5'-D(P*TP*AP*CP*GP*TP*GP*AP*TP*CP*GP*CP*A)-3')
;
3662.404  1   ?       ? ? ? 
4 non-polymer syn 'MAGNESIUM ION'                                       24.305    1   ?       ? ? ? 
5 non-polymer syn 'SULFATE ION'                                         96.063    1   ?       ? ? ? 
6 water       nat water                                                 18.015    384 ?       ? ? ? 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 polydeoxyribonucleotide no no '(DG)(DC)(DG)(DA)(DT)(DC)(DA)(DC)(DG)(DT)(DA)' GCGATCACGTA P ? 
2 'polypeptide(L)'        no no 
;AKMAFTLADRVTEEMLADKAALVVEVVEENYHDAPIVGIAVVNEHGRFFLRPETALADPQFVAWLGDETKKKSMFDSKRA
AVALKWKGIELCGVSFDLLLAAYLLDPAQGVDDVAAAAKMKQYEAVRPDEAVYGKGAKRAVPDEPVLAEHLVRKAAAIWA
LERPFLDELRRNEQDRLLVELEQPLSSILAEMEFAGVKVDTKRLEQMGEELAEQLRTVEQRIYELAGQEFNINSPKQLGV
ILFEKLQLPVLKKTKTGYSTSADVLEKLAPYHEIVENILHYRQLGKLQSTYIEGLLKVVRPDTKKVHTIFNQALTQTGRL
SSTEPNLQNIPIRLEEGRKIRQAFVPSESDWLIFAADYSQIELRVLAHIAEDDNLMEAFRRDLDIHTKTAMDIFQVSEDE
VTPNMRRQAKAVNFGIVYGISDYGLAQNLNISRKEAAEFIERYFESFPGVKRYMENIVQEAKQKGYVTTLLHRRRYLPDI
TSRNFNVRSFAERMAMNTPIQGSAADIIKKAMIDLNARLKEERLQARLLLQVHDELILEAPKEEMERLCRLVPEVMEQAV
TLRVPLKVDYHYGSTWYDAK
;
;AKMAFTLADRVTEEMLADKAALVVEVVEENYHDAPIVGIAVVNEHGRFFLRPETALADPQFVAWLGDETKKKSMFDSKRA
AVALKWKGIELCGVSFDLLLAAYLLDPAQGVDDVAAAAKMKQYEAVRPDEAVYGKGAKRAVPDEPVLAEHLVRKAAAIWA
LERPFLDELRRNEQDRLLVELEQPLSSILAEMEFAGVKVDTKRLEQMGEELAEQLRTVEQRIYELAGQEFNINSPKQLGV
ILFEKLQLPVLKKTKTGYSTSADVLEKLAPYHEIVENILHYRQLGKLQSTYIEGLLKVVRPDTKKVHTIFNQALTQTGRL
SSTEPNLQNIPIRLEEGRKIRQAFVPSESDWLIFAADYSQIELRVLAHIAEDDNLMEAFRRDLDIHTKTAMDIFQVSEDE
VTPNMRRQAKAVNFGIVYGISDYGLAQNLNISRKEAAEFIERYFESFPGVKRYMENIVQEAKQKGYVTTLLHRRRYLPDI
TSRNFNVRSFAERMAMNTPIQGSAADIIKKAMIDLNARLKEERLQARLLLQVHDELILEAPKEEMERLCRLVPEVMEQAV
TLRVPLKVDYHYGSTWYDAK
;
A ? 
3 polydeoxyribonucleotide no no '(DT)(DA)(DC)(DG)(DT)(DG)(DA)(DT)(DC)(DG)(DC)(DA)' TACGTGATCGCA T ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   DG  n 
1 2   DC  n 
1 3   DG  n 
1 4   DA  n 
1 5   DT  n 
1 6   DC  n 
1 7   DA  n 
1 8   DC  n 
1 9   DG  n 
1 10  DT  n 
1 11  DA  n 
2 1   ALA n 
2 2   LYS n 
2 3   MET n 
2 4   ALA n 
2 5   PHE n 
2 6   THR n 
2 7   LEU n 
2 8   ALA n 
2 9   ASP n 
2 10  ARG n 
2 11  VAL n 
2 12  THR n 
2 13  GLU n 
2 14  GLU n 
2 15  MET n 
2 16  LEU n 
2 17  ALA n 
2 18  ASP n 
2 19  LYS n 
2 20  ALA n 
2 21  ALA n 
2 22  LEU n 
2 23  VAL n 
2 24  VAL n 
2 25  GLU n 
2 26  VAL n 
2 27  VAL n 
2 28  GLU n 
2 29  GLU n 
2 30  ASN n 
2 31  TYR n 
2 32  HIS n 
2 33  ASP n 
2 34  ALA n 
2 35  PRO n 
2 36  ILE n 
2 37  VAL n 
2 38  GLY n 
2 39  ILE n 
2 40  ALA n 
2 41  VAL n 
2 42  VAL n 
2 43  ASN n 
2 44  GLU n 
2 45  HIS n 
2 46  GLY n 
2 47  ARG n 
2 48  PHE n 
2 49  PHE n 
2 50  LEU n 
2 51  ARG n 
2 52  PRO n 
2 53  GLU n 
2 54  THR n 
2 55  ALA n 
2 56  LEU n 
2 57  ALA n 
2 58  ASP n 
2 59  PRO n 
2 60  GLN n 
2 61  PHE n 
2 62  VAL n 
2 63  ALA n 
2 64  TRP n 
2 65  LEU n 
2 66  GLY n 
2 67  ASP n 
2 68  GLU n 
2 69  THR n 
2 70  LYS n 
2 71  LYS n 
2 72  LYS n 
2 73  SER n 
2 74  MET n 
2 75  PHE n 
2 76  ASP n 
2 77  SER n 
2 78  LYS n 
2 79  ARG n 
2 80  ALA n 
2 81  ALA n 
2 82  VAL n 
2 83  ALA n 
2 84  LEU n 
2 85  LYS n 
2 86  TRP n 
2 87  LYS n 
2 88  GLY n 
2 89  ILE n 
2 90  GLU n 
2 91  LEU n 
2 92  CYS n 
2 93  GLY n 
2 94  VAL n 
2 95  SER n 
2 96  PHE n 
2 97  ASP n 
2 98  LEU n 
2 99  LEU n 
2 100 LEU n 
2 101 ALA n 
2 102 ALA n 
2 103 TYR n 
2 104 LEU n 
2 105 LEU n 
2 106 ASP n 
2 107 PRO n 
2 108 ALA n 
2 109 GLN n 
2 110 GLY n 
2 111 VAL n 
2 112 ASP n 
2 113 ASP n 
2 114 VAL n 
2 115 ALA n 
2 116 ALA n 
2 117 ALA n 
2 118 ALA n 
2 119 LYS n 
2 120 MET n 
2 121 LYS n 
2 122 GLN n 
2 123 TYR n 
2 124 GLU n 
2 125 ALA n 
2 126 VAL n 
2 127 ARG n 
2 128 PRO n 
2 129 ASP n 
2 130 GLU n 
2 131 ALA n 
2 132 VAL n 
2 133 TYR n 
2 134 GLY n 
2 135 LYS n 
2 136 GLY n 
2 137 ALA n 
2 138 LYS n 
2 139 ARG n 
2 140 ALA n 
2 141 VAL n 
2 142 PRO n 
2 143 ASP n 
2 144 GLU n 
2 145 PRO n 
2 146 VAL n 
2 147 LEU n 
2 148 ALA n 
2 149 GLU n 
2 150 HIS n 
2 151 LEU n 
2 152 VAL n 
2 153 ARG n 
2 154 LYS n 
2 155 ALA n 
2 156 ALA n 
2 157 ALA n 
2 158 ILE n 
2 159 TRP n 
2 160 ALA n 
2 161 LEU n 
2 162 GLU n 
2 163 ARG n 
2 164 PRO n 
2 165 PHE n 
2 166 LEU n 
2 167 ASP n 
2 168 GLU n 
2 169 LEU n 
2 170 ARG n 
2 171 ARG n 
2 172 ASN n 
2 173 GLU n 
2 174 GLN n 
2 175 ASP n 
2 176 ARG n 
2 177 LEU n 
2 178 LEU n 
2 179 VAL n 
2 180 GLU n 
2 181 LEU n 
2 182 GLU n 
2 183 GLN n 
2 184 PRO n 
2 185 LEU n 
2 186 SER n 
2 187 SER n 
2 188 ILE n 
2 189 LEU n 
2 190 ALA n 
2 191 GLU n 
2 192 MET n 
2 193 GLU n 
2 194 PHE n 
2 195 ALA n 
2 196 GLY n 
2 197 VAL n 
2 198 LYS n 
2 199 VAL n 
2 200 ASP n 
2 201 THR n 
2 202 LYS n 
2 203 ARG n 
2 204 LEU n 
2 205 GLU n 
2 206 GLN n 
2 207 MET n 
2 208 GLY n 
2 209 GLU n 
2 210 GLU n 
2 211 LEU n 
2 212 ALA n 
2 213 GLU n 
2 214 GLN n 
2 215 LEU n 
2 216 ARG n 
2 217 THR n 
2 218 VAL n 
2 219 GLU n 
2 220 GLN n 
2 221 ARG n 
2 222 ILE n 
2 223 TYR n 
2 224 GLU n 
2 225 LEU n 
2 226 ALA n 
2 227 GLY n 
2 228 GLN n 
2 229 GLU n 
2 230 PHE n 
2 231 ASN n 
2 232 ILE n 
2 233 ASN n 
2 234 SER n 
2 235 PRO n 
2 236 LYS n 
2 237 GLN n 
2 238 LEU n 
2 239 GLY n 
2 240 VAL n 
2 241 ILE n 
2 242 LEU n 
2 243 PHE n 
2 244 GLU n 
2 245 LYS n 
2 246 LEU n 
2 247 GLN n 
2 248 LEU n 
2 249 PRO n 
2 250 VAL n 
2 251 LEU n 
2 252 LYS n 
2 253 LYS n 
2 254 THR n 
2 255 LYS n 
2 256 THR n 
2 257 GLY n 
2 258 TYR n 
2 259 SER n 
2 260 THR n 
2 261 SER n 
2 262 ALA n 
2 263 ASP n 
2 264 VAL n 
2 265 LEU n 
2 266 GLU n 
2 267 LYS n 
2 268 LEU n 
2 269 ALA n 
2 270 PRO n 
2 271 TYR n 
2 272 HIS n 
2 273 GLU n 
2 274 ILE n 
2 275 VAL n 
2 276 GLU n 
2 277 ASN n 
2 278 ILE n 
2 279 LEU n 
2 280 HIS n 
2 281 TYR n 
2 282 ARG n 
2 283 GLN n 
2 284 LEU n 
2 285 GLY n 
2 286 LYS n 
2 287 LEU n 
2 288 GLN n 
2 289 SER n 
2 290 THR n 
2 291 TYR n 
2 292 ILE n 
2 293 GLU n 
2 294 GLY n 
2 295 LEU n 
2 296 LEU n 
2 297 LYS n 
2 298 VAL n 
2 299 VAL n 
2 300 ARG n 
2 301 PRO n 
2 302 ASP n 
2 303 THR n 
2 304 LYS n 
2 305 LYS n 
2 306 VAL n 
2 307 HIS n 
2 308 THR n 
2 309 ILE n 
2 310 PHE n 
2 311 ASN n 
2 312 GLN n 
2 313 ALA n 
2 314 LEU n 
2 315 THR n 
2 316 GLN n 
2 317 THR n 
2 318 GLY n 
2 319 ARG n 
2 320 LEU n 
2 321 SER n 
2 322 SER n 
2 323 THR n 
2 324 GLU n 
2 325 PRO n 
2 326 ASN n 
2 327 LEU n 
2 328 GLN n 
2 329 ASN n 
2 330 ILE n 
2 331 PRO n 
2 332 ILE n 
2 333 ARG n 
2 334 LEU n 
2 335 GLU n 
2 336 GLU n 
2 337 GLY n 
2 338 ARG n 
2 339 LYS n 
2 340 ILE n 
2 341 ARG n 
2 342 GLN n 
2 343 ALA n 
2 344 PHE n 
2 345 VAL n 
2 346 PRO n 
2 347 SER n 
2 348 GLU n 
2 349 SER n 
2 350 ASP n 
2 351 TRP n 
2 352 LEU n 
2 353 ILE n 
2 354 PHE n 
2 355 ALA n 
2 356 ALA n 
2 357 ASP n 
2 358 TYR n 
2 359 SER n 
2 360 GLN n 
2 361 ILE n 
2 362 GLU n 
2 363 LEU n 
2 364 ARG n 
2 365 VAL n 
2 366 LEU n 
2 367 ALA n 
2 368 HIS n 
2 369 ILE n 
2 370 ALA n 
2 371 GLU n 
2 372 ASP n 
2 373 ASP n 
2 374 ASN n 
2 375 LEU n 
2 376 MET n 
2 377 GLU n 
2 378 ALA n 
2 379 PHE n 
2 380 ARG n 
2 381 ARG n 
2 382 ASP n 
2 383 LEU n 
2 384 ASP n 
2 385 ILE n 
2 386 HIS n 
2 387 THR n 
2 388 LYS n 
2 389 THR n 
2 390 ALA n 
2 391 MET n 
2 392 ASP n 
2 393 ILE n 
2 394 PHE n 
2 395 GLN n 
2 396 VAL n 
2 397 SER n 
2 398 GLU n 
2 399 ASP n 
2 400 GLU n 
2 401 VAL n 
2 402 THR n 
2 403 PRO n 
2 404 ASN n 
2 405 MET n 
2 406 ARG n 
2 407 ARG n 
2 408 GLN n 
2 409 ALA n 
2 410 LYS n 
2 411 ALA n 
2 412 VAL n 
2 413 ASN n 
2 414 PHE n 
2 415 GLY n 
2 416 ILE n 
2 417 VAL n 
2 418 TYR n 
2 419 GLY n 
2 420 ILE n 
2 421 SER n 
2 422 ASP n 
2 423 TYR n 
2 424 GLY n 
2 425 LEU n 
2 426 ALA n 
2 427 GLN n 
2 428 ASN n 
2 429 LEU n 
2 430 ASN n 
2 431 ILE n 
2 432 SER n 
2 433 ARG n 
2 434 LYS n 
2 435 GLU n 
2 436 ALA n 
2 437 ALA n 
2 438 GLU n 
2 439 PHE n 
2 440 ILE n 
2 441 GLU n 
2 442 ARG n 
2 443 TYR n 
2 444 PHE n 
2 445 GLU n 
2 446 SER n 
2 447 PHE n 
2 448 PRO n 
2 449 GLY n 
2 450 VAL n 
2 451 LYS n 
2 452 ARG n 
2 453 TYR n 
2 454 MET n 
2 455 GLU n 
2 456 ASN n 
2 457 ILE n 
2 458 VAL n 
2 459 GLN n 
2 460 GLU n 
2 461 ALA n 
2 462 LYS n 
2 463 GLN n 
2 464 LYS n 
2 465 GLY n 
2 466 TYR n 
2 467 VAL n 
2 468 THR n 
2 469 THR n 
2 470 LEU n 
2 471 LEU n 
2 472 HIS n 
2 473 ARG n 
2 474 ARG n 
2 475 ARG n 
2 476 TYR n 
2 477 LEU n 
2 478 PRO n 
2 479 ASP n 
2 480 ILE n 
2 481 THR n 
2 482 SER n 
2 483 ARG n 
2 484 ASN n 
2 485 PHE n 
2 486 ASN n 
2 487 VAL n 
2 488 ARG n 
2 489 SER n 
2 490 PHE n 
2 491 ALA n 
2 492 GLU n 
2 493 ARG n 
2 494 MET n 
2 495 ALA n 
2 496 MET n 
2 497 ASN n 
2 498 THR n 
2 499 PRO n 
2 500 ILE n 
2 501 GLN n 
2 502 GLY n 
2 503 SER n 
2 504 ALA n 
2 505 ALA n 
2 506 ASP n 
2 507 ILE n 
2 508 ILE n 
2 509 LYS n 
2 510 LYS n 
2 511 ALA n 
2 512 MET n 
2 513 ILE n 
2 514 ASP n 
2 515 LEU n 
2 516 ASN n 
2 517 ALA n 
2 518 ARG n 
2 519 LEU n 
2 520 LYS n 
2 521 GLU n 
2 522 GLU n 
2 523 ARG n 
2 524 LEU n 
2 525 GLN n 
2 526 ALA n 
2 527 ARG n 
2 528 LEU n 
2 529 LEU n 
2 530 LEU n 
2 531 GLN n 
2 532 VAL n 
2 533 HIS n 
2 534 ASP n 
2 535 GLU n 
2 536 LEU n 
2 537 ILE n 
2 538 LEU n 
2 539 GLU n 
2 540 ALA n 
2 541 PRO n 
2 542 LYS n 
2 543 GLU n 
2 544 GLU n 
2 545 MET n 
2 546 GLU n 
2 547 ARG n 
2 548 LEU n 
2 549 CYS n 
2 550 ARG n 
2 551 LEU n 
2 552 VAL n 
2 553 PRO n 
2 554 GLU n 
2 555 VAL n 
2 556 MET n 
2 557 GLU n 
2 558 GLN n 
2 559 ALA n 
2 560 VAL n 
2 561 THR n 
2 562 LEU n 
2 563 ARG n 
2 564 VAL n 
2 565 PRO n 
2 566 LEU n 
2 567 LYS n 
2 568 VAL n 
2 569 ASP n 
2 570 TYR n 
2 571 HIS n 
2 572 TYR n 
2 573 GLY n 
2 574 SER n 
2 575 THR n 
2 576 TRP n 
2 577 TYR n 
2 578 ASP n 
2 579 ALA n 
2 580 LYS n 
3 1   DT  n 
3 2   DA  n 
3 3   DC  n 
3 4   DG  n 
3 5   DT  n 
3 6   DG  n 
3 7   DA  n 
3 8   DT  n 
3 9   DC  n 
3 10  DG  n 
3 11  DC  n 
3 12  DA  n 
# 
_entity_src_gen.entity_id                          2 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      'Biological sequence' 
_entity_src_gen.pdbx_beg_seq_num                   1 
_entity_src_gen.pdbx_end_seq_num                   580 
_entity_src_gen.gene_src_common_name               ? 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 polA 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Geobacillus stearothermophilus' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     1422 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
loop_
_pdbx_entity_src_syn.entity_id 
_pdbx_entity_src_syn.pdbx_src_id 
_pdbx_entity_src_syn.pdbx_alt_source_flag 
_pdbx_entity_src_syn.pdbx_beg_seq_num 
_pdbx_entity_src_syn.pdbx_end_seq_num 
_pdbx_entity_src_syn.organism_scientific 
_pdbx_entity_src_syn.organism_common_name 
_pdbx_entity_src_syn.ncbi_taxonomy_id 
_pdbx_entity_src_syn.details 
1 1 sample 1 11 'synthetic construct' ? 32630 ? 
3 1 sample 1 12 'synthetic construct' ? 32630 ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_db_isoform 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
1 PDB 6DSV         6DSV   ? 1 ? 1 
2 UNP E1C9K5_GEOSE E1C9K5 ? 2 
;AKMAFTLADRVTEEMLADKAALVVEVVEENYHDAPIVGIAVVNEHGRFFLRPETALADPQFVAWLGDETKKKSMFDSKRA
AVALKWKGIELCGVSFDLLLAAYLLDPAQGVDDVAAAAKMKQYEAVRPDEAVYGKGAKRAVPDEPVLAEHLVRKAAAIWA
LERPFLDELRRNEQDRLLVELEQPLSSILAEMEFAGVKVDTKRLEQMGEELAEQLRTVEQRIYELAGQEFNINSPKQLGV
ILFEKLQLPVLKKSKTGYSTSADVLEKLAPYHEIVENILHYRQLGKLQSTYIEGLLKVVRPDTKKVHTIFNQALTQTGRL
SSTEPNLQNIPIRLEEGRKIRQAFVPSESDWLIFAADYSQIELRVLAHIAEDDNLMEAFRRDLDIHTKTAMDIFQVSEDE
VTPNMRRQAKAVNFGIVYGISDYGLAQNLNISRKEAAEFIERYFESFPGVKRYMENIVQEAKQKGYVTTLLHRRRYLPDI
TSRNFNVRSFAERMAMNTPIQGSAADIIKKAMIDLNARLKEERLQARLLLQVHDELILEAPKEEMERLCRLVPEVMEQAV
TLRVPLKVDYHYGSTWYDAK
;
1 
3 PDB 6DSV         6DSV   ? 3 ? 1 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 6DSV P 1 ? 11  ? 6DSV   1 ? 11  ? 1   11  
2 2 6DSV A 1 ? 580 ? E1C9K5 1 ? 580 ? 297 876 
3 3 6DSV T 1 ? 12  ? 6DSV   4 ? 15  ? 4   15  
# 
_struct_ref_seq_dif.align_id                     2 
_struct_ref_seq_dif.pdbx_pdb_id_code             6DSV 
_struct_ref_seq_dif.mon_id                       THR 
_struct_ref_seq_dif.pdbx_pdb_strand_id           A 
_struct_ref_seq_dif.seq_num                      254 
_struct_ref_seq_dif.pdbx_pdb_ins_code            ? 
_struct_ref_seq_dif.pdbx_seq_db_name             UNP 
_struct_ref_seq_dif.pdbx_seq_db_accession_code   E1C9K5 
_struct_ref_seq_dif.db_mon_id                    SER 
_struct_ref_seq_dif.pdbx_seq_db_seq_num          254 
_struct_ref_seq_dif.details                      conflict 
_struct_ref_seq_dif.pdbx_auth_seq_num            550 
_struct_ref_seq_dif.pdbx_ordinal                 1 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                              ? 'C3 H7 N O2'      89.093  
ARG 'L-peptide linking' y ARGININE                             ? 'C6 H15 N4 O2 1'  175.209 
ASN 'L-peptide linking' y ASPARAGINE                           ? 'C4 H8 N2 O3'     132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                      ? 'C4 H7 N O4'      133.103 
CYS 'L-peptide linking' y CYSTEINE                             ? 'C3 H7 N O2 S'    121.158 
DA  'DNA linking'       y "2'-DEOXYADENOSINE-5'-MONOPHOSPHATE" ? 'C10 H14 N5 O6 P' 331.222 
DC  'DNA linking'       y "2'-DEOXYCYTIDINE-5'-MONOPHOSPHATE"  ? 'C9 H14 N3 O7 P'  307.197 
DG  'DNA linking'       y "2'-DEOXYGUANOSINE-5'-MONOPHOSPHATE" ? 'C10 H14 N5 O7 P' 347.221 
DT  'DNA linking'       y "THYMIDINE-5'-MONOPHOSPHATE"         ? 'C10 H15 N2 O8 P' 322.208 
GLN 'L-peptide linking' y GLUTAMINE                            ? 'C5 H10 N2 O3'    146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                      ? 'C5 H9 N O4'      147.129 
GLY 'peptide linking'   y GLYCINE                              ? 'C2 H5 N O2'      75.067  
HIS 'L-peptide linking' y HISTIDINE                            ? 'C6 H10 N3 O2 1'  156.162 
HOH non-polymer         . WATER                                ? 'H2 O'            18.015  
ILE 'L-peptide linking' y ISOLEUCINE                           ? 'C6 H13 N O2'     131.173 
LEU 'L-peptide linking' y LEUCINE                              ? 'C6 H13 N O2'     131.173 
LYS 'L-peptide linking' y LYSINE                               ? 'C6 H15 N2 O2 1'  147.195 
MET 'L-peptide linking' y METHIONINE                           ? 'C5 H11 N O2 S'   149.211 
MG  non-polymer         . 'MAGNESIUM ION'                      ? 'Mg 2'            24.305  
PHE 'L-peptide linking' y PHENYLALANINE                        ? 'C9 H11 N O2'     165.189 
PRO 'L-peptide linking' y PROLINE                              ? 'C5 H9 N O2'      115.130 
SER 'L-peptide linking' y SERINE                               ? 'C3 H7 N O3'      105.093 
SO4 non-polymer         . 'SULFATE ION'                        ? 'O4 S -2'         96.063  
THR 'L-peptide linking' y THREONINE                            ? 'C4 H9 N O3'      119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                           ? 'C11 H12 N2 O2'   204.225 
TYR 'L-peptide linking' y TYROSINE                             ? 'C9 H11 N O3'     181.189 
VAL 'L-peptide linking' y VALINE                               ? 'C5 H11 N O2'     117.146 
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.entry_id                   6DSV 
_exptl.crystals_number            1 
_exptl.details                    ? 
_exptl.method                     'X-RAY DIFFRACTION' 
_exptl.method_details             ? 
# 
_exptl_crystal.colour                      ? 
_exptl_crystal.density_diffrn              ? 
_exptl_crystal.density_Matthews            2.90 
_exptl_crystal.density_method              ? 
_exptl_crystal.density_percent_sol         57.59 
_exptl_crystal.description                 ? 
_exptl_crystal.F_000                       ? 
_exptl_crystal.id                          1 
_exptl_crystal.preparation                 ? 
_exptl_crystal.size_max                    ? 
_exptl_crystal.size_mid                    ? 
_exptl_crystal.size_min                    ? 
_exptl_crystal.size_rad                    ? 
_exptl_crystal.colour_lustre               ? 
_exptl_crystal.colour_modifier             ? 
_exptl_crystal.colour_primary              ? 
_exptl_crystal.density_meas                ? 
_exptl_crystal.density_meas_esd            ? 
_exptl_crystal.density_meas_gt             ? 
_exptl_crystal.density_meas_lt             ? 
_exptl_crystal.density_meas_temp           ? 
_exptl_crystal.density_meas_temp_esd       ? 
_exptl_crystal.density_meas_temp_gt        ? 
_exptl_crystal.density_meas_temp_lt        ? 
_exptl_crystal.pdbx_crystal_image_url      ? 
_exptl_crystal.pdbx_crystal_image_format   ? 
_exptl_crystal.pdbx_mosaicity              ? 
_exptl_crystal.pdbx_mosaicity_esd          ? 
# 
_exptl_crystal_grow.apparatus       ? 
_exptl_crystal_grow.atmosphere      ? 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.details         ? 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.method_ref      ? 
_exptl_crystal_grow.pH              ? 
_exptl_crystal_grow.pressure        ? 
_exptl_crystal_grow.pressure_esd    ? 
_exptl_crystal_grow.seeding         ? 
_exptl_crystal_grow.seeding_ref     ? 
_exptl_crystal_grow.temp            298 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.temp_esd        ? 
_exptl_crystal_grow.time            ? 
_exptl_crystal_grow.pdbx_details    '50% ammonium sulfate, 0.1M MES, 2% MPD' 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.ambient_environment              ? 
_diffrn.ambient_temp                     100 
_diffrn.ambient_temp_details             ? 
_diffrn.ambient_temp_esd                 ? 
_diffrn.crystal_id                       1 
_diffrn.crystal_support                  ? 
_diffrn.crystal_treatment                ? 
_diffrn.details                          ? 
_diffrn.id                               1 
_diffrn.ambient_pressure                 ? 
_diffrn.ambient_pressure_esd             ? 
_diffrn.ambient_pressure_gt              ? 
_diffrn.ambient_pressure_lt              ? 
_diffrn.ambient_temp_gt                  ? 
_diffrn.ambient_temp_lt                  ? 
_diffrn.pdbx_serial_crystal_experiment   ? 
# 
_diffrn_detector.details                      ? 
_diffrn_detector.detector                     CCD 
_diffrn_detector.diffrn_id                    1 
_diffrn_detector.type                         'ADSC QUANTUM 315r' 
_diffrn_detector.area_resol_mean              ? 
_diffrn_detector.dtime                        ? 
_diffrn_detector.pdbx_frames_total            ? 
_diffrn_detector.pdbx_collection_time_total   ? 
_diffrn_detector.pdbx_collection_date         2018-02-14 
_diffrn_detector.pdbx_frequency               ? 
# 
_diffrn_radiation.collimation                      ? 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.filter_edge                      ? 
_diffrn_radiation.inhomogeneity                    ? 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.polarisn_norm                    ? 
_diffrn_radiation.polarisn_ratio                   ? 
_diffrn_radiation.probe                            ? 
_diffrn_radiation.type                             ? 
_diffrn_radiation.xray_symbol                      ? 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_wavelength_list             ? 
_diffrn_radiation.pdbx_wavelength                  ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_analyzer                    ? 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.current                     ? 
_diffrn_source.details                     ? 
_diffrn_source.diffrn_id                   1 
_diffrn_source.power                       ? 
_diffrn_source.size                        ? 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.target                      ? 
_diffrn_source.type                        'ALS BEAMLINE 8.2.1' 
_diffrn_source.voltage                     ? 
_diffrn_source.take-off_angle              ? 
_diffrn_source.pdbx_wavelength_list        1 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_synchrotron_beamline   8.2.1 
_diffrn_source.pdbx_synchrotron_site       ALS 
# 
_reflns.B_iso_Wilson_estimate            ? 
_reflns.entry_id                         6DSV 
_reflns.data_reduction_details           ? 
_reflns.data_reduction_method            ? 
_reflns.d_resolution_high                1.99 
_reflns.d_resolution_low                 44.0 
_reflns.details                          ? 
_reflns.limit_h_max                      ? 
_reflns.limit_h_min                      ? 
_reflns.limit_k_max                      ? 
_reflns.limit_k_min                      ? 
_reflns.limit_l_max                      ? 
_reflns.limit_l_min                      ? 
_reflns.number_all                       ? 
_reflns.number_obs                       58993 
_reflns.observed_criterion               ? 
_reflns.observed_criterion_F_max         ? 
_reflns.observed_criterion_F_min         ? 
_reflns.observed_criterion_I_max         ? 
_reflns.observed_criterion_I_min         ? 
_reflns.observed_criterion_sigma_F       ? 
_reflns.observed_criterion_sigma_I       ? 
_reflns.percent_possible_obs             99.9 
_reflns.R_free_details                   ? 
_reflns.Rmerge_F_all                     ? 
_reflns.Rmerge_F_obs                     ? 
_reflns.Friedel_coverage                 ? 
_reflns.number_gt                        ? 
_reflns.threshold_expression             ? 
_reflns.pdbx_redundancy                  7.2 
_reflns.pdbx_Rmerge_I_obs                0.327 
_reflns.pdbx_Rmerge_I_all                ? 
_reflns.pdbx_Rsym_value                  ? 
_reflns.pdbx_netI_over_av_sigmaI         ? 
_reflns.pdbx_netI_over_sigmaI            9.75 
_reflns.pdbx_res_netI_over_av_sigmaI_2   ? 
_reflns.pdbx_res_netI_over_sigmaI_2      ? 
_reflns.pdbx_chi_squared                 ? 
_reflns.pdbx_scaling_rejects             ? 
_reflns.pdbx_d_res_high_opt              ? 
_reflns.pdbx_d_res_low_opt               ? 
_reflns.pdbx_d_res_opt_method            ? 
_reflns.phase_calculation_details        ? 
_reflns.pdbx_Rrim_I_all                  ? 
_reflns.pdbx_Rpim_I_all                  ? 
_reflns.pdbx_d_opt                       ? 
_reflns.pdbx_number_measured_all         ? 
_reflns.pdbx_diffrn_id                   1 
_reflns.pdbx_ordinal                     1 
_reflns.pdbx_CC_half                     0.991 
_reflns.pdbx_R_split                     ? 
# 
_reflns_shell.d_res_high                  1.99 
_reflns_shell.d_res_low                   2.061 
_reflns_shell.meanI_over_sigI_all         ? 
_reflns_shell.meanI_over_sigI_obs         ? 
_reflns_shell.number_measured_all         ? 
_reflns_shell.number_measured_obs         ? 
_reflns_shell.number_possible             ? 
_reflns_shell.number_unique_all           ? 
_reflns_shell.number_unique_obs           5832 
_reflns_shell.percent_possible_all        ? 
_reflns_shell.percent_possible_obs        ? 
_reflns_shell.Rmerge_F_all                ? 
_reflns_shell.Rmerge_F_obs                ? 
_reflns_shell.Rmerge_I_all                ? 
_reflns_shell.Rmerge_I_obs                1.745 
_reflns_shell.meanI_over_sigI_gt          ? 
_reflns_shell.meanI_over_uI_all           ? 
_reflns_shell.meanI_over_uI_gt            ? 
_reflns_shell.number_measured_gt          ? 
_reflns_shell.number_unique_gt            ? 
_reflns_shell.percent_possible_gt         ? 
_reflns_shell.Rmerge_F_gt                 ? 
_reflns_shell.Rmerge_I_gt                 ? 
_reflns_shell.pdbx_redundancy             ? 
_reflns_shell.pdbx_Rsym_value             ? 
_reflns_shell.pdbx_chi_squared            ? 
_reflns_shell.pdbx_netI_over_sigmaI_all   ? 
_reflns_shell.pdbx_netI_over_sigmaI_obs   ? 
_reflns_shell.pdbx_Rrim_I_all             ? 
_reflns_shell.pdbx_Rpim_I_all             ? 
_reflns_shell.pdbx_rejects                ? 
_reflns_shell.pdbx_ordinal                1 
_reflns_shell.pdbx_diffrn_id              1 
_reflns_shell.pdbx_CC_half                0.598 
_reflns_shell.pdbx_R_split                ? 
# 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.B_iso_max                                ? 
_refine.B_iso_mean                               ? 
_refine.B_iso_min                                ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.details                                  ? 
_refine.diff_density_max                         ? 
_refine.diff_density_max_esd                     ? 
_refine.diff_density_min                         ? 
_refine.diff_density_min_esd                     ? 
_refine.diff_density_rms                         ? 
_refine.diff_density_rms_esd                     ? 
_refine.entry_id                                 6DSV 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.ls_abs_structure_details                 ? 
_refine.ls_abs_structure_Flack                   ? 
_refine.ls_abs_structure_Flack_esd               ? 
_refine.ls_abs_structure_Rogers                  ? 
_refine.ls_abs_structure_Rogers_esd              ? 
_refine.ls_d_res_high                            1.990 
_refine.ls_d_res_low                             43.541 
_refine.ls_extinction_coef                       ? 
_refine.ls_extinction_coef_esd                   ? 
_refine.ls_extinction_expression                 ? 
_refine.ls_extinction_method                     ? 
_refine.ls_goodness_of_fit_all                   ? 
_refine.ls_goodness_of_fit_all_esd               ? 
_refine.ls_goodness_of_fit_obs                   ? 
_refine.ls_goodness_of_fit_obs_esd               ? 
_refine.ls_hydrogen_treatment                    ? 
_refine.ls_matrix_type                           ? 
_refine.ls_number_constraints                    ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_reflns_all                     ? 
_refine.ls_number_reflns_obs                     58991 
_refine.ls_number_reflns_R_free                  2003 
_refine.ls_number_reflns_R_work                  ? 
_refine.ls_number_restraints                     ? 
_refine.ls_percent_reflns_obs                    99.92 
_refine.ls_percent_reflns_R_free                 3.40 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_obs                          0.1939 
_refine.ls_R_factor_R_free                       0.2284 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_R_factor_R_work                       0.1927 
_refine.ls_R_Fsqd_factor_obs                     ? 
_refine.ls_R_I_factor_obs                        ? 
_refine.ls_redundancy_reflns_all                 ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.ls_restrained_S_all                      ? 
_refine.ls_restrained_S_obs                      ? 
_refine.ls_shift_over_esd_max                    ? 
_refine.ls_shift_over_esd_mean                   ? 
_refine.ls_structure_factor_coef                 ? 
_refine.ls_weighting_details                     ? 
_refine.ls_weighting_scheme                      ? 
_refine.ls_wR_factor_all                         ? 
_refine.ls_wR_factor_obs                         ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.occupancy_max                            ? 
_refine.occupancy_min                            ? 
_refine.solvent_model_details                    'FLAT BULK SOLVENT MODEL' 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.ls_R_factor_gt                           ? 
_refine.ls_goodness_of_fit_gt                    ? 
_refine.ls_goodness_of_fit_ref                   ? 
_refine.ls_shift_over_su_max                     ? 
_refine.ls_shift_over_su_max_lt                  ? 
_refine.ls_shift_over_su_mean                    ? 
_refine.ls_shift_over_su_mean_lt                 ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          1.33 
_refine.pdbx_ls_sigma_Fsqd                       ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_ls_cross_valid_method               'FREE R-VALUE' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_stereochemistry_target_values       ML 
_refine.pdbx_R_Free_selection_details            ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.pdbx_solvent_vdw_probe_radii             1.11 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             0.90 
_refine.pdbx_real_space_R                        ? 
_refine.pdbx_density_correlation                 ? 
_refine.pdbx_pd_number_of_powder_patterns        ? 
_refine.pdbx_pd_number_of_points                 ? 
_refine.pdbx_pd_meas_number_of_points            ? 
_refine.pdbx_pd_proc_ls_prof_R_factor            ? 
_refine.pdbx_pd_proc_ls_prof_wR_factor           ? 
_refine.pdbx_pd_Marquardt_correlation_coeff      ? 
_refine.pdbx_pd_Fsqrd_R_factor                   ? 
_refine.pdbx_pd_ls_matrix_band_width             ? 
_refine.pdbx_overall_phase_error                 24.33 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_diffrn_id                           1 
_refine.overall_SU_B                             ? 
_refine.overall_SU_ML                            0.26 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_average_fsc_overall                 ? 
_refine.pdbx_average_fsc_work                    ? 
_refine.pdbx_average_fsc_free                    ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        4603 
_refine_hist.pdbx_number_atoms_nucleic_acid   469 
_refine_hist.pdbx_number_atoms_ligand         6 
_refine_hist.number_atoms_solvent             384 
_refine_hist.number_atoms_total               5462 
_refine_hist.d_res_high                       1.990 
_refine_hist.d_res_low                        43.541 
# 
loop_
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.criterion 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.number 
_refine_ls_restr.rejects 
_refine_ls_restr.type 
_refine_ls_restr.weight 
_refine_ls_restr.pdbx_restraint_function 
'X-RAY DIFFRACTION' ? 0.007  ? 5203 ? f_bond_d           ? ? 
'X-RAY DIFFRACTION' ? 0.844  ? 7137 ? f_angle_d          ? ? 
'X-RAY DIFFRACTION' ? 10.222 ? 3091 ? f_dihedral_angle_d ? ? 
'X-RAY DIFFRACTION' ? 0.050  ? 807  ? f_chiral_restr     ? ? 
'X-RAY DIFFRACTION' ? 0.005  ? 848  ? f_plane_restr      ? ? 
# 
loop_
_refine_ls_shell.pdbx_refine_id 
_refine_ls_shell.d_res_high 
_refine_ls_shell.d_res_low 
_refine_ls_shell.number_reflns_all 
_refine_ls_shell.number_reflns_obs 
_refine_ls_shell.number_reflns_R_free 
_refine_ls_shell.number_reflns_R_work 
_refine_ls_shell.percent_reflns_obs 
_refine_ls_shell.percent_reflns_R_free 
_refine_ls_shell.R_factor_all 
_refine_ls_shell.R_factor_obs 
_refine_ls_shell.R_factor_R_free 
_refine_ls_shell.R_factor_R_free_error 
_refine_ls_shell.R_factor_R_work 
_refine_ls_shell.redundancy_reflns_all 
_refine_ls_shell.redundancy_reflns_obs 
_refine_ls_shell.wR_factor_all 
_refine_ls_shell.wR_factor_obs 
_refine_ls_shell.wR_factor_R_free 
_refine_ls_shell.wR_factor_R_work 
_refine_ls_shell.pdbx_total_number_of_bins_used 
_refine_ls_shell.pdbx_phase_error 
_refine_ls_shell.pdbx_fsc_work 
_refine_ls_shell.pdbx_fsc_free 
'X-RAY DIFFRACTION' 1.9900 2.0398  . . 138 4017 100.00 . . . 0.4066 . 0.3571 . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.0398 2.0949  . . 149 4039 100.00 . . . 0.3225 . 0.2560 . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.0949 2.1566  . . 137 4008 100.00 . . . 0.2525 . 0.2329 . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.1566 2.2262  . . 134 4039 100.00 . . . 0.2500 . 0.2156 . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.2262 2.3057  . . 150 3995 100.00 . . . 0.2509 . 0.2048 . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.3057 2.3980  . . 133 4050 100.00 . . . 0.2665 . 0.1969 . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.3980 2.5072  . . 145 4040 100.00 . . . 0.2568 . 0.1951 . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.5072 2.6393  . . 148 4046 100.00 . . . 0.2182 . 0.1943 . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.6393 2.8047  . . 138 4051 100.00 . . . 0.2774 . 0.1993 . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.8047 3.0212  . . 144 4079 100.00 . . . 0.2374 . 0.1872 . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.0212 3.3251  . . 145 4081 100.00 . . . 0.2197 . 0.1774 . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.3251 3.8060  . . 145 4095 100.00 . . . 0.1982 . 0.1664 . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.8060 4.7942  . . 144 4151 100.00 . . . 0.1800 . 0.1560 . . . . . . . . . . 
'X-RAY DIFFRACTION' 4.7942 43.5514 . . 153 4297 99.00  . . . 0.1934 . 0.1904 . . . . . . . . . . 
# 
_struct.entry_id                     6DSV 
_struct.title                        'Bst DNA polymerase I post-chemistry (n+2) structure' 
_struct.pdbx_descriptor              'DNA polymerase I/DNA Complex' 
_struct.pdbx_model_details           ? 
_struct.pdbx_formula_weight          ? 
_struct.pdbx_formula_weight_method   ? 
_struct.pdbx_model_type_details      ? 
_struct.pdbx_CASP_flag               N 
# 
_struct_keywords.entry_id        6DSV 
_struct_keywords.text            'DNA synthesis, transferase, Transferase-DNA complex' 
_struct_keywords.pdbx_keywords   Transferase/DNA 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
D N N 4 ? 
E N N 5 ? 
F N N 6 ? 
G N N 6 ? 
H N N 6 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  AA1 THR B 12  ? LEU B 16  ? THR A 308 LEU A 312 5 ? 5  
HELX_P HELX_P2  AA2 ARG B 51  ? LEU B 56  ? ARG A 347 LEU A 352 1 ? 6  
HELX_P HELX_P3  AA3 ASP B 58  ? ASP B 67  ? ASP A 354 ASP A 363 1 ? 10 
HELX_P HELX_P4  AA4 ASP B 76  ? TRP B 86  ? ASP A 372 TRP A 382 1 ? 11 
HELX_P HELX_P5  AA5 LEU B 98  ? ASP B 106 ? LEU A 394 ASP A 402 1 ? 9  
HELX_P HELX_P6  AA6 PRO B 107 ? GLY B 110 ? PRO A 403 GLY A 406 5 ? 4  
HELX_P HELX_P7  AA7 ASP B 113 ? MET B 120 ? ASP A 409 MET A 416 1 ? 8  
HELX_P HELX_P8  AA8 PRO B 128 ? GLY B 134 ? PRO A 424 GLY A 430 1 ? 7  
HELX_P HELX_P9  AA9 LYS B 135 ? ARG B 139 ? LYS A 431 ARG A 435 5 ? 5  
HELX_P HELX_P10 AB1 ASP B 143 ? ASN B 172 ? ASP A 439 ASN A 468 1 ? 30 
HELX_P HELX_P11 AB2 GLN B 174 ? LEU B 181 ? GLN A 470 LEU A 477 1 ? 8  
HELX_P HELX_P12 AB3 LEU B 181 ? GLY B 196 ? LEU A 477 GLY A 492 1 ? 16 
HELX_P HELX_P13 AB4 ASP B 200 ? ALA B 226 ? ASP A 496 ALA A 522 1 ? 27 
HELX_P HELX_P14 AB5 SER B 234 ? GLU B 244 ? SER A 530 GLU A 540 1 ? 11 
HELX_P HELX_P15 AB6 SER B 261 ? ALA B 269 ? SER A 557 ALA A 565 1 ? 9  
HELX_P HELX_P16 AB7 PRO B 270 ? HIS B 272 ? PRO A 566 HIS A 568 5 ? 3  
HELX_P HELX_P17 AB8 GLU B 273 ? TYR B 291 ? GLU A 569 TYR A 587 1 ? 19 
HELX_P HELX_P18 AB9 TYR B 291 ? VAL B 299 ? TYR A 587 VAL A 595 1 ? 9  
HELX_P HELX_P19 AC1 ASN B 326 ? ILE B 330 ? ASN A 622 ILE A 626 5 ? 5  
HELX_P HELX_P20 AC2 LEU B 334 ? LYS B 339 ? LEU A 630 LYS A 635 1 ? 6  
HELX_P HELX_P21 AC3 ILE B 340 ? GLN B 342 ? ILE A 636 GLN A 638 5 ? 3  
HELX_P HELX_P22 AC4 GLN B 360 ? GLU B 371 ? GLN A 656 GLU A 667 1 ? 12 
HELX_P HELX_P23 AC5 ASP B 372 ? ARG B 381 ? ASP A 668 ARG A 677 1 ? 10 
HELX_P HELX_P24 AC6 ASP B 384 ? GLN B 395 ? ASP A 680 GLN A 691 1 ? 12 
HELX_P HELX_P25 AC7 SER B 397 ? VAL B 401 ? SER A 693 VAL A 697 5 ? 5  
HELX_P HELX_P26 AC8 THR B 402 ? GLY B 419 ? THR A 698 GLY A 715 1 ? 18 
HELX_P HELX_P27 AC9 SER B 421 ? ASN B 430 ? SER A 717 ASN A 726 1 ? 10 
HELX_P HELX_P28 AD1 SER B 432 ? PHE B 447 ? SER A 728 PHE A 743 1 ? 16 
HELX_P HELX_P29 AD2 PHE B 447 ? GLY B 465 ? PHE A 743 GLY A 761 1 ? 19 
HELX_P HELX_P30 AD3 PRO B 478 ? SER B 482 ? PRO A 774 SER A 778 5 ? 5  
HELX_P HELX_P31 AD4 ASN B 484 ? GLU B 522 ? ASN A 780 GLU A 818 1 ? 39 
HELX_P HELX_P32 AD5 GLU B 544 ? GLN B 558 ? GLU A 840 GLN A 854 1 ? 15 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
covale1  covale none ? A DA  11  N6  ? ? ? 1_555 C DT 1  O4 ? ? P DA  11  T DT 4   1_555 ? ? ? ? ? ? ?            1.416 ? 
metalc1  metalc ?    ? B ASP 534 OD1 ? ? ? 1_555 D MG .  MG ? ? A ASP 830 A MG 901 1_555 ? ? ? ? ? ? ?            1.811 ? 
hydrog1  hydrog ?    ? A DG  1   N1  ? ? ? 1_555 C DC 11 N3 ? ? P DG  1   T DC 14  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog2  hydrog ?    ? A DG  1   N2  ? ? ? 1_555 C DC 11 O2 ? ? P DG  1   T DC 14  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog3  hydrog ?    ? A DG  1   O6  ? ? ? 1_555 C DC 11 N4 ? ? P DG  1   T DC 14  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog4  hydrog ?    ? A DC  2   N3  ? ? ? 1_555 C DG 10 N2 ? ? P DC  2   T DG 13  1_555 ? ? ? ? ? ? 'DC-DG PAIR' ?     ? 
hydrog5  hydrog ?    ? A DG  3   N1  ? ? ? 1_555 C DC 9  N3 ? ? P DG  3   T DC 12  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog6  hydrog ?    ? A DG  3   N2  ? ? ? 1_555 C DC 9  O2 ? ? P DG  3   T DC 12  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog7  hydrog ?    ? A DG  3   O6  ? ? ? 1_555 C DC 9  N4 ? ? P DG  3   T DC 12  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog8  hydrog ?    ? A DA  4   N1  ? ? ? 1_555 C DT 8  N3 ? ? P DA  4   T DT 11  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog9  hydrog ?    ? A DA  4   N6  ? ? ? 1_555 C DT 8  O4 ? ? P DA  4   T DT 11  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog10 hydrog ?    ? A DT  5   N3  ? ? ? 1_555 C DA 7  N1 ? ? P DT  5   T DA 10  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog11 hydrog ?    ? A DT  5   O4  ? ? ? 1_555 C DA 7  N6 ? ? P DT  5   T DA 10  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog12 hydrog ?    ? A DC  6   N3  ? ? ? 1_555 C DG 6  N1 ? ? P DC  6   T DG 9   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog13 hydrog ?    ? A DC  6   N4  ? ? ? 1_555 C DG 6  O6 ? ? P DC  6   T DG 9   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog14 hydrog ?    ? A DC  6   O2  ? ? ? 1_555 C DG 6  N2 ? ? P DC  6   T DG 9   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog15 hydrog ?    ? A DA  7   N1  ? ? ? 1_555 C DT 5  N3 ? ? P DA  7   T DT 8   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog16 hydrog ?    ? A DA  7   N6  ? ? ? 1_555 C DT 5  O4 ? ? P DA  7   T DT 8   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog17 hydrog ?    ? A DC  8   N3  ? ? ? 1_555 C DG 4  N1 ? ? P DC  8   T DG 7   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog18 hydrog ?    ? A DC  8   N4  ? ? ? 1_555 C DG 4  O6 ? ? P DC  8   T DG 7   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog19 hydrog ?    ? A DC  8   O2  ? ? ? 1_555 C DG 4  N2 ? ? P DC  8   T DG 7   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog20 hydrog ?    ? A DG  9   N1  ? ? ? 1_555 C DC 3  N3 ? ? P DG  9   T DC 6   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog21 hydrog ?    ? A DG  9   N2  ? ? ? 1_555 C DC 3  O2 ? ? P DG  9   T DC 6   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog22 hydrog ?    ? A DG  9   O6  ? ? ? 1_555 C DC 3  N4 ? ? P DG  9   T DC 6   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog23 hydrog ?    ? A DT  10  N3  ? ? ? 1_555 C DA 2  N1 ? ? P DT  10  T DA 5   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog24 hydrog ?    ? A DT  10  O4  ? ? ? 1_555 C DA 2  N6 ? ? P DT  10  T DA 5   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
covale ? ? 
metalc ? ? 
hydrog ? ? 
# 
_struct_mon_prot_cis.pdbx_id                1 
_struct_mon_prot_cis.label_comp_id          GLU 
_struct_mon_prot_cis.label_seq_id           324 
_struct_mon_prot_cis.label_asym_id          B 
_struct_mon_prot_cis.label_alt_id           . 
_struct_mon_prot_cis.pdbx_PDB_ins_code      ? 
_struct_mon_prot_cis.auth_comp_id           GLU 
_struct_mon_prot_cis.auth_seq_id            620 
_struct_mon_prot_cis.auth_asym_id           A 
_struct_mon_prot_cis.pdbx_label_comp_id_2   PRO 
_struct_mon_prot_cis.pdbx_label_seq_id_2    325 
_struct_mon_prot_cis.pdbx_label_asym_id_2   B 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2    ? 
_struct_mon_prot_cis.pdbx_auth_comp_id_2    PRO 
_struct_mon_prot_cis.pdbx_auth_seq_id_2     621 
_struct_mon_prot_cis.pdbx_auth_asym_id_2    A 
_struct_mon_prot_cis.pdbx_PDB_model_num     1 
_struct_mon_prot_cis.pdbx_omega_angle       0.22 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA1 ? 6 ? 
AA2 ? 3 ? 
AA3 ? 2 ? 
AA4 ? 4 ? 
AA5 ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA1 1 2 ? parallel      
AA1 2 3 ? anti-parallel 
AA1 3 4 ? anti-parallel 
AA1 4 5 ? parallel      
AA1 5 6 ? parallel      
AA2 1 2 ? anti-parallel 
AA2 2 3 ? anti-parallel 
AA3 1 2 ? anti-parallel 
AA4 1 2 ? anti-parallel 
AA4 2 3 ? anti-parallel 
AA4 3 4 ? anti-parallel 
AA5 1 2 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA1 1 THR B 6   ? LEU B 7   ? THR A 302 LEU A 303 
AA1 2 GLY B 46  ? LEU B 50  ? GLY A 342 LEU A 346 
AA1 3 GLY B 38  ? ASN B 43  ? GLY A 334 ASN A 339 
AA1 4 LYS B 19  ? GLU B 25  ? LYS A 315 GLU A 321 
AA1 5 LYS B 71  ? MET B 74  ? LYS A 367 MET A 370 
AA1 6 VAL B 94  ? ASP B 97  ? VAL A 390 ASP A 393 
AA2 1 LYS B 305 ? VAL B 306 ? LYS A 601 VAL A 602 
AA2 2 VAL B 197 ? VAL B 199 ? VAL A 493 VAL A 495 
AA2 3 PHE B 344 ? VAL B 345 ? PHE A 640 VAL A 641 
AA3 1 ILE B 309 ? ASN B 311 ? ILE A 605 ASN A 607 
AA3 2 SER B 321 ? THR B 323 ? SER A 617 THR A 619 
AA4 1 ARG B 527 ? VAL B 532 ? ARG A 823 VAL A 828 
AA4 2 GLU B 535 ? PRO B 541 ? GLU A 831 PRO A 837 
AA4 3 TRP B 351 ? TYR B 358 ? TRP A 647 TYR A 654 
AA4 4 VAL B 568 ? GLY B 573 ? VAL A 864 GLY A 869 
AA5 1 TYR B 466 ? THR B 468 ? TYR A 762 THR A 764 
AA5 2 ARG B 474 ? TYR B 476 ? ARG A 770 TYR A 772 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA1 1 2 N THR B 6   ? N THR A 302 O ARG B 47  ? O ARG A 343 
AA1 2 3 O PHE B 48  ? O PHE A 344 N VAL B 41  ? N VAL A 337 
AA1 3 4 O VAL B 42  ? O VAL A 338 N ALA B 21  ? N ALA A 317 
AA1 4 5 N LEU B 22  ? N LEU A 318 O SER B 73  ? O SER A 369 
AA1 5 6 N MET B 74  ? N MET A 370 O PHE B 96  ? O PHE A 392 
AA2 1 2 O VAL B 306 ? O VAL A 602 N VAL B 197 ? N VAL A 493 
AA2 2 3 N LYS B 198 ? N LYS A 494 O VAL B 345 ? O VAL A 641 
AA3 1 2 N ASN B 311 ? N ASN A 607 O SER B 321 ? O SER A 617 
AA4 1 2 N VAL B 532 ? N VAL A 828 O GLU B 535 ? O GLU A 831 
AA4 2 3 O LEU B 538 ? O LEU A 834 N PHE B 354 ? N PHE A 650 
AA4 3 4 N ALA B 355 ? N ALA A 651 O HIS B 571 ? O HIS A 867 
AA5 1 2 N VAL B 467 ? N VAL A 763 O ARG B 475 ? O ARG A 771 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software A MG  901 ? 2 'binding site for residue MG A 901'  
AC2 Software A SO4 902 ? 3 'binding site for residue SO4 A 902' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1 AC1 2 GLU B 362 ? GLU A 658  . ? 1_555 ? 
2 AC1 2 ASP B 534 ? ASP A 830  . ? 1_555 ? 
3 AC2 3 ARG B 406 ? ARG A 702  . ? 1_555 ? 
4 AC2 3 LYS B 410 ? LYS A 706  . ? 1_555 ? 
5 AC2 3 HOH G .   ? HOH A 1102 . ? 1_555 ? 
# 
_atom_sites.entry_id                    6DSV 
_atom_sites.fract_transf_matrix[1][1]   0.011483 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.010745 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.009548 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
MG 
N  
O  
P  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    O  "O5'" . DG  A 1 1   ? 38.148  20.877 18.484  1.00 104.13 ? 1    DG  P "O5'" 1 
ATOM   2    C  "C5'" . DG  A 1 1   ? 37.163  20.039 17.879  1.00 110.96 ? 1    DG  P "C5'" 1 
ATOM   3    C  "C4'" . DG  A 1 1   ? 36.045  19.733 18.860  1.00 115.73 ? 1    DG  P "C4'" 1 
ATOM   4    O  "O4'" . DG  A 1 1   ? 36.618  19.180 20.059  1.00 115.16 ? 1    DG  P "O4'" 1 
ATOM   5    C  "C3'" . DG  A 1 1   ? 35.226  20.949 19.295  1.00 115.51 ? 1    DG  P "C3'" 1 
ATOM   6    O  "O3'" . DG  A 1 1   ? 33.911  20.925 18.681  1.00 123.07 ? 1    DG  P "O3'" 1 
ATOM   7    C  "C2'" . DG  A 1 1   ? 35.175  20.886 20.831  1.00 115.09 ? 1    DG  P "C2'" 1 
ATOM   8    C  "C1'" . DG  A 1 1   ? 35.869  19.570 21.182  1.00 116.71 ? 1    DG  P "C1'" 1 
ATOM   9    N  N9    . DG  A 1 1   ? 36.789  19.690 22.307  1.00 114.61 ? 1    DG  P N9    1 
ATOM   10   C  C8    . DG  A 1 1   ? 37.856  20.550 22.408  1.00 111.66 ? 1    DG  P C8    1 
ATOM   11   N  N7    . DG  A 1 1   ? 38.513  20.433 23.527  1.00 110.54 ? 1    DG  P N7    1 
ATOM   12   C  C5    . DG  A 1 1   ? 37.841  19.428 24.211  1.00 112.20 ? 1    DG  P C5    1 
ATOM   13   C  C6    . DG  A 1 1   ? 38.097  18.867 25.484  1.00 111.28 ? 1    DG  P C6    1 
ATOM   14   O  O6    . DG  A 1 1   ? 38.997  19.158 26.281  1.00 109.02 ? 1    DG  P O6    1 
ATOM   15   N  N1    . DG  A 1 1   ? 37.177  17.871 25.804  1.00 113.19 ? 1    DG  P N1    1 
ATOM   16   C  C2    . DG  A 1 1   ? 36.140  17.469 24.995  1.00 115.17 ? 1    DG  P C2    1 
ATOM   17   N  N2    . DG  A 1 1   ? 35.356  16.494 25.477  1.00 116.52 ? 1    DG  P N2    1 
ATOM   18   N  N3    . DG  A 1 1   ? 35.889  17.986 23.797  1.00 116.32 ? 1    DG  P N3    1 
ATOM   19   C  C4    . DG  A 1 1   ? 36.778  18.957 23.471  1.00 114.59 ? 1    DG  P C4    1 
ATOM   20   P  P     . DC  A 1 2   ? 32.678  20.096 19.310  1.00 126.88 ? 2    DC  P P     1 
ATOM   21   O  OP1   . DC  A 1 2   ? 33.155  18.789 19.813  1.00 134.13 ? 2    DC  P OP1   1 
ATOM   22   O  OP2   . DC  A 1 2   ? 31.597  20.105 18.298  1.00 132.00 ? 2    DC  P OP2   1 
ATOM   23   O  "O5'" . DC  A 1 2   ? 32.176  21.003 20.526  1.00 117.27 ? 2    DC  P "O5'" 1 
ATOM   24   C  "C5'" . DC  A 1 2   ? 30.913  20.760 21.121  1.00 115.14 ? 2    DC  P "C5'" 1 
ATOM   25   C  "C4'" . DC  A 1 2   ? 30.947  19.522 22.000  1.00 114.56 ? 2    DC  P "C4'" 1 
ATOM   26   O  "O4'" . DC  A 1 2   ? 32.241  19.419 22.656  1.00 113.26 ? 2    DC  P "O4'" 1 
ATOM   27   C  "C3'" . DC  A 1 2   ? 29.900  19.516 23.114  1.00 112.09 ? 2    DC  P "C3'" 1 
ATOM   28   O  "O3'" . DC  A 1 2   ? 29.259  18.256 23.192  1.00 117.47 ? 2    DC  P "O3'" 1 
ATOM   29   C  "C2'" . DC  A 1 2   ? 30.709  19.812 24.370  1.00 103.01 ? 2    DC  P "C2'" 1 
ATOM   30   C  "C1'" . DC  A 1 2   ? 32.053  19.196 24.036  1.00 103.02 ? 2    DC  P "C1'" 1 
ATOM   31   N  N1    . DC  A 1 2   ? 33.188  19.815 24.781  1.00 91.67  ? 2    DC  P N1    1 
ATOM   32   C  C2    . DC  A 1 2   ? 33.484  19.386 26.084  1.00 85.91  ? 2    DC  P C2    1 
ATOM   33   O  O2    . DC  A 1 2   ? 32.797  18.498 26.602  1.00 88.58  ? 2    DC  P O2    1 
ATOM   34   N  N3    . DC  A 1 2   ? 34.519  19.957 26.743  1.00 83.58  ? 2    DC  P N3    1 
ATOM   35   C  C4    . DC  A 1 2   ? 35.237  20.913 26.154  1.00 83.42  ? 2    DC  P C4    1 
ATOM   36   N  N4    . DC  A 1 2   ? 36.248  21.448 26.847  1.00 79.76  ? 2    DC  P N4    1 
ATOM   37   C  C5    . DC  A 1 2   ? 34.951  21.365 24.830  1.00 81.11  ? 2    DC  P C5    1 
ATOM   38   C  C6    . DC  A 1 2   ? 33.928  20.795 24.189  1.00 84.40  ? 2    DC  P C6    1 
ATOM   39   P  P     . DG  A 1 3   ? 27.760  18.167 23.764  1.00 119.79 ? 3    DG  P P     1 
ATOM   40   O  OP1   . DG  A 1 3   ? 27.226  16.826 23.437  1.00 124.92 ? 3    DG  P OP1   1 
ATOM   41   O  OP2   . DG  A 1 3   ? 27.043  19.381 23.312  1.00 118.64 ? 3    DG  P OP2   1 
ATOM   42   O  "O5'" . DG  A 1 3   ? 27.936  18.308 25.346  1.00 110.29 ? 3    DG  P "O5'" 1 
ATOM   43   C  "C5'" . DG  A 1 3   ? 28.484  17.243 26.110  1.00 109.83 ? 3    DG  P "C5'" 1 
ATOM   44   C  "C4'" . DG  A 1 3   ? 28.689  17.689 27.544  1.00 107.73 ? 3    DG  P "C4'" 1 
ATOM   45   O  "O4'" . DG  A 1 3   ? 29.974  18.324 27.659  1.00 101.01 ? 3    DG  P "O4'" 1 
ATOM   46   C  "C3'" . DG  A 1 3   ? 27.681  18.725 28.019  1.00 110.60 ? 3    DG  P "C3'" 1 
ATOM   47   O  "O3'" . DG  A 1 3   ? 26.565  18.081 28.691  1.00 123.75 ? 3    DG  P "O3'" 1 
ATOM   48   C  "C2'" . DG  A 1 3   ? 28.480  19.659 28.939  1.00 99.29  ? 3    DG  P "C2'" 1 
ATOM   49   C  "C1'" . DG  A 1 3   ? 29.943  19.290 28.690  1.00 97.06  ? 3    DG  P "C1'" 1 
ATOM   50   N  N9    . DG  A 1 3   ? 30.770  20.421 28.276  1.00 91.29  ? 3    DG  P N9    1 
ATOM   51   C  C8    . DG  A 1 3   ? 30.575  21.225 27.182  1.00 88.85  ? 3    DG  P C8    1 
ATOM   52   N  N7    . DG  A 1 3   ? 31.484  22.146 27.041  1.00 85.76  ? 3    DG  P N7    1 
ATOM   53   C  C5    . DG  A 1 3   ? 32.333  21.950 28.121  1.00 83.05  ? 3    DG  P C5    1 
ATOM   54   C  C6    . DG  A 1 3   ? 33.497  22.650 28.495  1.00 77.43  ? 3    DG  P C6    1 
ATOM   55   O  O6    . DG  A 1 3   ? 34.023  23.617 27.928  1.00 77.86  ? 3    DG  P O6    1 
ATOM   56   N  N1    . DG  A 1 3   ? 34.062  22.127 29.655  1.00 78.46  ? 3    DG  P N1    1 
ATOM   57   C  C2    . DG  A 1 3   ? 33.564  21.058 30.360  1.00 83.65  ? 3    DG  P C2    1 
ATOM   58   N  N2    . DG  A 1 3   ? 34.249  20.696 31.455  1.00 90.22  ? 3    DG  P N2    1 
ATOM   59   N  N3    . DG  A 1 3   ? 32.471  20.391 30.019  1.00 85.75  ? 3    DG  P N3    1 
ATOM   60   C  C4    . DG  A 1 3   ? 31.910  20.890 28.891  1.00 87.19  ? 3    DG  P C4    1 
ATOM   61   P  P     . DA  A 1 4   ? 26.588  17.734 30.266  1.00 129.64 ? 4    DA  P P     1 
ATOM   62   O  OP1   . DA  A 1 4   ? 27.881  17.098 30.603  1.00 133.62 ? 4    DA  P OP1   1 
ATOM   63   O  OP2   . DA  A 1 4   ? 25.335  17.002 30.549  1.00 136.35 ? 4    DA  P OP2   1 
ATOM   64   O  "O5'" . DA  A 1 4   ? 26.453  19.157 30.992  1.00 123.52 ? 4    DA  P "O5'" 1 
ATOM   65   C  "C5'" . DA  A 1 4   ? 26.126  19.234 32.370  1.00 119.76 ? 4    DA  P "C5'" 1 
ATOM   66   C  "C4'" . DA  A 1 4   ? 27.320  18.895 33.243  1.00 115.10 ? 4    DA  P "C4'" 1 
ATOM   67   O  "O4'" . DA  A 1 4   ? 28.542  19.372 32.620  1.00 109.66 ? 4    DA  P "O4'" 1 
ATOM   68   C  "C3'" . DA  A 1 4   ? 27.297  19.542 34.614  1.00 109.88 ? 4    DA  P "C3'" 1 
ATOM   69   O  "O3'" . DA  A 1 4   ? 28.033  18.757 35.526  1.00 112.80 ? 4    DA  P "O3'" 1 
ATOM   70   C  "C2'" . DA  A 1 4   ? 27.983  20.873 34.344  1.00 102.40 ? 4    DA  P "C2'" 1 
ATOM   71   C  "C1'" . DA  A 1 4   ? 29.071  20.455 33.364  1.00 101.43 ? 4    DA  P "C1'" 1 
ATOM   72   N  N9    . DA  A 1 4   ? 29.450  21.508 32.429  1.00 95.60  ? 4    DA  P N9    1 
ATOM   73   C  C8    . DA  A 1 4   ? 28.750  21.923 31.332  1.00 95.88  ? 4    DA  P C8    1 
ATOM   74   N  N7    . DA  A 1 4   ? 29.334  22.886 30.663  1.00 90.77  ? 4    DA  P N7    1 
ATOM   75   C  C5    . DA  A 1 4   ? 30.497  23.124 31.372  1.00 90.41  ? 4    DA  P C5    1 
ATOM   76   C  C6    . DA  A 1 4   ? 31.553  24.033 31.179  1.00 89.99  ? 4    DA  P C6    1 
ATOM   77   N  N6    . DA  A 1 4   ? 31.595  24.902 30.166  1.00 85.48  ? 4    DA  P N6    1 
ATOM   78   N  N1    . DA  A 1 4   ? 32.568  24.015 32.073  1.00 92.18  ? 4    DA  P N1    1 
ATOM   79   C  C2    . DA  A 1 4   ? 32.519  23.139 33.085  1.00 92.98  ? 4    DA  P C2    1 
ATOM   80   N  N3    . DA  A 1 4   ? 31.579  22.236 33.368  1.00 93.39  ? 4    DA  P N3    1 
ATOM   81   C  C4    . DA  A 1 4   ? 30.587  22.282 32.464  1.00 92.20  ? 4    DA  P C4    1 
ATOM   82   P  P     . DT  A 1 5   ? 27.724  18.863 37.097  1.00 115.09 ? 5    DT  P P     1 
ATOM   83   O  OP1   . DT  A 1 5   ? 28.393  17.713 37.750  1.00 119.32 ? 5    DT  P OP1   1 
ATOM   84   O  OP2   . DT  A 1 5   ? 26.267  19.069 37.258  1.00 116.31 ? 5    DT  P OP2   1 
ATOM   85   O  "O5'" . DT  A 1 5   ? 28.449  20.221 37.540  1.00 102.48 ? 5    DT  P "O5'" 1 
ATOM   86   C  "C5'" . DT  A 1 5   ? 29.864  20.310 37.490  1.00 92.54  ? 5    DT  P "C5'" 1 
ATOM   87   C  "C4'" . DT  A 1 5   ? 30.331  21.727 37.756  1.00 81.50  ? 5    DT  P "C4'" 1 
ATOM   88   O  "O4'" . DT  A 1 5   ? 30.416  22.455 36.520  1.00 67.71  ? 5    DT  P "O4'" 1 
ATOM   89   C  "C3'" . DT  A 1 5   ? 29.426  22.556 38.675  1.00 72.04  ? 5    DT  P "C3'" 1 
ATOM   90   O  "O3'" . DT  A 1 5   ? 30.098  22.780 39.913  1.00 69.69  ? 5    DT  P "O3'" 1 
ATOM   91   C  "C2'" . DT  A 1 5   ? 29.178  23.866 37.896  1.00 63.89  ? 5    DT  P "C2'" 1 
ATOM   92   C  "C1'" . DT  A 1 5   ? 30.242  23.812 36.805  1.00 72.01  ? 5    DT  P "C1'" 1 
ATOM   93   N  N1    . DT  A 1 5   ? 29.866  24.494 35.538  1.00 74.23  ? 5    DT  P N1    1 
ATOM   94   C  C2    . DT  A 1 5   ? 30.755  25.372 34.961  1.00 70.79  ? 5    DT  P C2    1 
ATOM   95   O  O2    . DT  A 1 5   ? 31.838  25.645 35.450  1.00 64.12  ? 5    DT  P O2    1 
ATOM   96   N  N3    . DT  A 1 5   ? 30.329  25.929 33.786  1.00 68.03  ? 5    DT  P N3    1 
ATOM   97   C  C4    . DT  A 1 5   ? 29.132  25.701 33.142  1.00 67.59  ? 5    DT  P C4    1 
ATOM   98   O  O4    . DT  A 1 5   ? 28.843  26.254 32.087  1.00 72.26  ? 5    DT  P O4    1 
ATOM   99   C  C5    . DT  A 1 5   ? 28.247  24.764 33.794  1.00 73.86  ? 5    DT  P C5    1 
ATOM   100  C  C7    . DT  A 1 5   ? 26.914  24.436 33.185  1.00 82.27  ? 5    DT  P C7    1 
ATOM   101  C  C6    . DT  A 1 5   ? 28.654  24.208 34.945  1.00 73.71  ? 5    DT  P C6    1 
ATOM   102  P  P     . DC  A 1 6   ? 29.370  23.544 41.125  1.00 67.03  ? 6    DC  P P     1 
ATOM   103  O  OP1   . DC  A 1 6   ? 29.954  23.002 42.368  1.00 74.07  ? 6    DC  P OP1   1 
ATOM   104  O  OP2   . DC  A 1 6   ? 27.906  23.518 40.906  1.00 73.98  ? 6    DC  P OP2   1 
ATOM   105  O  "O5'" . DC  A 1 6   ? 29.881  25.043 40.973  1.00 61.24  ? 6    DC  P "O5'" 1 
ATOM   106  C  "C5'" . DC  A 1 6   ? 31.270  25.288 40.838  1.00 61.09  ? 6    DC  P "C5'" 1 
ATOM   107  C  "C4'" . DC  A 1 6   ? 31.521  26.730 40.465  1.00 56.88  ? 6    DC  P "C4'" 1 
ATOM   108  O  "O4'" . DC  A 1 6   ? 31.181  26.940 39.076  1.00 61.61  ? 6    DC  P "O4'" 1 
ATOM   109  C  "C3'" . DC  A 1 6   ? 30.713  27.750 41.272  1.00 59.28  ? 6    DC  P "C3'" 1 
ATOM   110  O  "O3'" . DC  A 1 6   ? 31.604  28.679 41.862  1.00 53.53  ? 6    DC  P "O3'" 1 
ATOM   111  C  "C2'" . DC  A 1 6   ? 29.789  28.407 40.236  1.00 62.41  ? 6    DC  P "C2'" 1 
ATOM   112  C  "C1'" . DC  A 1 6   ? 30.555  28.188 38.940  1.00 60.09  ? 6    DC  P "C1'" 1 
ATOM   113  N  N1    . DC  A 1 6   ? 29.698  28.153 37.710  1.00 63.10  ? 6    DC  P N1    1 
ATOM   114  C  C2    . DC  A 1 6   ? 30.090  28.880 36.585  1.00 61.63  ? 6    DC  P C2    1 
ATOM   115  O  O2    . DC  A 1 6   ? 31.126  29.543 36.630  1.00 57.84  ? 6    DC  P O2    1 
ATOM   116  N  N3    . DC  A 1 6   ? 29.319  28.846 35.473  1.00 69.03  ? 6    DC  P N3    1 
ATOM   117  C  C4    . DC  A 1 6   ? 28.207  28.124 35.455  1.00 67.33  ? 6    DC  P C4    1 
ATOM   118  N  N4    . DC  A 1 6   ? 27.485  28.124 34.325  1.00 64.67  ? 6    DC  P N4    1 
ATOM   119  C  C5    . DC  A 1 6   ? 27.786  27.366 36.591  1.00 63.12  ? 6    DC  P C5    1 
ATOM   120  C  C6    . DC  A 1 6   ? 28.556  27.408 37.687  1.00 64.19  ? 6    DC  P C6    1 
ATOM   121  P  P     . DA  A 1 7   ? 31.083  29.776 42.909  1.00 51.60  ? 7    DA  P P     1 
ATOM   122  O  OP1   . DA  A 1 7   ? 32.209  29.991 43.850  1.00 45.72  ? 7    DA  P OP1   1 
ATOM   123  O  OP2   . DA  A 1 7   ? 29.740  29.406 43.397  1.00 55.63  ? 7    DA  P OP2   1 
ATOM   124  O  "O5'" . DA  A 1 7   ? 30.900  31.077 42.017  1.00 47.91  ? 7    DA  P "O5'" 1 
ATOM   125  C  "C5'" . DA  A 1 7   ? 32.007  31.584 41.302  1.00 46.10  ? 7    DA  P "C5'" 1 
ATOM   126  C  "C4'" . DA  A 1 7   ? 31.561  32.656 40.344  1.00 40.29  ? 7    DA  P "C4'" 1 
ATOM   127  O  "O4'" . DA  A 1 7   ? 30.827  32.050 39.260  1.00 48.48  ? 7    DA  P "O4'" 1 
ATOM   128  C  "C3'" . DA  A 1 7   ? 30.626  33.700 40.955  1.00 39.21  ? 7    DA  P "C3'" 1 
ATOM   129  O  "O3'" . DA  A 1 7   ? 31.225  34.969 40.873  1.00 37.06  ? 7    DA  P "O3'" 1 
ATOM   130  C  "C2'" . DA  A 1 7   ? 29.355  33.621 40.100  1.00 41.23  ? 7    DA  P "C2'" 1 
ATOM   131  C  "C1'" . DA  A 1 7   ? 29.860  32.961 38.835  1.00 48.40  ? 7    DA  P "C1'" 1 
ATOM   132  N  N9    . DA  A 1 7   ? 28.825  32.238 38.124  1.00 55.84  ? 7    DA  P N9    1 
ATOM   133  C  C8    . DA  A 1 7   ? 28.024  31.251 38.620  1.00 58.88  ? 7    DA  P C8    1 
ATOM   134  N  N7    . DA  A 1 7   ? 27.162  30.787 37.752  1.00 67.51  ? 7    DA  P N7    1 
ATOM   135  C  C5    . DA  A 1 7   ? 27.416  31.522 36.608  1.00 62.96  ? 7    DA  P C5    1 
ATOM   136  C  C6    . DA  A 1 7   ? 26.839  31.507 35.332  1.00 68.16  ? 7    DA  P C6    1 
ATOM   137  N  N6    . DA  A 1 7   ? 25.840  30.685 34.992  1.00 75.40  ? 7    DA  P N6    1 
ATOM   138  N  N1    . DA  A 1 7   ? 27.328  32.375 34.413  1.00 73.20  ? 7    DA  P N1    1 
ATOM   139  C  C2    . DA  A 1 7   ? 28.327  33.196 34.766  1.00 60.63  ? 7    DA  P C2    1 
ATOM   140  N  N3    . DA  A 1 7   ? 28.949  33.298 35.939  1.00 47.77  ? 7    DA  P N3    1 
ATOM   141  C  C4    . DA  A 1 7   ? 28.439  32.424 36.822  1.00 56.77  ? 7    DA  P C4    1 
ATOM   142  P  P     . DC  A 1 8   ? 30.469  36.260 41.456  1.00 36.05  ? 8    DC  P P     1 
ATOM   143  O  OP1   . DC  A 1 8   ? 31.535  37.244 41.761  1.00 36.98  ? 8    DC  P OP1   1 
ATOM   144  O  OP2   . DC  A 1 8   ? 29.504  35.822 42.486  1.00 36.99  ? 8    DC  P OP2   1 
ATOM   145  O  "O5'" . DC  A 1 8   ? 29.657  36.820 40.201  1.00 37.40  ? 8    DC  P "O5'" 1 
ATOM   146  C  "C5'" . DC  A 1 8   ? 30.365  37.114 39.008  1.00 37.40  ? 8    DC  P "C5'" 1 
ATOM   147  C  "C4'" . DC  A 1 8   ? 29.479  37.843 38.033  1.00 39.20  ? 8    DC  P "C4'" 1 
ATOM   148  O  "O4'" . DC  A 1 8   ? 28.704  36.884 37.276  1.00 41.76  ? 8    DC  P "O4'" 1 
ATOM   149  C  "C3'" . DC  A 1 8   ? 28.474  38.793 38.672  1.00 41.68  ? 8    DC  P "C3'" 1 
ATOM   150  O  "O3'" . DC  A 1 8   ? 28.381  39.937 37.888  1.00 43.21  ? 8    DC  P "O3'" 1 
ATOM   151  C  "C2'" . DC  A 1 8   ? 27.179  37.986 38.638  1.00 48.52  ? 8    DC  P "C2'" 1 
ATOM   152  C  "C1'" . DC  A 1 8   ? 27.352  37.245 37.327  1.00 43.84  ? 8    DC  P "C1'" 1 
ATOM   153  N  N1    . DC  A 1 8   ? 26.535  36.011 37.196  1.00 55.75  ? 8    DC  P N1    1 
ATOM   154  C  C2    . DC  A 1 8   ? 25.936  35.726 35.968  1.00 53.19  ? 8    DC  P C2    1 
ATOM   155  O  O2    . DC  A 1 8   ? 26.094  36.510 35.028  1.00 52.05  ? 8    DC  P O2    1 
ATOM   156  N  N3    . DC  A 1 8   ? 25.198  34.603 35.843  1.00 65.14  ? 8    DC  P N3    1 
ATOM   157  C  C4    . DC  A 1 8   ? 25.056  33.783 36.881  1.00 63.23  ? 8    DC  P C4    1 
ATOM   158  N  N4    . DC  A 1 8   ? 24.317  32.683 36.707  1.00 77.37  ? 8    DC  P N4    1 
ATOM   159  C  C5    . DC  A 1 8   ? 25.665  34.052 38.144  1.00 54.24  ? 8    DC  P C5    1 
ATOM   160  C  C6    . DC  A 1 8   ? 26.394  35.165 38.254  1.00 45.93  ? 8    DC  P C6    1 
ATOM   161  P  P     . DG  A 1 9   ? 28.015  41.358 38.538  1.00 51.40  ? 9    DG  P P     1 
ATOM   162  O  OP1   . DG  A 1 9   ? 29.221  42.191 38.296  1.00 48.20  ? 9    DG  P OP1   1 
ATOM   163  O  OP2   . DG  A 1 9   ? 27.446  41.154 39.878  1.00 49.81  ? 9    DG  P OP2   1 
ATOM   164  O  "O5'" . DG  A 1 9   ? 26.804  41.903 37.630  1.00 56.58  ? 9    DG  P "O5'" 1 
ATOM   165  C  "C5'" . DG  A 1 9   ? 27.060  42.508 36.382  1.00 53.17  ? 9    DG  P "C5'" 1 
ATOM   166  C  "C4'" . DG  A 1 9   ? 25.898  42.278 35.430  1.00 59.51  ? 9    DG  P "C4'" 1 
ATOM   167  O  "O4'" . DG  A 1 9   ? 25.779  40.866 35.158  1.00 55.17  ? 9    DG  P "O4'" 1 
ATOM   168  C  "C3'" . DG  A 1 9   ? 24.535  42.674 35.966  1.00 58.61  ? 9    DG  P "C3'" 1 
ATOM   169  O  "O3'" . DG  A 1 9   ? 24.308  44.067 35.756  1.00 55.23  ? 9    DG  P "O3'" 1 
ATOM   170  C  "C2'" . DG  A 1 9   ? 23.596  41.812 35.121  1.00 56.71  ? 9    DG  P "C2'" 1 
ATOM   171  C  "C1'" . DG  A 1 9   ? 24.431  40.548 34.869  1.00 54.28  ? 9    DG  P "C1'" 1 
ATOM   172  N  N9    . DG  A 1 9   ? 24.048  39.405 35.689  1.00 54.00  ? 9    DG  P N9    1 
ATOM   173  C  C8    . DG  A 1 9   ? 24.388  39.174 36.999  1.00 60.15  ? 9    DG  P C8    1 
ATOM   174  N  N7    . DG  A 1 9   ? 23.908  38.056 37.475  1.00 61.68  ? 9    DG  P N7    1 
ATOM   175  C  C5    . DG  A 1 9   ? 23.209  37.511 36.409  1.00 58.92  ? 9    DG  P C5    1 
ATOM   176  C  C6    . DG  A 1 9   ? 22.482  36.305 36.325  1.00 62.89  ? 9    DG  P C6    1 
ATOM   177  O  O6    . DG  A 1 9   ? 22.307  35.455 37.207  1.00 59.34  ? 9    DG  P O6    1 
ATOM   178  N  N1    . DG  A 1 9   ? 21.926  36.127 35.060  1.00 71.89  ? 9    DG  P N1    1 
ATOM   179  C  C2    . DG  A 1 9   ? 22.062  37.010 34.013  1.00 78.39  ? 9    DG  P C2    1 
ATOM   180  N  N2    . DG  A 1 9   ? 21.456  36.674 32.865  1.00 82.19  ? 9    DG  P N2    1 
ATOM   181  N  N3    . DG  A 1 9   ? 22.749  38.145 34.082  1.00 69.71  ? 9    DG  P N3    1 
ATOM   182  C  C4    . DG  A 1 9   ? 23.290  38.328 35.301  1.00 60.56  ? 9    DG  P C4    1 
ATOM   183  P  P     . DT  A 1 10  ? 23.156  44.860 36.532  1.00 57.79  ? 10   DT  P P     1 
ATOM   184  O  OP1   . DT  A 1 10  ? 23.398  46.243 36.347  1.00 79.61  ? 10   DT  P OP1   1 
ATOM   185  O  OP2   . DT  A 1 10  ? 22.991  44.360 37.844  1.00 55.26  ? 10   DT  P OP2   1 
ATOM   186  O  "O5'" . DT  A 1 10  ? 21.856  44.412 35.770  1.00 63.31  ? 10   DT  P "O5'" 1 
ATOM   187  C  "C5'" . DT  A 1 10  ? 21.625  44.954 34.481  1.00 66.93  ? 10   DT  P "C5'" 1 
ATOM   188  C  "C4'" . DT  A 1 10  ? 20.526  44.196 33.781  1.00 71.40  ? 10   DT  P "C4'" 1 
ATOM   189  O  "O4'" . DT  A 1 10  ? 20.814  42.791 33.703  1.00 79.66  ? 10   DT  P "O4'" 1 
ATOM   190  C  "C3'" . DT  A 1 10  ? 19.167  44.243 34.449  1.00 75.46  ? 10   DT  P "C3'" 1 
ATOM   191  O  "O3'" . DT  A 1 10  ? 18.567  45.511 34.170  1.00 93.14  ? 10   DT  P "O3'" 1 
ATOM   192  C  "C2'" . DT  A 1 10  ? 18.497  43.069 33.767  1.00 77.48  ? 10   DT  P "C2'" 1 
ATOM   193  C  "C1'" . DT  A 1 10  ? 19.610  42.051 33.639  1.00 74.30  ? 10   DT  P "C1'" 1 
ATOM   194  N  N1    . DT  A 1 10  ? 19.650  41.016 34.679  1.00 71.39  ? 10   DT  P N1    1 
ATOM   195  C  C2    . DT  A 1 10  ? 19.098  39.786 34.419  1.00 71.56  ? 10   DT  P C2    1 
ATOM   196  O  O2    . DT  A 1 10  ? 18.584  39.502 33.363  1.00 76.34  ? 10   DT  P O2    1 
ATOM   197  N  N3    . DT  A 1 10  ? 19.181  38.889 35.450  1.00 68.91  ? 10   DT  P N3    1 
ATOM   198  C  C4    . DT  A 1 10  ? 19.737  39.100 36.688  1.00 64.49  ? 10   DT  P C4    1 
ATOM   199  O  O4    . DT  A 1 10  ? 19.748  38.195 37.511  1.00 62.94  ? 10   DT  P O4    1 
ATOM   200  C  C5    . DT  A 1 10  ? 20.276  40.423 36.901  1.00 62.34  ? 10   DT  P C5    1 
ATOM   201  C  C7    . DT  A 1 10  ? 20.923  40.742 38.209  1.00 66.97  ? 10   DT  P C7    1 
ATOM   202  C  C6    . DT  A 1 10  ? 20.220  41.296 35.895  1.00 64.86  ? 10   DT  P C6    1 
ATOM   203  P  P     . DA  A 1 11  ? 17.546  46.219 35.155  1.00 102.87 ? 11   DA  P P     1 
ATOM   204  O  OP1   . DA  A 1 11  ? 16.669  46.996 34.342  1.00 121.45 ? 11   DA  P OP1   1 
ATOM   205  O  OP2   . DA  A 1 11  ? 18.325  46.841 36.224  1.00 102.55 ? 11   DA  P OP2   1 
ATOM   206  O  "O5'" . DA  A 1 11  ? 16.818  45.052 35.938  1.00 112.13 ? 11   DA  P "O5'" 1 
ATOM   207  C  "C5'" . DA  A 1 11  ? 15.608  44.435 35.513  1.00 109.71 ? 11   DA  P "C5'" 1 
ATOM   208  C  "C4'" . DA  A 1 11  ? 15.885  42.967 35.294  1.00 105.54 ? 11   DA  P "C4'" 1 
ATOM   209  O  "O4'" . DA  A 1 11  ? 16.009  42.211 36.510  1.00 103.08 ? 11   DA  P "O4'" 1 
ATOM   210  C  "C3'" . DA  A 1 11  ? 14.883  42.191 34.449  1.00 103.59 ? 11   DA  P "C3'" 1 
ATOM   211  O  "O3'" . DA  A 1 11  ? 15.346  42.093 33.113  1.00 103.73 ? 11   DA  P "O3'" 1 
ATOM   212  C  "C2'" . DA  A 1 11  ? 14.869  40.811 35.082  1.00 104.01 ? 11   DA  P "C2'" 1 
ATOM   213  C  "C1'" . DA  A 1 11  ? 16.055  40.903 36.006  1.00 106.47 ? 11   DA  P "C1'" 1 
ATOM   214  N  N9    . DA  A 1 11  ? 16.168  39.961 37.111  1.00 104.45 ? 11   DA  P N9    1 
ATOM   215  C  C8    . DA  A 1 11  ? 15.758  38.653 37.146  1.00 110.22 ? 11   DA  P C8    1 
ATOM   216  N  N7    . DA  A 1 11  ? 16.061  38.034 38.262  1.00 113.57 ? 11   DA  P N7    1 
ATOM   217  C  C5    . DA  A 1 11  ? 16.742  38.993 38.997  1.00 114.08 ? 11   DA  P C5    1 
ATOM   218  C  C6    . DA  A 1 11  ? 17.317  38.970 40.274  1.00 114.50 ? 11   DA  P C6    1 
ATOM   219  N  N6    . DA  A 1 11  ? 17.329  37.893 41.058  1.00 111.28 ? 11   DA  P N6    1 
ATOM   220  N  N1    . DA  A 1 11  ? 17.922  40.096 40.710  1.00 115.79 ? 11   DA  P N1    1 
ATOM   221  C  C2    . DA  A 1 11  ? 17.932  41.169 39.911  1.00 104.85 ? 11   DA  P C2    1 
ATOM   222  N  N3    . DA  A 1 11  ? 17.413  41.318 38.701  1.00 104.01 ? 11   DA  P N3    1 
ATOM   223  C  C4    . DA  A 1 11  ? 16.835  40.177 38.290  1.00 104.69 ? 11   DA  P C4    1 
ATOM   224  N  N     . ALA B 2 4   ? 7.105   11.823 -2.782  1.00 58.23  ? 300  ALA A N     1 
ATOM   225  C  CA    . ALA B 2 4   ? 7.386   12.348 -4.111  1.00 58.87  ? 300  ALA A CA    1 
ATOM   226  C  C     . ALA B 2 4   ? 7.351   13.865 -4.105  1.00 57.49  ? 300  ALA A C     1 
ATOM   227  O  O     . ALA B 2 4   ? 6.406   14.482 -3.597  1.00 51.85  ? 300  ALA A O     1 
ATOM   228  C  CB    . ALA B 2 4   ? 6.392   11.805 -5.127  1.00 57.09  ? 300  ALA A CB    1 
ATOM   229  N  N     . PHE B 2 5   ? 8.386   14.467 -4.681  1.00 49.25  ? 301  PHE A N     1 
ATOM   230  C  CA    . PHE B 2 5   ? 8.450   15.912 -4.774  1.00 43.11  ? 301  PHE A CA    1 
ATOM   231  C  C     . PHE B 2 5   ? 9.227   16.289 -6.021  1.00 47.06  ? 301  PHE A C     1 
ATOM   232  O  O     . PHE B 2 5   ? 10.126  15.562 -6.456  1.00 48.15  ? 301  PHE A O     1 
ATOM   233  C  CB    . PHE B 2 5   ? 9.091   16.536 -3.531  1.00 32.10  ? 301  PHE A CB    1 
ATOM   234  C  CG    . PHE B 2 5   ? 10.537  16.175 -3.339  1.00 31.84  ? 301  PHE A CG    1 
ATOM   235  C  CD1   . PHE B 2 5   ? 11.544  16.982 -3.852  1.00 32.18  ? 301  PHE A CD1   1 
ATOM   236  C  CD2   . PHE B 2 5   ? 10.891  15.049 -2.615  1.00 38.45  ? 301  PHE A CD2   1 
ATOM   237  C  CE1   . PHE B 2 5   ? 12.876  16.657 -3.662  1.00 34.87  ? 301  PHE A CE1   1 
ATOM   238  C  CE2   . PHE B 2 5   ? 12.225  14.717 -2.420  1.00 43.61  ? 301  PHE A CE2   1 
ATOM   239  C  CZ    . PHE B 2 5   ? 13.216  15.519 -2.945  1.00 41.04  ? 301  PHE A CZ    1 
ATOM   240  N  N     . THR B 2 6   ? 8.861   17.435 -6.588  1.00 39.10  ? 302  THR A N     1 
ATOM   241  C  CA    . THR B 2 6   ? 9.510   17.963 -7.782  1.00 43.50  ? 302  THR A CA    1 
ATOM   242  C  C     . THR B 2 6   ? 10.780  18.694 -7.372  1.00 48.98  ? 302  THR A C     1 
ATOM   243  O  O     . THR B 2 6   ? 10.717  19.765 -6.755  1.00 42.89  ? 302  THR A O     1 
ATOM   244  C  CB    . THR B 2 6   ? 8.570   18.908 -8.520  1.00 45.50  ? 302  THR A CB    1 
ATOM   245  O  OG1   . THR B 2 6   ? 7.355   18.220 -8.842  1.00 49.84  ? 302  THR A OG1   1 
ATOM   246  C  CG2   . THR B 2 6   ? 9.230   19.440 -9.778  1.00 44.19  ? 302  THR A CG2   1 
ATOM   247  N  N     . LEU B 2 7   ? 11.932  18.119 -7.701  1.00 45.10  ? 303  LEU A N     1 
ATOM   248  C  CA    . LEU B 2 7   ? 13.197  18.822 -7.524  1.00 48.90  ? 303  LEU A CA    1 
ATOM   249  C  C     . LEU B 2 7   ? 13.305  19.787 -8.691  1.00 52.04  ? 303  LEU A C     1 
ATOM   250  O  O     . LEU B 2 7   ? 13.753  19.437 -9.778  1.00 52.71  ? 303  LEU A O     1 
ATOM   251  C  CB    . LEU B 2 7   ? 14.364  17.849 -7.459  1.00 53.12  ? 303  LEU A CB    1 
ATOM   252  C  CG    . LEU B 2 7   ? 15.632  18.524 -6.946  1.00 58.87  ? 303  LEU A CG    1 
ATOM   253  C  CD1   . LEU B 2 7   ? 16.185  17.791 -5.744  1.00 53.77  ? 303  LEU A CD1   1 
ATOM   254  C  CD2   . LEU B 2 7   ? 16.656  18.594 -8.057  1.00 63.75  ? 303  LEU A CD2   1 
ATOM   255  N  N     . ALA B 2 8   ? 12.861  21.016 -8.464  1.00 54.79  ? 304  ALA A N     1 
ATOM   256  C  CA    . ALA B 2 8   ? 12.549  21.921 -9.559  1.00 60.98  ? 304  ALA A CA    1 
ATOM   257  C  C     . ALA B 2 8   ? 13.794  22.612 -10.102 1.00 67.41  ? 304  ALA A C     1 
ATOM   258  O  O     . ALA B 2 8   ? 14.740  22.913 -9.368  1.00 73.14  ? 304  ALA A O     1 
ATOM   259  C  CB    . ALA B 2 8   ? 11.537  22.969 -9.104  1.00 56.31  ? 304  ALA A CB    1 
ATOM   260  N  N     . ASP B 2 9   ? 13.771  22.868 -11.410 1.00 69.55  ? 305  ASP A N     1 
ATOM   261  C  CA    . ASP B 2 9   ? 14.837  23.571 -12.114 1.00 70.98  ? 305  ASP A CA    1 
ATOM   262  C  C     . ASP B 2 9   ? 14.504  25.031 -12.385 1.00 63.28  ? 305  ASP A C     1 
ATOM   263  O  O     . ASP B 2 9   ? 15.417  25.856 -12.484 1.00 66.85  ? 305  ASP A O     1 
ATOM   264  C  CB    . ASP B 2 9   ? 15.135  22.874 -13.447 1.00 77.58  ? 305  ASP A CB    1 
ATOM   265  C  CG    . ASP B 2 9   ? 13.868  22.441 -14.170 1.00 87.28  ? 305  ASP A CG    1 
ATOM   266  O  OD1   . ASP B 2 9   ? 12.978  21.849 -13.513 1.00 90.15  ? 305  ASP A OD1   1 
ATOM   267  O  OD2   . ASP B 2 9   ? 13.757  22.700 -15.389 1.00 90.26  ? 305  ASP A OD2   1 
ATOM   268  N  N     . ARG B 2 10  ? 13.219  25.355 -12.526 1.00 52.28  ? 306  ARG A N     1 
ATOM   269  C  CA    . ARG B 2 10  ? 12.750  26.725 -12.661 1.00 56.21  ? 306  ARG A CA    1 
ATOM   270  C  C     . ARG B 2 10  ? 11.429  26.854 -11.913 1.00 47.66  ? 306  ARG A C     1 
ATOM   271  O  O     . ARG B 2 10  ? 10.828  25.857 -11.500 1.00 36.90  ? 306  ARG A O     1 
ATOM   272  C  CB    . ARG B 2 10  ? 12.592  27.135 -14.133 1.00 62.84  ? 306  ARG A CB    1 
ATOM   273  C  CG    . ARG B 2 10  ? 11.943  26.084 -15.023 1.00 76.05  ? 306  ARG A CG    1 
ATOM   274  C  CD    . ARG B 2 10  ? 10.435  26.292 -15.140 1.00 82.91  ? 306  ARG A CD    1 
ATOM   275  N  NE    . ARG B 2 10  ? 9.871   25.616 -16.310 1.00 84.94  ? 306  ARG A NE    1 
ATOM   276  C  CZ    . ARG B 2 10  ? 8.692   25.911 -16.852 1.00 84.71  ? 306  ARG A CZ    1 
ATOM   277  N  NH1   . ARG B 2 10  ? 7.936   26.872 -16.332 1.00 84.90  ? 306  ARG A NH1   1 
ATOM   278  N  NH2   . ARG B 2 10  ? 8.266   25.243 -17.916 1.00 84.71  ? 306  ARG A NH2   1 
ATOM   279  N  N     . VAL B 2 11  ? 10.984  28.100 -11.742 1.00 45.07  ? 307  VAL A N     1 
ATOM   280  C  CA    . VAL B 2 11  ? 9.736   28.413 -11.051 1.00 43.88  ? 307  VAL A CA    1 
ATOM   281  C  C     . VAL B 2 11  ? 8.580   28.327 -12.041 1.00 44.67  ? 307  VAL A C     1 
ATOM   282  O  O     . VAL B 2 11  ? 8.604   28.955 -13.105 1.00 42.99  ? 307  VAL A O     1 
ATOM   283  C  CB    . VAL B 2 11  ? 9.805   29.810 -10.404 1.00 45.72  ? 307  VAL A CB    1 
ATOM   284  C  CG1   . VAL B 2 11  ? 8.423   30.268 -9.946  1.00 40.42  ? 307  VAL A CG1   1 
ATOM   285  C  CG2   . VAL B 2 11  ? 10.779  29.807 -9.239  1.00 39.71  ? 307  VAL A CG2   1 
ATOM   286  N  N     . THR B 2 12  ? 7.571   27.540 -11.697 1.00 41.84  ? 308  THR A N     1 
ATOM   287  C  CA    . THR B 2 12  ? 6.331   27.456 -12.450 1.00 41.75  ? 308  THR A CA    1 
ATOM   288  C  C     . THR B 2 12  ? 5.214   28.102 -11.646 1.00 44.83  ? 308  THR A C     1 
ATOM   289  O  O     . THR B 2 12  ? 5.314   28.264 -10.424 1.00 43.33  ? 308  THR A O     1 
ATOM   290  C  CB    . THR B 2 12  ? 5.963   26.000 -12.758 1.00 42.33  ? 308  THR A CB    1 
ATOM   291  O  OG1   . THR B 2 12  ? 5.739   25.298 -11.525 1.00 46.21  ? 308  THR A OG1   1 
ATOM   292  C  CG2   . THR B 2 12  ? 7.072   25.308 -13.541 1.00 42.55  ? 308  THR A CG2   1 
ATOM   293  N  N     . GLU B 2 13  ? 4.135   28.454 -12.347 1.00 40.73  ? 309  GLU A N     1 
ATOM   294  C  CA    . GLU B 2 13  ? 3.002   29.105 -11.689 1.00 48.28  ? 309  GLU A CA    1 
ATOM   295  C  C     . GLU B 2 13  ? 2.368   28.201 -10.638 1.00 42.14  ? 309  GLU A C     1 
ATOM   296  O  O     . GLU B 2 13  ? 1.862   28.686 -9.624  1.00 45.97  ? 309  GLU A O     1 
ATOM   297  C  CB    . GLU B 2 13  ? 1.971   29.535 -12.738 1.00 65.75  ? 309  GLU A CB    1 
ATOM   298  C  CG    . GLU B 2 13  ? 0.641   30.024 -12.169 1.00 80.60  ? 309  GLU A CG    1 
ATOM   299  C  CD    . GLU B 2 13  ? 0.748   31.393 -11.512 1.00 90.72  ? 309  GLU A CD    1 
ATOM   300  O  OE1   . GLU B 2 13  ? -0.035  31.664 -10.573 1.00 93.02  ? 309  GLU A OE1   1 
ATOM   301  O  OE2   . GLU B 2 13  ? 1.610   32.196 -11.935 1.00 92.36  ? 309  GLU A OE2   1 
ATOM   302  N  N     . GLU B 2 14  ? 2.415   26.889 -10.858 1.00 35.11  ? 310  GLU A N     1 
ATOM   303  C  CA    . GLU B 2 14  ? 1.933   25.896 -9.907  1.00 34.01  ? 310  GLU A CA    1 
ATOM   304  C  C     . GLU B 2 14  ? 2.520   26.109 -8.513  1.00 34.37  ? 310  GLU A C     1 
ATOM   305  O  O     . GLU B 2 14  ? 1.836   25.849 -7.507  1.00 37.30  ? 310  GLU A O     1 
ATOM   306  C  CB    . GLU B 2 14  ? 2.258   24.497 -10.407 1.00 39.32  ? 310  GLU A CB    1 
ATOM   307  C  CG    . GLU B 2 14  ? 1.721   24.165 -11.809 1.00 68.51  ? 310  GLU A CG    1 
ATOM   308  C  CD    . GLU B 2 14  ? 2.511   24.841 -12.955 1.00 73.17  ? 310  GLU A CD    1 
ATOM   309  O  OE1   . GLU B 2 14  ? 2.265   26.042 -13.228 1.00 72.24  ? 310  GLU A OE1   1 
ATOM   310  O  OE2   . GLU B 2 14  ? 3.370   24.173 -13.583 1.00 72.68  ? 310  GLU A OE2   1 
ATOM   311  N  N     . MET B 2 15  ? 3.760   26.587 -8.416  1.00 31.78  ? 311  MET A N     1 
ATOM   312  C  CA    . MET B 2 15  ? 4.338   26.827 -7.104  1.00 28.76  ? 311  MET A CA    1 
ATOM   313  C  C     . MET B 2 15  ? 3.894   28.136 -6.493  1.00 35.56  ? 311  MET A C     1 
ATOM   314  O  O     . MET B 2 15  ? 4.265   28.407 -5.344  1.00 39.39  ? 311  MET A O     1 
ATOM   315  C  CB    . MET B 2 15  ? 5.853   26.803 -7.177  1.00 32.35  ? 311  MET A CB    1 
ATOM   316  C  CG    . MET B 2 15  ? 6.363   25.802 -8.161  1.00 34.12  ? 311  MET A CG    1 
ATOM   317  S  SD    . MET B 2 15  ? 8.143   25.949 -8.380  1.00 42.36  ? 311  MET A SD    1 
ATOM   318  C  CE    . MET B 2 15  ? 8.434   24.468 -9.347  1.00 33.42  ? 311  MET A CE    1 
ATOM   319  N  N     . LEU B 2 16  ? 3.109   28.938 -7.211  1.00 33.48  ? 312  LEU A N     1 
ATOM   320  C  CA    . LEU B 2 16  ? 2.734   30.261 -6.729  1.00 35.63  ? 312  LEU A CA    1 
ATOM   321  C  C     . LEU B 2 16  ? 1.246   30.324 -6.393  1.00 41.38  ? 312  LEU A C     1 
ATOM   322  O  O     . LEU B 2 16  ? 0.559   31.282 -6.757  1.00 43.62  ? 312  LEU A O     1 
ATOM   323  C  CB    . LEU B 2 16  ? 3.115   31.318 -7.770  1.00 33.67  ? 312  LEU A CB    1 
ATOM   324  C  CG    . LEU B 2 16  ? 4.510   31.152 -8.378  1.00 35.19  ? 312  LEU A CG    1 
ATOM   325  C  CD1   . LEU B 2 16  ? 4.763   32.207 -9.436  1.00 35.26  ? 312  LEU A CD1   1 
ATOM   326  C  CD2   . LEU B 2 16  ? 5.584   31.202 -7.291  1.00 34.02  ? 312  LEU A CD2   1 
ATOM   327  N  N     . ALA B 2 17  ? 0.746   29.322 -5.674  1.00 40.38  ? 313  ALA A N     1 
ATOM   328  C  CA    . ALA B 2 17  ? -0.660  29.261 -5.308  1.00 37.95  ? 313  ALA A CA    1 
ATOM   329  C  C     . ALA B 2 17  ? -0.986  30.229 -4.168  1.00 30.20  ? 313  ALA A C     1 
ATOM   330  O  O     . ALA B 2 17  ? -0.107  30.792 -3.513  1.00 32.28  ? 313  ALA A O     1 
ATOM   331  C  CB    . ALA B 2 17  ? -1.048  27.837 -4.903  1.00 40.92  ? 313  ALA A CB    1 
ATOM   332  N  N     . ASP B 2 18  ? -2.289  30.390 -3.931  1.00 31.57  ? 314  ASP A N     1 
ATOM   333  C  CA    . ASP B 2 18  ? -2.839  31.271 -2.904  1.00 39.38  ? 314  ASP A CA    1 
ATOM   334  C  C     . ASP B 2 18  ? -2.514  30.827 -1.473  1.00 32.47  ? 314  ASP A C     1 
ATOM   335  O  O     . ASP B 2 18  ? -2.567  31.650 -0.551  1.00 29.20  ? 314  ASP A O     1 
ATOM   336  C  CB    . ASP B 2 18  ? -4.358  31.345 -3.090  1.00 57.64  ? 314  ASP A CB    1 
ATOM   337  C  CG    . ASP B 2 18  ? -5.045  32.142 -2.002  1.00 84.52  ? 314  ASP A CG    1 
ATOM   338  O  OD1   . ASP B 2 18  ? -4.829  33.372 -1.948  1.00 94.71  ? 314  ASP A OD1   1 
ATOM   339  O  OD2   . ASP B 2 18  ? -5.794  31.541 -1.197  1.00 92.60  ? 314  ASP A OD2   1 
ATOM   340  N  N     . LYS B 2 19  ? -2.221  29.551 -1.256  1.00 26.44  ? 315  LYS A N     1 
ATOM   341  C  CA    . LYS B 2 19  ? -1.920  29.036 0.073   1.00 27.72  ? 315  LYS A CA    1 
ATOM   342  C  C     . LYS B 2 19  ? -0.813  28.010 -0.050  1.00 23.13  ? 315  LYS A C     1 
ATOM   343  O  O     . LYS B 2 19  ? -0.876  27.131 -0.909  1.00 24.54  ? 315  LYS A O     1 
ATOM   344  C  CB    . LYS B 2 19  ? -3.150  28.397 0.728   1.00 35.42  ? 315  LYS A CB    1 
ATOM   345  C  CG    . LYS B 2 19  ? -3.034  28.292 2.251   1.00 39.56  ? 315  LYS A CG    1 
ATOM   346  C  CD    . LYS B 2 19  ? -4.297  27.702 2.885   1.00 43.86  ? 315  LYS A CD    1 
ATOM   347  C  CE    . LYS B 2 19  ? -4.004  27.138 4.277   1.00 40.34  ? 315  LYS A CE    1 
ATOM   348  N  NZ    . LYS B 2 19  ? -3.400  28.155 5.185   1.00 36.71  ? 315  LYS A NZ    1 
ATOM   349  N  N     . ALA B 2 20  ? 0.192   28.112 0.808   1.00 18.27  ? 316  ALA A N     1 
ATOM   350  C  CA    . ALA B 2 20  ? 1.306   27.185 0.706   1.00 21.14  ? 316  ALA A CA    1 
ATOM   351  C  C     . ALA B 2 20  ? 2.023   27.107 2.036   1.00 23.50  ? 316  ALA A C     1 
ATOM   352  O  O     . ALA B 2 20  ? 2.057   28.075 2.808   1.00 21.16  ? 316  ALA A O     1 
ATOM   353  C  CB    . ALA B 2 20  ? 2.298   27.606 -0.384  1.00 17.74  ? 316  ALA A CB    1 
ATOM   354  N  N     . ALA B 2 21  ? 2.590   25.938 2.289   1.00 17.09  ? 317  ALA A N     1 
ATOM   355  C  CA    . ALA B 2 21  ? 3.609   25.795 3.307   1.00 15.93  ? 317  ALA A CA    1 
ATOM   356  C  C     . ALA B 2 21  ? 4.933   26.148 2.654   1.00 16.46  ? 317  ALA A C     1 
ATOM   357  O  O     . ALA B 2 21  ? 5.209   25.730 1.530   1.00 20.54  ? 317  ALA A O     1 
ATOM   358  C  CB    . ALA B 2 21  ? 3.652   24.368 3.875   1.00 14.27  ? 317  ALA A CB    1 
ATOM   359  N  N     . LEU B 2 22  ? 5.745   26.928 3.346   1.00 16.12  ? 318  LEU A N     1 
ATOM   360  C  CA    . LEU B 2 22  ? 6.970   27.422 2.751   1.00 15.40  ? 318  LEU A CA    1 
ATOM   361  C  C     . LEU B 2 22  ? 8.095   27.184 3.734   1.00 16.52  ? 318  LEU A C     1 
ATOM   362  O  O     . LEU B 2 22  ? 7.955   27.465 4.928   1.00 17.71  ? 318  LEU A O     1 
ATOM   363  C  CB    . LEU B 2 22  ? 6.864   28.917 2.410   1.00 15.17  ? 318  LEU A CB    1 
ATOM   364  C  CG    . LEU B 2 22  ? 8.176   29.594 2.071   1.00 14.06  ? 318  LEU A CG    1 
ATOM   365  C  CD1   . LEU B 2 22  ? 8.513   29.191 0.629   1.00 15.29  ? 318  LEU A CD1   1 
ATOM   366  C  CD2   . LEU B 2 22  ? 8.044   31.139 2.158   1.00 15.84  ? 318  LEU A CD2   1 
ATOM   367  N  N     . VAL B 2 23  ? 9.200   26.661 3.233   1.00 17.02  ? 319  VAL A N     1 
ATOM   368  C  CA    . VAL B 2 23  ? 10.412  26.504 4.014   1.00 15.40  ? 319  VAL A CA    1 
ATOM   369  C  C     . VAL B 2 23  ? 11.495  27.276 3.290   1.00 18.29  ? 319  VAL A C     1 
ATOM   370  O  O     . VAL B 2 23  ? 11.758  27.034 2.107   1.00 18.93  ? 319  VAL A O     1 
ATOM   371  C  CB    . VAL B 2 23  ? 10.821  25.033 4.173   1.00 19.06  ? 319  VAL A CB    1 
ATOM   372  C  CG1   . VAL B 2 23  ? 12.219  24.952 4.743   1.00 15.54  ? 319  VAL A CG1   1 
ATOM   373  C  CG2   . VAL B 2 23  ? 9.816   24.312 5.054   1.00 21.23  ? 319  VAL A CG2   1 
ATOM   374  N  N     . VAL B 2 24  ? 12.103  28.215 3.986   1.00 17.08  ? 320  VAL A N     1 
ATOM   375  C  CA    . VAL B 2 24  ? 13.223  28.986 3.471   1.00 19.10  ? 320  VAL A CA    1 
ATOM   376  C  C     . VAL B 2 24  ? 14.338  28.717 4.460   1.00 23.00  ? 320  VAL A C     1 
ATOM   377  O  O     . VAL B 2 24  ? 14.364  29.299 5.546   1.00 23.93  ? 320  VAL A O     1 
ATOM   378  C  CB    . VAL B 2 24  ? 12.902  30.480 3.352   1.00 16.83  ? 320  VAL A CB    1 
ATOM   379  C  CG1   . VAL B 2 24  ? 14.135  31.271 2.888   1.00 17.96  ? 320  VAL A CG1   1 
ATOM   380  C  CG2   . VAL B 2 24  ? 11.748  30.680 2.406   1.00 17.43  ? 320  VAL A CG2   1 
ATOM   381  N  N     . GLU B 2 25  ? 15.230  27.797 4.120   1.00 23.63  ? 321  GLU A N     1 
ATOM   382  C  CA    . GLU B 2 25  ? 16.061  27.160 5.129   1.00 18.44  ? 321  GLU A CA    1 
ATOM   383  C  C     . GLU B 2 25  ? 17.355  27.935 5.330   1.00 18.61  ? 321  GLU A C     1 
ATOM   384  O  O     . GLU B 2 25  ? 18.137  28.125 4.389   1.00 19.89  ? 321  GLU A O     1 
ATOM   385  C  CB    . GLU B 2 25  ? 16.371  25.713 4.758   1.00 18.27  ? 321  GLU A CB    1 
ATOM   386  C  CG    . GLU B 2 25  ? 17.185  24.994 5.821   1.00 20.90  ? 321  GLU A CG    1 
ATOM   387  C  CD    . GLU B 2 25  ? 16.307  24.450 6.947   1.00 32.57  ? 321  GLU A CD    1 
ATOM   388  O  OE1   . GLU B 2 25  ? 15.135  24.872 7.045   1.00 35.89  ? 321  GLU A OE1   1 
ATOM   389  O  OE2   . GLU B 2 25  ? 16.768  23.574 7.714   1.00 33.97  ? 321  GLU A OE2   1 
ATOM   390  N  N     . VAL B 2 26  ? 17.590  28.328 6.571   1.00 18.32  ? 322  VAL A N     1 
ATOM   391  C  CA    . VAL B 2 26  ? 18.782  29.039 6.993   1.00 17.84  ? 322  VAL A CA    1 
ATOM   392  C  C     . VAL B 2 26  ? 19.380  28.193 8.094   1.00 18.29  ? 322  VAL A C     1 
ATOM   393  O  O     . VAL B 2 26  ? 18.793  28.082 9.180   1.00 19.87  ? 322  VAL A O     1 
ATOM   394  C  CB    . VAL B 2 26  ? 18.464  30.450 7.506   1.00 15.94  ? 322  VAL A CB    1 
ATOM   395  C  CG1   . VAL B 2 26  ? 19.749  31.167 7.850   1.00 16.60  ? 322  VAL A CG1   1 
ATOM   396  C  CG2   . VAL B 2 26  ? 17.639  31.213 6.473   1.00 18.31  ? 322  VAL A CG2   1 
ATOM   397  N  N     . VAL B 2 27  ? 20.534  27.592 7.826   1.00 22.13  ? 323  VAL A N     1 
ATOM   398  C  CA    . VAL B 2 27  ? 21.088  26.600 8.737   1.00 24.54  ? 323  VAL A CA    1 
ATOM   399  C  C     . VAL B 2 27  ? 21.963  27.250 9.800   1.00 24.39  ? 323  VAL A C     1 
ATOM   400  O  O     . VAL B 2 27  ? 21.975  26.810 10.954  1.00 25.57  ? 323  VAL A O     1 
ATOM   401  C  CB    . VAL B 2 27  ? 21.853  25.526 7.932   1.00 25.35  ? 323  VAL A CB    1 
ATOM   402  C  CG1   . VAL B 2 27  ? 22.503  24.518 8.863   1.00 33.69  ? 323  VAL A CG1   1 
ATOM   403  C  CG2   . VAL B 2 27  ? 20.887  24.816 6.994   1.00 29.01  ? 323  VAL A CG2   1 
ATOM   404  N  N     . GLU B 2 28  ? 22.691  28.303 9.436   1.00 19.56  ? 324  GLU A N     1 
ATOM   405  C  CA    . GLU B 2 28  ? 23.477  29.044 10.413  1.00 24.81  ? 324  GLU A CA    1 
ATOM   406  C  C     . GLU B 2 28  ? 22.578  29.519 11.545  1.00 28.32  ? 324  GLU A C     1 
ATOM   407  O  O     . GLU B 2 28  ? 21.479  30.032 11.310  1.00 25.99  ? 324  GLU A O     1 
ATOM   408  C  CB    . GLU B 2 28  ? 24.187  30.228 9.747   1.00 30.20  ? 324  GLU A CB    1 
ATOM   409  C  CG    . GLU B 2 28  ? 25.260  29.792 8.757   1.00 51.44  ? 324  GLU A CG    1 
ATOM   410  C  CD    . GLU B 2 28  ? 26.099  30.940 8.212   1.00 66.83  ? 324  GLU A CD    1 
ATOM   411  O  OE1   . GLU B 2 28  ? 26.807  30.717 7.201   1.00 67.43  ? 324  GLU A OE1   1 
ATOM   412  O  OE2   . GLU B 2 28  ? 26.056  32.054 8.786   1.00 65.89  ? 324  GLU A OE2   1 
ATOM   413  N  N     . GLU B 2 29  ? 23.031  29.294 12.780  1.00 23.25  ? 325  GLU A N     1 
ATOM   414  C  CA    . GLU B 2 29  ? 22.223  29.651 13.942  1.00 30.40  ? 325  GLU A CA    1 
ATOM   415  C  C     . GLU B 2 29  ? 21.914  31.146 13.948  1.00 26.33  ? 325  GLU A C     1 
ATOM   416  O  O     . GLU B 2 29  ? 20.764  31.555 14.137  1.00 23.59  ? 325  GLU A O     1 
ATOM   417  C  CB    . GLU B 2 29  ? 22.933  29.217 15.234  1.00 41.23  ? 325  GLU A CB    1 
ATOM   418  C  CG    . GLU B 2 29  ? 24.208  29.984 15.605  1.00 66.55  ? 325  GLU A CG    1 
ATOM   419  C  CD    . GLU B 2 29  ? 25.239  30.035 14.481  1.00 85.53  ? 325  GLU A CD    1 
ATOM   420  O  OE1   . GLU B 2 29  ? 25.682  31.153 14.131  1.00 87.13  ? 325  GLU A OE1   1 
ATOM   421  O  OE2   . GLU B 2 29  ? 25.589  28.962 13.934  1.00 90.38  ? 325  GLU A OE2   1 
ATOM   422  N  N     . ASN B 2 30  ? 22.923  31.975 13.712  1.00 22.21  ? 326  ASN A N     1 
ATOM   423  C  CA    . ASN B 2 30  ? 22.707  33.405 13.549  1.00 24.87  ? 326  ASN A CA    1 
ATOM   424  C  C     . ASN B 2 30  ? 22.299  33.673 12.106  1.00 19.86  ? 326  ASN A C     1 
ATOM   425  O  O     . ASN B 2 30  ? 23.138  33.638 11.205  1.00 20.56  ? 326  ASN A O     1 
ATOM   426  C  CB    . ASN B 2 30  ? 23.970  34.176 13.910  1.00 23.35  ? 326  ASN A CB    1 
ATOM   427  C  CG    . ASN B 2 30  ? 23.721  35.674 13.991  1.00 28.22  ? 326  ASN A CG    1 
ATOM   428  O  OD1   . ASN B 2 30  ? 23.100  36.260 13.100  1.00 23.96  ? 326  ASN A OD1   1 
ATOM   429  N  ND2   . ASN B 2 30  ? 24.175  36.291 15.072  1.00 24.46  ? 326  ASN A ND2   1 
ATOM   430  N  N     . TYR B 2 31  ? 21.031  33.968 11.879  1.00 14.51  ? 327  TYR A N     1 
ATOM   431  C  CA    . TYR B 2 31  ? 20.548  34.073 10.506  1.00 18.53  ? 327  TYR A CA    1 
ATOM   432  C  C     . TYR B 2 31  ? 20.827  35.417 9.840   1.00 18.66  ? 327  TYR A C     1 
ATOM   433  O  O     . TYR B 2 31  ? 20.449  35.582 8.675   1.00 18.30  ? 327  TYR A O     1 
ATOM   434  C  CB    . TYR B 2 31  ? 19.047  33.796 10.448  1.00 15.17  ? 327  TYR A CB    1 
ATOM   435  C  CG    . TYR B 2 31  ? 18.202  34.493 11.508  1.00 17.33  ? 327  TYR A CG    1 
ATOM   436  C  CD1   . TYR B 2 31  ? 17.970  35.864 11.461  1.00 21.15  ? 327  TYR A CD1   1 
ATOM   437  C  CD2   . TYR B 2 31  ? 17.592  33.759 12.519  1.00 16.09  ? 327  TYR A CD2   1 
ATOM   438  C  CE1   . TYR B 2 31  ? 17.178  36.493 12.405  1.00 26.18  ? 327  TYR A CE1   1 
ATOM   439  C  CE2   . TYR B 2 31  ? 16.795  34.381 13.470  1.00 17.08  ? 327  TYR A CE2   1 
ATOM   440  C  CZ    . TYR B 2 31  ? 16.591  35.733 13.415  1.00 22.31  ? 327  TYR A CZ    1 
ATOM   441  O  OH    . TYR B 2 31  ? 15.800  36.333 14.358  1.00 20.83  ? 327  TYR A OH    1 
ATOM   442  N  N     . HIS B 2 32  ? 21.476  36.364 10.522  1.00 19.73  ? 328  HIS A N     1 
ATOM   443  C  CA    . HIS B 2 32  ? 21.728  37.683 9.943   1.00 19.62  ? 328  HIS A CA    1 
ATOM   444  C  C     . HIS B 2 32  ? 22.748  37.592 8.816   1.00 18.94  ? 328  HIS A C     1 
ATOM   445  O  O     . HIS B 2 32  ? 23.898  37.208 9.048   1.00 19.53  ? 328  HIS A O     1 
ATOM   446  C  CB    . HIS B 2 32  ? 22.214  38.655 11.023  1.00 18.80  ? 328  HIS A CB    1 
ATOM   447  C  CG    . HIS B 2 32  ? 21.115  39.160 11.894  1.00 16.85  ? 328  HIS A CG    1 
ATOM   448  N  ND1   . HIS B 2 32  ? 20.075  39.920 11.407  1.00 19.36  ? 328  HIS A ND1   1 
ATOM   449  C  CD2   . HIS B 2 32  ? 20.862  38.973 13.212  1.00 22.84  ? 328  HIS A CD2   1 
ATOM   450  C  CE1   . HIS B 2 32  ? 19.235  40.194 12.391  1.00 22.00  ? 328  HIS A CE1   1 
ATOM   451  N  NE2   . HIS B 2 32  ? 19.688  39.630 13.495  1.00 21.07  ? 328  HIS A NE2   1 
ATOM   452  N  N     . ASP B 2 33  ? 22.335  37.982 7.601   1.00 17.40  ? 329  ASP A N     1 
ATOM   453  C  CA    . ASP B 2 33  ? 23.197  37.950 6.412   1.00 18.57  ? 329  ASP A CA    1 
ATOM   454  C  C     . ASP B 2 33  ? 23.681  36.533 6.114   1.00 18.74  ? 329  ASP A C     1 
ATOM   455  O  O     . ASP B 2 33  ? 24.757  36.336 5.559   1.00 20.51  ? 329  ASP A O     1 
ATOM   456  C  CB    . ASP B 2 33  ? 24.394  38.899 6.548   1.00 19.90  ? 329  ASP A CB    1 
ATOM   457  C  CG    . ASP B 2 33  ? 24.817  39.521 5.206   1.00 22.37  ? 329  ASP A CG    1 
ATOM   458  O  OD1   . ASP B 2 33  ? 24.077  39.363 4.211   1.00 21.03  ? 329  ASP A OD1   1 
ATOM   459  O  OD2   . ASP B 2 33  ? 25.898  40.145 5.149   1.00 22.52  ? 329  ASP A OD2   1 
ATOM   460  N  N     . ALA B 2 34  ? 22.899  35.554 6.474   1.00 21.52  ? 330  ALA A N     1 
ATOM   461  C  CA    . ALA B 2 34  ? 23.301  34.160 6.377   1.00 26.61  ? 330  ALA A CA    1 
ATOM   462  C  C     . ALA B 2 34  ? 22.740  33.521 5.115   1.00 21.40  ? 330  ALA A C     1 
ATOM   463  O  O     . ALA B 2 34  ? 21.704  33.946 4.591   1.00 20.40  ? 330  ALA A O     1 
ATOM   464  C  CB    . ALA B 2 34  ? 22.810  33.392 7.612   1.00 16.83  ? 330  ALA A CB    1 
ATOM   465  N  N     . PRO B 2 35  ? 23.377  32.472 4.610   1.00 25.97  ? 331  PRO A N     1 
ATOM   466  C  CA    . PRO B 2 35  ? 22.904  31.872 3.358   1.00 22.13  ? 331  PRO A CA    1 
ATOM   467  C  C     . PRO B 2 35  ? 21.559  31.194 3.529   1.00 23.85  ? 331  PRO A C     1 
ATOM   468  O  O     . PRO B 2 35  ? 21.220  30.670 4.591   1.00 24.66  ? 331  PRO A O     1 
ATOM   469  C  CB    . PRO B 2 35  ? 23.999  30.855 3.005   1.00 24.40  ? 331  PRO A CB    1 
ATOM   470  C  CG    . PRO B 2 35  ? 25.176  31.203 3.862   1.00 28.74  ? 331  PRO A CG    1 
ATOM   471  C  CD    . PRO B 2 35  ? 24.595  31.812 5.112   1.00 25.93  ? 331  PRO A CD    1 
ATOM   472  N  N     . ILE B 2 36  ? 20.776  31.220 2.460   1.00 22.84  ? 332  ILE A N     1 
ATOM   473  C  CA    . ILE B 2 36  ? 19.590  30.385 2.343   1.00 19.80  ? 332  ILE A CA    1 
ATOM   474  C  C     . ILE B 2 36  ? 20.017  29.167 1.534   1.00 23.39  ? 332  ILE A C     1 
ATOM   475  O  O     . ILE B 2 36  ? 20.480  29.305 0.399   1.00 25.00  ? 332  ILE A O     1 
ATOM   476  C  CB    . ILE B 2 36  ? 18.433  31.139 1.673   1.00 20.93  ? 332  ILE A CB    1 
ATOM   477  C  CG1   . ILE B 2 36  ? 17.997  32.307 2.542   1.00 24.24  ? 332  ILE A CG1   1 
ATOM   478  C  CG2   . ILE B 2 36  ? 17.263  30.194 1.327   1.00 16.90  ? 332  ILE A CG2   1 
ATOM   479  C  CD1   . ILE B 2 36  ? 17.083  33.255 1.833   1.00 29.48  ? 332  ILE A CD1   1 
ATOM   480  N  N     . VAL B 2 37  ? 19.904  27.976 2.126   1.00 23.40  ? 333  VAL A N     1 
ATOM   481  C  CA    . VAL B 2 37  ? 20.453  26.782 1.493   1.00 24.09  ? 333  VAL A CA    1 
ATOM   482  C  C     . VAL B 2 37  ? 19.446  26.068 0.614   1.00 22.67  ? 333  VAL A C     1 
ATOM   483  O  O     . VAL B 2 37  ? 19.832  25.189 -0.161  1.00 26.19  ? 333  VAL A O     1 
ATOM   484  C  CB    . VAL B 2 37  ? 20.983  25.785 2.540   1.00 27.86  ? 333  VAL A CB    1 
ATOM   485  C  CG1   . VAL B 2 37  ? 21.936  26.493 3.511   1.00 30.77  ? 333  VAL A CG1   1 
ATOM   486  C  CG2   . VAL B 2 37  ? 19.823  25.160 3.284   1.00 25.16  ? 333  VAL A CG2   1 
ATOM   487  N  N     . GLY B 2 38  ? 18.171  26.393 0.712   1.00 19.09  ? 334  GLY A N     1 
ATOM   488  C  CA    . GLY B 2 38  ? 17.192  25.657 -0.051  1.00 18.80  ? 334  GLY A CA    1 
ATOM   489  C  C     . GLY B 2 38  ? 15.809  26.142 0.296   1.00 17.64  ? 334  GLY A C     1 
ATOM   490  O  O     . GLY B 2 38  ? 15.590  26.788 1.325   1.00 18.71  ? 334  GLY A O     1 
ATOM   491  N  N     . ILE B 2 39  ? 14.880  25.832 -0.590  1.00 21.76  ? 335  ILE A N     1 
ATOM   492  C  CA    . ILE B 2 39  ? 13.519  26.335 -0.494  1.00 17.44  ? 335  ILE A CA    1 
ATOM   493  C  C     . ILE B 2 39  ? 12.573  25.198 -0.824  1.00 24.47  ? 335  ILE A C     1 
ATOM   494  O  O     . ILE B 2 39  ? 12.767  24.491 -1.817  1.00 20.17  ? 335  ILE A O     1 
ATOM   495  C  CB    . ILE B 2 39  ? 13.300  27.521 -1.454  1.00 19.60  ? 335  ILE A CB    1 
ATOM   496  C  CG1   . ILE B 2 39  ? 14.160  28.711 -1.005  1.00 24.83  ? 335  ILE A CG1   1 
ATOM   497  C  CG2   . ILE B 2 39  ? 11.816  27.849 -1.568  1.00 18.71  ? 335  ILE A CG2   1 
ATOM   498  C  CD1   . ILE B 2 39  ? 14.036  29.933 -1.874  1.00 28.30  ? 335  ILE A CD1   1 
ATOM   499  N  N     . ALA B 2 40  ? 11.560  25.014 -0.001  1.00 16.87  ? 336  ALA A N     1 
ATOM   500  C  CA    . ALA B 2 40  ? 10.539  24.036 -0.316  1.00 18.91  ? 336  ALA A CA    1 
ATOM   501  C  C     . ALA B 2 40  ? 9.182   24.714 -0.245  1.00 18.19  ? 336  ALA A C     1 
ATOM   502  O  O     . ALA B 2 40  ? 8.946   25.581 0.604   1.00 16.58  ? 336  ALA A O     1 
ATOM   503  C  CB    . ALA B 2 40  ? 10.603  22.821 0.627   1.00 16.97  ? 336  ALA A CB    1 
ATOM   504  N  N     . VAL B 2 41  ? 8.315   24.334 -1.170  1.00 20.15  ? 337  VAL A N     1 
ATOM   505  C  CA    . VAL B 2 41  ? 6.943   24.802 -1.241  1.00 19.64  ? 337  VAL A CA    1 
ATOM   506  C  C     . VAL B 2 41  ? 6.053   23.572 -1.289  1.00 21.65  ? 337  VAL A C     1 
ATOM   507  O  O     . VAL B 2 41  ? 6.275   22.673 -2.107  1.00 21.74  ? 337  VAL A O     1 
ATOM   508  C  CB    . VAL B 2 41  ? 6.712   25.676 -2.490  1.00 24.73  ? 337  VAL A CB    1 
ATOM   509  C  CG1   . VAL B 2 41  ? 5.240   26.042 -2.638  1.00 20.52  ? 337  VAL A CG1   1 
ATOM   510  C  CG2   . VAL B 2 41  ? 7.587   26.915 -2.429  1.00 21.97  ? 337  VAL A CG2   1 
ATOM   511  N  N     . VAL B 2 42  ? 5.041   23.531 -0.434  1.00 18.41  ? 338  VAL A N     1 
ATOM   512  C  CA    . VAL B 2 42  ? 4.001   22.517 -0.532  1.00 18.51  ? 338  VAL A CA    1 
ATOM   513  C  C     . VAL B 2 42  ? 2.672   23.240 -0.641  1.00 19.84  ? 338  VAL A C     1 
ATOM   514  O  O     . VAL B 2 42  ? 2.372   24.127 0.167   1.00 19.33  ? 338  VAL A O     1 
ATOM   515  C  CB    . VAL B 2 42  ? 4.037   21.547 0.661   1.00 21.75  ? 338  VAL A CB    1 
ATOM   516  C  CG1   . VAL B 2 42  ? 2.744   20.728 0.748   1.00 18.46  ? 338  VAL A CG1   1 
ATOM   517  C  CG2   . VAL B 2 42  ? 5.262   20.631 0.527   1.00 21.53  ? 338  VAL A CG2   1 
ATOM   518  N  N     . ASN B 2 43  ? 1.899   22.903 -1.664  1.00 22.61  ? 339  ASN A N     1 
ATOM   519  C  CA    . ASN B 2 43  ? 0.593   23.518 -1.827  1.00 22.49  ? 339  ASN A CA    1 
ATOM   520  C  C     . ASN B 2 43  ? -0.327  22.473 -2.442  1.00 26.80  ? 339  ASN A C     1 
ATOM   521  O  O     . ASN B 2 43  ? 0.049   21.309 -2.586  1.00 24.32  ? 339  ASN A O     1 
ATOM   522  C  CB    . ASN B 2 43  ? 0.692   24.817 -2.649  1.00 24.52  ? 339  ASN A CB    1 
ATOM   523  C  CG    . ASN B 2 43  ? 1.278   24.605 -4.049  1.00 28.68  ? 339  ASN A CG    1 
ATOM   524  O  OD1   . ASN B 2 43  ? 1.010   23.609 -4.711  1.00 27.26  ? 339  ASN A OD1   1 
ATOM   525  N  ND2   . ASN B 2 43  ? 2.074   25.561 -4.501  1.00 26.55  ? 339  ASN A ND2   1 
ATOM   526  N  N     . GLU B 2 44  ? -1.535  22.897 -2.817  1.00 27.18  ? 340  GLU A N     1 
ATOM   527  C  CA    . GLU B 2 44  ? -2.514  21.967 -3.363  1.00 33.24  ? 340  GLU A CA    1 
ATOM   528  C  C     . GLU B 2 44  ? -2.045  21.314 -4.658  1.00 32.60  ? 340  GLU A C     1 
ATOM   529  O  O     . GLU B 2 44  ? -2.600  20.287 -5.055  1.00 39.85  ? 340  GLU A O     1 
ATOM   530  C  CB    . GLU B 2 44  ? -3.833  22.697 -3.608  1.00 42.48  ? 340  GLU A CB    1 
ATOM   531  C  CG    . GLU B 2 44  ? -3.708  23.831 -4.614  1.00 58.55  ? 340  GLU A CG    1 
ATOM   532  C  CD    . GLU B 2 44  ? -4.992  24.084 -5.376  1.00 75.72  ? 340  GLU A CD    1 
ATOM   533  O  OE1   . GLU B 2 44  ? -5.195  23.444 -6.430  1.00 82.74  ? 340  GLU A OE1   1 
ATOM   534  O  OE2   . GLU B 2 44  ? -5.796  24.928 -4.927  1.00 81.21  ? 340  GLU A OE2   1 
ATOM   535  N  N     . HIS B 2 45  ? -1.058  21.888 -5.345  1.00 34.95  ? 341  HIS A N     1 
ATOM   536  C  CA    . HIS B 2 45  ? -0.621  21.322 -6.617  1.00 34.25  ? 341  HIS A CA    1 
ATOM   537  C  C     . HIS B 2 45  ? 0.569   20.398 -6.480  1.00 35.64  ? 341  HIS A C     1 
ATOM   538  O  O     . HIS B 2 45  ? 0.925   19.736 -7.455  1.00 39.45  ? 341  HIS A O     1 
ATOM   539  C  CB    . HIS B 2 45  ? -0.276  22.426 -7.616  1.00 33.40  ? 341  HIS A CB    1 
ATOM   540  C  CG    . HIS B 2 45  ? -1.394  23.386 -7.850  1.00 47.91  ? 341  HIS A CG    1 
ATOM   541  N  ND1   . HIS B 2 45  ? -1.286  24.734 -7.576  1.00 50.57  ? 341  HIS A ND1   1 
ATOM   542  C  CD2   . HIS B 2 45  ? -2.649  23.194 -8.318  1.00 51.56  ? 341  HIS A CD2   1 
ATOM   543  C  CE1   . HIS B 2 45  ? -2.425  25.333 -7.874  1.00 54.06  ? 341  HIS A CE1   1 
ATOM   544  N  NE2   . HIS B 2 45  ? -3.267  24.422 -8.329  1.00 55.42  ? 341  HIS A NE2   1 
ATOM   545  N  N     . GLY B 2 46  ? 1.196   20.338 -5.319  1.00 33.12  ? 342  GLY A N     1 
ATOM   546  C  CA    . GLY B 2 46  ? 2.238   19.367 -5.112  1.00 29.04  ? 342  GLY A CA    1 
ATOM   547  C  C     . GLY B 2 46  ? 3.286   19.881 -4.154  1.00 30.06  ? 342  GLY A C     1 
ATOM   548  O  O     . GLY B 2 46  ? 3.034   20.763 -3.331  1.00 23.87  ? 342  GLY A O     1 
ATOM   549  N  N     . ARG B 2 47  ? 4.463   19.279 -4.271  1.00 25.84  ? 343  ARG A N     1 
ATOM   550  C  CA    . ARG B 2 47  ? 5.567   19.523 -3.358  1.00 29.97  ? 343  ARG A CA    1 
ATOM   551  C  C     . ARG B 2 47  ? 6.788   19.857 -4.189  1.00 25.49  ? 343  ARG A C     1 
ATOM   552  O  O     . ARG B 2 47  ? 7.143   19.104 -5.099  1.00 24.99  ? 343  ARG A O     1 
ATOM   553  C  CB    . ARG B 2 47  ? 5.832   18.300 -2.473  1.00 28.42  ? 343  ARG A CB    1 
ATOM   554  C  CG    . ARG B 2 47  ? 4.582   17.728 -1.857  1.00 31.31  ? 343  ARG A CG    1 
ATOM   555  C  CD    . ARG B 2 47  ? 4.905   16.771 -0.759  1.00 36.00  ? 343  ARG A CD    1 
ATOM   556  N  NE    . ARG B 2 47  ? 3.702   16.086 -0.310  1.00 35.36  ? 343  ARG A NE    1 
ATOM   557  C  CZ    . ARG B 2 47  ? 3.256   14.945 -0.814  1.00 36.31  ? 343  ARG A CZ    1 
ATOM   558  N  NH1   . ARG B 2 47  ? 3.917   14.342 -1.791  1.00 41.66  ? 343  ARG A NH1   1 
ATOM   559  N  NH2   . ARG B 2 47  ? 2.148   14.405 -0.331  1.00 46.08  ? 343  ARG A NH2   1 
ATOM   560  N  N     . PHE B 2 48  ? 7.438   20.968 -3.869  1.00 24.39  ? 344  PHE A N     1 
ATOM   561  C  CA    . PHE B 2 48  ? 8.468   21.516 -4.739  1.00 23.16  ? 344  PHE A CA    1 
ATOM   562  C  C     . PHE B 2 48  ? 9.701   21.869 -3.932  1.00 24.73  ? 344  PHE A C     1 
ATOM   563  O  O     . PHE B 2 48  ? 9.602   22.447 -2.847  1.00 23.65  ? 344  PHE A O     1 
ATOM   564  C  CB    . PHE B 2 48  ? 7.958   22.754 -5.448  1.00 23.52  ? 344  PHE A CB    1 
ATOM   565  C  CG    . PHE B 2 48  ? 6.693   22.529 -6.199  1.00 31.04  ? 344  PHE A CG    1 
ATOM   566  C  CD1   . PHE B 2 48  ? 5.472   22.865 -5.639  1.00 24.01  ? 344  PHE A CD1   1 
ATOM   567  C  CD2   . PHE B 2 48  ? 6.723   21.981 -7.469  1.00 31.04  ? 344  PHE A CD2   1 
ATOM   568  C  CE1   . PHE B 2 48  ? 4.296   22.663 -6.348  1.00 28.95  ? 344  PHE A CE1   1 
ATOM   569  C  CE2   . PHE B 2 48  ? 5.554   21.773 -8.188  1.00 33.39  ? 344  PHE A CE2   1 
ATOM   570  C  CZ    . PHE B 2 48  ? 4.337   22.105 -7.627  1.00 30.15  ? 344  PHE A CZ    1 
ATOM   571  N  N     . PHE B 2 49  ? 10.864  21.546 -4.467  1.00 24.13  ? 345  PHE A N     1 
ATOM   572  C  CA    . PHE B 2 49  ? 12.103  22.017 -3.883  1.00 26.96  ? 345  PHE A CA    1 
ATOM   573  C  C     . PHE B 2 49  ? 12.779  22.913 -4.904  1.00 25.90  ? 345  PHE A C     1 
ATOM   574  O  O     . PHE B 2 49  ? 12.918  22.536 -6.075  1.00 27.50  ? 345  PHE A O     1 
ATOM   575  C  CB    . PHE B 2 49  ? 13.022  20.865 -3.483  1.00 29.39  ? 345  PHE A CB    1 
ATOM   576  C  CG    . PHE B 2 49  ? 14.408  21.306 -3.155  1.00 28.43  ? 345  PHE A CG    1 
ATOM   577  C  CD1   . PHE B 2 49  ? 15.379  21.364 -4.146  1.00 25.42  ? 345  PHE A CD1   1 
ATOM   578  C  CD2   . PHE B 2 49  ? 14.746  21.681 -1.854  1.00 25.28  ? 345  PHE A CD2   1 
ATOM   579  C  CE1   . PHE B 2 49  ? 16.661  21.798 -3.854  1.00 31.46  ? 345  PHE A CE1   1 
ATOM   580  C  CE2   . PHE B 2 49  ? 16.032  22.093 -1.551  1.00 23.17  ? 345  PHE A CE2   1 
ATOM   581  C  CZ    . PHE B 2 49  ? 16.992  22.154 -2.557  1.00 27.28  ? 345  PHE A CZ    1 
ATOM   582  N  N     . LEU B 2 50  ? 13.189  24.089 -4.460  1.00 25.64  ? 346  LEU A N     1 
ATOM   583  C  CA    . LEU B 2 50  ? 13.844  25.068 -5.311  1.00 27.66  ? 346  LEU A CA    1 
ATOM   584  C  C     . LEU B 2 50  ? 15.228  25.372 -4.766  1.00 25.93  ? 346  LEU A C     1 
ATOM   585  O  O     . LEU B 2 50  ? 15.408  25.541 -3.557  1.00 31.18  ? 346  LEU A O     1 
ATOM   586  C  CB    . LEU B 2 50  ? 13.026  26.352 -5.388  1.00 26.34  ? 346  LEU A CB    1 
ATOM   587  C  CG    . LEU B 2 50  ? 11.693  26.175 -6.110  1.00 32.41  ? 346  LEU A CG    1 
ATOM   588  C  CD1   . LEU B 2 50  ? 10.696  27.207 -5.649  1.00 37.40  ? 346  LEU A CD1   1 
ATOM   589  C  CD2   . LEU B 2 50  ? 11.909  26.283 -7.604  1.00 42.91  ? 346  LEU A CD2   1 
ATOM   590  N  N     . ARG B 2 51  ? 16.210  25.407 -5.650  1.00 28.60  ? 347  ARG A N     1 
ATOM   591  C  CA    . ARG B 2 51  ? 17.483  25.968 -5.263  1.00 28.21  ? 347  ARG A CA    1 
ATOM   592  C  C     . ARG B 2 51  ? 17.322  27.475 -5.076  1.00 30.55  ? 347  ARG A C     1 
ATOM   593  O  O     . ARG B 2 51  ? 16.640  28.132 -5.869  1.00 30.06  ? 347  ARG A O     1 
ATOM   594  C  CB    . ARG B 2 51  ? 18.546  25.668 -6.311  1.00 29.43  ? 347  ARG A CB    1 
ATOM   595  C  CG    . ARG B 2 51  ? 19.028  24.226 -6.277  1.00 34.33  ? 347  ARG A CG    1 
ATOM   596  C  CD    . ARG B 2 51  ? 19.713  23.854 -7.591  1.00 42.77  ? 347  ARG A CD    1 
ATOM   597  N  NE    . ARG B 2 51  ? 19.762  22.408 -7.794  1.00 49.84  ? 347  ARG A NE    1 
ATOM   598  C  CZ    . ARG B 2 51  ? 19.039  21.750 -8.696  1.00 64.20  ? 347  ARG A CZ    1 
ATOM   599  N  NH1   . ARG B 2 51  ? 18.197  22.404 -9.486  1.00 64.76  ? 347  ARG A NH1   1 
ATOM   600  N  NH2   . ARG B 2 51  ? 19.159  20.433 -8.808  1.00 69.88  ? 347  ARG A NH2   1 
ATOM   601  N  N     . PRO B 2 52  ? 17.918  28.044 -4.032  1.00 33.42  ? 348  PRO A N     1 
ATOM   602  C  CA    . PRO B 2 52  ? 17.657  29.463 -3.724  1.00 36.23  ? 348  PRO A CA    1 
ATOM   603  C  C     . PRO B 2 52  ? 18.160  30.419 -4.788  1.00 36.44  ? 348  PRO A C     1 
ATOM   604  O  O     . PRO B 2 52  ? 17.513  31.437 -5.059  1.00 38.87  ? 348  PRO A O     1 
ATOM   605  C  CB    . PRO B 2 52  ? 18.387  29.665 -2.387  1.00 40.66  ? 348  PRO A CB    1 
ATOM   606  C  CG    . PRO B 2 52  ? 19.434  28.576 -2.363  1.00 43.22  ? 348  PRO A CG    1 
ATOM   607  C  CD    . PRO B 2 52  ? 18.770  27.398 -3.020  1.00 38.25  ? 348  PRO A CD    1 
ATOM   608  N  N     . GLU B 2 53  ? 19.310  30.129 -5.393  1.00 36.94  ? 349  GLU A N     1 
ATOM   609  C  CA    . GLU B 2 53  ? 19.836  31.002 -6.438  1.00 52.62  ? 349  GLU A CA    1 
ATOM   610  C  C     . GLU B 2 53  ? 18.855  31.122 -7.593  1.00 49.40  ? 349  GLU A C     1 
ATOM   611  O  O     . GLU B 2 53  ? 18.685  32.203 -8.165  1.00 51.04  ? 349  GLU A O     1 
ATOM   612  C  CB    . GLU B 2 53  ? 21.190  30.479 -6.922  1.00 64.83  ? 349  GLU A CB    1 
ATOM   613  C  CG    . GLU B 2 53  ? 22.095  29.947 -5.802  1.00 76.33  ? 349  GLU A CG    1 
ATOM   614  C  CD    . GLU B 2 53  ? 21.732  28.536 -5.332  1.00 82.65  ? 349  GLU A CD    1 
ATOM   615  O  OE1   . GLU B 2 53  ? 22.635  27.812 -4.865  1.00 86.38  ? 349  GLU A OE1   1 
ATOM   616  O  OE2   . GLU B 2 53  ? 20.549  28.151 -5.430  1.00 81.05  ? 349  GLU A OE2   1 
ATOM   617  N  N     . THR B 2 54  ? 18.180  30.030 -7.927  1.00 48.48  ? 350  THR A N     1 
ATOM   618  C  CA    . THR B 2 54  ? 17.117  30.068 -8.918  1.00 49.66  ? 350  THR A CA    1 
ATOM   619  C  C     . THR B 2 54  ? 15.934  30.873 -8.404  1.00 39.51  ? 350  THR A C     1 
ATOM   620  O  O     . THR B 2 54  ? 15.630  31.954 -8.920  1.00 38.89  ? 350  THR A O     1 
ATOM   621  C  CB    . THR B 2 54  ? 16.663  28.652 -9.257  1.00 52.43  ? 350  THR A CB    1 
ATOM   622  O  OG1   . THR B 2 54  ? 17.766  27.914 -9.792  1.00 58.06  ? 350  THR A OG1   1 
ATOM   623  C  CG2   . THR B 2 54  ? 15.517  28.686 -10.255 1.00 53.55  ? 350  THR A CG2   1 
ATOM   624  N  N     . ALA B 2 55  ? 15.277  30.346 -7.371  1.00 32.22  ? 351  ALA A N     1 
ATOM   625  C  CA    . ALA B 2 55  ? 14.017  30.917 -6.912  1.00 29.75  ? 351  ALA A CA    1 
ATOM   626  C  C     . ALA B 2 55  ? 14.154  32.398 -6.583  1.00 29.39  ? 351  ALA A C     1 
ATOM   627  O  O     . ALA B 2 55  ? 13.285  33.200 -6.938  1.00 33.74  ? 351  ALA A O     1 
ATOM   628  C  CB    . ALA B 2 55  ? 13.515  30.147 -5.697  1.00 32.09  ? 351  ALA A CB    1 
ATOM   629  N  N     . LEU B 2 56  ? 15.243  32.782 -5.921  1.00 24.67  ? 352  LEU A N     1 
ATOM   630  C  CA    . LEU B 2 56  ? 15.373  34.152 -5.434  1.00 33.97  ? 352  LEU A CA    1 
ATOM   631  C  C     . LEU B 2 56  ? 15.803  35.127 -6.520  1.00 37.33  ? 352  LEU A C     1 
ATOM   632  O  O     . LEU B 2 56  ? 15.770  36.340 -6.291  1.00 39.76  ? 352  LEU A O     1 
ATOM   633  C  CB    . LEU B 2 56  ? 16.355  34.207 -4.263  1.00 29.31  ? 352  LEU A CB    1 
ATOM   634  C  CG    . LEU B 2 56  ? 15.867  33.448 -3.028  1.00 35.50  ? 352  LEU A CG    1 
ATOM   635  C  CD1   . LEU B 2 56  ? 16.744  33.740 -1.811  1.00 38.41  ? 352  LEU A CD1   1 
ATOM   636  C  CD2   . LEU B 2 56  ? 14.412  33.804 -2.733  1.00 31.64  ? 352  LEU A CD2   1 
ATOM   637  N  N     . ALA B 2 57  ? 16.198  34.635 -7.687  1.00 31.49  ? 353  ALA A N     1 
ATOM   638  C  CA    . ALA B 2 57  ? 16.378  35.490 -8.854  1.00 35.53  ? 353  ALA A CA    1 
ATOM   639  C  C     . ALA B 2 57  ? 15.149  35.521 -9.753  1.00 41.90  ? 353  ALA A C     1 
ATOM   640  O  O     . ALA B 2 57  ? 15.126  36.288 -10.720 1.00 50.03  ? 353  ALA A O     1 
ATOM   641  C  CB    . ALA B 2 57  ? 17.589  35.025 -9.673  1.00 35.39  ? 353  ALA A CB    1 
ATOM   642  N  N     . ASP B 2 58  ? 14.139  34.706 -9.463  1.00 41.25  ? 354  ASP A N     1 
ATOM   643  C  CA    . ASP B 2 58  ? 12.942  34.649 -10.293 1.00 39.58  ? 354  ASP A CA    1 
ATOM   644  C  C     . ASP B 2 58  ? 11.967  35.739 -9.874  1.00 40.06  ? 354  ASP A C     1 
ATOM   645  O  O     . ASP B 2 58  ? 11.460  35.699 -8.747  1.00 36.59  ? 354  ASP A O     1 
ATOM   646  C  CB    . ASP B 2 58  ? 12.266  33.290 -10.181 1.00 41.62  ? 354  ASP A CB    1 
ATOM   647  C  CG    . ASP B 2 58  ? 11.012  33.197 -11.043 1.00 54.23  ? 354  ASP A CG    1 
ATOM   648  O  OD1   . ASP B 2 58  ? 11.111  32.722 -12.197 1.00 61.24  ? 354  ASP A OD1   1 
ATOM   649  O  OD2   . ASP B 2 58  ? 9.931   33.620 -10.576 1.00 53.16  ? 354  ASP A OD2   1 
ATOM   650  N  N     . PRO B 2 59  ? 11.666  36.713 -10.739 1.00 47.72  ? 355  PRO A N     1 
ATOM   651  C  CA    . PRO B 2 59  ? 10.764  37.802 -10.324 1.00 31.26  ? 355  PRO A CA    1 
ATOM   652  C  C     . PRO B 2 59  ? 9.393   37.333 -9.868  1.00 34.67  ? 355  PRO A C     1 
ATOM   653  O  O     . PRO B 2 59  ? 8.844   37.918 -8.925  1.00 36.71  ? 355  PRO A O     1 
ATOM   654  C  CB    . PRO B 2 59  ? 10.670  38.685 -11.584 1.00 41.94  ? 355  PRO A CB    1 
ATOM   655  C  CG    . PRO B 2 59  ? 11.283  37.886 -12.691 1.00 42.87  ? 355  PRO A CG    1 
ATOM   656  C  CD    . PRO B 2 59  ? 12.269  36.964 -12.057 1.00 43.64  ? 355  PRO A CD    1 
ATOM   657  N  N     . GLN B 2 60  ? 8.817   36.301 -10.499 1.00 31.03  ? 356  GLN A N     1 
ATOM   658  C  CA    . GLN B 2 60  ? 7.516   35.810 -10.051 1.00 35.30  ? 356  GLN A CA    1 
ATOM   659  C  C     . GLN B 2 60  ? 7.607   35.226 -8.653  1.00 32.29  ? 356  GLN A C     1 
ATOM   660  O  O     . GLN B 2 60  ? 6.724   35.456 -7.822  1.00 29.62  ? 356  GLN A O     1 
ATOM   661  C  CB    . GLN B 2 60  ? 6.964   34.756 -11.005 1.00 40.16  ? 356  GLN A CB    1 
ATOM   662  C  CG    . GLN B 2 60  ? 6.348   35.335 -12.254 1.00 53.59  ? 356  GLN A CG    1 
ATOM   663  C  CD    . GLN B 2 60  ? 7.406   35.818 -13.204 1.00 67.48  ? 356  GLN A CD    1 
ATOM   664  O  OE1   . GLN B 2 60  ? 8.407   35.132 -13.432 1.00 72.51  ? 356  GLN A OE1   1 
ATOM   665  N  NE2   . GLN B 2 60  ? 7.215   37.014 -13.747 1.00 73.24  ? 356  GLN A NE2   1 
ATOM   666  N  N     . PHE B 2 61  ? 8.657   34.453 -8.384  1.00 26.98  ? 357  PHE A N     1 
ATOM   667  C  CA    . PHE B 2 61  ? 8.812   33.886 -7.057  1.00 26.50  ? 357  PHE A CA    1 
ATOM   668  C  C     . PHE B 2 61  ? 8.936   34.987 -6.017  1.00 27.32  ? 357  PHE A C     1 
ATOM   669  O  O     . PHE B 2 61  ? 8.243   34.975 -4.999  1.00 22.36  ? 357  PHE A O     1 
ATOM   670  C  CB    . PHE B 2 61  ? 10.025  32.969 -6.989  1.00 24.46  ? 357  PHE A CB    1 
ATOM   671  C  CG    . PHE B 2 61  ? 10.047  32.147 -5.747  1.00 32.03  ? 357  PHE A CG    1 
ATOM   672  C  CD1   . PHE B 2 61  ? 10.819  32.522 -4.657  1.00 29.91  ? 357  PHE A CD1   1 
ATOM   673  C  CD2   . PHE B 2 61  ? 9.236   31.033 -5.642  1.00 36.01  ? 357  PHE A CD2   1 
ATOM   674  C  CE1   . PHE B 2 61  ? 10.805  31.767 -3.482  1.00 29.42  ? 357  PHE A CE1   1 
ATOM   675  C  CE2   . PHE B 2 61  ? 9.218   30.271 -4.481  1.00 36.31  ? 357  PHE A CE2   1 
ATOM   676  C  CZ    . PHE B 2 61  ? 10.006  30.640 -3.397  1.00 23.94  ? 357  PHE A CZ    1 
ATOM   677  N  N     . VAL B 2 62  ? 9.796   35.963 -6.279  1.00 29.21  ? 358  VAL A N     1 
ATOM   678  C  CA    . VAL B 2 62  ? 10.002  37.052 -5.335  1.00 29.49  ? 358  VAL A CA    1 
ATOM   679  C  C     . VAL B 2 62  ? 8.720   37.854 -5.150  1.00 27.42  ? 358  VAL A C     1 
ATOM   680  O  O     . VAL B 2 62  ? 8.370   38.239 -4.025  1.00 31.72  ? 358  VAL A O     1 
ATOM   681  C  CB    . VAL B 2 62  ? 11.175  37.927 -5.809  1.00 34.84  ? 358  VAL A CB    1 
ATOM   682  C  CG1   . VAL B 2 62  ? 11.141  39.284 -5.140  1.00 29.59  ? 358  VAL A CG1   1 
ATOM   683  C  CG2   . VAL B 2 62  ? 12.487  37.205 -5.527  1.00 33.19  ? 358  VAL A CG2   1 
ATOM   684  N  N     . ALA B 2 63  ? 8.000   38.122 -6.245  1.00 25.98  ? 359  ALA A N     1 
ATOM   685  C  CA    . ALA B 2 63  ? 6.709   38.793 -6.127  1.00 25.90  ? 359  ALA A CA    1 
ATOM   686  C  C     . ALA B 2 63  ? 5.740   37.968 -5.289  1.00 28.71  ? 359  ALA A C     1 
ATOM   687  O  O     . ALA B 2 63  ? 4.995   38.512 -4.463  1.00 25.71  ? 359  ALA A O     1 
ATOM   688  C  CB    . ALA B 2 63  ? 6.116   39.064 -7.513  1.00 28.25  ? 359  ALA A CB    1 
ATOM   689  N  N     . TRP B 2 64  ? 5.747   36.650 -5.476  1.00 27.96  ? 360  TRP A N     1 
ATOM   690  C  CA    . TRP B 2 64  ? 4.881   35.793 -4.675  1.00 28.00  ? 360  TRP A CA    1 
ATOM   691  C  C     . TRP B 2 64  ? 5.237   35.880 -3.189  1.00 29.17  ? 360  TRP A C     1 
ATOM   692  O  O     . TRP B 2 64  ? 4.354   36.031 -2.335  1.00 20.47  ? 360  TRP A O     1 
ATOM   693  C  CB    . TRP B 2 64  ? 4.982   34.366 -5.201  1.00 29.23  ? 360  TRP A CB    1 
ATOM   694  C  CG    . TRP B 2 64  ? 4.199   33.382 -4.419  1.00 30.48  ? 360  TRP A CG    1 
ATOM   695  C  CD1   . TRP B 2 64  ? 2.866   33.112 -4.535  1.00 25.40  ? 360  TRP A CD1   1 
ATOM   696  C  CD2   . TRP B 2 64  ? 4.703   32.517 -3.398  1.00 25.90  ? 360  TRP A CD2   1 
ATOM   697  N  NE1   . TRP B 2 64  ? 2.508   32.125 -3.641  1.00 21.57  ? 360  TRP A NE1   1 
ATOM   698  C  CE2   . TRP B 2 64  ? 3.622   31.747 -2.932  1.00 27.23  ? 360  TRP A CE2   1 
ATOM   699  C  CE3   . TRP B 2 64  ? 5.969   32.319 -2.834  1.00 19.44  ? 360  TRP A CE3   1 
ATOM   700  C  CZ2   . TRP B 2 64  ? 3.766   30.795 -1.927  1.00 22.20  ? 360  TRP A CZ2   1 
ATOM   701  C  CZ3   . TRP B 2 64  ? 6.111   31.369 -1.837  1.00 20.18  ? 360  TRP A CZ3   1 
ATOM   702  C  CH2   . TRP B 2 64  ? 5.017   30.617 -1.395  1.00 26.55  ? 360  TRP A CH2   1 
ATOM   703  N  N     . LEU B 2 65  ? 6.533   35.818 -2.870  1.00 20.34  ? 361  LEU A N     1 
ATOM   704  C  CA    . LEU B 2 65  ? 6.994   35.952 -1.490  1.00 21.40  ? 361  LEU A CA    1 
ATOM   705  C  C     . LEU B 2 65  ? 6.460   37.216 -0.840  1.00 27.88  ? 361  LEU A C     1 
ATOM   706  O  O     . LEU B 2 65  ? 6.105   37.211 0.344   1.00 23.68  ? 361  LEU A O     1 
ATOM   707  C  CB    . LEU B 2 65  ? 8.520   35.979 -1.456  1.00 21.13  ? 361  LEU A CB    1 
ATOM   708  C  CG    . LEU B 2 65  ? 9.266   34.654 -1.559  1.00 25.21  ? 361  LEU A CG    1 
ATOM   709  C  CD1   . LEU B 2 65  ? 10.777  34.939 -1.610  1.00 20.00  ? 361  LEU A CD1   1 
ATOM   710  C  CD2   . LEU B 2 65  ? 8.903   33.717 -0.379  1.00 16.66  ? 361  LEU A CD2   1 
ATOM   711  N  N     . GLY B 2 66  ? 6.423   38.320 -1.594  1.00 25.43  ? 362  GLY A N     1 
ATOM   712  C  CA    . GLY B 2 66  ? 6.050   39.606 -1.048  1.00 28.43  ? 362  GLY A CA    1 
ATOM   713  C  C     . GLY B 2 66  ? 4.592   39.956 -1.178  1.00 33.50  ? 362  GLY A C     1 
ATOM   714  O  O     . GLY B 2 66  ? 4.177   41.049 -0.779  1.00 27.59  ? 362  GLY A O     1 
ATOM   715  N  N     . ASP B 2 67  ? 3.792   39.064 -1.748  1.00 30.03  ? 363  ASP A N     1 
ATOM   716  C  CA    . ASP B 2 67  ? 2.373   39.319 -1.939  1.00 31.65  ? 363  ASP A CA    1 
ATOM   717  C  C     . ASP B 2 67  ? 1.645   38.912 -0.661  1.00 28.62  ? 363  ASP A C     1 
ATOM   718  O  O     . ASP B 2 67  ? 1.541   37.719 -0.345  1.00 27.64  ? 363  ASP A O     1 
ATOM   719  C  CB    . ASP B 2 67  ? 1.861   38.563 -3.161  1.00 32.21  ? 363  ASP A CB    1 
ATOM   720  C  CG    . ASP B 2 67  ? 0.446   38.942 -3.537  1.00 34.98  ? 363  ASP A CG    1 
ATOM   721  O  OD1   . ASP B 2 67  ? -0.299  39.439 -2.663  1.00 42.24  ? 363  ASP A OD1   1 
ATOM   722  O  OD2   . ASP B 2 67  ? 0.072   38.729 -4.713  1.00 42.50  ? 363  ASP A OD2   1 
ATOM   723  N  N     . GLU B 2 68  ? 1.137   39.909 0.070   1.00 29.85  ? 364  GLU A N     1 
ATOM   724  C  CA    . GLU B 2 68  ? 0.429   39.651 1.319   1.00 31.19  ? 364  GLU A CA    1 
ATOM   725  C  C     . GLU B 2 68  ? -0.808  38.789 1.117   1.00 27.95  ? 364  GLU A C     1 
ATOM   726  O  O     . GLU B 2 68  ? -1.286  38.176 2.073   1.00 30.40  ? 364  GLU A O     1 
ATOM   727  C  CB    . GLU B 2 68  ? 0.031   40.972 1.979   1.00 37.00  ? 364  GLU A CB    1 
ATOM   728  N  N     . THR B 2 69  ? -1.352  38.743 -0.090  1.00 32.56  ? 365  THR A N     1 
ATOM   729  C  CA    . THR B 2 69  ? -2.543  37.951 -0.331  1.00 37.44  ? 365  THR A CA    1 
ATOM   730  C  C     . THR B 2 69  ? -2.228  36.497 -0.635  1.00 38.89  ? 365  THR A C     1 
ATOM   731  O  O     . THR B 2 69  ? -3.148  35.676 -0.673  1.00 39.00  ? 365  THR A O     1 
ATOM   732  C  CB    . THR B 2 69  ? -3.354  38.549 -1.479  1.00 37.61  ? 365  THR A CB    1 
ATOM   733  O  OG1   . THR B 2 69  ? -2.680  38.303 -2.721  1.00 42.15  ? 365  THR A OG1   1 
ATOM   734  C  CG2   . THR B 2 69  ? -3.514  40.048 -1.273  1.00 42.65  ? 365  THR A CG2   1 
ATOM   735  N  N     . LYS B 2 70  ? -0.964  36.167 -0.871  1.00 34.06  ? 366  LYS A N     1 
ATOM   736  C  CA    . LYS B 2 70  ? -0.545  34.780 -1.038  1.00 28.04  ? 366  LYS A CA    1 
ATOM   737  C  C     . LYS B 2 70  ? -0.099  34.279 0.335   1.00 25.28  ? 366  LYS A C     1 
ATOM   738  O  O     . LYS B 2 70  ? 0.980   34.629 0.826   1.00 24.99  ? 366  LYS A O     1 
ATOM   739  C  CB    . LYS B 2 70  ? 0.537   34.672 -2.111  1.00 23.05  ? 366  LYS A CB    1 
ATOM   740  C  CG    . LYS B 2 70  ? 0.165   35.404 -3.401  1.00 30.44  ? 366  LYS A CG    1 
ATOM   741  C  CD    . LYS B 2 70  ? -1.073  34.786 -4.072  1.00 31.07  ? 366  LYS A CD    1 
ATOM   742  C  CE    . LYS B 2 70  ? -1.351  35.410 -5.450  1.00 35.71  ? 366  LYS A CE    1 
ATOM   743  N  NZ    . LYS B 2 70  ? -1.452  36.890 -5.355  1.00 49.30  ? 366  LYS A NZ    1 
ATOM   744  N  N     . LYS B 2 71  ? -0.947  33.462 0.963   1.00 22.05  ? 367  LYS A N     1 
ATOM   745  C  CA    . LYS B 2 71  ? -0.764  33.100 2.361   1.00 21.05  ? 367  LYS A CA    1 
ATOM   746  C  C     . LYS B 2 71  ? 0.221   31.950 2.504   1.00 22.85  ? 367  LYS A C     1 
ATOM   747  O  O     . LYS B 2 71  ? 0.097   30.928 1.831   1.00 22.52  ? 367  LYS A O     1 
ATOM   748  C  CB    . LYS B 2 71  ? -2.107  32.716 2.980   1.00 18.28  ? 367  LYS A CB    1 
ATOM   749  C  CG    . LYS B 2 71  ? -3.145  33.815 2.864   1.00 24.39  ? 367  LYS A CG    1 
ATOM   750  C  CD    . LYS B 2 71  ? -2.659  35.083 3.545   1.00 32.00  ? 367  LYS A CD    1 
ATOM   751  C  CE    . LYS B 2 71  ? -3.653  36.221 3.352   1.00 37.91  ? 367  LYS A CE    1 
ATOM   752  N  NZ    . LYS B 2 71  ? -3.331  37.378 4.232   1.00 43.77  ? 367  LYS A NZ    1 
ATOM   753  N  N     . LYS B 2 72  ? 1.184   32.102 3.399   1.00 20.10  ? 368  LYS A N     1 
ATOM   754  C  CA    . LYS B 2 72  ? 2.181   31.075 3.629   1.00 17.01  ? 368  LYS A CA    1 
ATOM   755  C  C     . LYS B 2 72  ? 2.097   30.579 5.063   1.00 24.42  ? 368  LYS A C     1 
ATOM   756  O  O     . LYS B 2 72  ? 1.849   31.349 6.001   1.00 26.22  ? 368  LYS A O     1 
ATOM   757  C  CB    . LYS B 2 72  ? 3.600   31.578 3.341   1.00 18.91  ? 368  LYS A CB    1 
ATOM   758  C  CG    . LYS B 2 72  ? 3.824   32.050 1.912   1.00 22.32  ? 368  LYS A CG    1 
ATOM   759  C  CD    . LYS B 2 72  ? 3.937   33.556 1.858   1.00 23.73  ? 368  LYS A CD    1 
ATOM   760  C  CE    . LYS B 2 72  ? 4.052   34.071 0.424   1.00 26.68  ? 368  LYS A CE    1 
ATOM   761  N  NZ    . LYS B 2 72  ? 3.488   35.449 0.330   1.00 21.19  ? 368  LYS A NZ    1 
ATOM   762  N  N     . SER B 2 73  ? 2.302   29.282 5.217   1.00 17.13  ? 369  SER A N     1 
ATOM   763  C  CA    . SER B 2 73  ? 2.464   28.660 6.513   1.00 12.40  ? 369  SER A CA    1 
ATOM   764  C  C     . SER B 2 73  ? 3.929   28.298 6.672   1.00 13.96  ? 369  SER A C     1 
ATOM   765  O  O     . SER B 2 73  ? 4.535   27.759 5.745   1.00 18.20  ? 369  SER A O     1 
ATOM   766  C  CB    . SER B 2 73  ? 1.572   27.426 6.617   1.00 15.11  ? 369  SER A CB    1 
ATOM   767  O  OG    . SER B 2 73  ? 0.224   27.835 6.551   1.00 23.03  ? 369  SER A OG    1 
ATOM   768  N  N     . MET B 2 74  ? 4.511   28.618 7.828   1.00 11.65  ? 370  MET A N     1 
ATOM   769  C  CA    . MET B 2 74  ? 5.940   28.418 8.000   1.00 14.68  ? 370  MET A CA    1 
ATOM   770  C  C     . MET B 2 74  ? 6.212   27.978 9.423   1.00 11.48  ? 370  MET A C     1 
ATOM   771  O  O     . MET B 2 74  ? 5.307   27.923 10.260  1.00 20.22  ? 370  MET A O     1 
ATOM   772  C  CB    . MET B 2 74  ? 6.745   29.697 7.689   1.00 10.75  ? 370  MET A CB    1 
ATOM   773  C  CG    . MET B 2 74  ? 6.509   30.248 6.276   1.00 14.75  ? 370  MET A CG    1 
ATOM   774  S  SD    . MET B 2 74  ? 7.540   31.698 5.978   1.00 22.07  ? 370  MET A SD    1 
ATOM   775  C  CE    . MET B 2 74  ? 9.095   30.907 5.660   1.00 19.38  ? 370  MET A CE    1 
ATOM   776  N  N     . PHE B 2 75  ? 7.482   27.657 9.674   1.00 15.10  ? 371  PHE A N     1 
ATOM   777  C  CA    . PHE B 2 75  ? 8.025   27.476 11.020  1.00 13.94  ? 371  PHE A CA    1 
ATOM   778  C  C     . PHE B 2 75  ? 9.172   28.466 11.202  1.00 17.90  ? 371  PHE A C     1 
ATOM   779  O  O     . PHE B 2 75  ? 10.163  28.415 10.467  1.00 22.64  ? 371  PHE A O     1 
ATOM   780  C  CB    . PHE B 2 75  ? 8.503   26.034 11.208  1.00 10.13  ? 371  PHE A CB    1 
ATOM   781  C  CG    . PHE B 2 75  ? 9.091   25.747 12.555  1.00 16.48  ? 371  PHE A CG    1 
ATOM   782  C  CD1   . PHE B 2 75  ? 8.335   25.097 13.529  1.00 15.82  ? 371  PHE A CD1   1 
ATOM   783  C  CD2   . PHE B 2 75  ? 10.408  26.093 12.845  1.00 15.85  ? 371  PHE A CD2   1 
ATOM   784  C  CE1   . PHE B 2 75  ? 8.876   24.813 14.788  1.00 16.00  ? 371  PHE A CE1   1 
ATOM   785  C  CE2   . PHE B 2 75  ? 10.956  25.797 14.091  1.00 17.15  ? 371  PHE A CE2   1 
ATOM   786  C  CZ    . PHE B 2 75  ? 10.174  25.169 15.064  1.00 13.30  ? 371  PHE A CZ    1 
ATOM   787  N  N     . ASP B 2 76  ? 9.045   29.352 12.184  1.00 21.58  ? 372  ASP A N     1 
ATOM   788  C  CA    . ASP B 2 76  ? 10.080  30.350 12.493  1.00 18.18  ? 372  ASP A CA    1 
ATOM   789  C  C     . ASP B 2 76  ? 10.262  31.302 11.316  1.00 12.22  ? 372  ASP A C     1 
ATOM   790  O  O     . ASP B 2 76  ? 11.327  31.392 10.694  1.00 19.03  ? 372  ASP A O     1 
ATOM   791  C  CB    . ASP B 2 76  ? 11.423  29.714 12.871  1.00 25.43  ? 372  ASP A CB    1 
ATOM   792  C  CG    . ASP B 2 76  ? 12.382  30.728 13.535  1.00 40.27  ? 372  ASP A CG    1 
ATOM   793  O  OD1   . ASP B 2 76  ? 13.525  30.352 13.880  1.00 41.49  ? 372  ASP A OD1   1 
ATOM   794  O  OD2   . ASP B 2 76  ? 11.985  31.906 13.711  1.00 35.95  ? 372  ASP A OD2   1 
ATOM   795  N  N     . SER B 2 77  ? 9.173   31.975 10.991  1.00 14.84  ? 373  SER A N     1 
ATOM   796  C  CA    . SER B 2 77  ? 9.171   32.826 9.812   1.00 14.31  ? 373  SER A CA    1 
ATOM   797  C  C     . SER B 2 77  ? 10.067  34.045 9.992   1.00 22.19  ? 373  SER A C     1 
ATOM   798  O  O     . SER B 2 77  ? 10.534  34.606 8.997   1.00 24.46  ? 373  SER A O     1 
ATOM   799  C  CB    . SER B 2 77  ? 7.738   33.228 9.489   1.00 17.49  ? 373  SER A CB    1 
ATOM   800  O  OG    . SER B 2 77  ? 7.208   34.069 10.506  1.00 24.59  ? 373  SER A OG    1 
ATOM   801  N  N     . LYS B 2 78  ? 10.368  34.436 11.235  1.00 21.07  ? 374  LYS A N     1 
ATOM   802  C  CA    . LYS B 2 78  ? 11.284  35.556 11.422  1.00 20.65  ? 374  LYS A CA    1 
ATOM   803  C  C     . LYS B 2 78  ? 12.673  35.226 10.880  1.00 14.27  ? 374  LYS A C     1 
ATOM   804  O  O     . LYS B 2 78  ? 13.326  36.079 10.279  1.00 11.32  ? 374  LYS A O     1 
ATOM   805  C  CB    . LYS B 2 78  ? 11.355  35.948 12.902  1.00 20.67  ? 374  LYS A CB    1 
ATOM   806  C  CG    . LYS B 2 78  ? 12.381  37.039 13.215  1.00 14.02  ? 374  LYS A CG    1 
ATOM   807  C  CD    . LYS B 2 78  ? 12.009  37.809 14.506  1.00 13.17  ? 374  LYS A CD    1 
ATOM   808  C  CE    . LYS B 2 78  ? 12.172  36.943 15.768  1.00 11.30  ? 374  LYS A CE    1 
ATOM   809  N  NZ    . LYS B 2 78  ? 13.606  36.535 16.023  1.00 14.73  ? 374  LYS A NZ    1 
ATOM   810  N  N     . ARG B 2 79  ? 13.153  34.006 11.115  1.00 15.81  ? 375  ARG A N     1 
ATOM   811  C  CA    . ARG B 2 79  ? 14.444  33.583 10.573  1.00 17.83  ? 375  ARG A CA    1 
ATOM   812  C  C     . ARG B 2 79  ? 14.468  33.742 9.061   1.00 18.36  ? 375  ARG A C     1 
ATOM   813  O  O     . ARG B 2 79  ? 15.419  34.288 8.491   1.00 21.25  ? 375  ARG A O     1 
ATOM   814  C  CB    . ARG B 2 79  ? 14.711  32.121 10.978  1.00 21.72  ? 375  ARG A CB    1 
ATOM   815  C  CG    . ARG B 2 79  ? 15.744  31.341 10.155  1.00 14.44  ? 375  ARG A CG    1 
ATOM   816  C  CD    . ARG B 2 79  ? 16.035  29.933 10.827  1.00 17.91  ? 375  ARG A CD    1 
ATOM   817  N  NE    . ARG B 2 79  ? 16.538  30.128 12.187  1.00 20.24  ? 375  ARG A NE    1 
ATOM   818  C  CZ    . ARG B 2 79  ? 17.830  30.129 12.497  1.00 16.69  ? 375  ARG A CZ    1 
ATOM   819  N  NH1   . ARG B 2 79  ? 18.734  29.892 11.556  1.00 18.68  ? 375  ARG A NH1   1 
ATOM   820  N  NH2   . ARG B 2 79  ? 18.222  30.357 13.738  1.00 25.56  ? 375  ARG A NH2   1 
ATOM   821  N  N     . ALA B 2 80  ? 13.410  33.288 8.395   1.00 15.84  ? 376  ALA A N     1 
ATOM   822  C  CA    . ALA B 2 80  ? 13.334  33.431 6.954   1.00 19.44  ? 376  ALA A CA    1 
ATOM   823  C  C     . ALA B 2 80  ? 13.204  34.894 6.561   1.00 18.58  ? 376  ALA A C     1 
ATOM   824  O  O     . ALA B 2 80  ? 13.940  35.378 5.698   1.00 19.95  ? 376  ALA A O     1 
ATOM   825  C  CB    . ALA B 2 80  ? 12.159  32.621 6.415   1.00 16.97  ? 376  ALA A CB    1 
ATOM   826  N  N     . ALA B 2 81  ? 12.266  35.611 7.190   1.00 12.80  ? 377  ALA A N     1 
ATOM   827  C  CA    . ALA B 2 81  ? 12.048  37.024 6.889   1.00 19.39  ? 377  ALA A CA    1 
ATOM   828  C  C     . ALA B 2 81  ? 13.339  37.827 6.990   1.00 13.08  ? 377  ALA A C     1 
ATOM   829  O  O     . ALA B 2 81  ? 13.655  38.642 6.113   1.00 16.46  ? 377  ALA A O     1 
ATOM   830  C  CB    . ALA B 2 81  ? 10.984  37.593 7.831   1.00 15.33  ? 377  ALA A CB    1 
ATOM   831  N  N     . VAL B 2 82  ? 14.118  37.597 8.043   1.00 13.45  ? 378  VAL A N     1 
ATOM   832  C  CA    . VAL B 2 82  ? 15.325  38.394 8.222   1.00 13.38  ? 378  VAL A CA    1 
ATOM   833  C  C     . VAL B 2 82  ? 16.387  37.988 7.203   1.00 14.01  ? 378  VAL A C     1 
ATOM   834  O  O     . VAL B 2 82  ? 17.019  38.843 6.574   1.00 16.14  ? 378  VAL A O     1 
ATOM   835  C  CB    . VAL B 2 82  ? 15.851  38.271 9.660   1.00 13.18  ? 378  VAL A CB    1 
ATOM   836  C  CG1   . VAL B 2 82  ? 17.261  38.841 9.743   1.00 13.90  ? 378  VAL A CG1   1 
ATOM   837  C  CG2   . VAL B 2 82  ? 14.939  38.996 10.633  1.00 13.29  ? 378  VAL A CG2   1 
ATOM   838  N  N     . ALA B 2 83  ? 16.613  36.681 7.035   1.00 13.70  ? 379  ALA A N     1 
ATOM   839  C  CA    . ALA B 2 83  ? 17.553  36.231 6.002   1.00 17.29  ? 379  ALA A CA    1 
ATOM   840  C  C     . ALA B 2 83  ? 17.206  36.831 4.642   1.00 17.28  ? 379  ALA A C     1 
ATOM   841  O  O     . ALA B 2 83  ? 18.089  37.276 3.897   1.00 18.35  ? 379  ALA A O     1 
ATOM   842  C  CB    . ALA B 2 83  ? 17.556  34.701 5.929   1.00 16.08  ? 379  ALA A CB    1 
ATOM   843  N  N     . LEU B 2 84  ? 15.916  36.887 4.318   1.00 15.08  ? 380  LEU A N     1 
ATOM   844  C  CA    . LEU B 2 84  ? 15.506  37.482 3.053   1.00 15.85  ? 380  LEU A CA    1 
ATOM   845  C  C     . LEU B 2 84  ? 15.707  38.997 3.038   1.00 17.42  ? 380  LEU A C     1 
ATOM   846  O  O     . LEU B 2 84  ? 16.063  39.564 1.998   1.00 21.36  ? 380  LEU A O     1 
ATOM   847  C  CB    . LEU B 2 84  ? 14.048  37.130 2.772   1.00 17.00  ? 380  LEU A CB    1 
ATOM   848  C  CG    . LEU B 2 84  ? 13.853  35.669 2.393   1.00 20.80  ? 380  LEU A CG    1 
ATOM   849  C  CD1   . LEU B 2 84  ? 12.367  35.311 2.455   1.00 17.05  ? 380  LEU A CD1   1 
ATOM   850  C  CD2   . LEU B 2 84  ? 14.434  35.384 0.996   1.00 22.53  ? 380  LEU A CD2   1 
ATOM   851  N  N     . LYS B 2 85  ? 15.472  39.672 4.170   1.00 16.08  ? 381  LYS A N     1 
ATOM   852  C  CA    . LYS B 2 85  ? 15.703  41.113 4.232   1.00 19.42  ? 381  LYS A CA    1 
ATOM   853  C  C     . LYS B 2 85  ? 17.142  41.449 3.886   1.00 17.89  ? 381  LYS A C     1 
ATOM   854  O  O     . LYS B 2 85  ? 17.405  42.399 3.143   1.00 19.11  ? 381  LYS A O     1 
ATOM   855  C  CB    . LYS B 2 85  ? 15.373  41.645 5.625   1.00 21.11  ? 381  LYS A CB    1 
ATOM   856  C  CG    . LYS B 2 85  ? 13.924  41.990 5.867   1.00 26.78  ? 381  LYS A CG    1 
ATOM   857  C  CD    . LYS B 2 85  ? 13.761  42.494 7.314   1.00 35.03  ? 381  LYS A CD    1 
ATOM   858  C  CE    . LYS B 2 85  ? 12.305  42.478 7.789   1.00 33.60  ? 381  LYS A CE    1 
ATOM   859  N  NZ    . LYS B 2 85  ? 11.517  43.595 7.156   1.00 34.02  ? 381  LYS A NZ    1 
ATOM   860  N  N     . TRP B 2 86  ? 18.094  40.688 4.426   1.00 17.52  ? 382  TRP A N     1 
ATOM   861  C  CA    . TRP B 2 86  ? 19.487  40.916 4.070   1.00 24.48  ? 382  TRP A CA    1 
ATOM   862  C  C     . TRP B 2 86  ? 19.747  40.702 2.583   1.00 25.13  ? 382  TRP A C     1 
ATOM   863  O  O     . TRP B 2 86  ? 20.770  41.167 2.074   1.00 20.91  ? 382  TRP A O     1 
ATOM   864  C  CB    . TRP B 2 86  ? 20.402  40.009 4.887   1.00 20.20  ? 382  TRP A CB    1 
ATOM   865  C  CG    . TRP B 2 86  ? 20.607  40.446 6.303   1.00 17.77  ? 382  TRP A CG    1 
ATOM   866  C  CD1   . TRP B 2 86  ? 19.887  40.052 7.390   1.00 16.64  ? 382  TRP A CD1   1 
ATOM   867  C  CD2   . TRP B 2 86  ? 21.599  41.350 6.790   1.00 18.71  ? 382  TRP A CD2   1 
ATOM   868  N  NE1   . TRP B 2 86  ? 20.368  40.643 8.522   1.00 16.83  ? 382  TRP A NE1   1 
ATOM   869  C  CE2   . TRP B 2 86  ? 21.417  41.452 8.188   1.00 19.83  ? 382  TRP A CE2   1 
ATOM   870  C  CE3   . TRP B 2 86  ? 22.614  42.101 6.182   1.00 20.16  ? 382  TRP A CE3   1 
ATOM   871  C  CZ2   . TRP B 2 86  ? 22.215  42.257 8.989   1.00 18.88  ? 382  TRP A CZ2   1 
ATOM   872  C  CZ3   . TRP B 2 86  ? 23.414  42.892 6.980   1.00 20.91  ? 382  TRP A CZ3   1 
ATOM   873  C  CH2   . TRP B 2 86  ? 23.206  42.970 8.373   1.00 23.88  ? 382  TRP A CH2   1 
ATOM   874  N  N     . LYS B 2 87  ? 18.856  40.013 1.876   1.00 22.85  ? 383  LYS A N     1 
ATOM   875  C  CA    . LYS B 2 87  ? 18.957  39.893 0.429   1.00 24.57  ? 383  LYS A CA    1 
ATOM   876  C  C     . LYS B 2 87  ? 18.073  40.893 -0.299  1.00 26.52  ? 383  LYS A C     1 
ATOM   877  O  O     . LYS B 2 87  ? 17.923  40.786 -1.512  1.00 26.84  ? 383  LYS A O     1 
ATOM   878  C  CB    . LYS B 2 87  ? 18.600  38.473 -0.020  1.00 24.22  ? 383  LYS A CB    1 
ATOM   879  C  CG    . LYS B 2 87  ? 19.705  37.465 0.238   1.00 27.36  ? 383  LYS A CG    1 
ATOM   880  C  CD    . LYS B 2 87  ? 19.136  36.098 0.559   1.00 32.12  ? 383  LYS A CD    1 
ATOM   881  C  CE    . LYS B 2 87  ? 20.087  34.972 0.190   1.00 32.69  ? 383  LYS A CE    1 
ATOM   882  N  NZ    . LYS B 2 87  ? 21.503  35.401 -0.001  1.00 44.55  ? 383  LYS A NZ    1 
ATOM   883  N  N     . GLY B 2 88  ? 17.479  41.854 0.404   1.00 25.45  ? 384  GLY A N     1 
ATOM   884  C  CA    . GLY B 2 88  ? 16.616  42.814 -0.263  1.00 28.11  ? 384  GLY A CA    1 
ATOM   885  C  C     . GLY B 2 88  ? 15.265  42.264 -0.674  1.00 26.00  ? 384  GLY A C     1 
ATOM   886  O  O     . GLY B 2 88  ? 14.628  42.815 -1.569  1.00 25.34  ? 384  GLY A O     1 
ATOM   887  N  N     . ILE B 2 89  ? 14.792  41.200 -0.037  1.00 20.25  ? 385  ILE A N     1 
ATOM   888  C  CA    . ILE B 2 89  ? 13.562  40.528 -0.436  1.00 21.66  ? 385  ILE A CA    1 
ATOM   889  C  C     . ILE B 2 89  ? 12.586  40.558 0.732   1.00 24.95  ? 385  ILE A C     1 
ATOM   890  O  O     . ILE B 2 89  ? 12.941  40.175 1.851   1.00 21.97  ? 385  ILE A O     1 
ATOM   891  C  CB    . ILE B 2 89  ? 13.836  39.078 -0.863  1.00 20.00  ? 385  ILE A CB    1 
ATOM   892  C  CG1   . ILE B 2 89  ? 14.625  39.024 -2.172  1.00 29.34  ? 385  ILE A CG1   1 
ATOM   893  C  CG2   . ILE B 2 89  ? 12.547  38.296 -0.946  1.00 21.66  ? 385  ILE A CG2   1 
ATOM   894  C  CD1   . ILE B 2 89  ? 15.110  37.601 -2.489  1.00 25.01  ? 385  ILE A CD1   1 
ATOM   895  N  N     . GLU B 2 90  ? 11.357  40.992 0.465   1.00 23.16  ? 386  GLU A N     1 
ATOM   896  C  CA    . GLU B 2 90  ? 10.329  41.101 1.484   1.00 24.14  ? 386  GLU A CA    1 
ATOM   897  C  C     . GLU B 2 90  ? 9.501   39.826 1.524   1.00 26.21  ? 386  GLU A C     1 
ATOM   898  O  O     . GLU B 2 90  ? 9.082   39.307 0.487   1.00 23.08  ? 386  GLU A O     1 
ATOM   899  C  CB    . GLU B 2 90  ? 9.431   42.311 1.219   1.00 35.10  ? 386  GLU A CB    1 
ATOM   900  N  N     . LEU B 2 91  ? 9.267   39.324 2.724   1.00 19.71  ? 387  LEU A N     1 
ATOM   901  C  CA    . LEU B 2 91  ? 8.422   38.159 2.928   1.00 17.72  ? 387  LEU A CA    1 
ATOM   902  C  C     . LEU B 2 91  ? 7.120   38.637 3.556   1.00 21.37  ? 387  LEU A C     1 
ATOM   903  O  O     . LEU B 2 91  ? 7.133   39.206 4.649   1.00 29.68  ? 387  LEU A O     1 
ATOM   904  C  CB    . LEU B 2 91  ? 9.125   37.137 3.824   1.00 15.34  ? 387  LEU A CB    1 
ATOM   905  C  CG    . LEU B 2 91  ? 8.252   35.953 4.263   1.00 21.49  ? 387  LEU A CG    1 
ATOM   906  C  CD1   . LEU B 2 91  ? 7.856   35.127 3.035   1.00 21.86  ? 387  LEU A CD1   1 
ATOM   907  C  CD2   . LEU B 2 91  ? 9.017   35.107 5.251   1.00 21.64  ? 387  LEU A CD2   1 
ATOM   908  N  N     . CYS B 2 92  ? 6.003   38.430 2.866   1.00 19.55  ? 388  CYS A N     1 
ATOM   909  C  CA    . CYS B 2 92  ? 4.708   38.846 3.384   1.00 22.94  ? 388  CYS A CA    1 
ATOM   910  C  C     . CYS B 2 92  ? 3.731   37.683 3.344   1.00 24.45  ? 388  CYS A C     1 
ATOM   911  O  O     . CYS B 2 92  ? 3.970   36.660 2.701   1.00 20.85  ? 388  CYS A O     1 
ATOM   912  C  CB    . CYS B 2 92  ? 4.119   40.011 2.580   1.00 30.90  ? 388  CYS A CB    1 
ATOM   913  S  SG    . CYS B 2 92  ? 5.216   41.404 2.462   1.00 42.35  ? 388  CYS A SG    1 
ATOM   914  N  N     . GLY B 2 93  ? 2.592   37.890 3.991   1.00 20.77  ? 389  GLY A N     1 
ATOM   915  C  CA    . GLY B 2 93  ? 1.519   36.932 3.918   1.00 24.33  ? 389  GLY A CA    1 
ATOM   916  C  C     . GLY B 2 93  ? 1.721   35.701 4.764   1.00 21.45  ? 389  GLY A C     1 
ATOM   917  O  O     . GLY B 2 93  ? 1.011   34.708 4.573   1.00 19.87  ? 389  GLY A O     1 
ATOM   918  N  N     . VAL B 2 94  ? 2.668   35.720 5.695   1.00 15.81  ? 390  VAL A N     1 
ATOM   919  C  CA    . VAL B 2 94  ? 2.814   34.548 6.551   1.00 19.53  ? 390  VAL A CA    1 
ATOM   920  C  C     . VAL B 2 94  ? 1.643   34.540 7.524   1.00 27.11  ? 390  VAL A C     1 
ATOM   921  O  O     . VAL B 2 94  ? 1.591   35.336 8.463   1.00 26.13  ? 390  VAL A O     1 
ATOM   922  C  CB    . VAL B 2 94  ? 4.151   34.528 7.285   1.00 23.31  ? 390  VAL A CB    1 
ATOM   923  C  CG1   . VAL B 2 94  ? 4.208   33.280 8.154   1.00 16.01  ? 390  VAL A CG1   1 
ATOM   924  C  CG2   . VAL B 2 94  ? 5.295   34.537 6.282   1.00 21.21  ? 390  VAL A CG2   1 
ATOM   925  N  N     . SER B 2 95  ? 0.689   33.649 7.288   1.00 19.71  ? 391  SER A N     1 
ATOM   926  C  CA    . SER B 2 95  ? -0.539  33.638 8.059   1.00 19.32  ? 391  SER A CA    1 
ATOM   927  C  C     . SER B 2 95  ? -0.519  32.629 9.191   1.00 19.96  ? 391  SER A C     1 
ATOM   928  O  O     . SER B 2 95  ? -1.432  32.639 10.020  1.00 18.47  ? 391  SER A O     1 
ATOM   929  C  CB    . SER B 2 95  ? -1.724  33.354 7.125   1.00 24.60  ? 391  SER A CB    1 
ATOM   930  O  OG    . SER B 2 95  ? -1.559  32.081 6.532   1.00 29.54  ? 391  SER A OG    1 
ATOM   931  N  N     . PHE B 2 96  ? 0.482   31.749 9.237   1.00 16.77  ? 392  PHE A N     1 
ATOM   932  C  CA    . PHE B 2 96  ? 0.572   30.738 10.279  1.00 20.51  ? 392  PHE A CA    1 
ATOM   933  C  C     . PHE B 2 96  ? 2.042   30.441 10.498  1.00 24.36  ? 392  PHE A C     1 
ATOM   934  O  O     . PHE B 2 96  ? 2.753   30.104 9.545   1.00 18.07  ? 392  PHE A O     1 
ATOM   935  C  CB    . PHE B 2 96  ? -0.181  29.466 9.891   1.00 22.09  ? 392  PHE A CB    1 
ATOM   936  C  CG    . PHE B 2 96  ? -0.034  28.350 10.892  1.00 21.40  ? 392  PHE A CG    1 
ATOM   937  C  CD1   . PHE B 2 96  ? -0.697  28.394 12.101  1.00 23.13  ? 392  PHE A CD1   1 
ATOM   938  C  CD2   . PHE B 2 96  ? 0.786   27.264 10.623  1.00 20.57  ? 392  PHE A CD2   1 
ATOM   939  C  CE1   . PHE B 2 96  ? -0.559  27.347 13.034  1.00 19.33  ? 392  PHE A CE1   1 
ATOM   940  C  CE2   . PHE B 2 96  ? 0.930   26.227 11.548  1.00 25.61  ? 392  PHE A CE2   1 
ATOM   941  C  CZ    . PHE B 2 96  ? 0.253   26.273 12.750  1.00 19.97  ? 392  PHE A CZ    1 
ATOM   942  N  N     . ASP B 2 97  ? 2.503   30.607 11.731  1.00 15.95  ? 393  ASP A N     1 
ATOM   943  C  CA    . ASP B 2 97  ? 3.855   30.235 12.117  1.00 15.43  ? 393  ASP A CA    1 
ATOM   944  C  C     . ASP B 2 97  ? 3.735   29.101 13.127  1.00 15.75  ? 393  ASP A C     1 
ATOM   945  O  O     . ASP B 2 97  ? 3.289   29.307 14.260  1.00 13.35  ? 393  ASP A O     1 
ATOM   946  C  CB    . ASP B 2 97  ? 4.617   31.425 12.694  1.00 16.26  ? 393  ASP A CB    1 
ATOM   947  C  CG    . ASP B 2 97  ? 6.090   31.135 12.896  1.00 25.23  ? 393  ASP A CG    1 
ATOM   948  O  OD1   . ASP B 2 97  ? 6.420   30.002 13.332  1.00 28.24  ? 393  ASP A OD1   1 
ATOM   949  O  OD2   . ASP B 2 97  ? 6.924   32.034 12.618  1.00 25.30  ? 393  ASP A OD2   1 
ATOM   950  N  N     . LEU B 2 98  ? 4.160   27.914 12.718  1.00 16.16  ? 394  LEU A N     1 
ATOM   951  C  CA    . LEU B 2 98  ? 4.043   26.744 13.566  1.00 15.78  ? 394  LEU A CA    1 
ATOM   952  C  C     . LEU B 2 98  ? 4.913   26.848 14.812  1.00 12.65  ? 394  LEU A C     1 
ATOM   953  O  O     . LEU B 2 98  ? 4.539   26.330 15.872  1.00 16.84  ? 394  LEU A O     1 
ATOM   954  C  CB    . LEU B 2 98  ? 4.407   25.518 12.738  1.00 10.43  ? 394  LEU A CB    1 
ATOM   955  C  CG    . LEU B 2 98  ? 4.539   24.196 13.460  1.00 17.41  ? 394  LEU A CG    1 
ATOM   956  C  CD1   . LEU B 2 98  ? 3.192   23.836 14.082  1.00 15.64  ? 394  LEU A CD1   1 
ATOM   957  C  CD2   . LEU B 2 98  ? 5.025   23.121 12.440  1.00 14.80  ? 394  LEU A CD2   1 
ATOM   958  N  N     . LEU B 2 99  ? 6.093   27.464 14.704  1.00 13.05  ? 395  LEU A N     1 
ATOM   959  C  CA    . LEU B 2 99  ? 6.911   27.682 15.899  1.00 15.39  ? 395  LEU A CA    1 
ATOM   960  C  C     . LEU B 2 99  ? 6.131   28.440 16.963  1.00 17.79  ? 395  LEU A C     1 
ATOM   961  O  O     . LEU B 2 99  ? 6.091   28.040 18.132  1.00 14.15  ? 395  LEU A O     1 
ATOM   962  C  CB    . LEU B 2 99  ? 8.182   28.453 15.545  1.00 14.19  ? 395  LEU A CB    1 
ATOM   963  C  CG    . LEU B 2 99  ? 8.990   28.899 16.785  1.00 22.50  ? 395  LEU A CG    1 
ATOM   964  C  CD1   . LEU B 2 99  ? 9.482   27.701 17.597  1.00 18.78  ? 395  LEU A CD1   1 
ATOM   965  C  CD2   . LEU B 2 99  ? 10.158  29.799 16.413  1.00 22.47  ? 395  LEU A CD2   1 
ATOM   966  N  N     . LEU B 2 100 ? 5.499   29.543 16.571  1.00 12.47  ? 396  LEU A N     1 
ATOM   967  C  CA    . LEU B 2 100 ? 4.741   30.334 17.539  1.00 14.08  ? 396  LEU A CA    1 
ATOM   968  C  C     . LEU B 2 100 ? 3.504   29.598 18.008  1.00 12.43  ? 396  LEU A C     1 
ATOM   969  O  O     . LEU B 2 100 ? 3.098   29.742 19.164  1.00 14.30  ? 396  LEU A O     1 
ATOM   970  C  CB    . LEU B 2 100 ? 4.342   31.675 16.921  1.00 10.37  ? 396  LEU A CB    1 
ATOM   971  C  CG    . LEU B 2 100 ? 5.554   32.499 16.540  1.00 18.31  ? 396  LEU A CG    1 
ATOM   972  C  CD1   . LEU B 2 100 ? 5.121   33.843 15.914  1.00 16.00  ? 396  LEU A CD1   1 
ATOM   973  C  CD2   . LEU B 2 100 ? 6.459   32.701 17.778  1.00 16.07  ? 396  LEU A CD2   1 
ATOM   974  N  N     . ALA B 2 101 ? 2.843   28.859 17.110  1.00 16.03  ? 397  ALA A N     1 
ATOM   975  C  CA    . ALA B 2 101 ? 1.682   28.086 17.539  1.00 13.35  ? 397  ALA A CA    1 
ATOM   976  C  C     . ALA B 2 101 ? 2.079   27.061 18.595  1.00 13.20  ? 397  ALA A C     1 
ATOM   977  O  O     . ALA B 2 101 ? 1.402   26.912 19.615  1.00 13.25  ? 397  ALA A O     1 
ATOM   978  C  CB    . ALA B 2 101 ? 1.027   27.387 16.347  1.00 14.15  ? 397  ALA A CB    1 
ATOM   979  N  N     . ALA B 2 102 ? 3.161   26.323 18.341  1.00 11.25  ? 398  ALA A N     1 
ATOM   980  C  CA    . ALA B 2 102 ? 3.600   25.301 19.278  1.00 12.61  ? 398  ALA A CA    1 
ATOM   981  C  C     . ALA B 2 102 ? 3.983   25.930 20.605  1.00 19.93  ? 398  ALA A C     1 
ATOM   982  O  O     . ALA B 2 102 ? 3.658   25.401 21.669  1.00 20.10  ? 398  ALA A O     1 
ATOM   983  C  CB    . ALA B 2 102 ? 4.783   24.523 18.698  1.00 15.39  ? 398  ALA A CB    1 
ATOM   984  N  N     . TYR B 2 103 ? 4.653   27.076 20.549  1.00 17.66  ? 399  TYR A N     1 
ATOM   985  C  CA    . TYR B 2 103 ? 5.035   27.797 21.751  1.00 22.00  ? 399  TYR A CA    1 
ATOM   986  C  C     . TYR B 2 103 ? 3.826   28.203 22.587  1.00 23.44  ? 399  TYR A C     1 
ATOM   987  O  O     . TYR B 2 103 ? 3.837   28.063 23.818  1.00 20.14  ? 399  TYR A O     1 
ATOM   988  C  CB    . TYR B 2 103 ? 5.834   29.015 21.344  1.00 17.57  ? 399  TYR A CB    1 
ATOM   989  C  CG    . TYR B 2 103 ? 6.175   29.940 22.475  1.00 21.08  ? 399  TYR A CG    1 
ATOM   990  C  CD1   . TYR B 2 103 ? 7.027   29.528 23.504  1.00 20.61  ? 399  TYR A CD1   1 
ATOM   991  C  CD2   . TYR B 2 103 ? 5.675   31.227 22.503  1.00 21.49  ? 399  TYR A CD2   1 
ATOM   992  C  CE1   . TYR B 2 103 ? 7.370   30.389 24.520  1.00 23.45  ? 399  TYR A CE1   1 
ATOM   993  C  CE2   . TYR B 2 103 ? 6.009   32.096 23.520  1.00 19.51  ? 399  TYR A CE2   1 
ATOM   994  C  CZ    . TYR B 2 103 ? 6.851   31.669 24.528  1.00 23.53  ? 399  TYR A CZ    1 
ATOM   995  O  OH    . TYR B 2 103 ? 7.193   32.545 25.536  1.00 27.42  ? 399  TYR A OH    1 
ATOM   996  N  N     . LEU B 2 104 ? 2.779   28.726 21.947  1.00 16.58  ? 400  LEU A N     1 
ATOM   997  C  CA    . LEU B 2 104 ? 1.601   29.123 22.710  1.00 18.26  ? 400  LEU A CA    1 
ATOM   998  C  C     . LEU B 2 104 ? 0.883   27.916 23.292  1.00 22.41  ? 400  LEU A C     1 
ATOM   999  O  O     . LEU B 2 104 ? 0.282   28.016 24.364  1.00 22.35  ? 400  LEU A O     1 
ATOM   1000 C  CB    . LEU B 2 104 ? 0.631   29.910 21.831  1.00 18.37  ? 400  LEU A CB    1 
ATOM   1001 C  CG    . LEU B 2 104 ? 1.132   31.262 21.347  1.00 24.18  ? 400  LEU A CG    1 
ATOM   1002 C  CD1   . LEU B 2 104 ? 0.077   31.924 20.454  1.00 20.71  ? 400  LEU A CD1   1 
ATOM   1003 C  CD2   . LEU B 2 104 ? 1.478   32.122 22.560  1.00 31.90  ? 400  LEU A CD2   1 
ATOM   1004 N  N     . LEU B 2 105 ? 0.939   26.777 22.600  1.00 16.73  ? 401  LEU A N     1 
ATOM   1005 C  CA    . LEU B 2 105 ? 0.231   25.582 23.052  1.00 21.02  ? 401  LEU A CA    1 
ATOM   1006 C  C     . LEU B 2 105 ? 0.892   24.981 24.284  1.00 25.77  ? 401  LEU A C     1 
ATOM   1007 O  O     . LEU B 2 105 ? 0.204   24.463 25.175  1.00 29.13  ? 401  LEU A O     1 
ATOM   1008 C  CB    . LEU B 2 105 ? 0.183   24.554 21.930  1.00 15.76  ? 401  LEU A CB    1 
ATOM   1009 C  CG    . LEU B 2 105 ? -0.901  24.788 20.889  1.00 21.47  ? 401  LEU A CG    1 
ATOM   1010 C  CD1   . LEU B 2 105 ? -1.064  23.545 20.050  1.00 21.09  ? 401  LEU A CD1   1 
ATOM   1011 C  CD2   . LEU B 2 105 ? -2.206  25.127 21.606  1.00 17.64  ? 401  LEU A CD2   1 
ATOM   1012 N  N     . ASP B 2 106 ? 2.219   25.038 24.352  1.00 22.73  ? 402  ASP A N     1 
ATOM   1013 C  CA    . ASP B 2 106 ? 2.940   24.562 25.533  1.00 29.88  ? 402  ASP A CA    1 
ATOM   1014 C  C     . ASP B 2 106 ? 4.371   25.078 25.508  1.00 20.72  ? 402  ASP A C     1 
ATOM   1015 O  O     . ASP B 2 106 ? 5.241   24.441 24.900  1.00 25.73  ? 402  ASP A O     1 
ATOM   1016 C  CB    . ASP B 2 106 ? 2.933   23.032 25.592  1.00 27.72  ? 402  ASP A CB    1 
ATOM   1017 C  CG    . ASP B 2 106 ? 3.403   22.487 26.933  1.00 33.06  ? 402  ASP A CG    1 
ATOM   1018 O  OD1   . ASP B 2 106 ? 3.952   23.247 27.764  1.00 40.62  ? 402  ASP A OD1   1 
ATOM   1019 O  OD2   . ASP B 2 106 ? 3.216   21.279 27.161  1.00 40.52  ? 402  ASP A OD2   1 
ATOM   1020 N  N     . PRO B 2 107 ? 4.651   26.218 26.147  1.00 19.95  ? 403  PRO A N     1 
ATOM   1021 C  CA    . PRO B 2 107 ? 6.020   26.754 26.116  1.00 18.91  ? 403  PRO A CA    1 
ATOM   1022 C  C     . PRO B 2 107 ? 7.047   25.817 26.718  1.00 25.95  ? 403  PRO A C     1 
ATOM   1023 O  O     . PRO B 2 107 ? 8.231   25.915 26.379  1.00 25.94  ? 403  PRO A O     1 
ATOM   1024 C  CB    . PRO B 2 107 ? 5.916   28.048 26.944  1.00 19.06  ? 403  PRO A CB    1 
ATOM   1025 C  CG    . PRO B 2 107 ? 4.467   28.257 27.219  1.00 25.20  ? 403  PRO A CG    1 
ATOM   1026 C  CD    . PRO B 2 107 ? 3.789   26.953 27.095  1.00 16.46  ? 403  PRO A CD    1 
ATOM   1027 N  N     . ALA B 2 108 ? 6.638   24.927 27.626  1.00 20.99  ? 404  ALA A N     1 
ATOM   1028 C  CA    . ALA B 2 108 ? 7.611   24.055 28.276  1.00 27.27  ? 404  ALA A CA    1 
ATOM   1029 C  C     . ALA B 2 108 ? 8.179   22.993 27.337  1.00 38.39  ? 404  ALA A C     1 
ATOM   1030 O  O     . ALA B 2 108 ? 9.214   22.395 27.659  1.00 35.30  ? 404  ALA A O     1 
ATOM   1031 C  CB    . ALA B 2 108 ? 6.984   23.366 29.481  1.00 21.81  ? 404  ALA A CB    1 
ATOM   1032 N  N     . GLN B 2 109 ? 7.520   22.725 26.203  1.00 34.04  ? 405  GLN A N     1 
ATOM   1033 C  CA    . GLN B 2 109 ? 7.991   21.665 25.312  1.00 37.64  ? 405  GLN A CA    1 
ATOM   1034 C  C     . GLN B 2 109 ? 9.337   21.989 24.683  1.00 37.97  ? 405  GLN A C     1 
ATOM   1035 O  O     . GLN B 2 109 ? 9.998   21.082 24.172  1.00 40.48  ? 405  GLN A O     1 
ATOM   1036 C  CB    . GLN B 2 109 ? 6.974   21.393 24.199  1.00 41.86  ? 405  GLN A CB    1 
ATOM   1037 C  CG    . GLN B 2 109 ? 5.684   20.734 24.662  1.00 55.94  ? 405  GLN A CG    1 
ATOM   1038 C  CD    . GLN B 2 109 ? 5.890   19.315 25.172  1.00 65.20  ? 405  GLN A CD    1 
ATOM   1039 O  OE1   . GLN B 2 109 ? 5.851   18.354 24.401  1.00 65.11  ? 405  GLN A OE1   1 
ATOM   1040 N  NE2   . GLN B 2 109 ? 6.101   19.178 26.479  1.00 65.35  ? 405  GLN A NE2   1 
ATOM   1041 N  N     . GLY B 2 110 ? 9.752   23.251 24.698  1.00 36.27  ? 406  GLY A N     1 
ATOM   1042 C  CA    . GLY B 2 110 ? 11.021  23.614 24.091  1.00 37.03  ? 406  GLY A CA    1 
ATOM   1043 C  C     . GLY B 2 110 ? 11.073  23.351 22.601  1.00 36.66  ? 406  GLY A C     1 
ATOM   1044 O  O     . GLY B 2 110 ? 12.115  22.929 22.082  1.00 34.84  ? 406  GLY A O     1 
ATOM   1045 N  N     . VAL B 2 111 ? 9.970   23.600 21.896  1.00 29.98  ? 407  VAL A N     1 
ATOM   1046 C  CA    . VAL B 2 111 ? 9.892   23.290 20.472  1.00 31.69  ? 407  VAL A CA    1 
ATOM   1047 C  C     . VAL B 2 111 ? 10.920  24.107 19.707  1.00 29.66  ? 407  VAL A C     1 
ATOM   1048 O  O     . VAL B 2 111 ? 10.839  25.339 19.634  1.00 38.17  ? 407  VAL A O     1 
ATOM   1049 C  CB    . VAL B 2 111 ? 8.476   23.506 19.920  1.00 31.21  ? 407  VAL A CB    1 
ATOM   1050 C  CG1   . VAL B 2 111 ? 8.515   23.565 18.388  1.00 21.03  ? 407  VAL A CG1   1 
ATOM   1051 C  CG2   . VAL B 2 111 ? 7.560   22.368 20.414  1.00 24.87  ? 407  VAL A CG2   1 
ATOM   1052 N  N     . ASP B 2 112 ? 11.893  23.399 19.145  1.00 28.58  ? 408  ASP A N     1 
ATOM   1053 C  CA    . ASP B 2 112 ? 13.103  23.877 18.490  1.00 41.04  ? 408  ASP A CA    1 
ATOM   1054 C  C     . ASP B 2 112 ? 13.038  23.747 16.978  1.00 35.71  ? 408  ASP A C     1 
ATOM   1055 O  O     . ASP B 2 112 ? 13.623  24.555 16.255  1.00 24.18  ? 408  ASP A O     1 
ATOM   1056 C  CB    . ASP B 2 112 ? 14.302  23.056 18.977  1.00 53.31  ? 408  ASP A CB    1 
ATOM   1057 C  CG    . ASP B 2 112 ? 13.985  21.563 19.043  1.00 68.06  ? 408  ASP A CG    1 
ATOM   1058 O  OD1   . ASP B 2 112 ? 14.789  20.745 18.540  1.00 76.30  ? 408  ASP A OD1   1 
ATOM   1059 O  OD2   . ASP B 2 112 ? 12.921  21.209 19.598  1.00 70.07  ? 408  ASP A OD2   1 
ATOM   1060 N  N     . ASP B 2 113 ? 12.396  22.699 16.479  1.00 23.57  ? 409  ASP A N     1 
ATOM   1061 C  CA    . ASP B 2 113 ? 12.376  22.484 15.050  1.00 19.37  ? 409  ASP A CA    1 
ATOM   1062 C  C     . ASP B 2 113 ? 11.019  21.915 14.683  1.00 16.99  ? 409  ASP A C     1 
ATOM   1063 O  O     . ASP B 2 113 ? 10.194  21.633 15.551  1.00 18.01  ? 409  ASP A O     1 
ATOM   1064 C  CB    . ASP B 2 113 ? 13.535  21.587 14.613  1.00 22.33  ? 409  ASP A CB    1 
ATOM   1065 C  CG    . ASP B 2 113 ? 13.549  20.236 15.319  1.00 36.98  ? 409  ASP A CG    1 
ATOM   1066 O  OD1   . ASP B 2 113 ? 14.557  19.519 15.157  1.00 43.93  ? 409  ASP A OD1   1 
ATOM   1067 O  OD2   . ASP B 2 113 ? 12.574  19.880 16.020  1.00 41.91  ? 409  ASP A OD2   1 
ATOM   1068 N  N     . VAL B 2 114 ? 10.780  21.789 13.382  1.00 19.07  ? 410  VAL A N     1 
ATOM   1069 C  CA    . VAL B 2 114 ? 9.496   21.268 12.926  1.00 17.64  ? 410  VAL A CA    1 
ATOM   1070 C  C     . VAL B 2 114 ? 9.215   19.910 13.559  1.00 12.73  ? 410  VAL A C     1 
ATOM   1071 O  O     . VAL B 2 114 ? 8.090   19.634 13.984  1.00 16.98  ? 410  VAL A O     1 
ATOM   1072 C  CB    . VAL B 2 114 ? 9.463   21.201 11.391  1.00 20.40  ? 410  VAL A CB    1 
ATOM   1073 C  CG1   . VAL B 2 114 ? 8.231   20.428 10.929  1.00 18.00  ? 410  VAL A CG1   1 
ATOM   1074 C  CG2   . VAL B 2 114 ? 9.457   22.626 10.825  1.00 12.99  ? 410  VAL A CG2   1 
ATOM   1075 N  N     . ALA B 2 115 ? 10.238  19.062 13.665  1.00 13.49  ? 411  ALA A N     1 
ATOM   1076 C  CA    . ALA B 2 115 ? 10.019  17.704 14.162  1.00 17.09  ? 411  ALA A CA    1 
ATOM   1077 C  C     . ALA B 2 115 ? 9.461   17.717 15.577  1.00 24.68  ? 411  ALA A C     1 
ATOM   1078 O  O     . ALA B 2 115 ? 8.562   16.934 15.908  1.00 19.01  ? 411  ALA A O     1 
ATOM   1079 C  CB    . ALA B 2 115 ? 11.319  16.907 14.116  1.00 17.53  ? 411  ALA A CB    1 
ATOM   1080 N  N     . ALA B 2 116 ? 9.993   18.593 16.430  1.00 22.62  ? 412  ALA A N     1 
ATOM   1081 C  CA    . ALA B 2 116 ? 9.508   18.670 17.802  1.00 21.33  ? 412  ALA A CA    1 
ATOM   1082 C  C     . ALA B 2 116 ? 8.058   19.131 17.838  1.00 17.81  ? 412  ALA A C     1 
ATOM   1083 O  O     . ALA B 2 116 ? 7.257   18.597 18.605  1.00 19.92  ? 412  ALA A O     1 
ATOM   1084 C  CB    . ALA B 2 116 ? 10.397  19.608 18.619  1.00 18.18  ? 412  ALA A CB    1 
ATOM   1085 N  N     . ALA B 2 117 ? 7.683   20.096 16.986  1.00 13.33  ? 413  ALA A N     1 
ATOM   1086 C  CA    . ALA B 2 117 ? 6.290   20.533 16.995  1.00 13.55  ? 413  ALA A CA    1 
ATOM   1087 C  C     . ALA B 2 117 ? 5.380   19.438 16.454  1.00 13.94  ? 413  ALA A C     1 
ATOM   1088 O  O     . ALA B 2 117 ? 4.285   19.201 16.982  1.00 16.13  ? 413  ALA A O     1 
ATOM   1089 C  CB    . ALA B 2 117 ? 6.135   21.823 16.186  1.00 15.17  ? 413  ALA A CB    1 
ATOM   1090 N  N     . ALA B 2 118 ? 5.837   18.748 15.414  1.00 13.44  ? 414  ALA A N     1 
ATOM   1091 C  CA    . ALA B 2 118 ? 5.056   17.676 14.810  1.00 15.69  ? 414  ALA A CA    1 
ATOM   1092 C  C     . ALA B 2 118 ? 4.784   16.553 15.802  1.00 15.84  ? 414  ALA A C     1 
ATOM   1093 O  O     . ALA B 2 118 ? 3.692   15.974 15.809  1.00 19.90  ? 414  ALA A O     1 
ATOM   1094 C  CB    . ALA B 2 118 ? 5.792   17.151 13.573  1.00 14.45  ? 414  ALA A CB    1 
ATOM   1095 N  N     . LYS B 2 119 ? 5.761   16.236 16.652  1.00 17.76  ? 415  LYS A N     1 
ATOM   1096 C  CA    . LYS B 2 119 ? 5.562   15.191 17.655  1.00 21.41  ? 415  LYS A CA    1 
ATOM   1097 C  C     . LYS B 2 119 ? 4.357   15.479 18.548  1.00 31.02  ? 415  LYS A C     1 
ATOM   1098 O  O     . LYS B 2 119 ? 3.659   14.542 18.967  1.00 25.99  ? 415  LYS A O     1 
ATOM   1099 C  CB    . LYS B 2 119 ? 6.821   15.039 18.507  1.00 31.96  ? 415  LYS A CB    1 
ATOM   1100 C  CG    . LYS B 2 119 ? 7.815   14.026 17.982  1.00 52.15  ? 415  LYS A CG    1 
ATOM   1101 C  CD    . LYS B 2 119 ? 8.237   13.076 19.090  1.00 64.53  ? 415  LYS A CD    1 
ATOM   1102 C  CE    . LYS B 2 119 ? 9.270   12.069 18.605  1.00 73.37  ? 415  LYS A CE    1 
ATOM   1103 N  NZ    . LYS B 2 119 ? 9.081   10.739 19.269  1.00 74.43  ? 415  LYS A NZ    1 
ATOM   1104 N  N     . MET B 2 120 ? 4.071   16.762 18.812  1.00 27.47  ? 416  MET A N     1 
ATOM   1105 C  CA    . MET B 2 120 ? 2.925   17.118 19.649  1.00 22.61  ? 416  MET A CA    1 
ATOM   1106 C  C     . MET B 2 120 ? 1.626   16.604 19.058  1.00 22.44  ? 416  MET A C     1 
ATOM   1107 O  O     . MET B 2 120 ? 0.662   16.358 19.791  1.00 24.12  ? 416  MET A O     1 
ATOM   1108 C  CB    . MET B 2 120 ? 2.825   18.644 19.830  1.00 20.11  ? 416  MET A CB    1 
ATOM   1109 C  CG    . MET B 2 120 ? 3.984   19.319 20.564  1.00 27.96  ? 416  MET A CG    1 
ATOM   1110 S  SD    . MET B 2 120 ? 3.954   21.138 20.390  1.00 35.69  ? 416  MET A SD    1 
ATOM   1111 C  CE    . MET B 2 120 ? 2.449   21.590 21.243  1.00 40.56  ? 416  MET A CE    1 
ATOM   1112 N  N     . LYS B 2 121 ? 1.572   16.438 17.741  1.00 20.63  ? 417  LYS A N     1 
ATOM   1113 C  CA    . LYS B 2 121 ? 0.390   15.908 17.078  1.00 17.20  ? 417  LYS A CA    1 
ATOM   1114 C  C     . LYS B 2 121 ? 0.635   14.522 16.485  1.00 18.55  ? 417  LYS A C     1 
ATOM   1115 O  O     . LYS B 2 121 ? -0.018  14.140 15.509  1.00 22.55  ? 417  LYS A O     1 
ATOM   1116 C  CB    . LYS B 2 121 ? -0.070  16.878 15.994  1.00 17.85  ? 417  LYS A CB    1 
ATOM   1117 C  CG    . LYS B 2 121 ? -0.439  18.246 16.547  1.00 19.28  ? 417  LYS A CG    1 
ATOM   1118 C  CD    . LYS B 2 121 ? -1.653  18.178 17.440  1.00 27.96  ? 417  LYS A CD    1 
ATOM   1119 C  CE    . LYS B 2 121 ? -1.828  19.490 18.216  1.00 35.11  ? 417  LYS A CE    1 
ATOM   1120 N  NZ    . LYS B 2 121 ? -2.616  19.281 19.465  1.00 42.09  ? 417  LYS A NZ    1 
ATOM   1121 N  N     . GLN B 2 122 ? 1.584   13.776 17.049  1.00 18.65  ? 418  GLN A N     1 
ATOM   1122 C  CA    . GLN B 2 122 ? 1.867   12.398 16.632  1.00 24.45  ? 418  GLN A CA    1 
ATOM   1123 C  C     . GLN B 2 122 ? 2.222   12.320 15.148  1.00 28.20  ? 418  GLN A C     1 
ATOM   1124 O  O     . GLN B 2 122 ? 1.890   11.354 14.470  1.00 23.03  ? 418  GLN A O     1 
ATOM   1125 C  CB    . GLN B 2 122 ? 0.694   11.470 16.948  1.00 32.51  ? 418  GLN A CB    1 
ATOM   1126 C  CG    . GLN B 2 122 ? 0.244   11.488 18.418  1.00 35.11  ? 418  GLN A CG    1 
ATOM   1127 C  CD    . GLN B 2 122 ? 1.372   11.152 19.386  1.00 44.35  ? 418  GLN A CD    1 
ATOM   1128 O  OE1   . GLN B 2 122 ? 1.666   9.978  19.645  1.00 41.74  ? 418  GLN A OE1   1 
ATOM   1129 N  NE2   . GLN B 2 122 ? 2.005   12.185 19.935  1.00 46.29  ? 418  GLN A NE2   1 
ATOM   1130 N  N     . TYR B 2 123 ? 2.877   13.354 14.633  1.00 24.07  ? 419  TYR A N     1 
ATOM   1131 C  CA    . TYR B 2 123 ? 3.375   13.394 13.265  1.00 17.94  ? 419  TYR A CA    1 
ATOM   1132 C  C     . TYR B 2 123 ? 4.885   13.228 13.338  1.00 17.94  ? 419  TYR A C     1 
ATOM   1133 O  O     . TYR B 2 123 ? 5.575   14.063 13.938  1.00 17.24  ? 419  TYR A O     1 
ATOM   1134 C  CB    . TYR B 2 123 ? 2.996   14.716 12.587  1.00 16.81  ? 419  TYR A CB    1 
ATOM   1135 C  CG    . TYR B 2 123 ? 3.311   14.807 11.105  1.00 19.65  ? 419  TYR A CG    1 
ATOM   1136 C  CD1   . TYR B 2 123 ? 2.298   14.778 10.154  1.00 17.27  ? 419  TYR A CD1   1 
ATOM   1137 C  CD2   . TYR B 2 123 ? 4.624   14.951 10.665  1.00 16.61  ? 419  TYR A CD2   1 
ATOM   1138 C  CE1   . TYR B 2 123 ? 2.589   14.874 8.791   1.00 17.51  ? 419  TYR A CE1   1 
ATOM   1139 C  CE2   . TYR B 2 123 ? 4.933   15.040 9.310   1.00 16.82  ? 419  TYR A CE2   1 
ATOM   1140 C  CZ    . TYR B 2 123 ? 3.906   15.002 8.379   1.00 17.51  ? 419  TYR A CZ    1 
ATOM   1141 O  OH    . TYR B 2 123 ? 4.203   15.081 7.036   1.00 20.89  ? 419  TYR A OH    1 
ATOM   1142 N  N     . GLU B 2 124 ? 5.401   12.156 12.741  1.00 19.04  ? 420  GLU A N     1 
ATOM   1143 C  CA    . GLU B 2 124 ? 6.816   11.839 12.891  1.00 21.28  ? 420  GLU A CA    1 
ATOM   1144 C  C     . GLU B 2 124 ? 7.513   11.607 11.552  1.00 19.83  ? 420  GLU A C     1 
ATOM   1145 O  O     . GLU B 2 124 ? 8.618   11.066 11.524  1.00 26.77  ? 420  GLU A O     1 
ATOM   1146 C  CB    . GLU B 2 124 ? 6.983   10.627 13.821  1.00 28.52  ? 420  GLU A CB    1 
ATOM   1147 C  CG    . GLU B 2 124 ? 6.376   10.916 15.205  1.00 46.94  ? 420  GLU A CG    1 
ATOM   1148 C  CD    . GLU B 2 124 ? 7.029   10.158 16.347  1.00 61.63  ? 420  GLU A CD    1 
ATOM   1149 O  OE1   . GLU B 2 124 ? 6.730   10.498 17.512  1.00 67.60  ? 420  GLU A OE1   1 
ATOM   1150 O  OE2   . GLU B 2 124 ? 7.824   9.227  16.091  1.00 65.20  ? 420  GLU A OE2   1 
ATOM   1151 N  N     . ALA B 2 125 ? 6.915   12.042 10.446  1.00 22.51  ? 421  ALA A N     1 
ATOM   1152 C  CA    . ALA B 2 125 ? 7.512   11.864 9.123   1.00 20.03  ? 421  ALA A CA    1 
ATOM   1153 C  C     . ALA B 2 125 ? 8.454   12.999 8.750   1.00 25.25  ? 421  ALA A C     1 
ATOM   1154 O  O     . ALA B 2 125 ? 8.490   13.439 7.590   1.00 19.50  ? 421  ALA A O     1 
ATOM   1155 C  CB    . ALA B 2 125 ? 6.405   11.707 8.089   1.00 20.45  ? 421  ALA A CB    1 
ATOM   1156 N  N     . VAL B 2 126 ? 9.195   13.508 9.731   1.00 21.41  ? 422  VAL A N     1 
ATOM   1157 C  CA    . VAL B 2 126 ? 10.186  14.557 9.534   1.00 21.56  ? 422  VAL A CA    1 
ATOM   1158 C  C     . VAL B 2 126 ? 11.294  14.324 10.556  1.00 21.14  ? 422  VAL A C     1 
ATOM   1159 O  O     . VAL B 2 126 ? 11.028  13.939 11.696  1.00 24.78  ? 422  VAL A O     1 
ATOM   1160 C  CB    . VAL B 2 126 ? 9.539   15.957 9.655   1.00 22.65  ? 422  VAL A CB    1 
ATOM   1161 C  CG1   . VAL B 2 126 ? 8.821   16.092 10.990  1.00 20.65  ? 422  VAL A CG1   1 
ATOM   1162 C  CG2   . VAL B 2 126 ? 10.578  17.073 9.471   1.00 18.88  ? 422  VAL A CG2   1 
ATOM   1163 N  N     . ARG B 2 127 ? 12.509  14.501 10.144  1.00 21.25  ? 423  ARG A N     1 
ATOM   1164 C  CA    . ARG B 2 127 ? 13.626  14.323 11.056  1.00 21.12  ? 423  ARG A CA    1 
ATOM   1165 C  C     . ARG B 2 127 ? 13.914  15.611 11.821  1.00 26.65  ? 423  ARG A C     1 
ATOM   1166 O  O     . ARG B 2 127 ? 13.652  16.705 11.319  1.00 23.61  ? 423  ARG A O     1 
ATOM   1167 C  CB    . ARG B 2 127 ? 14.880  13.918 10.296  1.00 28.86  ? 423  ARG A CB    1 
ATOM   1168 C  CG    . ARG B 2 127 ? 14.659  12.850 9.245   1.00 41.12  ? 423  ARG A CG    1 
ATOM   1169 C  CD    . ARG B 2 127 ? 15.975  12.463 8.620   1.00 39.21  ? 423  ARG A CD    1 
ATOM   1170 N  NE    . ARG B 2 127 ? 16.730  11.608 9.524   1.00 60.88  ? 423  ARG A NE    1 
ATOM   1171 C  CZ    . ARG B 2 127 ? 18.046  11.442 9.467   1.00 64.20  ? 423  ARG A CZ    1 
ATOM   1172 N  NH1   . ARG B 2 127 ? 18.648  10.640 10.338  1.00 64.06  ? 423  ARG A NH1   1 
ATOM   1173 N  NH2   . ARG B 2 127 ? 18.755  12.077 8.539   1.00 59.29  ? 423  ARG A NH2   1 
ATOM   1174 N  N     . PRO B 2 128 ? 14.456  15.494 13.036  1.00 29.11  ? 424  PRO A N     1 
ATOM   1175 C  CA    . PRO B 2 128 ? 14.990  16.678 13.722  1.00 25.69  ? 424  PRO A CA    1 
ATOM   1176 C  C     . PRO B 2 128 ? 16.096  17.310 12.895  1.00 22.75  ? 424  PRO A C     1 
ATOM   1177 O  O     . PRO B 2 128 ? 16.903  16.614 12.276  1.00 27.11  ? 424  PRO A O     1 
ATOM   1178 C  CB    . PRO B 2 128 ? 15.543  16.112 15.037  1.00 22.54  ? 424  PRO A CB    1 
ATOM   1179 C  CG    . PRO B 2 128 ? 14.948  14.756 15.175  1.00 29.89  ? 424  PRO A CG    1 
ATOM   1180 C  CD    . PRO B 2 128 ? 14.693  14.253 13.792  1.00 27.62  ? 424  PRO A CD    1 
ATOM   1181 N  N     . ASP B 2 129 ? 16.156  18.641 12.927  1.00 20.86  ? 425  ASP A N     1 
ATOM   1182 C  CA    . ASP B 2 129 ? 17.224  19.357 12.235  1.00 23.60  ? 425  ASP A CA    1 
ATOM   1183 C  C     . ASP B 2 129 ? 18.603  18.841 12.642  1.00 29.83  ? 425  ASP A C     1 
ATOM   1184 O  O     . ASP B 2 129 ? 19.486  18.675 11.793  1.00 28.19  ? 425  ASP A O     1 
ATOM   1185 C  CB    . ASP B 2 129 ? 17.110  20.859 12.510  1.00 27.68  ? 425  ASP A CB    1 
ATOM   1186 C  CG    . ASP B 2 129 ? 16.039  21.548 11.646  1.00 37.84  ? 425  ASP A CG    1 
ATOM   1187 O  OD1   . ASP B 2 129 ? 15.744  21.071 10.533  1.00 38.58  ? 425  ASP A OD1   1 
ATOM   1188 O  OD2   . ASP B 2 129 ? 15.482  22.573 12.083  1.00 40.60  ? 425  ASP A OD2   1 
ATOM   1189 N  N     . GLU B 2 130 ? 18.809  18.565 13.934  1.00 30.60  ? 426  GLU A N     1 
ATOM   1190 C  CA    . GLU B 2 130 ? 20.132  18.122 14.374  1.00 37.36  ? 426  GLU A CA    1 
ATOM   1191 C  C     . GLU B 2 130 ? 20.515  16.772 13.774  1.00 29.64  ? 426  GLU A C     1 
ATOM   1192 O  O     . GLU B 2 130 ? 21.702  16.501 13.576  1.00 38.77  ? 426  GLU A O     1 
ATOM   1193 C  CB    . GLU B 2 130 ? 20.202  18.066 15.901  1.00 40.63  ? 426  GLU A CB    1 
ATOM   1194 N  N     . ALA B 2 131 ? 19.542  15.911 13.472  1.00 29.02  ? 427  ALA A N     1 
ATOM   1195 C  CA    . ALA B 2 131 ? 19.891  14.654 12.812  1.00 28.89  ? 427  ALA A CA    1 
ATOM   1196 C  C     . ALA B 2 131 ? 20.292  14.876 11.356  1.00 30.43  ? 427  ALA A C     1 
ATOM   1197 O  O     . ALA B 2 131 ? 21.046  14.078 10.792  1.00 32.74  ? 427  ALA A O     1 
ATOM   1198 C  CB    . ALA B 2 131 ? 18.726  13.662 12.896  1.00 35.31  ? 427  ALA A CB    1 
ATOM   1199 N  N     . VAL B 2 132 ? 19.799  15.938 10.727  1.00 30.60  ? 428  VAL A N     1 
ATOM   1200 C  CA    . VAL B 2 132 ? 20.118  16.181 9.321   1.00 34.52  ? 428  VAL A CA    1 
ATOM   1201 C  C     . VAL B 2 132 ? 21.413  16.967 9.178   1.00 27.88  ? 428  VAL A C     1 
ATOM   1202 O  O     . VAL B 2 132 ? 22.277  16.616 8.370   1.00 25.01  ? 428  VAL A O     1 
ATOM   1203 C  CB    . VAL B 2 132 ? 18.944  16.901 8.621   1.00 33.15  ? 428  VAL A CB    1 
ATOM   1204 C  CG1   . VAL B 2 132 ? 19.309  17.212 7.169   1.00 36.11  ? 428  VAL A CG1   1 
ATOM   1205 C  CG2   . VAL B 2 132 ? 17.676  16.055 8.701   1.00 29.47  ? 428  VAL A CG2   1 
ATOM   1206 N  N     . TYR B 2 133 ? 21.574  18.028 9.975   1.00 28.80  ? 429  TYR A N     1 
ATOM   1207 C  CA    . TYR B 2 133 ? 22.724  18.916 9.854   1.00 28.94  ? 429  TYR A CA    1 
ATOM   1208 C  C     . TYR B 2 133 ? 23.864  18.571 10.801  1.00 36.80  ? 429  TYR A C     1 
ATOM   1209 O  O     . TYR B 2 133 ? 24.977  19.061 10.599  1.00 43.93  ? 429  TYR A O     1 
ATOM   1210 C  CB    . TYR B 2 133 ? 22.287  20.364 10.085  1.00 23.74  ? 429  TYR A CB    1 
ATOM   1211 C  CG    . TYR B 2 133 ? 21.185  20.788 9.144   1.00 24.75  ? 429  TYR A CG    1 
ATOM   1212 C  CD1   . TYR B 2 133 ? 19.975  21.260 9.621   1.00 25.76  ? 429  TYR A CD1   1 
ATOM   1213 C  CD2   . TYR B 2 133 ? 21.356  20.703 7.778   1.00 32.60  ? 429  TYR A CD2   1 
ATOM   1214 C  CE1   . TYR B 2 133 ? 18.971  21.643 8.761   1.00 23.70  ? 429  TYR A CE1   1 
ATOM   1215 C  CE2   . TYR B 2 133 ? 20.355  21.082 6.905   1.00 29.26  ? 429  TYR A CE2   1 
ATOM   1216 C  CZ    . TYR B 2 133 ? 19.172  21.546 7.397   1.00 27.60  ? 429  TYR A CZ    1 
ATOM   1217 O  OH    . TYR B 2 133 ? 18.175  21.919 6.525   1.00 24.03  ? 429  TYR A OH    1 
ATOM   1218 N  N     . GLY B 2 134 ? 23.628  17.742 11.817  1.00 39.32  ? 430  GLY A N     1 
ATOM   1219 C  CA    . GLY B 2 134 ? 24.637  17.474 12.819  1.00 40.13  ? 430  GLY A CA    1 
ATOM   1220 C  C     . GLY B 2 134 ? 24.718  18.591 13.842  1.00 46.16  ? 430  GLY A C     1 
ATOM   1221 O  O     . GLY B 2 134 ? 24.091  19.644 13.723  1.00 40.74  ? 430  GLY A O     1 
ATOM   1222 N  N     . LYS B 2 135 ? 25.514  18.353 14.878  1.00 53.84  ? 431  LYS A N     1 
ATOM   1223 C  CA    . LYS B 2 135 ? 25.648  19.294 15.979  1.00 53.33  ? 431  LYS A CA    1 
ATOM   1224 C  C     . LYS B 2 135 ? 27.097  19.732 16.113  1.00 55.56  ? 431  LYS A C     1 
ATOM   1225 O  O     . LYS B 2 135 ? 28.015  18.911 16.019  1.00 53.70  ? 431  LYS A O     1 
ATOM   1226 C  CB    . LYS B 2 135 ? 25.164  18.677 17.296  1.00 48.35  ? 431  LYS A CB    1 
ATOM   1227 N  N     . GLY B 2 136 ? 27.295  21.030 16.309  1.00 51.75  ? 432  GLY A N     1 
ATOM   1228 C  CA    . GLY B 2 136 ? 28.598  21.522 16.734  1.00 54.58  ? 432  GLY A CA    1 
ATOM   1229 C  C     . GLY B 2 136 ? 29.604  21.544 15.609  1.00 64.11  ? 432  GLY A C     1 
ATOM   1230 O  O     . GLY B 2 136 ? 29.372  22.148 14.558  1.00 65.03  ? 432  GLY A O     1 
ATOM   1231 N  N     . ALA B 2 137 ? 30.748  20.898 15.841  1.00 68.16  ? 433  ALA A N     1 
ATOM   1232 C  CA    . ALA B 2 137 ? 31.832  20.907 14.863  1.00 69.27  ? 433  ALA A CA    1 
ATOM   1233 C  C     . ALA B 2 137 ? 31.376  20.321 13.532  1.00 68.88  ? 433  ALA A C     1 
ATOM   1234 O  O     . ALA B 2 137 ? 31.444  20.979 12.487  1.00 72.25  ? 433  ALA A O     1 
ATOM   1235 C  CB    . ALA B 2 137 ? 33.036  20.136 15.410  1.00 66.60  ? 433  ALA A CB    1 
ATOM   1236 N  N     . LYS B 2 138 ? 30.885  19.086 13.557  1.00 65.07  ? 434  LYS A N     1 
ATOM   1237 C  CA    . LYS B 2 138 ? 30.490  18.374 12.352  1.00 58.05  ? 434  LYS A CA    1 
ATOM   1238 C  C     . LYS B 2 138 ? 29.199  18.914 11.722  1.00 52.47  ? 434  LYS A C     1 
ATOM   1239 O  O     . LYS B 2 138 ? 28.627  18.248 10.852  1.00 48.66  ? 434  LYS A O     1 
ATOM   1240 C  CB    . LYS B 2 138 ? 30.360  16.880 12.661  1.00 57.02  ? 434  LYS A CB    1 
ATOM   1241 C  CG    . LYS B 2 138 ? 31.586  16.306 13.363  1.00 61.72  ? 434  LYS A CG    1 
ATOM   1242 C  CD    . LYS B 2 138 ? 31.428  14.824 13.685  1.00 63.87  ? 434  LYS A CD    1 
ATOM   1243 C  CE    . LYS B 2 138 ? 31.832  13.940 12.505  1.00 61.93  ? 434  LYS A CE    1 
ATOM   1244 N  NZ    . LYS B 2 138 ? 33.294  13.636 12.488  1.00 61.50  ? 434  LYS A NZ    1 
ATOM   1245 N  N     . ARG B 2 139 ? 28.745  20.102 12.114  1.00 49.63  ? 435  ARG A N     1 
ATOM   1246 C  CA    . ARG B 2 139 ? 27.549  20.683 11.519  1.00 47.78  ? 435  ARG A CA    1 
ATOM   1247 C  C     . ARG B 2 139 ? 27.830  21.094 10.079  1.00 54.00  ? 435  ARG A C     1 
ATOM   1248 O  O     . ARG B 2 139 ? 28.745  21.883 9.823   1.00 63.44  ? 435  ARG A O     1 
ATOM   1249 C  CB    . ARG B 2 139 ? 27.086  21.882 12.335  1.00 40.37  ? 435  ARG A CB    1 
ATOM   1250 C  CG    . ARG B 2 139 ? 25.666  22.301 12.054  1.00 44.83  ? 435  ARG A CG    1 
ATOM   1251 C  CD    . ARG B 2 139 ? 24.983  22.804 13.310  1.00 52.51  ? 435  ARG A CD    1 
ATOM   1252 N  NE    . ARG B 2 139 ? 23.581  23.097 13.047  1.00 51.64  ? 435  ARG A NE    1 
ATOM   1253 C  CZ    . ARG B 2 139 ? 23.161  24.214 12.469  1.00 49.21  ? 435  ARG A CZ    1 
ATOM   1254 N  NH1   . ARG B 2 139 ? 24.042  25.141 12.113  1.00 55.31  ? 435  ARG A NH1   1 
ATOM   1255 N  NH2   . ARG B 2 139 ? 21.866  24.405 12.250  1.00 48.05  ? 435  ARG A NH2   1 
ATOM   1256 N  N     . ALA B 2 140 ? 27.039  20.567 9.144   1.00 48.80  ? 436  ALA A N     1 
ATOM   1257 C  CA    . ALA B 2 140 ? 27.262  20.790 7.722   1.00 37.91  ? 436  ALA A CA    1 
ATOM   1258 C  C     . ALA B 2 140 ? 25.952  20.651 6.963   1.00 39.07  ? 436  ALA A C     1 
ATOM   1259 O  O     . ALA B 2 140 ? 25.054  19.902 7.364   1.00 38.04  ? 436  ALA A O     1 
ATOM   1260 C  CB    . ALA B 2 140 ? 28.289  19.813 7.147   1.00 34.70  ? 436  ALA A CB    1 
ATOM   1261 N  N     . VAL B 2 141 ? 25.851  21.383 5.864   1.00 42.71  ? 437  VAL A N     1 
ATOM   1262 C  CA    . VAL B 2 141 ? 24.704  21.225 4.970   1.00 38.76  ? 437  VAL A CA    1 
ATOM   1263 C  C     . VAL B 2 141 ? 24.902  19.948 4.159   1.00 37.23  ? 437  VAL A C     1 
ATOM   1264 O  O     . VAL B 2 141 ? 25.954  19.792 3.528   1.00 38.17  ? 437  VAL A O     1 
ATOM   1265 C  CB    . VAL B 2 141 ? 24.558  22.438 4.057   1.00 45.32  ? 437  VAL A CB    1 
ATOM   1266 C  CG1   . VAL B 2 141 ? 23.349  22.272 3.145   1.00 47.07  ? 437  VAL A CG1   1 
ATOM   1267 C  CG2   . VAL B 2 141 ? 24.446  23.721 4.891   1.00 42.90  ? 437  VAL A CG2   1 
ATOM   1268 N  N     . PRO B 2 142 ? 23.958  19.019 4.174   1.00 38.68  ? 438  PRO A N     1 
ATOM   1269 C  CA    . PRO B 2 142 ? 24.139  17.755 3.454   1.00 42.37  ? 438  PRO A CA    1 
ATOM   1270 C  C     . PRO B 2 142 ? 23.918  17.955 1.959   1.00 42.92  ? 438  PRO A C     1 
ATOM   1271 O  O     . PRO B 2 142 ? 23.593  19.048 1.494   1.00 42.58  ? 438  PRO A O     1 
ATOM   1272 C  CB    . PRO B 2 142 ? 23.078  16.839 4.071   1.00 44.00  ? 438  PRO A CB    1 
ATOM   1273 C  CG    . PRO B 2 142 ? 22.006  17.770 4.546   1.00 40.96  ? 438  PRO A CG    1 
ATOM   1274 C  CD    . PRO B 2 142 ? 22.671  19.080 4.894   1.00 33.14  ? 438  PRO A CD    1 
ATOM   1275 N  N     . ASP B 2 143 ? 24.110  16.867 1.213   1.00 45.25  ? 439  ASP A N     1 
ATOM   1276 C  CA    . ASP B 2 143 ? 23.968  16.895 -0.235  1.00 47.95  ? 439  ASP A CA    1 
ATOM   1277 C  C     . ASP B 2 143 ? 22.536  17.221 -0.632  1.00 43.04  ? 439  ASP A C     1 
ATOM   1278 O  O     . ASP B 2 143 ? 21.585  16.936 0.101   1.00 35.53  ? 439  ASP A O     1 
ATOM   1279 C  CB    . ASP B 2 143 ? 24.366  15.549 -0.840  1.00 57.49  ? 439  ASP A CB    1 
ATOM   1280 C  CG    . ASP B 2 143 ? 25.861  15.410 -1.017  1.00 78.59  ? 439  ASP A CG    1 
ATOM   1281 O  OD1   . ASP B 2 143 ? 26.344  14.258 -1.092  1.00 88.40  ? 439  ASP A OD1   1 
ATOM   1282 O  OD2   . ASP B 2 143 ? 26.551  16.452 -1.081  1.00 80.82  ? 439  ASP A OD2   1 
ATOM   1283 N  N     . GLU B 2 144 ? 22.395  17.804 -1.824  1.00 42.44  ? 440  GLU A N     1 
ATOM   1284 C  CA    . GLU B 2 144 ? 21.093  18.246 -2.322  1.00 42.39  ? 440  GLU A CA    1 
ATOM   1285 C  C     . GLU B 2 144 ? 19.995  17.196 -2.196  1.00 43.32  ? 440  GLU A C     1 
ATOM   1286 O  O     . GLU B 2 144 ? 18.889  17.553 -1.761  1.00 39.27  ? 440  GLU A O     1 
ATOM   1287 C  CB    . GLU B 2 144 ? 21.232  18.705 -3.778  1.00 51.22  ? 440  GLU A CB    1 
ATOM   1288 C  CG    . GLU B 2 144 ? 19.913  19.081 -4.423  1.00 58.58  ? 440  GLU A CG    1 
ATOM   1289 C  CD    . GLU B 2 144 ? 20.095  19.986 -5.629  1.00 70.53  ? 440  GLU A CD    1 
ATOM   1290 O  OE1   . GLU B 2 144 ? 20.516  21.151 -5.448  1.00 71.06  ? 440  GLU A OE1   1 
ATOM   1291 O  OE2   . GLU B 2 144 ? 19.822  19.525 -6.758  1.00 74.08  ? 440  GLU A OE2   1 
ATOM   1292 N  N     . PRO B 2 145 ? 20.201  15.921 -2.558  1.00 38.13  ? 441  PRO A N     1 
ATOM   1293 C  CA    . PRO B 2 145 ? 19.123  14.942 -2.332  1.00 33.32  ? 441  PRO A CA    1 
ATOM   1294 C  C     . PRO B 2 145 ? 18.698  14.855 -0.877  1.00 33.18  ? 441  PRO A C     1 
ATOM   1295 O  O     . PRO B 2 145 ? 17.495  14.868 -0.585  1.00 32.05  ? 441  PRO A O     1 
ATOM   1296 C  CB    . PRO B 2 145 ? 19.733  13.624 -2.839  1.00 39.79  ? 441  PRO A CB    1 
ATOM   1297 C  CG    . PRO B 2 145 ? 20.768  14.040 -3.812  1.00 39.69  ? 441  PRO A CG    1 
ATOM   1298 C  CD    . PRO B 2 145 ? 21.338  15.320 -3.280  1.00 36.94  ? 441  PRO A CD    1 
ATOM   1299 N  N     . VAL B 2 146 ? 19.652  14.779 0.052   1.00 33.70  ? 442  VAL A N     1 
ATOM   1300 C  CA    . VAL B 2 146 ? 19.291  14.674 1.464   1.00 29.31  ? 442  VAL A CA    1 
ATOM   1301 C  C     . VAL B 2 146 ? 18.648  15.970 1.946   1.00 33.36  ? 442  VAL A C     1 
ATOM   1302 O  O     . VAL B 2 146 ? 17.650  15.956 2.680   1.00 29.49  ? 442  VAL A O     1 
ATOM   1303 C  CB    . VAL B 2 146 ? 20.529  14.305 2.299   1.00 36.03  ? 442  VAL A CB    1 
ATOM   1304 C  CG1   . VAL B 2 146 ? 20.244  14.471 3.782   1.00 34.07  ? 442  VAL A CG1   1 
ATOM   1305 C  CG2   . VAL B 2 146 ? 20.981  12.877 1.980   1.00 37.75  ? 442  VAL A CG2   1 
ATOM   1306 N  N     . LEU B 2 147 ? 19.196  17.109 1.524   1.00 25.51  ? 443  LEU A N     1 
ATOM   1307 C  CA    . LEU B 2 147 ? 18.653  18.394 1.940   1.00 22.16  ? 443  LEU A CA    1 
ATOM   1308 C  C     . LEU B 2 147 ? 17.227  18.571 1.441   1.00 26.46  ? 443  LEU A C     1 
ATOM   1309 O  O     . LEU B 2 147 ? 16.328  18.950 2.208   1.00 23.05  ? 443  LEU A O     1 
ATOM   1310 C  CB    . LEU B 2 147 ? 19.546  19.520 1.430   1.00 35.10  ? 443  LEU A CB    1 
ATOM   1311 C  CG    . LEU B 2 147 ? 19.035  20.940 1.682   1.00 30.33  ? 443  LEU A CG    1 
ATOM   1312 C  CD1   . LEU B 2 147 ? 18.908  21.200 3.185   1.00 19.47  ? 443  LEU A CD1   1 
ATOM   1313 C  CD2   . LEU B 2 147 ? 19.986  21.935 1.031   1.00 25.97  ? 443  LEU A CD2   1 
ATOM   1314 N  N     . ALA B 2 148 ? 17.005  18.285 0.153   1.00 25.84  ? 444  ALA A N     1 
ATOM   1315 C  CA    . ALA B 2 148 ? 15.705  18.525 -0.466  1.00 28.74  ? 444  ALA A CA    1 
ATOM   1316 C  C     . ALA B 2 148 ? 14.621  17.660 0.160   1.00 27.86  ? 444  ALA A C     1 
ATOM   1317 O  O     . ALA B 2 148 ? 13.485  18.113 0.345   1.00 21.95  ? 444  ALA A O     1 
ATOM   1318 C  CB    . ALA B 2 148 ? 15.786  18.268 -1.973  1.00 35.29  ? 444  ALA A CB    1 
ATOM   1319 N  N     . GLU B 2 149 ? 14.950  16.409 0.481   1.00 26.51  ? 445  GLU A N     1 
ATOM   1320 C  CA    . GLU B 2 149 ? 14.009  15.556 1.193   1.00 25.60  ? 445  GLU A CA    1 
ATOM   1321 C  C     . GLU B 2 149 ? 13.635  16.168 2.533   1.00 20.72  ? 445  GLU A C     1 
ATOM   1322 O  O     . GLU B 2 149 ? 12.455  16.233 2.893   1.00 26.59  ? 445  GLU A O     1 
ATOM   1323 C  CB    . GLU B 2 149 ? 14.617  14.168 1.396   1.00 23.92  ? 445  GLU A CB    1 
ATOM   1324 C  CG    . GLU B 2 149 ? 13.981  13.379 2.539   1.00 43.02  ? 445  GLU A CG    1 
ATOM   1325 C  CD    . GLU B 2 149 ? 13.847  11.898 2.225   1.00 53.28  ? 445  GLU A CD    1 
ATOM   1326 O  OE1   . GLU B 2 149 ? 13.045  11.209 2.904   1.00 47.01  ? 445  GLU A OE1   1 
ATOM   1327 O  OE2   . GLU B 2 149 ? 14.552  11.428 1.300   1.00 51.87  ? 445  GLU A OE2   1 
ATOM   1328 N  N     . HIS B 2 150 ? 14.639  16.614 3.288   1.00 22.57  ? 446  HIS A N     1 
ATOM   1329 C  CA    . HIS B 2 150 ? 14.376  17.199 4.596   1.00 18.82  ? 446  HIS A CA    1 
ATOM   1330 C  C     . HIS B 2 150 ? 13.467  18.417 4.475   1.00 21.37  ? 446  HIS A C     1 
ATOM   1331 O  O     . HIS B 2 150 ? 12.453  18.517 5.178   1.00 19.04  ? 446  HIS A O     1 
ATOM   1332 C  CB    . HIS B 2 150 ? 15.700  17.550 5.288   1.00 22.36  ? 446  HIS A CB    1 
ATOM   1333 C  CG    . HIS B 2 150 ? 15.534  18.118 6.659   1.00 20.89  ? 446  HIS A CG    1 
ATOM   1334 N  ND1   . HIS B 2 150 ? 14.749  17.520 7.619   1.00 21.93  ? 446  HIS A ND1   1 
ATOM   1335 C  CD2   . HIS B 2 150 ? 16.027  19.245 7.226   1.00 22.51  ? 446  HIS A CD2   1 
ATOM   1336 C  CE1   . HIS B 2 150 ? 14.764  18.250 8.720   1.00 19.62  ? 446  HIS A CE1   1 
ATOM   1337 N  NE2   . HIS B 2 150 ? 15.533  19.301 8.509   1.00 17.06  ? 446  HIS A NE2   1 
ATOM   1338 N  N     . LEU B 2 151 ? 13.784  19.335 3.552   1.00 19.18  ? 447  LEU A N     1 
ATOM   1339 C  CA    . LEU B 2 151 ? 13.009  20.571 3.465   1.00 19.01  ? 447  LEU A CA    1 
ATOM   1340 C  C     . LEU B 2 151 ? 11.576  20.302 3.040   1.00 16.58  ? 447  LEU A C     1 
ATOM   1341 O  O     . LEU B 2 151 ? 10.643  20.898 3.588   1.00 17.00  ? 447  LEU A O     1 
ATOM   1342 C  CB    . LEU B 2 151 ? 13.661  21.549 2.491   1.00 16.90  ? 447  LEU A CB    1 
ATOM   1343 C  CG    . LEU B 2 151 ? 15.066  22.043 2.834   1.00 22.27  ? 447  LEU A CG    1 
ATOM   1344 C  CD1   . LEU B 2 151 ? 15.366  23.312 2.025   1.00 17.74  ? 447  LEU A CD1   1 
ATOM   1345 C  CD2   . LEU B 2 151 ? 15.205  22.312 4.328   1.00 19.77  ? 447  LEU A CD2   1 
ATOM   1346 N  N     . VAL B 2 152 ? 11.385  19.439 2.041   1.00 17.82  ? 448  VAL A N     1 
ATOM   1347 C  CA    . VAL B 2 152 ? 10.036  19.048 1.639   1.00 25.46  ? 448  VAL A CA    1 
ATOM   1348 C  C     . VAL B 2 152 ? 9.299   18.370 2.793   1.00 24.53  ? 448  VAL A C     1 
ATOM   1349 O  O     . VAL B 2 152 ? 8.110   18.618 3.016   1.00 17.15  ? 448  VAL A O     1 
ATOM   1350 C  CB    . VAL B 2 152 ? 10.093  18.145 0.393   1.00 29.27  ? 448  VAL A CB    1 
ATOM   1351 C  CG1   . VAL B 2 152 ? 8.717   17.602 0.063   1.00 20.33  ? 448  VAL A CG1   1 
ATOM   1352 C  CG2   . VAL B 2 152 ? 10.663  18.929 -0.793  1.00 27.16  ? 448  VAL A CG2   1 
ATOM   1353 N  N     . ARG B 2 153 ? 9.978   17.502 3.539   1.00 17.81  ? 449  ARG A N     1 
ATOM   1354 C  CA    . ARG B 2 153 ? 9.304   16.864 4.665   1.00 17.48  ? 449  ARG A CA    1 
ATOM   1355 C  C     . ARG B 2 153 ? 8.885   17.889 5.708   1.00 16.05  ? 449  ARG A C     1 
ATOM   1356 O  O     . ARG B 2 153 ? 7.805   17.775 6.302   1.00 15.74  ? 449  ARG A O     1 
ATOM   1357 C  CB    . ARG B 2 153 ? 10.197  15.793 5.286   1.00 18.19  ? 449  ARG A CB    1 
ATOM   1358 C  CG    . ARG B 2 153 ? 10.119  14.463 4.506   1.00 19.83  ? 449  ARG A CG    1 
ATOM   1359 C  CD    . ARG B 2 153 ? 11.046  13.419 5.083   1.00 20.77  ? 449  ARG A CD    1 
ATOM   1360 N  NE    . ARG B 2 153 ? 10.962  12.177 4.315   1.00 22.51  ? 449  ARG A NE    1 
ATOM   1361 C  CZ    . ARG B 2 153 ? 9.957   11.310 4.424   1.00 36.23  ? 449  ARG A CZ    1 
ATOM   1362 N  NH1   . ARG B 2 153 ? 8.958   11.543 5.276   1.00 31.97  ? 449  ARG A NH1   1 
ATOM   1363 N  NH2   . ARG B 2 153 ? 9.953   10.208 3.689   1.00 29.23  ? 449  ARG A NH2   1 
ATOM   1364 N  N     . LYS B 2 154 ? 9.725   18.905 5.938   1.00 15.33  ? 450  LYS A N     1 
ATOM   1365 C  CA    . LYS B 2 154 ? 9.353   19.959 6.873   1.00 14.14  ? 450  LYS A CA    1 
ATOM   1366 C  C     . LYS B 2 154 ? 8.136   20.717 6.362   1.00 17.84  ? 450  LYS A C     1 
ATOM   1367 O  O     . LYS B 2 154 ? 7.211   21.015 7.127   1.00 16.44  ? 450  LYS A O     1 
ATOM   1368 C  CB    . LYS B 2 154 ? 10.529  20.913 7.067   1.00 13.69  ? 450  LYS A CB    1 
ATOM   1369 C  CG    . LYS B 2 154 ? 11.659  20.452 7.972   1.00 16.33  ? 450  LYS A CG    1 
ATOM   1370 C  CD    . LYS B 2 154 ? 12.200  21.665 8.746   1.00 27.65  ? 450  LYS A CD    1 
ATOM   1371 C  CE    . LYS B 2 154 ? 13.521  22.104 8.177   1.00 30.13  ? 450  LYS A CE    1 
ATOM   1372 N  NZ    . LYS B 2 154 ? 14.171  23.168 8.975   1.00 26.94  ? 450  LYS A NZ    1 
ATOM   1373 N  N     . ALA B 2 155 ? 8.136   21.060 5.069   1.00 14.70  ? 451  ALA A N     1 
ATOM   1374 C  CA    . ALA B 2 155 ? 7.023   21.799 4.494   1.00 14.30  ? 451  ALA A CA    1 
ATOM   1375 C  C     . ALA B 2 155 ? 5.757   20.968 4.510   1.00 16.04  ? 451  ALA A C     1 
ATOM   1376 O  O     . ALA B 2 155 ? 4.674   21.487 4.802   1.00 14.53  ? 451  ALA A O     1 
ATOM   1377 C  CB    . ALA B 2 155 ? 7.371   22.224 3.069   1.00 15.06  ? 451  ALA A CB    1 
ATOM   1378 N  N     . ALA B 2 156 ? 5.875   19.670 4.199   1.00 18.46  ? 452  ALA A N     1 
ATOM   1379 C  CA    . ALA B 2 156 ? 4.723   18.782 4.288   1.00 17.67  ? 452  ALA A CA    1 
ATOM   1380 C  C     . ALA B 2 156 ? 4.195   18.701 5.718   1.00 15.64  ? 452  ALA A C     1 
ATOM   1381 O  O     . ALA B 2 156 ? 2.977   18.669 5.934   1.00 15.81  ? 452  ALA A O     1 
ATOM   1382 C  CB    . ALA B 2 156 ? 5.085   17.387 3.782   1.00 17.58  ? 452  ALA A CB    1 
ATOM   1383 N  N     . ALA B 2 157 ? 5.085   18.608 6.706   1.00 15.06  ? 453  ALA A N     1 
ATOM   1384 C  CA    . ALA B 2 157 ? 4.608   18.607 8.087   1.00 15.08  ? 453  ALA A CA    1 
ATOM   1385 C  C     . ALA B 2 157 ? 3.858   19.903 8.387   1.00 20.44  ? 453  ALA A C     1 
ATOM   1386 O  O     . ALA B 2 157 ? 2.760   19.887 8.950   1.00 17.03  ? 453  ALA A O     1 
ATOM   1387 C  CB    . ALA B 2 157 ? 5.773   18.421 9.065   1.00 15.20  ? 453  ALA A CB    1 
ATOM   1388 N  N     . ILE B 2 158 ? 4.423   21.038 7.981   1.00 14.54  ? 454  ILE A N     1 
ATOM   1389 C  CA    . ILE B 2 158 ? 3.760   22.316 8.243   1.00 14.33  ? 454  ILE A CA    1 
ATOM   1390 C  C     . ILE B 2 158 ? 2.373   22.331 7.619   1.00 13.28  ? 454  ILE A C     1 
ATOM   1391 O  O     . ILE B 2 158 ? 1.375   22.678 8.263   1.00 20.00  ? 454  ILE A O     1 
ATOM   1392 C  CB    . ILE B 2 158 ? 4.615   23.472 7.717   1.00 14.29  ? 454  ILE A CB    1 
ATOM   1393 C  CG1   . ILE B 2 158 ? 5.885   23.602 8.564   1.00 16.48  ? 454  ILE A CG1   1 
ATOM   1394 C  CG2   . ILE B 2 158 ? 3.776   24.763 7.736   1.00 16.40  ? 454  ILE A CG2   1 
ATOM   1395 C  CD1   . ILE B 2 158 ? 7.059   24.331 7.816   1.00 13.18  ? 454  ILE A CD1   1 
ATOM   1396 N  N     . TRP B 2 159 ? 2.296   21.919 6.364   1.00 16.91  ? 455  TRP A N     1 
ATOM   1397 C  CA    . TRP B 2 159 ? 1.033   21.805 5.652   1.00 14.97  ? 455  TRP A CA    1 
ATOM   1398 C  C     . TRP B 2 159 ? 0.029   20.960 6.427   1.00 25.10  ? 455  TRP A C     1 
ATOM   1399 O  O     . TRP B 2 159 ? -1.141  21.338 6.575   1.00 17.57  ? 455  TRP A O     1 
ATOM   1400 C  CB    . TRP B 2 159 ? 1.326   21.191 4.285   1.00 15.97  ? 455  TRP A CB    1 
ATOM   1401 C  CG    . TRP B 2 159 ? 0.208   21.197 3.305   1.00 26.73  ? 455  TRP A CG    1 
ATOM   1402 C  CD1   . TRP B 2 159 ? -0.458  20.110 2.813   1.00 34.24  ? 455  TRP A CD1   1 
ATOM   1403 C  CD2   . TRP B 2 159 ? -0.346  22.340 2.648   1.00 22.96  ? 455  TRP A CD2   1 
ATOM   1404 N  NE1   . TRP B 2 159 ? -1.408  20.513 1.900   1.00 33.11  ? 455  TRP A NE1   1 
ATOM   1405 C  CE2   . TRP B 2 159 ? -1.357  21.877 1.779   1.00 25.18  ? 455  TRP A CE2   1 
ATOM   1406 C  CE3   . TRP B 2 159 ? -0.095  23.713 2.722   1.00 24.50  ? 455  TRP A CE3   1 
ATOM   1407 C  CZ2   . TRP B 2 159 ? -2.114  22.738 0.983   1.00 28.96  ? 455  TRP A CZ2   1 
ATOM   1408 C  CZ3   . TRP B 2 159 ? -0.851  24.571 1.934   1.00 31.05  ? 455  TRP A CZ3   1 
ATOM   1409 C  CH2   . TRP B 2 159 ? -1.847  24.078 1.074   1.00 23.74  ? 455  TRP A CH2   1 
ATOM   1410 N  N     . ALA B 2 160 ? 0.472   19.805 6.927   1.00 16.89  ? 456  ALA A N     1 
ATOM   1411 C  CA    . ALA B 2 160 ? -0.442  18.895 7.608   1.00 21.57  ? 456  ALA A CA    1 
ATOM   1412 C  C     . ALA B 2 160 ? -0.790  19.374 9.009   1.00 22.11  ? 456  ALA A C     1 
ATOM   1413 O  O     . ALA B 2 160 ? -1.882  19.086 9.502   1.00 23.57  ? 456  ALA A O     1 
ATOM   1414 C  CB    . ALA B 2 160 ? 0.164   17.489 7.699   1.00 17.59  ? 456  ALA A CB    1 
ATOM   1415 N  N     . LEU B 2 161 ? 0.119   20.078 9.669   1.00 14.45  ? 457  LEU A N     1 
ATOM   1416 C  CA    . LEU B 2 161 ? -0.069  20.425 11.072  1.00 17.53  ? 457  LEU A CA    1 
ATOM   1417 C  C     . LEU B 2 161 ? -0.851  21.714 11.306  1.00 23.47  ? 457  LEU A C     1 
ATOM   1418 O  O     . LEU B 2 161 ? -1.298  21.941 12.436  1.00 19.11  ? 457  LEU A O     1 
ATOM   1419 C  CB    . LEU B 2 161 ? 1.286   20.559 11.764  1.00 17.01  ? 457  LEU A CB    1 
ATOM   1420 C  CG    . LEU B 2 161 ? 2.063   19.244 11.848  1.00 21.84  ? 457  LEU A CG    1 
ATOM   1421 C  CD1   . LEU B 2 161 ? 3.480   19.555 12.273  1.00 25.42  ? 457  LEU A CD1   1 
ATOM   1422 C  CD2   . LEU B 2 161 ? 1.388   18.254 12.776  1.00 17.94  ? 457  LEU A CD2   1 
ATOM   1423 N  N     . GLU B 2 162 ? -1.029  22.561 10.291  1.00 19.87  ? 458  GLU A N     1 
ATOM   1424 C  CA    . GLU B 2 162 ? -1.667  23.855 10.539  1.00 16.79  ? 458  GLU A CA    1 
ATOM   1425 C  C     . GLU B 2 162 ? -3.053  23.689 11.160  1.00 18.15  ? 458  GLU A C     1 
ATOM   1426 O  O     . GLU B 2 162 ? -3.382  24.334 12.163  1.00 19.65  ? 458  GLU A O     1 
ATOM   1427 C  CB    . GLU B 2 162 ? -1.761  24.654 9.246   1.00 16.91  ? 458  GLU A CB    1 
ATOM   1428 C  CG    . GLU B 2 162 ? -2.647  25.898 9.372   1.00 28.40  ? 458  GLU A CG    1 
ATOM   1429 C  CD    . GLU B 2 162 ? -2.546  26.816 8.155   1.00 42.70  ? 458  GLU A CD    1 
ATOM   1430 O  OE1   . GLU B 2 162 ? -1.722  26.521 7.265   1.00 40.66  ? 458  GLU A OE1   1 
ATOM   1431 O  OE2   . GLU B 2 162 ? -3.281  27.831 8.090   1.00 44.84  ? 458  GLU A OE2   1 
ATOM   1432 N  N     . ARG B 2 163 ? -3.873  22.809 10.582  1.00 16.64  ? 459  ARG A N     1 
ATOM   1433 C  CA    . ARG B 2 163 ? -5.243  22.611 11.056  1.00 18.97  ? 459  ARG A CA    1 
ATOM   1434 C  C     . ARG B 2 163 ? -5.323  22.126 12.506  1.00 25.96  ? 459  ARG A C     1 
ATOM   1435 O  O     . ARG B 2 163 ? -6.012  22.774 13.315  1.00 23.24  ? 459  ARG A O     1 
ATOM   1436 C  CB    . ARG B 2 163 ? -5.959  21.666 10.081  1.00 30.80  ? 459  ARG A CB    1 
ATOM   1437 C  CG    . ARG B 2 163 ? -7.467  21.781 10.034  1.00 48.66  ? 459  ARG A CG    1 
ATOM   1438 C  CD    . ARG B 2 163 ? -8.066  20.710 9.109   1.00 68.18  ? 459  ARG A CD    1 
ATOM   1439 N  NE    . ARG B 2 163 ? -7.154  20.296 8.035   1.00 74.29  ? 459  ARG A NE    1 
ATOM   1440 C  CZ    . ARG B 2 163 ? -6.959  20.973 6.905   1.00 72.64  ? 459  ARG A CZ    1 
ATOM   1441 N  NH1   . ARG B 2 163 ? -7.606  22.113 6.689   1.00 70.07  ? 459  ARG A NH1   1 
ATOM   1442 N  NH2   . ARG B 2 163 ? -6.109  20.517 5.993   1.00 71.00  ? 459  ARG A NH2   1 
ATOM   1443 N  N     . PRO B 2 164 ? -4.694  21.007 12.904  1.00 30.74  ? 460  PRO A N     1 
ATOM   1444 C  CA    . PRO B 2 164 ? -4.776  20.617 14.328  1.00 27.72  ? 460  PRO A CA    1 
ATOM   1445 C  C     . PRO B 2 164 ? -4.216  21.656 15.289  1.00 24.61  ? 460  PRO A C     1 
ATOM   1446 O  O     . PRO B 2 164 ? -4.728  21.784 16.409  1.00 19.84  ? 460  PRO A O     1 
ATOM   1447 C  CB    . PRO B 2 164 ? -3.968  19.309 14.395  1.00 26.25  ? 460  PRO A CB    1 
ATOM   1448 C  CG    . PRO B 2 164 ? -3.174  19.275 13.132  1.00 27.02  ? 460  PRO A CG    1 
ATOM   1449 C  CD    . PRO B 2 164 ? -4.024  19.960 12.111  1.00 29.13  ? 460  PRO A CD    1 
ATOM   1450 N  N     . PHE B 2 165 ? -3.177  22.395 14.895  1.00 16.79  ? 461  PHE A N     1 
ATOM   1451 C  CA    . PHE B 2 165 ? -2.636  23.419 15.779  1.00 22.58  ? 461  PHE A CA    1 
ATOM   1452 C  C     . PHE B 2 165 ? -3.618  24.577 15.948  1.00 19.01  ? 461  PHE A C     1 
ATOM   1453 O  O     . PHE B 2 165 ? -3.891  25.009 17.075  1.00 16.63  ? 461  PHE A O     1 
ATOM   1454 C  CB    . PHE B 2 165 ? -1.279  23.901 15.256  1.00 13.25  ? 461  PHE A CB    1 
ATOM   1455 C  CG    . PHE B 2 165 ? -0.117  23.127 15.824  1.00 16.93  ? 461  PHE A CG    1 
ATOM   1456 C  CD1   . PHE B 2 165 ? 0.601   23.609 16.905  1.00 14.62  ? 461  PHE A CD1   1 
ATOM   1457 C  CD2   . PHE B 2 165 ? 0.223   21.892 15.306  1.00 16.42  ? 461  PHE A CD2   1 
ATOM   1458 C  CE1   . PHE B 2 165 ? 1.661   22.862 17.461  1.00 23.18  ? 461  PHE A CE1   1 
ATOM   1459 C  CE2   . PHE B 2 165 ? 1.272   21.149 15.839  1.00 17.28  ? 461  PHE A CE2   1 
ATOM   1460 C  CZ    . PHE B 2 165 ? 1.996   21.627 16.912  1.00 15.18  ? 461  PHE A CZ    1 
ATOM   1461 N  N     . LEU B 2 166 ? -4.180  25.080 14.843  1.00 14.58  ? 462  LEU A N     1 
ATOM   1462 C  CA    . LEU B 2 166 ? -5.186  26.136 14.948  1.00 20.26  ? 462  LEU A CA    1 
ATOM   1463 C  C     . LEU B 2 166 ? -6.399  25.652 15.728  1.00 23.64  ? 462  LEU A C     1 
ATOM   1464 O  O     . LEU B 2 166 ? -7.001  26.414 16.497  1.00 27.86  ? 462  LEU A O     1 
ATOM   1465 C  CB    . LEU B 2 166 ? -5.608  26.621 13.557  1.00 20.42  ? 462  LEU A CB    1 
ATOM   1466 C  CG    . LEU B 2 166 ? -4.594  27.494 12.810  1.00 22.37  ? 462  LEU A CG    1 
ATOM   1467 C  CD1   . LEU B 2 166 ? -5.095  27.821 11.389  1.00 27.19  ? 462  LEU A CD1   1 
ATOM   1468 C  CD2   . LEU B 2 166 ? -4.297  28.793 13.591  1.00 26.60  ? 462  LEU A CD2   1 
ATOM   1469 N  N     . ASP B 2 167 ? -6.760  24.378 15.558  1.00 23.91  ? 463  ASP A N     1 
ATOM   1470 C  CA    . ASP B 2 167 ? -7.873  23.801 16.311  1.00 23.36  ? 463  ASP A CA    1 
ATOM   1471 C  C     . ASP B 2 167 ? -7.615  23.840 17.815  1.00 19.29  ? 463  ASP A C     1 
ATOM   1472 O  O     . ASP B 2 167 ? -8.497  24.194 18.601  1.00 19.09  ? 463  ASP A O     1 
ATOM   1473 C  CB    . ASP B 2 167 ? -8.115  22.359 15.863  1.00 35.19  ? 463  ASP A CB    1 
ATOM   1474 C  CG    . ASP B 2 167 ? -9.030  22.269 14.660  1.00 54.40  ? 463  ASP A CG    1 
ATOM   1475 O  OD1   . ASP B 2 167 ? -9.104  21.174 14.052  1.00 65.49  ? 463  ASP A OD1   1 
ATOM   1476 O  OD2   . ASP B 2 167 ? -9.665  23.294 14.325  1.00 58.42  ? 463  ASP A OD2   1 
ATOM   1477 N  N     . GLU B 2 168 ? -6.432  23.417 18.246  1.00 18.36  ? 464  GLU A N     1 
ATOM   1478 C  CA    . GLU B 2 168 ? -6.188  23.439 19.680  1.00 21.73  ? 464  GLU A CA    1 
ATOM   1479 C  C     . GLU B 2 168 ? -6.074  24.876 20.183  1.00 17.30  ? 464  GLU A C     1 
ATOM   1480 O  O     . GLU B 2 168 ? -6.608  25.205 21.248  1.00 19.41  ? 464  GLU A O     1 
ATOM   1481 C  CB    . GLU B 2 168 ? -4.939  22.629 20.032  1.00 22.31  ? 464  GLU A CB    1 
ATOM   1482 C  CG    . GLU B 2 168 ? -4.910  22.255 21.519  1.00 33.19  ? 464  GLU A CG    1 
ATOM   1483 C  CD    . GLU B 2 168 ? -3.650  21.505 21.947  1.00 55.71  ? 464  GLU A CD    1 
ATOM   1484 O  OE1   . GLU B 2 168 ? -2.901  21.017 21.071  1.00 61.69  ? 464  GLU A OE1   1 
ATOM   1485 O  OE2   . GLU B 2 168 ? -3.414  21.401 23.173  1.00 62.58  ? 464  GLU A OE2   1 
ATOM   1486 N  N     . LEU B 2 169 ? -5.394  25.743 19.427  1.00 16.30  ? 465  LEU A N     1 
ATOM   1487 C  CA    . LEU B 2 169 ? -5.352  27.165 19.780  1.00 16.25  ? 465  LEU A CA    1 
ATOM   1488 C  C     . LEU B 2 169 ? -6.750  27.722 19.967  1.00 20.13  ? 465  LEU A C     1 
ATOM   1489 O  O     . LEU B 2 169 ? -7.017  28.439 20.943  1.00 19.54  ? 465  LEU A O     1 
ATOM   1490 C  CB    . LEU B 2 169 ? -4.607  27.968 18.709  1.00 15.26  ? 465  LEU A CB    1 
ATOM   1491 C  CG    . LEU B 2 169 ? -3.102  27.776 18.732  1.00 23.61  ? 465  LEU A CG    1 
ATOM   1492 C  CD1   . LEU B 2 169 ? -2.487  28.382 17.498  1.00 19.60  ? 465  LEU A CD1   1 
ATOM   1493 C  CD2   . LEU B 2 169 ? -2.528  28.407 20.005  1.00 20.69  ? 465  LEU A CD2   1 
ATOM   1494 N  N     . ARG B 2 170 ? -7.674  27.371 19.069  1.00 18.05  ? 466  ARG A N     1 
ATOM   1495 C  CA    . ARG B 2 170 ? -9.039  27.874 19.205  1.00 20.95  ? 466  ARG A CA    1 
ATOM   1496 C  C     . ARG B 2 170 ? -9.706  27.323 20.454  1.00 27.68  ? 466  ARG A C     1 
ATOM   1497 O  O     . ARG B 2 170 ? -10.428 28.054 21.149  1.00 21.75  ? 466  ARG A O     1 
ATOM   1498 C  CB    . ARG B 2 170 ? -9.873  27.524 17.975  1.00 28.53  ? 466  ARG A CB    1 
ATOM   1499 C  CG    . ARG B 2 170 ? -9.510  28.313 16.720  1.00 45.65  ? 466  ARG A CG    1 
ATOM   1500 C  CD    . ARG B 2 170 ? -10.645 28.258 15.688  1.00 55.28  ? 466  ARG A CD    1 
ATOM   1501 N  NE    . ARG B 2 170 ? -10.412 27.272 14.633  1.00 57.46  ? 466  ARG A NE    1 
ATOM   1502 C  CZ    . ARG B 2 170 ? -9.725  27.514 13.522  1.00 62.08  ? 466  ARG A CZ    1 
ATOM   1503 N  NH1   . ARG B 2 170 ? -9.192  28.712 13.320  1.00 61.88  ? 466  ARG A NH1   1 
ATOM   1504 N  NH2   . ARG B 2 170 ? -9.569  26.560 12.614  1.00 66.62  ? 466  ARG A NH2   1 
ATOM   1505 N  N     . ARG B 2 171 ? -9.491  26.034 20.750  1.00 20.60  ? 467  ARG A N     1 
ATOM   1506 C  CA    . ARG B 2 171 ? -10.074 25.451 21.959  1.00 26.28  ? 467  ARG A CA    1 
ATOM   1507 C  C     . ARG B 2 171 ? -9.534  26.137 23.210  1.00 21.92  ? 467  ARG A C     1 
ATOM   1508 O  O     . ARG B 2 171 ? -10.263 26.319 24.191  1.00 27.53  ? 467  ARG A O     1 
ATOM   1509 C  CB    . ARG B 2 171 ? -9.794  23.943 22.022  1.00 28.52  ? 467  ARG A CB    1 
ATOM   1510 C  CG    . ARG B 2 171 ? -10.756 23.088 21.213  1.00 35.19  ? 467  ARG A CG    1 
ATOM   1511 C  CD    . ARG B 2 171 ? -10.609 21.601 21.570  1.00 36.82  ? 467  ARG A CD    1 
ATOM   1512 N  NE    . ARG B 2 171 ? -9.256  21.092 21.321  1.00 38.81  ? 467  ARG A NE    1 
ATOM   1513 C  CZ    . ARG B 2 171 ? -8.803  20.717 20.123  1.00 36.24  ? 467  ARG A CZ    1 
ATOM   1514 N  NH1   . ARG B 2 171 ? -9.587  20.811 19.057  1.00 37.21  ? 467  ARG A NH1   1 
ATOM   1515 N  NH2   . ARG B 2 171 ? -7.559  20.261 19.983  1.00 26.91  ? 467  ARG A NH2   1 
ATOM   1516 N  N     . ASN B 2 172 ? -8.257  26.532 23.186  1.00 28.74  ? 468  ASN A N     1 
ATOM   1517 C  CA    . ASN B 2 172 ? -7.634  27.264 24.276  1.00 32.36  ? 468  ASN A CA    1 
ATOM   1518 C  C     . ASN B 2 172 ? -7.965  28.750 24.272  1.00 27.59  ? 468  ASN A C     1 
ATOM   1519 O  O     . ASN B 2 172 ? -7.469  29.462 25.146  1.00 34.28  ? 468  ASN A O     1 
ATOM   1520 C  CB    . ASN B 2 172 ? -6.106  27.140 24.211  1.00 29.85  ? 468  ASN A CB    1 
ATOM   1521 C  CG    . ASN B 2 172 ? -5.593  25.734 24.504  1.00 27.46  ? 468  ASN A CG    1 
ATOM   1522 O  OD1   . ASN B 2 172 ? -4.388  25.485 24.418  1.00 32.54  ? 468  ASN A OD1   1 
ATOM   1523 N  ND2   . ASN B 2 172 ? -6.477  24.836 24.801  1.00 29.03  ? 468  ASN A ND2   1 
ATOM   1524 N  N     . GLU B 2 173 ? -8.725  29.235 23.290  1.00 27.59  ? 469  GLU A N     1 
ATOM   1525 C  CA    . GLU B 2 173 ? -8.937  30.673 23.097  1.00 26.96  ? 469  GLU A CA    1 
ATOM   1526 C  C     . GLU B 2 173 ? -7.610  31.407 22.943  1.00 26.81  ? 469  GLU A C     1 
ATOM   1527 O  O     . GLU B 2 173 ? -7.402  32.496 23.483  1.00 24.89  ? 469  GLU A O     1 
ATOM   1528 C  CB    . GLU B 2 173 ? -9.761  31.278 24.241  1.00 41.32  ? 469  GLU A CB    1 
ATOM   1529 C  CG    . GLU B 2 173 ? -11.014 30.480 24.583  1.00 53.34  ? 469  GLU A CG    1 
ATOM   1530 C  CD    . GLU B 2 173 ? -11.765 31.030 25.800  1.00 72.56  ? 469  GLU A CD    1 
ATOM   1531 O  OE1   . GLU B 2 173 ? -12.579 30.281 26.386  1.00 76.87  ? 469  GLU A OE1   1 
ATOM   1532 O  OE2   . GLU B 2 173 ? -11.544 32.206 26.171  1.00 74.43  ? 469  GLU A OE2   1 
ATOM   1533 N  N     . GLN B 2 174 ? -6.688  30.802 22.209  1.00 24.44  ? 470  GLN A N     1 
ATOM   1534 C  CA    . GLN B 2 174 ? -5.425  31.443 21.916  1.00 22.97  ? 470  GLN A CA    1 
ATOM   1535 C  C     . GLN B 2 174 ? -5.278  31.766 20.443  1.00 22.17  ? 470  GLN A C     1 
ATOM   1536 O  O     . GLN B 2 174 ? -4.188  32.144 20.008  1.00 21.04  ? 470  GLN A O     1 
ATOM   1537 C  CB    . GLN B 2 174 ? -4.270  30.562 22.369  1.00 22.63  ? 470  GLN A CB    1 
ATOM   1538 C  CG    . GLN B 2 174 ? -4.224  30.331 23.853  1.00 23.30  ? 470  GLN A CG    1 
ATOM   1539 C  CD    . GLN B 2 174 ? -3.093  29.416 24.208  1.00 32.92  ? 470  GLN A CD    1 
ATOM   1540 O  OE1   . GLN B 2 174 ? -2.261  29.739 25.058  1.00 30.89  ? 470  GLN A OE1   1 
ATOM   1541 N  NE2   . GLN B 2 174 ? -3.026  28.278 23.538  1.00 23.35  ? 470  GLN A NE2   1 
ATOM   1542 N  N     . ASP B 2 175 ? -6.340  31.579 19.661  1.00 26.93  ? 471  ASP A N     1 
ATOM   1543 C  CA    . ASP B 2 175 ? -6.266  31.832 18.223  1.00 27.17  ? 471  ASP A CA    1 
ATOM   1544 C  C     . ASP B 2 175 ? -5.940  33.285 17.944  1.00 21.32  ? 471  ASP A C     1 
ATOM   1545 O  O     . ASP B 2 175 ? -5.098  33.587 17.091  1.00 22.49  ? 471  ASP A O     1 
ATOM   1546 C  CB    . ASP B 2 175 ? -7.583  31.443 17.543  1.00 32.90  ? 471  ASP A CB    1 
ATOM   1547 C  CG    . ASP B 2 175 ? -8.806  32.085 18.212  1.00 53.52  ? 471  ASP A CG    1 
ATOM   1548 O  OD1   . ASP B 2 175 ? -9.520  32.862 17.528  1.00 58.61  ? 471  ASP A OD1   1 
ATOM   1549 O  OD2   . ASP B 2 175 ? -9.054  31.808 19.417  1.00 50.37  ? 471  ASP A OD2   1 
ATOM   1550 N  N     . ARG B 2 176 ? -6.594  34.205 18.655  1.00 21.73  ? 472  ARG A N     1 
ATOM   1551 C  CA    . ARG B 2 176 ? -6.292  35.621 18.460  1.00 23.73  ? 472  ARG A CA    1 
ATOM   1552 C  C     . ARG B 2 176 ? -4.925  35.976 19.015  1.00 20.24  ? 472  ARG A C     1 
ATOM   1553 O  O     . ARG B 2 176 ? -4.224  36.811 18.440  1.00 23.84  ? 472  ARG A O     1 
ATOM   1554 C  CB    . ARG B 2 176 ? -7.368  36.490 19.108  1.00 32.59  ? 472  ARG A CB    1 
ATOM   1555 C  CG    . ARG B 2 176 ? -8.729  36.379 18.441  1.00 44.87  ? 472  ARG A CG    1 
ATOM   1556 C  CD    . ARG B 2 176 ? -9.776  37.193 19.194  1.00 55.91  ? 472  ARG A CD    1 
ATOM   1557 N  NE    . ARG B 2 176 ? -9.622  38.623 18.940  1.00 65.77  ? 472  ARG A NE    1 
ATOM   1558 C  CZ    . ARG B 2 176 ? -10.026 39.588 19.764  1.00 69.62  ? 472  ARG A CZ    1 
ATOM   1559 N  NH1   . ARG B 2 176 ? -10.621 39.290 20.915  1.00 66.72  ? 472  ARG A NH1   1 
ATOM   1560 N  NH2   . ARG B 2 176 ? -9.833  40.858 19.433  1.00 66.60  ? 472  ARG A NH2   1 
ATOM   1561 N  N     . LEU B 2 177 ? -4.530  35.348 20.124  1.00 20.25  ? 473  LEU A N     1 
ATOM   1562 C  CA    . LEU B 2 177 ? -3.183  35.552 20.645  1.00 19.40  ? 473  LEU A CA    1 
ATOM   1563 C  C     . LEU B 2 177 ? -2.136  35.251 19.582  1.00 18.46  ? 473  LEU A C     1 
ATOM   1564 O  O     . LEU B 2 177 ? -1.178  36.008 19.409  1.00 18.00  ? 473  LEU A O     1 
ATOM   1565 C  CB    . LEU B 2 177 ? -2.971  34.665 21.866  1.00 19.91  ? 473  LEU A CB    1 
ATOM   1566 C  CG    . LEU B 2 177 ? -1.626  34.695 22.592  1.00 23.57  ? 473  LEU A CG    1 
ATOM   1567 C  CD1   . LEU B 2 177 ? -1.277  36.110 23.049  1.00 27.12  ? 473  LEU A CD1   1 
ATOM   1568 C  CD2   . LEU B 2 177 ? -1.618  33.687 23.782  1.00 20.62  ? 473  LEU A CD2   1 
ATOM   1569 N  N     . LEU B 2 178 ? -2.302  34.145 18.857  1.00 18.69  ? 474  LEU A N     1 
ATOM   1570 C  CA    . LEU B 2 178 ? -1.409  33.838 17.746  1.00 17.99  ? 474  LEU A CA    1 
ATOM   1571 C  C     . LEU B 2 178 ? -1.502  34.892 16.660  1.00 19.97  ? 474  LEU A C     1 
ATOM   1572 O  O     . LEU B 2 178 ? -0.489  35.451 16.222  1.00 16.88  ? 474  LEU A O     1 
ATOM   1573 C  CB    . LEU B 2 178 ? -1.764  32.466 17.142  1.00 18.57  ? 474  LEU A CB    1 
ATOM   1574 C  CG    . LEU B 2 178 ? -0.890  32.130 15.932  1.00 18.00  ? 474  LEU A CG    1 
ATOM   1575 C  CD1   . LEU B 2 178 ? 0.577   32.072 16.371  1.00 20.02  ? 474  LEU A CD1   1 
ATOM   1576 C  CD2   . LEU B 2 178 ? -1.343  30.803 15.246  1.00 18.74  ? 474  LEU A CD2   1 
ATOM   1577 N  N     . VAL B 2 179 ? -2.711  35.119 16.159  1.00 20.77  ? 475  VAL A N     1 
ATOM   1578 C  CA    . VAL B 2 179 ? -2.879  35.839 14.902  1.00 17.78  ? 475  VAL A CA    1 
ATOM   1579 C  C     . VAL B 2 179 ? -2.769  37.344 15.102  1.00 17.42  ? 475  VAL A C     1 
ATOM   1580 O  O     . VAL B 2 179 ? -2.264  38.048 14.229  1.00 19.08  ? 475  VAL A O     1 
ATOM   1581 C  CB    . VAL B 2 179 ? -4.229  35.455 14.260  1.00 26.50  ? 475  VAL A CB    1 
ATOM   1582 C  CG1   . VAL B 2 179 ? -4.614  36.449 13.146  1.00 29.47  ? 475  VAL A CG1   1 
ATOM   1583 C  CG2   . VAL B 2 179 ? -4.163  34.044 13.719  1.00 25.26  ? 475  VAL A CG2   1 
ATOM   1584 N  N     . GLU B 2 180 ? -3.223  37.863 16.238  1.00 20.04  ? 476  GLU A N     1 
ATOM   1585 C  CA    . GLU B 2 180 ? -3.250  39.304 16.455  1.00 25.77  ? 476  GLU A CA    1 
ATOM   1586 C  C     . GLU B 2 180 ? -2.111  39.809 17.328  1.00 23.31  ? 476  GLU A C     1 
ATOM   1587 O  O     . GLU B 2 180 ? -1.876  41.017 17.370  1.00 21.47  ? 476  GLU A O     1 
ATOM   1588 C  CB    . GLU B 2 180 ? -4.590  39.716 17.073  1.00 25.55  ? 476  GLU A CB    1 
ATOM   1589 C  CG    . GLU B 2 180 ? -5.785  39.309 16.219  1.00 34.27  ? 476  GLU A CG    1 
ATOM   1590 C  CD    . GLU B 2 180 ? -7.110  39.773 16.799  1.00 51.15  ? 476  GLU A CD    1 
ATOM   1591 O  OE1   . GLU B 2 180 ? -8.169  39.298 16.328  1.00 56.28  ? 476  GLU A OE1   1 
ATOM   1592 O  OE2   . GLU B 2 180 ? -7.091  40.612 17.725  1.00 60.39  ? 476  GLU A OE2   1 
ATOM   1593 N  N     . LEU B 2 181 ? -1.394  38.935 18.028  1.00 20.09  ? 477  LEU A N     1 
ATOM   1594 C  CA    . LEU B 2 181 ? -0.280  39.402 18.842  1.00 17.58  ? 477  LEU A CA    1 
ATOM   1595 C  C     . LEU B 2 181 ? 1.047   38.802 18.400  1.00 18.92  ? 477  LEU A C     1 
ATOM   1596 O  O     . LEU B 2 181 ? 1.914   39.542 17.944  1.00 18.56  ? 477  LEU A O     1 
ATOM   1597 C  CB    . LEU B 2 181 ? -0.545  39.125 20.322  1.00 21.54  ? 477  LEU A CB    1 
ATOM   1598 C  CG    . LEU B 2 181 ? 0.467   39.795 21.255  1.00 31.93  ? 477  LEU A CG    1 
ATOM   1599 C  CD1   . LEU B 2 181 ? -0.119  41.067 21.857  1.00 31.24  ? 477  LEU A CD1   1 
ATOM   1600 C  CD2   . LEU B 2 181 ? 0.949   38.866 22.347  1.00 41.40  ? 477  LEU A CD2   1 
ATOM   1601 N  N     . GLU B 2 182 ? 1.235   37.482 18.501  1.00 17.14  ? 478  GLU A N     1 
ATOM   1602 C  CA    . GLU B 2 182 ? 2.571   36.914 18.313  1.00 15.30  ? 478  GLU A CA    1 
ATOM   1603 C  C     . GLU B 2 182 ? 3.049   37.035 16.872  1.00 14.86  ? 478  GLU A C     1 
ATOM   1604 O  O     . GLU B 2 182 ? 4.219   37.354 16.625  1.00 14.36  ? 478  GLU A O     1 
ATOM   1605 C  CB    . GLU B 2 182 ? 2.604   35.444 18.759  1.00 15.68  ? 478  GLU A CB    1 
ATOM   1606 C  CG    . GLU B 2 182 ? 2.426   35.212 20.257  1.00 24.28  ? 478  GLU A CG    1 
ATOM   1607 C  CD    . GLU B 2 182 ? 3.474   35.920 21.167  1.00 39.17  ? 478  GLU A CD    1 
ATOM   1608 O  OE1   . GLU B 2 182 ? 4.527   36.404 20.684  1.00 37.94  ? 478  GLU A OE1   1 
ATOM   1609 O  OE2   . GLU B 2 182 ? 3.237   35.972 22.394  1.00 37.32  ? 478  GLU A OE2   1 
ATOM   1610 N  N     . GLN B 2 183 ? 2.187   36.711 15.900  1.00 15.14  ? 479  GLN A N     1 
ATOM   1611 C  CA    . GLN B 2 183 ? 2.636   36.773 14.509  1.00 17.99  ? 479  GLN A CA    1 
ATOM   1612 C  C     . GLN B 2 183 ? 2.925   38.208 14.087  1.00 14.88  ? 479  GLN A C     1 
ATOM   1613 O  O     . GLN B 2 183 ? 4.005   38.446 13.516  1.00 20.55  ? 479  GLN A O     1 
ATOM   1614 C  CB    . GLN B 2 183 ? 1.626   36.052 13.596  1.00 16.57  ? 479  GLN A CB    1 
ATOM   1615 C  CG    . GLN B 2 183 ? 1.728   34.552 13.727  1.00 24.52  ? 479  GLN A CG    1 
ATOM   1616 C  CD    . GLN B 2 183 ? 0.684   33.766 12.936  1.00 19.40  ? 479  GLN A CD    1 
ATOM   1617 O  OE1   . GLN B 2 183 ? -0.186  34.329 12.237  1.00 22.18  ? 479  GLN A OE1   1 
ATOM   1618 N  NE2   . GLN B 2 183 ? 0.750   32.468 13.075  1.00 16.79  ? 479  GLN A NE2   1 
ATOM   1619 N  N     . PRO B 2 184 ? 2.065   39.206 14.366  1.00 15.08  ? 480  PRO A N     1 
ATOM   1620 C  CA    . PRO B 2 184 ? 2.438   40.595 14.052  1.00 19.41  ? 480  PRO A CA    1 
ATOM   1621 C  C     . PRO B 2 184 ? 3.696   41.034 14.762  1.00 16.54  ? 480  PRO A C     1 
ATOM   1622 O  O     . PRO B 2 184 ? 4.516   41.761 14.189  1.00 14.74  ? 480  PRO A O     1 
ATOM   1623 C  CB    . PRO B 2 184 ? 1.228   41.413 14.531  1.00 17.83  ? 480  PRO A CB    1 
ATOM   1624 C  CG    . PRO B 2 184 ? 0.118   40.445 14.530  1.00 20.70  ? 480  PRO A CG    1 
ATOM   1625 C  CD    . PRO B 2 184 ? 0.687   39.126 14.864  1.00 15.34  ? 480  PRO A CD    1 
ATOM   1626 N  N     . LEU B 2 185 ? 3.885   40.593 16.003  1.00 19.33  ? 481  LEU A N     1 
ATOM   1627 C  CA    . LEU B 2 185 ? 5.099   40.963 16.715  1.00 21.14  ? 481  LEU A CA    1 
ATOM   1628 C  C     . LEU B 2 185 ? 6.315   40.393 16.018  1.00 15.75  ? 481  LEU A C     1 
ATOM   1629 O  O     . LEU B 2 185 ? 7.354   41.062 15.910  1.00 15.58  ? 481  LEU A O     1 
ATOM   1630 C  CB    . LEU B 2 185 ? 5.039   40.478 18.159  1.00 15.88  ? 481  LEU A CB    1 
ATOM   1631 C  CG    . LEU B 2 185 ? 6.278   40.800 18.987  1.00 22.22  ? 481  LEU A CG    1 
ATOM   1632 C  CD1   . LEU B 2 185 ? 6.292   42.294 19.289  1.00 17.08  ? 481  LEU A CD1   1 
ATOM   1633 C  CD2   . LEU B 2 185 ? 6.216   40.013 20.264  1.00 21.28  ? 481  LEU A CD2   1 
ATOM   1634 N  N     . SER B 2 186 ? 6.191   39.170 15.499  1.00 13.50  ? 482  SER A N     1 
ATOM   1635 C  CA    . SER B 2 186 ? 7.316   38.554 14.814  1.00 13.30  ? 482  SER A CA    1 
ATOM   1636 C  C     . SER B 2 186 ? 7.822   39.436 13.677  1.00 17.57  ? 482  SER A C     1 
ATOM   1637 O  O     . SER B 2 186 ? 9.034   39.564 13.476  1.00 18.22  ? 482  SER A O     1 
ATOM   1638 C  CB    . SER B 2 186 ? 6.916   37.171 14.285  1.00 16.98  ? 482  SER A CB    1 
ATOM   1639 O  OG    . SER B 2 186 ? 8.010   36.589 13.624  1.00 32.29  ? 482  SER A OG    1 
ATOM   1640 N  N     . SER B 2 187 ? 6.914   40.028 12.903  1.00 18.16  ? 483  SER A N     1 
ATOM   1641 C  CA    . SER B 2 187 ? 7.343   40.920 11.826  1.00 18.42  ? 483  SER A CA    1 
ATOM   1642 C  C     . SER B 2 187 ? 8.028   42.168 12.376  1.00 18.55  ? 483  SER A C     1 
ATOM   1643 O  O     . SER B 2 187 ? 8.984   42.674 11.775  1.00 16.31  ? 483  SER A O     1 
ATOM   1644 C  CB    . SER B 2 187 ? 6.139   41.325 10.965  1.00 19.87  ? 483  SER A CB    1 
ATOM   1645 O  OG    . SER B 2 187 ? 5.478   40.172 10.461  1.00 30.61  ? 483  SER A OG    1 
ATOM   1646 N  N     . ILE B 2 188 ? 7.513   42.709 13.479  1.00 15.00  ? 484  ILE A N     1 
ATOM   1647 C  CA    . ILE B 2 188 ? 8.117   43.891 14.102  1.00 16.99  ? 484  ILE A CA    1 
ATOM   1648 C  C     . ILE B 2 188 ? 9.507   43.562 14.634  1.00 15.86  ? 484  ILE A C     1 
ATOM   1649 O  O     . ILE B 2 188 ? 10.462  44.334 14.459  1.00 13.51  ? 484  ILE A O     1 
ATOM   1650 C  CB    . ILE B 2 188 ? 7.191   44.418 15.208  1.00 17.84  ? 484  ILE A CB    1 
ATOM   1651 C  CG1   . ILE B 2 188 ? 5.981   45.096 14.571  1.00 16.52  ? 484  ILE A CG1   1 
ATOM   1652 C  CG2   . ILE B 2 188 ? 7.932   45.422 16.125  1.00 15.04  ? 484  ILE A CG2   1 
ATOM   1653 C  CD1   . ILE B 2 188 ? 4.840   45.332 15.517  1.00 16.38  ? 484  ILE A CD1   1 
ATOM   1654 N  N     . LEU B 2 189 ? 9.658   42.389 15.244  1.00 12.97  ? 485  LEU A N     1 
ATOM   1655 C  CA    . LEU B 2 189 ? 10.967  41.996 15.742  1.00 12.87  ? 485  LEU A CA    1 
ATOM   1656 C  C     . LEU B 2 189 ? 11.947  41.789 14.600  1.00 13.34  ? 485  LEU A C     1 
ATOM   1657 O  O     . LEU B 2 189 ? 13.135  42.095 14.739  1.00 14.19  ? 485  LEU A O     1 
ATOM   1658 C  CB    . LEU B 2 189 ? 10.857  40.714 16.585  1.00 12.83  ? 485  LEU A CB    1 
ATOM   1659 C  CG    . LEU B 2 189 ? 10.014  40.844 17.849  1.00 17.93  ? 485  LEU A CG    1 
ATOM   1660 C  CD1   . LEU B 2 189 ? 9.779   39.429 18.431  1.00 16.93  ? 485  LEU A CD1   1 
ATOM   1661 C  CD2   . LEU B 2 189 ? 10.656  41.752 18.902  1.00 13.04  ? 485  LEU A CD2   1 
ATOM   1662 N  N     . ALA B 2 190 ? 11.469  41.282 13.462  1.00 13.09  ? 486  ALA A N     1 
ATOM   1663 C  CA    . ALA B 2 190 ? 12.369  41.052 12.335  1.00 13.05  ? 486  ALA A CA    1 
ATOM   1664 C  C     . ALA B 2 190 ? 12.911  42.376 11.804  1.00 13.23  ? 486  ALA A C     1 
ATOM   1665 O  O     . ALA B 2 190 ? 14.088  42.481 11.444  1.00 14.51  ? 486  ALA A O     1 
ATOM   1666 C  CB    . ALA B 2 190 ? 11.642  40.300 11.226  1.00 13.15  ? 486  ALA A CB    1 
ATOM   1667 N  N     . GLU B 2 191 ? 12.061  43.385 11.740  1.00 13.28  ? 487  GLU A N     1 
ATOM   1668 C  CA    . GLU B 2 191 ? 12.527  44.698 11.318  1.00 13.58  ? 487  GLU A CA    1 
ATOM   1669 C  C     . GLU B 2 191 ? 13.472  45.306 12.360  1.00 23.72  ? 487  GLU A C     1 
ATOM   1670 O  O     . GLU B 2 191 ? 14.512  45.871 12.005  1.00 19.89  ? 487  GLU A O     1 
ATOM   1671 C  CB    . GLU B 2 191 ? 11.328  45.603 11.051  1.00 19.16  ? 487  GLU A CB    1 
ATOM   1672 C  CG    . GLU B 2 191 ? 11.731  46.994 10.559  1.00 32.24  ? 487  GLU A CG    1 
ATOM   1673 C  CD    . GLU B 2 191 ? 12.831  46.955 9.479   1.00 51.45  ? 487  GLU A CD    1 
ATOM   1674 O  OE1   . GLU B 2 191 ? 13.969  47.419 9.748   1.00 39.04  ? 487  GLU A OE1   1 
ATOM   1675 O  OE2   . GLU B 2 191 ? 12.555  46.448 8.360   1.00 55.34  ? 487  GLU A OE2   1 
ATOM   1676 N  N     . MET B 2 192 ? 13.143  45.173 13.651  1.00 13.47  ? 488  MET A N     1 
ATOM   1677 C  CA    . MET B 2 192 ? 14.046  45.647 14.701  1.00 19.82  ? 488  MET A CA    1 
ATOM   1678 C  C     . MET B 2 192 ? 15.412  44.993 14.578  1.00 17.89  ? 488  MET A C     1 
ATOM   1679 O  O     . MET B 2 192 ? 16.443  45.675 14.607  1.00 20.57  ? 488  MET A O     1 
ATOM   1680 C  CB    . MET B 2 192 ? 13.462  45.359 16.095  1.00 13.41  ? 488  MET A CB    1 
ATOM   1681 C  CG    . MET B 2 192 ? 12.300  46.279 16.478  1.00 19.94  ? 488  MET A CG    1 
ATOM   1682 S  SD    . MET B 2 192 ? 11.348  45.527 17.835  1.00 23.61  ? 488  MET A SD    1 
ATOM   1683 C  CE    . MET B 2 192 ? 12.608  45.477 19.132  1.00 14.82  ? 488  MET A CE    1 
ATOM   1684 N  N     . GLU B 2 193 ? 15.438  43.659 14.456  1.00 13.42  ? 489  GLU A N     1 
ATOM   1685 C  CA    . GLU B 2 193 ? 16.712  42.954 14.374  1.00 16.98  ? 489  GLU A CA    1 
ATOM   1686 C  C     . GLU B 2 193 ? 17.478  43.371 13.134  1.00 15.85  ? 489  GLU A C     1 
ATOM   1687 O  O     . GLU B 2 193 ? 18.704  43.560 13.173  1.00 16.16  ? 489  GLU A O     1 
ATOM   1688 C  CB    . GLU B 2 193 ? 16.485  41.437 14.353  1.00 13.40  ? 489  GLU A CB    1 
ATOM   1689 C  CG    . GLU B 2 193 ? 15.806  40.874 15.581  1.00 17.96  ? 489  GLU A CG    1 
ATOM   1690 C  CD    . GLU B 2 193 ? 15.488  39.390 15.425  1.00 21.82  ? 489  GLU A CD    1 
ATOM   1691 O  OE1   . GLU B 2 193 ? 14.937  38.785 16.366  1.00 23.17  ? 489  GLU A OE1   1 
ATOM   1692 O  OE2   . GLU B 2 193 ? 15.790  38.834 14.349  1.00 20.20  ? 489  GLU A OE2   1 
ATOM   1693 N  N     . PHE B 2 194 ? 16.773  43.477 12.009  1.00 15.82  ? 490  PHE A N     1 
ATOM   1694 C  CA    . PHE B 2 194 ? 17.410  43.879 10.771  1.00 18.93  ? 490  PHE A CA    1 
ATOM   1695 C  C     . PHE B 2 194 ? 17.974  45.297 10.879  1.00 26.03  ? 490  PHE A C     1 
ATOM   1696 O  O     . PHE B 2 194 ? 19.092  45.563 10.429  1.00 17.19  ? 490  PHE A O     1 
ATOM   1697 C  CB    . PHE B 2 194 ? 16.407  43.790 9.621   1.00 14.48  ? 490  PHE A CB    1 
ATOM   1698 C  CG    . PHE B 2 194 ? 16.998  44.123 8.290   1.00 16.07  ? 490  PHE A CG    1 
ATOM   1699 C  CD1   . PHE B 2 194 ? 18.028  43.346 7.765   1.00 16.39  ? 490  PHE A CD1   1 
ATOM   1700 C  CD2   . PHE B 2 194 ? 16.539  45.206 7.563   1.00 19.18  ? 490  PHE A CD2   1 
ATOM   1701 C  CE1   . PHE B 2 194 ? 18.586  43.648 6.523   1.00 18.96  ? 490  PHE A CE1   1 
ATOM   1702 C  CE2   . PHE B 2 194 ? 17.101  45.514 6.307   1.00 22.50  ? 490  PHE A CE2   1 
ATOM   1703 C  CZ    . PHE B 2 194 ? 18.117  44.740 5.799   1.00 20.33  ? 490  PHE A CZ    1 
ATOM   1704 N  N     . ALA B 2 195 ? 17.221  46.221 11.481  1.00 23.33  ? 491  ALA A N     1 
ATOM   1705 C  CA    . ALA B 2 195 ? 17.729  47.585 11.616  1.00 21.82  ? 491  ALA A CA    1 
ATOM   1706 C  C     . ALA B 2 195 ? 19.001  47.610 12.451  1.00 21.05  ? 491  ALA A C     1 
ATOM   1707 O  O     . ALA B 2 195 ? 19.967  48.303 12.100  1.00 21.80  ? 491  ALA A O     1 
ATOM   1708 C  CB    . ALA B 2 195 ? 16.668  48.498 12.224  1.00 15.98  ? 491  ALA A CB    1 
ATOM   1709 N  N     . GLY B 2 196 ? 19.031  46.830 13.528  1.00 15.57  ? 492  GLY A N     1 
ATOM   1710 C  CA    . GLY B 2 196 ? 20.190  46.741 14.401  1.00 15.43  ? 492  GLY A CA    1 
ATOM   1711 C  C     . GLY B 2 196 ? 20.352  48.027 15.192  1.00 15.81  ? 492  GLY A C     1 
ATOM   1712 O  O     . GLY B 2 196 ? 19.566  48.956 15.082  1.00 18.54  ? 492  GLY A O     1 
ATOM   1713 N  N     . VAL B 2 197 ? 21.385  48.069 16.022  1.00 17.55  ? 493  VAL A N     1 
ATOM   1714 C  CA    . VAL B 2 197 ? 21.661  49.263 16.800  1.00 19.58  ? 493  VAL A CA    1 
ATOM   1715 C  C     . VAL B 2 197 ? 23.128  49.619 16.642  1.00 17.46  ? 493  VAL A C     1 
ATOM   1716 O  O     . VAL B 2 197 ? 24.007  48.766 16.796  1.00 17.50  ? 493  VAL A O     1 
ATOM   1717 C  CB    . VAL B 2 197 ? 21.258  49.108 18.283  1.00 22.43  ? 493  VAL A CB    1 
ATOM   1718 C  CG1   . VAL B 2 197 ? 21.757  47.854 18.852  1.00 39.61  ? 493  VAL A CG1   1 
ATOM   1719 C  CG2   . VAL B 2 197 ? 21.738  50.306 19.104  1.00 17.00  ? 493  VAL A CG2   1 
ATOM   1720 N  N     . LYS B 2 198 ? 23.383  50.878 16.327  1.00 18.22  ? 494  LYS A N     1 
ATOM   1721 C  CA    . LYS B 2 198 ? 24.736  51.302 16.016  1.00 21.15  ? 494  LYS A CA    1 
ATOM   1722 C  C     . LYS B 2 198 ? 25.550  51.333 17.300  1.00 21.15  ? 494  LYS A C     1 
ATOM   1723 O  O     . LYS B 2 198 ? 25.049  51.710 18.363  1.00 19.29  ? 494  LYS A O     1 
ATOM   1724 C  CB    . LYS B 2 198 ? 24.715  52.676 15.330  1.00 21.30  ? 494  LYS A CB    1 
ATOM   1725 C  CG    . LYS B 2 198 ? 26.087  53.245 15.055  1.00 23.09  ? 494  LYS A CG    1 
ATOM   1726 C  CD    . LYS B 2 198 ? 26.668  52.698 13.779  1.00 40.67  ? 494  LYS A CD    1 
ATOM   1727 C  CE    . LYS B 2 198 ? 25.701  52.867 12.619  1.00 54.02  ? 494  LYS A CE    1 
ATOM   1728 N  NZ    . LYS B 2 198 ? 25.761  54.233 12.026  1.00 62.89  ? 494  LYS A NZ    1 
ATOM   1729 N  N     . VAL B 2 199 ? 26.791  50.868 17.211  1.00 19.98  ? 495  VAL A N     1 
ATOM   1730 C  CA    . VAL B 2 199 ? 27.694  50.783 18.346  1.00 20.36  ? 495  VAL A CA    1 
ATOM   1731 C  C     . VAL B 2 199 ? 28.887  51.680 18.086  1.00 21.67  ? 495  VAL A C     1 
ATOM   1732 O  O     . VAL B 2 199 ? 29.468  51.649 16.994  1.00 30.74  ? 495  VAL A O     1 
ATOM   1733 C  CB    . VAL B 2 199 ? 28.148  49.333 18.599  1.00 23.36  ? 495  VAL A CB    1 
ATOM   1734 C  CG1   . VAL B 2 199 ? 29.203  49.293 19.688  1.00 20.48  ? 495  VAL A CG1   1 
ATOM   1735 C  CG2   . VAL B 2 199 ? 26.966  48.501 18.993  1.00 27.34  ? 495  VAL A CG2   1 
ATOM   1736 N  N     . ASP B 2 200 ? 29.249  52.484 19.082  1.00 30.16  ? 496  ASP A N     1 
ATOM   1737 C  CA    . ASP B 2 200 ? 30.428  53.344 18.995  1.00 30.61  ? 496  ASP A CA    1 
ATOM   1738 C  C     . ASP B 2 200 ? 31.603  52.483 19.430  1.00 30.68  ? 496  ASP A C     1 
ATOM   1739 O  O     . ASP B 2 200 ? 31.928  52.394 20.611  1.00 25.15  ? 496  ASP A O     1 
ATOM   1740 C  CB    . ASP B 2 200 ? 30.240  54.580 19.868  1.00 29.59  ? 496  ASP A CB    1 
ATOM   1741 C  CG    . ASP B 2 200 ? 31.480  55.480 19.943  1.00 36.59  ? 496  ASP A CG    1 
ATOM   1742 O  OD1   . ASP B 2 200 ? 32.544  55.179 19.357  1.00 35.98  ? 496  ASP A OD1   1 
ATOM   1743 O  OD2   . ASP B 2 200 ? 31.369  56.516 20.630  1.00 40.30  ? 496  ASP A OD2   1 
ATOM   1744 N  N     . THR B 2 201 ? 32.243  51.823 18.464  1.00 28.18  ? 497  THR A N     1 
ATOM   1745 C  CA    . THR B 2 201 ? 33.256  50.842 18.838  1.00 35.86  ? 497  THR A CA    1 
ATOM   1746 C  C     . THR B 2 201 ? 34.509  51.516 19.373  1.00 34.03  ? 497  THR A C     1 
ATOM   1747 O  O     . THR B 2 201 ? 35.212  50.937 20.207  1.00 27.71  ? 497  THR A O     1 
ATOM   1748 C  CB    . THR B 2 201 ? 33.606  49.955 17.648  1.00 30.90  ? 497  THR A CB    1 
ATOM   1749 O  OG1   . THR B 2 201 ? 33.890  50.793 16.536  1.00 31.23  ? 497  THR A OG1   1 
ATOM   1750 C  CG2   . THR B 2 201 ? 32.449  49.036 17.295  1.00 23.75  ? 497  THR A CG2   1 
ATOM   1751 N  N     . LYS B 2 202 ? 34.805  52.727 18.904  1.00 33.95  ? 498  LYS A N     1 
ATOM   1752 C  CA    . LYS B 2 202 ? 35.934  53.473 19.450  1.00 39.47  ? 498  LYS A CA    1 
ATOM   1753 C  C     . LYS B 2 202 ? 35.786  53.652 20.955  1.00 30.54  ? 498  LYS A C     1 
ATOM   1754 O  O     . LYS B 2 202 ? 36.724  53.397 21.717  1.00 35.24  ? 498  LYS A O     1 
ATOM   1755 C  CB    . LYS B 2 202 ? 36.056  54.831 18.759  1.00 42.69  ? 498  LYS A CB    1 
ATOM   1756 C  CG    . LYS B 2 202 ? 36.767  54.790 17.425  1.00 59.20  ? 498  LYS A CG    1 
ATOM   1757 C  CD    . LYS B 2 202 ? 38.071  54.019 17.516  1.00 66.02  ? 498  LYS A CD    1 
ATOM   1758 C  CE    . LYS B 2 202 ? 38.976  54.375 16.354  1.00 69.54  ? 498  LYS A CE    1 
ATOM   1759 N  NZ    . LYS B 2 202 ? 38.177  54.901 15.212  1.00 71.33  ? 498  LYS A NZ    1 
ATOM   1760 N  N     . ARG B 2 203 ? 34.609  54.099 21.398  1.00 33.35  ? 499  ARG A N     1 
ATOM   1761 C  CA    . ARG B 2 203 ? 34.362  54.249 22.828  1.00 36.22  ? 499  ARG A CA    1 
ATOM   1762 C  C     . ARG B 2 203 ? 34.487  52.913 23.554  1.00 38.95  ? 499  ARG A C     1 
ATOM   1763 O  O     . ARG B 2 203 ? 35.091  52.840 24.631  1.00 36.19  ? 499  ARG A O     1 
ATOM   1764 C  CB    . ARG B 2 203 ? 32.982  54.866 23.060  1.00 36.65  ? 499  ARG A CB    1 
ATOM   1765 C  CG    . ARG B 2 203 ? 32.697  55.229 24.516  1.00 49.01  ? 499  ARG A CG    1 
ATOM   1766 C  CD    . ARG B 2 203 ? 32.784  56.728 24.752  1.00 62.19  ? 499  ARG A CD    1 
ATOM   1767 N  NE    . ARG B 2 203 ? 31.458  57.339 24.774  1.00 73.96  ? 499  ARG A NE    1 
ATOM   1768 C  CZ    . ARG B 2 203 ? 31.230  58.642 24.904  1.00 80.97  ? 499  ARG A CZ    1 
ATOM   1769 N  NH1   . ARG B 2 203 ? 32.245  59.491 25.026  1.00 86.62  ? 499  ARG A NH1   1 
ATOM   1770 N  NH2   . ARG B 2 203 ? 29.982  59.094 24.910  1.00 77.16  ? 499  ARG A NH2   1 
ATOM   1771 N  N     . LEU B 2 204 ? 33.916  51.843 22.989  1.00 30.81  ? 500  LEU A N     1 
ATOM   1772 C  CA    . LEU B 2 204 ? 34.052  50.531 23.622  1.00 32.31  ? 500  LEU A CA    1 
ATOM   1773 C  C     . LEU B 2 204 ? 35.510  50.107 23.699  1.00 34.30  ? 500  LEU A C     1 
ATOM   1774 O  O     . LEU B 2 204 ? 35.960  49.580 24.722  1.00 35.85  ? 500  LEU A O     1 
ATOM   1775 C  CB    . LEU B 2 204 ? 33.252  49.480 22.860  1.00 34.16  ? 500  LEU A CB    1 
ATOM   1776 C  CG    . LEU B 2 204 ? 31.796  49.252 23.237  1.00 34.64  ? 500  LEU A CG    1 
ATOM   1777 C  CD1   . LEU B 2 204 ? 31.298  47.996 22.563  1.00 35.08  ? 500  LEU A CD1   1 
ATOM   1778 C  CD2   . LEU B 2 204 ? 31.607  49.172 24.756  1.00 35.03  ? 500  LEU A CD2   1 
ATOM   1779 N  N     . GLU B 2 205 ? 36.269  50.321 22.625  1.00 32.62  ? 501  GLU A N     1 
ATOM   1780 C  CA    . GLU B 2 205 ? 37.677  49.950 22.669  1.00 44.80  ? 501  GLU A CA    1 
ATOM   1781 C  C     . GLU B 2 205 ? 38.442  50.800 23.674  1.00 47.07  ? 501  GLU A C     1 
ATOM   1782 O  O     . GLU B 2 205 ? 39.357  50.297 24.337  1.00 45.60  ? 501  GLU A O     1 
ATOM   1783 C  CB    . GLU B 2 205 ? 38.293  50.052 21.275  1.00 53.74  ? 501  GLU A CB    1 
ATOM   1784 C  CG    . GLU B 2 205 ? 38.224  48.738 20.502  1.00 67.38  ? 501  GLU A CG    1 
ATOM   1785 C  CD    . GLU B 2 205 ? 38.190  48.934 18.995  1.00 81.09  ? 501  GLU A CD    1 
ATOM   1786 O  OE1   . GLU B 2 205 ? 37.669  48.046 18.283  1.00 81.06  ? 501  GLU A OE1   1 
ATOM   1787 O  OE2   . GLU B 2 205 ? 38.689  49.977 18.522  1.00 87.37  ? 501  GLU A OE2   1 
ATOM   1788 N  N     . GLN B 2 206 ? 38.074  52.077 23.817  1.00 43.84  ? 502  GLN A N     1 
ATOM   1789 C  CA    . GLN B 2 206 ? 38.725  52.916 24.816  1.00 49.64  ? 502  GLN A CA    1 
ATOM   1790 C  C     . GLN B 2 206 ? 38.367  52.458 26.227  1.00 46.54  ? 502  GLN A C     1 
ATOM   1791 O  O     . GLN B 2 206 ? 39.232  52.423 27.109  1.00 45.22  ? 502  GLN A O     1 
ATOM   1792 C  CB    . GLN B 2 206 ? 38.360  54.389 24.593  1.00 60.11  ? 502  GLN A CB    1 
ATOM   1793 C  CG    . GLN B 2 206 ? 37.274  54.955 25.510  1.00 70.01  ? 502  GLN A CG    1 
ATOM   1794 C  CD    . GLN B 2 206 ? 37.042  56.440 25.306  1.00 80.73  ? 502  GLN A CD    1 
ATOM   1795 O  OE1   . GLN B 2 206 ? 37.831  57.120 24.648  1.00 84.67  ? 502  GLN A OE1   1 
ATOM   1796 N  NE2   . GLN B 2 206 ? 35.950  56.951 25.867  1.00 83.96  ? 502  GLN A NE2   1 
ATOM   1797 N  N     . MET B 2 207 ? 37.108  52.075 26.451  1.00 39.06  ? 503  MET A N     1 
ATOM   1798 C  CA    . MET B 2 207 ? 36.721  51.528 27.745  1.00 41.58  ? 503  MET A CA    1 
ATOM   1799 C  C     . MET B 2 207 ? 37.494  50.250 28.042  1.00 45.25  ? 503  MET A C     1 
ATOM   1800 O  O     . MET B 2 207 ? 38.052  50.088 29.132  1.00 45.99  ? 503  MET A O     1 
ATOM   1801 C  CB    . MET B 2 207 ? 35.218  51.264 27.778  1.00 38.40  ? 503  MET A CB    1 
ATOM   1802 C  CG    . MET B 2 207 ? 34.387  52.488 28.071  1.00 44.26  ? 503  MET A CG    1 
ATOM   1803 S  SD    . MET B 2 207 ? 32.633  52.245 27.725  1.00 55.21  ? 503  MET A SD    1 
ATOM   1804 C  CE    . MET B 2 207 ? 32.050  53.936 27.894  1.00 58.97  ? 503  MET A CE    1 
ATOM   1805 N  N     . GLY B 2 208 ? 37.543  49.334 27.074  1.00 40.76  ? 504  GLY A N     1 
ATOM   1806 C  CA    . GLY B 2 208 ? 38.323  48.121 27.251  1.00 38.16  ? 504  GLY A CA    1 
ATOM   1807 C  C     . GLY B 2 208 ? 39.781  48.401 27.555  1.00 45.70  ? 504  GLY A C     1 
ATOM   1808 O  O     . GLY B 2 208 ? 40.403  47.700 28.356  1.00 41.73  ? 504  GLY A O     1 
ATOM   1809 N  N     . GLU B 2 209 ? 40.306  49.476 27.011  1.00 50.78  ? 505  GLU A N     1 
ATOM   1810 C  CA    . GLU B 2 209 ? 41.684  49.828 27.233  1.00 55.68  ? 505  GLU A CA    1 
ATOM   1811 C  C     . GLU B 2 209 ? 41.826  50.250 28.673  1.00 53.34  ? 505  GLU A C     1 
ATOM   1812 O  O     . GLU B 2 209 ? 42.761  49.906 29.329  1.00 53.74  ? 505  GLU A O     1 
ATOM   1813 C  CB    . GLU B 2 209 ? 42.128  50.898 26.257  1.00 30.00  ? 505  GLU A CB    1 
ATOM   1814 C  CG    . GLU B 2 209 ? 43.184  50.415 25.286  1.00 30.00  ? 505  GLU A CG    1 
ATOM   1815 C  CD    . GLU B 2 209 ? 42.898  50.690 23.820  1.00 30.00  ? 505  GLU A CD    1 
ATOM   1816 O  OE1   . GLU B 2 209 ? 43.046  51.846 23.372  1.00 30.00  ? 505  GLU A OE1   1 
ATOM   1817 O  OE2   . GLU B 2 209 ? 42.549  49.728 23.103  1.00 30.00  ? 505  GLU A OE2   1 
ATOM   1818 N  N     . GLU B 2 210 ? 40.862  50.992 29.145  1.00 50.29  ? 506  GLU A N     1 
ATOM   1819 C  CA    . GLU B 2 210 ? 40.855  51.431 30.537  1.00 50.30  ? 506  GLU A CA    1 
ATOM   1820 C  C     . GLU B 2 210 ? 40.768  50.245 31.487  1.00 48.29  ? 506  GLU A C     1 
ATOM   1821 O  O     . GLU B 2 210 ? 41.567  50.126 32.425  1.00 54.27  ? 506  GLU A O     1 
ATOM   1822 C  CB    . GLU B 2 210 ? 39.679  52.373 30.771  1.00 61.44  ? 506  GLU A CB    1 
ATOM   1823 C  CG    . GLU B 2 210 ? 40.048  53.825 30.982  1.00 77.68  ? 506  GLU A CG    1 
ATOM   1824 C  CD    . GLU B 2 210 ? 38.823  54.712 31.099  1.00 90.36  ? 506  GLU A CD    1 
ATOM   1825 O  OE1   . GLU B 2 210 ? 37.792  54.397 30.465  1.00 93.48  ? 506  GLU A OE1   1 
ATOM   1826 O  OE2   . GLU B 2 210 ? 38.889  55.720 31.833  1.00 93.39  ? 506  GLU A OE2   1 
ATOM   1827 N  N     . LEU B 2 211 ? 39.785  49.365 31.265  1.00 40.01  ? 507  LEU A N     1 
ATOM   1828 C  CA    . LEU B 2 211 ? 39.591  48.212 32.141  1.00 46.63  ? 507  LEU A CA    1 
ATOM   1829 C  C     . LEU B 2 211 ? 40.843  47.350 32.215  1.00 47.44  ? 507  LEU A C     1 
ATOM   1830 O  O     . LEU B 2 211 ? 41.234  46.901 33.301  1.00 43.73  ? 507  LEU A O     1 
ATOM   1831 C  CB    . LEU B 2 211 ? 38.411  47.383 31.649  1.00 37.47  ? 507  LEU A CB    1 
ATOM   1832 C  CG    . LEU B 2 211 ? 37.026  47.980 31.844  1.00 43.11  ? 507  LEU A CG    1 
ATOM   1833 C  CD1   . LEU B 2 211 ? 36.007  47.106 31.149  1.00 41.98  ? 507  LEU A CD1   1 
ATOM   1834 C  CD2   . LEU B 2 211 ? 36.710  48.109 33.330  1.00 43.61  ? 507  LEU A CD2   1 
ATOM   1835 N  N     . ALA B 2 212 ? 41.483  47.104 31.069  1.00 48.64  ? 508  ALA A N     1 
ATOM   1836 C  CA    . ALA B 2 212 ? 42.678  46.269 31.049  1.00 51.16  ? 508  ALA A CA    1 
ATOM   1837 C  C     . ALA B 2 212 ? 43.778  46.839 31.934  1.00 49.54  ? 508  ALA A C     1 
ATOM   1838 O  O     . ALA B 2 212 ? 44.565  46.079 32.505  1.00 52.27  ? 508  ALA A O     1 
ATOM   1839 C  CB    . ALA B 2 212 ? 43.183  46.106 29.615  1.00 47.51  ? 508  ALA A CB    1 
ATOM   1840 N  N     . GLU B 2 213 ? 43.845  48.165 32.068  1.00 52.20  ? 509  GLU A N     1 
ATOM   1841 C  CA    . GLU B 2 213 ? 44.877  48.769 32.905  1.00 57.86  ? 509  GLU A CA    1 
ATOM   1842 C  C     . GLU B 2 213 ? 44.550  48.620 34.387  1.00 61.13  ? 509  GLU A C     1 
ATOM   1843 O  O     . GLU B 2 213 ? 45.425  48.268 35.187  1.00 59.95  ? 509  GLU A O     1 
ATOM   1844 C  CB    . GLU B 2 213 ? 45.062  50.243 32.543  1.00 61.43  ? 509  GLU A CB    1 
ATOM   1845 C  CG    . GLU B 2 213 ? 46.380  50.828 33.032  1.00 74.34  ? 509  GLU A CG    1 
ATOM   1846 C  CD    . GLU B 2 213 ? 47.068  51.692 31.987  1.00 88.64  ? 509  GLU A CD    1 
ATOM   1847 O  OE1   . GLU B 2 213 ? 46.360  52.346 31.188  1.00 92.33  ? 509  GLU A OE1   1 
ATOM   1848 O  OE2   . GLU B 2 213 ? 48.320  51.717 31.967  1.00 91.19  ? 509  GLU A OE2   1 
ATOM   1849 N  N     . GLN B 2 214 ? 43.302  48.898 34.777  1.00 58.77  ? 510  GLN A N     1 
ATOM   1850 C  CA    . GLN B 2 214 ? 42.908  48.656 36.160  1.00 56.35  ? 510  GLN A CA    1 
ATOM   1851 C  C     . GLN B 2 214 ? 43.012  47.180 36.501  1.00 51.84  ? 510  GLN A C     1 
ATOM   1852 O  O     . GLN B 2 214 ? 43.481  46.817 37.586  1.00 49.91  ? 510  GLN A O     1 
ATOM   1853 C  CB    . GLN B 2 214 ? 41.487  49.137 36.416  1.00 49.67  ? 510  GLN A CB    1 
ATOM   1854 C  CG    . GLN B 2 214 ? 41.152  50.483 35.879  1.00 61.66  ? 510  GLN A CG    1 
ATOM   1855 C  CD    . GLN B 2 214 ? 39.691  50.794 36.094  1.00 73.50  ? 510  GLN A CD    1 
ATOM   1856 O  OE1   . GLN B 2 214 ? 38.867  50.606 35.199  1.00 76.95  ? 510  GLN A OE1   1 
ATOM   1857 N  NE2   . GLN B 2 214 ? 39.354  51.248 37.297  1.00 77.93  ? 510  GLN A NE2   1 
ATOM   1858 N  N     . LEU B 2 215 ? 42.571  46.313 35.588  1.00 45.84  ? 511  LEU A N     1 
ATOM   1859 C  CA    . LEU B 2 215 ? 42.696  44.884 35.825  1.00 42.23  ? 511  LEU A CA    1 
ATOM   1860 C  C     . LEU B 2 215 ? 44.153  44.488 35.997  1.00 46.67  ? 511  LEU A C     1 
ATOM   1861 O  O     . LEU B 2 215 ? 44.474  43.647 36.841  1.00 47.41  ? 511  LEU A O     1 
ATOM   1862 C  CB    . LEU B 2 215 ? 42.050  44.096 34.692  1.00 42.24  ? 511  LEU A CB    1 
ATOM   1863 C  CG    . LEU B 2 215 ? 41.932  42.611 35.027  1.00 55.60  ? 511  LEU A CG    1 
ATOM   1864 C  CD1   . LEU B 2 215 ? 40.543  42.081 34.697  1.00 56.54  ? 511  LEU A CD1   1 
ATOM   1865 C  CD2   . LEU B 2 215 ? 43.025  41.793 34.334  1.00 61.43  ? 511  LEU A CD2   1 
ATOM   1866 N  N     . ARG B 2 216 ? 45.056  45.152 35.332  1.00 48.27  ? 512  ARG A N     1 
ATOM   1867 C  CA    . ARG B 2 216 ? 46.420  44.789 35.551  1.00 48.22  ? 512  ARG A CA    1 
ATOM   1868 C  C     . ARG B 2 216 ? 46.819  45.257 36.927  1.00 48.92  ? 512  ARG A C     1 
ATOM   1869 O  O     . ARG B 2 216 ? 47.480  44.568 37.636  1.00 49.27  ? 512  ARG A O     1 
ATOM   1870 C  CB    . ARG B 2 216 ? 47.299  45.392 34.505  1.00 30.00  ? 512  ARG A CB    1 
ATOM   1871 C  CG    . ARG B 2 216 ? 47.357  44.531 33.270  1.00 30.00  ? 512  ARG A CG    1 
ATOM   1872 C  CD    . ARG B 2 216 ? 47.860  45.316 32.076  1.00 30.00  ? 512  ARG A CD    1 
ATOM   1873 N  NE    . ARG B 2 216 ? 47.515  44.599 30.866  1.00 30.00  ? 512  ARG A NE    1 
ATOM   1874 C  CZ    . ARG B 2 216 ? 47.122  45.181 29.750  1.00 30.00  ? 512  ARG A CZ    1 
ATOM   1875 N  NH1   . ARG B 2 216 ? 47.043  46.502 29.691  1.00 30.00  ? 512  ARG A NH1   1 
ATOM   1876 N  NH2   . ARG B 2 216 ? 46.825  44.437 28.697  1.00 30.00  ? 512  ARG A NH2   1 
ATOM   1877 N  N     . THR B 2 217 ? 46.333  46.403 37.321  1.00 49.72  ? 513  THR A N     1 
ATOM   1878 C  CA    . THR B 2 217 ? 46.721  46.929 38.625  1.00 56.41  ? 513  THR A CA    1 
ATOM   1879 C  C     . THR B 2 217 ? 46.142  46.089 39.757  1.00 51.98  ? 513  THR A C     1 
ATOM   1880 O  O     . THR B 2 217 ? 46.870  45.677 40.669  1.00 46.40  ? 513  THR A O     1 
ATOM   1881 C  CB    . THR B 2 217 ? 46.277  48.387 38.746  1.00 59.74  ? 513  THR A CB    1 
ATOM   1882 O  OG1   . THR B 2 217 ? 47.169  49.218 37.991  1.00 66.10  ? 513  THR A OG1   1 
ATOM   1883 C  CG2   . THR B 2 217 ? 46.286  48.833 40.198  1.00 53.38  ? 513  THR A CG2   1 
ATOM   1884 N  N     . VAL B 2 218 ? 44.833  45.820 39.719  1.00 41.54  ? 514  VAL A N     1 
ATOM   1885 C  CA    . VAL B 2 218 ? 44.221  45.058 40.802  1.00 42.92  ? 514  VAL A CA    1 
ATOM   1886 C  C     . VAL B 2 218 ? 44.785  43.642 40.837  1.00 40.34  ? 514  VAL A C     1 
ATOM   1887 O  O     . VAL B 2 218 ? 44.988  43.063 41.912  1.00 42.82  ? 514  VAL A O     1 
ATOM   1888 C  CB    . VAL B 2 218 ? 42.685  45.061 40.672  1.00 40.09  ? 514  VAL A CB    1 
ATOM   1889 C  CG1   . VAL B 2 218 ? 42.057  44.432 41.914  1.00 41.77  ? 514  VAL A CG1   1 
ATOM   1890 C  CG2   . VAL B 2 218 ? 42.177  46.471 40.503  1.00 37.91  ? 514  VAL A CG2   1 
ATOM   1891 N  N     . GLU B 2 219 ? 45.073  43.073 39.668  1.00 37.37  ? 515  GLU A N     1 
ATOM   1892 C  CA    . GLU B 2 219 ? 45.604  41.717 39.623  1.00 39.48  ? 515  GLU A CA    1 
ATOM   1893 C  C     . GLU B 2 219 ? 46.985  41.650 40.266  1.00 44.36  ? 515  GLU A C     1 
ATOM   1894 O  O     . GLU B 2 219 ? 47.310  40.677 40.960  1.00 48.51  ? 515  GLU A O     1 
ATOM   1895 C  CB    . GLU B 2 219 ? 45.634  41.242 38.174  1.00 50.27  ? 515  GLU A CB    1 
ATOM   1896 C  CG    . GLU B 2 219 ? 46.266  39.904 37.910  1.00 68.91  ? 515  GLU A CG    1 
ATOM   1897 C  CD    . GLU B 2 219 ? 46.257  39.565 36.424  1.00 84.56  ? 515  GLU A CD    1 
ATOM   1898 O  OE1   . GLU B 2 219 ? 47.298  39.100 35.907  1.00 86.55  ? 515  GLU A OE1   1 
ATOM   1899 O  OE2   . GLU B 2 219 ? 45.206  39.773 35.772  1.00 87.60  ? 515  GLU A OE2   1 
ATOM   1900 N  N     . GLN B 2 220 ? 47.802  42.688 40.070  1.00 37.58  ? 516  GLN A N     1 
ATOM   1901 C  CA    . GLN B 2 220 ? 49.111  42.726 40.709  1.00 42.10  ? 516  GLN A CA    1 
ATOM   1902 C  C     . GLN B 2 220 ? 48.977  42.826 42.221  1.00 44.74  ? 516  GLN A C     1 
ATOM   1903 O  O     . GLN B 2 220 ? 49.706  42.156 42.958  1.00 50.39  ? 516  GLN A O     1 
ATOM   1904 C  CB    . GLN B 2 220 ? 49.934  43.897 40.171  1.00 53.03  ? 516  GLN A CB    1 
ATOM   1905 C  CG    . GLN B 2 220 ? 50.534  43.671 38.788  1.00 62.15  ? 516  GLN A CG    1 
ATOM   1906 C  CD    . GLN B 2 220 ? 51.337  42.389 38.693  1.00 64.09  ? 516  GLN A CD    1 
ATOM   1907 O  OE1   . GLN B 2 220 ? 52.452  42.299 39.204  1.00 67.84  ? 516  GLN A OE1   1 
ATOM   1908 N  NE2   . GLN B 2 220 ? 50.773  41.388 38.027  1.00 64.02  ? 516  GLN A NE2   1 
ATOM   1909 N  N     . ARG B 2 221 ? 48.052  43.665 42.699  1.00 41.60  ? 517  ARG A N     1 
ATOM   1910 C  CA    . ARG B 2 221 ? 47.836  43.784 44.135  1.00 41.53  ? 517  ARG A CA    1 
ATOM   1911 C  C     . ARG B 2 221 ? 47.364  42.459 44.723  1.00 41.34  ? 517  ARG A C     1 
ATOM   1912 O  O     . ARG B 2 221 ? 47.809  42.052 45.801  1.00 44.22  ? 517  ARG A O     1 
ATOM   1913 C  CB    . ARG B 2 221 ? 46.827  44.900 44.419  1.00 40.53  ? 517  ARG A CB    1 
ATOM   1914 C  CG    . ARG B 2 221 ? 46.561  45.163 45.900  1.00 60.65  ? 517  ARG A CG    1 
ATOM   1915 C  CD    . ARG B 2 221 ? 47.242  46.430 46.419  1.00 72.17  ? 517  ARG A CD    1 
ATOM   1916 N  NE    . ARG B 2 221 ? 47.364  46.434 47.874  1.00 76.20  ? 517  ARG A NE    1 
ATOM   1917 C  CZ    . ARG B 2 221 ? 48.476  46.081 48.524  1.00 78.51  ? 517  ARG A CZ    1 
ATOM   1918 N  NH1   . ARG B 2 221 ? 49.558  45.709 47.846  1.00 83.61  ? 517  ARG A NH1   1 
ATOM   1919 N  NH2   . ARG B 2 221 ? 48.529  46.100 49.846  1.00 67.46  ? 517  ARG A NH2   1 
ATOM   1920 N  N     . ILE B 2 222 ? 46.480  41.760 44.013  1.00 38.68  ? 518  ILE A N     1 
ATOM   1921 C  CA    . ILE B 2 222 ? 46.006  40.462 44.475  1.00 36.01  ? 518  ILE A CA    1 
ATOM   1922 C  C     . ILE B 2 222 ? 47.166  39.485 44.615  1.00 40.27  ? 518  ILE A C     1 
ATOM   1923 O  O     . ILE B 2 222 ? 47.239  38.717 45.586  1.00 44.14  ? 518  ILE A O     1 
ATOM   1924 C  CB    . ILE B 2 222 ? 44.919  39.936 43.521  1.00 34.47  ? 518  ILE A CB    1 
ATOM   1925 C  CG1   . ILE B 2 222 ? 43.646  40.770 43.694  1.00 33.40  ? 518  ILE A CG1   1 
ATOM   1926 C  CG2   . ILE B 2 222 ? 44.666  38.463 43.760  1.00 34.22  ? 518  ILE A CG2   1 
ATOM   1927 C  CD1   . ILE B 2 222 ? 42.593  40.561 42.621  1.00 31.96  ? 518  ILE A CD1   1 
ATOM   1928 N  N     . TYR B 2 223 ? 48.109  39.517 43.674  1.00 39.36  ? 519  TYR A N     1 
ATOM   1929 C  CA    . TYR B 2 223 ? 49.207  38.553 43.703  1.00 47.11  ? 519  TYR A CA    1 
ATOM   1930 C  C     . TYR B 2 223 ? 50.155  38.818 44.857  1.00 51.85  ? 519  TYR A C     1 
ATOM   1931 O  O     . TYR B 2 223 ? 50.680  37.877 45.465  1.00 53.67  ? 519  TYR A O     1 
ATOM   1932 C  CB    . TYR B 2 223 ? 49.980  38.577 42.389  1.00 50.79  ? 519  TYR A CB    1 
ATOM   1933 C  CG    . TYR B 2 223 ? 49.196  38.039 41.229  1.00 59.87  ? 519  TYR A CG    1 
ATOM   1934 C  CD1   . TYR B 2 223 ? 49.506  38.407 39.927  1.00 59.01  ? 519  TYR A CD1   1 
ATOM   1935 C  CD2   . TYR B 2 223 ? 48.136  37.166 41.434  1.00 62.53  ? 519  TYR A CD2   1 
ATOM   1936 C  CE1   . TYR B 2 223 ? 48.789  37.917 38.858  1.00 61.09  ? 519  TYR A CE1   1 
ATOM   1937 C  CE2   . TYR B 2 223 ? 47.405  36.674 40.370  1.00 63.78  ? 519  TYR A CE2   1 
ATOM   1938 C  CZ    . TYR B 2 223 ? 47.736  37.053 39.083  1.00 64.08  ? 519  TYR A CZ    1 
ATOM   1939 O  OH    . TYR B 2 223 ? 47.014  36.566 38.018  1.00 66.67  ? 519  TYR A OH    1 
ATOM   1940 N  N     . GLU B 2 224 ? 50.412  40.086 45.164  1.00 54.97  ? 520  GLU A N     1 
ATOM   1941 C  CA    . GLU B 2 224 ? 51.292  40.362 46.291  1.00 64.39  ? 520  GLU A CA    1 
ATOM   1942 C  C     . GLU B 2 224 ? 50.590  40.123 47.623  1.00 60.39  ? 520  GLU A C     1 
ATOM   1943 O  O     . GLU B 2 224 ? 51.256  39.898 48.637  1.00 59.62  ? 520  GLU A O     1 
ATOM   1944 C  CB    . GLU B 2 224 ? 51.814  41.792 46.209  1.00 75.65  ? 520  GLU A CB    1 
ATOM   1945 C  CG    . GLU B 2 224 ? 50.830  42.821 46.623  1.00 87.47  ? 520  GLU A CG    1 
ATOM   1946 C  CD    . GLU B 2 224 ? 51.491  44.099 47.057  1.00 99.84  ? 520  GLU A CD    1 
ATOM   1947 O  OE1   . GLU B 2 224 ? 51.500  45.046 46.248  1.00 103.63 ? 520  GLU A OE1   1 
ATOM   1948 O  OE2   . GLU B 2 224 ? 51.985  44.175 48.207  1.00 103.31 ? 520  GLU A OE2   1 
ATOM   1949 N  N     . LEU B 2 225 ? 49.257  40.176 47.645  1.00 56.81  ? 521  LEU A N     1 
ATOM   1950 C  CA    . LEU B 2 225 ? 48.524  39.839 48.859  1.00 51.52  ? 521  LEU A CA    1 
ATOM   1951 C  C     . LEU B 2 225 ? 48.455  38.331 49.064  1.00 48.96  ? 521  LEU A C     1 
ATOM   1952 O  O     . LEU B 2 225 ? 48.569  37.853 50.196  1.00 53.53  ? 521  LEU A O     1 
ATOM   1953 C  CB    . LEU B 2 225 ? 47.118  40.433 48.811  1.00 46.24  ? 521  LEU A CB    1 
ATOM   1954 C  CG    . LEU B 2 225 ? 46.930  41.908 49.178  1.00 54.99  ? 521  LEU A CG    1 
ATOM   1955 C  CD1   . LEU B 2 225 ? 48.114  42.726 48.723  1.00 65.01  ? 521  LEU A CD1   1 
ATOM   1956 C  CD2   . LEU B 2 225 ? 45.638  42.471 48.583  1.00 42.99  ? 521  LEU A CD2   1 
ATOM   1957 N  N     . ALA B 2 226 ? 48.258  37.570 47.986  1.00 43.09  ? 522  ALA A N     1 
ATOM   1958 C  CA    . ALA B 2 226 ? 48.267  36.117 48.077  1.00 51.39  ? 522  ALA A CA    1 
ATOM   1959 C  C     . ALA B 2 226 ? 49.667  35.546 48.262  1.00 56.62  ? 522  ALA A C     1 
ATOM   1960 O  O     . ALA B 2 226 ? 49.804  34.325 48.414  1.00 60.01  ? 522  ALA A O     1 
ATOM   1961 C  CB    . ALA B 2 226 ? 47.635  35.509 46.824  1.00 38.62  ? 522  ALA A CB    1 
ATOM   1962 N  N     . GLY B 2 227 ? 50.700  36.389 48.247  1.00 50.47  ? 523  GLY A N     1 
ATOM   1963 C  CA    . GLY B 2 227 ? 52.071  35.928 48.295  1.00 60.54  ? 523  GLY A CA    1 
ATOM   1964 C  C     . GLY B 2 227 ? 52.534  35.161 47.078  1.00 65.48  ? 523  GLY A C     1 
ATOM   1965 O  O     . GLY B 2 227 ? 53.681  34.698 47.059  1.00 67.36  ? 523  GLY A O     1 
ATOM   1966 N  N     . GLN B 2 228 ? 51.693  35.018 46.057  1.00 59.55  ? 524  GLN A N     1 
ATOM   1967 C  CA    . GLN B 2 228 ? 52.045  34.230 44.888  1.00 62.77  ? 524  GLN A CA    1 
ATOM   1968 C  C     . GLN B 2 228 ? 51.101  34.589 43.751  1.00 67.27  ? 524  GLN A C     1 
ATOM   1969 O  O     . GLN B 2 228 ? 50.110  35.300 43.932  1.00 63.78  ? 524  GLN A O     1 
ATOM   1970 C  CB    . GLN B 2 228 ? 51.981  32.729 45.192  1.00 67.83  ? 524  GLN A CB    1 
ATOM   1971 C  CG    . GLN B 2 228 ? 50.584  32.247 45.565  1.00 65.96  ? 524  GLN A CG    1 
ATOM   1972 C  CD    . GLN B 2 228 ? 50.479  30.736 45.629  1.00 65.68  ? 524  GLN A CD    1 
ATOM   1973 O  OE1   . GLN B 2 228 ? 50.549  30.143 46.704  1.00 68.86  ? 524  GLN A OE1   1 
ATOM   1974 N  NE2   . GLN B 2 228 ? 50.299  30.107 44.476  1.00 67.57  ? 524  GLN A NE2   1 
ATOM   1975 N  N     . GLU B 2 229 ? 51.420  34.072 42.574  1.00 68.22  ? 525  GLU A N     1 
ATOM   1976 C  CA    . GLU B 2 229 ? 50.582  34.224 41.401  1.00 69.10  ? 525  GLU A CA    1 
ATOM   1977 C  C     . GLU B 2 229 ? 49.665  33.012 41.275  1.00 63.74  ? 525  GLU A C     1 
ATOM   1978 O  O     . GLU B 2 229 ? 49.993  31.911 41.726  1.00 67.08  ? 525  GLU A O     1 
ATOM   1979 C  CB    . GLU B 2 229 ? 51.448  34.384 40.149  1.00 80.18  ? 525  GLU A CB    1 
ATOM   1980 C  CG    . GLU B 2 229 ? 52.574  35.422 40.282  1.00 92.11  ? 525  GLU A CG    1 
ATOM   1981 C  CD    . GLU B 2 229 ? 53.809  34.899 41.026  1.00 104.56 ? 525  GLU A CD    1 
ATOM   1982 O  OE1   . GLU B 2 229 ? 54.454  35.693 41.748  1.00 107.41 ? 525  GLU A OE1   1 
ATOM   1983 O  OE2   . GLU B 2 229 ? 54.132  33.697 40.897  1.00 107.99 ? 525  GLU A OE2   1 
ATOM   1984 N  N     . PHE B 2 230 ? 48.497  33.231 40.680  1.00 58.73  ? 526  PHE A N     1 
ATOM   1985 C  CA    . PHE B 2 230 ? 47.518  32.170 40.464  1.00 50.65  ? 526  PHE A CA    1 
ATOM   1986 C  C     . PHE B 2 230 ? 46.449  32.712 39.525  1.00 49.24  ? 526  PHE A C     1 
ATOM   1987 O  O     . PHE B 2 230 ? 46.365  33.918 39.281  1.00 47.16  ? 526  PHE A O     1 
ATOM   1988 C  CB    . PHE B 2 230 ? 46.906  31.676 41.786  1.00 51.36  ? 526  PHE A CB    1 
ATOM   1989 C  CG    . PHE B 2 230 ? 46.071  32.708 42.500  1.00 47.42  ? 526  PHE A CG    1 
ATOM   1990 C  CD1   . PHE B 2 230 ? 46.670  33.757 43.178  1.00 45.25  ? 526  PHE A CD1   1 
ATOM   1991 C  CD2   . PHE B 2 230 ? 44.688  32.623 42.493  1.00 44.75  ? 526  PHE A CD2   1 
ATOM   1992 C  CE1   . PHE B 2 230 ? 45.908  34.707 43.830  1.00 37.65  ? 526  PHE A CE1   1 
ATOM   1993 C  CE2   . PHE B 2 230 ? 43.919  33.566 43.139  1.00 42.34  ? 526  PHE A CE2   1 
ATOM   1994 C  CZ    . PHE B 2 230 ? 44.532  34.609 43.814  1.00 37.24  ? 526  PHE A CZ    1 
ATOM   1995 N  N     . ASN B 2 231 ? 45.636  31.807 38.991  1.00 47.66  ? 527  ASN A N     1 
ATOM   1996 C  CA    . ASN B 2 231 ? 44.567  32.202 38.080  1.00 47.63  ? 527  ASN A CA    1 
ATOM   1997 C  C     . ASN B 2 231 ? 43.369  32.618 38.919  1.00 43.81  ? 527  ASN A C     1 
ATOM   1998 O  O     . ASN B 2 231 ? 42.655  31.777 39.469  1.00 45.31  ? 527  ASN A O     1 
ATOM   1999 C  CB    . ASN B 2 231 ? 44.220  31.071 37.119  1.00 47.47  ? 527  ASN A CB    1 
ATOM   2000 C  CG    . ASN B 2 231 ? 43.079  31.429 36.190  1.00 58.68  ? 527  ASN A CG    1 
ATOM   2001 O  OD1   . ASN B 2 231 ? 42.745  32.605 36.017  1.00 61.34  ? 527  ASN A OD1   1 
ATOM   2002 N  ND2   . ASN B 2 231 ? 42.472  30.416 35.584  1.00 62.55  ? 527  ASN A ND2   1 
ATOM   2003 N  N     . ILE B 2 232 ? 43.150  33.931 39.017  1.00 41.67  ? 528  ILE A N     1 
ATOM   2004 C  CA    . ILE B 2 232 ? 42.079  34.461 39.854  1.00 40.62  ? 528  ILE A CA    1 
ATOM   2005 C  C     . ILE B 2 232 ? 40.721  34.027 39.327  1.00 46.48  ? 528  ILE A C     1 
ATOM   2006 O  O     . ILE B 2 232 ? 39.764  33.888 40.098  1.00 43.15  ? 528  ILE A O     1 
ATOM   2007 C  CB    . ILE B 2 232 ? 42.201  35.997 39.941  1.00 39.59  ? 528  ILE A CB    1 
ATOM   2008 C  CG1   . ILE B 2 232 ? 43.607  36.387 40.401  1.00 37.26  ? 528  ILE A CG1   1 
ATOM   2009 C  CG2   . ILE B 2 232 ? 41.147  36.587 40.868  1.00 43.13  ? 528  ILE A CG2   1 
ATOM   2010 C  CD1   . ILE B 2 232 ? 43.958  37.839 40.154  1.00 39.67  ? 528  ILE A CD1   1 
ATOM   2011 N  N     . ASN B 2 233 ? 40.618  33.778 38.018  1.00 45.13  ? 529  ASN A N     1 
ATOM   2012 C  CA    . ASN B 2 233 ? 39.363  33.372 37.395  1.00 44.80  ? 529  ASN A CA    1 
ATOM   2013 C  C     . ASN B 2 233 ? 39.028  31.904 37.615  1.00 42.64  ? 529  ASN A C     1 
ATOM   2014 O  O     . ASN B 2 233 ? 37.970  31.452 37.161  1.00 53.94  ? 529  ASN A O     1 
ATOM   2015 C  CB    . ASN B 2 233 ? 39.400  33.662 35.895  1.00 47.57  ? 529  ASN A CB    1 
ATOM   2016 C  CG    . ASN B 2 233 ? 39.702  35.105 35.600  1.00 54.41  ? 529  ASN A CG    1 
ATOM   2017 O  OD1   . ASN B 2 233 ? 39.019  36.004 36.089  1.00 50.49  ? 529  ASN A OD1   1 
ATOM   2018 N  ND2   . ASN B 2 233 ? 40.736  35.340 34.802  1.00 62.79  ? 529  ASN A ND2   1 
ATOM   2019 N  N     . SER B 2 234 ? 39.894  31.150 38.277  1.00 34.64  ? 530  SER A N     1 
ATOM   2020 C  CA    . SER B 2 234 ? 39.612  29.754 38.555  1.00 41.95  ? 530  SER A CA    1 
ATOM   2021 C  C     . SER B 2 234 ? 39.108  29.615 39.982  1.00 57.00  ? 530  SER A C     1 
ATOM   2022 O  O     . SER B 2 234 ? 39.917  29.688 40.920  1.00 51.39  ? 530  SER A O     1 
ATOM   2023 C  CB    . SER B 2 234 ? 40.860  28.910 38.361  1.00 36.47  ? 530  SER A CB    1 
ATOM   2024 O  OG    . SER B 2 234 ? 40.835  27.834 39.274  1.00 49.88  ? 530  SER A OG    1 
ATOM   2025 N  N     . PRO B 2 235 ? 37.810  29.387 40.200  1.00 63.21  ? 531  PRO A N     1 
ATOM   2026 C  CA    . PRO B 2 235 ? 37.304  29.284 41.580  1.00 66.05  ? 531  PRO A CA    1 
ATOM   2027 C  C     . PRO B 2 235 ? 37.935  28.156 42.375  1.00 58.52  ? 531  PRO A C     1 
ATOM   2028 O  O     . PRO B 2 235 ? 37.837  28.155 43.610  1.00 55.35  ? 531  PRO A O     1 
ATOM   2029 C  CB    . PRO B 2 235 ? 35.796  29.067 41.389  1.00 69.44  ? 531  PRO A CB    1 
ATOM   2030 C  CG    . PRO B 2 235 ? 35.507  29.530 39.986  1.00 66.90  ? 531  PRO A CG    1 
ATOM   2031 C  CD    . PRO B 2 235 ? 36.742  29.225 39.201  1.00 65.89  ? 531  PRO A CD    1 
ATOM   2032 N  N     . LYS B 2 236 ? 38.593  27.204 41.714  1.00 51.81  ? 532  LYS A N     1 
ATOM   2033 C  CA    . LYS B 2 236 ? 39.354  26.203 42.448  1.00 58.08  ? 532  LYS A CA    1 
ATOM   2034 C  C     . LYS B 2 236 ? 40.666  26.777 42.964  1.00 55.45  ? 532  LYS A C     1 
ATOM   2035 O  O     . LYS B 2 236 ? 41.026  26.570 44.129  1.00 60.96  ? 532  LYS A O     1 
ATOM   2036 C  CB    . LYS B 2 236 ? 39.613  24.983 41.569  1.00 64.81  ? 532  LYS A CB    1 
ATOM   2037 C  CG    . LYS B 2 236 ? 39.030  23.707 42.132  1.00 73.15  ? 532  LYS A CG    1 
ATOM   2038 C  CD    . LYS B 2 236 ? 39.266  22.540 41.191  1.00 85.17  ? 532  LYS A CD    1 
ATOM   2039 C  CE    . LYS B 2 236 ? 40.748  22.331 40.932  1.00 92.49  ? 532  LYS A CE    1 
ATOM   2040 N  NZ    . LYS B 2 236 ? 41.072  20.889 40.738  1.00 94.00  ? 532  LYS A NZ    1 
ATOM   2041 N  N     . GLN B 2 237 ? 41.403  27.495 42.113  1.00 43.49  ? 533  GLN A N     1 
ATOM   2042 C  CA    . GLN B 2 237 ? 42.643  28.108 42.579  1.00 46.81  ? 533  GLN A CA    1 
ATOM   2043 C  C     . GLN B 2 237 ? 42.355  29.177 43.625  1.00 43.49  ? 533  GLN A C     1 
ATOM   2044 O  O     . GLN B 2 237 ? 42.983  29.208 44.690  1.00 40.97  ? 533  GLN A O     1 
ATOM   2045 C  CB    . GLN B 2 237 ? 43.414  28.701 41.405  1.00 50.58  ? 533  GLN A CB    1 
ATOM   2046 C  CG    . GLN B 2 237 ? 43.937  27.668 40.420  1.00 54.22  ? 533  GLN A CG    1 
ATOM   2047 C  CD    . GLN B 2 237 ? 44.925  28.267 39.444  1.00 60.89  ? 533  GLN A CD    1 
ATOM   2048 O  OE1   . GLN B 2 237 ? 45.868  28.958 39.842  1.00 63.15  ? 533  GLN A OE1   1 
ATOM   2049 N  NE2   . GLN B 2 237 ? 44.712  28.017 38.156  1.00 66.32  ? 533  GLN A NE2   1 
ATOM   2050 N  N     . LEU B 2 238 ? 41.398  30.060 43.333  1.00 38.91  ? 534  LEU A N     1 
ATOM   2051 C  CA    . LEU B 2 238 ? 40.994  31.065 44.307  1.00 39.91  ? 534  LEU A CA    1 
ATOM   2052 C  C     . LEU B 2 238 ? 40.553  30.419 45.613  1.00 39.07  ? 534  LEU A C     1 
ATOM   2053 O  O     . LEU B 2 238 ? 40.892  30.902 46.700  1.00 39.19  ? 534  LEU A O     1 
ATOM   2054 C  CB    . LEU B 2 238 ? 39.877  31.923 43.726  1.00 35.26  ? 534  LEU A CB    1 
ATOM   2055 C  CG    . LEU B 2 238 ? 39.449  33.075 44.628  1.00 34.43  ? 534  LEU A CG    1 
ATOM   2056 C  CD1   . LEU B 2 238 ? 40.653  33.922 44.982  1.00 38.69  ? 534  LEU A CD1   1 
ATOM   2057 C  CD2   . LEU B 2 238 ? 38.379  33.903 43.946  1.00 40.79  ? 534  LEU A CD2   1 
ATOM   2058 N  N     . GLY B 2 239 ? 39.808  29.315 45.526  1.00 36.08  ? 535  GLY A N     1 
ATOM   2059 C  CA    . GLY B 2 239 ? 39.397  28.613 46.729  1.00 33.94  ? 535  GLY A CA    1 
ATOM   2060 C  C     . GLY B 2 239 ? 40.571  28.186 47.587  1.00 41.34  ? 535  GLY A C     1 
ATOM   2061 O  O     . GLY B 2 239 ? 40.513  28.262 48.815  1.00 51.37  ? 535  GLY A O     1 
ATOM   2062 N  N     . VAL B 2 240 ? 41.664  27.754 46.958  1.00 49.31  ? 536  VAL A N     1 
ATOM   2063 C  CA    . VAL B 2 240 ? 42.821  27.314 47.733  1.00 48.70  ? 536  VAL A CA    1 
ATOM   2064 C  C     . VAL B 2 240 ? 43.542  28.507 48.355  1.00 48.50  ? 536  VAL A C     1 
ATOM   2065 O  O     . VAL B 2 240 ? 44.049  28.423 49.480  1.00 45.24  ? 536  VAL A O     1 
ATOM   2066 C  CB    . VAL B 2 240 ? 43.760  26.466 46.856  1.00 53.44  ? 536  VAL A CB    1 
ATOM   2067 C  CG1   . VAL B 2 240 ? 45.193  26.529 47.370  1.00 47.60  ? 536  VAL A CG1   1 
ATOM   2068 C  CG2   . VAL B 2 240 ? 43.281  25.023 46.815  1.00 55.35  ? 536  VAL A CG2   1 
ATOM   2069 N  N     . ILE B 2 241 ? 43.599  29.634 47.642  1.00 48.44  ? 537  ILE A N     1 
ATOM   2070 C  CA    . ILE B 2 241 ? 44.270  30.818 48.175  1.00 42.51  ? 537  ILE A CA    1 
ATOM   2071 C  C     . ILE B 2 241 ? 43.515  31.355 49.384  1.00 36.81  ? 537  ILE A C     1 
ATOM   2072 O  O     . ILE B 2 241 ? 44.098  31.603 50.442  1.00 37.85  ? 537  ILE A O     1 
ATOM   2073 C  CB    . ILE B 2 241 ? 44.407  31.896 47.083  1.00 45.31  ? 537  ILE A CB    1 
ATOM   2074 C  CG1   . ILE B 2 241 ? 45.411  31.467 46.011  1.00 43.93  ? 537  ILE A CG1   1 
ATOM   2075 C  CG2   . ILE B 2 241 ? 44.832  33.220 47.703  1.00 48.29  ? 537  ILE A CG2   1 
ATOM   2076 C  CD1   . ILE B 2 241 ? 46.832  31.321 46.535  1.00 47.89  ? 537  ILE A CD1   1 
ATOM   2077 N  N     . LEU B 2 242 ? 42.199  31.522 49.247  1.00 38.22  ? 538  LEU A N     1 
ATOM   2078 C  CA    . LEU B 2 242 ? 41.401  32.127 50.306  1.00 37.16  ? 538  LEU A CA    1 
ATOM   2079 C  C     . LEU B 2 242 ? 41.259  31.201 51.509  1.00 37.68  ? 538  LEU A C     1 
ATOM   2080 O  O     . LEU B 2 242 ? 41.470  31.620 52.653  1.00 37.21  ? 538  LEU A O     1 
ATOM   2081 C  CB    . LEU B 2 242 ? 40.022  32.498 49.768  1.00 35.89  ? 538  LEU A CB    1 
ATOM   2082 C  CG    . LEU B 2 242 ? 39.991  33.564 48.677  1.00 37.02  ? 538  LEU A CG    1 
ATOM   2083 C  CD1   . LEU B 2 242 ? 38.551  33.883 48.314  1.00 36.97  ? 538  LEU A CD1   1 
ATOM   2084 C  CD2   . LEU B 2 242 ? 40.748  34.815 49.113  1.00 33.73  ? 538  LEU A CD2   1 
ATOM   2085 N  N     . PHE B 2 243 ? 40.878  29.947 51.274  1.00 40.09  ? 539  PHE A N     1 
ATOM   2086 C  CA    . PHE B 2 243 ? 40.398  29.086 52.347  1.00 44.22  ? 539  PHE A CA    1 
ATOM   2087 C  C     . PHE B 2 243 ? 41.434  28.105 52.867  1.00 43.99  ? 539  PHE A C     1 
ATOM   2088 O  O     . PHE B 2 243 ? 41.224  27.520 53.934  1.00 44.77  ? 539  PHE A O     1 
ATOM   2089 C  CB    . PHE B 2 243 ? 39.150  28.339 51.879  1.00 41.50  ? 539  PHE A CB    1 
ATOM   2090 C  CG    . PHE B 2 243 ? 38.081  29.257 51.394  1.00 39.92  ? 539  PHE A CG    1 
ATOM   2091 C  CD1   . PHE B 2 243 ? 37.447  30.120 52.280  1.00 37.74  ? 539  PHE A CD1   1 
ATOM   2092 C  CD2   . PHE B 2 243 ? 37.739  29.305 50.054  1.00 37.85  ? 539  PHE A CD2   1 
ATOM   2093 C  CE1   . PHE B 2 243 ? 36.472  30.990 51.841  1.00 37.83  ? 539  PHE A CE1   1 
ATOM   2094 C  CE2   . PHE B 2 243 ? 36.763  30.185 49.603  1.00 35.83  ? 539  PHE A CE2   1 
ATOM   2095 C  CZ    . PHE B 2 243 ? 36.130  31.021 50.493  1.00 38.94  ? 539  PHE A CZ    1 
ATOM   2096 N  N     . GLU B 2 244 ? 42.548  27.927 52.167  1.00 50.19  ? 540  GLU A N     1 
ATOM   2097 C  CA    . GLU B 2 244 ? 43.654  27.141 52.693  1.00 54.75  ? 540  GLU A CA    1 
ATOM   2098 C  C     . GLU B 2 244 ? 44.856  27.997 53.048  1.00 50.20  ? 540  GLU A C     1 
ATOM   2099 O  O     . GLU B 2 244 ? 45.368  27.903 54.163  1.00 60.01  ? 540  GLU A O     1 
ATOM   2100 C  CB    . GLU B 2 244 ? 44.077  26.062 51.689  1.00 57.94  ? 540  GLU A CB    1 
ATOM   2101 C  CG    . GLU B 2 244 ? 43.175  24.844 51.656  1.00 66.89  ? 540  GLU A CG    1 
ATOM   2102 C  CD    . GLU B 2 244 ? 43.451  23.964 50.449  1.00 69.26  ? 540  GLU A CD    1 
ATOM   2103 O  OE1   . GLU B 2 244 ? 42.484  23.437 49.859  1.00 68.57  ? 540  GLU A OE1   1 
ATOM   2104 O  OE2   . GLU B 2 244 ? 44.639  23.807 50.089  1.00 70.81  ? 540  GLU A OE2   1 
ATOM   2105 N  N     . LYS B 2 245 ? 45.331  28.834 52.122  1.00 48.83  ? 541  LYS A N     1 
ATOM   2106 C  CA    . LYS B 2 245 ? 46.528  29.617 52.416  1.00 52.66  ? 541  LYS A CA    1 
ATOM   2107 C  C     . LYS B 2 245 ? 46.232  30.709 53.436  1.00 41.85  ? 541  LYS A C     1 
ATOM   2108 O  O     . LYS B 2 245 ? 46.886  30.790 54.481  1.00 44.77  ? 541  LYS A O     1 
ATOM   2109 C  CB    . LYS B 2 245 ? 47.105  30.219 51.138  1.00 55.17  ? 541  LYS A CB    1 
ATOM   2110 C  CG    . LYS B 2 245 ? 48.365  31.036 51.401  1.00 62.76  ? 541  LYS A CG    1 
ATOM   2111 C  CD    . LYS B 2 245 ? 49.197  31.218 50.145  1.00 66.05  ? 541  LYS A CD    1 
ATOM   2112 C  CE    . LYS B 2 245 ? 50.518  31.891 50.469  1.00 68.61  ? 541  LYS A CE    1 
ATOM   2113 N  NZ    . LYS B 2 245 ? 51.378  31.969 49.258  1.00 75.23  ? 541  LYS A NZ    1 
ATOM   2114 N  N     . LEU B 2 246 ? 45.241  31.547 53.159  1.00 40.55  ? 542  LEU A N     1 
ATOM   2115 C  CA    . LEU B 2 246 ? 44.892  32.635 54.057  1.00 44.50  ? 542  LEU A CA    1 
ATOM   2116 C  C     . LEU B 2 246 ? 43.898  32.220 55.126  1.00 41.59  ? 542  LEU A C     1 
ATOM   2117 O  O     . LEU B 2 246 ? 43.617  33.017 56.027  1.00 40.93  ? 542  LEU A O     1 
ATOM   2118 C  CB    . LEU B 2 246 ? 44.326  33.810 53.258  1.00 39.35  ? 542  LEU A CB    1 
ATOM   2119 C  CG    . LEU B 2 246 ? 45.300  34.418 52.245  1.00 41.07  ? 542  LEU A CG    1 
ATOM   2120 C  CD1   . LEU B 2 246 ? 44.559  35.335 51.287  1.00 38.06  ? 542  LEU A CD1   1 
ATOM   2121 C  CD2   . LEU B 2 246 ? 46.436  35.159 52.940  1.00 40.80  ? 542  LEU A CD2   1 
ATOM   2122 N  N     . GLN B 2 247 ? 43.343  31.009 55.030  1.00 40.47  ? 543  GLN A N     1 
ATOM   2123 C  CA    . GLN B 2 247 ? 42.579  30.411 56.122  1.00 43.09  ? 543  GLN A CA    1 
ATOM   2124 C  C     . GLN B 2 247 ? 41.353  31.240 56.485  1.00 40.99  ? 543  GLN A C     1 
ATOM   2125 O  O     . GLN B 2 247 ? 40.965  31.320 57.654  1.00 41.33  ? 543  GLN A O     1 
ATOM   2126 C  CB    . GLN B 2 247 ? 43.460  30.197 57.354  1.00 42.61  ? 543  GLN A CB    1 
ATOM   2127 C  CG    . GLN B 2 247 ? 44.594  29.232 57.106  1.00 55.14  ? 543  GLN A CG    1 
ATOM   2128 C  CD    . GLN B 2 247 ? 44.098  27.809 57.090  1.00 53.52  ? 543  GLN A CD    1 
ATOM   2129 O  OE1   . GLN B 2 247 ? 43.298  27.415 57.938  1.00 54.85  ? 543  GLN A OE1   1 
ATOM   2130 N  NE2   . GLN B 2 247 ? 44.534  27.038 56.096  1.00 48.82  ? 543  GLN A NE2   1 
ATOM   2131 N  N     . LEU B 2 248 ? 40.750  31.876 55.493  1.00 38.76  ? 544  LEU A N     1 
ATOM   2132 C  CA    . LEU B 2 248 ? 39.493  32.560 55.715  1.00 43.79  ? 544  LEU A CA    1 
ATOM   2133 C  C     . LEU B 2 248 ? 38.397  31.540 56.022  1.00 43.87  ? 544  LEU A C     1 
ATOM   2134 O  O     . LEU B 2 248 ? 38.489  30.380 55.609  1.00 39.43  ? 544  LEU A O     1 
ATOM   2135 C  CB    . LEU B 2 248 ? 39.133  33.394 54.491  1.00 36.61  ? 544  LEU A CB    1 
ATOM   2136 C  CG    . LEU B 2 248 ? 40.297  34.302 54.093  1.00 36.88  ? 544  LEU A CG    1 
ATOM   2137 C  CD1   . LEU B 2 248 ? 40.040  35.053 52.775  1.00 40.48  ? 544  LEU A CD1   1 
ATOM   2138 C  CD2   . LEU B 2 248 ? 40.633  35.264 55.216  1.00 37.84  ? 544  LEU A CD2   1 
ATOM   2139 N  N     . PRO B 2 249 ? 37.361  31.935 56.760  1.00 42.84  ? 545  PRO A N     1 
ATOM   2140 C  CA    . PRO B 2 249 ? 36.318  30.969 57.125  1.00 46.16  ? 545  PRO A CA    1 
ATOM   2141 C  C     . PRO B 2 249 ? 35.580  30.459 55.895  1.00 42.24  ? 545  PRO A C     1 
ATOM   2142 O  O     . PRO B 2 249 ? 35.424  31.167 54.897  1.00 46.04  ? 545  PRO A O     1 
ATOM   2143 C  CB    . PRO B 2 249 ? 35.384  31.774 58.036  1.00 48.28  ? 545  PRO A CB    1 
ATOM   2144 C  CG    . PRO B 2 249 ? 36.160  32.988 58.439  1.00 48.84  ? 545  PRO A CG    1 
ATOM   2145 C  CD    . PRO B 2 249 ? 37.091  33.274 57.307  1.00 43.63  ? 545  PRO A CD    1 
ATOM   2146 N  N     . VAL B 2 250 ? 35.128  29.209 55.972  1.00 44.57  ? 546  VAL A N     1 
ATOM   2147 C  CA    . VAL B 2 250 ? 34.308  28.620 54.918  1.00 49.80  ? 546  VAL A CA    1 
ATOM   2148 C  C     . VAL B 2 250 ? 32.849  28.811 55.313  1.00 53.40  ? 546  VAL A C     1 
ATOM   2149 O  O     . VAL B 2 250 ? 32.346  28.138 56.216  1.00 58.86  ? 546  VAL A O     1 
ATOM   2150 C  CB    . VAL B 2 250 ? 34.635  27.138 54.689  1.00 49.41  ? 546  VAL A CB    1 
ATOM   2151 C  CG1   . VAL B 2 250 ? 33.916  26.635 53.431  1.00 48.62  ? 546  VAL A CG1   1 
ATOM   2152 C  CG2   . VAL B 2 250 ? 36.143  26.926 54.568  1.00 46.64  ? 546  VAL A CG2   1 
ATOM   2153 N  N     . LEU B 2 251 ? 32.172  29.734 54.633  1.00 58.58  ? 547  LEU A N     1 
ATOM   2154 C  CA    . LEU B 2 251 ? 30.788  30.090 54.919  1.00 64.82  ? 547  LEU A CA    1 
ATOM   2155 C  C     . LEU B 2 251 ? 29.792  29.413 53.988  1.00 71.77  ? 547  LEU A C     1 
ATOM   2156 O  O     . LEU B 2 251 ? 28.584  29.495 54.232  1.00 77.95  ? 547  LEU A O     1 
ATOM   2157 C  CB    . LEU B 2 251 ? 30.605  31.613 54.824  1.00 61.80  ? 547  LEU A CB    1 
ATOM   2158 C  CG    . LEU B 2 251 ? 30.961  32.446 56.061  1.00 67.17  ? 547  LEU A CG    1 
ATOM   2159 C  CD1   . LEU B 2 251 ? 30.338  31.858 57.319  1.00 66.81  ? 547  LEU A CD1   1 
ATOM   2160 C  CD2   . LEU B 2 251 ? 32.464  32.581 56.223  1.00 65.98  ? 547  LEU A CD2   1 
ATOM   2161 N  N     . LYS B 2 252 ? 30.265  28.758 52.930  1.00 69.91  ? 548  LYS A N     1 
ATOM   2162 C  CA    . LYS B 2 252 ? 29.384  28.142 51.947  1.00 69.10  ? 548  LYS A CA    1 
ATOM   2163 C  C     . LYS B 2 252 ? 30.181  27.164 51.095  1.00 63.81  ? 548  LYS A C     1 
ATOM   2164 O  O     . LYS B 2 252 ? 31.270  27.496 50.618  1.00 56.01  ? 548  LYS A O     1 
ATOM   2165 C  CB    . LYS B 2 252 ? 28.721  29.213 51.073  1.00 69.89  ? 548  LYS A CB    1 
ATOM   2166 C  CG    . LYS B 2 252 ? 27.348  28.831 50.520  1.00 74.59  ? 548  LYS A CG    1 
ATOM   2167 C  CD    . LYS B 2 252 ? 26.723  29.991 49.746  1.00 71.50  ? 548  LYS A CD    1 
ATOM   2168 C  CE    . LYS B 2 252 ? 25.216  29.821 49.593  1.00 71.65  ? 548  LYS A CE    1 
ATOM   2169 N  NZ    . LYS B 2 252 ? 24.649  30.735 48.557  1.00 71.44  ? 548  LYS A NZ    1 
ATOM   2170 N  N     . LYS B 2 253 ? 29.665  25.952 50.921  1.00 65.60  ? 549  LYS A N     1 
ATOM   2171 C  CA    . LYS B 2 253 ? 30.296  24.946 50.085  1.00 72.60  ? 549  LYS A CA    1 
ATOM   2172 C  C     . LYS B 2 253 ? 29.454  24.730 48.834  1.00 79.60  ? 549  LYS A C     1 
ATOM   2173 O  O     . LYS B 2 253 ? 28.222  24.784 48.887  1.00 82.36  ? 549  LYS A O     1 
ATOM   2174 C  CB    . LYS B 2 253 ? 30.471  23.631 50.850  1.00 72.89  ? 549  LYS A CB    1 
ATOM   2175 N  N     . THR B 2 254 ? 30.144  24.468 47.730  1.00 82.35  ? 550  THR A N     1 
ATOM   2176 C  CA    . THR B 2 254 ? 29.501  24.161 46.462  1.00 86.34  ? 550  THR A CA    1 
ATOM   2177 C  C     . THR B 2 254 ? 29.655  22.678 46.181  1.00 88.86  ? 550  THR A C     1 
ATOM   2178 O  O     . THR B 2 254 ? 30.429  22.004 46.851  1.00 87.44  ? 550  THR A O     1 
ATOM   2179 C  CB    . THR B 2 254 ? 30.154  24.853 45.271  1.00 30.00  ? 550  THR A CB    1 
ATOM   2180 O  OG1   . THR B 2 254 ? 31.520  24.457 45.193  1.00 30.00  ? 550  THR A OG1   1 
ATOM   2181 C  CG2   . THR B 2 254 ? 30.001  26.367 45.345  1.00 30.00  ? 550  THR A CG2   1 
ATOM   2182 N  N     . LYS B 2 255 ? 28.967  22.188 45.141  1.00 90.83  ? 551  LYS A N     1 
ATOM   2183 C  CA    . LYS B 2 255 ? 28.999  20.763 44.819  1.00 90.79  ? 551  LYS A CA    1 
ATOM   2184 C  C     . LYS B 2 255 ? 30.423  20.223 44.854  1.00 94.10  ? 551  LYS A C     1 
ATOM   2185 O  O     . LYS B 2 255 ? 30.695  19.181 45.463  1.00 90.26  ? 551  LYS A O     1 
ATOM   2186 C  CB    . LYS B 2 255 ? 28.375  20.518 43.441  1.00 87.36  ? 551  LYS A CB    1 
ATOM   2187 C  CG    . LYS B 2 255 ? 27.110  21.312 43.150  1.00 84.01  ? 551  LYS A CG    1 
ATOM   2188 C  CD    . LYS B 2 255 ? 25.874  20.603 43.675  1.00 83.86  ? 551  LYS A CD    1 
ATOM   2189 C  CE    . LYS B 2 255 ? 25.113  19.915 42.554  1.00 84.13  ? 551  LYS A CE    1 
ATOM   2190 N  NZ    . LYS B 2 255 ? 24.483  18.646 43.012  1.00 89.21  ? 551  LYS A NZ    1 
ATOM   2191 N  N     . THR B 2 256 ? 31.349  20.937 44.218  1.00 98.54  ? 552  THR A N     1 
ATOM   2192 C  CA    . THR B 2 256 ? 32.719  20.465 44.069  1.00 99.66  ? 552  THR A CA    1 
ATOM   2193 C  C     . THR B 2 256 ? 33.653  20.973 45.162  1.00 96.06  ? 552  THR A C     1 
ATOM   2194 O  O     . THR B 2 256 ? 34.653  20.311 45.464  1.00 97.62  ? 552  THR A O     1 
ATOM   2195 C  CB    . THR B 2 256 ? 33.258  20.866 42.689  1.00 98.05  ? 552  THR A CB    1 
ATOM   2196 O  OG1   . THR B 2 256 ? 32.747  22.156 42.321  1.00 91.77  ? 552  THR A OG1   1 
ATOM   2197 C  CG2   . THR B 2 256 ? 32.829  19.850 41.639  1.00 97.90  ? 552  THR A CG2   1 
ATOM   2198 N  N     . GLY B 2 257 ? 33.357  22.120 45.773  1.00 91.81  ? 553  GLY A N     1 
ATOM   2199 C  CA    . GLY B 2 257 ? 34.246  22.641 46.794  1.00 86.01  ? 553  GLY A CA    1 
ATOM   2200 C  C     . GLY B 2 257 ? 33.852  23.958 47.435  1.00 74.07  ? 553  GLY A C     1 
ATOM   2201 O  O     . GLY B 2 257 ? 32.729  24.114 47.925  1.00 69.26  ? 553  GLY A O     1 
ATOM   2202 N  N     . TYR B 2 258 ? 34.783  24.912 47.435  1.00 66.88  ? 554  TYR A N     1 
ATOM   2203 C  CA    . TYR B 2 258 ? 34.648  26.156 48.186  1.00 60.89  ? 554  TYR A CA    1 
ATOM   2204 C  C     . TYR B 2 258 ? 33.934  27.210 47.347  1.00 51.00  ? 554  TYR A C     1 
ATOM   2205 O  O     . TYR B 2 258 ? 34.433  27.615 46.288  1.00 47.77  ? 554  TYR A O     1 
ATOM   2206 C  CB    . TYR B 2 258 ? 36.018  26.684 48.607  1.00 62.44  ? 554  TYR A CB    1 
ATOM   2207 C  CG    . TYR B 2 258 ? 36.829  25.789 49.522  1.00 61.40  ? 554  TYR A CG    1 
ATOM   2208 C  CD1   . TYR B 2 258 ? 36.391  25.492 50.806  1.00 58.33  ? 554  TYR A CD1   1 
ATOM   2209 C  CD2   . TYR B 2 258 ? 38.056  25.276 49.113  1.00 60.68  ? 554  TYR A CD2   1 
ATOM   2210 C  CE1   . TYR B 2 258 ? 37.143  24.690 51.652  1.00 62.52  ? 554  TYR A CE1   1 
ATOM   2211 C  CE2   . TYR B 2 258 ? 38.813  24.470 49.952  1.00 66.37  ? 554  TYR A CE2   1 
ATOM   2212 C  CZ    . TYR B 2 258 ? 38.352  24.182 51.221  1.00 65.40  ? 554  TYR A CZ    1 
ATOM   2213 O  OH    . TYR B 2 258 ? 39.097  23.385 52.063  1.00 71.39  ? 554  TYR A OH    1 
ATOM   2214 N  N     . SER B 2 259 ? 32.789  27.679 47.834  1.00 46.68  ? 555  SER A N     1 
ATOM   2215 C  CA    . SER B 2 259 ? 32.093  28.764 47.161  1.00 43.29  ? 555  SER A CA    1 
ATOM   2216 C  C     . SER B 2 259 ? 32.885  30.065 47.263  1.00 42.51  ? 555  SER A C     1 
ATOM   2217 O  O     . SER B 2 259 ? 33.427  30.407 48.320  1.00 36.28  ? 555  SER A O     1 
ATOM   2218 C  CB    . SER B 2 259 ? 30.704  28.958 47.760  1.00 49.23  ? 555  SER A CB    1 
ATOM   2219 O  OG    . SER B 2 259 ? 30.078  30.101 47.199  1.00 53.65  ? 555  SER A OG    1 
ATOM   2220 N  N     . THR B 2 260 ? 32.950  30.795 46.149  1.00 37.95  ? 556  THR A N     1 
ATOM   2221 C  CA    . THR B 2 260 ? 33.596  32.103 46.098  1.00 45.50  ? 556  THR A CA    1 
ATOM   2222 C  C     . THR B 2 260 ? 32.691  33.133 45.427  1.00 47.58  ? 556  THR A C     1 
ATOM   2223 O  O     . THR B 2 260 ? 33.173  34.081 44.794  1.00 39.29  ? 556  THR A O     1 
ATOM   2224 C  CB    . THR B 2 260 ? 34.943  32.038 45.374  1.00 46.66  ? 556  THR A CB    1 
ATOM   2225 O  OG1   . THR B 2 260 ? 34.728  31.789 43.977  1.00 49.41  ? 556  THR A OG1   1 
ATOM   2226 C  CG2   . THR B 2 260 ? 35.845  30.944 45.970  1.00 39.23  ? 556  THR A CG2   1 
ATOM   2227 N  N     . SER B 2 261 ? 31.379  32.962 45.548  1.00 49.56  ? 557  SER A N     1 
ATOM   2228 C  CA    . SER B 2 261 ? 30.466  33.942 44.986  1.00 51.50  ? 557  SER A CA    1 
ATOM   2229 C  C     . SER B 2 261 ? 30.628  35.281 45.698  1.00 52.07  ? 557  SER A C     1 
ATOM   2230 O  O     . SER B 2 261 ? 31.118  35.362 46.831  1.00 49.67  ? 557  SER A O     1 
ATOM   2231 C  CB    . SER B 2 261 ? 29.022  33.462 45.100  1.00 57.56  ? 557  SER A CB    1 
ATOM   2232 O  OG    . SER B 2 261 ? 28.647  33.337 46.460  1.00 62.31  ? 557  SER A OG    1 
ATOM   2233 N  N     . ALA B 2 262 ? 30.205  36.346 45.013  1.00 46.02  ? 558  ALA A N     1 
ATOM   2234 C  CA    . ALA B 2 262 ? 30.300  37.678 45.595  1.00 47.09  ? 558  ALA A CA    1 
ATOM   2235 C  C     . ALA B 2 262 ? 29.576  37.753 46.933  1.00 46.03  ? 558  ALA A C     1 
ATOM   2236 O  O     . ALA B 2 262 ? 29.998  38.498 47.820  1.00 40.60  ? 558  ALA A O     1 
ATOM   2237 C  CB    . ALA B 2 262 ? 29.752  38.720 44.619  1.00 38.55  ? 558  ALA A CB    1 
ATOM   2238 N  N     . ASP B 2 263 ? 28.505  36.971 47.102  1.00 55.99  ? 559  ASP A N     1 
ATOM   2239 C  CA    . ASP B 2 263 ? 27.800  36.915 48.381  1.00 65.25  ? 559  ASP A CA    1 
ATOM   2240 C  C     . ASP B 2 263 ? 28.733  36.483 49.506  1.00 56.52  ? 559  ASP A C     1 
ATOM   2241 O  O     . ASP B 2 263 ? 28.767  37.099 50.577  1.00 53.15  ? 559  ASP A O     1 
ATOM   2242 C  CB    . ASP B 2 263 ? 26.615  35.951 48.279  1.00 82.66  ? 559  ASP A CB    1 
ATOM   2243 C  CG    . ASP B 2 263 ? 25.274  36.662 48.285  1.00 101.39 ? 559  ASP A CG    1 
ATOM   2244 O  OD1   . ASP B 2 263 ? 25.240  37.875 48.589  1.00 107.41 ? 559  ASP A OD1   1 
ATOM   2245 O  OD2   . ASP B 2 263 ? 24.253  36.004 47.986  1.00 106.79 ? 559  ASP A OD2   1 
ATOM   2246 N  N     . VAL B 2 264 ? 29.497  35.417 49.274  1.00 46.50  ? 560  VAL A N     1 
ATOM   2247 C  CA    . VAL B 2 264 ? 30.422  34.918 50.283  1.00 41.55  ? 560  VAL A CA    1 
ATOM   2248 C  C     . VAL B 2 264 ? 31.572  35.895 50.493  1.00 40.80  ? 560  VAL A C     1 
ATOM   2249 O  O     . VAL B 2 264 ? 31.983  36.157 51.629  1.00 43.71  ? 560  VAL A O     1 
ATOM   2250 C  CB    . VAL B 2 264 ? 30.926  33.525 49.872  1.00 42.03  ? 560  VAL A CB    1 
ATOM   2251 C  CG1   . VAL B 2 264 ? 31.840  32.964 50.926  1.00 45.38  ? 560  VAL A CG1   1 
ATOM   2252 C  CG2   . VAL B 2 264 ? 29.747  32.593 49.627  1.00 46.69  ? 560  VAL A CG2   1 
ATOM   2253 N  N     . LEU B 2 265 ? 32.109  36.453 49.407  1.00 38.13  ? 561  LEU A N     1 
ATOM   2254 C  CA    . LEU B 2 265 ? 33.278  37.315 49.530  1.00 40.38  ? 561  LEU A CA    1 
ATOM   2255 C  C     . LEU B 2 265 ? 32.959  38.581 50.314  1.00 31.92  ? 561  LEU A C     1 
ATOM   2256 O  O     . LEU B 2 265 ? 33.779  39.041 51.108  1.00 36.14  ? 561  LEU A O     1 
ATOM   2257 C  CB    . LEU B 2 265 ? 33.821  37.667 48.147  1.00 36.92  ? 561  LEU A CB    1 
ATOM   2258 C  CG    . LEU B 2 265 ? 34.240  36.480 47.277  1.00 38.01  ? 561  LEU A CG    1 
ATOM   2259 C  CD1   . LEU B 2 265 ? 34.788  36.975 45.945  1.00 33.72  ? 561  LEU A CD1   1 
ATOM   2260 C  CD2   . LEU B 2 265 ? 35.255  35.605 47.991  1.00 29.44  ? 561  LEU A CD2   1 
ATOM   2261 N  N     . GLU B 2 266 ? 31.787  39.175 50.088  1.00 42.44  ? 562  GLU A N     1 
ATOM   2262 C  CA    . GLU B 2 266 ? 31.411  40.347 50.875  1.00 43.90  ? 562  GLU A CA    1 
ATOM   2263 C  C     . GLU B 2 266 ? 31.478  40.039 52.364  1.00 39.89  ? 562  GLU A C     1 
ATOM   2264 O  O     . GLU B 2 266 ? 31.989  40.844 53.152  1.00 41.35  ? 562  GLU A O     1 
ATOM   2265 C  CB    . GLU B 2 266 ? 30.012  40.819 50.484  1.00 56.56  ? 562  GLU A CB    1 
ATOM   2266 C  CG    . GLU B 2 266 ? 29.918  41.390 49.074  1.00 75.17  ? 562  GLU A CG    1 
ATOM   2267 C  CD    . GLU B 2 266 ? 28.484  41.475 48.579  1.00 88.48  ? 562  GLU A CD    1 
ATOM   2268 O  OE1   . GLU B 2 266 ? 28.204  41.001 47.453  1.00 87.57  ? 562  GLU A OE1   1 
ATOM   2269 O  OE2   . GLU B 2 266 ? 27.636  42.017 49.321  1.00 96.07  ? 562  GLU A OE2   1 
ATOM   2270 N  N     . LYS B 2 267 ? 31.006  38.851 52.758  1.00 36.65  ? 563  LYS A N     1 
ATOM   2271 C  CA    . LYS B 2 267 ? 31.067  38.435 54.159  1.00 44.00  ? 563  LYS A CA    1 
ATOM   2272 C  C     . LYS B 2 267 ? 32.500  38.242 54.640  1.00 41.61  ? 563  LYS A C     1 
ATOM   2273 O  O     . LYS B 2 267 ? 32.771  38.388 55.834  1.00 46.99  ? 563  LYS A O     1 
ATOM   2274 C  CB    . LYS B 2 267 ? 30.278  37.141 54.355  1.00 48.43  ? 563  LYS A CB    1 
ATOM   2275 C  CG    . LYS B 2 267 ? 28.846  37.341 54.810  1.00 57.96  ? 563  LYS A CG    1 
ATOM   2276 C  CD    . LYS B 2 267 ? 27.931  37.648 53.638  1.00 69.68  ? 563  LYS A CD    1 
ATOM   2277 C  CE    . LYS B 2 267 ? 26.584  36.948 53.768  1.00 70.85  ? 563  LYS A CE    1 
ATOM   2278 N  NZ    . LYS B 2 267 ? 25.635  37.395 52.705  1.00 75.63  ? 563  LYS A NZ    1 
ATOM   2279 N  N     . LEU B 2 268 ? 33.427  37.904 53.748  1.00 39.60  ? 564  LEU A N     1 
ATOM   2280 C  CA    . LEU B 2 268 ? 34.803  37.660 54.168  1.00 41.86  ? 564  LEU A CA    1 
ATOM   2281 C  C     . LEU B 2 268 ? 35.668  38.911 54.142  1.00 38.08  ? 564  LEU A C     1 
ATOM   2282 O  O     . LEU B 2 268 ? 36.800  38.873 54.641  1.00 37.94  ? 564  LEU A O     1 
ATOM   2283 C  CB    . LEU B 2 268 ? 35.445  36.592 53.279  1.00 42.88  ? 564  LEU A CB    1 
ATOM   2284 C  CG    . LEU B 2 268 ? 34.814  35.207 53.345  1.00 46.81  ? 564  LEU A CG    1 
ATOM   2285 C  CD1   . LEU B 2 268 ? 35.349  34.349 52.214  1.00 32.64  ? 564  LEU A CD1   1 
ATOM   2286 C  CD2   . LEU B 2 268 ? 35.079  34.565 54.705  1.00 34.49  ? 564  LEU A CD2   1 
ATOM   2287 N  N     . ALA B 2 269 ? 35.162  40.004 53.579  1.00 36.07  ? 565  ALA A N     1 
ATOM   2288 C  CA    . ALA B 2 269 ? 35.958  41.218 53.409  1.00 40.78  ? 565  ALA A CA    1 
ATOM   2289 C  C     . ALA B 2 269 ? 36.691  41.698 54.660  1.00 41.52  ? 565  ALA A C     1 
ATOM   2290 O  O     . ALA B 2 269 ? 37.866  42.084 54.524  1.00 37.07  ? 565  ALA A O     1 
ATOM   2291 C  CB    . ALA B 2 269 ? 35.060  42.330 52.848  1.00 42.12  ? 565  ALA A CB    1 
ATOM   2292 N  N     . PRO B 2 270 ? 36.106  41.693 55.879  1.00 38.72  ? 566  PRO A N     1 
ATOM   2293 C  CA    . PRO B 2 270 ? 36.854  42.207 57.049  1.00 41.91  ? 566  PRO A CA    1 
ATOM   2294 C  C     . PRO B 2 270 ? 38.072  41.390 57.419  1.00 48.40  ? 566  PRO A C     1 
ATOM   2295 O  O     . PRO B 2 270 ? 38.931  41.897 58.156  1.00 40.21  ? 566  PRO A O     1 
ATOM   2296 C  CB    . PRO B 2 270 ? 35.824  42.168 58.196  1.00 38.14  ? 566  PRO A CB    1 
ATOM   2297 C  CG    . PRO B 2 270 ? 34.488  42.115 57.526  1.00 40.33  ? 566  PRO A CG    1 
ATOM   2298 C  CD    . PRO B 2 270 ? 34.707  41.372 56.227  1.00 39.66  ? 566  PRO A CD    1 
ATOM   2299 N  N     . TYR B 2 271 ? 38.166  40.137 56.973  1.00 37.84  ? 567  TYR A N     1 
ATOM   2300 C  CA    . TYR B 2 271 ? 39.270  39.296 57.414  1.00 38.77  ? 567  TYR A CA    1 
ATOM   2301 C  C     . TYR B 2 271 ? 40.547  39.560 56.636  1.00 38.91  ? 567  TYR A C     1 
ATOM   2302 O  O     . TYR B 2 271 ? 41.640  39.405 57.181  1.00 40.59  ? 567  TYR A O     1 
ATOM   2303 C  CB    . TYR B 2 271 ? 38.888  37.818 57.296  1.00 41.08  ? 567  TYR A CB    1 
ATOM   2304 C  CG    . TYR B 2 271 ? 37.762  37.445 58.212  1.00 41.87  ? 567  TYR A CG    1 
ATOM   2305 C  CD1   . TYR B 2 271 ? 37.989  37.250 59.570  1.00 41.82  ? 567  TYR A CD1   1 
ATOM   2306 C  CD2   . TYR B 2 271 ? 36.465  37.325 57.734  1.00 43.72  ? 567  TYR A CD2   1 
ATOM   2307 C  CE1   . TYR B 2 271 ? 36.955  36.924 60.427  1.00 42.97  ? 567  TYR A CE1   1 
ATOM   2308 C  CE2   . TYR B 2 271 ? 35.420  36.999 58.584  1.00 50.61  ? 567  TYR A CE2   1 
ATOM   2309 C  CZ    . TYR B 2 271 ? 35.676  36.795 59.930  1.00 48.20  ? 567  TYR A CZ    1 
ATOM   2310 O  OH    . TYR B 2 271 ? 34.645  36.474 60.779  1.00 45.85  ? 567  TYR A OH    1 
ATOM   2311 N  N     . HIS B 2 272 ? 40.449  39.932 55.366  1.00 37.84  ? 568  HIS A N     1 
ATOM   2312 C  CA    . HIS B 2 272 ? 41.678  40.105 54.613  1.00 47.28  ? 568  HIS A CA    1 
ATOM   2313 C  C     . HIS B 2 272 ? 41.436  41.072 53.469  1.00 39.51  ? 568  HIS A C     1 
ATOM   2314 O  O     . HIS B 2 272 ? 40.373  41.060 52.840  1.00 39.72  ? 568  HIS A O     1 
ATOM   2315 C  CB    . HIS B 2 272 ? 42.214  38.768 54.087  1.00 37.99  ? 568  HIS A CB    1 
ATOM   2316 C  CG    . HIS B 2 272 ? 43.632  38.842 53.605  1.00 46.84  ? 568  HIS A CG    1 
ATOM   2317 N  ND1   . HIS B 2 272 ? 44.690  38.285 54.295  1.00 46.62  ? 568  HIS A ND1   1 
ATOM   2318 C  CD2   . HIS B 2 272 ? 44.167  39.431 52.510  1.00 41.98  ? 568  HIS A CD2   1 
ATOM   2319 C  CE1   . HIS B 2 272 ? 45.811  38.511 53.632  1.00 45.10  ? 568  HIS A CE1   1 
ATOM   2320 N  NE2   . HIS B 2 272 ? 45.521  39.205 52.546  1.00 44.60  ? 568  HIS A NE2   1 
ATOM   2321 N  N     . GLU B 2 273 ? 42.443  41.898 53.210  1.00 39.34  ? 569  GLU A N     1 
ATOM   2322 C  CA    . GLU B 2 273 ? 42.335  42.934 52.194  1.00 39.71  ? 569  GLU A CA    1 
ATOM   2323 C  C     . GLU B 2 273 ? 42.223  42.346 50.797  1.00 37.43  ? 569  GLU A C     1 
ATOM   2324 O  O     . GLU B 2 273 ? 41.712  43.026 49.898  1.00 37.29  ? 569  GLU A O     1 
ATOM   2325 C  CB    . GLU B 2 273 ? 43.539  43.881 52.285  1.00 49.62  ? 569  GLU A CB    1 
ATOM   2326 C  CG    . GLU B 2 273 ? 43.716  44.636 53.634  1.00 69.46  ? 569  GLU A CG    1 
ATOM   2327 C  CD    . GLU B 2 273 ? 43.600  43.756 54.892  1.00 85.89  ? 569  GLU A CD    1 
ATOM   2328 O  OE1   . GLU B 2 273 ? 42.733  44.048 55.747  1.00 89.64  ? 569  GLU A OE1   1 
ATOM   2329 O  OE2   . GLU B 2 273 ? 44.359  42.764 55.017  1.00 87.99  ? 569  GLU A OE2   1 
ATOM   2330 N  N     . ILE B 2 274 ? 42.676  41.097 50.601  1.00 36.21  ? 570  ILE A N     1 
ATOM   2331 C  CA    . ILE B 2 274 ? 42.542  40.413 49.312  1.00 38.07  ? 570  ILE A CA    1 
ATOM   2332 C  C     . ILE B 2 274 ? 41.095  40.386 48.849  1.00 33.78  ? 570  ILE A C     1 
ATOM   2333 O  O     . ILE B 2 274 ? 40.819  40.438 47.643  1.00 32.87  ? 570  ILE A O     1 
ATOM   2334 C  CB    . ILE B 2 274 ? 43.116  38.974 49.383  1.00 42.88  ? 570  ILE A CB    1 
ATOM   2335 C  CG1   . ILE B 2 274 ? 43.186  38.340 47.996  1.00 47.48  ? 570  ILE A CG1   1 
ATOM   2336 C  CG2   . ILE B 2 274 ? 42.263  38.054 50.249  1.00 38.34  ? 570  ILE A CG2   1 
ATOM   2337 C  CD1   . ILE B 2 274 ? 44.518  38.474 47.338  1.00 54.89  ? 570  ILE A CD1   1 
ATOM   2338 N  N     . VAL B 2 275 ? 40.147  40.293 49.780  1.00 33.64  ? 571  VAL A N     1 
ATOM   2339 C  CA    . VAL B 2 275 ? 38.788  39.970 49.367  1.00 32.40  ? 571  VAL A CA    1 
ATOM   2340 C  C     . VAL B 2 275 ? 38.172  41.120 48.585  1.00 38.68  ? 571  VAL A C     1 
ATOM   2341 O  O     . VAL B 2 275 ? 37.525  40.907 47.549  1.00 33.83  ? 571  VAL A O     1 
ATOM   2342 C  CB    . VAL B 2 275 ? 37.931  39.585 50.581  1.00 32.63  ? 571  VAL A CB    1 
ATOM   2343 C  CG1   . VAL B 2 275 ? 36.540  39.259 50.093  1.00 38.75  ? 571  VAL A CG1   1 
ATOM   2344 C  CG2   . VAL B 2 275 ? 38.544  38.376 51.298  1.00 33.45  ? 571  VAL A CG2   1 
ATOM   2345 N  N     . GLU B 2 276 ? 38.366  42.355 49.059  1.00 32.27  ? 572  GLU A N     1 
ATOM   2346 C  CA    . GLU B 2 276 ? 37.874  43.515 48.322  1.00 31.74  ? 572  GLU A CA    1 
ATOM   2347 C  C     . GLU B 2 276 ? 38.463  43.559 46.916  1.00 31.30  ? 572  GLU A C     1 
ATOM   2348 O  O     . GLU B 2 276 ? 37.751  43.821 45.942  1.00 37.05  ? 572  GLU A O     1 
ATOM   2349 C  CB    . GLU B 2 276 ? 38.202  44.800 49.092  1.00 41.43  ? 572  GLU A CB    1 
ATOM   2350 C  CG    . GLU B 2 276 ? 37.737  46.085 48.406  1.00 61.59  ? 572  GLU A CG    1 
ATOM   2351 C  CD    . GLU B 2 276 ? 38.008  47.339 49.243  1.00 80.84  ? 572  GLU A CD    1 
ATOM   2352 O  OE1   . GLU B 2 276 ? 37.238  48.320 49.121  1.00 83.67  ? 572  GLU A OE1   1 
ATOM   2353 O  OE2   . GLU B 2 276 ? 38.992  47.345 50.019  1.00 85.08  ? 572  GLU A OE2   1 
ATOM   2354 N  N     . ASN B 2 277 ? 39.761  43.288 46.790  1.00 36.76  ? 573  ASN A N     1 
ATOM   2355 C  CA    . ASN B 2 277 ? 40.391  43.315 45.475  1.00 37.86  ? 573  ASN A CA    1 
ATOM   2356 C  C     . ASN B 2 277 ? 39.859  42.213 44.571  1.00 30.77  ? 573  ASN A C     1 
ATOM   2357 O  O     . ASN B 2 277 ? 39.710  42.426 43.366  1.00 32.53  ? 573  ASN A O     1 
ATOM   2358 C  CB    . ASN B 2 277 ? 41.904  43.210 45.618  1.00 40.49  ? 573  ASN A CB    1 
ATOM   2359 C  CG    . ASN B 2 277 ? 42.518  44.483 46.139  1.00 46.59  ? 573  ASN A CG    1 
ATOM   2360 O  OD1   . ASN B 2 277 ? 42.646  45.462 45.412  1.00 42.30  ? 573  ASN A OD1   1 
ATOM   2361 N  ND2   . ASN B 2 277 ? 42.903  44.480 47.407  1.00 35.31  ? 573  ASN A ND2   1 
ATOM   2362 N  N     . ILE B 2 278 ? 39.559  41.034 45.126  1.00 30.62  ? 574  ILE A N     1 
ATOM   2363 C  CA    . ILE B 2 278 ? 38.938  39.974 44.327  1.00 32.39  ? 574  ILE A CA    1 
ATOM   2364 C  C     . ILE B 2 278 ? 37.598  40.437 43.769  1.00 28.45  ? 574  ILE A C     1 
ATOM   2365 O  O     . ILE B 2 278 ? 37.306  40.266 42.579  1.00 32.22  ? 574  ILE A O     1 
ATOM   2366 C  CB    . ILE B 2 278 ? 38.765  38.691 45.156  1.00 35.79  ? 574  ILE A CB    1 
ATOM   2367 C  CG1   . ILE B 2 278 ? 40.124  38.133 45.590  1.00 45.74  ? 574  ILE A CG1   1 
ATOM   2368 C  CG2   . ILE B 2 278 ? 37.945  37.669 44.370  1.00 28.87  ? 574  ILE A CG2   1 
ATOM   2369 C  CD1   . ILE B 2 278 ? 41.064  37.884 44.454  1.00 45.59  ? 574  ILE A CD1   1 
ATOM   2370 N  N     . LEU B 2 279 ? 36.743  40.983 44.634  1.00 32.19  ? 575  LEU A N     1 
ATOM   2371 C  CA    . LEU B 2 279 ? 35.464  41.519 44.184  1.00 33.27  ? 575  LEU A CA    1 
ATOM   2372 C  C     . LEU B 2 279 ? 35.661  42.531 43.064  1.00 27.13  ? 575  LEU A C     1 
ATOM   2373 O  O     . LEU B 2 279 ? 35.010  42.454 42.017  1.00 37.55  ? 575  LEU A O     1 
ATOM   2374 C  CB    . LEU B 2 279 ? 34.729  42.166 45.357  1.00 27.75  ? 575  LEU A CB    1 
ATOM   2375 C  CG    . LEU B 2 279 ? 34.236  41.177 46.403  1.00 35.86  ? 575  LEU A CG    1 
ATOM   2376 C  CD1   . LEU B 2 279 ? 34.078  41.836 47.782  1.00 38.39  ? 575  LEU A CD1   1 
ATOM   2377 C  CD2   . LEU B 2 279 ? 32.936  40.552 45.927  1.00 35.13  ? 575  LEU A CD2   1 
ATOM   2378 N  N     . HIS B 2 280 ? 36.571  43.484 43.273  1.00 35.68  ? 576  HIS A N     1 
ATOM   2379 C  CA    . HIS B 2 280 ? 36.842  44.498 42.260  1.00 34.32  ? 576  HIS A CA    1 
ATOM   2380 C  C     . HIS B 2 280 ? 37.344  43.862 40.971  1.00 33.98  ? 576  HIS A C     1 
ATOM   2381 O  O     . HIS B 2 280 ? 36.932  44.250 39.872  1.00 32.23  ? 576  HIS A O     1 
ATOM   2382 C  CB    . HIS B 2 280 ? 37.859  45.506 42.796  1.00 39.89  ? 576  HIS A CB    1 
ATOM   2383 C  CG    . HIS B 2 280 ? 37.984  46.745 41.963  1.00 52.81  ? 576  HIS A CG    1 
ATOM   2384 N  ND1   . HIS B 2 280 ? 39.175  47.423 41.814  1.00 55.82  ? 576  HIS A ND1   1 
ATOM   2385 C  CD2   . HIS B 2 280 ? 37.067  47.430 41.239  1.00 54.40  ? 576  HIS A CD2   1 
ATOM   2386 C  CE1   . HIS B 2 280 ? 38.987  48.472 41.032  1.00 57.15  ? 576  HIS A CE1   1 
ATOM   2387 N  NE2   . HIS B 2 280 ? 37.716  48.500 40.671  1.00 55.97  ? 576  HIS A NE2   1 
ATOM   2388 N  N     . TYR B 2 281 ? 38.230  42.876 41.086  1.00 31.08  ? 577  TYR A N     1 
ATOM   2389 C  CA    . TYR B 2 281 ? 38.698  42.159 39.908  1.00 27.85  ? 577  TYR A CA    1 
ATOM   2390 C  C     . TYR B 2 281 ? 37.555  41.431 39.219  1.00 34.04  ? 577  TYR A C     1 
ATOM   2391 O  O     . TYR B 2 281 ? 37.486  41.392 37.986  1.00 38.10  ? 577  TYR A O     1 
ATOM   2392 C  CB    . TYR B 2 281 ? 39.797  41.179 40.310  1.00 28.73  ? 577  TYR A CB    1 
ATOM   2393 C  CG    . TYR B 2 281 ? 40.359  40.369 39.169  1.00 33.13  ? 577  TYR A CG    1 
ATOM   2394 C  CD1   . TYR B 2 281 ? 41.449  40.825 38.438  1.00 34.50  ? 577  TYR A CD1   1 
ATOM   2395 C  CD2   . TYR B 2 281 ? 39.803  39.144 38.825  1.00 37.02  ? 577  TYR A CD2   1 
ATOM   2396 C  CE1   . TYR B 2 281 ? 41.976  40.072 37.389  1.00 39.61  ? 577  TYR A CE1   1 
ATOM   2397 C  CE2   . TYR B 2 281 ? 40.316  38.391 37.780  1.00 46.68  ? 577  TYR A CE2   1 
ATOM   2398 C  CZ    . TYR B 2 281 ? 41.403  38.858 37.067  1.00 47.92  ? 577  TYR A CZ    1 
ATOM   2399 O  OH    . TYR B 2 281 ? 41.915  38.107 36.031  1.00 59.12  ? 577  TYR A OH    1 
ATOM   2400 N  N     . ARG B 2 282 ? 36.640  40.856 39.999  1.00 34.95  ? 578  ARG A N     1 
ATOM   2401 C  CA    . ARG B 2 282 ? 35.515  40.141 39.409  1.00 36.34  ? 578  ARG A CA    1 
ATOM   2402 C  C     . ARG B 2 282 ? 34.607  41.081 38.632  1.00 33.16  ? 578  ARG A C     1 
ATOM   2403 O  O     . ARG B 2 282 ? 34.071  40.707 37.587  1.00 33.35  ? 578  ARG A O     1 
ATOM   2404 C  CB    . ARG B 2 282 ? 34.713  39.433 40.497  1.00 43.09  ? 578  ARG A CB    1 
ATOM   2405 C  CG    . ARG B 2 282 ? 35.357  38.187 41.026  1.00 41.16  ? 578  ARG A CG    1 
ATOM   2406 C  CD    . ARG B 2 282 ? 34.634  36.974 40.511  1.00 43.22  ? 578  ARG A CD    1 
ATOM   2407 N  NE    . ARG B 2 282 ? 35.255  35.739 40.974  1.00 40.44  ? 578  ARG A NE    1 
ATOM   2408 C  CZ    . ARG B 2 282 ? 34.831  35.045 42.022  1.00 40.92  ? 578  ARG A CZ    1 
ATOM   2409 N  NH1   . ARG B 2 282 ? 33.788  35.468 42.723  1.00 38.33  ? 578  ARG A NH1   1 
ATOM   2410 N  NH2   . ARG B 2 282 ? 35.447  33.927 42.365  1.00 46.71  ? 578  ARG A NH2   1 
ATOM   2411 N  N     . GLN B 2 283 ? 34.378  42.289 39.147  1.00 35.11  ? 579  GLN A N     1 
ATOM   2412 C  CA    . GLN B 2 283 ? 33.471  43.187 38.442  1.00 42.65  ? 579  GLN A CA    1 
ATOM   2413 C  C     . GLN B 2 283 ? 34.129  43.755 37.187  1.00 33.38  ? 579  GLN A C     1 
ATOM   2414 O  O     . GLN B 2 283 ? 33.498  43.803 36.126  1.00 41.79  ? 579  GLN A O     1 
ATOM   2415 C  CB    . GLN B 2 283 ? 32.977  44.297 39.375  1.00 58.61  ? 579  GLN A CB    1 
ATOM   2416 C  CG    . GLN B 2 283 ? 34.043  45.246 39.891  1.00 75.47  ? 579  GLN A CG    1 
ATOM   2417 C  CD    . GLN B 2 283 ? 33.520  46.652 40.136  1.00 87.01  ? 579  GLN A CD    1 
ATOM   2418 O  OE1   . GLN B 2 283 ? 32.887  47.255 39.267  1.00 86.84  ? 579  GLN A OE1   1 
ATOM   2419 N  NE2   . GLN B 2 283 ? 33.791  47.183 41.327  1.00 89.33  ? 579  GLN A NE2   1 
ATOM   2420 N  N     . LEU B 2 284 ? 35.402  44.159 37.280  1.00 31.13  ? 580  LEU A N     1 
ATOM   2421 C  CA    . LEU B 2 284 ? 36.128  44.634 36.104  1.00 41.80  ? 580  LEU A CA    1 
ATOM   2422 C  C     . LEU B 2 284 ? 36.228  43.548 35.045  1.00 41.19  ? 580  LEU A C     1 
ATOM   2423 O  O     . LEU B 2 284 ? 36.050  43.815 33.850  1.00 40.06  ? 580  LEU A O     1 
ATOM   2424 C  CB    . LEU B 2 284 ? 37.532  45.111 36.486  1.00 40.87  ? 580  LEU A CB    1 
ATOM   2425 C  CG    . LEU B 2 284 ? 37.739  46.298 37.433  1.00 47.32  ? 580  LEU A CG    1 
ATOM   2426 C  CD1   . LEU B 2 284 ? 39.226  46.582 37.616  1.00 45.94  ? 580  LEU A CD1   1 
ATOM   2427 C  CD2   . LEU B 2 284 ? 37.011  47.541 36.946  1.00 49.21  ? 580  LEU A CD2   1 
ATOM   2428 N  N     . GLY B 2 285 ? 36.518  42.315 35.463  1.00 35.21  ? 581  GLY A N     1 
ATOM   2429 C  CA    . GLY B 2 285 ? 36.646  41.234 34.503  1.00 28.20  ? 581  GLY A CA    1 
ATOM   2430 C  C     . GLY B 2 285 ? 35.331  40.852 33.856  1.00 33.12  ? 581  GLY A C     1 
ATOM   2431 O  O     . GLY B 2 285 ? 35.298  40.448 32.688  1.00 26.97  ? 581  GLY A O     1 
ATOM   2432 N  N     . LYS B 2 286 ? 34.234  40.967 34.596  1.00 31.55  ? 582  LYS A N     1 
ATOM   2433 C  CA    . LYS B 2 286 ? 32.920  40.759 34.001  1.00 33.13  ? 582  LYS A CA    1 
ATOM   2434 C  C     . LYS B 2 286 ? 32.667  41.768 32.885  1.00 31.69  ? 582  LYS A C     1 
ATOM   2435 O  O     . LYS B 2 286 ? 32.256  41.400 31.780  1.00 28.82  ? 582  LYS A O     1 
ATOM   2436 C  CB    . LYS B 2 286 ? 31.846  40.870 35.084  1.00 36.28  ? 582  LYS A CB    1 
ATOM   2437 C  CG    . LYS B 2 286 ? 30.434  40.663 34.590  1.00 41.05  ? 582  LYS A CG    1 
ATOM   2438 C  CD    . LYS B 2 286 ? 30.187  39.234 34.159  1.00 42.50  ? 582  LYS A CD    1 
ATOM   2439 C  CE    . LYS B 2 286 ? 28.753  38.838 34.477  1.00 34.47  ? 582  LYS A CE    1 
ATOM   2440 N  NZ    . LYS B 2 286 ? 28.456  37.447 34.087  1.00 35.48  ? 582  LYS A NZ    1 
ATOM   2441 N  N     . LEU B 2 287 ? 32.932  43.048 33.159  1.00 24.84  ? 583  LEU A N     1 
ATOM   2442 C  CA    . LEU B 2 287 ? 32.740  44.088 32.159  1.00 34.22  ? 583  LEU A CA    1 
ATOM   2443 C  C     . LEU B 2 287 ? 33.599  43.832 30.933  1.00 38.50  ? 583  LEU A C     1 
ATOM   2444 O  O     . LEU B 2 287 ? 33.111  43.873 29.796  1.00 36.88  ? 583  LEU A O     1 
ATOM   2445 C  CB    . LEU B 2 287 ? 33.071  45.455 32.755  1.00 36.47  ? 583  LEU A CB    1 
ATOM   2446 C  CG    . LEU B 2 287 ? 32.127  45.948 33.842  1.00 44.80  ? 583  LEU A CG    1 
ATOM   2447 C  CD1   . LEU B 2 287 ? 32.484  47.373 34.261  1.00 44.74  ? 583  LEU A CD1   1 
ATOM   2448 C  CD2   . LEU B 2 287 ? 30.703  45.866 33.338  1.00 47.34  ? 583  LEU A CD2   1 
ATOM   2449 N  N     . GLN B 2 288 ? 34.885  43.562 31.148  1.00 32.48  ? 584  GLN A N     1 
ATOM   2450 C  CA    . GLN B 2 288 ? 35.816  43.456 30.032  1.00 35.35  ? 584  GLN A CA    1 
ATOM   2451 C  C     . GLN B 2 288 ? 35.527  42.226 29.186  1.00 41.70  ? 584  GLN A C     1 
ATOM   2452 O  O     . GLN B 2 288 ? 35.377  42.324 27.962  1.00 40.94  ? 584  GLN A O     1 
ATOM   2453 C  CB    . GLN B 2 288 ? 37.253  43.431 30.549  1.00 41.43  ? 584  GLN A CB    1 
ATOM   2454 C  CG    . GLN B 2 288 ? 38.292  43.161 29.467  1.00 55.44  ? 584  GLN A CG    1 
ATOM   2455 C  CD    . GLN B 2 288 ? 38.799  44.438 28.833  1.00 60.23  ? 584  GLN A CD    1 
ATOM   2456 O  OE1   . GLN B 2 288 ? 38.013  45.284 28.406  1.00 64.25  ? 584  GLN A OE1   1 
ATOM   2457 N  NE2   . GLN B 2 288 ? 40.115  44.586 28.768  1.00 61.05  ? 584  GLN A NE2   1 
ATOM   2458 N  N     . SER B 2 289 ? 35.443  41.059 29.825  1.00 37.77  ? 585  SER A N     1 
ATOM   2459 C  CA    . SER B 2 289 ? 35.209  39.819 29.098  1.00 44.38  ? 585  SER A CA    1 
ATOM   2460 C  C     . SER B 2 289 ? 33.821  39.800 28.472  1.00 47.97  ? 585  SER A C     1 
ATOM   2461 O  O     . SER B 2 289 ? 33.674  39.647 27.253  1.00 50.65  ? 585  SER A O     1 
ATOM   2462 C  CB    . SER B 2 289 ? 35.380  38.629 30.038  1.00 55.64  ? 585  SER A CB    1 
ATOM   2463 O  OG    . SER B 2 289 ? 34.398  38.673 31.060  1.00 65.53  ? 585  SER A OG    1 
ATOM   2464 N  N     . THR B 2 290 ? 32.785  39.956 29.297  1.00 39.68  ? 586  THR A N     1 
ATOM   2465 C  CA    . THR B 2 290 ? 31.422  39.726 28.828  1.00 38.63  ? 586  THR A CA    1 
ATOM   2466 C  C     . THR B 2 290 ? 30.926  40.874 27.959  1.00 44.39  ? 586  THR A C     1 
ATOM   2467 O  O     . THR B 2 290 ? 30.372  40.650 26.878  1.00 44.53  ? 586  THR A O     1 
ATOM   2468 C  CB    . THR B 2 290 ? 30.474  39.516 30.014  1.00 46.95  ? 586  THR A CB    1 
ATOM   2469 O  OG1   . THR B 2 290 ? 30.631  38.186 30.533  1.00 52.74  ? 586  THR A OG1   1 
ATOM   2470 C  CG2   . THR B 2 290 ? 29.024  39.721 29.585  1.00 41.02  ? 586  THR A CG2   1 
ATOM   2471 N  N     . TYR B 2 291 ? 31.105  42.110 28.411  1.00 36.64  ? 587  TYR A N     1 
ATOM   2472 C  CA    . TYR B 2 291 ? 30.429  43.218 27.757  1.00 36.61  ? 587  TYR A CA    1 
ATOM   2473 C  C     . TYR B 2 291 ? 31.296  43.967 26.763  1.00 36.92  ? 587  TYR A C     1 
ATOM   2474 O  O     . TYR B 2 291 ? 30.832  44.262 25.666  1.00 51.62  ? 587  TYR A O     1 
ATOM   2475 C  CB    . TYR B 2 291 ? 29.886  44.185 28.805  1.00 29.45  ? 587  TYR A CB    1 
ATOM   2476 C  CG    . TYR B 2 291 ? 28.851  43.532 29.670  1.00 34.68  ? 587  TYR A CG    1 
ATOM   2477 C  CD1   . TYR B 2 291 ? 27.596  43.223 29.161  1.00 37.99  ? 587  TYR A CD1   1 
ATOM   2478 C  CD2   . TYR B 2 291 ? 29.133  43.192 30.989  1.00 42.40  ? 587  TYR A CD2   1 
ATOM   2479 C  CE1   . TYR B 2 291 ? 26.645  42.605 29.944  1.00 43.77  ? 587  TYR A CE1   1 
ATOM   2480 C  CE2   . TYR B 2 291 ? 28.186  42.580 31.789  1.00 42.79  ? 587  TYR A CE2   1 
ATOM   2481 C  CZ    . TYR B 2 291 ? 26.943  42.289 31.262  1.00 41.87  ? 587  TYR A CZ    1 
ATOM   2482 O  OH    . TYR B 2 291 ? 26.000  41.679 32.051  1.00 36.46  ? 587  TYR A OH    1 
ATOM   2483 N  N     . ILE B 2 292 ? 32.538  44.289 27.101  1.00 32.39  ? 588  ILE A N     1 
ATOM   2484 C  CA    . ILE B 2 292 ? 33.389  44.986 26.147  1.00 34.71  ? 588  ILE A CA    1 
ATOM   2485 C  C     . ILE B 2 292 ? 33.780  44.009 25.053  1.00 37.78  ? 588  ILE A C     1 
ATOM   2486 O  O     . ILE B 2 292 ? 33.375  44.166 23.896  1.00 35.50  ? 588  ILE A O     1 
ATOM   2487 C  CB    . ILE B 2 292 ? 34.638  45.595 26.805  1.00 32.40  ? 588  ILE A CB    1 
ATOM   2488 C  CG1   . ILE B 2 292 ? 34.248  46.622 27.876  1.00 39.66  ? 588  ILE A CG1   1 
ATOM   2489 C  CG2   . ILE B 2 292 ? 35.531  46.226 25.752  1.00 32.11  ? 588  ILE A CG2   1 
ATOM   2490 C  CD1   . ILE B 2 292 ? 32.964  47.355 27.598  1.00 35.87  ? 588  ILE A CD1   1 
ATOM   2491 N  N     . GLU B 2 293 ? 34.562  42.985 25.410  1.00 32.05  ? 589  GLU A N     1 
ATOM   2492 C  CA    . GLU B 2 293 ? 35.012  42.028 24.404  1.00 32.32  ? 589  GLU A CA    1 
ATOM   2493 C  C     . GLU B 2 293 ? 33.832  41.310 23.764  1.00 34.47  ? 589  GLU A C     1 
ATOM   2494 O  O     . GLU B 2 293 ? 33.801  41.121 22.544  1.00 39.56  ? 589  GLU A O     1 
ATOM   2495 C  CB    . GLU B 2 293 ? 35.984  41.027 25.025  1.00 29.78  ? 589  GLU A CB    1 
ATOM   2496 C  CG    . GLU B 2 293 ? 37.298  41.661 25.438  1.00 40.59  ? 589  GLU A CG    1 
ATOM   2497 C  CD    . GLU B 2 293 ? 38.222  40.685 26.142  1.00 62.79  ? 589  GLU A CD    1 
ATOM   2498 O  OE1   . GLU B 2 293 ? 37.883  39.483 26.199  1.00 67.98  ? 589  GLU A OE1   1 
ATOM   2499 O  OE2   . GLU B 2 293 ? 39.287  41.119 26.632  1.00 68.48  ? 589  GLU A OE2   1 
ATOM   2500 N  N     . GLY B 2 294 ? 32.836  40.935 24.567  1.00 28.66  ? 590  GLY A N     1 
ATOM   2501 C  CA    . GLY B 2 294 ? 31.681  40.247 24.016  1.00 25.73  ? 590  GLY A CA    1 
ATOM   2502 C  C     . GLY B 2 294 ? 30.919  41.085 23.002  1.00 29.62  ? 590  GLY A C     1 
ATOM   2503 O  O     . GLY B 2 294 ? 30.506  40.584 21.954  1.00 32.35  ? 590  GLY A O     1 
ATOM   2504 N  N     . LEU B 2 295 ? 30.721  42.372 23.294  1.00 29.04  ? 591  LEU A N     1 
ATOM   2505 C  CA    . LEU B 2 295 ? 30.022  43.216 22.331  1.00 25.22  ? 591  LEU A CA    1 
ATOM   2506 C  C     . LEU B 2 295 ? 30.853  43.414 21.076  1.00 29.22  ? 591  LEU A C     1 
ATOM   2507 O  O     . LEU B 2 295 ? 30.328  43.329 19.962  1.00 30.25  ? 591  LEU A O     1 
ATOM   2508 C  CB    . LEU B 2 295 ? 29.667  44.567 22.942  1.00 32.79  ? 591  LEU A CB    1 
ATOM   2509 C  CG    . LEU B 2 295 ? 28.302  44.578 23.610  1.00 36.51  ? 591  LEU A CG    1 
ATOM   2510 C  CD1   . LEU B 2 295 ? 28.113  45.864 24.414  1.00 40.68  ? 591  LEU A CD1   1 
ATOM   2511 C  CD2   . LEU B 2 295 ? 27.229  44.426 22.546  1.00 25.66  ? 591  LEU A CD2   1 
ATOM   2512 N  N     . LEU B 2 296 ? 32.154  43.665 21.236  1.00 31.61  ? 592  LEU A N     1 
ATOM   2513 C  CA    . LEU B 2 296 ? 32.988  43.935 20.072  1.00 31.89  ? 592  LEU A CA    1 
ATOM   2514 C  C     . LEU B 2 296 ? 33.042  42.738 19.138  1.00 35.15  ? 592  LEU A C     1 
ATOM   2515 O  O     . LEU B 2 296 ? 33.228  42.903 17.925  1.00 38.73  ? 592  LEU A O     1 
ATOM   2516 C  CB    . LEU B 2 296 ? 34.395  44.337 20.520  1.00 30.39  ? 592  LEU A CB    1 
ATOM   2517 C  CG    . LEU B 2 296 ? 34.469  45.722 21.170  1.00 39.04  ? 592  LEU A CG    1 
ATOM   2518 C  CD1   . LEU B 2 296 ? 35.833  45.992 21.792  1.00 37.97  ? 592  LEU A CD1   1 
ATOM   2519 C  CD2   . LEU B 2 296 ? 34.129  46.805 20.142  1.00 37.65  ? 592  LEU A CD2   1 
ATOM   2520 N  N     . LYS B 2 297 ? 32.872  41.529 19.677  1.00 29.07  ? 593  LYS A N     1 
ATOM   2521 C  CA    . LYS B 2 297 ? 32.897  40.336 18.836  1.00 32.47  ? 593  LYS A CA    1 
ATOM   2522 C  C     . LYS B 2 297 ? 31.702  40.277 17.895  1.00 20.37  ? 593  LYS A C     1 
ATOM   2523 O  O     . LYS B 2 297 ? 31.819  39.737 16.794  1.00 34.52  ? 593  LYS A O     1 
ATOM   2524 C  CB    . LYS B 2 297 ? 32.925  39.071 19.700  1.00 37.35  ? 593  LYS A CB    1 
ATOM   2525 C  CG    . LYS B 2 297 ? 34.262  38.762 20.353  1.00 51.02  ? 593  LYS A CG    1 
ATOM   2526 C  CD    . LYS B 2 297 ? 34.189  37.438 21.123  1.00 51.61  ? 593  LYS A CD    1 
ATOM   2527 C  CE    . LYS B 2 297 ? 35.001  37.474 22.415  1.00 55.00  ? 593  LYS A CE    1 
ATOM   2528 N  NZ    . LYS B 2 297 ? 36.399  36.985 22.231  1.00 54.40  ? 593  LYS A NZ    1 
ATOM   2529 N  N     . VAL B 2 298 ? 30.549  40.813 18.297  1.00 21.65  ? 594  VAL A N     1 
ATOM   2530 C  CA    . VAL B 2 298 ? 29.318  40.646 17.529  1.00 26.17  ? 594  VAL A CA    1 
ATOM   2531 C  C     . VAL B 2 298 ? 28.881  41.933 16.834  1.00 30.92  ? 594  VAL A C     1 
ATOM   2532 O  O     . VAL B 2 298 ? 27.804  41.966 16.227  1.00 24.69  ? 594  VAL A O     1 
ATOM   2533 C  CB    . VAL B 2 298 ? 28.187  40.086 18.401  1.00 20.66  ? 594  VAL A CB    1 
ATOM   2534 C  CG1   . VAL B 2 298 ? 28.639  38.774 19.047  1.00 25.47  ? 594  VAL A CG1   1 
ATOM   2535 C  CG2   . VAL B 2 298 ? 27.781  41.075 19.434  1.00 20.01  ? 594  VAL A CG2   1 
ATOM   2536 N  N     . VAL B 2 299 ? 29.683  42.995 16.906  1.00 22.13  ? 595  VAL A N     1 
ATOM   2537 C  CA    . VAL B 2 299 ? 29.453  44.141 16.039  1.00 22.79  ? 595  VAL A CA    1 
ATOM   2538 C  C     . VAL B 2 299 ? 29.837  43.757 14.622  1.00 21.95  ? 595  VAL A C     1 
ATOM   2539 O  O     . VAL B 2 299 ? 30.941  43.259 14.380  1.00 25.29  ? 595  VAL A O     1 
ATOM   2540 C  CB    . VAL B 2 299 ? 30.256  45.360 16.509  1.00 29.42  ? 595  VAL A CB    1 
ATOM   2541 C  CG1   . VAL B 2 299 ? 30.061  46.527 15.531  1.00 23.19  ? 595  VAL A CG1   1 
ATOM   2542 C  CG2   . VAL B 2 299 ? 29.832  45.756 17.913  1.00 28.45  ? 595  VAL A CG2   1 
ATOM   2543 N  N     . ARG B 2 300 ? 28.931  43.978 13.684  1.00 25.87  ? 596  ARG A N     1 
ATOM   2544 C  CA    . ARG B 2 300 ? 29.228  43.718 12.281  1.00 27.88  ? 596  ARG A CA    1 
ATOM   2545 C  C     . ARG B 2 300 ? 30.098  44.834 11.731  1.00 30.04  ? 596  ARG A C     1 
ATOM   2546 O  O     . ARG B 2 300 ? 29.658  45.991 11.704  1.00 29.36  ? 596  ARG A O     1 
ATOM   2547 C  CB    . ARG B 2 300 ? 27.948  43.620 11.481  1.00 24.48  ? 596  ARG A CB    1 
ATOM   2548 C  CG    . ARG B 2 300 ? 26.889  42.830 12.194  1.00 28.34  ? 596  ARG A CG    1 
ATOM   2549 C  CD    . ARG B 2 300 ? 26.175  41.927 11.236  1.00 41.64  ? 596  ARG A CD    1 
ATOM   2550 N  NE    . ARG B 2 300 ? 25.881  40.648 11.854  1.00 50.62  ? 596  ARG A NE    1 
ATOM   2551 C  CZ    . ARG B 2 300 ? 25.929  39.497 11.199  1.00 47.69  ? 596  ARG A CZ    1 
ATOM   2552 N  NH1   . ARG B 2 300 ? 26.264  39.494 9.915   1.00 40.10  ? 596  ARG A NH1   1 
ATOM   2553 N  NH2   . ARG B 2 300 ? 25.649  38.364 11.827  1.00 50.09  ? 596  ARG A NH2   1 
ATOM   2554 N  N     . PRO B 2 301 ? 31.317  44.543 11.278  1.00 28.28  ? 597  PRO A N     1 
ATOM   2555 C  CA    . PRO B 2 301 ? 32.202  45.627 10.842  1.00 24.50  ? 597  PRO A CA    1 
ATOM   2556 C  C     . PRO B 2 301 ? 31.679  46.373 9.637   1.00 34.28  ? 597  PRO A C     1 
ATOM   2557 O  O     . PRO B 2 301 ? 32.044  47.537 9.454   1.00 38.32  ? 597  PRO A O     1 
ATOM   2558 C  CB    . PRO B 2 301 ? 33.527  44.913 10.544  1.00 29.51  ? 597  PRO A CB    1 
ATOM   2559 C  CG    . PRO B 2 301 ? 33.170  43.463 10.389  1.00 28.34  ? 597  PRO A CG    1 
ATOM   2560 C  CD    . PRO B 2 301 ? 31.962  43.219 11.226  1.00 31.95  ? 597  PRO A CD    1 
ATOM   2561 N  N     . ASP B 2 302 ? 30.827  45.751 8.816   1.00 39.06  ? 598  ASP A N     1 
ATOM   2562 C  CA    . ASP B 2 302 ? 30.203  46.477 7.718   1.00 42.18  ? 598  ASP A CA    1 
ATOM   2563 C  C     . ASP B 2 302 ? 29.357  47.625 8.254   1.00 54.65  ? 598  ASP A C     1 
ATOM   2564 O  O     . ASP B 2 302 ? 29.660  48.802 8.023   1.00 65.16  ? 598  ASP A O     1 
ATOM   2565 C  CB    . ASP B 2 302 ? 29.354  45.530 6.856   1.00 29.42  ? 598  ASP A CB    1 
ATOM   2566 C  CG    . ASP B 2 302 ? 28.587  44.527 7.678   1.00 48.62  ? 598  ASP A CG    1 
ATOM   2567 O  OD1   . ASP B 2 302 ? 29.164  44.068 8.680   1.00 49.22  ? 598  ASP A OD1   1 
ATOM   2568 O  OD2   . ASP B 2 302 ? 27.414  44.210 7.338   1.00 46.89  ? 598  ASP A OD2   1 
ATOM   2569 N  N     . THR B 2 303 ? 28.306  47.297 9.006   1.00 50.12  ? 599  THR A N     1 
ATOM   2570 C  CA    . THR B 2 303 ? 27.335  48.275 9.482   1.00 38.95  ? 599  THR A CA    1 
ATOM   2571 C  C     . THR B 2 303 ? 27.753  48.963 10.778  1.00 38.19  ? 599  THR A C     1 
ATOM   2572 O  O     . THR B 2 303 ? 27.153  49.979 11.144  1.00 31.94  ? 599  THR A O     1 
ATOM   2573 C  CB    . THR B 2 303 ? 25.979  47.594 9.688   1.00 44.32  ? 599  THR A CB    1 
ATOM   2574 O  OG1   . THR B 2 303 ? 26.072  46.654 10.760  1.00 43.51  ? 599  THR A OG1   1 
ATOM   2575 C  CG2   . THR B 2 303 ? 25.547  46.850 8.436   1.00 55.73  ? 599  THR A CG2   1 
ATOM   2576 N  N     . LYS B 2 304 ? 28.768  48.446 11.464  1.00 29.54  ? 600  LYS A N     1 
ATOM   2577 C  CA    . LYS B 2 304 ? 29.074  48.824 12.839  1.00 21.61  ? 600  LYS A CA    1 
ATOM   2578 C  C     . LYS B 2 304 ? 27.823  48.802 13.718  1.00 20.43  ? 600  LYS A C     1 
ATOM   2579 O  O     . LYS B 2 304 ? 27.672  49.615 14.633  1.00 23.81  ? 600  LYS A O     1 
ATOM   2580 C  CB    . LYS B 2 304 ? 29.761  50.183 12.908  1.00 51.59  ? 600  LYS A CB    1 
ATOM   2581 C  CG    . LYS B 2 304 ? 30.699  50.278 14.087  1.00 54.21  ? 600  LYS A CG    1 
ATOM   2582 C  CD    . LYS B 2 304 ? 31.728  51.364 13.895  1.00 58.39  ? 600  LYS A CD    1 
ATOM   2583 C  CE    . LYS B 2 304 ? 31.276  52.633 14.594  1.00 58.90  ? 600  LYS A CE    1 
ATOM   2584 N  NZ    . LYS B 2 304 ? 32.390  53.259 15.335  1.00 60.36  ? 600  LYS A NZ    1 
ATOM   2585 N  N     . LYS B 2 305 ? 26.913  47.875 13.445  1.00 19.51  ? 601  LYS A N     1 
ATOM   2586 C  CA    . LYS B 2 305 ? 25.747  47.664 14.285  1.00 19.96  ? 601  LYS A CA    1 
ATOM   2587 C  C     . LYS B 2 305 ? 25.801  46.278 14.927  1.00 22.20  ? 601  LYS A C     1 
ATOM   2588 O  O     . LYS B 2 305 ? 26.455  45.365 14.428  1.00 18.18  ? 601  LYS A O     1 
ATOM   2589 C  CB    . LYS B 2 305 ? 24.468  47.802 13.459  1.00 26.21  ? 601  LYS A CB    1 
ATOM   2590 C  CG    . LYS B 2 305 ? 24.240  49.203 12.895  1.00 27.43  ? 601  LYS A CG    1 
ATOM   2591 C  CD    . LYS B 2 305 ? 23.041  49.195 11.973  1.00 31.19  ? 601  LYS A CD    1 
ATOM   2592 C  CE    . LYS B 2 305 ? 22.615  50.601 11.590  1.00 27.50  ? 601  LYS A CE    1 
ATOM   2593 N  NZ    . LYS B 2 305 ? 21.290  50.591 10.918  1.00 38.92  ? 601  LYS A NZ    1 
ATOM   2594 N  N     . VAL B 2 306 ? 25.108  46.121 16.037  1.00 22.84  ? 602  VAL A N     1 
ATOM   2595 C  CA    . VAL B 2 306 ? 24.782  44.786 16.520  1.00 23.97  ? 602  VAL A CA    1 
ATOM   2596 C  C     . VAL B 2 306 ? 23.374  44.476 16.050  1.00 21.92  ? 602  VAL A C     1 
ATOM   2597 O  O     . VAL B 2 306 ? 22.512  45.364 15.978  1.00 19.64  ? 602  VAL A O     1 
ATOM   2598 C  CB    . VAL B 2 306 ? 24.923  44.644 18.048  1.00 20.10  ? 602  VAL A CB    1 
ATOM   2599 C  CG1   . VAL B 2 306 ? 26.368  44.773 18.424  1.00 19.50  ? 602  VAL A CG1   1 
ATOM   2600 C  CG2   . VAL B 2 306 ? 24.130  45.671 18.778  1.00 19.90  ? 602  VAL A CG2   1 
ATOM   2601 N  N     . HIS B 2 307 ? 23.160  43.230 15.663  1.00 15.69  ? 603  HIS A N     1 
ATOM   2602 C  CA    . HIS B 2 307 ? 21.871  42.785 15.162  1.00 15.12  ? 603  HIS A CA    1 
ATOM   2603 C  C     . HIS B 2 307 ? 21.486  41.625 16.060  1.00 18.20  ? 603  HIS A C     1 
ATOM   2604 O  O     . HIS B 2 307 ? 21.812  40.483 15.758  1.00 15.63  ? 603  HIS A O     1 
ATOM   2605 C  CB    . HIS B 2 307 ? 21.958  42.379 13.679  1.00 15.38  ? 603  HIS A CB    1 
ATOM   2606 C  CG    . HIS B 2 307 ? 22.320  43.514 12.769  1.00 17.43  ? 603  HIS A CG    1 
ATOM   2607 N  ND1   . HIS B 2 307 ? 21.378  44.307 12.148  1.00 18.38  ? 603  HIS A ND1   1 
ATOM   2608 C  CD2   . HIS B 2 307 ? 23.528  44.007 12.402  1.00 18.84  ? 603  HIS A CD2   1 
ATOM   2609 C  CE1   . HIS B 2 307 ? 21.988  45.220 11.415  1.00 23.32  ? 603  HIS A CE1   1 
ATOM   2610 N  NE2   . HIS B 2 307 ? 23.294  45.062 11.554  1.00 19.01  ? 603  HIS A NE2   1 
ATOM   2611 N  N     . THR B 2 308 ? 20.844  41.924 17.182  1.00 17.08  ? 604  THR A N     1 
ATOM   2612 C  CA    . THR B 2 308 ? 20.429  40.875 18.090  1.00 17.10  ? 604  THR A CA    1 
ATOM   2613 C  C     . THR B 2 308 ? 19.438  39.942 17.394  1.00 15.40  ? 604  THR A C     1 
ATOM   2614 O  O     . THR B 2 308 ? 18.896  40.232 16.323  1.00 19.15  ? 604  THR A O     1 
ATOM   2615 C  CB    . THR B 2 308 ? 19.810  41.486 19.356  1.00 16.19  ? 604  THR A CB    1 
ATOM   2616 O  OG1   . THR B 2 308 ? 19.781  40.514 20.410  1.00 17.56  ? 604  THR A OG1   1 
ATOM   2617 C  CG2   . THR B 2 308 ? 18.410  41.985 19.074  1.00 19.46  ? 604  THR A CG2   1 
ATOM   2618 N  N     . ILE B 2 309 ? 19.228  38.789 18.004  1.00 17.72  ? 605  ILE A N     1 
ATOM   2619 C  CA    . ILE B 2 309 ? 18.184  37.871 17.588  1.00 20.09  ? 605  ILE A CA    1 
ATOM   2620 C  C     . ILE B 2 309 ? 17.242  37.733 18.766  1.00 14.82  ? 605  ILE A C     1 
ATOM   2621 O  O     . ILE B 2 309 ? 17.654  37.292 19.839  1.00 16.89  ? 605  ILE A O     1 
ATOM   2622 C  CB    . ILE B 2 309 ? 18.746  36.510 17.177  1.00 21.37  ? 605  ILE A CB    1 
ATOM   2623 C  CG1   . ILE B 2 309 ? 19.549  36.649 15.873  1.00 20.89  ? 605  ILE A CG1   1 
ATOM   2624 C  CG2   . ILE B 2 309 ? 17.617  35.495 17.050  1.00 18.67  ? 605  ILE A CG2   1 
ATOM   2625 C  CD1   . ILE B 2 309 ? 20.120  35.352 15.411  1.00 26.86  ? 605  ILE A CD1   1 
ATOM   2626 N  N     . PHE B 2 310 ? 16.002  38.131 18.576  1.00 13.17  ? 606  PHE A N     1 
ATOM   2627 C  CA    . PHE B 2 310 ? 15.001  38.003 19.622  1.00 15.15  ? 606  PHE A CA    1 
ATOM   2628 C  C     . PHE B 2 310 ? 14.419  36.607 19.578  1.00 22.73  ? 606  PHE A C     1 
ATOM   2629 O  O     . PHE B 2 310 ? 13.974  36.152 18.526  1.00 28.26  ? 606  PHE A O     1 
ATOM   2630 C  CB    . PHE B 2 310 ? 13.899  39.038 19.444  1.00 17.83  ? 606  PHE A CB    1 
ATOM   2631 C  CG    . PHE B 2 310 ? 14.312  40.410 19.838  1.00 26.02  ? 606  PHE A CG    1 
ATOM   2632 C  CD1   . PHE B 2 310 ? 14.573  41.370 18.874  1.00 23.30  ? 606  PHE A CD1   1 
ATOM   2633 C  CD2   . PHE B 2 310 ? 14.471  40.740 21.177  1.00 32.80  ? 606  PHE A CD2   1 
ATOM   2634 C  CE1   . PHE B 2 310 ? 14.973  42.633 19.232  1.00 25.98  ? 606  PHE A CE1   1 
ATOM   2635 C  CE2   . PHE B 2 310 ? 14.872  42.007 21.548  1.00 37.91  ? 606  PHE A CE2   1 
ATOM   2636 C  CZ    . PHE B 2 310 ? 15.131  42.954 20.574  1.00 31.39  ? 606  PHE A CZ    1 
ATOM   2637 N  N     . ASN B 2 311 ? 14.440  35.915 20.711  1.00 22.19  ? 607  ASN A N     1 
ATOM   2638 C  CA    . ASN B 2 311 ? 13.827  34.592 20.785  1.00 20.60  ? 607  ASN A CA    1 
ATOM   2639 C  C     . ASN B 2 311 ? 12.440  34.794 21.370  1.00 25.48  ? 607  ASN A C     1 
ATOM   2640 O  O     . ASN B 2 311 ? 12.280  35.049 22.566  1.00 23.29  ? 607  ASN A O     1 
ATOM   2641 C  CB    . ASN B 2 311 ? 14.650  33.609 21.600  1.00 20.50  ? 607  ASN A CB    1 
ATOM   2642 C  CG    . ASN B 2 311 ? 14.170  32.172 21.395  1.00 30.55  ? 607  ASN A CG    1 
ATOM   2643 O  OD1   . ASN B 2 311 ? 13.040  31.945 20.941  1.00 31.05  ? 607  ASN A OD1   1 
ATOM   2644 N  ND2   . ASN B 2 311 ? 15.025  31.208 21.702  1.00 29.19  ? 607  ASN A ND2   1 
ATOM   2645 N  N     . GLN B 2 312 ? 11.445  34.728 20.501  1.00 18.69  ? 608  GLN A N     1 
ATOM   2646 C  CA    . GLN B 2 312 ? 10.056  34.954 20.865  1.00 23.35  ? 608  GLN A CA    1 
ATOM   2647 C  C     . GLN B 2 312 ? 9.406   33.703 21.434  1.00 16.17  ? 608  GLN A C     1 
ATOM   2648 O  O     . GLN B 2 312 ? 8.316   33.772 22.011  1.00 23.62  ? 608  GLN A O     1 
ATOM   2649 C  CB    . GLN B 2 312 ? 9.313   35.429 19.610  1.00 23.10  ? 608  GLN A CB    1 
ATOM   2650 C  CG    . GLN B 2 312 ? 7.907   35.855 19.794  1.00 21.43  ? 608  GLN A CG    1 
ATOM   2651 C  CD    . GLN B 2 312 ? 7.290   36.314 18.485  1.00 21.32  ? 608  GLN A CD    1 
ATOM   2652 O  OE1   . GLN B 2 312 ? 7.955   36.349 17.436  1.00 20.95  ? 608  GLN A OE1   1 
ATOM   2653 N  NE2   . GLN B 2 312 ? 6.027   36.676 18.538  1.00 17.47  ? 608  GLN A NE2   1 
ATOM   2654 N  N     . ALA B 2 313 ? 10.054  32.565 21.315  1.00 14.78  ? 609  ALA A N     1 
ATOM   2655 C  CA    . ALA B 2 313 ? 9.399   31.310 21.625  1.00 21.90  ? 609  ALA A CA    1 
ATOM   2656 C  C     . ALA B 2 313 ? 10.226  30.499 22.602  1.00 23.04  ? 609  ALA A C     1 
ATOM   2657 O  O     . ALA B 2 313 ? 10.354  29.287 22.461  1.00 23.75  ? 609  ALA A O     1 
ATOM   2658 C  CB    . ALA B 2 313 ? 9.143   30.519 20.341  1.00 25.40  ? 609  ALA A CB    1 
ATOM   2659 N  N     . LEU B 2 314 ? 10.786  31.141 23.626  1.00 22.47  ? 610  LEU A N     1 
ATOM   2660 C  CA    . LEU B 2 314 ? 11.659  30.437 24.563  1.00 26.76  ? 610  LEU A CA    1 
ATOM   2661 C  C     . LEU B 2 314 ? 11.114  30.441 25.985  1.00 27.32  ? 610  LEU A C     1 
ATOM   2662 O  O     . LEU B 2 314 ? 10.916  29.370 26.553  1.00 26.05  ? 610  LEU A O     1 
ATOM   2663 C  CB    . LEU B 2 314 ? 13.077  31.030 24.539  1.00 25.34  ? 610  LEU A CB    1 
ATOM   2664 C  CG    . LEU B 2 314 ? 14.163  30.228 25.279  1.00 44.98  ? 610  LEU A CG    1 
ATOM   2665 C  CD1   . LEU B 2 314 ? 15.526  30.453 24.658  1.00 50.68  ? 610  LEU A CD1   1 
ATOM   2666 C  CD2   . LEU B 2 314 ? 14.233  30.547 26.772  1.00 50.20  ? 610  LEU A CD2   1 
ATOM   2667 N  N     . THR B 2 315 ? 10.871  31.608 26.577  1.00 20.10  ? 611  THR A N     1 
ATOM   2668 C  CA    . THR B 2 315 ? 10.574  31.708 27.998  1.00 21.39  ? 611  THR A CA    1 
ATOM   2669 C  C     . THR B 2 315 ? 9.198   31.145 28.326  1.00 21.12  ? 611  THR A C     1 
ATOM   2670 O  O     . THR B 2 315 ? 8.269   31.172 27.514  1.00 20.89  ? 611  THR A O     1 
ATOM   2671 C  CB    . THR B 2 315 ? 10.626  33.166 28.454  1.00 20.83  ? 611  THR A CB    1 
ATOM   2672 O  OG1   . THR B 2 315 ? 9.508   33.860 27.887  1.00 18.42  ? 611  THR A OG1   1 
ATOM   2673 C  CG2   . THR B 2 315 ? 11.903  33.827 27.976  1.00 23.26  ? 611  THR A CG2   1 
ATOM   2674 N  N     . GLN B 2 316 ? 9.062   30.669 29.551  1.00 19.89  ? 612  GLN A N     1 
ATOM   2675 C  CA    . GLN B 2 316 ? 7.782   30.147 29.993  1.00 20.60  ? 612  GLN A CA    1 
ATOM   2676 C  C     . GLN B 2 316 ? 6.842   31.239 30.465  1.00 26.38  ? 612  GLN A C     1 
ATOM   2677 O  O     . GLN B 2 316 ? 5.680   30.950 30.757  1.00 32.14  ? 612  GLN A O     1 
ATOM   2678 C  CB    . GLN B 2 316 ? 8.016   29.111 31.085  1.00 23.83  ? 612  GLN A CB    1 
ATOM   2679 C  CG    . GLN B 2 316 ? 8.476   27.780 30.471  1.00 32.27  ? 612  GLN A CG    1 
ATOM   2680 C  CD    . GLN B 2 316 ? 7.862   26.600 31.187  1.00 42.16  ? 612  GLN A CD    1 
ATOM   2681 O  OE1   . GLN B 2 316 ? 6.703   26.245 30.953  1.00 43.75  ? 612  GLN A OE1   1 
ATOM   2682 N  NE2   . GLN B 2 316 ? 8.624   26.008 32.092  1.00 44.18  ? 612  GLN A NE2   1 
ATOM   2683 N  N     . THR B 2 317 ? 7.313   32.482 30.523  1.00 24.77  ? 613  THR A N     1 
ATOM   2684 C  CA    . THR B 2 317 ? 6.464   33.607 30.872  1.00 28.31  ? 613  THR A CA    1 
ATOM   2685 C  C     . THR B 2 317 ? 5.904   34.334 29.663  1.00 23.22  ? 613  THR A C     1 
ATOM   2686 O  O     . THR B 2 317 ? 4.931   35.074 29.814  1.00 32.01  ? 613  THR A O     1 
ATOM   2687 C  CB    . THR B 2 317 ? 7.241   34.622 31.716  1.00 22.37  ? 613  THR A CB    1 
ATOM   2688 O  OG1   . THR B 2 317 ? 8.416   35.011 30.996  1.00 21.03  ? 613  THR A OG1   1 
ATOM   2689 C  CG2   . THR B 2 317 ? 7.630   34.003 33.061  1.00 28.93  ? 613  THR A CG2   1 
ATOM   2690 N  N     . GLY B 2 318 ? 6.487   34.155 28.476  1.00 18.92  ? 614  GLY A N     1 
ATOM   2691 C  CA    . GLY B 2 318 ? 6.131   34.975 27.344  1.00 21.90  ? 614  GLY A CA    1 
ATOM   2692 C  C     . GLY B 2 318 ? 7.017   36.188 27.156  1.00 26.42  ? 614  GLY A C     1 
ATOM   2693 O  O     . GLY B 2 318 ? 6.852   36.905 26.168  1.00 19.55  ? 614  GLY A O     1 
ATOM   2694 N  N     . ARG B 2 319 ? 7.944   36.442 28.078  1.00 17.48  ? 615  ARG A N     1 
ATOM   2695 C  CA    . ARG B 2 319 ? 8.963   37.456 27.860  1.00 22.98  ? 615  ARG A CA    1 
ATOM   2696 C  C     . ARG B 2 319 ? 9.805   37.106 26.641  1.00 22.39  ? 615  ARG A C     1 
ATOM   2697 O  O     . ARG B 2 319 ? 10.057  35.936 26.348  1.00 20.60  ? 615  ARG A O     1 
ATOM   2698 C  CB    . ARG B 2 319 ? 9.863   37.576 29.089  1.00 22.12  ? 615  ARG A CB    1 
ATOM   2699 C  CG    . ARG B 2 319 ? 9.155   38.129 30.300  1.00 26.00  ? 615  ARG A CG    1 
ATOM   2700 C  CD    . ARG B 2 319 ? 9.264   39.619 30.284  1.00 32.84  ? 615  ARG A CD    1 
ATOM   2701 N  NE    . ARG B 2 319 ? 8.780   40.232 31.518  1.00 37.39  ? 615  ARG A NE    1 
ATOM   2702 C  CZ    . ARG B 2 319 ? 8.720   41.548 31.702  1.00 30.08  ? 615  ARG A CZ    1 
ATOM   2703 N  NH1   . ARG B 2 319 ? 9.118   42.354 30.726  1.00 35.52  ? 615  ARG A NH1   1 
ATOM   2704 N  NH2   . ARG B 2 319 ? 8.275   42.059 32.853  1.00 29.99  ? 615  ARG A NH2   1 
ATOM   2705 N  N     . LEU B 2 320 ? 10.232  38.137 25.926  1.00 19.57  ? 616  LEU A N     1 
ATOM   2706 C  CA    . LEU B 2 320 ? 11.272  37.987 24.920  1.00 17.75  ? 616  LEU A CA    1 
ATOM   2707 C  C     . LEU B 2 320 ? 12.629  37.772 25.574  1.00 20.72  ? 616  LEU A C     1 
ATOM   2708 O  O     . LEU B 2 320 ? 12.939  38.384 26.591  1.00 25.78  ? 616  LEU A O     1 
ATOM   2709 C  CB    . LEU B 2 320 ? 11.347  39.240 24.051  1.00 19.68  ? 616  LEU A CB    1 
ATOM   2710 C  CG    . LEU B 2 320 ? 10.093  39.556 23.254  1.00 29.08  ? 616  LEU A CG    1 
ATOM   2711 C  CD1   . LEU B 2 320 ? 10.294  40.858 22.557  1.00 26.25  ? 616  LEU A CD1   1 
ATOM   2712 C  CD2   . LEU B 2 320 ? 9.827   38.424 22.239  1.00 24.23  ? 616  LEU A CD2   1 
ATOM   2713 N  N     . SER B 2 321 ? 13.447  36.906 24.980  1.00 20.82  ? 617  SER A N     1 
ATOM   2714 C  CA    . SER B 2 321 ? 14.873  36.899 25.271  1.00 20.45  ? 617  SER A CA    1 
ATOM   2715 C  C     . SER B 2 321 ? 15.600  37.328 24.002  1.00 25.12  ? 617  SER A C     1 
ATOM   2716 O  O     . SER B 2 321 ? 15.017  37.393 22.919  1.00 23.43  ? 617  SER A O     1 
ATOM   2717 C  CB    . SER B 2 321 ? 15.356  35.515 25.760  1.00 18.45  ? 617  SER A CB    1 
ATOM   2718 O  OG    . SER B 2 321 ? 15.250  34.558 24.722  1.00 32.01  ? 617  SER A OG    1 
ATOM   2719 N  N     . SER B 2 322 ? 16.879  37.647 24.134  1.00 23.13  ? 618  SER A N     1 
ATOM   2720 C  CA    . SER B 2 322 ? 17.648  38.062 22.969  1.00 23.72  ? 618  SER A CA    1 
ATOM   2721 C  C     . SER B 2 322 ? 19.071  37.566 23.127  1.00 24.24  ? 618  SER A C     1 
ATOM   2722 O  O     . SER B 2 322 ? 19.542  37.347 24.249  1.00 20.90  ? 618  SER A O     1 
ATOM   2723 C  CB    . SER B 2 322 ? 17.613  39.590 22.776  1.00 27.58  ? 618  SER A CB    1 
ATOM   2724 O  OG    . SER B 2 322 ? 18.007  40.283 23.944  1.00 29.86  ? 618  SER A OG    1 
ATOM   2725 N  N     . THR B 2 323 ? 19.749  37.368 21.990  1.00 18.99  ? 619  THR A N     1 
ATOM   2726 C  CA    . THR B 2 323 ? 21.101  36.829 21.985  1.00 21.60  ? 619  THR A CA    1 
ATOM   2727 C  C     . THR B 2 323 ? 21.924  37.475 20.876  1.00 21.34  ? 619  THR A C     1 
ATOM   2728 O  O     . THR B 2 323 ? 21.388  37.998 19.897  1.00 20.91  ? 619  THR A O     1 
ATOM   2729 C  CB    . THR B 2 323 ? 21.122  35.306 21.758  1.00 28.24  ? 619  THR A CB    1 
ATOM   2730 O  OG1   . THR B 2 323 ? 20.436  35.019 20.538  1.00 30.83  ? 619  THR A OG1   1 
ATOM   2731 C  CG2   . THR B 2 323 ? 20.448  34.539 22.905  1.00 34.01  ? 619  THR A CG2   1 
ATOM   2732 N  N     . GLU B 2 324 ? 23.248  37.389 21.030  1.00 16.35  ? 620  GLU A N     1 
ATOM   2733 C  CA    . GLU B 2 324 ? 24.201  37.723 19.978  1.00 21.76  ? 620  GLU A CA    1 
ATOM   2734 C  C     . GLU B 2 324 ? 24.036  39.150 19.459  1.00 21.69  ? 620  GLU A C     1 
ATOM   2735 O  O     . GLU B 2 324 ? 23.828  39.348 18.260  1.00 28.24  ? 620  GLU A O     1 
ATOM   2736 C  CB    . GLU B 2 324 ? 24.053  36.743 18.811  1.00 26.34  ? 620  GLU A CB    1 
ATOM   2737 C  CG    . GLU B 2 324 ? 24.437  35.315 19.136  1.00 43.57  ? 620  GLU A CG    1 
ATOM   2738 C  CD    . GLU B 2 324 ? 24.602  34.452 17.885  1.00 67.08  ? 620  GLU A CD    1 
ATOM   2739 O  OE1   . GLU B 2 324 ? 25.602  34.642 17.153  1.00 73.16  ? 620  GLU A OE1   1 
ATOM   2740 O  OE2   . GLU B 2 324 ? 23.732  33.588 17.631  1.00 72.75  ? 620  GLU A OE2   1 
ATOM   2741 N  N     . PRO B 2 325 ? 24.125  40.169 20.312  1.00 29.18  ? 621  PRO A N     1 
ATOM   2742 C  CA    . PRO B 2 325 ? 24.376  40.084 21.743  1.00 26.36  ? 621  PRO A CA    1 
ATOM   2743 C  C     . PRO B 2 325 ? 23.073  40.012 22.513  1.00 28.17  ? 621  PRO A C     1 
ATOM   2744 O  O     . PRO B 2 325 ? 22.006  40.356 21.999  1.00 18.89  ? 621  PRO A O     1 
ATOM   2745 C  CB    . PRO B 2 325 ? 25.091  41.390 22.036  1.00 26.64  ? 621  PRO A CB    1 
ATOM   2746 C  CG    . PRO B 2 325 ? 24.353  42.362 21.129  1.00 22.51  ? 621  PRO A CG    1 
ATOM   2747 C  CD    . PRO B 2 325 ? 23.995  41.566 19.876  1.00 25.77  ? 621  PRO A CD    1 
ATOM   2748 N  N     . ASN B 2 326 ? 23.163  39.571 23.755  1.00 21.20  ? 622  ASN A N     1 
ATOM   2749 C  CA    . ASN B 2 326 ? 22.046  39.711 24.668  1.00 20.76  ? 622  ASN A CA    1 
ATOM   2750 C  C     . ASN B 2 326 ? 22.072  41.128 25.213  1.00 27.84  ? 622  ASN A C     1 
ATOM   2751 O  O     . ASN B 2 326 ? 22.938  41.474 26.016  1.00 31.50  ? 622  ASN A O     1 
ATOM   2752 C  CB    . ASN B 2 326 ? 22.135  38.695 25.792  1.00 24.94  ? 622  ASN A CB    1 
ATOM   2753 C  CG    . ASN B 2 326 ? 21.097  38.938 26.862  1.00 32.99  ? 622  ASN A CG    1 
ATOM   2754 O  OD1   . ASN B 2 326 ? 20.106  39.650 26.647  1.00 32.22  ? 622  ASN A OD1   1 
ATOM   2755 N  ND2   . ASN B 2 326 ? 21.318  38.352 28.026  1.00 26.24  ? 622  ASN A ND2   1 
ATOM   2756 N  N     . LEU B 2 327 ? 21.136  41.952 24.775  1.00 19.48  ? 623  LEU A N     1 
ATOM   2757 C  CA    . LEU B 2 327 ? 21.120  43.333 25.209  1.00 23.54  ? 623  LEU A CA    1 
ATOM   2758 C  C     . LEU B 2 327 ? 20.258  43.522 26.438  1.00 30.12  ? 623  LEU A C     1 
ATOM   2759 O  O     . LEU B 2 327 ? 20.155  44.641 26.945  1.00 41.31  ? 623  LEU A O     1 
ATOM   2760 C  CB    . LEU B 2 327 ? 20.650  44.224 24.063  1.00 26.73  ? 623  LEU A CB    1 
ATOM   2761 C  CG    . LEU B 2 327 ? 21.696  44.197 22.944  1.00 34.78  ? 623  LEU A CG    1 
ATOM   2762 C  CD1   . LEU B 2 327 ? 21.232  44.941 21.698  1.00 32.03  ? 623  LEU A CD1   1 
ATOM   2763 C  CD2   . LEU B 2 327 ? 23.018  44.766 23.456  1.00 33.53  ? 623  LEU A CD2   1 
ATOM   2764 N  N     . GLN B 2 328 ? 19.667  42.442 26.942  1.00 24.00  ? 624  GLN A N     1 
ATOM   2765 C  CA    . GLN B 2 328 ? 18.870  42.511 28.150  1.00 24.97  ? 624  GLN A CA    1 
ATOM   2766 C  C     . GLN B 2 328 ? 19.703  42.522 29.426  1.00 35.73  ? 624  GLN A C     1 
ATOM   2767 O  O     . GLN B 2 328 ? 19.137  42.714 30.502  1.00 37.46  ? 624  GLN A O     1 
ATOM   2768 C  CB    . GLN B 2 328 ? 17.878  41.343 28.187  1.00 37.90  ? 624  GLN A CB    1 
ATOM   2769 C  CG    . GLN B 2 328 ? 16.581  41.625 27.434  1.00 52.31  ? 624  GLN A CG    1 
ATOM   2770 C  CD    . GLN B 2 328 ? 16.217  40.521 26.461  1.00 61.74  ? 624  GLN A CD    1 
ATOM   2771 O  OE1   . GLN B 2 328 ? 16.495  39.347 26.706  1.00 67.46  ? 624  GLN A OE1   1 
ATOM   2772 N  NE2   . GLN B 2 328 ? 15.589  40.893 25.348  1.00 63.36  ? 624  GLN A NE2   1 
ATOM   2773 N  N     . ASN B 2 329 ? 21.015  42.325 29.380  1.00 34.50  ? 625  ASN A N     1 
ATOM   2774 C  CA    . ASN B 2 329 ? 21.722  42.489 30.649  1.00 36.95  ? 625  ASN A CA    1 
ATOM   2775 C  C     . ASN B 2 329 ? 22.890  43.455 30.531  1.00 37.95  ? 625  ASN A C     1 
ATOM   2776 O  O     . ASN B 2 329 ? 23.909  43.298 31.200  1.00 40.89  ? 625  ASN A O     1 
ATOM   2777 C  CB    . ASN B 2 329 ? 22.167  41.151 31.243  1.00 25.28  ? 625  ASN A CB    1 
ATOM   2778 C  CG    . ASN B 2 329 ? 22.991  40.313 30.293  1.00 32.92  ? 625  ASN A CG    1 
ATOM   2779 O  OD1   . ASN B 2 329 ? 23.207  40.687 29.137  1.00 33.14  ? 625  ASN A OD1   1 
ATOM   2780 N  ND2   . ASN B 2 329 ? 23.477  39.152 30.791  1.00 25.51  ? 625  ASN A ND2   1 
ATOM   2781 N  N     . ILE B 2 330 ? 22.751  44.498 29.722  1.00 41.23  ? 626  ILE A N     1 
ATOM   2782 C  CA    . ILE B 2 330 ? 23.755  45.571 29.757  1.00 40.89  ? 626  ILE A CA    1 
ATOM   2783 C  C     . ILE B 2 330 ? 23.684  46.263 31.116  1.00 44.19  ? 626  ILE A C     1 
ATOM   2784 O  O     . ILE B 2 330 ? 22.590  46.683 31.535  1.00 43.92  ? 626  ILE A O     1 
ATOM   2785 C  CB    . ILE B 2 330 ? 23.529  46.563 28.614  1.00 35.38  ? 626  ILE A CB    1 
ATOM   2786 C  CG1   . ILE B 2 330 ? 23.531  45.837 27.264  1.00 35.17  ? 626  ILE A CG1   1 
ATOM   2787 C  CG2   . ILE B 2 330 ? 24.618  47.628 28.617  1.00 25.21  ? 626  ILE A CG2   1 
ATOM   2788 C  CD1   . ILE B 2 330 ? 24.811  45.053 26.980  1.00 34.20  ? 626  ILE A CD1   1 
ATOM   2789 N  N     . PRO B 2 331 ? 24.803  46.395 31.834  1.00 43.43  ? 627  PRO A N     1 
ATOM   2790 C  CA    . PRO B 2 331 ? 24.750  46.811 33.244  1.00 41.18  ? 627  PRO A CA    1 
ATOM   2791 C  C     . PRO B 2 331 ? 24.067  48.155 33.444  1.00 43.12  ? 627  PRO A C     1 
ATOM   2792 O  O     . PRO B 2 331 ? 24.028  49.009 32.554  1.00 42.82  ? 627  PRO A O     1 
ATOM   2793 C  CB    . PRO B 2 331 ? 26.228  46.886 33.647  1.00 43.09  ? 627  PRO A CB    1 
ATOM   2794 C  CG    . PRO B 2 331 ? 26.918  45.958 32.707  1.00 44.63  ? 627  PRO A CG    1 
ATOM   2795 C  CD    . PRO B 2 331 ? 26.172  46.065 31.405  1.00 43.70  ? 627  PRO A CD    1 
ATOM   2796 N  N     . ILE B 2 332 ? 23.544  48.342 34.657  1.00 49.35  ? 628  ILE A N     1 
ATOM   2797 C  CA    . ILE B 2 332 ? 22.823  49.563 35.004  1.00 51.51  ? 628  ILE A CA    1 
ATOM   2798 C  C     . ILE B 2 332 ? 23.088  49.978 36.448  1.00 51.17  ? 628  ILE A C     1 
ATOM   2799 O  O     . ILE B 2 332 ? 23.201  51.174 36.746  1.00 53.02  ? 628  ILE A O     1 
ATOM   2800 C  CB    . ILE B 2 332 ? 21.312  49.392 34.747  1.00 57.37  ? 628  ILE A CB    1 
ATOM   2801 C  CG1   . ILE B 2 332 ? 20.597  50.745 34.817  1.00 65.57  ? 628  ILE A CG1   1 
ATOM   2802 C  CG2   . ILE B 2 332 ? 20.693  48.370 35.701  1.00 49.41  ? 628  ILE A CG2   1 
ATOM   2803 C  CD1   . ILE B 2 332 ? 20.474  51.436 33.479  1.00 68.15  ? 628  ILE A CD1   1 
ATOM   2804 N  N     . ARG B 2 333 ? 23.192  49.001 37.351  1.00 41.76  ? 629  ARG A N     1 
ATOM   2805 C  CA    . ARG B 2 333 ? 23.299  49.307 38.775  1.00 50.76  ? 629  ARG A CA    1 
ATOM   2806 C  C     . ARG B 2 333 ? 24.586  50.067 39.077  1.00 51.90  ? 629  ARG A C     1 
ATOM   2807 O  O     . ARG B 2 333 ? 24.556  51.168 39.636  1.00 55.33  ? 629  ARG A O     1 
ATOM   2808 C  CB    . ARG B 2 333 ? 23.213  48.017 39.596  1.00 41.54  ? 629  ARG A CB    1 
ATOM   2809 N  N     . LEU B 2 334 ? 25.729  49.495 38.705  1.00 53.60  ? 630  LEU A N     1 
ATOM   2810 C  CA    . LEU B 2 334 ? 27.014  50.125 38.970  1.00 50.60  ? 630  LEU A CA    1 
ATOM   2811 C  C     . LEU B 2 334 ? 27.328  51.146 37.881  1.00 51.37  ? 630  LEU A C     1 
ATOM   2812 O  O     . LEU B 2 334 ? 27.182  50.860 36.689  1.00 44.63  ? 630  LEU A O     1 
ATOM   2813 C  CB    . LEU B 2 334 ? 28.120  49.072 39.052  1.00 41.67  ? 630  LEU A CB    1 
ATOM   2814 N  N     . GLU B 2 335 ? 27.758  52.338 38.296  1.00 52.48  ? 631  GLU A N     1 
ATOM   2815 C  CA    . GLU B 2 335 ? 28.109  53.375 37.332  1.00 67.76  ? 631  GLU A CA    1 
ATOM   2816 C  C     . GLU B 2 335 ? 29.230  52.916 36.407  1.00 72.32  ? 631  GLU A C     1 
ATOM   2817 O  O     . GLU B 2 335 ? 29.214  53.219 35.206  1.00 69.41  ? 631  GLU A O     1 
ATOM   2818 C  CB    . GLU B 2 335 ? 28.509  54.660 38.060  1.00 77.68  ? 631  GLU A CB    1 
ATOM   2819 C  CG    . GLU B 2 335 ? 28.984  55.775 37.136  1.00 88.32  ? 631  GLU A CG    1 
ATOM   2820 C  CD    . GLU B 2 335 ? 27.926  56.184 36.120  1.00 97.62  ? 631  GLU A CD    1 
ATOM   2821 O  OE1   . GLU B 2 335 ? 28.273  56.370 34.932  1.00 100.07 ? 631  GLU A OE1   1 
ATOM   2822 O  OE2   . GLU B 2 335 ? 26.746  56.319 36.508  1.00 100.68 ? 631  GLU A OE2   1 
ATOM   2823 N  N     . GLU B 2 336 ? 30.207  52.177 36.947  1.00 71.75  ? 632  GLU A N     1 
ATOM   2824 C  CA    . GLU B 2 336 ? 31.302  51.663 36.126  1.00 71.94  ? 632  GLU A CA    1 
ATOM   2825 C  C     . GLU B 2 336 ? 30.772  50.894 34.921  1.00 62.56  ? 632  GLU A C     1 
ATOM   2826 O  O     . GLU B 2 336 ? 31.289  51.038 33.804  1.00 56.60  ? 632  GLU A O     1 
ATOM   2827 C  CB    . GLU B 2 336 ? 32.223  50.774 36.968  1.00 77.53  ? 632  GLU A CB    1 
ATOM   2828 C  CG    . GLU B 2 336 ? 33.126  51.531 37.940  1.00 84.98  ? 632  GLU A CG    1 
ATOM   2829 C  CD    . GLU B 2 336 ? 33.269  50.826 39.286  1.00 92.05  ? 632  GLU A CD    1 
ATOM   2830 O  OE1   . GLU B 2 336 ? 32.233  50.467 39.889  1.00 92.17  ? 632  GLU A OE1   1 
ATOM   2831 O  OE2   . GLU B 2 336 ? 34.419  50.632 39.740  1.00 93.41  ? 632  GLU A OE2   1 
ATOM   2832 N  N     . GLY B 2 337 ? 29.720  50.099 35.127  1.00 50.83  ? 633  GLY A N     1 
ATOM   2833 C  CA    . GLY B 2 337 ? 29.145  49.280 34.076  1.00 47.32  ? 633  GLY A CA    1 
ATOM   2834 C  C     . GLY B 2 337 ? 28.103  49.980 33.226  1.00 48.74  ? 633  GLY A C     1 
ATOM   2835 O  O     . GLY B 2 337 ? 28.014  49.722 32.024  1.00 47.26  ? 633  GLY A O     1 
ATOM   2836 N  N     . ARG B 2 338 ? 27.308  50.867 33.829  1.00 48.01  ? 634  ARG A N     1 
ATOM   2837 C  CA    . ARG B 2 338 ? 26.231  51.507 33.081  1.00 45.49  ? 634  ARG A CA    1 
ATOM   2838 C  C     . ARG B 2 338 ? 26.777  52.347 31.931  1.00 31.78  ? 634  ARG A C     1 
ATOM   2839 O  O     . ARG B 2 338 ? 26.112  52.501 30.904  1.00 37.70  ? 634  ARG A O     1 
ATOM   2840 C  CB    . ARG B 2 338 ? 25.376  52.353 34.030  1.00 57.57  ? 634  ARG A CB    1 
ATOM   2841 C  CG    . ARG B 2 338 ? 24.386  53.281 33.348  1.00 70.60  ? 634  ARG A CG    1 
ATOM   2842 C  CD    . ARG B 2 338 ? 23.598  54.117 34.352  1.00 80.51  ? 634  ARG A CD    1 
ATOM   2843 N  NE    . ARG B 2 338 ? 22.232  54.363 33.896  1.00 94.24  ? 634  ARG A NE    1 
ATOM   2844 C  CZ    . ARG B 2 338 ? 21.181  54.504 34.699  1.00 100.86 ? 634  ARG A CZ    1 
ATOM   2845 N  NH1   . ARG B 2 338 ? 21.330  54.420 36.014  1.00 101.47 ? 634  ARG A NH1   1 
ATOM   2846 N  NH2   . ARG B 2 338 ? 19.977  54.724 34.185  1.00 101.61 ? 634  ARG A NH2   1 
ATOM   2847 N  N     . LYS B 2 339 ? 27.992  52.877 32.079  1.00 30.69  ? 635  LYS A N     1 
ATOM   2848 C  CA    . LYS B 2 339 ? 28.656  53.591 31.004  1.00 41.52  ? 635  LYS A CA    1 
ATOM   2849 C  C     . LYS B 2 339 ? 28.816  52.756 29.741  1.00 45.12  ? 635  LYS A C     1 
ATOM   2850 O  O     . LYS B 2 339 ? 29.120  53.327 28.690  1.00 47.09  ? 635  LYS A O     1 
ATOM   2851 C  CB    . LYS B 2 339 ? 30.022  54.082 31.479  1.00 49.52  ? 635  LYS A CB    1 
ATOM   2852 C  CG    . LYS B 2 339 ? 29.950  55.321 32.370  1.00 53.79  ? 635  LYS A CG    1 
ATOM   2853 C  CD    . LYS B 2 339 ? 31.331  55.887 32.643  1.00 58.57  ? 635  LYS A CD    1 
ATOM   2854 C  CE    . LYS B 2 339 ? 31.288  56.976 33.711  1.00 59.29  ? 635  LYS A CE    1 
ATOM   2855 N  NZ    . LYS B 2 339 ? 31.573  58.325 33.144  1.00 59.79  ? 635  LYS A NZ    1 
ATOM   2856 N  N     . ILE B 2 340 ? 28.632  51.431 29.811  1.00 37.17  ? 636  ILE A N     1 
ATOM   2857 C  CA    . ILE B 2 340 ? 28.654  50.623 28.594  1.00 29.54  ? 636  ILE A CA    1 
ATOM   2858 C  C     . ILE B 2 340 ? 27.575  51.099 27.634  1.00 30.40  ? 636  ILE A C     1 
ATOM   2859 O  O     . ILE B 2 340 ? 27.772  51.126 26.414  1.00 26.89  ? 636  ILE A O     1 
ATOM   2860 C  CB    . ILE B 2 340 ? 28.497  49.130 28.940  1.00 23.93  ? 636  ILE A CB    1 
ATOM   2861 C  CG1   . ILE B 2 340 ? 29.767  48.632 29.618  1.00 32.89  ? 636  ILE A CG1   1 
ATOM   2862 C  CG2   . ILE B 2 340 ? 28.222  48.271 27.693  1.00 26.49  ? 636  ILE A CG2   1 
ATOM   2863 C  CD1   . ILE B 2 340 ? 29.591  47.298 30.281  1.00 46.38  ? 636  ILE A CD1   1 
ATOM   2864 N  N     . ARG B 2 341 ? 26.441  51.544 28.178  1.00 33.25  ? 637  ARG A N     1 
ATOM   2865 C  CA    . ARG B 2 341 ? 25.349  52.006 27.335  1.00 26.39  ? 637  ARG A CA    1 
ATOM   2866 C  C     . ARG B 2 341 ? 25.695  53.263 26.557  1.00 23.29  ? 637  ARG A C     1 
ATOM   2867 O  O     . ARG B 2 341 ? 24.983  53.592 25.605  1.00 25.38  ? 637  ARG A O     1 
ATOM   2868 C  CB    . ARG B 2 341 ? 24.106  52.222 28.183  1.00 33.15  ? 637  ARG A CB    1 
ATOM   2869 C  CG    . ARG B 2 341 ? 23.650  50.935 28.820  1.00 41.40  ? 637  ARG A CG    1 
ATOM   2870 C  CD    . ARG B 2 341 ? 22.950  51.182 30.130  1.00 50.25  ? 637  ARG A CD    1 
ATOM   2871 N  NE    . ARG B 2 341 ? 21.515  51.277 29.909  1.00 52.10  ? 637  ARG A NE    1 
ATOM   2872 C  CZ    . ARG B 2 341 ? 20.644  50.329 30.224  1.00 37.58  ? 637  ARG A CZ    1 
ATOM   2873 N  NH1   . ARG B 2 341 ? 21.057  49.201 30.802  1.00 39.42  ? 637  ARG A NH1   1 
ATOM   2874 N  NH2   . ARG B 2 341 ? 19.355  50.524 29.972  1.00 35.40  ? 637  ARG A NH2   1 
ATOM   2875 N  N     . GLN B 2 342 ? 26.767  53.971 26.922  1.00 23.09  ? 638  GLN A N     1 
ATOM   2876 C  CA    . GLN B 2 342 ? 27.217  55.070 26.077  1.00 27.56  ? 638  GLN A CA    1 
ATOM   2877 C  C     . GLN B 2 342 ? 27.627  54.587 24.695  1.00 30.82  ? 638  GLN A C     1 
ATOM   2878 O  O     . GLN B 2 342 ? 27.705  55.398 23.765  1.00 26.32  ? 638  GLN A O     1 
ATOM   2879 C  CB    . GLN B 2 342 ? 28.391  55.807 26.722  1.00 37.72  ? 638  GLN A CB    1 
ATOM   2880 C  CG    . GLN B 2 342 ? 28.127  56.272 28.146  1.00 48.49  ? 638  GLN A CG    1 
ATOM   2881 C  CD    . GLN B 2 342 ? 29.255  57.112 28.701  1.00 48.69  ? 638  GLN A CD    1 
ATOM   2882 O  OE1   . GLN B 2 342 ? 30.415  56.933 28.331  1.00 51.41  ? 638  GLN A OE1   1 
ATOM   2883 N  NE2   . GLN B 2 342 ? 28.922  58.041 29.592  1.00 52.47  ? 638  GLN A NE2   1 
ATOM   2884 N  N     . ALA B 2 343 ? 27.885  53.292 24.532  1.00 26.47  ? 639  ALA A N     1 
ATOM   2885 C  CA    . ALA B 2 343 ? 28.368  52.807 23.249  1.00 26.17  ? 639  ALA A CA    1 
ATOM   2886 C  C     . ALA B 2 343 ? 27.247  52.574 22.259  1.00 22.56  ? 639  ALA A C     1 
ATOM   2887 O  O     . ALA B 2 343 ? 27.521  52.380 21.073  1.00 31.30  ? 639  ALA A O     1 
ATOM   2888 C  CB    . ALA B 2 343 ? 29.158  51.519 23.431  1.00 28.87  ? 639  ALA A CB    1 
ATOM   2889 N  N     . PHE B 2 344 ? 26.004  52.605 22.709  1.00 22.69  ? 640  PHE A N     1 
ATOM   2890 C  CA    . PHE B 2 344 ? 24.853  52.393 21.845  1.00 19.47  ? 640  PHE A CA    1 
ATOM   2891 C  C     . PHE B 2 344 ? 24.325  53.748 21.424  1.00 20.04  ? 640  PHE A C     1 
ATOM   2892 O  O     . PHE B 2 344 ? 23.838  54.519 22.252  1.00 23.80  ? 640  PHE A O     1 
ATOM   2893 C  CB    . PHE B 2 344 ? 23.798  51.572 22.559  1.00 18.55  ? 640  PHE A CB    1 
ATOM   2894 C  CG    . PHE B 2 344 ? 24.285  50.208 22.909  1.00 23.45  ? 640  PHE A CG    1 
ATOM   2895 C  CD1   . PHE B 2 344 ? 24.064  49.152 22.051  1.00 26.19  ? 640  PHE A CD1   1 
ATOM   2896 C  CD2   . PHE B 2 344 ? 25.017  49.996 24.072  1.00 23.94  ? 640  PHE A CD2   1 
ATOM   2897 C  CE1   . PHE B 2 344 ? 24.523  47.882 22.360  1.00 25.50  ? 640  PHE A CE1   1 
ATOM   2898 C  CE2   . PHE B 2 344 ? 25.482  48.733 24.385  1.00 27.41  ? 640  PHE A CE2   1 
ATOM   2899 C  CZ    . PHE B 2 344 ? 25.234  47.676 23.524  1.00 21.32  ? 640  PHE A CZ    1 
ATOM   2900 N  N     . VAL B 2 345 ? 24.425  54.022 20.135  1.00 21.74  ? 641  VAL A N     1 
ATOM   2901 C  CA    . VAL B 2 345 ? 24.243  55.371 19.611  1.00 21.13  ? 641  VAL A CA    1 
ATOM   2902 C  C     . VAL B 2 345 ? 23.207  55.293 18.502  1.00 20.62  ? 641  VAL A C     1 
ATOM   2903 O  O     . VAL B 2 345 ? 22.894  54.195 18.010  1.00 19.76  ? 641  VAL A O     1 
ATOM   2904 C  CB    . VAL B 2 345 ? 25.584  55.967 19.121  1.00 22.29  ? 641  VAL A CB    1 
ATOM   2905 C  CG1   . VAL B 2 345 ? 26.554  56.057 20.284  1.00 26.59  ? 641  VAL A CG1   1 
ATOM   2906 C  CG2   . VAL B 2 345 ? 26.182  55.118 18.017  1.00 22.11  ? 641  VAL A CG2   1 
ATOM   2907 N  N     . PRO B 2 346 ? 22.605  56.423 18.129  1.00 21.20  ? 642  PRO A N     1 
ATOM   2908 C  CA    . PRO B 2 346 ? 21.720  56.418 16.958  1.00 22.80  ? 642  PRO A CA    1 
ATOM   2909 C  C     . PRO B 2 346 ? 22.516  56.105 15.700  1.00 24.46  ? 642  PRO A C     1 
ATOM   2910 O  O     . PRO B 2 346 ? 23.721  56.343 15.626  1.00 24.42  ? 642  PRO A O     1 
ATOM   2911 C  CB    . PRO B 2 346 ? 21.153  57.845 16.913  1.00 24.58  ? 642  PRO A CB    1 
ATOM   2912 C  CG    . PRO B 2 346 ? 21.553  58.495 18.182  1.00 23.75  ? 642  PRO A CG    1 
ATOM   2913 C  CD    . PRO B 2 346 ? 22.743  57.767 18.717  1.00 23.91  ? 642  PRO A CD    1 
ATOM   2914 N  N     . SER B 2 347 ? 21.829  55.562 14.703  1.00 25.34  ? 643  SER A N     1 
ATOM   2915 C  CA    . SER B 2 347 ? 22.524  55.100 13.512  1.00 30.34  ? 643  SER A CA    1 
ATOM   2916 C  C     . SER B 2 347 ? 22.681  56.186 12.459  1.00 33.87  ? 643  SER A C     1 
ATOM   2917 O  O     . SER B 2 347 ? 23.338  55.951 11.436  1.00 32.72  ? 643  SER A O     1 
ATOM   2918 C  CB    . SER B 2 347 ? 21.801  53.885 12.914  1.00 24.33  ? 643  SER A CB    1 
ATOM   2919 O  OG    . SER B 2 347 ? 20.453  54.191 12.602  1.00 30.01  ? 643  SER A OG    1 
ATOM   2920 N  N     . GLU B 2 348 ? 22.102  57.365 12.677  1.00 30.64  ? 644  GLU A N     1 
ATOM   2921 C  CA    . GLU B 2 348 ? 22.227  58.463 11.732  1.00 30.71  ? 644  GLU A CA    1 
ATOM   2922 C  C     . GLU B 2 348 ? 22.532  59.740 12.494  1.00 35.34  ? 644  GLU A C     1 
ATOM   2923 O  O     . GLU B 2 348 ? 22.159  59.891 13.660  1.00 29.51  ? 644  GLU A O     1 
ATOM   2924 C  CB    . GLU B 2 348 ? 20.955  58.639 10.896  1.00 40.32  ? 644  GLU A CB    1 
ATOM   2925 C  CG    . GLU B 2 348 ? 20.365  57.333 10.403  1.00 55.30  ? 644  GLU A CG    1 
ATOM   2926 C  CD    . GLU B 2 348 ? 19.482  57.510 9.192   1.00 73.06  ? 644  GLU A CD    1 
ATOM   2927 O  OE1   . GLU B 2 348 ? 18.746  58.518 9.133   1.00 80.57  ? 644  GLU A OE1   1 
ATOM   2928 O  OE2   . GLU B 2 348 ? 19.529  56.639 8.298   1.00 79.65  ? 644  GLU A OE2   1 
ATOM   2929 N  N     . SER B 2 349 ? 23.239  60.650 11.827  1.00 35.73  ? 645  SER A N     1 
ATOM   2930 C  CA    . SER B 2 349 ? 23.538  61.941 12.422  1.00 42.05  ? 645  SER A CA    1 
ATOM   2931 C  C     . SER B 2 349 ? 22.250  62.726 12.641  1.00 29.82  ? 645  SER A C     1 
ATOM   2932 O  O     . SER B 2 349 ? 21.302  62.647 11.852  1.00 32.80  ? 645  SER A O     1 
ATOM   2933 C  CB    . SER B 2 349 ? 24.487  62.741 11.523  1.00 48.55  ? 645  SER A CB    1 
ATOM   2934 O  OG    . SER B 2 349 ? 23.943  62.863 10.218  1.00 47.98  ? 645  SER A OG    1 
ATOM   2935 N  N     . ASP B 2 350 ? 22.231  63.506 13.717  1.00 35.61  ? 646  ASP A N     1 
ATOM   2936 C  CA    . ASP B 2 350 ? 21.067  64.299 14.097  1.00 34.59  ? 646  ASP A CA    1 
ATOM   2937 C  C     . ASP B 2 350 ? 19.883  63.425 14.496  1.00 31.91  ? 646  ASP A C     1 
ATOM   2938 O  O     . ASP B 2 350 ? 18.744  63.904 14.520  1.00 26.85  ? 646  ASP A O     1 
ATOM   2939 C  CB    . ASP B 2 350 ? 20.653  65.271 12.979  1.00 42.78  ? 646  ASP A CB    1 
ATOM   2940 C  CG    . ASP B 2 350 ? 21.447  66.575 13.005  1.00 67.51  ? 646  ASP A CG    1 
ATOM   2941 O  OD1   . ASP B 2 350 ? 21.092  67.500 12.239  1.00 79.57  ? 646  ASP A OD1   1 
ATOM   2942 O  OD2   . ASP B 2 350 ? 22.418  66.677 13.791  1.00 68.91  ? 646  ASP A OD2   1 
ATOM   2943 N  N     . TRP B 2 351 ? 20.120  62.139 14.764  1.00 22.92  ? 647  TRP A N     1 
ATOM   2944 C  CA    . TRP B 2 351 ? 19.119  61.288 15.400  1.00 21.75  ? 647  TRP A CA    1 
ATOM   2945 C  C     . TRP B 2 351 ? 19.427  61.165 16.886  1.00 23.47  ? 647  TRP A C     1 
ATOM   2946 O  O     . TRP B 2 351 ? 20.547  61.428 17.324  1.00 22.84  ? 647  TRP A O     1 
ATOM   2947 C  CB    . TRP B 2 351 ? 19.066  59.902 14.741  1.00 21.52  ? 647  TRP A CB    1 
ATOM   2948 C  CG    . TRP B 2 351 ? 18.349  59.910 13.417  1.00 24.61  ? 647  TRP A CG    1 
ATOM   2949 C  CD1   . TRP B 2 351 ? 18.445  60.871 12.445  1.00 23.40  ? 647  TRP A CD1   1 
ATOM   2950 C  CD2   . TRP B 2 351 ? 17.417  58.932 12.922  1.00 21.37  ? 647  TRP A CD2   1 
ATOM   2951 N  NE1   . TRP B 2 351 ? 17.638  60.548 11.383  1.00 26.16  ? 647  TRP A NE1   1 
ATOM   2952 C  CE2   . TRP B 2 351 ? 17.002  59.362 11.647  1.00 24.17  ? 647  TRP A CE2   1 
ATOM   2953 C  CE3   . TRP B 2 351 ? 16.896  57.737 13.433  1.00 22.06  ? 647  TRP A CE3   1 
ATOM   2954 C  CZ2   . TRP B 2 351 ? 16.088  58.646 10.878  1.00 29.51  ? 647  TRP A CZ2   1 
ATOM   2955 C  CZ3   . TRP B 2 351 ? 15.997  57.024 12.666  1.00 24.88  ? 647  TRP A CZ3   1 
ATOM   2956 C  CH2   . TRP B 2 351 ? 15.597  57.480 11.406  1.00 29.28  ? 647  TRP A CH2   1 
ATOM   2957 N  N     . LEU B 2 352 ? 18.411  60.773 17.669  1.00 20.19  ? 648  LEU A N     1 
ATOM   2958 C  CA    . LEU B 2 352 ? 18.579  60.559 19.096  1.00 19.65  ? 648  LEU A CA    1 
ATOM   2959 C  C     . LEU B 2 352 ? 17.965  59.220 19.502  1.00 18.73  ? 648  LEU A C     1 
ATOM   2960 O  O     . LEU B 2 352 ? 17.088  58.680 18.828  1.00 19.68  ? 648  LEU A O     1 
ATOM   2961 C  CB    . LEU B 2 352 ? 17.943  61.698 19.911  1.00 23.38  ? 648  LEU A CB    1 
ATOM   2962 C  CG    . LEU B 2 352 ? 18.597  63.076 19.706  1.00 26.74  ? 648  LEU A CG    1 
ATOM   2963 C  CD1   . LEU B 2 352 ? 17.811  64.214 20.400  1.00 27.55  ? 648  LEU A CD1   1 
ATOM   2964 C  CD2   . LEU B 2 352 ? 20.073  63.086 20.135  1.00 26.57  ? 648  LEU A CD2   1 
ATOM   2965 N  N     . ILE B 2 353 ? 18.426  58.690 20.620  1.00 18.40  ? 649  ILE A N     1 
ATOM   2966 C  CA    . ILE B 2 353 ? 17.797  57.521 21.227  1.00 17.55  ? 649  ILE A CA    1 
ATOM   2967 C  C     . ILE B 2 353 ? 16.663  57.993 22.117  1.00 17.72  ? 649  ILE A C     1 
ATOM   2968 O  O     . ILE B 2 353 ? 16.831  58.928 22.892  1.00 19.41  ? 649  ILE A O     1 
ATOM   2969 C  CB    . ILE B 2 353 ? 18.808  56.696 22.035  1.00 17.59  ? 649  ILE A CB    1 
ATOM   2970 C  CG1   . ILE B 2 353 ? 19.928  56.186 21.136  1.00 18.66  ? 649  ILE A CG1   1 
ATOM   2971 C  CG2   . ILE B 2 353 ? 18.081  55.531 22.741  1.00 17.81  ? 649  ILE A CG2   1 
ATOM   2972 C  CD1   . ILE B 2 353 ? 19.427  55.649 19.806  1.00 20.30  ? 649  ILE A CD1   1 
ATOM   2973 N  N     . PHE B 2 354 ? 15.507  57.352 21.996  1.00 16.57  ? 650  PHE A N     1 
ATOM   2974 C  CA    . PHE B 2 354 ? 14.352  57.593 22.848  1.00 16.45  ? 650  PHE A CA    1 
ATOM   2975 C  C     . PHE B 2 354 ? 14.038  56.279 23.547  1.00 19.21  ? 650  PHE A C     1 
ATOM   2976 O  O     . PHE B 2 354 ? 13.901  55.246 22.890  1.00 18.21  ? 650  PHE A O     1 
ATOM   2977 C  CB    . PHE B 2 354 ? 13.162  58.075 22.013  1.00 15.70  ? 650  PHE A CB    1 
ATOM   2978 C  CG    . PHE B 2 354 ? 11.940  58.415 22.812  1.00 15.64  ? 650  PHE A CG    1 
ATOM   2979 C  CD1   . PHE B 2 354 ? 11.624  59.738 23.069  1.00 18.17  ? 650  PHE A CD1   1 
ATOM   2980 C  CD2   . PHE B 2 354 ? 11.089  57.429 23.263  1.00 16.57  ? 650  PHE A CD2   1 
ATOM   2981 C  CE1   . PHE B 2 354 ? 10.488  60.063 23.793  1.00 18.10  ? 650  PHE A CE1   1 
ATOM   2982 C  CE2   . PHE B 2 354 ? 9.952   57.735 23.989  1.00 14.32  ? 650  PHE A CE2   1 
ATOM   2983 C  CZ    . PHE B 2 354 ? 9.651   59.073 24.255  1.00 14.68  ? 650  PHE A CZ    1 
ATOM   2984 N  N     . ALA B 2 355 ? 13.961  56.306 24.870  1.00 16.23  ? 651  ALA A N     1 
ATOM   2985 C  CA    . ALA B 2 355 ? 13.704  55.098 25.640  1.00 14.45  ? 651  ALA A CA    1 
ATOM   2986 C  C     . ALA B 2 355 ? 12.503  55.353 26.528  1.00 26.50  ? 651  ALA A C     1 
ATOM   2987 O  O     . ALA B 2 355 ? 12.416  56.404 27.174  1.00 24.26  ? 651  ALA A O     1 
ATOM   2988 C  CB    . ALA B 2 355 ? 14.927  54.703 26.467  1.00 17.87  ? 651  ALA A CB    1 
ATOM   2989 N  N     . ALA B 2 356 ? 11.565  54.414 26.536  1.00 13.32  ? 652  ALA A N     1 
ATOM   2990 C  CA    . ALA B 2 356 ? 10.367  54.541 27.356  1.00 12.97  ? 652  ALA A CA    1 
ATOM   2991 C  C     . ALA B 2 356 ? 10.165  53.237 28.105  1.00 19.84  ? 652  ALA A C     1 
ATOM   2992 O  O     . ALA B 2 356 ? 10.242  52.158 27.502  1.00 18.57  ? 652  ALA A O     1 
ATOM   2993 C  CB    . ALA B 2 356 ? 9.144   54.869 26.502  1.00 16.71  ? 652  ALA A CB    1 
ATOM   2994 N  N     . ASP B 2 357 ? 9.912   53.326 29.412  1.00 17.33  ? 653  ASP A N     1 
ATOM   2995 C  CA    . ASP B 2 357 ? 9.806   52.128 30.236  1.00 21.90  ? 653  ASP A CA    1 
ATOM   2996 C  C     . ASP B 2 357 ? 8.562   52.190 31.107  1.00 18.56  ? 653  ASP A C     1 
ATOM   2997 O  O     . ASP B 2 357 ? 8.206   53.252 31.631  1.00 19.25  ? 653  ASP A O     1 
ATOM   2998 C  CB    . ASP B 2 357 ? 11.046  51.943 31.111  1.00 37.87  ? 653  ASP A CB    1 
ATOM   2999 C  CG    . ASP B 2 357 ? 11.168  53.018 32.171  1.00 71.09  ? 653  ASP A CG    1 
ATOM   3000 O  OD1   . ASP B 2 357 ? 11.680  54.113 31.845  1.00 80.54  ? 653  ASP A OD1   1 
ATOM   3001 O  OD2   . ASP B 2 357 ? 10.740  52.776 33.323  1.00 81.83  ? 653  ASP A OD2   1 
ATOM   3002 N  N     . TYR B 2 358 ? 7.896   51.050 31.251  1.00 15.24  ? 654  TYR A N     1 
ATOM   3003 C  CA    . TYR B 2 358 ? 6.802   50.976 32.203  1.00 17.75  ? 654  TYR A CA    1 
ATOM   3004 C  C     . TYR B 2 358 ? 7.359   51.077 33.610  1.00 17.86  ? 654  TYR A C     1 
ATOM   3005 O  O     . TYR B 2 358 ? 8.379   50.470 33.929  1.00 24.07  ? 654  TYR A O     1 
ATOM   3006 C  CB    . TYR B 2 358 ? 6.033   49.673 32.043  1.00 11.24  ? 654  TYR A CB    1 
ATOM   3007 C  CG    . TYR B 2 358 ? 5.148   49.644 30.825  1.00 18.63  ? 654  TYR A CG    1 
ATOM   3008 C  CD1   . TYR B 2 358 ? 5.514   48.928 29.695  1.00 15.70  ? 654  TYR A CD1   1 
ATOM   3009 C  CD2   . TYR B 2 358 ? 3.947   50.344 30.799  1.00 11.18  ? 654  TYR A CD2   1 
ATOM   3010 C  CE1   . TYR B 2 358 ? 4.701   48.882 28.588  1.00 17.01  ? 654  TYR A CE1   1 
ATOM   3011 C  CE2   . TYR B 2 358 ? 3.130   50.309 29.701  1.00 11.98  ? 654  TYR A CE2   1 
ATOM   3012 C  CZ    . TYR B 2 358 ? 3.515   49.573 28.586  1.00 17.18  ? 654  TYR A CZ    1 
ATOM   3013 O  OH    . TYR B 2 358 ? 2.708   49.542 27.473  1.00 15.60  ? 654  TYR A OH    1 
ATOM   3014 N  N     . SER B 2 359 ? 6.695   51.868 34.445  1.00 12.12  ? 655  SER A N     1 
ATOM   3015 C  CA    . SER B 2 359 ? 7.020   51.946 35.857  1.00 19.54  ? 655  SER A CA    1 
ATOM   3016 C  C     . SER B 2 359 ? 6.204   50.905 36.621  1.00 12.07  ? 655  SER A C     1 
ATOM   3017 O  O     . SER B 2 359 ? 4.970   50.974 36.653  1.00 15.10  ? 655  SER A O     1 
ATOM   3018 C  CB    . SER B 2 359 ? 6.738   53.349 36.397  1.00 24.59  ? 655  SER A CB    1 
ATOM   3019 O  OG    . SER B 2 359 ? 7.020   53.388 37.782  1.00 26.91  ? 655  SER A OG    1 
ATOM   3020 N  N     . GLN B 2 360 ? 6.898   49.975 37.256  1.00 12.15  ? 656  GLN A N     1 
ATOM   3021 C  CA    . GLN B 2 360 ? 6.280   48.926 38.081  1.00 12.14  ? 656  GLN A CA    1 
ATOM   3022 C  C     . GLN B 2 360 ? 5.119   48.243 37.367  1.00 17.13  ? 656  GLN A C     1 
ATOM   3023 O  O     . GLN B 2 360 ? 4.047   48.051 37.938  1.00 13.98  ? 656  GLN A O     1 
ATOM   3024 C  CB    . GLN B 2 360 ? 5.817   49.487 39.427  1.00 21.48  ? 656  GLN A CB    1 
ATOM   3025 C  CG    . GLN B 2 360 ? 6.913   50.190 40.236  1.00 15.86  ? 656  GLN A CG    1 
ATOM   3026 C  CD    . GLN B 2 360 ? 8.014   49.244 40.692  1.00 22.52  ? 656  GLN A CD    1 
ATOM   3027 O  OE1   . GLN B 2 360 ? 7.778   48.051 40.887  1.00 28.97  ? 656  GLN A OE1   1 
ATOM   3028 N  NE2   . GLN B 2 360 ? 9.228   49.783 40.889  1.00 25.78  ? 656  GLN A NE2   1 
ATOM   3029 N  N     . ILE B 2 361 ? 5.330   47.841 36.108  1.00 12.90  ? 657  ILE A N     1 
ATOM   3030 C  CA    . ILE B 2 361 ? 4.197   47.216 35.423  1.00 17.22  ? 657  ILE A CA    1 
ATOM   3031 C  C     . ILE B 2 361 ? 3.785   45.907 36.111  1.00 13.36  ? 657  ILE A C     1 
ATOM   3032 O  O     . ILE B 2 361 ? 2.592   45.588 36.193  1.00 11.80  ? 657  ILE A O     1 
ATOM   3033 C  CB    . ILE B 2 361 ? 4.486   47.025 33.920  1.00 13.39  ? 657  ILE A CB    1 
ATOM   3034 C  CG1   . ILE B 2 361 ? 3.217   46.550 33.210  1.00 18.39  ? 657  ILE A CG1   1 
ATOM   3035 C  CG2   . ILE B 2 361 ? 5.671   46.096 33.684  1.00 12.81  ? 657  ILE A CG2   1 
ATOM   3036 C  CD1   . ILE B 2 361 ? 3.410   46.265 31.723  1.00 27.56  ? 657  ILE A CD1   1 
ATOM   3037 N  N     . GLU B 2 362 ? 4.735   45.154 36.667  1.00 12.39  ? 658  GLU A N     1 
ATOM   3038 C  CA    . GLU B 2 362 ? 4.348   43.862 37.228  1.00 13.97  ? 658  GLU A CA    1 
ATOM   3039 C  C     . GLU B 2 362 ? 3.453   44.050 38.449  1.00 18.87  ? 658  GLU A C     1 
ATOM   3040 O  O     . GLU B 2 362 ? 2.400   43.415 38.557  1.00 15.46  ? 658  GLU A O     1 
ATOM   3041 C  CB    . GLU B 2 362 ? 5.589   43.032 37.568  1.00 11.66  ? 658  GLU A CB    1 
ATOM   3042 C  CG    . GLU B 2 362 ? 6.525   42.772 36.365  1.00 19.23  ? 658  GLU A CG    1 
ATOM   3043 C  CD    . GLU B 2 362 ? 7.486   43.956 36.094  1.00 34.04  ? 658  GLU A CD    1 
ATOM   3044 O  OE1   . GLU B 2 362 ? 8.400   43.831 35.242  1.00 27.43  ? 658  GLU A OE1   1 
ATOM   3045 O  OE2   . GLU B 2 362 ? 7.327   45.021 36.740  1.00 27.27  ? 658  GLU A OE2   1 
ATOM   3046 N  N     . LEU B 2 363 ? 3.835   44.945 39.373  1.00 13.97  ? 659  LEU A N     1 
ATOM   3047 C  CA    . LEU B 2 363 ? 2.976   45.171 40.529  1.00 12.72  ? 659  LEU A CA    1 
ATOM   3048 C  C     . LEU B 2 363 ? 1.660   45.806 40.126  1.00 12.29  ? 659  LEU A C     1 
ATOM   3049 O  O     . LEU B 2 363 ? 0.634   45.548 40.760  1.00 14.15  ? 659  LEU A O     1 
ATOM   3050 C  CB    . LEU B 2 363 ? 3.687   46.032 41.584  1.00 12.81  ? 659  LEU A CB    1 
ATOM   3051 C  CG    . LEU B 2 363 ? 4.873   45.365 42.272  1.00 17.37  ? 659  LEU A CG    1 
ATOM   3052 C  CD1   . LEU B 2 363 ? 5.612   46.365 43.145  1.00 16.37  ? 659  LEU A CD1   1 
ATOM   3053 C  CD2   . LEU B 2 363 ? 4.353   44.198 43.101  1.00 22.38  ? 659  LEU A CD2   1 
ATOM   3054 N  N     . ARG B 2 364 ? 1.660   46.647 39.092  1.00 12.03  ? 660  ARG A N     1 
ATOM   3055 C  CA    . ARG B 2 364 ? 0.392   47.179 38.618  1.00 12.26  ? 660  ARG A CA    1 
ATOM   3056 C  C     . ARG B 2 364 ? -0.493  46.060 38.094  1.00 12.99  ? 660  ARG A C     1 
ATOM   3057 O  O     . ARG B 2 364 ? -1.699  46.028 38.352  1.00 13.47  ? 660  ARG A O     1 
ATOM   3058 C  CB    . ARG B 2 364 ? 0.632   48.221 37.525  1.00 11.84  ? 660  ARG A CB    1 
ATOM   3059 C  CG    . ARG B 2 364 ? 1.052   49.598 38.119  1.00 14.70  ? 660  ARG A CG    1 
ATOM   3060 C  CD    . ARG B 2 364 ? 1.646   50.524 37.031  1.00 16.43  ? 660  ARG A CD    1 
ATOM   3061 N  NE    . ARG B 2 364 ? 2.363   51.643 37.657  1.00 12.33  ? 660  ARG A NE    1 
ATOM   3062 C  CZ    . ARG B 2 364 ? 1.785   52.750 38.103  1.00 13.57  ? 660  ARG A CZ    1 
ATOM   3063 N  NH1   . ARG B 2 364 ? 0.494   52.954 37.914  1.00 13.94  ? 660  ARG A NH1   1 
ATOM   3064 N  NH2   . ARG B 2 364 ? 2.524   53.687 38.677  1.00 17.34  ? 660  ARG A NH2   1 
ATOM   3065 N  N     . VAL B 2 365 ? 0.087   45.150 37.321  1.00 12.44  ? 661  VAL A N     1 
ATOM   3066 C  CA    . VAL B 2 365 ? -0.684  43.997 36.853  1.00 12.03  ? 661  VAL A CA    1 
ATOM   3067 C  C     . VAL B 2 365 ? -1.198  43.193 38.044  1.00 11.86  ? 661  VAL A C     1 
ATOM   3068 O  O     . VAL B 2 365 ? -2.362  42.764 38.068  1.00 12.05  ? 661  VAL A O     1 
ATOM   3069 C  CB    . VAL B 2 365 ? 0.169   43.141 35.897  1.00 12.86  ? 661  VAL A CB    1 
ATOM   3070 C  CG1   . VAL B 2 365 ? -0.413  41.720 35.769  1.00 12.90  ? 661  VAL A CG1   1 
ATOM   3071 C  CG2   . VAL B 2 365 ? 0.247   43.844 34.523  1.00 16.88  ? 661  VAL A CG2   1 
ATOM   3072 N  N     . LEU B 2 366 ? -0.351  43.013 39.072  1.00 12.04  ? 662  LEU A N     1 
ATOM   3073 C  CA    . LEU B 2 366 ? -0.786  42.295 40.270  1.00 12.46  ? 662  LEU A CA    1 
ATOM   3074 C  C     . LEU B 2 366 ? -1.955  42.999 40.947  1.00 25.06  ? 662  LEU A C     1 
ATOM   3075 O  O     . LEU B 2 366 ? -2.911  42.339 41.374  1.00 13.66  ? 662  LEU A O     1 
ATOM   3076 C  CB    . LEU B 2 366 ? 0.370   42.131 41.262  1.00 16.89  ? 662  LEU A CB    1 
ATOM   3077 C  CG    . LEU B 2 366 ? 0.002   41.507 42.610  1.00 13.27  ? 662  LEU A CG    1 
ATOM   3078 C  CD1   . LEU B 2 366 ? -0.553  40.088 42.416  1.00 16.25  ? 662  LEU A CD1   1 
ATOM   3079 C  CD2   . LEU B 2 366 ? 1.215   41.503 43.524  1.00 13.59  ? 662  LEU A CD2   1 
ATOM   3080 N  N     . ALA B 2 367 ? -1.888  44.334 41.070  1.00 14.85  ? 663  ALA A N     1 
ATOM   3081 C  CA    . ALA B 2 367 ? -2.990  45.088 41.670  1.00 18.22  ? 663  ALA A CA    1 
ATOM   3082 C  C     . ALA B 2 367 ? -4.283  44.828 40.929  1.00 15.75  ? 663  ALA A C     1 
ATOM   3083 O  O     . ALA B 2 367 ? -5.346  44.657 41.534  1.00 22.35  ? 663  ALA A O     1 
ATOM   3084 C  CB    . ALA B 2 367 ? -2.685  46.588 41.644  1.00 13.38  ? 663  ALA A CB    1 
ATOM   3085 N  N     . HIS B 2 368 ? -4.204  44.824 39.610  1.00 12.91  ? 664  HIS A N     1 
ATOM   3086 C  CA    . HIS B 2 368 ? -5.375  44.590 38.780  1.00 16.35  ? 664  HIS A CA    1 
ATOM   3087 C  C     . HIS B 2 368 ? -5.901  43.165 38.946  1.00 18.97  ? 664  HIS A C     1 
ATOM   3088 O  O     . HIS B 2 368 ? -7.093  42.956 39.184  1.00 20.48  ? 664  HIS A O     1 
ATOM   3089 C  CB    . HIS B 2 368 ? -4.998  44.859 37.331  1.00 14.65  ? 664  HIS A CB    1 
ATOM   3090 C  CG    . HIS B 2 368 ? -6.017  44.389 36.347  1.00 20.12  ? 664  HIS A CG    1 
ATOM   3091 N  ND1   . HIS B 2 368 ? -7.056  45.186 35.923  1.00 19.22  ? 664  HIS A ND1   1 
ATOM   3092 C  CD2   . HIS B 2 368 ? -6.147  43.210 35.691  1.00 19.99  ? 664  HIS A CD2   1 
ATOM   3093 C  CE1   . HIS B 2 368 ? -7.794  44.513 35.056  1.00 25.10  ? 664  HIS A CE1   1 
ATOM   3094 N  NE2   . HIS B 2 368 ? -7.268  43.308 34.905  1.00 22.03  ? 664  HIS A NE2   1 
ATOM   3095 N  N     . ILE B 2 369 ? -5.028  42.173 38.805  1.00 14.49  ? 665  ILE A N     1 
ATOM   3096 C  CA    . ILE B 2 369 ? -5.481  40.783 38.785  1.00 19.12  ? 665  ILE A CA    1 
ATOM   3097 C  C     . ILE B 2 369 ? -5.992  40.370 40.151  1.00 22.56  ? 665  ILE A C     1 
ATOM   3098 O  O     . ILE B 2 369 ? -7.005  39.673 40.261  1.00 19.56  ? 665  ILE A O     1 
ATOM   3099 C  CB    . ILE B 2 369 ? -4.350  39.852 38.319  1.00 22.13  ? 665  ILE A CB    1 
ATOM   3100 C  CG1   . ILE B 2 369 ? -4.156  39.980 36.812  1.00 15.02  ? 665  ILE A CG1   1 
ATOM   3101 C  CG2   . ILE B 2 369 ? -4.660  38.409 38.668  1.00 31.79  ? 665  ILE A CG2   1 
ATOM   3102 C  CD1   . ILE B 2 369 ? -2.983  39.170 36.325  1.00 30.81  ? 665  ILE A CD1   1 
ATOM   3103 N  N     . ALA B 2 370 ? -5.298  40.790 41.211  1.00 19.27  ? 666  ALA A N     1 
ATOM   3104 C  CA    . ALA B 2 370 ? -5.716  40.478 42.568  1.00 23.54  ? 666  ALA A CA    1 
ATOM   3105 C  C     . ALA B 2 370 ? -6.833  41.389 43.045  1.00 25.13  ? 666  ALA A C     1 
ATOM   3106 O  O     . ALA B 2 370 ? -7.521  41.047 44.009  1.00 21.30  ? 666  ALA A O     1 
ATOM   3107 C  CB    . ALA B 2 370 ? -4.521  40.580 43.529  1.00 17.63  ? 666  ALA A CB    1 
ATOM   3108 N  N     . GLU B 2 371 ? -7.034  42.535 42.388  1.00 20.19  ? 667  GLU A N     1 
ATOM   3109 C  CA    . GLU B 2 371 ? -7.988  43.542 42.856  1.00 22.65  ? 667  GLU A CA    1 
ATOM   3110 C  C     . GLU B 2 371 ? -7.773  43.828 44.341  1.00 23.26  ? 667  GLU A C     1 
ATOM   3111 O  O     . GLU B 2 371 ? -8.717  43.940 45.124  1.00 24.34  ? 667  GLU A O     1 
ATOM   3112 C  CB    . GLU B 2 371 ? -9.421  43.117 42.571  1.00 25.05  ? 667  GLU A CB    1 
ATOM   3113 C  CG    . GLU B 2 371 ? -9.626  42.801 41.098  1.00 51.95  ? 667  GLU A CG    1 
ATOM   3114 C  CD    . GLU B 2 371 ? -11.076 42.644 40.712  1.00 72.81  ? 667  GLU A CD    1 
ATOM   3115 O  OE1   . GLU B 2 371 ? -11.834 43.636 40.817  1.00 79.62  ? 667  GLU A OE1   1 
ATOM   3116 O  OE2   . GLU B 2 371 ? -11.448 41.528 40.285  1.00 80.61  ? 667  GLU A OE2   1 
ATOM   3117 N  N     . ASP B 2 372 ? -6.509  43.913 44.735  1.00 17.23  ? 668  ASP A N     1 
ATOM   3118 C  CA    . ASP B 2 372 ? -6.180  44.275 46.108  1.00 20.86  ? 668  ASP A CA    1 
ATOM   3119 C  C     . ASP B 2 372 ? -6.449  45.761 46.293  1.00 22.53  ? 668  ASP A C     1 
ATOM   3120 O  O     . ASP B 2 372 ? -5.855  46.584 45.594  1.00 19.92  ? 668  ASP A O     1 
ATOM   3121 C  CB    . ASP B 2 372 ? -4.721  43.958 46.388  1.00 19.69  ? 668  ASP A CB    1 
ATOM   3122 C  CG    . ASP B 2 372 ? -4.343  44.216 47.824  1.00 25.15  ? 668  ASP A CG    1 
ATOM   3123 O  OD1   . ASP B 2 372 ? -4.391  43.263 48.619  1.00 28.52  ? 668  ASP A OD1   1 
ATOM   3124 O  OD2   . ASP B 2 372 ? -4.019  45.376 48.164  1.00 26.18  ? 668  ASP A OD2   1 
ATOM   3125 N  N     . ASP B 2 373 ? -7.344  46.111 47.218  1.00 23.44  ? 669  ASP A N     1 
ATOM   3126 C  CA    . ASP B 2 373 ? -7.752  47.509 47.325  1.00 19.53  ? 669  ASP A CA    1 
ATOM   3127 C  C     . ASP B 2 373 ? -6.583  48.397 47.715  1.00 23.35  ? 669  ASP A C     1 
ATOM   3128 O  O     . ASP B 2 373 ? -6.428  49.501 47.181  1.00 24.79  ? 669  ASP A O     1 
ATOM   3129 C  CB    . ASP B 2 373 ? -8.892  47.656 48.329  1.00 25.84  ? 669  ASP A CB    1 
ATOM   3130 C  CG    . ASP B 2 373 ? -10.164 46.975 47.862  1.00 47.80  ? 669  ASP A CG    1 
ATOM   3131 O  OD1   . ASP B 2 373 ? -10.237 46.622 46.667  1.00 52.53  ? 669  ASP A OD1   1 
ATOM   3132 O  OD2   . ASP B 2 373 ? -11.091 46.795 48.687  1.00 56.19  ? 669  ASP A OD2   1 
ATOM   3133 N  N     . ASN B 2 374 ? -5.748  47.933 48.646  1.00 24.43  ? 670  ASN A N     1 
ATOM   3134 C  CA    . ASN B 2 374 ? -4.625  48.747 49.097  1.00 21.11  ? 670  ASN A CA    1 
ATOM   3135 C  C     . ASN B 2 374 ? -3.629  48.963 47.969  1.00 26.39  ? 670  ASN A C     1 
ATOM   3136 O  O     . ASN B 2 374 ? -3.157  50.081 47.745  1.00 20.07  ? 670  ASN A O     1 
ATOM   3137 C  CB    . ASN B 2 374 ? -3.952  48.080 50.289  1.00 25.01  ? 670  ASN A CB    1 
ATOM   3138 C  CG    . ASN B 2 374 ? -3.144  49.049 51.116  1.00 44.48  ? 670  ASN A CG    1 
ATOM   3139 O  OD1   . ASN B 2 374 ? -3.398  50.254 51.114  1.00 58.03  ? 670  ASN A OD1   1 
ATOM   3140 N  ND2   . ASN B 2 374 ? -2.158  48.527 51.833  1.00 53.03  ? 670  ASN A ND2   1 
ATOM   3141 N  N     . LEU B 2 375 ? -3.314  47.903 47.235  1.00 16.24  ? 671  LEU A N     1 
ATOM   3142 C  CA    . LEU B 2 375 ? -2.364  48.014 46.149  1.00 15.48  ? 671  LEU A CA    1 
ATOM   3143 C  C     . LEU B 2 375 ? -2.916  48.880 45.017  1.00 15.14  ? 671  LEU A C     1 
ATOM   3144 O  O     . LEU B 2 375 ? -2.181  49.666 44.423  1.00 16.03  ? 671  LEU A O     1 
ATOM   3145 C  CB    . LEU B 2 375 ? -2.014  46.616 45.636  1.00 17.23  ? 671  LEU A CB    1 
ATOM   3146 C  CG    . LEU B 2 375 ? -0.728  46.473 44.832  1.00 23.80  ? 671  LEU A CG    1 
ATOM   3147 C  CD1   . LEU B 2 375 ? 0.480   46.986 45.632  1.00 22.32  ? 671  LEU A CD1   1 
ATOM   3148 C  CD2   . LEU B 2 375 ? -0.515  45.010 44.445  1.00 23.21  ? 671  LEU A CD2   1 
ATOM   3149 N  N     . MET B 2 376 ? -4.193  48.719 44.677  1.00 15.25  ? 672  MET A N     1 
ATOM   3150 C  CA    . MET B 2 376 ? -4.777  49.526 43.613  1.00 18.59  ? 672  MET A CA    1 
ATOM   3151 C  C     . MET B 2 376 ? -4.767  50.994 43.993  1.00 23.37  ? 672  MET A C     1 
ATOM   3152 O  O     . MET B 2 376 ? -4.459  51.864 43.162  1.00 18.96  ? 672  MET A O     1 
ATOM   3153 C  CB    . MET B 2 376 ? -6.207  49.073 43.321  1.00 20.38  ? 672  MET A CB    1 
ATOM   3154 C  CG    . MET B 2 376 ? -6.281  47.724 42.614  1.00 27.26  ? 672  MET A CG    1 
ATOM   3155 S  SD    . MET B 2 376 ? -7.952  47.332 42.042  1.00 32.24  ? 672  MET A SD    1 
ATOM   3156 C  CE    . MET B 2 376 ? -8.810  47.111 43.600  1.00 35.46  ? 672  MET A CE    1 
ATOM   3157 N  N     . GLU B 2 377 ? -5.101  51.284 45.249  1.00 20.31  ? 673  GLU A N     1 
ATOM   3158 C  CA    . GLU B 2 377 ? -5.114  52.666 45.706  1.00 25.23  ? 673  GLU A CA    1 
ATOM   3159 C  C     . GLU B 2 377 ? -3.711  53.255 45.673  1.00 21.76  ? 673  GLU A C     1 
ATOM   3160 O  O     . GLU B 2 377 ? -3.519  54.399 45.250  1.00 21.86  ? 673  GLU A O     1 
ATOM   3161 C  CB    . GLU B 2 377 ? -5.714  52.740 47.110  1.00 21.41  ? 673  GLU A CB    1 
ATOM   3162 C  CG    . GLU B 2 377 ? -5.698  54.151 47.738  1.00 32.44  ? 673  GLU A CG    1 
ATOM   3163 C  CD    . GLU B 2 377 ? -6.806  55.083 47.213  1.00 40.92  ? 673  GLU A CD    1 
ATOM   3164 O  OE1   . GLU B 2 377 ? -7.402  54.814 46.143  1.00 44.38  ? 673  GLU A OE1   1 
ATOM   3165 O  OE2   . GLU B 2 377 ? -7.086  56.100 47.885  1.00 50.34  ? 673  GLU A OE2   1 
ATOM   3166 N  N     . ALA B 2 378 ? -2.710  52.476 46.086  1.00 17.28  ? 674  ALA A N     1 
ATOM   3167 C  CA    . ALA B 2 378 ? -1.342  52.975 46.026  1.00 16.18  ? 674  ALA A CA    1 
ATOM   3168 C  C     . ALA B 2 378 ? -0.973  53.400 44.604  1.00 21.13  ? 674  ALA A C     1 
ATOM   3169 O  O     . ALA B 2 378 ? -0.325  54.433 44.409  1.00 17.45  ? 674  ALA A O     1 
ATOM   3170 C  CB    . ALA B 2 378 ? -0.378  51.916 46.546  1.00 16.35  ? 674  ALA A CB    1 
ATOM   3171 N  N     . PHE B 2 379 ? -1.372  52.616 43.593  1.00 16.67  ? 675  PHE A N     1 
ATOM   3172 C  CA    . PHE B 2 379 ? -1.053  52.990 42.216  1.00 18.04  ? 675  PHE A CA    1 
ATOM   3173 C  C     . PHE B 2 379 ? -2.005  54.049 41.681  1.00 21.06  ? 675  PHE A C     1 
ATOM   3174 O  O     . PHE B 2 379 ? -1.607  54.878 40.855  1.00 20.96  ? 675  PHE A O     1 
ATOM   3175 C  CB    . PHE B 2 379 ? -1.070  51.756 41.311  1.00 14.46  ? 675  PHE A CB    1 
ATOM   3176 C  CG    . PHE B 2 379 ? 0.134   50.895 41.486  1.00 16.45  ? 675  PHE A CG    1 
ATOM   3177 C  CD1   . PHE B 2 379 ? 1.408   51.427 41.331  1.00 13.44  ? 675  PHE A CD1   1 
ATOM   3178 C  CD2   . PHE B 2 379 ? -0.001  49.572 41.867  1.00 16.21  ? 675  PHE A CD2   1 
ATOM   3179 C  CE1   . PHE B 2 379 ? 2.524   50.634 41.515  1.00 17.96  ? 675  PHE A CE1   1 
ATOM   3180 C  CE2   . PHE B 2 379 ? 1.109   48.759 42.053  1.00 14.63  ? 675  PHE A CE2   1 
ATOM   3181 C  CZ    . PHE B 2 379 ? 2.368   49.277 41.889  1.00 13.24  ? 675  PHE A CZ    1 
ATOM   3182 N  N     . ARG B 2 380 ? -3.253  54.054 42.141  1.00 15.10  ? 676  ARG A N     1 
ATOM   3183 C  CA    . ARG B 2 380 ? -4.141  55.134 41.743  1.00 17.40  ? 676  ARG A CA    1 
ATOM   3184 C  C     . ARG B 2 380 ? -3.645  56.472 42.269  1.00 20.50  ? 676  ARG A C     1 
ATOM   3185 O  O     . ARG B 2 380 ? -3.865  57.500 41.629  1.00 19.69  ? 676  ARG A O     1 
ATOM   3186 C  CB    . ARG B 2 380 ? -5.549  54.847 42.232  1.00 18.59  ? 676  ARG A CB    1 
ATOM   3187 C  CG    . ARG B 2 380 ? -6.163  53.753 41.421  1.00 21.56  ? 676  ARG A CG    1 
ATOM   3188 C  CD    . ARG B 2 380 ? -7.468  53.289 42.001  1.00 23.55  ? 676  ARG A CD    1 
ATOM   3189 N  NE    . ARG B 2 380 ? -8.084  52.345 41.085  1.00 29.72  ? 676  ARG A NE    1 
ATOM   3190 C  CZ    . ARG B 2 380 ? -9.145  51.620 41.391  1.00 33.41  ? 676  ARG A CZ    1 
ATOM   3191 N  NH1   . ARG B 2 380 ? -9.695  51.741 42.594  1.00 30.81  ? 676  ARG A NH1   1 
ATOM   3192 N  NH2   . ARG B 2 380 ? -9.658  50.794 40.494  1.00 27.06  ? 676  ARG A NH2   1 
ATOM   3193 N  N     . ARG B 2 381 ? -2.967  56.478 43.415  1.00 19.92  ? 677  ARG A N     1 
ATOM   3194 C  CA    . ARG B 2 381 ? -2.352  57.684 43.953  1.00 16.84  ? 677  ARG A CA    1 
ATOM   3195 C  C     . ARG B 2 381 ? -0.951  57.914 43.400  1.00 16.41  ? 677  ARG A C     1 
ATOM   3196 O  O     . ARG B 2 381 ? -0.300  58.883 43.790  1.00 21.94  ? 677  ARG A O     1 
ATOM   3197 C  CB    . ARG B 2 381 ? -2.288  57.629 45.482  1.00 17.53  ? 677  ARG A CB    1 
ATOM   3198 C  CG    . ARG B 2 381 ? -3.633  57.512 46.180  1.00 19.73  ? 677  ARG A CG    1 
ATOM   3199 C  CD    . ARG B 2 381 ? -3.504  57.214 47.686  1.00 23.79  ? 677  ARG A CD    1 
ATOM   3200 N  NE    . ARG B 2 381 ? -2.671  58.213 48.334  1.00 27.35  ? 677  ARG A NE    1 
ATOM   3201 C  CZ    . ARG B 2 381 ? -2.186  58.111 49.567  1.00 34.62  ? 677  ARG A CZ    1 
ATOM   3202 N  NH1   . ARG B 2 381 ? -2.455  57.047 50.312  1.00 30.28  ? 677  ARG A NH1   1 
ATOM   3203 N  NH2   . ARG B 2 381 ? -1.434  59.090 50.053  1.00 33.14  ? 677  ARG A NH2   1 
ATOM   3204 N  N     . ASP B 2 382 ? -0.468  57.035 42.526  1.00 19.66  ? 678  ASP A N     1 
ATOM   3205 C  CA    . ASP B 2 382 ? 0.891   57.117 41.979  1.00 26.93  ? 678  ASP A CA    1 
ATOM   3206 C  C     . ASP B 2 382 ? 1.932   57.280 43.085  1.00 27.02  ? 678  ASP A C     1 
ATOM   3207 O  O     . ASP B 2 382 ? 2.869   58.078 42.976  1.00 21.75  ? 678  ASP A O     1 
ATOM   3208 C  CB    . ASP B 2 382 ? 1.033   58.239 40.942  1.00 32.14  ? 678  ASP A CB    1 
ATOM   3209 C  CG    . ASP B 2 382 ? 2.208   57.994 39.976  1.00 42.36  ? 678  ASP A CG    1 
ATOM   3210 O  OD1   . ASP B 2 382 ? 2.552   56.809 39.729  1.00 42.70  ? 678  ASP A OD1   1 
ATOM   3211 O  OD2   . ASP B 2 382 ? 2.794   58.972 39.471  1.00 43.18  ? 678  ASP A OD2   1 
ATOM   3212 N  N     . LEU B 2 383 ? 1.778   56.501 44.154  1.00 27.21  ? 679  LEU A N     1 
ATOM   3213 C  CA    . LEU B 2 383 ? 2.751   56.523 45.235  1.00 25.59  ? 679  LEU A CA    1 
ATOM   3214 C  C     . LEU B 2 383 ? 4.043   55.824 44.820  1.00 24.58  ? 679  LEU A C     1 
ATOM   3215 O  O     . LEU B 2 383 ? 4.094   55.068 43.850  1.00 29.45  ? 679  LEU A O     1 
ATOM   3216 C  CB    . LEU B 2 383 ? 2.189   55.838 46.479  1.00 26.15  ? 679  LEU A CB    1 
ATOM   3217 C  CG    . LEU B 2 383 ? 0.869   56.402 46.968  1.00 25.14  ? 679  LEU A CG    1 
ATOM   3218 C  CD1   . LEU B 2 383 ? 0.453   55.725 48.277  1.00 32.76  ? 679  LEU A CD1   1 
ATOM   3219 C  CD2   . LEU B 2 383 ? 1.043   57.902 47.144  1.00 30.79  ? 679  LEU A CD2   1 
ATOM   3220 N  N     . ASP B 2 384 ? 5.103   56.096 45.571  1.00 21.95  ? 680  ASP A N     1 
ATOM   3221 C  CA    . ASP B 2 384 ? 6.284   55.246 45.522  1.00 25.26  ? 680  ASP A CA    1 
ATOM   3222 C  C     . ASP B 2 384 ? 5.906   53.918 46.175  1.00 16.50  ? 680  ASP A C     1 
ATOM   3223 O  O     . ASP B 2 384 ? 5.637   53.870 47.379  1.00 18.67  ? 680  ASP A O     1 
ATOM   3224 C  CB    . ASP B 2 384 ? 7.447   55.930 46.239  1.00 30.91  ? 680  ASP A CB    1 
ATOM   3225 C  CG    . ASP B 2 384 ? 8.757   55.152 46.120  1.00 44.90  ? 680  ASP A CG    1 
ATOM   3226 O  OD1   . ASP B 2 384 ? 8.750   53.918 46.323  1.00 38.51  ? 680  ASP A OD1   1 
ATOM   3227 O  OD2   . ASP B 2 384 ? 9.802   55.783 45.830  1.00 47.73  ? 680  ASP A OD2   1 
ATOM   3228 N  N     . ILE B 2 385 ? 5.838   52.851 45.381  1.00 15.57  ? 681  ILE A N     1 
ATOM   3229 C  CA    . ILE B 2 385 ? 5.241   51.626 45.890  1.00 21.41  ? 681  ILE A CA    1 
ATOM   3230 C  C     . ILE B 2 385 ? 6.095   51.033 46.996  1.00 16.09  ? 681  ILE A C     1 
ATOM   3231 O  O     . ILE B 2 385 ? 5.572   50.416 47.928  1.00 24.61  ? 681  ILE A O     1 
ATOM   3232 C  CB    . ILE B 2 385 ? 5.013   50.619 44.745  1.00 14.75  ? 681  ILE A CB    1 
ATOM   3233 C  CG1   . ILE B 2 385 ? 4.290   49.367 45.256  1.00 18.77  ? 681  ILE A CG1   1 
ATOM   3234 C  CG2   . ILE B 2 385 ? 6.337   50.202 44.107  1.00 20.37  ? 681  ILE A CG2   1 
ATOM   3235 C  CD1   . ILE B 2 385 ? 2.946   49.629 45.892  1.00 25.73  ? 681  ILE A CD1   1 
ATOM   3236 N  N     . HIS B 2 386 ? 7.416   51.196 46.917  1.00 16.26  ? 682  HIS A N     1 
ATOM   3237 C  CA    . HIS B 2 386 ? 8.270   50.597 47.936  1.00 21.53  ? 682  HIS A CA    1 
ATOM   3238 C  C     . HIS B 2 386 ? 8.125   51.337 49.252  1.00 19.01  ? 682  HIS A C     1 
ATOM   3239 O  O     . HIS B 2 386 ? 8.045   50.718 50.313  1.00 18.41  ? 682  HIS A O     1 
ATOM   3240 C  CB    . HIS B 2 386 ? 9.718   50.581 47.462  1.00 16.93  ? 682  HIS A CB    1 
ATOM   3241 C  CG    . HIS B 2 386 ? 9.900   49.819 46.193  1.00 21.44  ? 682  HIS A CG    1 
ATOM   3242 N  ND1   . HIS B 2 386 ? 9.266   48.616 45.971  1.00 17.90  ? 682  HIS A ND1   1 
ATOM   3243 C  CD2   . HIS B 2 386 ? 10.580  50.107 45.056  1.00 18.37  ? 682  HIS A CD2   1 
ATOM   3244 C  CE1   . HIS B 2 386 ? 9.583   48.170 44.768  1.00 19.72  ? 682  HIS A CE1   1 
ATOM   3245 N  NE2   . HIS B 2 386 ? 10.373  49.061 44.189  1.00 23.88  ? 682  HIS A NE2   1 
ATOM   3246 N  N     . THR B 2 387 ? 8.027   52.661 49.193  1.00 18.00  ? 683  THR A N     1 
ATOM   3247 C  CA    . THR B 2 387 ? 7.794   53.419 50.410  1.00 22.87  ? 683  THR A CA    1 
ATOM   3248 C  C     . THR B 2 387 ? 6.448   53.073 51.021  1.00 19.07  ? 683  THR A C     1 
ATOM   3249 O  O     . THR B 2 387 ? 6.339   52.844 52.231  1.00 21.76  ? 683  THR A O     1 
ATOM   3250 C  CB    . THR B 2 387 ? 7.888   54.900 50.094  1.00 20.37  ? 683  THR A CB    1 
ATOM   3251 O  OG1   . THR B 2 387 ? 9.226   55.174 49.677  1.00 23.32  ? 683  THR A OG1   1 
ATOM   3252 C  CG2   . THR B 2 387 ? 7.516   55.717 51.320  1.00 20.10  ? 683  THR A CG2   1 
ATOM   3253 N  N     . LYS B 2 388 ? 5.403   53.034 50.191  1.00 18.96  ? 684  LYS A N     1 
ATOM   3254 C  CA    . LYS B 2 388 ? 4.080   52.690 50.696  1.00 20.64  ? 684  LYS A CA    1 
ATOM   3255 C  C     . LYS B 2 388 ? 4.043   51.263 51.225  1.00 18.64  ? 684  LYS A C     1 
ATOM   3256 O  O     . LYS B 2 388 ? 3.337   50.974 52.197  1.00 20.64  ? 684  LYS A O     1 
ATOM   3257 C  CB    . LYS B 2 388 ? 3.035   52.854 49.597  1.00 24.25  ? 684  LYS A CB    1 
ATOM   3258 C  CG    . LYS B 2 388 ? 1.638   52.515 50.071  1.00 27.64  ? 684  LYS A CG    1 
ATOM   3259 C  CD    . LYS B 2 388 ? 1.184   53.489 51.159  1.00 34.16  ? 684  LYS A CD    1 
ATOM   3260 C  CE    . LYS B 2 388 ? -0.307  53.338 51.457  1.00 46.98  ? 684  LYS A CE    1 
ATOM   3261 N  NZ    . LYS B 2 388 ? -0.834  54.496 52.244  1.00 49.76  ? 684  LYS A NZ    1 
ATOM   3262 N  N     . THR B 2 389 ? 4.762   50.346 50.579  1.00 18.08  ? 685  THR A N     1 
ATOM   3263 C  CA    . THR B 2 389 ? 4.821   48.996 51.118  1.00 18.26  ? 685  THR A CA    1 
ATOM   3264 C  C     . THR B 2 389 ? 5.499   48.984 52.486  1.00 21.97  ? 685  THR A C     1 
ATOM   3265 O  O     . THR B 2 389 ? 5.070   48.255 53.384  1.00 20.34  ? 685  THR A O     1 
ATOM   3266 C  CB    . THR B 2 389 ? 5.536   48.063 50.148  1.00 17.56  ? 685  THR A CB    1 
ATOM   3267 O  OG1   . THR B 2 389 ? 4.790   48.005 48.926  1.00 21.68  ? 685  THR A OG1   1 
ATOM   3268 C  CG2   . THR B 2 389 ? 5.612   46.645 50.732  1.00 17.85  ? 685  THR A CG2   1 
ATOM   3269 N  N     . ALA B 2 390 ? 6.565   49.773 52.655  1.00 19.66  ? 686  ALA A N     1 
ATOM   3270 C  CA    . ALA B 2 390 ? 7.211   49.878 53.961  1.00 20.79  ? 686  ALA A CA    1 
ATOM   3271 C  C     . ALA B 2 390 ? 6.250   50.439 55.000  1.00 24.68  ? 686  ALA A C     1 
ATOM   3272 O  O     . ALA B 2 390 ? 6.146   49.912 56.113  1.00 24.06  ? 686  ALA A O     1 
ATOM   3273 C  CB    . ALA B 2 390 ? 8.460   50.758 53.873  1.00 22.54  ? 686  ALA A CB    1 
ATOM   3274 N  N     . MET B 2 391 ? 5.544   51.517 54.651  1.00 23.71  ? 687  MET A N     1 
ATOM   3275 C  CA    . MET B 2 391 ? 4.603   52.128 55.584  1.00 26.60  ? 687  MET A CA    1 
ATOM   3276 C  C     . MET B 2 391 ? 3.599   51.108 56.078  1.00 29.27  ? 687  MET A C     1 
ATOM   3277 O  O     . MET B 2 391 ? 3.327   51.025 57.278  1.00 31.91  ? 687  MET A O     1 
ATOM   3278 C  CB    . MET B 2 391 ? 3.874   53.295 54.922  1.00 24.57  ? 687  MET A CB    1 
ATOM   3279 C  CG    . MET B 2 391 ? 4.719   54.509 54.756  1.00 32.24  ? 687  MET A CG    1 
ATOM   3280 S  SD    . MET B 2 391 ? 4.028   55.668 53.574  1.00 33.29  ? 687  MET A SD    1 
ATOM   3281 C  CE    . MET B 2 391 ? 2.416   55.983 54.311  1.00 30.19  ? 687  MET A CE    1 
ATOM   3282 N  N     . ASP B 2 392 ? 3.081   50.290 55.165  1.00 23.76  ? 688  ASP A N     1 
ATOM   3283 C  CA    . ASP B 2 392 ? 2.070   49.303 55.515  1.00 27.34  ? 688  ASP A CA    1 
ATOM   3284 C  C     . ASP B 2 392 ? 2.661   48.176 56.352  1.00 31.82  ? 688  ASP A C     1 
ATOM   3285 O  O     . ASP B 2 392 ? 2.091   47.786 57.378  1.00 32.86  ? 688  ASP A O     1 
ATOM   3286 C  CB    . ASP B 2 392 ? 1.435   48.749 54.238  1.00 34.74  ? 688  ASP A CB    1 
ATOM   3287 C  CG    . ASP B 2 392 ? 0.511   49.752 53.559  1.00 48.85  ? 688  ASP A CG    1 
ATOM   3288 O  OD1   . ASP B 2 392 ? 0.121   50.752 54.198  1.00 52.67  ? 688  ASP A OD1   1 
ATOM   3289 O  OD2   . ASP B 2 392 ? 0.184   49.543 52.373  1.00 55.64  ? 688  ASP A OD2   1 
ATOM   3290 N  N     . ILE B 2 393 ? 3.796   47.625 55.923  1.00 25.81  ? 689  ILE A N     1 
ATOM   3291 C  CA    . ILE B 2 393 ? 4.348   46.462 56.610  1.00 32.44  ? 689  ILE A CA    1 
ATOM   3292 C  C     . ILE B 2 393 ? 4.771   46.836 58.022  1.00 34.28  ? 689  ILE A C     1 
ATOM   3293 O  O     . ILE B 2 393 ? 4.450   46.140 58.989  1.00 43.35  ? 689  ILE A O     1 
ATOM   3294 C  CB    . ILE B 2 393 ? 5.522   45.865 55.816  1.00 38.10  ? 689  ILE A CB    1 
ATOM   3295 C  CG1   . ILE B 2 393 ? 5.026   45.087 54.606  1.00 32.13  ? 689  ILE A CG1   1 
ATOM   3296 C  CG2   . ILE B 2 393 ? 6.343   44.937 56.695  1.00 48.36  ? 689  ILE A CG2   1 
ATOM   3297 C  CD1   . ILE B 2 393 ? 6.168   44.655 53.720  1.00 38.16  ? 689  ILE A CD1   1 
ATOM   3298 N  N     . PHE B 2 394 ? 5.489   47.943 58.163  1.00 26.71  ? 690  PHE A N     1 
ATOM   3299 C  CA    . PHE B 2 394 ? 5.999   48.369 59.456  1.00 34.46  ? 690  PHE A CA    1 
ATOM   3300 C  C     . PHE B 2 394 ? 5.034   49.270 60.209  1.00 40.75  ? 690  PHE A C     1 
ATOM   3301 O  O     . PHE B 2 394 ? 5.344   49.665 61.335  1.00 44.97  ? 690  PHE A O     1 
ATOM   3302 C  CB    . PHE B 2 394 ? 7.343   49.078 59.280  1.00 26.43  ? 690  PHE A CB    1 
ATOM   3303 C  CG    . PHE B 2 394 ? 8.369   48.245 58.570  1.00 31.70  ? 690  PHE A CG    1 
ATOM   3304 C  CD1   . PHE B 2 394 ? 8.800   48.581 57.291  1.00 31.10  ? 690  PHE A CD1   1 
ATOM   3305 C  CD2   . PHE B 2 394 ? 8.884   47.111 59.168  1.00 39.24  ? 690  PHE A CD2   1 
ATOM   3306 C  CE1   . PHE B 2 394 ? 9.733   47.803 56.628  1.00 32.11  ? 690  PHE A CE1   1 
ATOM   3307 C  CE2   . PHE B 2 394 ? 9.814   46.331 58.511  1.00 40.68  ? 690  PHE A CE2   1 
ATOM   3308 C  CZ    . PHE B 2 394 ? 10.239  46.678 57.240  1.00 39.64  ? 690  PHE A CZ    1 
ATOM   3309 N  N     . GLN B 2 395 ? 3.880   49.596 59.628  1.00 37.63  ? 691  GLN A N     1 
ATOM   3310 C  CA    . GLN B 2 395 ? 2.860   50.397 60.302  1.00 47.10  ? 691  GLN A CA    1 
ATOM   3311 C  C     . GLN B 2 395 ? 3.440   51.718 60.803  1.00 46.23  ? 691  GLN A C     1 
ATOM   3312 O  O     . GLN B 2 395 ? 3.338   52.063 61.981  1.00 45.17  ? 691  GLN A O     1 
ATOM   3313 C  CB    . GLN B 2 395 ? 2.220   49.619 61.455  1.00 53.61  ? 691  GLN A CB    1 
ATOM   3314 C  CG    . GLN B 2 395 ? 1.336   48.471 61.014  1.00 64.78  ? 691  GLN A CG    1 
ATOM   3315 C  CD    . GLN B 2 395 ? 1.291   47.348 62.036  1.00 80.46  ? 691  GLN A CD    1 
ATOM   3316 O  OE1   . GLN B 2 395 ? 2.126   47.281 62.941  1.00 87.80  ? 691  GLN A OE1   1 
ATOM   3317 N  NE2   . GLN B 2 395 ? 0.312   46.460 61.897  1.00 82.85  ? 691  GLN A NE2   1 
ATOM   3318 N  N     . VAL B 2 396 ? 4.081   52.454 59.896  1.00 34.66  ? 692  VAL A N     1 
ATOM   3319 C  CA    . VAL B 2 396 ? 4.649   53.755 60.211  1.00 33.26  ? 692  VAL A CA    1 
ATOM   3320 C  C     . VAL B 2 396 ? 4.167   54.754 59.169  1.00 41.79  ? 692  VAL A C     1 
ATOM   3321 O  O     . VAL B 2 396 ? 3.586   54.389 58.148  1.00 43.26  ? 692  VAL A O     1 
ATOM   3322 C  CB    . VAL B 2 396 ? 6.194   53.731 60.266  1.00 38.42  ? 692  VAL A CB    1 
ATOM   3323 C  CG1   . VAL B 2 396 ? 6.692   52.566 61.129  1.00 33.39  ? 692  VAL A CG1   1 
ATOM   3324 C  CG2   . VAL B 2 396 ? 6.773   53.640 58.855  1.00 31.71  ? 692  VAL A CG2   1 
ATOM   3325 N  N     . SER B 2 397 ? 4.420   56.032 59.436  1.00 36.02  ? 693  SER A N     1 
ATOM   3326 C  CA    . SER B 2 397 ? 4.069   57.047 58.459  1.00 38.47  ? 693  SER A CA    1 
ATOM   3327 C  C     . SER B 2 397 ? 5.239   57.278 57.501  1.00 43.31  ? 693  SER A C     1 
ATOM   3328 O  O     . SER B 2 397 ? 6.365   56.826 57.729  1.00 40.03  ? 693  SER A O     1 
ATOM   3329 C  CB    . SER B 2 397 ? 3.671   58.339 59.156  1.00 43.63  ? 693  SER A CB    1 
ATOM   3330 O  OG    . SER B 2 397 ? 4.784   58.864 59.843  1.00 48.65  ? 693  SER A OG    1 
ATOM   3331 N  N     . GLU B 2 398 ? 4.959   58.007 56.418  1.00 44.11  ? 694  GLU A N     1 
ATOM   3332 C  CA    . GLU B 2 398 ? 5.949   58.182 55.358  1.00 43.23  ? 694  GLU A CA    1 
ATOM   3333 C  C     . GLU B 2 398 ? 7.237   58.817 55.874  1.00 43.88  ? 694  GLU A C     1 
ATOM   3334 O  O     . GLU B 2 398 ? 8.335   58.446 55.440  1.00 39.32  ? 694  GLU A O     1 
ATOM   3335 C  CB    . GLU B 2 398 ? 5.364   59.023 54.227  1.00 42.55  ? 694  GLU A CB    1 
ATOM   3336 C  CG    . GLU B 2 398 ? 6.320   59.210 53.056  1.00 46.66  ? 694  GLU A CG    1 
ATOM   3337 C  CD    . GLU B 2 398 ? 5.625   59.749 51.820  1.00 62.85  ? 694  GLU A CD    1 
ATOM   3338 O  OE1   . GLU B 2 398 ? 6.246   59.734 50.736  1.00 71.48  ? 694  GLU A OE1   1 
ATOM   3339 O  OE2   . GLU B 2 398 ? 4.457   60.184 51.934  1.00 66.98  ? 694  GLU A OE2   1 
ATOM   3340 N  N     . ASP B 2 399 ? 7.127   59.785 56.788  1.00 41.91  ? 695  ASP A N     1 
ATOM   3341 C  CA    . ASP B 2 399 ? 8.321   60.411 57.346  1.00 43.51  ? 695  ASP A CA    1 
ATOM   3342 C  C     . ASP B 2 399 ? 9.121   59.458 58.228  1.00 40.06  ? 695  ASP A C     1 
ATOM   3343 O  O     . ASP B 2 399 ? 10.291  59.732 58.518  1.00 41.64  ? 695  ASP A O     1 
ATOM   3344 C  CB    . ASP B 2 399 ? 7.937   61.655 58.154  1.00 55.10  ? 695  ASP A CB    1 
ATOM   3345 C  CG    . ASP B 2 399 ? 7.072   61.320 59.357  1.00 69.76  ? 695  ASP A CG    1 
ATOM   3346 O  OD1   . ASP B 2 399 ? 6.414   60.259 59.329  1.00 75.84  ? 695  ASP A OD1   1 
ATOM   3347 O  OD2   . ASP B 2 399 ? 7.054   62.107 60.330  1.00 77.44  ? 695  ASP A OD2   1 
ATOM   3348 N  N     . GLU B 2 400 ? 8.515   58.365 58.678  1.00 35.41  ? 696  GLU A N     1 
ATOM   3349 C  CA    . GLU B 2 400 ? 9.187   57.410 59.545  1.00 35.86  ? 696  GLU A CA    1 
ATOM   3350 C  C     . GLU B 2 400 ? 9.828   56.267 58.771  1.00 39.45  ? 696  GLU A C     1 
ATOM   3351 O  O     . GLU B 2 400 ? 10.447  55.391 59.382  1.00 35.92  ? 696  GLU A O     1 
ATOM   3352 C  CB    . GLU B 2 400 ? 8.199   56.850 60.578  1.00 43.34  ? 696  GLU A CB    1 
ATOM   3353 C  CG    . GLU B 2 400 ? 7.942   57.782 61.767  1.00 58.31  ? 696  GLU A CG    1 
ATOM   3354 C  CD    . GLU B 2 400 ? 6.487   57.785 62.228  1.00 74.20  ? 696  GLU A CD    1 
ATOM   3355 O  OE1   . GLU B 2 400 ? 5.975   58.873 62.583  1.00 81.75  ? 696  GLU A OE1   1 
ATOM   3356 O  OE2   . GLU B 2 400 ? 5.855   56.704 62.245  1.00 77.80  ? 696  GLU A OE2   1 
ATOM   3357 N  N     . VAL B 2 401 ? 9.700   56.244 57.450  1.00 32.10  ? 697  VAL A N     1 
ATOM   3358 C  CA    . VAL B 2 401 ? 10.300  55.171 56.670  1.00 29.17  ? 697  VAL A CA    1 
ATOM   3359 C  C     . VAL B 2 401 ? 11.777  55.477 56.491  1.00 27.53  ? 697  VAL A C     1 
ATOM   3360 O  O     . VAL B 2 401 ? 12.146  56.486 55.884  1.00 28.49  ? 697  VAL A O     1 
ATOM   3361 C  CB    . VAL B 2 401 ? 9.596   54.990 55.318  1.00 30.31  ? 697  VAL A CB    1 
ATOM   3362 C  CG1   . VAL B 2 401 ? 10.294  53.898 54.515  1.00 22.79  ? 697  VAL A CG1   1 
ATOM   3363 C  CG2   . VAL B 2 401 ? 8.154   54.589 55.549  1.00 31.08  ? 697  VAL A CG2   1 
ATOM   3364 N  N     . THR B 2 402 ? 12.615  54.623 57.035  1.00 27.97  ? 698  THR A N     1 
ATOM   3365 C  CA    . THR B 2 402 ? 14.051  54.772 56.908  1.00 26.14  ? 698  THR A CA    1 
ATOM   3366 C  C     . THR B 2 402 ? 14.511  54.106 55.619  1.00 25.04  ? 698  THR A C     1 
ATOM   3367 O  O     . THR B 2 402 ? 13.780  53.302 55.028  1.00 24.07  ? 698  THR A O     1 
ATOM   3368 C  CB    . THR B 2 402 ? 14.753  54.144 58.122  1.00 27.40  ? 698  THR A CB    1 
ATOM   3369 O  OG1   . THR B 2 402 ? 14.454  52.741 58.145  1.00 30.84  ? 698  THR A OG1   1 
ATOM   3370 C  CG2   . THR B 2 402 ? 14.261  54.774 59.412  1.00 28.58  ? 698  THR A CG2   1 
ATOM   3371 N  N     . PRO B 2 403 ? 15.701  54.454 55.126  1.00 25.21  ? 699  PRO A N     1 
ATOM   3372 C  CA    . PRO B 2 403 ? 16.173  53.818 53.890  1.00 24.27  ? 699  PRO A CA    1 
ATOM   3373 C  C     . PRO B 2 403 ? 16.206  52.300 53.993  1.00 24.09  ? 699  PRO A C     1 
ATOM   3374 O  O     . PRO B 2 403 ? 15.889  51.612 53.020  1.00 24.72  ? 699  PRO A O     1 
ATOM   3375 C  CB    . PRO B 2 403 ? 17.571  54.424 53.706  1.00 24.95  ? 699  PRO A CB    1 
ATOM   3376 C  CG    . PRO B 2 403 ? 17.467  55.785 54.323  1.00 25.72  ? 699  PRO A CG    1 
ATOM   3377 C  CD    . PRO B 2 403 ? 16.514  55.633 55.495  1.00 31.30  ? 699  PRO A CD    1 
ATOM   3378 N  N     . ASN B 2 404 ? 16.542  51.755 55.167  1.00 25.13  ? 700  ASN A N     1 
ATOM   3379 C  CA    . ASN B 2 404 ? 16.593  50.301 55.295  1.00 25.07  ? 700  ASN A CA    1 
ATOM   3380 C  C     . ASN B 2 404 ? 15.197  49.689 55.281  1.00 24.32  ? 700  ASN A C     1 
ATOM   3381 O  O     . ASN B 2 404 ? 15.004  48.586 54.756  1.00 23.69  ? 700  ASN A O     1 
ATOM   3382 C  CB    . ASN B 2 404 ? 17.341  49.880 56.567  1.00 26.52  ? 700  ASN A CB    1 
ATOM   3383 C  CG    . ASN B 2 404 ? 17.773  48.419 56.508  1.00 26.59  ? 700  ASN A CG    1 
ATOM   3384 O  OD1   . ASN B 2 404 ? 18.242  47.954 55.472  1.00 27.97  ? 700  ASN A OD1   1 
ATOM   3385 N  ND2   . ASN B 2 404 ? 17.579  47.691 57.592  1.00 27.43  ? 700  ASN A ND2   1 
ATOM   3386 N  N     . MET B 2 405 ? 14.214  50.372 55.871  1.00 28.99  ? 701  MET A N     1 
ATOM   3387 C  CA    . MET B 2 405 ? 12.847  49.875 55.777  1.00 23.80  ? 701  MET A CA    1 
ATOM   3388 C  C     . MET B 2 405 ? 12.386  49.844 54.335  1.00 22.42  ? 701  MET A C     1 
ATOM   3389 O  O     . MET B 2 405 ? 11.724  48.898 53.912  1.00 22.47  ? 701  MET A O     1 
ATOM   3390 C  CB    . MET B 2 405 ? 11.895  50.729 56.601  1.00 24.30  ? 701  MET A CB    1 
ATOM   3391 C  CG    . MET B 2 405 ? 11.999  50.480 58.065  1.00 41.01  ? 701  MET A CG    1 
ATOM   3392 S  SD    . MET B 2 405 ? 11.419  51.918 58.956  1.00 47.42  ? 701  MET A SD    1 
ATOM   3393 C  CE    . MET B 2 405 ? 9.680   51.632 58.899  1.00 30.49  ? 701  MET A CE    1 
ATOM   3394 N  N     . ARG B 2 406 ? 12.716  50.881 53.569  1.00 22.06  ? 702  ARG A N     1 
ATOM   3395 C  CA    . ARG B 2 406 ? 12.326  50.894 52.171  1.00 20.86  ? 702  ARG A CA    1 
ATOM   3396 C  C     . ARG B 2 406 ? 13.055  49.804 51.400  1.00 20.41  ? 702  ARG A C     1 
ATOM   3397 O  O     . ARG B 2 406 ? 12.476  49.179 50.515  1.00 19.51  ? 702  ARG A O     1 
ATOM   3398 C  CB    . ARG B 2 406 ? 12.608  52.256 51.553  1.00 20.73  ? 702  ARG A CB    1 
ATOM   3399 C  CG    . ARG B 2 406 ? 12.058  52.381 50.132  1.00 19.57  ? 702  ARG A CG    1 
ATOM   3400 C  CD    . ARG B 2 406 ? 12.471  53.724 49.532  1.00 24.47  ? 702  ARG A CD    1 
ATOM   3401 N  NE    . ARG B 2 406 ? 11.966  53.920 48.175  1.00 20.95  ? 702  ARG A NE    1 
ATOM   3402 C  CZ    . ARG B 2 406 ? 12.504  53.390 47.087  1.00 22.26  ? 702  ARG A CZ    1 
ATOM   3403 N  NH1   . ARG B 2 406 ? 13.559  52.597 47.168  1.00 26.35  ? 702  ARG A NH1   1 
ATOM   3404 N  NH2   . ARG B 2 406 ? 11.969  53.657 45.908  1.00 24.65  ? 702  ARG A NH2   1 
ATOM   3405 N  N     . ARG B 2 407 ? 14.320  49.562 51.740  1.00 21.13  ? 703  ARG A N     1 
ATOM   3406 C  CA    . ARG B 2 407 ? 15.095  48.518 51.082  1.00 23.04  ? 703  ARG A CA    1 
ATOM   3407 C  C     . ARG B 2 407 ? 14.448  47.154 51.278  1.00 21.91  ? 703  ARG A C     1 
ATOM   3408 O  O     . ARG B 2 407 ? 14.299  46.382 50.328  1.00 20.80  ? 703  ARG A O     1 
ATOM   3409 C  CB    . ARG B 2 407 ? 16.521  48.516 51.629  1.00 26.48  ? 703  ARG A CB    1 
ATOM   3410 C  CG    . ARG B 2 407 ? 17.358  47.275 51.290  1.00 31.18  ? 703  ARG A CG    1 
ATOM   3411 C  CD    . ARG B 2 407 ? 18.839  47.503 51.661  1.00 31.12  ? 703  ARG A CD    1 
ATOM   3412 N  NE    . ARG B 2 407 ? 19.281  48.826 51.209  1.00 37.17  ? 703  ARG A NE    1 
ATOM   3413 C  CZ    . ARG B 2 407 ? 19.513  49.868 52.012  1.00 44.59  ? 703  ARG A CZ    1 
ATOM   3414 N  NH1   . ARG B 2 407 ? 19.363  49.746 53.326  1.00 37.06  ? 703  ARG A NH1   1 
ATOM   3415 N  NH2   . ARG B 2 407 ? 19.894  51.037 51.504  1.00 36.18  ? 703  ARG A NH2   1 
ATOM   3416 N  N     . GLN B 2 408 ? 14.041  46.848 52.507  1.00 21.39  ? 704  GLN A N     1 
ATOM   3417 C  CA    . GLN B 2 408 ? 13.412  45.565 52.763  1.00 21.30  ? 704  GLN A CA    1 
ATOM   3418 C  C     . GLN B 2 408 ? 12.065  45.451 52.067  1.00 20.26  ? 704  GLN A C     1 
ATOM   3419 O  O     . GLN B 2 408 ? 11.739  44.395 51.516  1.00 21.38  ? 704  GLN A O     1 
ATOM   3420 C  CB    . GLN B 2 408 ? 13.279  45.370 54.262  1.00 31.63  ? 704  GLN A CB    1 
ATOM   3421 C  CG    . GLN B 2 408 ? 14.635  45.458 54.923  1.00 35.72  ? 704  GLN A CG    1 
ATOM   3422 C  CD    . GLN B 2 408 ? 14.655  44.774 56.239  1.00 46.04  ? 704  GLN A CD    1 
ATOM   3423 O  OE1   . GLN B 2 408 ? 13.956  45.182 57.159  1.00 50.34  ? 704  GLN A OE1   1 
ATOM   3424 N  NE2   . GLN B 2 408 ? 15.446  43.711 56.347  1.00 42.19  ? 704  GLN A NE2   1 
ATOM   3425 N  N     . ALA B 2 409 ? 11.265  46.520 52.087  1.00 20.04  ? 705  ALA A N     1 
ATOM   3426 C  CA    . ALA B 2 409 ? 10.007  46.499 51.353  1.00 19.13  ? 705  ALA A CA    1 
ATOM   3427 C  C     . ALA B 2 409 ? 10.261  46.300 49.869  1.00 21.64  ? 705  ALA A C     1 
ATOM   3428 O  O     . ALA B 2 409 ? 9.532   45.568 49.189  1.00 19.37  ? 705  ALA A O     1 
ATOM   3429 C  CB    . ALA B 2 409 ? 9.234   47.799 51.593  1.00 19.18  ? 705  ALA A CB    1 
ATOM   3430 N  N     . LYS B 2 410 ? 11.296  46.948 49.348  1.00 22.48  ? 706  LYS A N     1 
ATOM   3431 C  CA    . LYS B 2 410 ? 11.615  46.789 47.943  1.00 17.39  ? 706  LYS A CA    1 
ATOM   3432 C  C     . LYS B 2 410 ? 11.997  45.346 47.640  1.00 26.03  ? 706  LYS A C     1 
ATOM   3433 O  O     . LYS B 2 410 ? 11.599  44.793 46.608  1.00 20.45  ? 706  LYS A O     1 
ATOM   3434 C  CB    . LYS B 2 410 ? 12.741  47.749 47.566  1.00 17.61  ? 706  LYS A CB    1 
ATOM   3435 C  CG    . LYS B 2 410 ? 13.059  47.770 46.079  1.00 19.31  ? 706  LYS A CG    1 
ATOM   3436 C  CD    . LYS B 2 410 ? 14.312  48.576 45.825  1.00 29.03  ? 706  LYS A CD    1 
ATOM   3437 C  CE    . LYS B 2 410 ? 14.480  48.916 44.361  1.00 37.46  ? 706  LYS A CE    1 
ATOM   3438 N  NZ    . LYS B 2 410 ? 15.839  49.492 44.140  1.00 45.97  ? 706  LYS A NZ    1 
ATOM   3439 N  N     . ALA B 2 411 ? 12.757  44.713 48.538  1.00 18.12  ? 707  ALA A N     1 
ATOM   3440 C  CA    . ALA B 2 411 ? 13.117  43.311 48.340  1.00 18.17  ? 707  ALA A CA    1 
ATOM   3441 C  C     . ALA B 2 411 ? 11.891  42.409 48.368  1.00 24.71  ? 707  ALA A C     1 
ATOM   3442 O  O     . ALA B 2 411 ? 11.828  41.413 47.642  1.00 24.36  ? 707  ALA A O     1 
ATOM   3443 C  CB    . ALA B 2 411 ? 14.124  42.864 49.405  1.00 19.29  ? 707  ALA A CB    1 
ATOM   3444 N  N     . VAL B 2 412 ? 10.916  42.718 49.220  1.00 22.61  ? 708  VAL A N     1 
ATOM   3445 C  CA    . VAL B 2 412 ? 9.694   41.924 49.235  1.00 17.67  ? 708  VAL A CA    1 
ATOM   3446 C  C     . VAL B 2 412 ? 8.950   42.094 47.917  1.00 17.40  ? 708  VAL A C     1 
ATOM   3447 O  O     . VAL B 2 412 ? 8.477   41.121 47.322  1.00 22.64  ? 708  VAL A O     1 
ATOM   3448 C  CB    . VAL B 2 412 ? 8.813   42.312 50.439  1.00 22.17  ? 708  VAL A CB    1 
ATOM   3449 C  CG1   . VAL B 2 412 ? 7.464   41.598 50.356  1.00 20.69  ? 708  VAL A CG1   1 
ATOM   3450 C  CG2   . VAL B 2 412 ? 9.532   41.999 51.758  1.00 23.37  ? 708  VAL A CG2   1 
ATOM   3451 N  N     . ASN B 2 413 ? 8.859   43.331 47.431  1.00 16.42  ? 709  ASN A N     1 
ATOM   3452 C  CA    . ASN B 2 413 ? 8.219   43.579 46.141  1.00 18.23  ? 709  ASN A CA    1 
ATOM   3453 C  C     . ASN B 2 413 ? 8.959   42.866 45.021  1.00 16.55  ? 709  ASN A C     1 
ATOM   3454 O  O     . ASN B 2 413 ? 8.337   42.263 44.139  1.00 17.42  ? 709  ASN A O     1 
ATOM   3455 C  CB    . ASN B 2 413 ? 8.155   45.084 45.870  1.00 15.25  ? 709  ASN A CB    1 
ATOM   3456 C  CG    . ASN B 2 413 ? 7.088   45.764 46.693  1.00 22.44  ? 709  ASN A CG    1 
ATOM   3457 O  OD1   . ASN B 2 413 ? 7.167   46.965 46.976  1.00 21.75  ? 709  ASN A OD1   1 
ATOM   3458 N  ND2   . ASN B 2 413 ? 6.085   44.996 47.100  1.00 15.57  ? 709  ASN A ND2   1 
ATOM   3459 N  N     . PHE B 2 414 ? 10.291  42.921 45.045  1.00 17.62  ? 710  PHE A N     1 
ATOM   3460 C  CA    . PHE B 2 414 ? 11.088  42.182 44.075  1.00 21.66  ? 710  PHE A CA    1 
ATOM   3461 C  C     . PHE B 2 414 ? 10.767  40.693 44.131  1.00 26.44  ? 710  PHE A C     1 
ATOM   3462 O  O     . PHE B 2 414 ? 10.614  40.046 43.089  1.00 24.67  ? 710  PHE A O     1 
ATOM   3463 C  CB    . PHE B 2 414 ? 12.576  42.432 44.341  1.00 26.25  ? 710  PHE A CB    1 
ATOM   3464 C  CG    . PHE B 2 414 ? 13.498  41.488 43.618  1.00 41.31  ? 710  PHE A CG    1 
ATOM   3465 C  CD1   . PHE B 2 414 ? 13.808  40.243 44.157  1.00 47.78  ? 710  PHE A CD1   1 
ATOM   3466 C  CD2   . PHE B 2 414 ? 14.077  41.853 42.410  1.00 46.87  ? 710  PHE A CD2   1 
ATOM   3467 C  CE1   . PHE B 2 414 ? 14.648  39.378 43.507  1.00 47.91  ? 710  PHE A CE1   1 
ATOM   3468 C  CE2   . PHE B 2 414 ? 14.930  40.983 41.754  1.00 48.16  ? 710  PHE A CE2   1 
ATOM   3469 C  CZ    . PHE B 2 414 ? 15.204  39.742 42.306  1.00 47.48  ? 710  PHE A CZ    1 
ATOM   3470 N  N     . GLY B 2 415 ? 10.663  40.138 45.342  1.00 20.14  ? 711  GLY A N     1 
ATOM   3471 C  CA    . GLY B 2 415 ? 10.349  38.723 45.489  1.00 21.92  ? 711  GLY A CA    1 
ATOM   3472 C  C     . GLY B 2 415 ? 9.012   38.345 44.880  1.00 30.42  ? 711  GLY A C     1 
ATOM   3473 O  O     . GLY B 2 415 ? 8.869   37.269 44.291  1.00 25.71  ? 711  GLY A O     1 
ATOM   3474 N  N     . ILE B 2 416 ? 8.016   39.224 45.005  1.00 27.25  ? 712  ILE A N     1 
ATOM   3475 C  CA    . ILE B 2 416 ? 6.736   38.981 44.345  1.00 26.91  ? 712  ILE A CA    1 
ATOM   3476 C  C     . ILE B 2 416 ? 6.890   39.036 42.829  1.00 24.18  ? 712  ILE A C     1 
ATOM   3477 O  O     . ILE B 2 416 ? 6.432   38.142 42.113  1.00 27.91  ? 712  ILE A O     1 
ATOM   3478 C  CB    . ILE B 2 416 ? 5.683   39.986 44.828  1.00 33.29  ? 712  ILE A CB    1 
ATOM   3479 C  CG1   . ILE B 2 416 ? 5.425   39.792 46.315  1.00 29.71  ? 712  ILE A CG1   1 
ATOM   3480 C  CG2   . ILE B 2 416 ? 4.396   39.819 44.031  1.00 41.37  ? 712  ILE A CG2   1 
ATOM   3481 C  CD1   . ILE B 2 416 ? 4.857   41.004 46.967  1.00 33.06  ? 712  ILE A CD1   1 
ATOM   3482 N  N     . VAL B 2 417 ? 7.538   40.087 42.321  1.00 20.52  ? 713  VAL A N     1 
ATOM   3483 C  CA    . VAL B 2 417 ? 7.639   40.295 40.879  1.00 21.85  ? 713  VAL A CA    1 
ATOM   3484 C  C     . VAL B 2 417 ? 8.332   39.115 40.206  1.00 25.10  ? 713  VAL A C     1 
ATOM   3485 O  O     . VAL B 2 417 ? 7.982   38.725 39.082  1.00 23.58  ? 713  VAL A O     1 
ATOM   3486 C  CB    . VAL B 2 417 ? 8.372   41.618 40.589  1.00 18.47  ? 713  VAL A CB    1 
ATOM   3487 C  CG1   . VAL B 2 417 ? 8.792   41.725 39.102  1.00 23.80  ? 713  VAL A CG1   1 
ATOM   3488 C  CG2   . VAL B 2 417 ? 7.498   42.819 41.009  1.00 22.39  ? 713  VAL A CG2   1 
ATOM   3489 N  N     . TYR B 2 418 ? 9.332   38.537 40.868  1.00 21.23  ? 714  TYR A N     1 
ATOM   3490 C  CA    . TYR B 2 418 ? 10.102  37.448 40.280  1.00 21.73  ? 714  TYR A CA    1 
ATOM   3491 C  C     . TYR B 2 418 ? 9.811   36.102 40.924  1.00 25.34  ? 714  TYR A C     1 
ATOM   3492 O  O     . TYR B 2 418 ? 10.449  35.109 40.574  1.00 34.09  ? 714  TYR A O     1 
ATOM   3493 C  CB    . TYR B 2 418 ? 11.588  37.771 40.336  1.00 23.73  ? 714  TYR A CB    1 
ATOM   3494 C  CG    . TYR B 2 418 ? 11.923  38.975 39.490  1.00 34.00  ? 714  TYR A CG    1 
ATOM   3495 C  CD1   . TYR B 2 418 ? 11.862  38.918 38.100  1.00 39.82  ? 714  TYR A CD1   1 
ATOM   3496 C  CD2   . TYR B 2 418 ? 12.262  40.183 40.081  1.00 38.32  ? 714  TYR A CD2   1 
ATOM   3497 C  CE1   . TYR B 2 418 ? 12.152  40.042 37.327  1.00 43.39  ? 714  TYR A CE1   1 
ATOM   3498 C  CE2   . TYR B 2 418 ? 12.558  41.299 39.326  1.00 43.43  ? 714  TYR A CE2   1 
ATOM   3499 C  CZ    . TYR B 2 418 ? 12.505  41.229 37.954  1.00 45.04  ? 714  TYR A CZ    1 
ATOM   3500 O  OH    . TYR B 2 418 ? 12.803  42.364 37.231  1.00 48.32  ? 714  TYR A OH    1 
ATOM   3501 N  N     . GLY B 2 419 ? 8.831   36.040 41.816  1.00 20.72  ? 715  GLY A N     1 
ATOM   3502 C  CA    . GLY B 2 419 ? 8.399   34.787 42.399  1.00 25.44  ? 715  GLY A CA    1 
ATOM   3503 C  C     . GLY B 2 419 ? 9.479   34.010 43.128  1.00 33.65  ? 715  GLY A C     1 
ATOM   3504 O  O     . GLY B 2 419 ? 9.606   32.802 42.919  1.00 31.17  ? 715  GLY A O     1 
ATOM   3505 N  N     . ILE B 2 420 ? 10.267  34.671 43.982  1.00 28.25  ? 716  ILE A N     1 
ATOM   3506 C  CA    . ILE B 2 420 ? 11.316  33.956 44.711  1.00 28.38  ? 716  ILE A CA    1 
ATOM   3507 C  C     . ILE B 2 420 ? 10.737  33.321 45.972  1.00 27.08  ? 716  ILE A C     1 
ATOM   3508 O  O     . ILE B 2 420 ? 9.659   33.676 46.454  1.00 28.92  ? 716  ILE A O     1 
ATOM   3509 C  CB    . ILE B 2 420 ? 12.510  34.870 45.049  1.00 37.34  ? 716  ILE A CB    1 
ATOM   3510 C  CG1   . ILE B 2 420 ? 12.147  35.824 46.179  1.00 42.11  ? 716  ILE A CG1   1 
ATOM   3511 C  CG2   . ILE B 2 420 ? 12.988  35.642 43.822  1.00 40.85  ? 716  ILE A CG2   1 
ATOM   3512 C  CD1   . ILE B 2 420 ? 13.315  36.692 46.646  1.00 45.50  ? 716  ILE A CD1   1 
ATOM   3513 N  N     . SER B 2 421 ? 11.473  32.357 46.511  1.00 33.45  ? 717  SER A N     1 
ATOM   3514 C  CA    . SER B 2 421 ? 11.062  31.663 47.713  1.00 35.24  ? 717  SER A CA    1 
ATOM   3515 C  C     . SER B 2 421 ? 11.379  32.495 48.953  1.00 35.14  ? 717  SER A C     1 
ATOM   3516 O  O     . SER B 2 421 ? 12.100  33.496 48.903  1.00 30.36  ? 717  SER A O     1 
ATOM   3517 C  CB    . SER B 2 421 ? 11.773  30.318 47.815  1.00 40.04  ? 717  SER A CB    1 
ATOM   3518 O  OG    . SER B 2 421 ? 13.175  30.536 47.832  1.00 32.37  ? 717  SER A OG    1 
ATOM   3519 N  N     . ASP B 2 422 ? 10.835  32.044 50.086  1.00 38.42  ? 718  ASP A N     1 
ATOM   3520 C  CA    . ASP B 2 422 ? 11.250  32.562 51.386  1.00 39.24  ? 718  ASP A CA    1 
ATOM   3521 C  C     . ASP B 2 422 ? 12.756  32.423 51.587  1.00 33.62  ? 718  ASP A C     1 
ATOM   3522 O  O     . ASP B 2 422 ? 13.402  33.341 52.106  1.00 39.37  ? 718  ASP A O     1 
ATOM   3523 C  CB    . ASP B 2 422 ? 10.498  31.833 52.494  1.00 51.20  ? 718  ASP A CB    1 
ATOM   3524 C  CG    . ASP B 2 422 ? 10.533  30.322 52.319  1.00 67.49  ? 718  ASP A CG    1 
ATOM   3525 O  OD1   . ASP B 2 422 ? 11.174  29.846 51.352  1.00 67.85  ? 718  ASP A OD1   1 
ATOM   3526 O  OD2   . ASP B 2 422 ? 9.920   29.611 53.145  1.00 75.06  ? 718  ASP A OD2   1 
ATOM   3527 N  N     . TYR B 2 423 ? 13.333  31.277 51.206  1.00 31.03  ? 719  TYR A N     1 
ATOM   3528 C  CA    . TYR B 2 423 ? 14.789  31.132 51.261  1.00 37.18  ? 719  TYR A CA    1 
ATOM   3529 C  C     . TYR B 2 423 ? 15.470  32.207 50.425  1.00 32.90  ? 719  TYR A C     1 
ATOM   3530 O  O     . TYR B 2 423 ? 16.481  32.785 50.843  1.00 37.08  ? 719  TYR A O     1 
ATOM   3531 C  CB    . TYR B 2 423 ? 15.236  29.750 50.756  1.00 39.21  ? 719  TYR A CB    1 
ATOM   3532 C  CG    . TYR B 2 423 ? 14.890  28.540 51.603  1.00 64.61  ? 719  TYR A CG    1 
ATOM   3533 C  CD1   . TYR B 2 423 ? 13.842  27.693 51.241  1.00 72.36  ? 719  TYR A CD1   1 
ATOM   3534 C  CD2   . TYR B 2 423 ? 15.640  28.205 52.731  1.00 68.66  ? 719  TYR A CD2   1 
ATOM   3535 C  CE1   . TYR B 2 423 ? 13.526  26.568 51.993  1.00 71.47  ? 719  TYR A CE1   1 
ATOM   3536 C  CE2   . TYR B 2 423 ? 15.331  27.073 53.489  1.00 68.91  ? 719  TYR A CE2   1 
ATOM   3537 C  CZ    . TYR B 2 423 ? 14.270  26.265 53.114  1.00 72.60  ? 719  TYR A CZ    1 
ATOM   3538 O  OH    . TYR B 2 423 ? 13.948  25.148 53.855  1.00 78.72  ? 719  TYR A OH    1 
ATOM   3539 N  N     . GLY B 2 424 ? 14.932  32.479 49.233  1.00 33.43  ? 720  GLY A N     1 
ATOM   3540 C  CA    . GLY B 2 424 ? 15.530  33.483 48.368  1.00 30.87  ? 720  GLY A CA    1 
ATOM   3541 C  C     . GLY B 2 424 ? 15.392  34.893 48.915  1.00 32.06  ? 720  GLY A C     1 
ATOM   3542 O  O     . GLY B 2 424 ? 16.303  35.712 48.771  1.00 34.39  ? 720  GLY A O     1 
ATOM   3543 N  N     . LEU B 2 425 ? 14.251  35.200 49.540  1.00 27.78  ? 721  LEU A N     1 
ATOM   3544 C  CA    . LEU B 2 425 ? 14.088  36.505 50.171  1.00 31.23  ? 721  LEU A CA    1 
ATOM   3545 C  C     . LEU B 2 425 ? 15.036  36.646 51.351  1.00 31.82  ? 721  LEU A C     1 
ATOM   3546 O  O     . LEU B 2 425 ? 15.746  37.649 51.476  1.00 37.05  ? 721  LEU A O     1 
ATOM   3547 C  CB    . LEU B 2 425 ? 12.639  36.708 50.615  1.00 31.38  ? 721  LEU A CB    1 
ATOM   3548 C  CG    . LEU B 2 425 ? 12.368  38.001 51.399  1.00 36.24  ? 721  LEU A CG    1 
ATOM   3549 C  CD1   . LEU B 2 425 ? 12.536  39.224 50.506  1.00 31.33  ? 721  LEU A CD1   1 
ATOM   3550 C  CD2   . LEU B 2 425 ? 10.988  37.999 52.028  1.00 32.16  ? 721  LEU A CD2   1 
ATOM   3551 N  N     . ALA B 2 426 ? 15.062  35.636 52.222  1.00 28.49  ? 722  ALA A N     1 
ATOM   3552 C  CA    . ALA B 2 426 ? 16.011  35.609 53.328  1.00 31.80  ? 722  ALA A CA    1 
ATOM   3553 C  C     . ALA B 2 426 ? 17.439  35.857 52.851  1.00 33.26  ? 722  ALA A C     1 
ATOM   3554 O  O     . ALA B 2 426 ? 18.191  36.606 53.479  1.00 40.05  ? 722  ALA A O     1 
ATOM   3555 C  CB    . ALA B 2 426 ? 15.916  34.261 54.045  1.00 33.37  ? 722  ALA A CB    1 
ATOM   3556 N  N     . GLN B 2 427 ? 17.829  35.232 51.743  1.00 39.86  ? 723  GLN A N     1 
ATOM   3557 C  CA    . GLN B 2 427 ? 19.192  35.376 51.245  1.00 45.58  ? 723  GLN A CA    1 
ATOM   3558 C  C     . GLN B 2 427 ? 19.442  36.786 50.731  1.00 49.37  ? 723  GLN A C     1 
ATOM   3559 O  O     . GLN B 2 427 ? 20.531  37.341 50.919  1.00 46.10  ? 723  GLN A O     1 
ATOM   3560 C  CB    . GLN B 2 427 ? 19.441  34.350 50.141  1.00 58.03  ? 723  GLN A CB    1 
ATOM   3561 C  CG    . GLN B 2 427 ? 20.822  34.389 49.509  1.00 73.14  ? 723  GLN A CG    1 
ATOM   3562 C  CD    . GLN B 2 427 ? 21.150  33.101 48.766  1.00 82.63  ? 723  GLN A CD    1 
ATOM   3563 O  OE1   . GLN B 2 427 ? 22.157  32.447 49.046  1.00 88.16  ? 723  GLN A OE1   1 
ATOM   3564 N  NE2   . GLN B 2 427 ? 20.293  32.730 47.816  1.00 76.94  ? 723  GLN A NE2   1 
ATOM   3565 N  N     . ASN B 2 428 ? 18.446  37.378 50.068  1.00 48.67  ? 724  ASN A N     1 
ATOM   3566 C  CA    . ASN B 2 428 ? 18.602  38.733 49.559  1.00 46.14  ? 724  ASN A CA    1 
ATOM   3567 C  C     . ASN B 2 428 ? 18.592  39.757 50.685  1.00 43.27  ? 724  ASN A C     1 
ATOM   3568 O  O     . ASN B 2 428 ? 19.309  40.759 50.614  1.00 45.91  ? 724  ASN A O     1 
ATOM   3569 C  CB    . ASN B 2 428 ? 17.508  39.027 48.531  1.00 44.22  ? 724  ASN A CB    1 
ATOM   3570 C  CG    . ASN B 2 428 ? 17.587  38.095 47.336  1.00 47.28  ? 724  ASN A CG    1 
ATOM   3571 O  OD1   . ASN B 2 428 ? 18.572  37.370 47.177  1.00 51.79  ? 724  ASN A OD1   1 
ATOM   3572 N  ND2   . ASN B 2 428 ? 16.552  38.098 46.496  1.00 42.32  ? 724  ASN A ND2   1 
ATOM   3573 N  N     . LEU B 2 429 ? 17.807  39.522 51.732  1.00 43.69  ? 725  LEU A N     1 
ATOM   3574 C  CA    . LEU B 2 429 ? 17.777  40.416 52.881  1.00 32.92  ? 725  LEU A CA    1 
ATOM   3575 C  C     . LEU B 2 429 ? 18.831  40.066 53.918  1.00 41.05  ? 725  LEU A C     1 
ATOM   3576 O  O     . LEU B 2 429 ? 18.955  40.779 54.924  1.00 37.65  ? 725  LEU A O     1 
ATOM   3577 C  CB    . LEU B 2 429 ? 16.385  40.398 53.518  1.00 28.52  ? 725  LEU A CB    1 
ATOM   3578 C  CG    . LEU B 2 429 ? 15.411  41.178 52.640  1.00 30.63  ? 725  LEU A CG    1 
ATOM   3579 C  CD1   . LEU B 2 429 ? 14.027  41.191 53.244  1.00 30.20  ? 725  LEU A CD1   1 
ATOM   3580 C  CD2   . LEU B 2 429 ? 15.953  42.597 52.471  1.00 32.31  ? 725  LEU A CD2   1 
ATOM   3581 N  N     . ASN B 2 430 ? 19.591  38.997 53.690  1.00 40.99  ? 726  ASN A N     1 
ATOM   3582 C  CA    . ASN B 2 430 ? 20.573  38.505 54.651  1.00 43.63  ? 726  ASN A CA    1 
ATOM   3583 C  C     . ASN B 2 430 ? 19.949  38.350 56.038  1.00 41.15  ? 726  ASN A C     1 
ATOM   3584 O  O     . ASN B 2 430 ? 20.459  38.856 57.039  1.00 43.21  ? 726  ASN A O     1 
ATOM   3585 C  CB    . ASN B 2 430 ? 21.801  39.420 54.697  1.00 52.60  ? 726  ASN A CB    1 
ATOM   3586 C  CG    . ASN B 2 430 ? 23.001  38.747 55.344  1.00 64.48  ? 726  ASN A CG    1 
ATOM   3587 O  OD1   . ASN B 2 430 ? 23.095  37.519 55.371  1.00 67.47  ? 726  ASN A OD1   1 
ATOM   3588 N  ND2   . ASN B 2 430 ? 23.924  39.548 55.873  1.00 61.75  ? 726  ASN A ND2   1 
ATOM   3589 N  N     . ILE B 2 431 ? 18.814  37.654 56.091  1.00 38.86  ? 727  ILE A N     1 
ATOM   3590 C  CA    . ILE B 2 431 ? 18.105  37.384 57.336  1.00 39.33  ? 727  ILE A CA    1 
ATOM   3591 C  C     . ILE B 2 431 ? 17.764  35.898 57.383  1.00 41.28  ? 727  ILE A C     1 
ATOM   3592 O  O     . ILE B 2 431 ? 18.033  35.151 56.442  1.00 40.84  ? 727  ILE A O     1 
ATOM   3593 C  CB    . ILE B 2 431 ? 16.837  38.252 57.489  1.00 42.64  ? 727  ILE A CB    1 
ATOM   3594 C  CG1   . ILE B 2 431 ? 15.871  37.995 56.322  1.00 45.10  ? 727  ILE A CG1   1 
ATOM   3595 C  CG2   . ILE B 2 431 ? 17.217  39.728 57.559  1.00 35.46  ? 727  ILE A CG2   1 
ATOM   3596 C  CD1   . ILE B 2 431 ? 14.587  38.829 56.356  1.00 42.40  ? 727  ILE A CD1   1 
ATOM   3597 N  N     . SER B 2 432 ? 17.183  35.468 58.500  1.00 37.23  ? 728  SER A N     1 
ATOM   3598 C  CA    . SER B 2 432 ? 16.839  34.065 58.635  1.00 36.96  ? 728  SER A CA    1 
ATOM   3599 C  C     . SER B 2 432 ? 15.623  33.727 57.773  1.00 44.55  ? 728  SER A C     1 
ATOM   3600 O  O     . SER B 2 432 ? 14.881  34.603 57.319  1.00 43.64  ? 728  SER A O     1 
ATOM   3601 C  CB    . SER B 2 432 ? 16.561  33.718 60.091  1.00 40.82  ? 728  SER A CB    1 
ATOM   3602 O  OG    . SER B 2 432 ? 15.209  33.969 60.401  1.00 43.26  ? 728  SER A OG    1 
ATOM   3603 N  N     . ARG B 2 433 ? 15.432  32.427 57.536  1.00 53.53  ? 729  ARG A N     1 
ATOM   3604 C  CA    . ARG B 2 433 ? 14.251  31.994 56.800  1.00 48.68  ? 729  ARG A CA    1 
ATOM   3605 C  C     . ARG B 2 433 ? 12.987  32.279 57.593  1.00 46.03  ? 729  ARG A C     1 
ATOM   3606 O  O     . ARG B 2 433 ? 11.971  32.697 57.024  1.00 47.97  ? 729  ARG A O     1 
ATOM   3607 C  CB    . ARG B 2 433 ? 14.347  30.509 56.459  1.00 54.41  ? 729  ARG A CB    1 
ATOM   3608 C  CG    . ARG B 2 433 ? 13.511  30.130 55.247  1.00 65.81  ? 729  ARG A CG    1 
ATOM   3609 C  CD    . ARG B 2 433 ? 12.993  28.707 55.354  1.00 76.75  ? 729  ARG A CD    1 
ATOM   3610 N  NE    . ARG B 2 433 ? 12.579  28.378 56.712  1.00 86.53  ? 729  ARG A NE    1 
ATOM   3611 C  CZ    . ARG B 2 433 ? 11.404  28.708 57.237  1.00 89.96  ? 729  ARG A CZ    1 
ATOM   3612 N  NH1   . ARG B 2 433 ? 11.115  28.365 58.484  1.00 90.79  ? 729  ARG A NH1   1 
ATOM   3613 N  NH2   . ARG B 2 433 ? 10.514  29.377 56.515  1.00 89.94  ? 729  ARG A NH2   1 
ATOM   3614 N  N     . LYS B 2 434 ? 13.039  32.076 58.910  1.00 40.63  ? 730  LYS A N     1 
ATOM   3615 C  CA    . LYS B 2 434 ? 11.904  32.407 59.759  1.00 43.17  ? 730  LYS A CA    1 
ATOM   3616 C  C     . LYS B 2 434 ? 11.570  33.887 59.669  1.00 44.76  ? 730  LYS A C     1 
ATOM   3617 O  O     . LYS B 2 434 ? 10.395  34.263 59.632  1.00 53.97  ? 730  LYS A O     1 
ATOM   3618 C  CB    . LYS B 2 434 ? 12.200  32.017 61.209  1.00 41.54  ? 730  LYS A CB    1 
ATOM   3619 N  N     . GLU B 2 435 ? 12.595  34.745 59.650  1.00 42.87  ? 731  GLU A N     1 
ATOM   3620 C  CA    . GLU B 2 435 ? 12.351  36.181 59.580  1.00 40.38  ? 731  GLU A CA    1 
ATOM   3621 C  C     . GLU B 2 435 ? 11.771  36.565 58.226  1.00 36.86  ? 731  GLU A C     1 
ATOM   3622 O  O     . GLU B 2 435 ? 10.810  37.339 58.157  1.00 37.74  ? 731  GLU A O     1 
ATOM   3623 C  CB    . GLU B 2 435 ? 13.641  36.955 59.864  1.00 50.23  ? 731  GLU A CB    1 
ATOM   3624 C  CG    . GLU B 2 435 ? 14.249  36.657 61.242  1.00 62.30  ? 731  GLU A CG    1 
ATOM   3625 C  CD    . GLU B 2 435 ? 15.648  37.244 61.425  1.00 74.99  ? 731  GLU A CD    1 
ATOM   3626 O  OE1   . GLU B 2 435 ? 16.605  36.750 60.786  1.00 76.28  ? 731  GLU A OE1   1 
ATOM   3627 O  OE2   . GLU B 2 435 ? 15.793  38.193 62.226  1.00 78.16  ? 731  GLU A OE2   1 
ATOM   3628 N  N     . ALA B 2 436 ? 12.330  36.021 57.139  1.00 32.02  ? 732  ALA A N     1 
ATOM   3629 C  CA    . ALA B 2 436 ? 11.769  36.279 55.818  1.00 37.13  ? 732  ALA A CA    1 
ATOM   3630 C  C     . ALA B 2 436 ? 10.306  35.866 55.762  1.00 42.54  ? 732  ALA A C     1 
ATOM   3631 O  O     . ALA B 2 436 ? 9.468   36.593 55.213  1.00 38.23  ? 732  ALA A O     1 
ATOM   3632 C  CB    . ALA B 2 436 ? 12.581  35.554 54.742  1.00 37.50  ? 732  ALA A CB    1 
ATOM   3633 N  N     . ALA B 2 437 ? 9.978   34.714 56.354  1.00 48.15  ? 733  ALA A N     1 
ATOM   3634 C  CA    . ALA B 2 437 ? 8.597   34.240 56.368  1.00 48.01  ? 733  ALA A CA    1 
ATOM   3635 C  C     . ALA B 2 437 ? 7.678   35.235 57.061  1.00 41.67  ? 733  ALA A C     1 
ATOM   3636 O  O     . ALA B 2 437 ? 6.594   35.546 56.554  1.00 34.66  ? 733  ALA A O     1 
ATOM   3637 C  CB    . ALA B 2 437 ? 8.517   32.875 57.052  1.00 47.74  ? 733  ALA A CB    1 
ATOM   3638 N  N     . GLU B 2 438 ? 8.097   35.762 58.210  1.00 36.06  ? 734  GLU A N     1 
ATOM   3639 C  CA    . GLU B 2 438 ? 7.240   36.704 58.924  1.00 42.08  ? 734  GLU A CA    1 
ATOM   3640 C  C     . GLU B 2 438 ? 7.141   38.046 58.208  1.00 39.81  ? 734  GLU A C     1 
ATOM   3641 O  O     . GLU B 2 438 ? 6.135   38.750 58.360  1.00 47.07  ? 734  GLU A O     1 
ATOM   3642 C  CB    . GLU B 2 438 ? 7.738   36.894 60.358  1.00 54.16  ? 734  GLU A CB    1 
ATOM   3643 C  CG    . GLU B 2 438 ? 6.749   37.631 61.266  1.00 65.93  ? 734  GLU A CG    1 
ATOM   3644 C  CD    . GLU B 2 438 ? 5.279   37.317 60.960  1.00 74.68  ? 734  GLU A CD    1 
ATOM   3645 O  OE1   . GLU B 2 438 ? 4.469   38.271 60.942  1.00 74.71  ? 734  GLU A OE1   1 
ATOM   3646 O  OE2   . GLU B 2 438 ? 4.921   36.129 60.769  1.00 76.81  ? 734  GLU A OE2   1 
ATOM   3647 N  N     . PHE B 2 439 ? 8.172   38.428 57.446  1.00 37.01  ? 735  PHE A N     1 
ATOM   3648 C  CA    . PHE B 2 439 ? 8.049   39.574 56.549  1.00 39.51  ? 735  PHE A CA    1 
ATOM   3649 C  C     . PHE B 2 439 ? 6.894   39.368 55.580  1.00 44.31  ? 735  PHE A C     1 
ATOM   3650 O  O     . PHE B 2 439 ? 6.053   40.257 55.382  1.00 38.51  ? 735  PHE A O     1 
ATOM   3651 C  CB    . PHE B 2 439 ? 9.346   39.763 55.760  1.00 51.82  ? 735  PHE A CB    1 
ATOM   3652 C  CG    . PHE B 2 439 ? 10.198  40.885 56.242  1.00 61.79  ? 735  PHE A CG    1 
ATOM   3653 C  CD1   . PHE B 2 439 ? 11.422  40.626 56.839  1.00 66.40  ? 735  PHE A CD1   1 
ATOM   3654 C  CD2   . PHE B 2 439 ? 9.798   42.195 56.078  1.00 70.57  ? 735  PHE A CD2   1 
ATOM   3655 C  CE1   . PHE B 2 439 ? 12.225  41.651 57.282  1.00 67.43  ? 735  PHE A CE1   1 
ATOM   3656 C  CE2   . PHE B 2 439 ? 10.598  43.231 56.516  1.00 75.68  ? 735  PHE A CE2   1 
ATOM   3657 C  CZ    . PHE B 2 439 ? 11.816  42.956 57.123  1.00 73.71  ? 735  PHE A CZ    1 
ATOM   3658 N  N     . ILE B 2 440 ? 6.860   38.192 54.952  1.00 38.67  ? 736  ILE A N     1 
ATOM   3659 C  CA    . ILE B 2 440 ? 5.831   37.870 53.972  1.00 37.78  ? 736  ILE A CA    1 
ATOM   3660 C  C     . ILE B 2 440 ? 4.449   37.930 54.607  1.00 37.15  ? 736  ILE A C     1 
ATOM   3661 O  O     . ILE B 2 440 ? 3.500   38.457 54.015  1.00 32.65  ? 736  ILE A O     1 
ATOM   3662 C  CB    . ILE B 2 440 ? 6.115   36.486 53.358  1.00 39.82  ? 736  ILE A CB    1 
ATOM   3663 C  CG1   . ILE B 2 440 ? 7.483   36.471 52.677  1.00 37.38  ? 736  ILE A CG1   1 
ATOM   3664 C  CG2   . ILE B 2 440 ? 5.031   36.102 52.372  1.00 44.87  ? 736  ILE A CG2   1 
ATOM   3665 C  CD1   . ILE B 2 440 ? 7.529   37.221 51.373  1.00 44.79  ? 736  ILE A CD1   1 
ATOM   3666 N  N     . GLU B 2 441 ? 4.312   37.397 55.823  1.00 37.66  ? 737  GLU A N     1 
ATOM   3667 C  CA    . GLU B 2 441 ? 3.001   37.383 56.457  1.00 37.88  ? 737  GLU A CA    1 
ATOM   3668 C  C     . GLU B 2 441 ? 2.534   38.793 56.769  1.00 39.87  ? 737  GLU A C     1 
ATOM   3669 O  O     . GLU B 2 441 ? 1.349   39.104 56.617  1.00 41.30  ? 737  GLU A O     1 
ATOM   3670 C  CB    . GLU B 2 441 ? 3.022   36.530 57.726  1.00 51.99  ? 737  GLU A CB    1 
ATOM   3671 C  CG    . GLU B 2 441 ? 2.450   35.125 57.523  1.00 68.99  ? 737  GLU A CG    1 
ATOM   3672 C  CD    . GLU B 2 441 ? 1.226   35.094 56.598  1.00 80.01  ? 737  GLU A CD    1 
ATOM   3673 O  OE1   . GLU B 2 441 ? 1.274   34.383 55.569  1.00 80.14  ? 737  GLU A OE1   1 
ATOM   3674 O  OE2   . GLU B 2 441 ? 0.213   35.768 56.898  1.00 83.32  ? 737  GLU A OE2   1 
ATOM   3675 N  N     . ARG B 2 442 ? 3.449   39.662 57.203  1.00 38.96  ? 738  ARG A N     1 
ATOM   3676 C  CA    . ARG B 2 442 ? 3.075   41.054 57.426  1.00 40.35  ? 738  ARG A CA    1 
ATOM   3677 C  C     . ARG B 2 442 ? 2.619   41.701 56.126  1.00 31.58  ? 738  ARG A C     1 
ATOM   3678 O  O     . ARG B 2 442 ? 1.686   42.513 56.118  1.00 35.96  ? 738  ARG A O     1 
ATOM   3679 C  CB    . ARG B 2 442 ? 4.249   41.824 58.032  1.00 46.42  ? 738  ARG A CB    1 
ATOM   3680 C  CG    . ARG B 2 442 ? 4.420   41.629 59.524  1.00 54.56  ? 738  ARG A CG    1 
ATOM   3681 C  CD    . ARG B 2 442 ? 3.314   42.327 60.301  1.00 72.18  ? 738  ARG A CD    1 
ATOM   3682 N  NE    . ARG B 2 442 ? 2.864   43.539 59.624  1.00 83.86  ? 738  ARG A NE    1 
ATOM   3683 C  CZ    . ARG B 2 442 ? 1.713   44.156 59.875  1.00 93.90  ? 738  ARG A CZ    1 
ATOM   3684 N  NH1   . ARG B 2 442 ? 0.887   43.677 60.796  1.00 95.82  ? 738  ARG A NH1   1 
ATOM   3685 N  NH2   . ARG B 2 442 ? 1.387   45.254 59.204  1.00 97.31  ? 738  ARG A NH2   1 
ATOM   3686 N  N     . TYR B 2 443 ? 3.266   41.343 55.012  1.00 28.71  ? 739  TYR A N     1 
ATOM   3687 C  CA    . TYR B 2 443 ? 2.833   41.835 53.712  1.00 34.50  ? 739  TYR A CA    1 
ATOM   3688 C  C     . TYR B 2 443 ? 1.404   41.399 53.412  1.00 34.94  ? 739  TYR A C     1 
ATOM   3689 O  O     . TYR B 2 443 ? 0.596   42.190 52.911  1.00 30.17  ? 739  TYR A O     1 
ATOM   3690 C  CB    . TYR B 2 443 ? 3.786   41.341 52.618  1.00 28.24  ? 739  TYR A CB    1 
ATOM   3691 C  CG    . TYR B 2 443 ? 3.401   41.850 51.261  1.00 28.12  ? 739  TYR A CG    1 
ATOM   3692 C  CD1   . TYR B 2 443 ? 3.864   43.079 50.808  1.00 22.93  ? 739  TYR A CD1   1 
ATOM   3693 C  CD2   . TYR B 2 443 ? 2.553   41.113 50.438  1.00 24.17  ? 739  TYR A CD2   1 
ATOM   3694 C  CE1   . TYR B 2 443 ? 3.503   43.557 49.562  1.00 26.63  ? 739  TYR A CE1   1 
ATOM   3695 C  CE2   . TYR B 2 443 ? 2.172   41.585 49.198  1.00 25.80  ? 739  TYR A CE2   1 
ATOM   3696 C  CZ    . TYR B 2 443 ? 2.650   42.805 48.764  1.00 27.15  ? 739  TYR A CZ    1 
ATOM   3697 O  OH    . TYR B 2 443 ? 2.278   43.281 47.536  1.00 27.19  ? 739  TYR A OH    1 
ATOM   3698 N  N     . PHE B 2 444 ? 1.069   40.143 53.716  1.00 30.58  ? 740  PHE A N     1 
ATOM   3699 C  CA    . PHE B 2 444 ? -0.256  39.655 53.351  1.00 29.92  ? 740  PHE A CA    1 
ATOM   3700 C  C     . PHE B 2 444 ? -1.337  40.257 54.233  1.00 30.11  ? 740  PHE A C     1 
ATOM   3701 O  O     . PHE B 2 444 ? -2.490  40.355 53.802  1.00 32.78  ? 740  PHE A O     1 
ATOM   3702 C  CB    . PHE B 2 444 ? -0.308  38.134 53.413  1.00 22.24  ? 740  PHE A CB    1 
ATOM   3703 C  CG    . PHE B 2 444 ? 0.432   37.458 52.315  1.00 23.94  ? 740  PHE A CG    1 
ATOM   3704 C  CD1   . PHE B 2 444 ? 0.414   37.962 51.025  1.00 27.88  ? 740  PHE A CD1   1 
ATOM   3705 C  CD2   . PHE B 2 444 ? 1.125   36.288 52.562  1.00 32.22  ? 740  PHE A CD2   1 
ATOM   3706 C  CE1   . PHE B 2 444 ? 1.105   37.331 50.009  1.00 26.22  ? 740  PHE A CE1   1 
ATOM   3707 C  CE2   . PHE B 2 444 ? 1.802   35.640 51.558  1.00 26.99  ? 740  PHE A CE2   1 
ATOM   3708 C  CZ    . PHE B 2 444 ? 1.805   36.166 50.271  1.00 27.28  ? 740  PHE A CZ    1 
ATOM   3709 N  N     . GLU B 2 445 ? -0.987  40.687 55.456  1.00 28.94  ? 741  GLU A N     1 
ATOM   3710 C  CA    . GLU B 2 445 ? -1.940  41.432 56.275  1.00 28.79  ? 741  GLU A CA    1 
ATOM   3711 C  C     . GLU B 2 445 ? -2.190  42.824 55.716  1.00 35.91  ? 741  GLU A C     1 
ATOM   3712 O  O     . GLU B 2 445 ? -3.287  43.369 55.872  1.00 33.63  ? 741  GLU A O     1 
ATOM   3713 C  CB    . GLU B 2 445 ? -1.448  41.547 57.718  1.00 42.67  ? 741  GLU A CB    1 
ATOM   3714 C  CG    . GLU B 2 445 ? -1.051  40.229 58.357  1.00 57.94  ? 741  GLU A CG    1 
ATOM   3715 C  CD    . GLU B 2 445 ? -1.918  39.070 57.899  1.00 81.76  ? 741  GLU A CD    1 
ATOM   3716 O  OE1   . GLU B 2 445 ? -1.364  38.094 57.346  1.00 89.46  ? 741  GLU A OE1   1 
ATOM   3717 O  OE2   . GLU B 2 445 ? -3.151  39.129 58.095  1.00 90.41  ? 741  GLU A OE2   1 
ATOM   3718 N  N     . SER B 2 446 ? -1.185  43.424 55.088  1.00 35.84  ? 742  SER A N     1 
ATOM   3719 C  CA    . SER B 2 446 ? -1.394  44.723 54.472  1.00 35.13  ? 742  SER A CA    1 
ATOM   3720 C  C     . SER B 2 446 ? -2.077  44.592 53.125  1.00 31.67  ? 742  SER A C     1 
ATOM   3721 O  O     . SER B 2 446 ? -2.775  45.514 52.685  1.00 31.14  ? 742  SER A O     1 
ATOM   3722 C  CB    . SER B 2 446 ? -0.058  45.445 54.320  1.00 46.23  ? 742  SER A CB    1 
ATOM   3723 O  OG    . SER B 2 446 ? 0.599   45.539 55.572  1.00 59.43  ? 742  SER A OG    1 
ATOM   3724 N  N     . PHE B 2 447 ? -1.892  43.468 52.445  1.00 24.73  ? 743  PHE A N     1 
ATOM   3725 C  CA    . PHE B 2 447 ? -2.430  43.297 51.107  1.00 24.02  ? 743  PHE A CA    1 
ATOM   3726 C  C     . PHE B 2 447 ? -3.187  41.986 51.073  1.00 24.29  ? 743  PHE A C     1 
ATOM   3727 O  O     . PHE B 2 447 ? -2.760  41.024 50.430  1.00 20.64  ? 743  PHE A O     1 
ATOM   3728 C  CB    . PHE B 2 447 ? -1.308  43.369 50.073  1.00 26.86  ? 743  PHE A CB    1 
ATOM   3729 C  CG    . PHE B 2 447 ? -0.558  44.682 50.115  1.00 26.86  ? 743  PHE A CG    1 
ATOM   3730 C  CD1   . PHE B 2 447 ? 0.614   44.802 50.855  1.00 24.73  ? 743  PHE A CD1   1 
ATOM   3731 C  CD2   . PHE B 2 447 ? -1.052  45.801 49.444  1.00 21.61  ? 743  PHE A CD2   1 
ATOM   3732 C  CE1   . PHE B 2 447 ? 1.304   46.013 50.907  1.00 27.57  ? 743  PHE A CE1   1 
ATOM   3733 C  CE2   . PHE B 2 447 ? -0.371  47.032 49.497  1.00 24.77  ? 743  PHE A CE2   1 
ATOM   3734 C  CZ    . PHE B 2 447 ? 0.809   47.131 50.235  1.00 30.41  ? 743  PHE A CZ    1 
ATOM   3735 N  N     . PRO B 2 448 ? -4.327  41.920 51.763  1.00 21.37  ? 744  PRO A N     1 
ATOM   3736 C  CA    . PRO B 2 448 ? -5.067  40.655 51.819  1.00 24.33  ? 744  PRO A CA    1 
ATOM   3737 C  C     . PRO B 2 448 ? -5.541  40.203 50.461  1.00 21.58  ? 744  PRO A C     1 
ATOM   3738 O  O     . PRO B 2 448 ? -5.672  38.997 50.232  1.00 18.46  ? 744  PRO A O     1 
ATOM   3739 C  CB    . PRO B 2 448 ? -6.246  40.978 52.749  1.00 25.99  ? 744  PRO A CB    1 
ATOM   3740 C  CG    . PRO B 2 448 ? -6.445  42.478 52.559  1.00 26.53  ? 744  PRO A CG    1 
ATOM   3741 C  CD    . PRO B 2 448 ? -5.048  43.016 52.440  1.00 20.81  ? 744  PRO A CD    1 
ATOM   3742 N  N     . GLY B 2 449 ? -5.811  41.139 49.552  1.00 18.23  ? 745  GLY A N     1 
ATOM   3743 C  CA    . GLY B 2 449 ? -6.220  40.754 48.216  1.00 18.41  ? 745  GLY A CA    1 
ATOM   3744 C  C     . GLY B 2 449 ? -5.115  40.023 47.485  1.00 20.26  ? 745  GLY A C     1 
ATOM   3745 O  O     . GLY B 2 449 ? -5.376  39.060 46.767  1.00 16.31  ? 745  GLY A O     1 
ATOM   3746 N  N     . VAL B 2 450 ? -3.864  40.452 47.680  1.00 21.80  ? 746  VAL A N     1 
ATOM   3747 C  CA    . VAL B 2 450 ? -2.742  39.738 47.077  1.00 16.12  ? 746  VAL A CA    1 
ATOM   3748 C  C     . VAL B 2 450 ? -2.642  38.332 47.661  1.00 16.32  ? 746  VAL A C     1 
ATOM   3749 O  O     . VAL B 2 450 ? -2.409  37.359 46.936  1.00 20.10  ? 746  VAL A O     1 
ATOM   3750 C  CB    . VAL B 2 450 ? -1.433  40.524 47.269  1.00 18.74  ? 746  VAL A CB    1 
ATOM   3751 C  CG1   . VAL B 2 450 ? -0.228  39.689 46.823  1.00 18.61  ? 746  VAL A CG1   1 
ATOM   3752 C  CG2   . VAL B 2 450 ? -1.487  41.860 46.501  1.00 15.24  ? 746  VAL A CG2   1 
ATOM   3753 N  N     . LYS B 2 451 ? -2.806  38.205 48.975  1.00 17.14  ? 747  LYS A N     1 
ATOM   3754 C  CA    . LYS B 2 451 ? -2.795  36.881 49.591  1.00 18.91  ? 747  LYS A CA    1 
ATOM   3755 C  C     . LYS B 2 451 ? -3.871  35.986 48.988  1.00 18.45  ? 747  LYS A C     1 
ATOM   3756 O  O     . LYS B 2 451 ? -3.621  34.817 48.685  1.00 20.94  ? 747  LYS A O     1 
ATOM   3757 C  CB    . LYS B 2 451 ? -3.000  36.995 51.099  1.00 19.99  ? 747  LYS A CB    1 
ATOM   3758 C  CG    . LYS B 2 451 ? -2.985  35.637 51.795  1.00 24.69  ? 747  LYS A CG    1 
ATOM   3759 C  CD    . LYS B 2 451 ? -3.114  35.780 53.305  1.00 31.85  ? 747  LYS A CD    1 
ATOM   3760 C  CE    . LYS B 2 451 ? -2.797  34.463 54.003  1.00 39.31  ? 747  LYS A CE    1 
ATOM   3761 N  NZ    . LYS B 2 451 ? -3.556  34.321 55.279  1.00 42.73  ? 747  LYS A NZ    1 
ATOM   3762 N  N     . ARG B 2 452 ? -5.088  36.514 48.835  1.00 21.88  ? 748  ARG A N     1 
ATOM   3763 C  CA    . ARG B 2 452 ? -6.175  35.726 48.259  1.00 25.03  ? 748  ARG A CA    1 
ATOM   3764 C  C     . ARG B 2 452 ? -5.868  35.327 46.828  1.00 27.73  ? 748  ARG A C     1 
ATOM   3765 O  O     . ARG B 2 452 ? -6.192  34.212 46.400  1.00 20.80  ? 748  ARG A O     1 
ATOM   3766 C  CB    . ARG B 2 452 ? -7.480  36.518 48.316  1.00 23.88  ? 748  ARG A CB    1 
ATOM   3767 C  CG    . ARG B 2 452 ? -8.018  36.655 49.745  1.00 43.19  ? 748  ARG A CG    1 
ATOM   3768 C  CD    . ARG B 2 452 ? -9.423  37.245 49.770  1.00 55.15  ? 748  ARG A CD    1 
ATOM   3769 N  NE    . ARG B 2 452 ? -9.448  38.611 49.256  1.00 64.98  ? 748  ARG A NE    1 
ATOM   3770 C  CZ    . ARG B 2 452 ? -9.415  39.704 50.015  1.00 66.40  ? 748  ARG A CZ    1 
ATOM   3771 N  NH1   . ARG B 2 452 ? -9.358  39.601 51.338  1.00 60.84  ? 748  ARG A NH1   1 
ATOM   3772 N  NH2   . ARG B 2 452 ? -9.440  40.904 49.446  1.00 66.31  ? 748  ARG A NH2   1 
ATOM   3773 N  N     . TYR B 2 453 ? -5.282  36.242 46.055  1.00 21.25  ? 749  TYR A N     1 
ATOM   3774 C  CA    . TYR B 2 453 ? -4.892  35.892 44.704  1.00 19.68  ? 749  TYR A CA    1 
ATOM   3775 C  C     . TYR B 2 453 ? -3.855  34.776 44.711  1.00 20.57  ? 749  TYR A C     1 
ATOM   3776 O  O     . TYR B 2 453 ? -3.903  33.872 43.867  1.00 19.14  ? 749  TYR A O     1 
ATOM   3777 C  CB    . TYR B 2 453 ? -4.360  37.126 43.962  1.00 16.28  ? 749  TYR A CB    1 
ATOM   3778 C  CG    . TYR B 2 453 ? -3.460  36.729 42.841  1.00 16.50  ? 749  TYR A CG    1 
ATOM   3779 C  CD1   . TYR B 2 453 ? -3.991  36.251 41.645  1.00 16.77  ? 749  TYR A CD1   1 
ATOM   3780 C  CD2   . TYR B 2 453 ? -2.075  36.741 42.997  1.00 15.65  ? 749  TYR A CD2   1 
ATOM   3781 C  CE1   . TYR B 2 453 ? -3.182  35.833 40.633  1.00 23.28  ? 749  TYR A CE1   1 
ATOM   3782 C  CE2   . TYR B 2 453 ? -1.246  36.324 41.962  1.00 19.63  ? 749  TYR A CE2   1 
ATOM   3783 C  CZ    . TYR B 2 453 ? -1.806  35.872 40.790  1.00 20.12  ? 749  TYR A CZ    1 
ATOM   3784 O  OH    . TYR B 2 453 ? -1.000  35.444 39.752  1.00 23.77  ? 749  TYR A OH    1 
ATOM   3785 N  N     . MET B 2 454 ? -2.890  34.842 45.629  1.00 15.83  ? 750  MET A N     1 
ATOM   3786 C  CA    . MET B 2 454 ? -1.858  33.814 45.697  1.00 19.04  ? 750  MET A CA    1 
ATOM   3787 C  C     . MET B 2 454 ? -2.478  32.454 45.981  1.00 26.27  ? 750  MET A C     1 
ATOM   3788 O  O     . MET B 2 454 ? -2.203  31.473 45.279  1.00 26.94  ? 750  MET A O     1 
ATOM   3789 C  CB    . MET B 2 454 ? -0.826  34.144 46.777  1.00 26.00  ? 750  MET A CB    1 
ATOM   3790 C  CG    . MET B 2 454 ? 0.039   35.390 46.553  1.00 45.82  ? 750  MET A CG    1 
ATOM   3791 S  SD    . MET B 2 454 ? 0.743   35.535 44.906  1.00 63.34  ? 750  MET A SD    1 
ATOM   3792 C  CE    . MET B 2 454 ? 2.312   36.319 45.275  1.00 68.08  ? 750  MET A CE    1 
ATOM   3793 N  N     . GLU B 2 455 ? -3.346  32.387 46.996  1.00 18.78  ? 751  GLU A N     1 
ATOM   3794 C  CA    . GLU B 2 455 ? -4.018  31.126 47.314  1.00 18.33  ? 751  GLU A CA    1 
ATOM   3795 C  C     . GLU B 2 455 ? -4.896  30.652 46.162  1.00 23.56  ? 751  GLU A C     1 
ATOM   3796 O  O     . GLU B 2 455 ? -4.897  29.462 45.823  1.00 22.58  ? 751  GLU A O     1 
ATOM   3797 C  CB    . GLU B 2 455 ? -4.859  31.290 48.583  1.00 20.50  ? 751  GLU A CB    1 
ATOM   3798 C  CG    . GLU B 2 455 ? -4.045  31.673 49.809  1.00 30.28  ? 751  GLU A CG    1 
ATOM   3799 C  CD    . GLU B 2 455 ? -4.906  32.241 50.949  1.00 41.48  ? 751  GLU A CD    1 
ATOM   3800 O  OE1   . GLU B 2 455 ? -4.378  32.374 52.075  1.00 44.66  ? 751  GLU A OE1   1 
ATOM   3801 O  OE2   . GLU B 2 455 ? -6.096  32.573 50.718  1.00 41.07  ? 751  GLU A OE2   1 
ATOM   3802 N  N     . ASN B 2 456 ? -5.653  31.567 45.550  1.00 17.70  ? 752  ASN A N     1 
ATOM   3803 C  CA    . ASN B 2 456 ? -6.610  31.173 44.521  1.00 19.74  ? 752  ASN A CA    1 
ATOM   3804 C  C     . ASN B 2 456 ? -5.905  30.700 43.264  1.00 19.74  ? 752  ASN A C     1 
ATOM   3805 O  O     . ASN B 2 456 ? -6.348  29.750 42.621  1.00 19.49  ? 752  ASN A O     1 
ATOM   3806 C  CB    . ASN B 2 456 ? -7.537  32.338 44.169  1.00 27.70  ? 752  ASN A CB    1 
ATOM   3807 C  CG    . ASN B 2 456 ? -8.541  32.629 45.266  1.00 29.60  ? 752  ASN A CG    1 
ATOM   3808 O  OD1   . ASN B 2 456 ? -8.719  31.828 46.165  1.00 29.44  ? 752  ASN A OD1   1 
ATOM   3809 N  ND2   . ASN B 2 456 ? -9.178  33.792 45.205  1.00 31.82  ? 752  ASN A ND2   1 
ATOM   3810 N  N     . ILE B 2 457 ? -4.823  31.368 42.882  1.00 17.74  ? 753  ILE A N     1 
ATOM   3811 C  CA    . ILE B 2 457 ? -4.156  30.985 41.652  1.00 18.02  ? 753  ILE A CA    1 
ATOM   3812 C  C     . ILE B 2 457 ? -3.470  29.640 41.830  1.00 19.58  ? 753  ILE A C     1 
ATOM   3813 O  O     . ILE B 2 457 ? -3.416  28.835 40.893  1.00 18.99  ? 753  ILE A O     1 
ATOM   3814 C  CB    . ILE B 2 457 ? -3.178  32.081 41.196  1.00 14.63  ? 753  ILE A CB    1 
ATOM   3815 C  CG1   . ILE B 2 457 ? -2.788  31.861 39.730  1.00 14.95  ? 753  ILE A CG1   1 
ATOM   3816 C  CG2   . ILE B 2 457 ? -1.937  32.090 42.059  1.00 15.11  ? 753  ILE A CG2   1 
ATOM   3817 C  CD1   . ILE B 2 457 ? -3.902  32.183 38.757  1.00 21.62  ? 753  ILE A CD1   1 
ATOM   3818 N  N     . VAL B 2 458 ? -2.988  29.340 43.037  1.00 17.01  ? 754  VAL A N     1 
ATOM   3819 C  CA    . VAL B 2 458 ? -2.388  28.030 43.241  1.00 16.66  ? 754  VAL A CA    1 
ATOM   3820 C  C     . VAL B 2 458 ? -3.455  26.947 43.162  1.00 20.26  ? 754  VAL A C     1 
ATOM   3821 O  O     . VAL B 2 458 ? -3.249  25.897 42.538  1.00 18.22  ? 754  VAL A O     1 
ATOM   3822 C  CB    . VAL B 2 458 ? -1.617  28.004 44.568  1.00 21.40  ? 754  VAL A CB    1 
ATOM   3823 C  CG1   . VAL B 2 458 ? -1.340  26.552 44.999  1.00 22.70  ? 754  VAL A CG1   1 
ATOM   3824 C  CG2   . VAL B 2 458 ? -0.321  28.795 44.411  1.00 17.75  ? 754  VAL A CG2   1 
ATOM   3825 N  N     . GLN B 2 459 ? -4.624  27.202 43.751  1.00 21.78  ? 755  GLN A N     1 
ATOM   3826 C  CA    . GLN B 2 459 ? -5.724  26.243 43.657  1.00 24.16  ? 755  GLN A CA    1 
ATOM   3827 C  C     . GLN B 2 459 ? -6.172  26.073 42.214  1.00 26.74  ? 755  GLN A C     1 
ATOM   3828 O  O     . GLN B 2 459 ? -6.471  24.962 41.771  1.00 18.97  ? 755  GLN A O     1 
ATOM   3829 C  CB    . GLN B 2 459 ? -6.896  26.704 44.522  1.00 33.80  ? 755  GLN A CB    1 
ATOM   3830 C  CG    . GLN B 2 459 ? -7.589  25.590 45.269  1.00 53.85  ? 755  GLN A CG    1 
ATOM   3831 C  CD    . GLN B 2 459 ? -6.609  24.620 45.918  1.00 62.20  ? 755  GLN A CD    1 
ATOM   3832 O  OE1   . GLN B 2 459 ? -5.639  25.031 46.565  1.00 65.99  ? 755  GLN A OE1   1 
ATOM   3833 N  NE2   . GLN B 2 459 ? -6.860  23.325 45.747  1.00 59.09  ? 755  GLN A NE2   1 
ATOM   3834 N  N     . GLU B 2 460 ? -6.229  27.169 41.463  1.00 21.83  ? 756  GLU A N     1 
ATOM   3835 C  CA    . GLU B 2 460 ? -6.611  27.069 40.065  1.00 23.91  ? 756  GLU A CA    1 
ATOM   3836 C  C     . GLU B 2 460 ? -5.580  26.276 39.272  1.00 20.12  ? 756  GLU A C     1 
ATOM   3837 O  O     . GLU B 2 460 ? -5.941  25.479 38.400  1.00 21.10  ? 756  GLU A O     1 
ATOM   3838 C  CB    . GLU B 2 460 ? -6.792  28.469 39.470  1.00 28.09  ? 756  GLU A CB    1 
ATOM   3839 C  CG    . GLU B 2 460 ? -7.253  28.459 38.025  1.00 45.36  ? 756  GLU A CG    1 
ATOM   3840 C  CD    . GLU B 2 460 ? -7.612  29.844 37.515  1.00 68.72  ? 756  GLU A CD    1 
ATOM   3841 O  OE1   . GLU B 2 460 ? -7.404  30.823 38.265  1.00 73.23  ? 756  GLU A OE1   1 
ATOM   3842 O  OE2   . GLU B 2 460 ? -8.098  29.951 36.366  1.00 74.07  ? 756  GLU A OE2   1 
ATOM   3843 N  N     . ALA B 2 461 ? -4.292  26.495 39.546  1.00 19.10  ? 757  ALA A N     1 
ATOM   3844 C  CA    . ALA B 2 461 ? -3.255  25.734 38.860  1.00 22.34  ? 757  ALA A CA    1 
ATOM   3845 C  C     . ALA B 2 461 ? -3.387  24.250 39.151  1.00 21.43  ? 757  ALA A C     1 
ATOM   3846 O  O     . ALA B 2 461 ? -3.205  23.416 38.256  1.00 17.21  ? 757  ALA A O     1 
ATOM   3847 C  CB    . ALA B 2 461 ? -1.871  26.210 39.281  1.00 19.45  ? 757  ALA A CB    1 
ATOM   3848 N  N     . LYS B 2 462 ? -3.686  23.904 40.406  1.00 21.66  ? 758  LYS A N     1 
ATOM   3849 C  CA    . LYS B 2 462 ? -3.880  22.505 40.765  1.00 25.36  ? 758  LYS A CA    1 
ATOM   3850 C  C     . LYS B 2 462 ? -5.110  21.936 40.073  1.00 18.68  ? 758  LYS A C     1 
ATOM   3851 O  O     . LYS B 2 462 ? -5.077  20.820 39.554  1.00 34.74  ? 758  LYS A O     1 
ATOM   3852 C  CB    . LYS B 2 462 ? -3.998  22.369 42.287  1.00 23.70  ? 758  LYS A CB    1 
ATOM   3853 C  CG    . LYS B 2 462 ? -2.667  22.523 43.035  1.00 41.40  ? 758  LYS A CG    1 
ATOM   3854 C  CD    . LYS B 2 462 ? -2.824  22.265 44.537  1.00 56.18  ? 758  LYS A CD    1 
ATOM   3855 C  CE    . LYS B 2 462 ? -1.802  23.036 45.392  1.00 61.57  ? 758  LYS A CE    1 
ATOM   3856 N  NZ    . LYS B 2 462 ? -0.375  22.586 45.262  1.00 58.34  ? 758  LYS A NZ    1 
ATOM   3857 N  N     . GLN B 2 463 ? -6.202  22.697 40.052  1.00 24.14  ? 759  GLN A N     1 
ATOM   3858 C  CA    . GLN B 2 463 ? -7.443  22.207 39.467  1.00 24.49  ? 759  GLN A CA    1 
ATOM   3859 C  C     . GLN B 2 463 ? -7.327  22.071 37.951  1.00 26.17  ? 759  GLN A C     1 
ATOM   3860 O  O     . GLN B 2 463 ? -7.674  21.030 37.386  1.00 23.84  ? 759  GLN A O     1 
ATOM   3861 C  CB    . GLN B 2 463 ? -8.586  23.149 39.839  1.00 28.65  ? 759  GLN A CB    1 
ATOM   3862 C  CG    . GLN B 2 463 ? -9.925  22.776 39.236  1.00 34.05  ? 759  GLN A CG    1 
ATOM   3863 C  CD    . GLN B 2 463 ? -10.292 23.638 38.035  1.00 36.56  ? 759  GLN A CD    1 
ATOM   3864 O  OE1   . GLN B 2 463 ? -10.389 24.858 38.148  1.00 33.48  ? 759  GLN A OE1   1 
ATOM   3865 N  NE2   . GLN B 2 463 ? -10.524 22.998 36.877  1.00 33.05  ? 759  GLN A NE2   1 
ATOM   3866 N  N     . LYS B 2 464 ? -6.843  23.121 37.275  1.00 19.91  ? 760  LYS A N     1 
ATOM   3867 C  CA    . LYS B 2 464 ? -6.814  23.175 35.821  1.00 21.66  ? 760  LYS A CA    1 
ATOM   3868 C  C     . LYS B 2 464 ? -5.572  22.543 35.217  1.00 21.73  ? 760  LYS A C     1 
ATOM   3869 O  O     . LYS B 2 464 ? -5.600  22.164 34.047  1.00 21.91  ? 760  LYS A O     1 
ATOM   3870 C  CB    . LYS B 2 464 ? -6.857  24.622 35.349  1.00 21.46  ? 760  LYS A CB    1 
ATOM   3871 C  CG    . LYS B 2 464 ? -8.186  25.334 35.483  1.00 36.48  ? 760  LYS A CG    1 
ATOM   3872 C  CD    . LYS B 2 464 ? -8.352  26.333 34.344  1.00 44.96  ? 760  LYS A CD    1 
ATOM   3873 C  CE    . LYS B 2 464 ? -9.809  26.692 34.103  1.00 53.13  ? 760  LYS A CE    1 
ATOM   3874 N  NZ    . LYS B 2 464 ? -10.197 26.450 32.655  1.00 58.29  ? 760  LYS A NZ    1 
ATOM   3875 N  N     . GLY B 2 465 ? -4.474  22.479 35.954  1.00 20.18  ? 761  GLY A N     1 
ATOM   3876 C  CA    . GLY B 2 465 ? -3.208  22.068 35.405  1.00 19.81  ? 761  GLY A CA    1 
ATOM   3877 C  C     . GLY B 2 465 ? -2.342  23.189 34.866  1.00 16.39  ? 761  GLY A C     1 
ATOM   3878 O  O     . GLY B 2 465 ? -1.173  22.938 34.553  1.00 16.38  ? 761  GLY A O     1 
ATOM   3879 N  N     . TYR B 2 466 ? -2.864  24.416 34.755  1.00 15.84  ? 762  TYR A N     1 
ATOM   3880 C  CA    . TYR B 2 466 ? -2.107  25.508 34.153  1.00 22.29  ? 762  TYR A CA    1 
ATOM   3881 C  C     . TYR B 2 466 ? -2.611  26.828 34.714  1.00 20.07  ? 762  TYR A C     1 
ATOM   3882 O  O     . TYR B 2 466 ? -3.657  26.896 35.355  1.00 15.50  ? 762  TYR A O     1 
ATOM   3883 C  CB    . TYR B 2 466 ? -2.233  25.519 32.612  1.00 15.03  ? 762  TYR A CB    1 
ATOM   3884 C  CG    . TYR B 2 466 ? -3.664  25.676 32.164  1.00 15.14  ? 762  TYR A CG    1 
ATOM   3885 C  CD1   . TYR B 2 466 ? -4.211  26.933 31.956  1.00 15.46  ? 762  TYR A CD1   1 
ATOM   3886 C  CD2   . TYR B 2 466 ? -4.492  24.565 31.992  1.00 20.79  ? 762  TYR A CD2   1 
ATOM   3887 C  CE1   . TYR B 2 466 ? -5.529  27.088 31.567  1.00 16.09  ? 762  TYR A CE1   1 
ATOM   3888 C  CE2   . TYR B 2 466 ? -5.816  24.719 31.607  1.00 21.33  ? 762  TYR A CE2   1 
ATOM   3889 C  CZ    . TYR B 2 466 ? -6.325  25.993 31.397  1.00 21.37  ? 762  TYR A CZ    1 
ATOM   3890 O  OH    . TYR B 2 466 ? -7.645  26.180 31.025  1.00 18.41  ? 762  TYR A OH    1 
ATOM   3891 N  N     . VAL B 2 467 ? -1.865  27.888 34.435  1.00 16.35  ? 763  VAL A N     1 
ATOM   3892 C  CA    . VAL B 2 467 ? -2.311  29.239 34.734  1.00 16.76  ? 763  VAL A CA    1 
ATOM   3893 C  C     . VAL B 2 467 ? -2.247  30.034 33.447  1.00 19.84  ? 763  VAL A C     1 
ATOM   3894 O  O     . VAL B 2 467 ? -1.567  29.655 32.492  1.00 13.32  ? 763  VAL A O     1 
ATOM   3895 C  CB    . VAL B 2 467 ? -1.478  29.911 35.848  1.00 14.37  ? 763  VAL A CB    1 
ATOM   3896 C  CG1   . VAL B 2 467 ? -1.670  29.188 37.141  1.00 14.36  ? 763  VAL A CG1   1 
ATOM   3897 C  CG2   . VAL B 2 467 ? -0.002  29.912 35.477  1.00 16.66  ? 763  VAL A CG2   1 
ATOM   3898 N  N     . THR B 2 468 ? -2.971  31.148 33.426  1.00 19.49  ? 764  THR A N     1 
ATOM   3899 C  CA    . THR B 2 468 ? -3.102  31.960 32.232  1.00 17.14  ? 764  THR A CA    1 
ATOM   3900 C  C     . THR B 2 468 ? -2.761  33.407 32.551  1.00 24.84  ? 764  THR A C     1 
ATOM   3901 O  O     . THR B 2 468 ? -2.825  33.843 33.703  1.00 20.12  ? 764  THR A O     1 
ATOM   3902 C  CB    . THR B 2 468 ? -4.522  31.904 31.650  1.00 22.80  ? 764  THR A CB    1 
ATOM   3903 O  OG1   . THR B 2 468 ? -5.431  32.508 32.574  1.00 33.18  ? 764  THR A OG1   1 
ATOM   3904 C  CG2   . THR B 2 468 ? -4.954  30.472 31.423  1.00 19.23  ? 764  THR A CG2   1 
ATOM   3905 N  N     . THR B 2 469 ? -2.400  34.139 31.501  1.00 18.72  ? 765  THR A N     1 
ATOM   3906 C  CA    . THR B 2 469 ? -2.173  35.569 31.543  1.00 16.81  ? 765  THR A CA    1 
ATOM   3907 C  C     . THR B 2 469 ? -3.393  36.286 30.978  1.00 20.99  ? 765  THR A C     1 
ATOM   3908 O  O     . THR B 2 469 ? -4.326  35.672 30.457  1.00 20.14  ? 765  THR A O     1 
ATOM   3909 C  CB    . THR B 2 469 ? -0.943  35.948 30.721  1.00 17.73  ? 765  THR A CB    1 
ATOM   3910 O  OG1   . THR B 2 469 ? -1.222  35.681 29.328  1.00 20.72  ? 765  THR A OG1   1 
ATOM   3911 C  CG2   . THR B 2 469 ? 0.262   35.138 31.162  1.00 15.75  ? 765  THR A CG2   1 
ATOM   3912 N  N     . LEU B 2 470 ? -3.346  37.615 31.028  1.00 18.02  ? 766  LEU A N     1 
ATOM   3913 C  CA    . LEU B 2 470 ? -4.494  38.408 30.617  1.00 21.02  ? 766  LEU A CA    1 
ATOM   3914 C  C     . LEU B 2 470 ? -4.838  38.199 29.146  1.00 18.81  ? 766  LEU A C     1 
ATOM   3915 O  O     . LEU B 2 470 ? -6.011  38.290 28.774  1.00 21.48  ? 766  LEU A O     1 
ATOM   3916 C  CB    . LEU B 2 470 ? -4.228  39.888 30.903  1.00 34.04  ? 766  LEU A CB    1 
ATOM   3917 C  CG    . LEU B 2 470 ? -4.402  40.274 32.380  1.00 36.86  ? 766  LEU A CG    1 
ATOM   3918 C  CD1   . LEU B 2 470 ? -4.151  41.754 32.578  1.00 36.07  ? 766  LEU A CD1   1 
ATOM   3919 C  CD2   . LEU B 2 470 ? -5.777  39.880 32.905  1.00 42.31  ? 766  LEU A CD2   1 
ATOM   3920 N  N     . LEU B 2 471 ? -3.847  37.907 28.299  1.00 15.54  ? 767  LEU A N     1 
ATOM   3921 C  CA    . LEU B 2 471 ? -4.093  37.670 26.881  1.00 26.31  ? 767  LEU A CA    1 
ATOM   3922 C  C     . LEU B 2 471 ? -4.137  36.184 26.527  1.00 31.43  ? 767  LEU A C     1 
ATOM   3923 O  O     . LEU B 2 471 ? -4.027  35.838 25.344  1.00 28.60  ? 767  LEU A O     1 
ATOM   3924 C  CB    . LEU B 2 471 ? -3.042  38.390 26.029  1.00 26.69  ? 767  LEU A CB    1 
ATOM   3925 C  CG    . LEU B 2 471 ? -3.074  39.923 26.074  1.00 32.04  ? 767  LEU A CG    1 
ATOM   3926 C  CD1   . LEU B 2 471 ? -2.376  40.527 24.858  1.00 32.88  ? 767  LEU A CD1   1 
ATOM   3927 C  CD2   . LEU B 2 471 ? -4.501  40.483 26.228  1.00 30.11  ? 767  LEU A CD2   1 
ATOM   3928 N  N     . HIS B 2 472 ? -4.287  35.303 27.525  1.00 20.39  ? 768  HIS A N     1 
ATOM   3929 C  CA    . HIS B 2 472 ? -4.571  33.875 27.353  1.00 20.58  ? 768  HIS A CA    1 
ATOM   3930 C  C     . HIS B 2 472 ? -3.349  33.042 27.007  1.00 13.92  ? 768  HIS A C     1 
ATOM   3931 O  O     . HIS B 2 472 ? -3.480  31.921 26.506  1.00 16.60  ? 768  HIS A O     1 
ATOM   3932 C  CB    . HIS B 2 472 ? -5.657  33.622 26.303  1.00 20.95  ? 768  HIS A CB    1 
ATOM   3933 C  CG    . HIS B 2 472 ? -6.952  34.292 26.624  1.00 31.60  ? 768  HIS A CG    1 
ATOM   3934 N  ND1   . HIS B 2 472 ? -8.026  34.295 25.763  1.00 33.34  ? 768  HIS A ND1   1 
ATOM   3935 C  CD2   . HIS B 2 472 ? -7.345  34.980 27.723  1.00 32.66  ? 768  HIS A CD2   1 
ATOM   3936 C  CE1   . HIS B 2 472 ? -9.026  34.959 26.317  1.00 39.07  ? 768  HIS A CE1   1 
ATOM   3937 N  NE2   . HIS B 2 472 ? -8.637  35.387 27.505  1.00 35.16  ? 768  HIS A NE2   1 
ATOM   3938 N  N     . ARG B 2 473 ? -2.158  33.544 27.268  1.00 14.24  ? 769  ARG A N     1 
ATOM   3939 C  CA    . ARG B 2 473 ? -1.001  32.674 27.294  1.00 19.27  ? 769  ARG A CA    1 
ATOM   3940 C  C     . ARG B 2 473 ? -1.141  31.703 28.454  1.00 22.97  ? 769  ARG A C     1 
ATOM   3941 O  O     . ARG B 2 473 ? -1.685  32.038 29.510  1.00 18.72  ? 769  ARG A O     1 
ATOM   3942 C  CB    . ARG B 2 473 ? 0.267   33.492 27.456  1.00 21.09  ? 769  ARG A CB    1 
ATOM   3943 C  CG    . ARG B 2 473 ? 1.524   32.813 27.001  1.00 32.62  ? 769  ARG A CG    1 
ATOM   3944 C  CD    . ARG B 2 473 ? 2.695   33.728 27.275  1.00 33.43  ? 769  ARG A CD    1 
ATOM   3945 N  NE    . ARG B 2 473 ? 2.480   35.026 26.641  1.00 27.90  ? 769  ARG A NE    1 
ATOM   3946 C  CZ    . ARG B 2 473 ? 2.738   35.263 25.358  1.00 33.09  ? 769  ARG A CZ    1 
ATOM   3947 N  NH1   . ARG B 2 473 ? 3.229   34.282 24.598  1.00 28.46  ? 769  ARG A NH1   1 
ATOM   3948 N  NH2   . ARG B 2 473 ? 2.518   36.473 24.835  1.00 31.89  ? 769  ARG A NH2   1 
ATOM   3949 N  N     . ARG B 2 474 ? -0.664  30.483 28.272  1.00 13.38  ? 770  ARG A N     1 
ATOM   3950 C  CA    . ARG B 2 474 ? -0.787  29.561 29.389  1.00 13.53  ? 770  ARG A CA    1 
ATOM   3951 C  C     . ARG B 2 474 ? 0.549   28.925 29.700  1.00 16.17  ? 770  ARG A C     1 
ATOM   3952 O  O     . ARG B 2 474 ? 1.476   28.891 28.882  1.00 16.04  ? 770  ARG A O     1 
ATOM   3953 C  CB    . ARG B 2 474 ? -1.891  28.509 29.169  1.00 18.26  ? 770  ARG A CB    1 
ATOM   3954 C  CG    . ARG B 2 474 ? -1.761  27.547 28.052  1.00 35.40  ? 770  ARG A CG    1 
ATOM   3955 C  CD    . ARG B 2 474 ? -2.867  26.479 28.164  1.00 35.02  ? 770  ARG A CD    1 
ATOM   3956 N  NE    . ARG B 2 474 ? -4.232  26.992 27.978  1.00 25.79  ? 770  ARG A NE    1 
ATOM   3957 C  CZ    . ARG B 2 474 ? -5.318  26.221 27.967  1.00 22.74  ? 770  ARG A CZ    1 
ATOM   3958 N  NH1   . ARG B 2 474 ? -5.197  24.911 28.131  1.00 21.80  ? 770  ARG A NH1   1 
ATOM   3959 N  NH2   . ARG B 2 474 ? -6.527  26.743 27.782  1.00 20.83  ? 770  ARG A NH2   1 
ATOM   3960 N  N     . ARG B 2 475 ? 0.644   28.481 30.943  1.00 15.09  ? 771  ARG A N     1 
ATOM   3961 C  CA    . ARG B 2 475 ? 1.808   27.768 31.436  1.00 15.02  ? 771  ARG A CA    1 
ATOM   3962 C  C     . ARG B 2 475 ? 1.293   26.575 32.215  1.00 16.98  ? 771  ARG A C     1 
ATOM   3963 O  O     . ARG B 2 475 ? 0.571   26.756 33.202  1.00 14.35  ? 771  ARG A O     1 
ATOM   3964 C  CB    . ARG B 2 475 ? 2.664   28.654 32.338  1.00 14.71  ? 771  ARG A CB    1 
ATOM   3965 C  CG    . ARG B 2 475 ? 3.847   27.919 32.937  1.00 19.11  ? 771  ARG A CG    1 
ATOM   3966 C  CD    . ARG B 2 475 ? 4.749   28.849 33.720  1.00 22.90  ? 771  ARG A CD    1 
ATOM   3967 N  NE    . ARG B 2 475 ? 5.994   28.163 34.028  1.00 20.43  ? 771  ARG A NE    1 
ATOM   3968 C  CZ    . ARG B 2 475 ? 7.092   28.770 34.444  1.00 22.48  ? 771  ARG A CZ    1 
ATOM   3969 N  NH1   . ARG B 2 475 ? 7.086   30.091 34.599  1.00 15.20  ? 771  ARG A NH1   1 
ATOM   3970 N  NH2   . ARG B 2 475 ? 8.187   28.059 34.675  1.00 23.75  ? 771  ARG A NH2   1 
ATOM   3971 N  N     . TYR B 2 476 ? 1.653   25.375 31.764  1.00 16.49  ? 772  TYR A N     1 
ATOM   3972 C  CA    . TYR B 2 476 ? 1.269   24.157 32.451  1.00 16.93  ? 772  TYR A CA    1 
ATOM   3973 C  C     . TYR B 2 476 ? 2.220   23.937 33.609  1.00 15.72  ? 772  TYR A C     1 
ATOM   3974 O  O     . TYR B 2 476 ? 3.422   24.175 33.491  1.00 15.84  ? 772  TYR A O     1 
ATOM   3975 C  CB    . TYR B 2 476 ? 1.298   22.953 31.493  1.00 20.91  ? 772  TYR A CB    1 
ATOM   3976 C  CG    . TYR B 2 476 ? 0.202   23.041 30.465  1.00 22.17  ? 772  TYR A CG    1 
ATOM   3977 C  CD1   . TYR B 2 476 ? -1.062  22.603 30.785  1.00 16.26  ? 772  TYR A CD1   1 
ATOM   3978 C  CD2   . TYR B 2 476 ? 0.410   23.624 29.197  1.00 20.30  ? 772  TYR A CD2   1 
ATOM   3979 C  CE1   . TYR B 2 476 ? -2.092  22.725 29.899  1.00 29.39  ? 772  TYR A CE1   1 
ATOM   3980 C  CE2   . TYR B 2 476 ? -0.637  23.737 28.281  1.00 20.96  ? 772  TYR A CE2   1 
ATOM   3981 C  CZ    . TYR B 2 476 ? -1.882  23.249 28.638  1.00 20.26  ? 772  TYR A CZ    1 
ATOM   3982 O  OH    . TYR B 2 476 ? -2.942  23.306 27.787  1.00 23.56  ? 772  TYR A OH    1 
ATOM   3983 N  N     . LEU B 2 477 ? 1.687   23.513 34.744  1.00 16.06  ? 773  LEU A N     1 
ATOM   3984 C  CA    . LEU B 2 477 ? 2.519   23.278 35.921  1.00 19.18  ? 773  LEU A CA    1 
ATOM   3985 C  C     . LEU B 2 477 ? 2.245   21.883 36.447  1.00 19.01  ? 773  LEU A C     1 
ATOM   3986 O  O     . LEU B 2 477 ? 1.566   21.715 37.472  1.00 24.20  ? 773  LEU A O     1 
ATOM   3987 C  CB    . LEU B 2 477 ? 2.284   24.334 36.999  1.00 18.83  ? 773  LEU A CB    1 
ATOM   3988 C  CG    . LEU B 2 477 ? 2.645   25.751 36.549  1.00 28.39  ? 773  LEU A CG    1 
ATOM   3989 C  CD1   . LEU B 2 477 ? 1.870   26.744 37.366  1.00 22.56  ? 773  LEU A CD1   1 
ATOM   3990 C  CD2   . LEU B 2 477 ? 4.145   26.006 36.649  1.00 22.52  ? 773  LEU A CD2   1 
ATOM   3991 N  N     . PRO B 2 478 ? 2.744   20.852 35.752  1.00 22.59  ? 774  PRO A N     1 
ATOM   3992 C  CA    . PRO B 2 478 ? 2.574   19.484 36.264  1.00 28.49  ? 774  PRO A CA    1 
ATOM   3993 C  C     . PRO B 2 478 ? 3.226   19.260 37.618  1.00 25.73  ? 774  PRO A C     1 
ATOM   3994 O  O     . PRO B 2 478 ? 2.763   18.398 38.364  1.00 23.53  ? 774  PRO A O     1 
ATOM   3995 C  CB    . PRO B 2 478 ? 3.211   18.608 35.175  1.00 27.98  ? 774  PRO A CB    1 
ATOM   3996 C  CG    . PRO B 2 478 ? 4.149   19.505 34.464  1.00 22.16  ? 774  PRO A CG    1 
ATOM   3997 C  CD    . PRO B 2 478 ? 3.565   20.895 34.534  1.00 20.24  ? 774  PRO A CD    1 
ATOM   3998 N  N     . ASP B 2 479 ? 4.256   20.018 37.987  1.00 25.59  ? 775  ASP A N     1 
ATOM   3999 C  CA    . ASP B 2 479 ? 4.895   19.801 39.286  1.00 27.37  ? 775  ASP A CA    1 
ATOM   4000 C  C     . ASP B 2 479 ? 4.089   20.353 40.457  1.00 29.25  ? 775  ASP A C     1 
ATOM   4001 O  O     . ASP B 2 479 ? 4.518   20.209 41.606  1.00 25.78  ? 775  ASP A O     1 
ATOM   4002 C  CB    . ASP B 2 479 ? 6.296   20.419 39.307  1.00 31.52  ? 775  ASP A CB    1 
ATOM   4003 C  CG    . ASP B 2 479 ? 7.216   19.844 38.234  1.00 48.47  ? 775  ASP A CG    1 
ATOM   4004 O  OD1   . ASP B 2 479 ? 8.236   20.495 37.906  1.00 55.11  ? 775  ASP A OD1   1 
ATOM   4005 O  OD2   . ASP B 2 479 ? 6.919   18.747 37.718  1.00 57.64  ? 775  ASP A OD2   1 
ATOM   4006 N  N     . ILE B 2 480 ? 2.936   20.977 40.209  1.00 23.30  ? 776  ILE A N     1 
ATOM   4007 C  CA    . ILE B 2 480 ? 2.173   21.562 41.299  1.00 23.56  ? 776  ILE A CA    1 
ATOM   4008 C  C     . ILE B 2 480 ? 1.660   20.509 42.289  1.00 29.09  ? 776  ILE A C     1 
ATOM   4009 O  O     . ILE B 2 480 ? 1.316   20.854 43.417  1.00 33.25  ? 776  ILE A O     1 
ATOM   4010 C  CB    . ILE B 2 480 ? 1.013   22.408 40.739  1.00 24.51  ? 776  ILE A CB    1 
ATOM   4011 C  CG1   . ILE B 2 480 ? 0.625   23.499 41.728  1.00 31.42  ? 776  ILE A CG1   1 
ATOM   4012 C  CG2   . ILE B 2 480 ? -0.185  21.549 40.432  1.00 29.32  ? 776  ILE A CG2   1 
ATOM   4013 C  CD1   . ILE B 2 480 ? 1.375   24.760 41.549  1.00 37.65  ? 776  ILE A CD1   1 
ATOM   4014 N  N     . THR B 2 481 ? 1.592   19.239 41.904  1.00 35.01  ? 777  THR A N     1 
ATOM   4015 C  CA    . THR B 2 481 ? 1.187   18.192 42.840  1.00 46.84  ? 777  THR A CA    1 
ATOM   4016 C  C     . THR B 2 481 ? 2.344   17.320 43.301  1.00 45.55  ? 777  THR A C     1 
ATOM   4017 O  O     . THR B 2 481 ? 2.113   16.352 44.034  1.00 40.20  ? 777  THR A O     1 
ATOM   4018 C  CB    . THR B 2 481 ? 0.104   17.294 42.231  1.00 50.89  ? 777  THR A CB    1 
ATOM   4019 O  OG1   . THR B 2 481 ? 0.475   16.929 40.897  1.00 58.84  ? 777  THR A OG1   1 
ATOM   4020 C  CG2   . THR B 2 481 ? -1.242  18.008 42.212  1.00 59.32  ? 777  THR A CG2   1 
ATOM   4021 N  N     . SER B 2 482 ? 3.575   17.638 42.903  1.00 38.40  ? 778  SER A N     1 
ATOM   4022 C  CA    . SER B 2 482 ? 4.722   16.813 43.255  1.00 44.87  ? 778  SER A CA    1 
ATOM   4023 C  C     . SER B 2 482 ? 4.832   16.634 44.769  1.00 41.77  ? 778  SER A C     1 
ATOM   4024 O  O     . SER B 2 482 ? 4.427   17.493 45.558  1.00 39.27  ? 778  SER A O     1 
ATOM   4025 C  CB    . SER B 2 482 ? 6.004   17.439 42.714  1.00 46.77  ? 778  SER A CB    1 
ATOM   4026 O  OG    . SER B 2 482 ? 7.149   16.829 43.285  1.00 40.68  ? 778  SER A OG    1 
ATOM   4027 N  N     . ARG B 2 483 ? 5.388   15.501 45.176  1.00 36.50  ? 779  ARG A N     1 
ATOM   4028 C  CA    . ARG B 2 483 ? 5.580   15.265 46.597  1.00 36.59  ? 779  ARG A CA    1 
ATOM   4029 C  C     . ARG B 2 483 ? 6.906   15.799 47.113  1.00 43.38  ? 779  ARG A C     1 
ATOM   4030 O  O     . ARG B 2 483 ? 7.088   15.873 48.334  1.00 43.90  ? 779  ARG A O     1 
ATOM   4031 C  CB    . ARG B 2 483 ? 5.464   13.774 46.912  1.00 41.76  ? 779  ARG A CB    1 
ATOM   4032 C  CG    . ARG B 2 483 ? 4.140   13.445 47.570  1.00 47.94  ? 779  ARG A CG    1 
ATOM   4033 C  CD    . ARG B 2 483 ? 2.997   13.647 46.587  1.00 55.68  ? 779  ARG A CD    1 
ATOM   4034 N  NE    . ARG B 2 483 ? 2.892   12.512 45.674  1.00 53.41  ? 779  ARG A NE    1 
ATOM   4035 C  CZ    . ARG B 2 483 ? 2.353   12.565 44.461  1.00 51.97  ? 779  ARG A CZ    1 
ATOM   4036 N  NH1   . ARG B 2 483 ? 1.850   13.706 43.985  1.00 39.44  ? 779  ARG A NH1   1 
ATOM   4037 N  NH2   . ARG B 2 483 ? 2.317   11.467 43.721  1.00 53.98  ? 779  ARG A NH2   1 
ATOM   4038 N  N     . ASN B 2 484 ? 7.825   16.178 46.228  1.00 36.37  ? 780  ASN A N     1 
ATOM   4039 C  CA    . ASN B 2 484 ? 9.054   16.838 46.652  1.00 39.88  ? 780  ASN A CA    1 
ATOM   4040 C  C     . ASN B 2 484 ? 8.753   18.301 46.949  1.00 37.51  ? 780  ASN A C     1 
ATOM   4041 O  O     . ASN B 2 484 ? 8.239   19.028 46.088  1.00 35.65  ? 780  ASN A O     1 
ATOM   4042 C  CB    . ASN B 2 484 ? 10.141  16.712 45.588  1.00 50.48  ? 780  ASN A CB    1 
ATOM   4043 C  CG    . ASN B 2 484 ? 11.422  17.434 45.981  1.00 55.95  ? 780  ASN A CG    1 
ATOM   4044 O  OD1   . ASN B 2 484 ? 11.557  18.641 45.778  1.00 56.99  ? 780  ASN A OD1   1 
ATOM   4045 N  ND2   . ASN B 2 484 ? 12.363  16.696 46.558  1.00 54.27  ? 780  ASN A ND2   1 
ATOM   4046 N  N     . PHE B 2 485 ? 9.082   18.734 48.163  1.00 35.93  ? 781  PHE A N     1 
ATOM   4047 C  CA    . PHE B 2 485 ? 8.661   20.052 48.615  1.00 40.29  ? 781  PHE A CA    1 
ATOM   4048 C  C     . PHE B 2 485 ? 9.256   21.158 47.753  1.00 37.16  ? 781  PHE A C     1 
ATOM   4049 O  O     . PHE B 2 485 ? 8.574   22.140 47.434  1.00 35.57  ? 781  PHE A O     1 
ATOM   4050 C  CB    . PHE B 2 485 ? 9.052   20.254 50.081  1.00 30.53  ? 781  PHE A CB    1 
ATOM   4051 C  CG    . PHE B 2 485 ? 8.823   21.645 50.569  1.00 35.21  ? 781  PHE A CG    1 
ATOM   4052 C  CD1   . PHE B 2 485 ? 9.829   22.600 50.492  1.00 37.97  ? 781  PHE A CD1   1 
ATOM   4053 C  CD2   . PHE B 2 485 ? 7.592   22.010 51.087  1.00 41.30  ? 781  PHE A CD2   1 
ATOM   4054 C  CE1   . PHE B 2 485 ? 9.611   23.893 50.930  1.00 44.68  ? 781  PHE A CE1   1 
ATOM   4055 C  CE2   . PHE B 2 485 ? 7.365   23.301 51.528  1.00 45.11  ? 781  PHE A CE2   1 
ATOM   4056 C  CZ    . PHE B 2 485 ? 8.378   24.244 51.450  1.00 49.26  ? 781  PHE A CZ    1 
ATOM   4057 N  N     . ASN B 2 486 ? 10.536  21.035 47.395  1.00 32.88  ? 782  ASN A N     1 
ATOM   4058 C  CA    . ASN B 2 486 ? 11.187  22.098 46.636  1.00 37.40  ? 782  ASN A CA    1 
ATOM   4059 C  C     . ASN B 2 486 ? 10.626  22.173 45.227  1.00 31.87  ? 782  ASN A C     1 
ATOM   4060 O  O     . ASN B 2 486 ? 10.408  23.266 44.692  1.00 33.69  ? 782  ASN A O     1 
ATOM   4061 C  CB    . ASN B 2 486 ? 12.699  21.873 46.592  1.00 46.20  ? 782  ASN A CB    1 
ATOM   4062 C  CG    . ASN B 2 486 ? 13.377  22.154 47.926  1.00 61.00  ? 782  ASN A CG    1 
ATOM   4063 O  OD1   . ASN B 2 486 ? 12.829  22.849 48.786  1.00 62.93  ? 782  ASN A OD1   1 
ATOM   4064 N  ND2   . ASN B 2 486 ? 14.578  21.610 48.103  1.00 59.52  ? 782  ASN A ND2   1 
ATOM   4065 N  N     . VAL B 2 487 ? 10.391  21.015 44.615  1.00 31.65  ? 783  VAL A N     1 
ATOM   4066 C  CA    . VAL B 2 487 ? 9.796   20.979 43.287  1.00 34.05  ? 783  VAL A CA    1 
ATOM   4067 C  C     . VAL B 2 487 ? 8.411   21.613 43.317  1.00 33.62  ? 783  VAL A C     1 
ATOM   4068 O  O     . VAL B 2 487 ? 8.069   22.438 42.468  1.00 25.21  ? 783  VAL A O     1 
ATOM   4069 C  CB    . VAL B 2 487 ? 9.755   19.531 42.768  1.00 38.37  ? 783  VAL A CB    1 
ATOM   4070 C  CG1   . VAL B 2 487 ? 8.780   19.400 41.624  1.00 39.63  ? 783  VAL A CG1   1 
ATOM   4071 C  CG2   . VAL B 2 487 ? 11.150  19.096 42.330  1.00 40.49  ? 783  VAL A CG2   1 
ATOM   4072 N  N     . ARG B 2 488 ? 7.609   21.259 44.321  1.00 29.85  ? 784  ARG A N     1 
ATOM   4073 C  CA    . ARG B 2 488 ? 6.240   21.751 44.381  1.00 26.98  ? 784  ARG A CA    1 
ATOM   4074 C  C     . ARG B 2 488 ? 6.200   23.238 44.697  1.00 23.39  ? 784  ARG A C     1 
ATOM   4075 O  O     . ARG B 2 488 ? 5.344   23.963 44.180  1.00 24.20  ? 784  ARG A O     1 
ATOM   4076 C  CB    . ARG B 2 488 ? 5.444   20.960 45.419  1.00 27.95  ? 784  ARG A CB    1 
ATOM   4077 C  CG    . ARG B 2 488 ? 3.984   21.370 45.505  1.00 30.52  ? 784  ARG A CG    1 
ATOM   4078 C  CD    . ARG B 2 488 ? 3.244   20.589 46.576  1.00 36.46  ? 784  ARG A CD    1 
ATOM   4079 N  NE    . ARG B 2 488 ? 3.798   20.825 47.909  1.00 37.15  ? 784  ARG A NE    1 
ATOM   4080 C  CZ    . ARG B 2 488 ? 4.422   19.895 48.637  1.00 43.72  ? 784  ARG A CZ    1 
ATOM   4081 N  NH1   . ARG B 2 488 ? 4.577   18.666 48.157  1.00 41.56  ? 784  ARG A NH1   1 
ATOM   4082 N  NH2   . ARG B 2 488 ? 4.895   20.193 49.841  1.00 33.64  ? 784  ARG A NH2   1 
ATOM   4083 N  N     . SER B 2 489 ? 7.105   23.705 45.554  1.00 24.14  ? 785  SER A N     1 
ATOM   4084 C  CA    . SER B 2 489 ? 7.117   25.118 45.908  1.00 22.71  ? 785  SER A CA    1 
ATOM   4085 C  C     . SER B 2 489 ? 7.464   25.964 44.704  1.00 29.19  ? 785  SER A C     1 
ATOM   4086 O  O     . SER B 2 489 ? 6.880   27.031 44.497  1.00 25.33  ? 785  SER A O     1 
ATOM   4087 C  CB    . SER B 2 489 ? 8.116   25.385 47.035  1.00 25.82  ? 785  SER A CB    1 
ATOM   4088 O  OG    . SER B 2 489 ? 7.914   24.490 48.103  1.00 39.82  ? 785  SER A OG    1 
ATOM   4089 N  N     . PHE B 2 490 ? 8.424   25.501 43.905  1.00 29.56  ? 786  PHE A N     1 
ATOM   4090 C  CA    . PHE B 2 490 ? 8.773   26.212 42.693  1.00 30.23  ? 786  PHE A CA    1 
ATOM   4091 C  C     . PHE B 2 490 ? 7.562   26.334 41.786  1.00 24.56  ? 786  PHE A C     1 
ATOM   4092 O  O     . PHE B 2 490 ? 7.236   27.427 41.324  1.00 21.89  ? 786  PHE A O     1 
ATOM   4093 C  CB    . PHE B 2 490 ? 9.911   25.514 41.958  1.00 30.35  ? 786  PHE A CB    1 
ATOM   4094 C  CG    . PHE B 2 490 ? 10.332  26.258 40.731  1.00 36.52  ? 786  PHE A CG    1 
ATOM   4095 C  CD1   . PHE B 2 490 ? 10.998  27.468 40.845  1.00 36.79  ? 786  PHE A CD1   1 
ATOM   4096 C  CD2   . PHE B 2 490 ? 9.998   25.796 39.469  1.00 39.22  ? 786  PHE A CD2   1 
ATOM   4097 C  CE1   . PHE B 2 490 ? 11.357  28.190 39.711  1.00 43.09  ? 786  PHE A CE1   1 
ATOM   4098 C  CE2   . PHE B 2 490 ? 10.358  26.510 38.329  1.00 38.32  ? 786  PHE A CE2   1 
ATOM   4099 C  CZ    . PHE B 2 490 ? 11.041  27.706 38.449  1.00 34.03  ? 786  PHE A CZ    1 
ATOM   4100 N  N     . ALA B 2 491 ? 6.858   25.217 41.560  1.00 18.56  ? 787  ALA A N     1 
ATOM   4101 C  CA    . ALA B 2 491 ? 5.672   25.249 40.711  1.00 17.13  ? 787  ALA A CA    1 
ATOM   4102 C  C     . ALA B 2 491 ? 4.604   26.173 41.277  1.00 16.73  ? 787  ALA A C     1 
ATOM   4103 O  O     . ALA B 2 491 ? 3.888   26.831 40.519  1.00 20.01  ? 787  ALA A O     1 
ATOM   4104 C  CB    . ALA B 2 491 ? 5.110   23.836 40.527  1.00 17.67  ? 787  ALA A CB    1 
ATOM   4105 N  N     . GLU B 2 492 ? 4.457   26.212 42.606  1.00 22.74  ? 788  GLU A N     1 
ATOM   4106 C  CA    . GLU B 2 492 ? 3.492   27.118 43.221  1.00 18.81  ? 788  GLU A CA    1 
ATOM   4107 C  C     . GLU B 2 492 ? 3.896   28.562 43.004  1.00 20.80  ? 788  GLU A C     1 
ATOM   4108 O  O     . GLU B 2 492 ? 3.054   29.418 42.697  1.00 18.76  ? 788  GLU A O     1 
ATOM   4109 C  CB    . GLU B 2 492 ? 3.376   26.828 44.725  1.00 23.41  ? 788  GLU A CB    1 
ATOM   4110 C  CG    . GLU B 2 492 ? 2.415   25.704 45.076  1.00 27.99  ? 788  GLU A CG    1 
ATOM   4111 C  CD    . GLU B 2 492 ? 2.473   25.310 46.570  1.00 38.71  ? 788  GLU A CD    1 
ATOM   4112 O  OE1   . GLU B 2 492 ? 2.066   24.174 46.911  1.00 39.94  ? 788  GLU A OE1   1 
ATOM   4113 O  OE2   . GLU B 2 492 ? 2.920   26.132 47.405  1.00 44.03  ? 788  GLU A OE2   1 
ATOM   4114 N  N     . ARG B 2 493 ? 5.180   28.860 43.179  1.00 18.56  ? 789  ARG A N     1 
ATOM   4115 C  CA    . ARG B 2 493 ? 5.634   30.219 42.906  1.00 23.63  ? 789  ARG A CA    1 
ATOM   4116 C  C     . ARG B 2 493 ? 5.468   30.573 41.436  1.00 22.65  ? 789  ARG A C     1 
ATOM   4117 O  O     . ARG B 2 493 ? 5.195   31.732 41.106  1.00 20.35  ? 789  ARG A O     1 
ATOM   4118 C  CB    . ARG B 2 493 ? 7.082   30.388 43.354  1.00 21.55  ? 789  ARG A CB    1 
ATOM   4119 C  CG    . ARG B 2 493 ? 7.190   30.540 44.854  1.00 28.13  ? 789  ARG A CG    1 
ATOM   4120 C  CD    . ARG B 2 493 ? 8.470   29.940 45.399  1.00 32.49  ? 789  ARG A CD    1 
ATOM   4121 N  NE    . ARG B 2 493 ? 9.607   30.281 44.564  1.00 36.75  ? 789  ARG A NE    1 
ATOM   4122 C  CZ    . ARG B 2 493 ? 10.622  29.464 44.322  1.00 38.41  ? 789  ARG A CZ    1 
ATOM   4123 N  NH1   . ARG B 2 493 ? 10.646  28.258 44.861  1.00 30.87  ? 789  ARG A NH1   1 
ATOM   4124 N  NH2   . ARG B 2 493 ? 11.617  29.863 43.539  1.00 53.86  ? 789  ARG A NH2   1 
ATOM   4125 N  N     . MET B 2 494 ? 5.577   29.588 40.538  1.00 17.55  ? 790  MET A N     1 
ATOM   4126 C  CA    . MET B 2 494 ? 5.387   29.909 39.127  1.00 14.60  ? 790  MET A CA    1 
ATOM   4127 C  C     . MET B 2 494 ? 3.921   30.144 38.803  1.00 14.24  ? 790  MET A C     1 
ATOM   4128 O  O     . MET B 2 494 ? 3.602   30.966 37.940  1.00 16.51  ? 790  MET A O     1 
ATOM   4129 C  CB    . MET B 2 494 ? 5.961   28.805 38.250  1.00 18.24  ? 790  MET A CB    1 
ATOM   4130 C  CG    . MET B 2 494 ? 7.471   28.714 38.353  1.00 24.05  ? 790  MET A CG    1 
ATOM   4131 S  SD    . MET B 2 494 ? 8.345   30.208 37.811  1.00 36.93  ? 790  MET A SD    1 
ATOM   4132 C  CE    . MET B 2 494 ? 8.401   31.317 39.226  1.00 36.55  ? 790  MET A CE    1 
ATOM   4133 N  N     . ALA B 2 495 ? 3.025   29.412 39.462  1.00 14.63  ? 791  ALA A N     1 
ATOM   4134 C  CA    . ALA B 2 495 ? 1.600   29.661 39.317  1.00 14.43  ? 791  ALA A CA    1 
ATOM   4135 C  C     . ALA B 2 495 ? 1.260   31.080 39.743  1.00 15.64  ? 791  ALA A C     1 
ATOM   4136 O  O     . ALA B 2 495 ? 0.431   31.756 39.115  1.00 15.91  ? 791  ALA A O     1 
ATOM   4137 C  CB    . ALA B 2 495 ? 0.811   28.638 40.145  1.00 16.70  ? 791  ALA A CB    1 
ATOM   4138 N  N     . MET B 2 496 ? 1.908   31.566 40.793  1.00 18.90  ? 792  MET A N     1 
ATOM   4139 C  CA    . MET B 2 496 ? 1.610   32.919 41.235  1.00 16.79  ? 792  MET A CA    1 
ATOM   4140 C  C     . MET B 2 496 ? 2.220   33.947 40.293  1.00 15.38  ? 792  MET A C     1 
ATOM   4141 O  O     . MET B 2 496 ? 1.583   34.945 39.944  1.00 19.80  ? 792  MET A O     1 
ATOM   4142 C  CB    . MET B 2 496 ? 2.144   33.119 42.664  1.00 14.56  ? 792  MET A CB    1 
ATOM   4143 C  CG    . MET B 2 496 ? 1.642   32.093 43.701  1.00 32.06  ? 792  MET A CG    1 
ATOM   4144 S  SD    . MET B 2 496 ? 2.208   32.414 45.416  1.00 42.57  ? 792  MET A SD    1 
ATOM   4145 C  CE    . MET B 2 496 ? 3.781   31.612 45.499  1.00 45.10  ? 792  MET A CE    1 
ATOM   4146 N  N     . ASN B 2 497 ? 3.451   33.703 39.864  1.00 16.10  ? 793  ASN A N     1 
ATOM   4147 C  CA    . ASN B 2 497 ? 4.255   34.696 39.172  1.00 15.01  ? 793  ASN A CA    1 
ATOM   4148 C  C     . ASN B 2 497 ? 3.905   34.797 37.691  1.00 17.89  ? 793  ASN A C     1 
ATOM   4149 O  O     . ASN B 2 497 ? 3.934   35.891 37.114  1.00 16.06  ? 793  ASN A O     1 
ATOM   4150 C  CB    . ASN B 2 497 ? 5.725   34.322 39.340  1.00 18.25  ? 793  ASN A CB    1 
ATOM   4151 C  CG    . ASN B 2 497 ? 6.650   35.370 38.804  1.00 28.87  ? 793  ASN A CG    1 
ATOM   4152 O  OD1   . ASN B 2 497 ? 7.341   35.147 37.810  1.00 26.83  ? 793  ASN A OD1   1 
ATOM   4153 N  ND2   . ASN B 2 497 ? 6.680   36.526 39.463  1.00 25.34  ? 793  ASN A ND2   1 
ATOM   4154 N  N     . THR B 2 498 ? 3.605   33.673 37.051  1.00 15.94  ? 794  THR A N     1 
ATOM   4155 C  CA    . THR B 2 498 ? 3.435   33.706 35.605  1.00 20.90  ? 794  THR A CA    1 
ATOM   4156 C  C     . THR B 2 498 ? 2.270   34.587 35.169  1.00 12.04  ? 794  THR A C     1 
ATOM   4157 O  O     . THR B 2 498 ? 2.436   35.326 34.188  1.00 14.02  ? 794  THR A O     1 
ATOM   4158 C  CB    . THR B 2 498 ? 3.327   32.276 35.053  1.00 24.28  ? 794  THR A CB    1 
ATOM   4159 O  OG1   . THR B 2 498 ? 4.596   31.633 35.219  1.00 26.55  ? 794  THR A OG1   1 
ATOM   4160 C  CG2   . THR B 2 498 ? 3.002   32.300 33.561  1.00 18.98  ? 794  THR A CG2   1 
ATOM   4161 N  N     . PRO B 2 499 ? 1.120   34.607 35.842  1.00 14.75  ? 795  PRO A N     1 
ATOM   4162 C  CA    . PRO B 2 499 ? 0.077   35.558 35.439  1.00 14.61  ? 795  PRO A CA    1 
ATOM   4163 C  C     . PRO B 2 499 ? 0.519   36.995 35.578  1.00 24.18  ? 795  PRO A C     1 
ATOM   4164 O  O     . PRO B 2 499 ? -0.037  37.866 34.907  1.00 20.86  ? 795  PRO A O     1 
ATOM   4165 C  CB    . PRO B 2 499 ? -1.079  35.236 36.389  1.00 12.27  ? 795  PRO A CB    1 
ATOM   4166 C  CG    . PRO B 2 499 ? -0.855  33.739 36.732  1.00 13.80  ? 795  PRO A CG    1 
ATOM   4167 C  CD    . PRO B 2 499 ? 0.635   33.669 36.868  1.00 15.56  ? 795  PRO A CD    1 
ATOM   4168 N  N     . ILE B 2 500 ? 1.502   37.270 36.426  1.00 20.34  ? 796  ILE A N     1 
ATOM   4169 C  CA    . ILE B 2 500 ? 1.984   38.638 36.587  1.00 17.00  ? 796  ILE A CA    1 
ATOM   4170 C  C     . ILE B 2 500 ? 3.004   38.960 35.512  1.00 17.13  ? 796  ILE A C     1 
ATOM   4171 O  O     . ILE B 2 500 ? 2.830   39.891 34.717  1.00 14.34  ? 796  ILE A O     1 
ATOM   4172 C  CB    . ILE B 2 500 ? 2.598   38.828 37.986  1.00 18.02  ? 796  ILE A CB    1 
ATOM   4173 C  CG1   . ILE B 2 500 ? 1.533   38.660 39.075  1.00 22.32  ? 796  ILE A CG1   1 
ATOM   4174 C  CG2   . ILE B 2 500 ? 3.309   40.183 38.067  1.00 19.21  ? 796  ILE A CG2   1 
ATOM   4175 C  CD1   . ILE B 2 500 ? 2.132   38.476 40.467  1.00 23.69  ? 796  ILE A CD1   1 
ATOM   4176 N  N     . GLN B 2 501 ? 4.095   38.189 35.494  1.00 11.50  ? 797  GLN A N     1 
ATOM   4177 C  CA    . GLN B 2 501 ? 5.174   38.428 34.546  1.00 17.21  ? 797  GLN A CA    1 
ATOM   4178 C  C     . GLN B 2 501 ? 4.688   38.254 33.120  1.00 20.68  ? 797  GLN A C     1 
ATOM   4179 O  O     . GLN B 2 501 ? 5.029   39.052 32.235  1.00 18.85  ? 797  GLN A O     1 
ATOM   4180 C  CB    . GLN B 2 501 ? 6.337   37.483 34.847  1.00 19.16  ? 797  GLN A CB    1 
ATOM   4181 C  CG    . GLN B 2 501 ? 7.222   37.990 35.989  1.00 24.70  ? 797  GLN A CG    1 
ATOM   4182 C  CD    . GLN B 2 501 ? 8.033   39.227 35.592  1.00 34.27  ? 797  GLN A CD    1 
ATOM   4183 O  OE1   . GLN B 2 501 ? 7.949   39.718 34.456  1.00 42.71  ? 797  GLN A OE1   1 
ATOM   4184 N  NE2   . GLN B 2 501 ? 8.823   39.734 36.528  1.00 30.09  ? 797  GLN A NE2   1 
ATOM   4185 N  N     . GLY B 2 502 ? 3.867   37.228 32.888  1.00 18.25  ? 798  GLY A N     1 
ATOM   4186 C  CA    . GLY B 2 502 ? 3.362   36.967 31.556  1.00 14.88  ? 798  GLY A CA    1 
ATOM   4187 C  C     . GLY B 2 502 ? 2.345   37.984 31.077  1.00 19.19  ? 798  GLY A C     1 
ATOM   4188 O  O     . GLY B 2 502 ? 2.261   38.260 29.878  1.00 19.20  ? 798  GLY A O     1 
ATOM   4189 N  N     . SER B 2 503 ? 1.534   38.526 31.984  1.00 13.84  ? 799  SER A N     1 
ATOM   4190 C  CA    . SER B 2 503 ? 0.603   39.569 31.566  1.00 10.91  ? 799  SER A CA    1 
ATOM   4191 C  C     . SER B 2 503 ? 1.355   40.855 31.253  1.00 10.75  ? 799  SER A C     1 
ATOM   4192 O  O     . SER B 2 503 ? 1.006   41.573 30.305  1.00 14.54  ? 799  SER A O     1 
ATOM   4193 C  CB    . SER B 2 503 ? -0.465  39.801 32.640  1.00 15.21  ? 799  SER A CB    1 
ATOM   4194 O  OG    . SER B 2 503 ? -1.287  38.638 32.795  1.00 17.04  ? 799  SER A OG    1 
ATOM   4195 N  N     . ALA B 2 504 ? 2.413   41.136 32.013  1.00 13.83  ? 800  ALA A N     1 
ATOM   4196 C  CA    . ALA B 2 504 ? 3.242   42.300 31.721  1.00 18.02  ? 800  ALA A CA    1 
ATOM   4197 C  C     . ALA B 2 504 ? 3.931   42.140 30.372  1.00 21.37  ? 800  ALA A C     1 
ATOM   4198 O  O     . ALA B 2 504 ? 4.016   43.092 29.587  1.00 18.70  ? 800  ALA A O     1 
ATOM   4199 C  CB    . ALA B 2 504 ? 4.263   42.516 32.846  1.00 14.73  ? 800  ALA A CB    1 
ATOM   4200 N  N     . ALA B 2 505 ? 4.407   40.929 30.076  1.00 15.99  ? 801  ALA A N     1 
ATOM   4201 C  CA    . ALA B 2 505 ? 4.968   40.666 28.763  1.00 18.39  ? 801  ALA A CA    1 
ATOM   4202 C  C     . ALA B 2 505 ? 3.917   40.852 27.681  1.00 12.57  ? 801  ALA A C     1 
ATOM   4203 O  O     . ALA B 2 505 ? 4.188   41.486 26.661  1.00 14.44  ? 801  ALA A O     1 
ATOM   4204 C  CB    . ALA B 2 505 ? 5.555   39.259 28.705  1.00 20.66  ? 801  ALA A CB    1 
ATOM   4205 N  N     . ASP B 2 506 ? 2.707   40.327 27.900  1.00 13.52  ? 802  ASP A N     1 
ATOM   4206 C  CA    . ASP B 2 506 ? 1.623   40.524 26.945  1.00 15.30  ? 802  ASP A CA    1 
ATOM   4207 C  C     . ASP B 2 506 ? 1.402   42.005 26.655  1.00 18.52  ? 802  ASP A C     1 
ATOM   4208 O  O     . ASP B 2 506 ? 1.217   42.398 25.498  1.00 16.75  ? 802  ASP A O     1 
ATOM   4209 C  CB    . ASP B 2 506 ? 0.321   39.931 27.478  1.00 16.10  ? 802  ASP A CB    1 
ATOM   4210 C  CG    . ASP B 2 506 ? 0.324   38.391 27.535  1.00 37.80  ? 802  ASP A CG    1 
ATOM   4211 O  OD1   . ASP B 2 506 ? -0.613  37.850 28.163  1.00 30.64  ? 802  ASP A OD1   1 
ATOM   4212 O  OD2   . ASP B 2 506 ? 1.226   37.728 26.963  1.00 32.27  ? 802  ASP A OD2   1 
ATOM   4213 N  N     . ILE B 2 507 ? 1.385   42.833 27.698  1.00 10.78  ? 803  ILE A N     1 
ATOM   4214 C  CA    . ILE B 2 507 ? 1.095   44.257 27.519  1.00 15.93  ? 803  ILE A CA    1 
ATOM   4215 C  C     . ILE B 2 507 ? 2.179   44.910 26.692  1.00 11.24  ? 803  ILE A C     1 
ATOM   4216 O  O     . ILE B 2 507 ? 1.906   45.713 25.793  1.00 16.08  ? 803  ILE A O     1 
ATOM   4217 C  CB    . ILE B 2 507 ? 0.959   44.954 28.881  1.00 14.22  ? 803  ILE A CB    1 
ATOM   4218 C  CG1   . ILE B 2 507 ? -0.323  44.493 29.583  1.00 20.60  ? 803  ILE A CG1   1 
ATOM   4219 C  CG2   . ILE B 2 507 ? 1.016   46.488 28.706  1.00 15.22  ? 803  ILE A CG2   1 
ATOM   4220 C  CD1   . ILE B 2 507 ? -0.299  44.731 31.080  1.00 18.51  ? 803  ILE A CD1   1 
ATOM   4221 N  N     . ILE B 2 508 ? 3.431   44.611 27.025  1.00 14.45  ? 804  ILE A N     1 
ATOM   4222 C  CA    . ILE B 2 508 ? 4.550   45.193 26.297  1.00 18.98  ? 804  ILE A CA    1 
ATOM   4223 C  C     . ILE B 2 508 ? 4.467   44.816 24.826  1.00 16.57  ? 804  ILE A C     1 
ATOM   4224 O  O     . ILE B 2 508 ? 4.656   45.657 23.937  1.00 14.18  ? 804  ILE A O     1 
ATOM   4225 C  CB    . ILE B 2 508 ? 5.876   44.728 26.921  1.00 18.57  ? 804  ILE A CB    1 
ATOM   4226 C  CG1   . ILE B 2 508 ? 6.057   45.373 28.295  1.00 23.18  ? 804  ILE A CG1   1 
ATOM   4227 C  CG2   . ILE B 2 508 ? 7.039   45.062 26.011  1.00 26.20  ? 804  ILE A CG2   1 
ATOM   4228 C  CD1   . ILE B 2 508 ? 7.039   44.625 29.202  1.00 21.46  ? 804  ILE A CD1   1 
ATOM   4229 N  N     . LYS B 2 509 ? 4.184   43.542 24.544  1.00 14.05  ? 805  LYS A N     1 
ATOM   4230 C  CA    . LYS B 2 509 ? 4.034   43.121 23.155  1.00 14.43  ? 805  LYS A CA    1 
ATOM   4231 C  C     . LYS B 2 509 ? 2.912   43.874 22.471  1.00 13.31  ? 805  LYS A C     1 
ATOM   4232 O  O     . LYS B 2 509 ? 3.037   44.257 21.304  1.00 12.56  ? 805  LYS A O     1 
ATOM   4233 C  CB    . LYS B 2 509 ? 3.761   41.624 23.076  1.00 11.56  ? 805  LYS A CB    1 
ATOM   4234 C  CG    . LYS B 2 509 ? 4.949   40.808 23.470  1.00 15.59  ? 805  LYS A CG    1 
ATOM   4235 C  CD    . LYS B 2 509 ? 4.585   39.343 23.503  1.00 24.43  ? 805  LYS A CD    1 
ATOM   4236 C  CE    . LYS B 2 509 ? 5.821   38.494 23.722  1.00 33.74  ? 805  LYS A CE    1 
ATOM   4237 N  NZ    . LYS B 2 509 ? 5.474   37.036 23.640  1.00 28.78  ? 805  LYS A NZ    1 
ATOM   4238 N  N     . LYS B 2 510 ? 1.779   44.023 23.152  1.00 12.84  ? 806  LYS A N     1 
ATOM   4239 C  CA    . LYS B 2 510 ? 0.674   44.756 22.556  1.00 16.69  ? 806  LYS A CA    1 
ATOM   4240 C  C     . LYS B 2 510 ? 1.065   46.201 22.312  1.00 19.51  ? 806  LYS A C     1 
ATOM   4241 O  O     . LYS B 2 510 ? 0.674   46.804 21.297  1.00 14.08  ? 806  LYS A O     1 
ATOM   4242 C  CB    . LYS B 2 510 ? -0.561  44.691 23.458  1.00 17.15  ? 806  LYS A CB    1 
ATOM   4243 C  CG    . LYS B 2 510 ? -1.816  45.226 22.763  1.00 28.99  ? 806  LYS A CG    1 
ATOM   4244 C  CD    . LYS B 2 510 ? -3.106  44.894 23.515  1.00 36.12  ? 806  LYS A CD    1 
ATOM   4245 C  CE    . LYS B 2 510 ? -4.311  45.557 22.825  1.00 37.67  ? 806  LYS A CE    1 
ATOM   4246 N  NZ    . LYS B 2 510 ? -4.041  47.010 22.459  1.00 33.59  ? 806  LYS A NZ    1 
ATOM   4247 N  N     . ALA B 2 511 ? 1.839   46.767 23.240  1.00 13.89  ? 807  ALA A N     1 
ATOM   4248 C  CA    . ALA B 2 511 ? 2.308   48.139 23.104  1.00 19.47  ? 807  ALA A CA    1 
ATOM   4249 C  C     . ALA B 2 511 ? 3.222   48.283 21.901  1.00 14.40  ? 807  ALA A C     1 
ATOM   4250 O  O     . ALA B 2 511 ? 3.135   49.272 21.180  1.00 13.48  ? 807  ALA A O     1 
ATOM   4251 C  CB    . ALA B 2 511 ? 3.053   48.580 24.369  1.00 13.63  ? 807  ALA A CB    1 
ATOM   4252 N  N     . MET B 2 512 ? 4.116   47.309 21.678  1.00 13.94  ? 808  MET A N     1 
ATOM   4253 C  CA    . MET B 2 512 ? 4.993   47.369 20.503  1.00 14.68  ? 808  MET A CA    1 
ATOM   4254 C  C     . MET B 2 512 ? 4.206   47.306 19.199  1.00 14.48  ? 808  MET A C     1 
ATOM   4255 O  O     . MET B 2 512 ? 4.531   48.013 18.241  1.00 14.51  ? 808  MET A O     1 
ATOM   4256 C  CB    . MET B 2 512 ? 6.036   46.246 20.529  1.00 13.41  ? 808  MET A CB    1 
ATOM   4257 C  CG    . MET B 2 512 ? 6.993   46.290 21.688  1.00 18.37  ? 808  MET A CG    1 
ATOM   4258 S  SD    . MET B 2 512 ? 7.925   44.750 21.796  1.00 24.99  ? 808  MET A SD    1 
ATOM   4259 C  CE    . MET B 2 512 ? 9.047   44.947 20.376  1.00 22.53  ? 808  MET A CE    1 
ATOM   4260 N  N     . ILE B 2 513 ? 3.173   46.466 19.144  1.00 14.28  ? 809  ILE A N     1 
ATOM   4261 C  CA    . ILE B 2 513 ? 2.317   46.399 17.961  1.00 13.31  ? 809  ILE A CA    1 
ATOM   4262 C  C     . ILE B 2 513 ? 1.583   47.720 17.745  1.00 15.74  ? 809  ILE A C     1 
ATOM   4263 O  O     . ILE B 2 513 ? 1.553   48.257 16.629  1.00 17.65  ? 809  ILE A O     1 
ATOM   4264 C  CB    . ILE B 2 513 ? 1.337   45.224 18.092  1.00 15.62  ? 809  ILE A CB    1 
ATOM   4265 C  CG1   . ILE B 2 513 ? 2.130   43.912 18.090  1.00 20.02  ? 809  ILE A CG1   1 
ATOM   4266 C  CG2   . ILE B 2 513 ? 0.280   45.285 16.996  1.00 16.76  ? 809  ILE A CG2   1 
ATOM   4267 C  CD1   . ILE B 2 513 ? 1.382   42.751 18.688  1.00 19.20  ? 809  ILE A CD1   1 
ATOM   4268 N  N     . ASP B 2 514 ? 0.971   48.257 18.805  1.00 13.25  ? 810  ASP A N     1 
ATOM   4269 C  CA    . ASP B 2 514 ? 0.270   49.531 18.699  1.00 13.56  ? 810  ASP A CA    1 
ATOM   4270 C  C     . ASP B 2 514 ? 1.230   50.652 18.341  1.00 16.47  ? 810  ASP A C     1 
ATOM   4271 O  O     . ASP B 2 514 ? 0.880   51.562 17.587  1.00 15.81  ? 810  ASP A O     1 
ATOM   4272 C  CB    . ASP B 2 514 ? -0.427  49.870 20.025  1.00 15.16  ? 810  ASP A CB    1 
ATOM   4273 C  CG    . ASP B 2 514 ? -1.480  48.855 20.434  1.00 33.14  ? 810  ASP A CG    1 
ATOM   4274 O  OD1   . ASP B 2 514 ? -1.818  47.949 19.633  1.00 37.71  ? 810  ASP A OD1   1 
ATOM   4275 O  OD2   . ASP B 2 514 ? -1.979  48.978 21.579  1.00 36.10  ? 810  ASP A OD2   1 
ATOM   4276 N  N     . LEU B 2 515 ? 2.431   50.632 18.917  1.00 13.46  ? 811  LEU A N     1 
ATOM   4277 C  CA    . LEU B 2 515 ? 3.410   51.665 18.630  1.00 13.73  ? 811  LEU A CA    1 
ATOM   4278 C  C     . LEU B 2 515 ? 3.833   51.614 17.170  1.00 18.85  ? 811  LEU A C     1 
ATOM   4279 O  O     . LEU B 2 515 ? 3.875   52.641 16.484  1.00 22.09  ? 811  LEU A O     1 
ATOM   4280 C  CB    . LEU B 2 515 ? 4.616   51.491 19.545  1.00 17.83  ? 811  LEU A CB    1 
ATOM   4281 C  CG    . LEU B 2 515 ? 5.687   52.559 19.389  1.00 20.45  ? 811  LEU A CG    1 
ATOM   4282 C  CD1   . LEU B 2 515 ? 5.058   53.956 19.402  1.00 21.70  ? 811  LEU A CD1   1 
ATOM   4283 C  CD2   . LEU B 2 515 ? 6.721   52.425 20.497  1.00 28.55  ? 811  LEU A CD2   1 
ATOM   4284 N  N     . ASN B 2 516 ? 4.127   50.411 16.672  1.00 15.87  ? 812  ASN A N     1 
ATOM   4285 C  CA    . ASN B 2 516 ? 4.528   50.255 15.283  1.00 19.18  ? 812  ASN A CA    1 
ATOM   4286 C  C     . ASN B 2 516 ? 3.471   50.803 14.332  1.00 16.88  ? 812  ASN A C     1 
ATOM   4287 O  O     . ASN B 2 516 ? 3.802   51.514 13.378  1.00 17.55  ? 812  ASN A O     1 
ATOM   4288 C  CB    . ASN B 2 516 ? 4.799   48.781 14.986  1.00 20.21  ? 812  ASN A CB    1 
ATOM   4289 C  CG    . ASN B 2 516 ? 4.989   48.517 13.512  1.00 28.62  ? 812  ASN A CG    1 
ATOM   4290 O  OD1   . ASN B 2 516 ? 4.095   48.003 12.830  1.00 31.66  ? 812  ASN A OD1   1 
ATOM   4291 N  ND2   . ASN B 2 516 ? 6.161   48.860 13.010  1.00 21.24  ? 812  ASN A ND2   1 
ATOM   4292 N  N     . ALA B 2 517 ? 2.195   50.495 14.575  1.00 16.43  ? 813  ALA A N     1 
ATOM   4293 C  CA    . ALA B 2 517 ? 1.152   51.030 13.702  1.00 16.11  ? 813  ALA A CA    1 
ATOM   4294 C  C     . ALA B 2 517 ? 1.009   52.539 13.872  1.00 16.36  ? 813  ALA A C     1 
ATOM   4295 O  O     . ALA B 2 517 ? 0.772   53.254 12.894  1.00 17.17  ? 813  ALA A O     1 
ATOM   4296 C  CB    . ALA B 2 517 ? -0.184  50.339 13.967  1.00 19.44  ? 813  ALA A CB    1 
ATOM   4297 N  N     . ARG B 2 518 ? 1.146   53.045 15.103  1.00 16.95  ? 814  ARG A N     1 
ATOM   4298 C  CA    . ARG B 2 518 ? 1.009   54.487 15.317  1.00 17.93  ? 814  ARG A CA    1 
ATOM   4299 C  C     . ARG B 2 518 ? 2.137   55.255 14.645  1.00 16.55  ? 814  ARG A C     1 
ATOM   4300 O  O     . ARG B 2 518 ? 1.904   56.310 14.048  1.00 19.81  ? 814  ARG A O     1 
ATOM   4301 C  CB    . ARG B 2 518 ? 0.974   54.818 16.807  1.00 28.05  ? 814  ARG A CB    1 
ATOM   4302 C  CG    . ARG B 2 518 ? -0.360  54.569 17.447  1.00 39.37  ? 814  ARG A CG    1 
ATOM   4303 C  CD    . ARG B 2 518 ? -1.481  55.231 16.658  1.00 49.49  ? 814  ARG A CD    1 
ATOM   4304 N  NE    . ARG B 2 518 ? -1.298  56.674 16.516  1.00 51.06  ? 814  ARG A NE    1 
ATOM   4305 C  CZ    . ARG B 2 518 ? -1.460  57.553 17.502  1.00 54.44  ? 814  ARG A CZ    1 
ATOM   4306 N  NH1   . ARG B 2 518 ? -1.802  57.144 18.721  1.00 49.16  ? 814  ARG A NH1   1 
ATOM   4307 N  NH2   . ARG B 2 518 ? -1.279  58.847 17.269  1.00 54.97  ? 814  ARG A NH2   1 
ATOM   4308 N  N     . LEU B 2 519 ? 3.366   54.747 14.742  1.00 17.15  ? 815  LEU A N     1 
ATOM   4309 C  CA    . LEU B 2 519 ? 4.484   55.379 14.051  1.00 20.06  ? 815  LEU A CA    1 
ATOM   4310 C  C     . LEU B 2 519 ? 4.213   55.498 12.558  1.00 19.94  ? 815  LEU A C     1 
ATOM   4311 O  O     . LEU B 2 519 ? 4.507   56.537 11.948  1.00 21.31  ? 815  LEU A O     1 
ATOM   4312 C  CB    . LEU B 2 519 ? 5.765   54.589 14.303  1.00 20.68  ? 815  LEU A CB    1 
ATOM   4313 C  CG    . LEU B 2 519 ? 6.284   54.674 15.734  1.00 17.26  ? 815  LEU A CG    1 
ATOM   4314 C  CD1   . LEU B 2 519 ? 7.531   53.846 15.891  1.00 19.76  ? 815  LEU A CD1   1 
ATOM   4315 C  CD2   . LEU B 2 519 ? 6.556   56.134 16.091  1.00 16.04  ? 815  LEU A CD2   1 
ATOM   4316 N  N     . LYS B 2 520 ? 3.630   54.454 11.956  1.00 23.80  ? 816  LYS A N     1 
ATOM   4317 C  CA    . LYS B 2 520 ? 3.328   54.495 10.526  1.00 27.88  ? 816  LYS A CA    1 
ATOM   4318 C  C     . LYS B 2 520 ? 2.179   55.454 10.235  1.00 22.51  ? 816  LYS A C     1 
ATOM   4319 O  O     . LYS B 2 520 ? 2.223   56.202 9.252   1.00 23.49  ? 816  LYS A O     1 
ATOM   4320 C  CB    . LYS B 2 520 ? 2.978   53.100 10.003  1.00 26.10  ? 816  LYS A CB    1 
ATOM   4321 C  CG    . LYS B 2 520 ? 4.060   52.031 10.110  1.00 43.23  ? 816  LYS A CG    1 
ATOM   4322 C  CD    . LYS B 2 520 ? 5.465   52.606 10.180  1.00 56.78  ? 816  LYS A CD    1 
ATOM   4323 C  CE    . LYS B 2 520 ? 6.147   52.550 8.826   1.00 66.14  ? 816  LYS A CE    1 
ATOM   4324 N  NZ    . LYS B 2 520 ? 7.544   53.061 8.881   1.00 68.10  ? 816  LYS A NZ    1 
ATOM   4325 N  N     . GLU B 2 521 ? 1.128   55.416 11.058  1.00 21.46  ? 817  GLU A N     1 
ATOM   4326 C  CA    . GLU B 2 521 ? 0.014   56.342 10.889  1.00 20.50  ? 817  GLU A CA    1 
ATOM   4327 C  C     . GLU B 2 521 ? 0.484   57.786 10.955  1.00 25.77  ? 817  GLU A C     1 
ATOM   4328 O  O     . GLU B 2 521 ? 0.035   58.630 10.175  1.00 28.52  ? 817  GLU A O     1 
ATOM   4329 C  CB    . GLU B 2 521 ? -1.039  56.127 11.975  1.00 33.81  ? 817  GLU A CB    1 
ATOM   4330 C  CG    . GLU B 2 521 ? -1.798  54.827 11.993  1.00 61.97  ? 817  GLU A CG    1 
ATOM   4331 C  CD    . GLU B 2 521 ? -2.505  54.636 13.340  1.00 79.86  ? 817  GLU A CD    1 
ATOM   4332 O  OE1   . GLU B 2 521 ? -2.394  53.541 13.944  1.00 80.47  ? 817  GLU A OE1   1 
ATOM   4333 O  OE2   . GLU B 2 521 ? -3.155  55.602 13.805  1.00 82.62  ? 817  GLU A OE2   1 
ATOM   4334 N  N     . GLU B 2 522 ? 1.365   58.097 11.902  1.00 20.69  ? 818  GLU A N     1 
ATOM   4335 C  CA    . GLU B 2 522 ? 1.843   59.462 12.064  1.00 23.39  ? 818  GLU A CA    1 
ATOM   4336 C  C     . GLU B 2 522 ? 2.923   59.821 11.059  1.00 24.24  ? 818  GLU A C     1 
ATOM   4337 O  O     . GLU B 2 522 ? 3.416   60.952 11.086  1.00 26.89  ? 818  GLU A O     1 
ATOM   4338 C  CB    . GLU B 2 522 ? 2.386   59.671 13.479  1.00 27.42  ? 818  GLU A CB    1 
ATOM   4339 C  CG    . GLU B 2 522 ? 1.394   59.359 14.563  1.00 36.55  ? 818  GLU A CG    1 
ATOM   4340 C  CD    . GLU B 2 522 ? 0.181   60.253 14.493  1.00 59.62  ? 818  GLU A CD    1 
ATOM   4341 O  OE1   . GLU B 2 522 ? -0.931  59.737 14.247  1.00 66.30  ? 818  GLU A OE1   1 
ATOM   4342 O  OE2   . GLU B 2 522 ? 0.344   61.478 14.678  1.00 73.27  ? 818  GLU A OE2   1 
ATOM   4343 N  N     . ARG B 2 523 ? 3.313   58.874 10.206  1.00 23.59  ? 819  ARG A N     1 
ATOM   4344 C  CA    . ARG B 2 523 ? 4.390   59.061 9.241   1.00 26.81  ? 819  ARG A CA    1 
ATOM   4345 C  C     . ARG B 2 523 ? 5.658   59.595 9.903   1.00 24.83  ? 819  ARG A C     1 
ATOM   4346 O  O     . ARG B 2 523 ? 6.334   60.488 9.389   1.00 34.40  ? 819  ARG A O     1 
ATOM   4347 C  CB    . ARG B 2 523 ? 3.937   59.958 8.089   1.00 36.23  ? 819  ARG A CB    1 
ATOM   4348 C  CG    . ARG B 2 523 ? 3.218   59.166 7.006   1.00 33.79  ? 819  ARG A CG    1 
ATOM   4349 C  CD    . ARG B 2 523 ? 1.762   59.131 7.310   1.00 36.37  ? 819  ARG A CD    1 
ATOM   4350 N  NE    . ARG B 2 523 ? 0.955   58.691 6.186   1.00 34.41  ? 819  ARG A NE    1 
ATOM   4351 C  CZ    . ARG B 2 523 ? 0.467   57.459 6.052   1.00 31.21  ? 819  ARG A CZ    1 
ATOM   4352 N  NH1   . ARG B 2 523 ? 0.733   56.530 6.956   1.00 26.38  ? 819  ARG A NH1   1 
ATOM   4353 N  NH2   . ARG B 2 523 ? -0.280  57.152 4.999   1.00 37.65  ? 819  ARG A NH2   1 
ATOM   4354 N  N     . LEU B 2 524 ? 6.002   59.015 11.042  1.00 22.48  ? 820  LEU A N     1 
ATOM   4355 C  CA    . LEU B 2 524 ? 7.254   59.328 11.705  1.00 24.38  ? 820  LEU A CA    1 
ATOM   4356 C  C     . LEU B 2 524 ? 8.353   58.442 11.142  1.00 29.34  ? 820  LEU A C     1 
ATOM   4357 O  O     . LEU B 2 524 ? 8.106   57.303 10.745  1.00 26.43  ? 820  LEU A O     1 
ATOM   4358 C  CB    . LEU B 2 524 ? 7.122   59.116 13.206  1.00 24.79  ? 820  LEU A CB    1 
ATOM   4359 C  CG    . LEU B 2 524 ? 6.292   60.208 13.885  1.00 24.34  ? 820  LEU A CG    1 
ATOM   4360 C  CD1   . LEU B 2 524 ? 5.850   59.775 15.255  1.00 23.92  ? 820  LEU A CD1   1 
ATOM   4361 C  CD2   . LEU B 2 524 ? 7.063   61.509 13.976  1.00 29.86  ? 820  LEU A CD2   1 
ATOM   4362 N  N     . GLN B 2 525 ? 9.569   58.985 11.094  1.00 26.97  ? 821  GLN A N     1 
ATOM   4363 C  CA    . GLN B 2 525 ? 10.738  58.197 10.741  1.00 28.33  ? 821  GLN A CA    1 
ATOM   4364 C  C     . GLN B 2 525 ? 11.263  57.384 11.915  1.00 26.45  ? 821  GLN A C     1 
ATOM   4365 O  O     . GLN B 2 525 ? 12.100  56.500 11.716  1.00 26.68  ? 821  GLN A O     1 
ATOM   4366 C  CB    . GLN B 2 525 ? 11.846  59.115 10.219  1.00 35.44  ? 821  GLN A CB    1 
ATOM   4367 C  CG    . GLN B 2 525 ? 11.499  59.847 8.921   1.00 29.33  ? 821  GLN A CG    1 
ATOM   4368 C  CD    . GLN B 2 525 ? 12.679  60.604 8.383   1.00 35.92  ? 821  GLN A CD    1 
ATOM   4369 O  OE1   . GLN B 2 525 ? 12.670  61.835 8.315   1.00 37.79  ? 821  GLN A OE1   1 
ATOM   4370 N  NE2   . GLN B 2 525 ? 13.726  59.875 8.028   1.00 36.34  ? 821  GLN A NE2   1 
ATOM   4371 N  N     . ALA B 2 526 ? 10.808  57.675 13.124  1.00 20.42  ? 822  ALA A N     1 
ATOM   4372 C  CA    . ALA B 2 526 ? 11.235  56.933 14.308  1.00 21.90  ? 822  ALA A CA    1 
ATOM   4373 C  C     . ALA B 2 526 ? 11.073  55.434 14.100  1.00 24.67  ? 822  ALA A C     1 
ATOM   4374 O  O     . ALA B 2 526 ? 10.109  54.986 13.480  1.00 30.56  ? 822  ALA A O     1 
ATOM   4375 C  CB    . ALA B 2 526 ? 10.403  57.364 15.510  1.00 21.77  ? 822  ALA A CB    1 
ATOM   4376 N  N     . ARG B 2 527 ? 11.958  54.687 14.701  1.00 21.40  ? 823  ARG A N     1 
ATOM   4377 C  CA    . ARG B 2 527 ? 11.844  53.266 14.641  1.00 29.37  ? 823  ARG A CA    1 
ATOM   4378 C  C     . ARG B 2 527 ? 12.260  52.491 15.901  1.00 28.96  ? 823  ARG A C     1 
ATOM   4379 O  O     . ARG B 2 527 ? 13.156  52.864 16.549  1.00 16.30  ? 823  ARG A O     1 
ATOM   4380 C  CB    . ARG B 2 527 ? 12.631  52.763 13.473  1.00 30.00  ? 823  ARG A CB    1 
ATOM   4381 C  CG    . ARG B 2 527 ? 13.941  52.231 13.873  1.00 30.00  ? 823  ARG A CG    1 
ATOM   4382 C  CD    . ARG B 2 527 ? 14.990  52.903 13.130  1.00 30.00  ? 823  ARG A CD    1 
ATOM   4383 N  NE    . ARG B 2 527 ? 15.319  52.140 11.976  1.00 30.00  ? 823  ARG A NE    1 
ATOM   4384 C  CZ    . ARG B 2 527 ? 16.054  52.590 10.982  1.00 30.00  ? 823  ARG A CZ    1 
ATOM   4385 N  NH1   . ARG B 2 527 ? 16.521  53.824 11.019  1.00 30.00  ? 823  ARG A NH1   1 
ATOM   4386 N  NH2   . ARG B 2 527 ? 16.323  51.792 9.932   1.00 30.00  ? 823  ARG A NH2   1 
ATOM   4387 N  N     . LEU B 2 528 ? 11.514  51.447 16.232  1.00 22.09  ? 824  LEU A N     1 
ATOM   4388 C  CA    . LEU B 2 528 ? 11.860  50.564 17.330  1.00 24.16  ? 824  LEU A CA    1 
ATOM   4389 C  C     . LEU B 2 528 ? 13.198  49.889 17.082  1.00 20.88  ? 824  LEU A C     1 
ATOM   4390 O  O     . LEU B 2 528 ? 13.436  49.340 16.007  1.00 22.23  ? 824  LEU A O     1 
ATOM   4391 C  CB    . LEU B 2 528 ? 10.776  49.497 17.471  1.00 20.26  ? 824  LEU A CB    1 
ATOM   4392 C  CG    . LEU B 2 528 ? 9.526   49.877 18.233  1.00 38.74  ? 824  LEU A CG    1 
ATOM   4393 C  CD1   . LEU B 2 528 ? 8.441   48.841 17.981  1.00 35.98  ? 824  LEU A CD1   1 
ATOM   4394 C  CD2   . LEU B 2 528 ? 9.884   49.970 19.712  1.00 39.55  ? 824  LEU A CD2   1 
ATOM   4395 N  N     . LEU B 2 529 ? 14.062  49.906 18.088  1.00 16.86  ? 825  LEU A N     1 
ATOM   4396 C  CA    . LEU B 2 529 ? 15.324  49.185 18.031  1.00 18.41  ? 825  LEU A CA    1 
ATOM   4397 C  C     . LEU B 2 529 ? 15.378  48.000 18.976  1.00 24.70  ? 825  LEU A C     1 
ATOM   4398 O  O     . LEU B 2 529 ? 15.914  46.948 18.613  1.00 20.93  ? 825  LEU A O     1 
ATOM   4399 C  CB    . LEU B 2 529 ? 16.487  50.117 18.370  1.00 20.18  ? 825  LEU A CB    1 
ATOM   4400 C  CG    . LEU B 2 529 ? 16.773  51.278 17.412  1.00 22.63  ? 825  LEU A CG    1 
ATOM   4401 C  CD1   . LEU B 2 529 ? 17.941  52.032 17.948  1.00 24.17  ? 825  LEU A CD1   1 
ATOM   4402 C  CD2   . LEU B 2 529 ? 17.050  50.790 15.991  1.00 23.86  ? 825  LEU A CD2   1 
ATOM   4403 N  N     . LEU B 2 530 ? 14.851  48.151 20.190  1.00 19.50  ? 826  LEU A N     1 
ATOM   4404 C  CA    . LEU B 2 530 ? 15.067  47.158 21.226  1.00 15.92  ? 826  LEU A CA    1 
ATOM   4405 C  C     . LEU B 2 530 ? 13.865  47.131 22.147  1.00 14.56  ? 826  LEU A C     1 
ATOM   4406 O  O     . LEU B 2 530 ? 13.238  48.159 22.408  1.00 16.68  ? 826  LEU A O     1 
ATOM   4407 C  CB    . LEU B 2 530 ? 16.323  47.452 22.054  1.00 18.32  ? 826  LEU A CB    1 
ATOM   4408 C  CG    . LEU B 2 530 ? 17.679  47.255 21.402  1.00 32.01  ? 826  LEU A CG    1 
ATOM   4409 C  CD1   . LEU B 2 530 ? 18.789  47.656 22.379  1.00 26.95  ? 826  LEU A CD1   1 
ATOM   4410 C  CD2   . LEU B 2 530 ? 17.842  45.813 20.890  1.00 27.01  ? 826  LEU A CD2   1 
ATOM   4411 N  N     . GLN B 2 531 ? 13.545  45.936 22.613  1.00 15.73  ? 827  GLN A N     1 
ATOM   4412 C  CA    . GLN B 2 531 ? 12.680  45.744 23.761  1.00 18.33  ? 827  GLN A CA    1 
ATOM   4413 C  C     . GLN B 2 531 ? 13.554  45.106 24.822  1.00 19.92  ? 827  GLN A C     1 
ATOM   4414 O  O     . GLN B 2 531 ? 14.154  44.057 24.580  1.00 19.87  ? 827  GLN A O     1 
ATOM   4415 C  CB    . GLN B 2 531 ? 11.481  44.872 23.415  1.00 17.98  ? 827  GLN A CB    1 
ATOM   4416 C  CG    . GLN B 2 531 ? 10.342  45.003 24.408  1.00 24.00  ? 827  GLN A CG    1 
ATOM   4417 C  CD    . GLN B 2 531 ? 10.566  44.185 25.642  1.00 28.19  ? 827  GLN A CD    1 
ATOM   4418 O  OE1   . GLN B 2 531 ? 10.555  42.960 25.582  1.00 25.49  ? 827  GLN A OE1   1 
ATOM   4419 N  NE2   . GLN B 2 531 ? 10.777  44.856 26.781  1.00 38.55  ? 827  GLN A NE2   1 
ATOM   4420 N  N     . VAL B 2 532 ? 13.692  45.776 25.955  1.00 20.05  ? 828  VAL A N     1 
ATOM   4421 C  CA    . VAL B 2 532 ? 14.572  45.329 27.027  1.00 30.45  ? 828  VAL A CA    1 
ATOM   4422 C  C     . VAL B 2 532 ? 13.740  45.395 28.291  1.00 30.05  ? 828  VAL A C     1 
ATOM   4423 O  O     . VAL B 2 532 ? 13.336  46.488 28.710  1.00 24.53  ? 828  VAL A O     1 
ATOM   4424 C  CB    . VAL B 2 532 ? 15.834  46.199 27.157  1.00 39.55  ? 828  VAL A CB    1 
ATOM   4425 C  CG1   . VAL B 2 532 ? 16.681  45.727 28.312  1.00 46.74  ? 828  VAL A CG1   1 
ATOM   4426 C  CG2   . VAL B 2 532 ? 16.646  46.166 25.880  1.00 44.55  ? 828  VAL A CG2   1 
ATOM   4427 N  N     . HIS B 2 533 ? 13.484  44.232 28.894  1.00 25.49  ? 829  HIS A N     1 
ATOM   4428 C  CA    . HIS B 2 533 ? 12.642  44.111 30.079  1.00 26.92  ? 829  HIS A CA    1 
ATOM   4429 C  C     . HIS B 2 533 ? 11.315  44.807 29.895  1.00 15.22  ? 829  HIS A C     1 
ATOM   4430 O  O     . HIS B 2 533 ? 10.417  44.296 29.230  1.00 29.88  ? 829  HIS A O     1 
ATOM   4431 C  CB    . HIS B 2 533 ? 13.318  44.694 31.316  1.00 43.04  ? 829  HIS A CB    1 
ATOM   4432 C  CG    . HIS B 2 533 ? 14.792  44.505 31.335  1.00 71.85  ? 829  HIS A CG    1 
ATOM   4433 N  ND1   . HIS B 2 533 ? 15.380  43.284 31.087  1.00 78.39  ? 829  HIS A ND1   1 
ATOM   4434 C  CD2   . HIS B 2 533 ? 15.802  45.375 31.569  1.00 76.77  ? 829  HIS A CD2   1 
ATOM   4435 C  CE1   . HIS B 2 533 ? 16.690  43.412 31.168  1.00 77.13  ? 829  HIS A CE1   1 
ATOM   4436 N  NE2   . HIS B 2 533 ? 16.974  44.670 31.457  1.00 77.52  ? 829  HIS A NE2   1 
ATOM   4437 N  N     . ASP B 2 534 ? 11.174  45.967 30.531  1.00 19.09  ? 830  ASP A N     1 
ATOM   4438 C  CA    . ASP B 2 534 ? 9.935   46.723 30.488  1.00 19.36  ? 830  ASP A CA    1 
ATOM   4439 C  C     . ASP B 2 534 ? 10.118  48.011 29.717  1.00 16.88  ? 830  ASP A C     1 
ATOM   4440 O  O     . ASP B 2 534 ? 9.309   48.924 29.857  1.00 14.40  ? 830  ASP A O     1 
ATOM   4441 C  CB    . ASP B 2 534 ? 9.429   47.032 31.900  1.00 17.23  ? 830  ASP A CB    1 
ATOM   4442 C  CG    . ASP B 2 534 ? 9.221   45.773 32.752  1.00 27.49  ? 830  ASP A CG    1 
ATOM   4443 O  OD1   . ASP B 2 534 ? 9.301   45.910 33.998  1.00 30.46  ? 830  ASP A OD1   1 
ATOM   4444 O  OD2   . ASP B 2 534 ? 8.985   44.653 32.199  1.00 19.81  ? 830  ASP A OD2   1 
ATOM   4445 N  N     . GLU B 2 535 ? 11.198  48.111 28.948  1.00 14.80  ? 831  GLU A N     1 
ATOM   4446 C  CA    . GLU B 2 535 ? 11.574  49.327 28.245  1.00 20.24  ? 831  GLU A CA    1 
ATOM   4447 C  C     . GLU B 2 535 ? 11.514  49.073 26.746  1.00 21.47  ? 831  GLU A C     1 
ATOM   4448 O  O     . GLU B 2 535 ? 11.864  47.982 26.279  1.00 20.43  ? 831  GLU A O     1 
ATOM   4449 C  CB    . GLU B 2 535 ? 12.991  49.787 28.638  1.00 26.00  ? 831  GLU A CB    1 
ATOM   4450 C  CG    . GLU B 2 535 ? 13.394  51.140 28.048  1.00 39.50  ? 831  GLU A CG    1 
ATOM   4451 C  CD    . GLU B 2 535 ? 14.676  51.724 28.652  1.00 53.70  ? 831  GLU A CD    1 
ATOM   4452 O  OE1   . GLU B 2 535 ? 14.598  52.786 29.326  1.00 55.55  ? 831  GLU A OE1   1 
ATOM   4453 O  OE2   . GLU B 2 535 ? 15.763  51.140 28.429  1.00 51.33  ? 831  GLU A OE2   1 
ATOM   4454 N  N     . LEU B 2 536 ? 11.030  50.072 26.011  1.00 14.87  ? 832  LEU A N     1 
ATOM   4455 C  CA    . LEU B 2 536 ? 11.127  50.145 24.559  1.00 14.55  ? 832  LEU A CA    1 
ATOM   4456 C  C     . LEU B 2 536 ? 12.157  51.204 24.208  1.00 18.50  ? 832  LEU A C     1 
ATOM   4457 O  O     . LEU B 2 536 ? 12.120  52.312 24.751  1.00 14.98  ? 832  LEU A O     1 
ATOM   4458 C  CB    . LEU B 2 536 ? 9.789   50.522 23.937  1.00 18.70  ? 832  LEU A CB    1 
ATOM   4459 C  CG    . LEU B 2 536 ? 8.650   49.541 24.136  1.00 24.02  ? 832  LEU A CG    1 
ATOM   4460 C  CD1   . LEU B 2 536 ? 7.435   49.956 23.307  1.00 21.92  ? 832  LEU A CD1   1 
ATOM   4461 C  CD2   . LEU B 2 536 ? 9.146   48.189 23.706  1.00 35.91  ? 832  LEU A CD2   1 
ATOM   4462 N  N     . ILE B 2 537 ? 13.067  50.875 23.307  1.00 16.47  ? 833  ILE A N     1 
ATOM   4463 C  CA    . ILE B 2 537 ? 14.075  51.816 22.861  1.00 14.62  ? 833  ILE A CA    1 
ATOM   4464 C  C     . ILE B 2 537 ? 13.870  52.051 21.379  1.00 23.75  ? 833  ILE A C     1 
ATOM   4465 O  O     . ILE B 2 537 ? 13.746  51.096 20.600  1.00 17.00  ? 833  ILE A O     1 
ATOM   4466 C  CB    . ILE B 2 537 ? 15.496  51.324 23.158  1.00 16.10  ? 833  ILE A CB    1 
ATOM   4467 C  CG1   . ILE B 2 537 ? 15.670  51.160 24.670  1.00 20.85  ? 833  ILE A CG1   1 
ATOM   4468 C  CG2   . ILE B 2 537 ? 16.504  52.362 22.689  1.00 17.73  ? 833  ILE A CG2   1 
ATOM   4469 C  CD1   . ILE B 2 537 ? 15.867  49.747 25.099  1.00 33.34  ? 833  ILE A CD1   1 
ATOM   4470 N  N     . LEU B 2 538 ? 13.811  53.323 21.007  1.00 14.91  ? 834  LEU A N     1 
ATOM   4471 C  CA    . LEU B 2 538 ? 13.632  53.774 19.641  1.00 17.35  ? 834  LEU A CA    1 
ATOM   4472 C  C     . LEU B 2 538 ? 14.784  54.703 19.296  1.00 18.83  ? 834  LEU A C     1 
ATOM   4473 O  O     . LEU B 2 538 ? 15.494  55.188 20.178  1.00 16.22  ? 834  LEU A O     1 
ATOM   4474 C  CB    . LEU B 2 538 ? 12.314  54.535 19.474  1.00 17.86  ? 834  LEU A CB    1 
ATOM   4475 C  CG    . LEU B 2 538 ? 10.987  53.828 19.746  1.00 21.70  ? 834  LEU A CG    1 
ATOM   4476 C  CD1   . LEU B 2 538 ? 10.691  53.775 21.223  1.00 27.56  ? 834  LEU A CD1   1 
ATOM   4477 C  CD2   . LEU B 2 538 ? 9.885   54.604 19.039  1.00 27.50  ? 834  LEU A CD2   1 
ATOM   4478 N  N     . GLU B 2 539 ? 14.990  54.930 18.006  1.00 16.95  ? 835  GLU A N     1 
ATOM   4479 C  CA    . GLU B 2 539 ? 15.816  56.041 17.555  1.00 17.54  ? 835  GLU A CA    1 
ATOM   4480 C  C     . GLU B 2 539 ? 14.992  56.837 16.564  1.00 22.57  ? 835  GLU A C     1 
ATOM   4481 O  O     . GLU B 2 539 ? 14.129  56.282 15.880  1.00 22.58  ? 835  GLU A O     1 
ATOM   4482 C  CB    . GLU B 2 539 ? 17.139  55.588 16.905  1.00 18.83  ? 835  GLU A CB    1 
ATOM   4483 C  CG    . GLU B 2 539 ? 16.978  54.717 15.644  1.00 25.40  ? 835  GLU A CG    1 
ATOM   4484 C  CD    . GLU B 2 539 ? 18.300  54.362 14.958  1.00 30.93  ? 835  GLU A CD    1 
ATOM   4485 O  OE1   . GLU B 2 539 ? 19.382  54.726 15.481  1.00 32.07  ? 835  GLU A OE1   1 
ATOM   4486 O  OE2   . GLU B 2 539 ? 18.257  53.720 13.879  1.00 29.29  ? 835  GLU A OE2   1 
ATOM   4487 N  N     . ALA B 2 540 ? 15.261  58.138 16.489  1.00 20.03  ? 836  ALA A N     1 
ATOM   4488 C  CA    . ALA B 2 540 ? 14.457  59.013 15.650  1.00 18.82  ? 836  ALA A CA    1 
ATOM   4489 C  C     . ALA B 2 540 ? 15.244  60.278 15.368  1.00 19.70  ? 836  ALA A C     1 
ATOM   4490 O  O     . ALA B 2 540 ? 16.145  60.642 16.144  1.00 20.16  ? 836  ALA A O     1 
ATOM   4491 C  CB    . ALA B 2 540 ? 13.122  59.352 16.331  1.00 19.40  ? 836  ALA A CB    1 
ATOM   4492 N  N     . PRO B 2 541 ? 14.916  60.983 14.284  1.00 24.88  ? 837  PRO A N     1 
ATOM   4493 C  CA    . PRO B 2 541 ? 15.478  62.321 14.075  1.00 22.54  ? 837  PRO A CA    1 
ATOM   4494 C  C     . PRO B 2 541 ? 15.229  63.183 15.297  1.00 20.94  ? 837  PRO A C     1 
ATOM   4495 O  O     . PRO B 2 541 ? 14.194  63.069 15.951  1.00 20.23  ? 837  PRO A O     1 
ATOM   4496 C  CB    . PRO B 2 541 ? 14.707  62.849 12.857  1.00 27.57  ? 837  PRO A CB    1 
ATOM   4497 C  CG    . PRO B 2 541 ? 14.229  61.621 12.139  1.00 31.96  ? 837  PRO A CG    1 
ATOM   4498 C  CD    . PRO B 2 541 ? 14.018  60.565 13.188  1.00 24.24  ? 837  PRO A CD    1 
ATOM   4499 N  N     . LYS B 2 542 ? 16.194  64.039 15.617  1.00 21.54  ? 838  LYS A N     1 
ATOM   4500 C  CA    . LYS B 2 542 ? 16.012  64.919 16.763  1.00 21.38  ? 838  LYS A CA    1 
ATOM   4501 C  C     . LYS B 2 542 ? 14.724  65.715 16.629  1.00 29.02  ? 838  LYS A C     1 
ATOM   4502 O  O     . LYS B 2 542 ? 14.043  65.967 17.627  1.00 25.17  ? 838  LYS A O     1 
ATOM   4503 C  CB    . LYS B 2 542 ? 17.215  65.856 16.922  1.00 27.80  ? 838  LYS A CB    1 
ATOM   4504 C  CG    . LYS B 2 542 ? 17.454  66.800 15.758  1.00 33.55  ? 838  LYS A CG    1 
ATOM   4505 C  CD    . LYS B 2 542 ? 18.638  67.717 16.037  1.00 45.75  ? 838  LYS A CD    1 
ATOM   4506 C  CE    . LYS B 2 542 ? 19.109  68.474 14.788  1.00 53.82  ? 838  LYS A CE    1 
ATOM   4507 N  NZ    . LYS B 2 542 ? 18.008  68.840 13.848  1.00 61.37  ? 838  LYS A NZ    1 
ATOM   4508 N  N     . GLU B 2 543 ? 14.351  66.064 15.393  1.00 25.94  ? 839  GLU A N     1 
ATOM   4509 C  CA    . GLU B 2 543 ? 13.133  66.802 15.099  1.00 33.01  ? 839  GLU A CA    1 
ATOM   4510 C  C     . GLU B 2 543 ? 11.854  66.051 15.460  1.00 31.32  ? 839  GLU A C     1 
ATOM   4511 O  O     . GLU B 2 543 ? 10.778  66.651 15.390  1.00 31.79  ? 839  GLU A O     1 
ATOM   4512 C  CB    . GLU B 2 543 ? 13.094  67.163 13.614  1.00 29.16  ? 839  GLU A CB    1 
ATOM   4513 C  CG    . GLU B 2 543 ? 14.192  68.125 13.178  1.00 42.78  ? 839  GLU A CG    1 
ATOM   4514 C  CD    . GLU B 2 543 ? 15.459  67.398 12.714  1.00 53.30  ? 839  GLU A CD    1 
ATOM   4515 O  OE1   . GLU B 2 543 ? 16.361  68.081 12.165  1.00 51.73  ? 839  GLU A OE1   1 
ATOM   4516 O  OE2   . GLU B 2 543 ? 15.552  66.151 12.899  1.00 32.99  ? 839  GLU A OE2   1 
ATOM   4517 N  N     . GLU B 2 544 ? 11.918  64.766 15.815  1.00 21.90  ? 840  GLU A N     1 
ATOM   4518 C  CA    . GLU B 2 544 ? 10.708  64.050 16.195  1.00 19.70  ? 840  GLU A CA    1 
ATOM   4519 C  C     . GLU B 2 544 ? 10.601  63.833 17.688  1.00 18.92  ? 840  GLU A C     1 
ATOM   4520 O  O     . GLU B 2 544 ? 9.643   63.195 18.142  1.00 18.98  ? 840  GLU A O     1 
ATOM   4521 C  CB    . GLU B 2 544 ? 10.637  62.690 15.472  1.00 23.64  ? 840  GLU A CB    1 
ATOM   4522 C  CG    . GLU B 2 544 ? 10.627  62.785 13.951  1.00 33.09  ? 840  GLU A CG    1 
ATOM   4523 C  CD    . GLU B 2 544 ? 10.325  61.445 13.271  1.00 47.53  ? 840  GLU A CD    1 
ATOM   4524 O  OE1   . GLU B 2 544 ? 10.145  61.425 12.029  1.00 46.80  ? 840  GLU A OE1   1 
ATOM   4525 O  OE2   . GLU B 2 544 ? 10.258  60.409 13.981  1.00 47.87  ? 840  GLU A OE2   1 
ATOM   4526 N  N     . MET B 2 545 ? 11.576  64.302 18.467  1.00 23.93  ? 841  MET A N     1 
ATOM   4527 C  CA    . MET B 2 545 ? 11.580  63.963 19.886  1.00 22.50  ? 841  MET A CA    1 
ATOM   4528 C  C     . MET B 2 545 ? 10.321  64.479 20.573  1.00 20.42  ? 841  MET A C     1 
ATOM   4529 O  O     . MET B 2 545 ? 9.704   63.760 21.359  1.00 18.66  ? 841  MET A O     1 
ATOM   4530 C  CB    . MET B 2 545 ? 12.840  64.505 20.567  1.00 20.97  ? 841  MET A CB    1 
ATOM   4531 C  CG    . MET B 2 545 ? 14.120  63.743 20.223  1.00 29.33  ? 841  MET A CG    1 
ATOM   4532 S  SD    . MET B 2 545 ? 14.122  61.952 20.637  1.00 29.86  ? 841  MET A SD    1 
ATOM   4533 C  CE    . MET B 2 545 ? 13.890  61.236 19.042  1.00 27.87  ? 841  MET A CE    1 
ATOM   4534 N  N     . GLU B 2 546 ? 9.881   65.697 20.235  1.00 19.12  ? 842  GLU A N     1 
ATOM   4535 C  CA    . GLU B 2 546 ? 8.742   66.264 20.954  1.00 18.72  ? 842  GLU A CA    1 
ATOM   4536 C  C     . GLU B 2 546 ? 7.457   65.507 20.639  1.00 18.28  ? 842  GLU A C     1 
ATOM   4537 O  O     . GLU B 2 546 ? 6.650   65.249 21.540  1.00 17.81  ? 842  GLU A O     1 
ATOM   4538 C  CB    . GLU B 2 546 ? 8.620   67.752 20.635  1.00 23.95  ? 842  GLU A CB    1 
ATOM   4539 C  CG    . GLU B 2 546 ? 9.907   68.495 20.966  1.00 23.48  ? 842  GLU A CG    1 
ATOM   4540 C  CD    . GLU B 2 546 ? 9.742   70.004 20.957  1.00 32.10  ? 842  GLU A CD    1 
ATOM   4541 O  OE1   . GLU B 2 546 ? 8.954   70.523 21.787  1.00 29.10  ? 842  GLU A OE1   1 
ATOM   4542 O  OE2   . GLU B 2 546 ? 10.406  70.665 20.125  1.00 34.31  ? 842  GLU A OE2   1 
ATOM   4543 N  N     . ARG B 2 547 ? 7.283   65.088 19.384  1.00 18.47  ? 843  ARG A N     1 
ATOM   4544 C  CA    . ARG B 2 547 ? 6.146   64.245 19.029  1.00 22.17  ? 843  ARG A CA    1 
ATOM   4545 C  C     . ARG B 2 547 ? 6.202   62.900 19.754  1.00 17.18  ? 843  ARG A C     1 
ATOM   4546 O  O     . ARG B 2 547 ? 5.180   62.416 20.243  1.00 21.85  ? 843  ARG A O     1 
ATOM   4547 C  CB    . ARG B 2 547 ? 6.098   64.027 17.511  1.00 18.61  ? 843  ARG A CB    1 
ATOM   4548 C  CG    . ARG B 2 547 ? 5.313   65.110 16.761  1.00 23.17  ? 843  ARG A CG    1 
ATOM   4549 C  CD    . ARG B 2 547 ? 5.442   64.926 15.257  1.00 32.79  ? 843  ARG A CD    1 
ATOM   4550 N  NE    . ARG B 2 547 ? 6.809   65.211 14.816  1.00 49.25  ? 843  ARG A NE    1 
ATOM   4551 C  CZ    . ARG B 2 547 ? 7.277   64.992 13.588  1.00 46.45  ? 843  ARG A CZ    1 
ATOM   4552 N  NH1   . ARG B 2 547 ? 6.483   64.469 12.662  1.00 44.75  ? 843  ARG A NH1   1 
ATOM   4553 N  NH2   . ARG B 2 547 ? 8.540   65.302 13.287  1.00 33.83  ? 843  ARG A NH2   1 
ATOM   4554 N  N     . LEU B 2 548 ? 7.384   62.285 19.834  1.00 16.93  ? 844  LEU A N     1 
ATOM   4555 C  CA    . LEU B 2 548 ? 7.488   60.996 20.517  1.00 21.23  ? 844  LEU A CA    1 
ATOM   4556 C  C     . LEU B 2 548 ? 7.223   61.130 22.005  1.00 21.65  ? 844  LEU A C     1 
ATOM   4557 O  O     . LEU B 2 548 ? 6.606   60.249 22.609  1.00 15.14  ? 844  LEU A O     1 
ATOM   4558 C  CB    . LEU B 2 548 ? 8.863   60.382 20.305  1.00 17.98  ? 844  LEU A CB    1 
ATOM   4559 C  CG    . LEU B 2 548 ? 9.100   59.971 18.862  1.00 21.72  ? 844  LEU A CG    1 
ATOM   4560 C  CD1   . LEU B 2 548 ? 10.551  59.615 18.719  1.00 33.06  ? 844  LEU A CD1   1 
ATOM   4561 C  CD2   . LEU B 2 548 ? 8.214   58.789 18.505  1.00 16.30  ? 844  LEU A CD2   1 
ATOM   4562 N  N     . CYS B 2 549 ? 7.706   62.217 22.614  1.00 16.08  ? 845  CYS A N     1 
ATOM   4563 C  CA    . CYS B 2 549 ? 7.428   62.478 24.017  1.00 17.65  ? 845  CYS A CA    1 
ATOM   4564 C  C     . CYS B 2 549 ? 5.941   62.404 24.310  1.00 20.90  ? 845  CYS A C     1 
ATOM   4565 O  O     . CYS B 2 549 ? 5.537   61.986 25.398  1.00 27.55  ? 845  CYS A O     1 
ATOM   4566 C  CB    . CYS B 2 549 ? 7.972   63.850 24.418  1.00 19.96  ? 845  CYS A CB    1 
ATOM   4567 S  SG    . CYS B 2 549 ? 9.719   63.785 24.673  1.00 27.32  ? 845  CYS A SG    1 
ATOM   4568 N  N     . ARG B 2 550 ? 5.114   62.822 23.364  1.00 16.69  ? 846  ARG A N     1 
ATOM   4569 C  CA    . ARG B 2 550 ? 3.680   62.707 23.578  1.00 25.19  ? 846  ARG A CA    1 
ATOM   4570 C  C     . ARG B 2 550 ? 3.133   61.377 23.114  1.00 29.01  ? 846  ARG A C     1 
ATOM   4571 O  O     . ARG B 2 550 ? 2.290   60.795 23.794  1.00 26.20  ? 846  ARG A O     1 
ATOM   4572 C  CB    . ARG B 2 550 ? 2.945   63.815 22.850  1.00 25.04  ? 846  ARG A CB    1 
ATOM   4573 C  CG    . ARG B 2 550 ? 2.755   64.989 23.715  1.00 37.33  ? 846  ARG A CG    1 
ATOM   4574 C  CD    . ARG B 2 550 ? 2.248   66.102 22.891  1.00 33.11  ? 846  ARG A CD    1 
ATOM   4575 N  NE    . ARG B 2 550 ? 0.832   66.014 22.536  1.00 40.08  ? 846  ARG A NE    1 
ATOM   4576 C  CZ    . ARG B 2 550 ? -0.157  66.326 23.368  1.00 41.47  ? 846  ARG A CZ    1 
ATOM   4577 N  NH1   . ARG B 2 550 ? 0.125   66.701 24.607  1.00 28.87  ? 846  ARG A NH1   1 
ATOM   4578 N  NH2   . ARG B 2 550 ? -1.421  66.261 22.967  1.00 42.87  ? 846  ARG A NH2   1 
ATOM   4579 N  N     . LEU B 2 551 ? 3.609   60.898 21.963  1.00 22.64  ? 847  LEU A N     1 
ATOM   4580 C  CA    . LEU B 2 551 ? 3.011   59.735 21.325  1.00 22.78  ? 847  LEU A CA    1 
ATOM   4581 C  C     . LEU B 2 551 ? 3.331   58.446 22.074  1.00 18.12  ? 847  LEU A C     1 
ATOM   4582 O  O     . LEU B 2 551 ? 2.431   57.656 22.377  1.00 19.84  ? 847  LEU A O     1 
ATOM   4583 C  CB    . LEU B 2 551 ? 3.510   59.641 19.885  1.00 23.22  ? 847  LEU A CB    1 
ATOM   4584 C  CG    . LEU B 2 551 ? 2.855   58.557 19.049  1.00 34.10  ? 847  LEU A CG    1 
ATOM   4585 C  CD1   . LEU B 2 551 ? 1.351   58.708 19.183  1.00 47.19  ? 847  LEU A CD1   1 
ATOM   4586 C  CD2   . LEU B 2 551 ? 3.284   58.704 17.612  1.00 31.20  ? 847  LEU A CD2   1 
ATOM   4587 N  N     . VAL B 2 552 ? 4.616   58.175 22.304  1.00 14.35  ? 848  VAL A N     1 
ATOM   4588 C  CA    . VAL B 2 552 ? 5.019   56.856 22.798  1.00 16.21  ? 848  VAL A CA    1 
ATOM   4589 C  C     . VAL B 2 552 ? 4.418   56.570 24.169  1.00 19.85  ? 848  VAL A C     1 
ATOM   4590 O  O     . VAL B 2 552 ? 3.842   55.482 24.351  1.00 18.46  ? 848  VAL A O     1 
ATOM   4591 C  CB    . VAL B 2 552 ? 6.546   56.732 22.792  1.00 13.80  ? 848  VAL A CB    1 
ATOM   4592 C  CG1   . VAL B 2 552 ? 6.963   55.386 23.360  1.00 15.60  ? 848  VAL A CG1   1 
ATOM   4593 C  CG2   . VAL B 2 552 ? 7.091   56.899 21.378  1.00 18.90  ? 848  VAL A CG2   1 
ATOM   4594 N  N     . PRO B 2 553 ? 4.514   57.466 25.167  1.00 23.91  ? 849  PRO A N     1 
ATOM   4595 C  CA    . PRO B 2 553 ? 3.910   57.161 26.471  1.00 20.17  ? 849  PRO A CA    1 
ATOM   4596 C  C     . PRO B 2 553 ? 2.434   56.907 26.371  1.00 21.66  ? 849  PRO A C     1 
ATOM   4597 O  O     . PRO B 2 553 ? 1.909   56.028 27.067  1.00 23.87  ? 849  PRO A O     1 
ATOM   4598 C  CB    . PRO B 2 553 ? 4.199   58.425 27.297  1.00 22.70  ? 849  PRO A CB    1 
ATOM   4599 C  CG    . PRO B 2 553 ? 5.376   59.019 26.670  1.00 28.79  ? 849  PRO A CG    1 
ATOM   4600 C  CD    . PRO B 2 553 ? 5.211   58.766 25.204  1.00 28.82  ? 849  PRO A CD    1 
ATOM   4601 N  N     . GLU B 2 554 ? 1.746   57.667 25.525  1.00 17.15  ? 850  GLU A N     1 
ATOM   4602 C  CA    . GLU B 2 554 ? 0.313   57.465 25.347  1.00 25.25  ? 850  GLU A CA    1 
ATOM   4603 C  C     . GLU B 2 554 ? 0.016   56.075 24.804  1.00 25.77  ? 850  GLU A C     1 
ATOM   4604 O  O     . GLU B 2 554 ? -0.872  55.377 25.310  1.00 21.52  ? 850  GLU A O     1 
ATOM   4605 C  CB    . GLU B 2 554 ? -0.259  58.525 24.410  1.00 28.65  ? 850  GLU A CB    1 
ATOM   4606 C  CG    . GLU B 2 554 ? -1.778  58.474 24.300  1.00 43.70  ? 850  GLU A CG    1 
ATOM   4607 C  CD    . GLU B 2 554 ? -2.480  58.715 25.641  1.00 66.80  ? 850  GLU A CD    1 
ATOM   4608 O  OE1   . GLU B 2 554 ? -3.645  58.283 25.798  1.00 73.47  ? 850  GLU A OE1   1 
ATOM   4609 O  OE2   . GLU B 2 554 ? -1.873  59.343 26.537  1.00 75.00  ? 850  GLU A OE2   1 
ATOM   4610 N  N     . VAL B 2 555 ? 0.731   55.662 23.751  1.00 14.40  ? 851  VAL A N     1 
ATOM   4611 C  CA    . VAL B 2 555 ? 0.475   54.342 23.178  1.00 13.17  ? 851  VAL A CA    1 
ATOM   4612 C  C     . VAL B 2 555 ? 0.765   53.260 24.212  1.00 13.69  ? 851  VAL A C     1 
ATOM   4613 O  O     . VAL B 2 555 ? -0.015  52.319 24.389  1.00 18.89  ? 851  VAL A O     1 
ATOM   4614 C  CB    . VAL B 2 555 ? 1.302   54.136 21.893  1.00 13.35  ? 851  VAL A CB    1 
ATOM   4615 C  CG1   . VAL B 2 555 ? 1.220   52.666 21.438  1.00 15.88  ? 851  VAL A CG1   1 
ATOM   4616 C  CG2   . VAL B 2 555 ? 0.809   55.032 20.806  1.00 17.57  ? 851  VAL A CG2   1 
ATOM   4617 N  N     . MET B 2 556 ? 1.871   53.398 24.934  1.00 16.38  ? 852  MET A N     1 
ATOM   4618 C  CA    . MET B 2 556 ? 2.202   52.403 25.943  1.00 14.57  ? 852  MET A CA    1 
ATOM   4619 C  C     . MET B 2 556 ? 1.181   52.412 27.078  1.00 19.72  ? 852  MET A C     1 
ATOM   4620 O  O     . MET B 2 556 ? 0.719   51.357 27.518  1.00 17.27  ? 852  MET A O     1 
ATOM   4621 C  CB    . MET B 2 556 ? 3.609   52.673 26.457  1.00 19.29  ? 852  MET A CB    1 
ATOM   4622 C  CG    . MET B 2 556 ? 4.638   52.451 25.386  1.00 20.07  ? 852  MET A CG    1 
ATOM   4623 S  SD    . MET B 2 556 ? 6.290   52.796 25.960  1.00 22.42  ? 852  MET A SD    1 
ATOM   4624 C  CE    . MET B 2 556 ? 6.534   51.508 27.202  1.00 20.09  ? 852  MET A CE    1 
ATOM   4625 N  N     . GLU B 2 557 ? 0.776   53.597 27.525  1.00 14.21  ? 853  GLU A N     1 
ATOM   4626 C  CA    . GLU B 2 557 ? -0.187  53.682 28.615  1.00 18.88  ? 853  GLU A CA    1 
ATOM   4627 C  C     . GLU B 2 557 ? -1.570  53.199 28.198  1.00 28.79  ? 853  GLU A C     1 
ATOM   4628 O  O     . GLU B 2 557 ? -2.349  52.764 29.051  1.00 26.03  ? 853  GLU A O     1 
ATOM   4629 C  CB    . GLU B 2 557 ? -0.278  55.117 29.139  1.00 19.28  ? 853  GLU A CB    1 
ATOM   4630 C  CG    . GLU B 2 557 ? 0.888   55.497 30.035  1.00 33.30  ? 853  GLU A CG    1 
ATOM   4631 C  CD    . GLU B 2 557 ? 0.997   57.004 30.296  1.00 45.52  ? 853  GLU A CD    1 
ATOM   4632 O  OE1   . GLU B 2 557 ? 0.265   57.784 29.646  1.00 43.24  ? 853  GLU A OE1   1 
ATOM   4633 O  OE2   . GLU B 2 557 ? 1.825   57.402 31.158  1.00 49.07  ? 853  GLU A OE2   1 
ATOM   4634 N  N     . GLN B 2 558 ? -1.917  53.285 26.914  1.00 21.86  ? 854  GLN A N     1 
ATOM   4635 C  CA    . GLN B 2 558 ? -3.239  52.847 26.494  1.00 26.12  ? 854  GLN A CA    1 
ATOM   4636 C  C     . GLN B 2 558 ? -3.249  51.430 25.954  1.00 22.56  ? 854  GLN A C     1 
ATOM   4637 O  O     . GLN B 2 558 ? -4.292  50.983 25.472  1.00 21.61  ? 854  GLN A O     1 
ATOM   4638 C  CB    . GLN B 2 558 ? -3.820  53.802 25.455  1.00 27.66  ? 854  GLN A CB    1 
ATOM   4639 C  CG    . GLN B 2 558 ? -4.147  55.177 26.038  1.00 37.61  ? 854  GLN A CG    1 
ATOM   4640 C  CD    . GLN B 2 558 ? -4.884  55.078 27.363  1.00 52.24  ? 854  GLN A CD    1 
ATOM   4641 O  OE1   . GLN B 2 558 ? -6.021  54.611 27.419  1.00 52.88  ? 854  GLN A OE1   1 
ATOM   4642 N  NE2   . GLN B 2 558 ? -4.235  55.513 28.440  1.00 59.97  ? 854  GLN A NE2   1 
ATOM   4643 N  N     . ALA B 2 559 ? -2.125  50.707 26.043  1.00 19.31  ? 855  ALA A N     1 
ATOM   4644 C  CA    . ALA B 2 559 ? -2.040  49.392 25.396  1.00 25.30  ? 855  ALA A CA    1 
ATOM   4645 C  C     . ALA B 2 559 ? -3.125  48.445 25.905  1.00 28.70  ? 855  ALA A C     1 
ATOM   4646 O  O     . ALA B 2 559 ? -3.728  47.690 25.130  1.00 21.50  ? 855  ALA A O     1 
ATOM   4647 C  CB    . ALA B 2 559 ? -0.654  48.789 25.615  1.00 24.63  ? 855  ALA A CB    1 
ATOM   4648 N  N     . VAL B 2 560 ? -3.385  48.469 27.207  1.00 22.32  ? 856  VAL A N     1 
ATOM   4649 C  CA    . VAL B 2 560 ? -4.522  47.775 27.786  1.00 26.76  ? 856  VAL A CA    1 
ATOM   4650 C  C     . VAL B 2 560 ? -5.140  48.712 28.810  1.00 25.88  ? 856  VAL A C     1 
ATOM   4651 O  O     . VAL B 2 560 ? -4.544  49.714 29.207  1.00 33.07  ? 856  VAL A O     1 
ATOM   4652 C  CB    . VAL B 2 560 ? -4.139  46.430 28.437  1.00 27.95  ? 856  VAL A CB    1 
ATOM   4653 C  CG1   . VAL B 2 560 ? -3.506  45.479 27.401  1.00 17.92  ? 856  VAL A CG1   1 
ATOM   4654 C  CG2   . VAL B 2 560 ? -3.212  46.661 29.639  1.00 25.98  ? 856  VAL A CG2   1 
ATOM   4655 N  N     . THR B 2 561 ? -6.354  48.393 29.217  1.00 21.59  ? 857  THR A N     1 
ATOM   4656 C  CA    . THR B 2 561 ? -7.029  49.114 30.289  1.00 30.66  ? 857  THR A CA    1 
ATOM   4657 C  C     . THR B 2 561 ? -7.063  48.204 31.510  1.00 27.67  ? 857  THR A C     1 
ATOM   4658 O  O     . THR B 2 561 ? -7.763  47.190 31.512  1.00 31.23  ? 857  THR A O     1 
ATOM   4659 C  CB    . THR B 2 561 ? -8.439  49.529 29.882  1.00 41.29  ? 857  THR A CB    1 
ATOM   4660 O  OG1   . THR B 2 561 ? -8.387  50.229 28.633  1.00 50.81  ? 857  THR A OG1   1 
ATOM   4661 C  CG2   . THR B 2 561 ? -9.049  50.434 30.944  1.00 37.99  ? 857  THR A CG2   1 
ATOM   4662 N  N     . LEU B 2 562 ? -6.281  48.540 32.523  1.00 22.49  ? 858  LEU A N     1 
ATOM   4663 C  CA    . LEU B 2 562 ? -6.360  47.858 33.805  1.00 20.42  ? 858  LEU A CA    1 
ATOM   4664 C  C     . LEU B 2 562 ? -7.185  48.684 34.784  1.00 23.59  ? 858  LEU A C     1 
ATOM   4665 O  O     . LEU B 2 562 ? -7.563  49.828 34.515  1.00 24.84  ? 858  LEU A O     1 
ATOM   4666 C  CB    . LEU B 2 562 ? -4.964  47.614 34.368  1.00 19.91  ? 858  LEU A CB    1 
ATOM   4667 C  CG    . LEU B 2 562 ? -3.981  46.905 33.449  1.00 25.90  ? 858  LEU A CG    1 
ATOM   4668 C  CD1   . LEU B 2 562 ? -2.625  46.805 34.141  1.00 29.29  ? 858  LEU A CD1   1 
ATOM   4669 C  CD2   . LEU B 2 562 ? -4.538  45.531 33.073  1.00 26.21  ? 858  LEU A CD2   1 
ATOM   4670 N  N     . ARG B 2 563 ? -7.456  48.086 35.942  1.00 23.48  ? 859  ARG A N     1 
ATOM   4671 C  CA    . ARG B 2 563 ? -8.095  48.793 37.041  1.00 20.71  ? 859  ARG A CA    1 
ATOM   4672 C  C     . ARG B 2 563 ? -7.180  49.828 37.674  1.00 21.26  ? 859  ARG A C     1 
ATOM   4673 O  O     . ARG B 2 563 ? -7.634  50.581 38.537  1.00 19.35  ? 859  ARG A O     1 
ATOM   4674 C  CB    . ARG B 2 563 ? -8.547  47.794 38.111  1.00 21.58  ? 859  ARG A CB    1 
ATOM   4675 C  CG    . ARG B 2 563 ? -9.587  46.813 37.598  1.00 25.58  ? 859  ARG A CG    1 
ATOM   4676 C  CD    . ARG B 2 563 ? -9.908  45.741 38.626  1.00 33.83  ? 859  ARG A CD    1 
ATOM   4677 N  NE    . ARG B 2 563 ? -11.014 44.904 38.177  1.00 39.01  ? 859  ARG A NE    1 
ATOM   4678 C  CZ    . ARG B 2 563 ? -10.880 43.658 37.725  1.00 51.10  ? 859  ARG A CZ    1 
ATOM   4679 N  NH1   . ARG B 2 563 ? -9.683  43.074 37.685  1.00 35.52  ? 859  ARG A NH1   1 
ATOM   4680 N  NH2   . ARG B 2 563 ? -11.952 42.983 37.328  1.00 58.97  ? 859  ARG A NH2   1 
ATOM   4681 N  N     . VAL B 2 564 ? -5.900  49.837 37.317  1.00 15.08  ? 860  VAL A N     1 
ATOM   4682 C  CA    . VAL B 2 564 ? -4.981  50.890 37.741  1.00 17.79  ? 860  VAL A CA    1 
ATOM   4683 C  C     . VAL B 2 564 ? -4.339  51.456 36.482  1.00 17.19  ? 860  VAL A C     1 
ATOM   4684 O  O     . VAL B 2 564 ? -4.277  50.780 35.443  1.00 18.61  ? 860  VAL A O     1 
ATOM   4685 C  CB    . VAL B 2 564 ? -3.922  50.365 38.745  1.00 18.36  ? 860  VAL A CB    1 
ATOM   4686 C  CG1   . VAL B 2 564 ? -4.618  49.779 39.986  1.00 20.78  ? 860  VAL A CG1   1 
ATOM   4687 C  CG2   . VAL B 2 564 ? -3.049  49.330 38.109  1.00 13.82  ? 860  VAL A CG2   1 
ATOM   4688 N  N     . PRO B 2 565 ? -3.888  52.702 36.524  1.00 20.86  ? 861  PRO A N     1 
ATOM   4689 C  CA    . PRO B 2 565 ? -3.236  53.276 35.342  1.00 15.96  ? 861  PRO A CA    1 
ATOM   4690 C  C     . PRO B 2 565 ? -1.936  52.553 35.066  1.00 12.53  ? 861  PRO A C     1 
ATOM   4691 O  O     . PRO B 2 565 ? -1.289  52.023 35.965  1.00 18.26  ? 861  PRO A O     1 
ATOM   4692 C  CB    . PRO B 2 565 ? -2.967  54.734 35.748  1.00 22.12  ? 861  PRO A CB    1 
ATOM   4693 C  CG    . PRO B 2 565 ? -3.714  54.953 37.021  1.00 22.20  ? 861  PRO A CG    1 
ATOM   4694 C  CD    . PRO B 2 565 ? -3.866  53.620 37.667  1.00 19.67  ? 861  PRO A CD    1 
ATOM   4695 N  N     . LEU B 2 566 ? -1.541  52.547 33.814  1.00 16.77  ? 862  LEU A N     1 
ATOM   4696 C  CA    . LEU B 2 566 ? -0.171  52.220 33.492  1.00 18.25  ? 862  LEU A CA    1 
ATOM   4697 C  C     . LEU B 2 566 ? 0.631   53.517 33.478  1.00 23.15  ? 862  LEU A C     1 
ATOM   4698 O  O     . LEU B 2 566 ? 0.141   54.548 33.030  1.00 27.07  ? 862  LEU A O     1 
ATOM   4699 C  CB    . LEU B 2 566 ? -0.106  51.524 32.143  1.00 14.20  ? 862  LEU A CB    1 
ATOM   4700 C  CG    . LEU B 2 566 ? -0.748  50.132 32.203  1.00 23.04  ? 862  LEU A CG    1 
ATOM   4701 C  CD1   . LEU B 2 566 ? -0.911  49.589 30.820  1.00 21.94  ? 862  LEU A CD1   1 
ATOM   4702 C  CD2   . LEU B 2 566 ? 0.139   49.229 33.010  1.00 24.93  ? 862  LEU A CD2   1 
ATOM   4703 N  N     . LYS B 2 567 ? 1.849   53.470 33.990  1.00 22.75  ? 863  LYS A N     1 
ATOM   4704 C  CA    . LYS B 2 567 ? 2.706   54.645 34.001  1.00 15.80  ? 863  LYS A CA    1 
ATOM   4705 C  C     . LYS B 2 567 ? 3.965   54.372 33.193  1.00 19.77  ? 863  LYS A C     1 
ATOM   4706 O  O     . LYS B 2 567 ? 4.564   53.291 33.285  1.00 19.78  ? 863  LYS A O     1 
ATOM   4707 C  CB    . LYS B 2 567 ? 3.085   55.047 35.419  1.00 22.09  ? 863  LYS A CB    1 
ATOM   4708 C  CG    . LYS B 2 567 ? 3.669   56.436 35.503  1.00 26.20  ? 863  LYS A CG    1 
ATOM   4709 C  CD    . LYS B 2 567 ? 4.268   56.728 36.866  1.00 40.59  ? 863  LYS A CD    1 
ATOM   4710 C  CE    . LYS B 2 567 ? 4.588   58.211 36.978  1.00 47.65  ? 863  LYS A CE    1 
ATOM   4711 N  NZ    . LYS B 2 567 ? 5.165   58.565 38.298  1.00 54.52  ? 863  LYS A NZ    1 
ATOM   4712 N  N     . VAL B 2 568 ? 4.369   55.362 32.416  1.00 15.31  ? 864  VAL A N     1 
ATOM   4713 C  CA    . VAL B 2 568 ? 5.501   55.239 31.510  1.00 20.98  ? 864  VAL A CA    1 
ATOM   4714 C  C     . VAL B 2 568 ? 6.436   56.404 31.775  1.00 19.26  ? 864  VAL A C     1 
ATOM   4715 O  O     . VAL B 2 568 ? 6.014   57.561 31.715  1.00 21.54  ? 864  VAL A O     1 
ATOM   4716 C  CB    . VAL B 2 568 ? 5.045   55.225 30.043  1.00 23.03  ? 864  VAL A CB    1 
ATOM   4717 C  CG1   . VAL B 2 568 ? 6.243   55.275 29.093  1.00 26.50  ? 864  VAL A CG1   1 
ATOM   4718 C  CG2   . VAL B 2 568 ? 4.198   53.981 29.786  1.00 18.60  ? 864  VAL A CG2   1 
ATOM   4719 N  N     . ASP B 2 569 ? 7.686   56.102 32.096  1.00 15.62  ? 865  ASP A N     1 
ATOM   4720 C  CA    . ASP B 2 569 ? 8.751   57.097 32.108  1.00 23.56  ? 865  ASP A CA    1 
ATOM   4721 C  C     . ASP B 2 569 ? 9.505   57.046 30.788  1.00 23.07  ? 865  ASP A C     1 
ATOM   4722 O  O     . ASP B 2 569 ? 9.672   55.982 30.189  1.00 22.68  ? 865  ASP A O     1 
ATOM   4723 C  CB    . ASP B 2 569 ? 9.733   56.852 33.255  1.00 24.18  ? 865  ASP A CB    1 
ATOM   4724 C  CG    . ASP B 2 569 ? 9.058   56.896 34.630  1.00 54.45  ? 865  ASP A CG    1 
ATOM   4725 O  OD1   . ASP B 2 569 ? 8.248   57.818 34.876  1.00 56.11  ? 865  ASP A OD1   1 
ATOM   4726 O  OD2   . ASP B 2 569 ? 9.344   56.006 35.462  1.00 61.17  ? 865  ASP A OD2   1 
ATOM   4727 N  N     . TYR B 2 570 ? 9.992   58.199 30.349  1.00 18.94  ? 866  TYR A N     1 
ATOM   4728 C  CA    . TYR B 2 570 ? 10.660  58.249 29.058  1.00 16.67  ? 866  TYR A CA    1 
ATOM   4729 C  C     . TYR B 2 570 ? 11.740  59.313 29.085  1.00 22.58  ? 866  TYR A C     1 
ATOM   4730 O  O     . TYR B 2 570 ? 11.649  60.308 29.818  1.00 21.02  ? 866  TYR A O     1 
ATOM   4731 C  CB    . TYR B 2 570 ? 9.672   58.521 27.936  1.00 18.59  ? 866  TYR A CB    1 
ATOM   4732 C  CG    . TYR B 2 570 ? 8.859   59.759 28.187  1.00 26.48  ? 866  TYR A CG    1 
ATOM   4733 C  CD1   . TYR B 2 570 ? 9.204   60.967 27.599  1.00 23.35  ? 866  TYR A CD1   1 
ATOM   4734 C  CD2   . TYR B 2 570 ? 7.758   59.724 29.028  1.00 30.53  ? 866  TYR A CD2   1 
ATOM   4735 C  CE1   . TYR B 2 570 ? 8.468   62.116 27.832  1.00 28.52  ? 866  TYR A CE1   1 
ATOM   4736 C  CE2   . TYR B 2 570 ? 7.021   60.859 29.269  1.00 32.24  ? 866  TYR A CE2   1 
ATOM   4737 C  CZ    . TYR B 2 570 ? 7.379   62.052 28.667  1.00 32.95  ? 866  TYR A CZ    1 
ATOM   4738 O  OH    . TYR B 2 570 ? 6.636   63.179 28.907  1.00 42.02  ? 866  TYR A OH    1 
ATOM   4739 N  N     . HIS B 2 571 ? 12.780  59.064 28.300  1.00 17.94  ? 867  HIS A N     1 
ATOM   4740 C  CA    . HIS B 2 571 ? 13.903  59.969 28.178  1.00 22.04  ? 867  HIS A CA    1 
ATOM   4741 C  C     . HIS B 2 571 ? 14.476  59.809 26.786  1.00 22.55  ? 867  HIS A C     1 
ATOM   4742 O  O     . HIS B 2 571 ? 14.225  58.824 26.089  1.00 18.08  ? 867  HIS A O     1 
ATOM   4743 C  CB    . HIS B 2 571 ? 14.981  59.695 29.232  1.00 26.11  ? 867  HIS A CB    1 
ATOM   4744 C  CG    . HIS B 2 571 ? 14.465  59.737 30.639  1.00 44.33  ? 867  HIS A CG    1 
ATOM   4745 N  ND1   . HIS B 2 571 ? 13.958  58.627 31.280  1.00 46.33  ? 867  HIS A ND1   1 
ATOM   4746 C  CD2   . HIS B 2 571 ? 14.348  60.764 31.516  1.00 49.84  ? 867  HIS A CD2   1 
ATOM   4747 C  CE1   . HIS B 2 571 ? 13.563  58.963 32.495  1.00 48.01  ? 867  HIS A CE1   1 
ATOM   4748 N  NE2   . HIS B 2 571 ? 13.792  60.254 32.665  1.00 48.10  ? 867  HIS A NE2   1 
ATOM   4749 N  N     . TYR B 2 572 ? 15.235  60.801 26.379  1.00 19.99  ? 868  TYR A N     1 
ATOM   4750 C  CA    . TYR B 2 572 ? 15.921  60.705 25.111  1.00 20.30  ? 868  TYR A CA    1 
ATOM   4751 C  C     . TYR B 2 572 ? 17.285  61.333 25.281  1.00 20.29  ? 868  TYR A C     1 
ATOM   4752 O  O     . TYR B 2 572 ? 17.509  62.145 26.185  1.00 21.95  ? 868  TYR A O     1 
ATOM   4753 C  CB    . TYR B 2 572 ? 15.098  61.347 23.987  1.00 17.11  ? 868  TYR A CB    1 
ATOM   4754 C  CG    . TYR B 2 572 ? 14.868  62.823 24.146  1.00 24.60  ? 868  TYR A CG    1 
ATOM   4755 C  CD1   . TYR B 2 572 ? 15.748  63.733 23.597  1.00 25.62  ? 868  TYR A CD1   1 
ATOM   4756 C  CD2   . TYR B 2 572 ? 13.765  63.303 24.842  1.00 29.08  ? 868  TYR A CD2   1 
ATOM   4757 C  CE1   . TYR B 2 572 ? 15.553  65.092 23.740  1.00 35.54  ? 868  TYR A CE1   1 
ATOM   4758 C  CE2   . TYR B 2 572 ? 13.554  64.659 24.991  1.00 30.66  ? 868  TYR A CE2   1 
ATOM   4759 C  CZ    . TYR B 2 572 ? 14.457  65.553 24.433  1.00 37.93  ? 868  TYR A CZ    1 
ATOM   4760 O  OH    . TYR B 2 572 ? 14.270  66.912 24.559  1.00 40.61  ? 868  TYR A OH    1 
ATOM   4761 N  N     . GLY B 2 573 ? 18.207  60.923 24.425  1.00 19.93  ? 869  GLY A N     1 
ATOM   4762 C  CA    . GLY B 2 573 ? 19.535  61.490 24.474  1.00 19.05  ? 869  GLY A CA    1 
ATOM   4763 C  C     . GLY B 2 573 ? 20.343  61.003 23.303  1.00 20.94  ? 869  GLY A C     1 
ATOM   4764 O  O     . GLY B 2 573 ? 19.824  60.342 22.402  1.00 19.83  ? 869  GLY A O     1 
ATOM   4765 N  N     . SER B 2 574 ? 21.623  61.342 23.325  1.00 20.40  ? 870  SER A N     1 
ATOM   4766 C  CA    . SER B 2 574 ? 22.496  61.005 22.217  1.00 25.58  ? 870  SER A CA    1 
ATOM   4767 C  C     . SER B 2 574 ? 23.061  59.595 22.316  1.00 24.93  ? 870  SER A C     1 
ATOM   4768 O  O     . SER B 2 574 ? 23.702  59.140 21.370  1.00 27.58  ? 870  SER A O     1 
ATOM   4769 C  CB    . SER B 2 574 ? 23.639  62.015 22.127  1.00 33.95  ? 870  SER A CB    1 
ATOM   4770 O  OG    . SER B 2 574 ? 24.442  61.957 23.287  1.00 42.11  ? 870  SER A OG    1 
ATOM   4771 N  N     . THR B 2 575 ? 22.883  58.918 23.446  1.00 20.31  ? 871  THR A N     1 
ATOM   4772 C  CA    . THR B 2 575 ? 23.251  57.519 23.600  1.00 20.10  ? 871  THR A CA    1 
ATOM   4773 C  C     . THR B 2 575 ? 22.181  56.861 24.441  1.00 19.06  ? 871  THR A C     1 
ATOM   4774 O  O     . THR B 2 575 ? 21.359  57.534 25.067  1.00 18.63  ? 871  THR A O     1 
ATOM   4775 C  CB    . THR B 2 575 ? 24.601  57.306 24.306  1.00 27.70  ? 871  THR A CB    1 
ATOM   4776 O  OG1   . THR B 2 575 ? 24.430  57.565 25.704  1.00 36.08  ? 871  THR A OG1   1 
ATOM   4777 C  CG2   . THR B 2 575 ? 25.691  58.197 23.756  1.00 22.01  ? 871  THR A CG2   1 
ATOM   4778 N  N     . TRP B 2 576 ? 22.215  55.525 24.470  1.00 18.74  ? 872  TRP A N     1 
ATOM   4779 C  CA    . TRP B 2 576 ? 21.321  54.795 25.358  1.00 24.77  ? 872  TRP A CA    1 
ATOM   4780 C  C     . TRP B 2 576 ? 21.529  55.233 26.802  1.00 20.76  ? 872  TRP A C     1 
ATOM   4781 O  O     . TRP B 2 576 ? 20.570  55.446 27.548  1.00 21.61  ? 872  TRP A O     1 
ATOM   4782 C  CB    . TRP B 2 576 ? 21.576  53.298 25.199  1.00 19.97  ? 872  TRP A CB    1 
ATOM   4783 C  CG    . TRP B 2 576 ? 20.559  52.425 25.809  1.00 23.73  ? 872  TRP A CG    1 
ATOM   4784 C  CD1   . TRP B 2 576 ? 19.380  52.797 26.390  1.00 22.45  ? 872  TRP A CD1   1 
ATOM   4785 C  CD2   . TRP B 2 576 ? 20.620  50.997 25.890  1.00 20.00  ? 872  TRP A CD2   1 
ATOM   4786 N  NE1   . TRP B 2 576 ? 18.702  51.670 26.835  1.00 19.87  ? 872  TRP A NE1   1 
ATOM   4787 C  CE2   . TRP B 2 576 ? 19.446  50.561 26.533  1.00 19.72  ? 872  TRP A CE2   1 
ATOM   4788 C  CE3   . TRP B 2 576 ? 21.553  50.049 25.468  1.00 24.03  ? 872  TRP A CE3   1 
ATOM   4789 C  CZ2   . TRP B 2 576 ? 19.184  49.209 26.774  1.00 24.08  ? 872  TRP A CZ2   1 
ATOM   4790 C  CZ3   . TRP B 2 576 ? 21.297  48.704 25.715  1.00 23.18  ? 872  TRP A CZ3   1 
ATOM   4791 C  CH2   . TRP B 2 576 ? 20.122  48.301 26.358  1.00 27.14  ? 872  TRP A CH2   1 
ATOM   4792 N  N     . TYR B 2 577 ? 22.785  55.412 27.192  1.00 19.39  ? 873  TYR A N     1 
ATOM   4793 C  CA    . TYR B 2 577 ? 23.100  55.857 28.540  1.00 28.57  ? 873  TYR A CA    1 
ATOM   4794 C  C     . TYR B 2 577 ? 22.412  57.180 28.855  1.00 36.81  ? 873  TYR A C     1 
ATOM   4795 O  O     . TYR B 2 577 ? 21.788  57.334 29.911  1.00 28.16  ? 873  TYR A O     1 
ATOM   4796 C  CB    . TYR B 2 577 ? 24.613  55.976 28.674  1.00 29.59  ? 873  TYR A CB    1 
ATOM   4797 C  CG    . TYR B 2 577 ? 25.084  56.601 29.959  1.00 37.16  ? 873  TYR A CG    1 
ATOM   4798 C  CD1   . TYR B 2 577 ? 25.142  55.863 31.133  1.00 48.84  ? 873  TYR A CD1   1 
ATOM   4799 C  CD2   . TYR B 2 577 ? 25.479  57.929 29.998  1.00 46.36  ? 873  TYR A CD2   1 
ATOM   4800 C  CE1   . TYR B 2 577 ? 25.582  56.435 32.313  1.00 58.12  ? 873  TYR A CE1   1 
ATOM   4801 C  CE2   . TYR B 2 577 ? 25.918  58.511 31.171  1.00 57.62  ? 873  TYR A CE2   1 
ATOM   4802 C  CZ    . TYR B 2 577 ? 25.968  57.761 32.324  1.00 59.11  ? 873  TYR A CZ    1 
ATOM   4803 O  OH    . TYR B 2 577 ? 26.406  58.346 33.486  1.00 63.77  ? 873  TYR A OH    1 
ATOM   4804 N  N     . ASP B 2 578 ? 22.494  58.139 27.931  1.00 33.98  ? 874  ASP A N     1 
ATOM   4805 C  CA    . ASP B 2 578 ? 21.901  59.450 28.163  1.00 37.48  ? 874  ASP A CA    1 
ATOM   4806 C  C     . ASP B 2 578 ? 20.391  59.424 28.083  1.00 38.94  ? 874  ASP A C     1 
ATOM   4807 O  O     . ASP B 2 578 ? 19.743  60.343 28.594  1.00 39.27  ? 874  ASP A O     1 
ATOM   4808 C  CB    . ASP B 2 578 ? 22.448  60.461 27.163  1.00 37.80  ? 874  ASP A CB    1 
ATOM   4809 C  CG    . ASP B 2 578 ? 23.949  60.500 27.163  1.00 53.10  ? 874  ASP A CG    1 
ATOM   4810 O  OD1   . ASP B 2 578 ? 24.561  60.062 26.164  1.00 61.58  ? 874  ASP A OD1   1 
ATOM   4811 O  OD2   . ASP B 2 578 ? 24.515  60.952 28.182  1.00 56.52  ? 874  ASP A OD2   1 
ATOM   4812 N  N     . ALA B 2 579 ? 19.807  58.402 27.458  1.00 25.14  ? 875  ALA A N     1 
ATOM   4813 C  CA    . ALA B 2 579 ? 18.353  58.286 27.408  1.00 22.22  ? 875  ALA A CA    1 
ATOM   4814 C  C     . ALA B 2 579 ? 17.853  57.826 28.779  1.00 42.89  ? 875  ALA A C     1 
ATOM   4815 O  O     . ALA B 2 579 ? 17.191  56.803 28.933  1.00 36.45  ? 875  ALA A O     1 
ATOM   4816 C  CB    . ALA B 2 579 ? 17.929  57.339 26.294  1.00 29.47  ? 875  ALA A CB    1 
ATOM   4817 N  N     . LYS B 2 580 ? 18.209  58.624 29.787  1.00 64.20  ? 876  LYS A N     1 
ATOM   4818 C  CA    . LYS B 2 580 ? 17.990  58.320 31.197  1.00 78.72  ? 876  LYS A CA    1 
ATOM   4819 C  C     . LYS B 2 580 ? 17.429  59.536 31.929  1.00 87.24  ? 876  LYS A C     1 
ATOM   4820 O  O     . LYS B 2 580 ? 17.497  60.664 31.433  1.00 89.03  ? 876  LYS A O     1 
ATOM   4821 C  CB    . LYS B 2 580 ? 19.294  57.883 31.867  1.00 82.21  ? 876  LYS A CB    1 
ATOM   4822 C  CG    . LYS B 2 580 ? 20.256  59.039 32.141  1.00 82.64  ? 876  LYS A CG    1 
ATOM   4823 C  CD    . LYS B 2 580 ? 21.526  58.575 32.836  1.00 83.00  ? 876  LYS A CD    1 
ATOM   4824 C  CE    . LYS B 2 580 ? 22.556  59.689 32.893  1.00 85.49  ? 876  LYS A CE    1 
ATOM   4825 N  NZ    . LYS B 2 580 ? 22.783  60.285 31.549  1.00 86.53  ? 876  LYS A NZ    1 
ATOM   4826 O  OXT   . LYS B 2 580 ? 16.906  59.424 33.040  1.00 90.55  ? 876  LYS A OXT   1 
ATOM   4827 P  P     . DT  C 3 1   ? 14.657  31.284 44.576  1.00 117.66 ? 4    DT  T P     1 
ATOM   4828 O  OP1   . DT  C 3 1   ? 13.556  31.574 45.475  1.00 112.05 ? 4    DT  T OP1   1 
ATOM   4829 O  OP2   . DT  C 3 1   ? 15.662  32.318 44.301  1.00 106.58 ? 4    DT  T OP2   1 
ATOM   4830 O  "O5'" . DT  C 3 1   ? 14.004  30.723 43.233  1.00 115.90 ? 4    DT  T "O5'" 1 
ATOM   4831 C  "C5'" . DT  C 3 1   ? 14.619  30.901 41.948  1.00 103.78 ? 4    DT  T "C5'" 1 
ATOM   4832 C  "C4'" . DT  C 3 1   ? 13.578  31.156 40.883  1.00 106.63 ? 4    DT  T "C4'" 1 
ATOM   4833 O  "O4'" . DT  C 3 1   ? 13.087  32.513 40.993  1.00 105.33 ? 4    DT  T "O4'" 1 
ATOM   4834 C  "C3'" . DT  C 3 1   ? 14.088  31.014 39.448  1.00 102.01 ? 4    DT  T "C3'" 1 
ATOM   4835 O  "O3'" . DT  C 3 1   ? 13.894  29.705 38.887  1.00 107.92 ? 4    DT  T "O3'" 1 
ATOM   4836 C  "C2'" . DT  C 3 1   ? 13.314  32.076 38.688  1.00 102.80 ? 4    DT  T "C2'" 1 
ATOM   4837 C  "C1'" . DT  C 3 1   ? 13.115  33.168 39.730  1.00 106.66 ? 4    DT  T "C1'" 1 
ATOM   4838 N  N1    . DT  C 3 1   ? 14.145  34.250 39.785  1.00 102.04 ? 4    DT  T N1    1 
ATOM   4839 C  C2    . DT  C 3 1   ? 14.176  35.177 38.766  1.00 100.36 ? 4    DT  T C2    1 
ATOM   4840 O  O2    . DT  C 3 1   ? 13.424  35.145 37.814  1.00 107.42 ? 4    DT  T O2    1 
ATOM   4841 N  N3    . DT  C 3 1   ? 15.133  36.148 38.902  1.00 93.49  ? 4    DT  T N3    1 
ATOM   4842 C  C4    . DT  C 3 1   ? 16.036  36.288 39.929  1.00 89.94  ? 4    DT  T C4    1 
ATOM   4843 O  O4    . DT  C 3 1   ? 16.831  37.221 39.915  1.00 84.50  ? 4    DT  T O4    1 
ATOM   4844 C  C5    . DT  C 3 1   ? 15.952  35.281 40.964  1.00 90.14  ? 4    DT  T C5    1 
ATOM   4845 C  C7    . DT  C 3 1   ? 16.900  35.346 42.119  1.00 91.17  ? 4    DT  T C7    1 
ATOM   4846 C  C6    . DT  C 3 1   ? 15.022  34.328 40.842  1.00 94.90  ? 4    DT  T C6    1 
ATOM   4847 P  P     . DA  C 3 2   ? 14.954  29.131 37.890  1.00 103.86 ? 5    DA  T P     1 
ATOM   4848 O  OP1   . DA  C 3 2   ? 14.634  27.726 37.550  1.00 109.19 ? 5    DA  T OP1   1 
ATOM   4849 O  OP2   . DA  C 3 2   ? 16.280  29.467 38.455  1.00 100.26 ? 5    DA  T OP2   1 
ATOM   4850 O  "O5'" . DA  C 3 2   ? 14.747  30.025 36.582  1.00 109.04 ? 5    DA  T "O5'" 1 
ATOM   4851 C  "C5'" . DA  C 3 2   ? 13.467  30.118 35.968  1.00 115.26 ? 5    DA  T "C5'" 1 
ATOM   4852 C  "C4'" . DA  C 3 2   ? 13.483  31.165 34.869  1.00 113.07 ? 5    DA  T "C4'" 1 
ATOM   4853 O  "O4'" . DA  C 3 2   ? 13.674  32.473 35.456  1.00 108.78 ? 5    DA  T "O4'" 1 
ATOM   4854 C  "C3'" . DA  C 3 2   ? 14.575  30.968 33.820  1.00 106.39 ? 5    DA  T "C3'" 1 
ATOM   4855 O  "O3'" . DA  C 3 2   ? 13.979  30.497 32.610  1.00 113.01 ? 5    DA  T "O3'" 1 
ATOM   4856 C  "C2'" . DA  C 3 2   ? 15.202  32.353 33.630  1.00 98.70  ? 5    DA  T "C2'" 1 
ATOM   4857 C  "C1'" . DA  C 3 2   ? 14.749  33.152 34.848  1.00 99.26  ? 5    DA  T "C1'" 1 
ATOM   4858 N  N9    . DA  C 3 2   ? 15.794  33.365 35.847  1.00 92.73  ? 5    DA  T N9    1 
ATOM   4859 C  C8    . DA  C 3 2   ? 16.024  32.628 36.975  1.00 93.80  ? 5    DA  T C8    1 
ATOM   4860 N  N7    . DA  C 3 2   ? 17.031  33.061 37.695  1.00 89.18  ? 5    DA  T N7    1 
ATOM   4861 C  C5    . DA  C 3 2   ? 17.486  34.162 36.995  1.00 85.64  ? 5    DA  T C5    1 
ATOM   4862 C  C6    . DA  C 3 2   ? 18.530  35.067 37.235  1.00 81.40  ? 5    DA  T C6    1 
ATOM   4863 N  N6    . DA  C 3 2   ? 19.338  34.991 38.296  1.00 75.77  ? 5    DA  T N6    1 
ATOM   4864 N  N1    . DA  C 3 2   ? 18.722  36.049 36.332  1.00 87.49  ? 5    DA  T N1    1 
ATOM   4865 C  C2    . DA  C 3 2   ? 17.911  36.120 35.270  1.00 85.97  ? 5    DA  T C2    1 
ATOM   4866 N  N3    . DA  C 3 2   ? 16.893  35.331 34.942  1.00 85.78  ? 5    DA  T N3    1 
ATOM   4867 C  C4    . DA  C 3 2   ? 16.733  34.363 35.854  1.00 87.96  ? 5    DA  T C4    1 
ATOM   4868 P  P     . DC  C 3 3   ? 14.825  29.633 31.552  1.00 115.42 ? 6    DC  T P     1 
ATOM   4869 O  OP1   . DC  C 3 3   ? 13.853  29.048 30.599  1.00 122.36 ? 6    DC  T OP1   1 
ATOM   4870 O  OP2   . DC  C 3 3   ? 15.763  28.757 32.287  1.00 115.64 ? 6    DC  T OP2   1 
ATOM   4871 O  "O5'" . DC  C 3 3   ? 15.686  30.727 30.781  1.00 106.06 ? 6    DC  T "O5'" 1 
ATOM   4872 C  "C5'" . DC  C 3 3   ? 15.045  31.860 30.223  1.00 101.90 ? 6    DC  T "C5'" 1 
ATOM   4873 C  "C4'" . DC  C 3 3   ? 16.067  32.782 29.604  1.00 94.99  ? 6    DC  T "C4'" 1 
ATOM   4874 O  "O4'" . DC  C 3 3   ? 16.756  33.520 30.645  1.00 89.64  ? 6    DC  T "O4'" 1 
ATOM   4875 C  "C3'" . DC  C 3 3   ? 17.142  32.069 28.793  1.00 87.53  ? 6    DC  T "C3'" 1 
ATOM   4876 O  "O3'" . DC  C 3 3   ? 17.319  32.732 27.568  1.00 84.98  ? 6    DC  T "O3'" 1 
ATOM   4877 C  "C2'" . DC  C 3 3   ? 18.389  32.150 29.676  1.00 82.60  ? 6    DC  T "C2'" 1 
ATOM   4878 C  "C1'" . DC  C 3 3   ? 18.150  33.433 30.457  1.00 83.14  ? 6    DC  T "C1'" 1 
ATOM   4879 N  N1    . DC  C 3 3   ? 18.795  33.436 31.806  1.00 85.67  ? 6    DC  T N1    1 
ATOM   4880 C  C2    . DC  C 3 3   ? 19.476  34.575 32.254  1.00 82.69  ? 6    DC  T C2    1 
ATOM   4881 O  O2    . DC  C 3 3   ? 19.550  35.567 31.519  1.00 81.89  ? 6    DC  T O2    1 
ATOM   4882 N  N3    . DC  C 3 3   ? 20.048  34.558 33.483  1.00 79.41  ? 6    DC  T N3    1 
ATOM   4883 C  C4    . DC  C 3 3   ? 19.950  33.473 34.247  1.00 84.01  ? 6    DC  T C4    1 
ATOM   4884 N  N4    . DC  C 3 3   ? 20.529  33.502 35.454  1.00 83.89  ? 6    DC  T N4    1 
ATOM   4885 C  C5    . DC  C 3 3   ? 19.256  32.306 33.808  1.00 85.30  ? 6    DC  T C5    1 
ATOM   4886 C  C6    . DC  C 3 3   ? 18.700  32.332 32.597  1.00 86.81  ? 6    DC  T C6    1 
ATOM   4887 P  P     . DG  C 3 4   ? 18.367  32.170 26.494  1.00 83.49  ? 7    DG  T P     1 
ATOM   4888 O  OP1   . DG  C 3 4   ? 17.885  32.606 25.167  1.00 85.77  ? 7    DG  T OP1   1 
ATOM   4889 O  OP2   . DG  C 3 4   ? 18.632  30.737 26.763  1.00 85.11  ? 7    DG  T OP2   1 
ATOM   4890 O  "O5'" . DG  C 3 4   ? 19.688  32.981 26.830  1.00 77.88  ? 7    DG  T "O5'" 1 
ATOM   4891 C  "C5'" . DG  C 3 4   ? 19.591  34.357 27.095  1.00 76.51  ? 7    DG  T "C5'" 1 
ATOM   4892 C  "C4'" . DG  C 3 4   ? 20.953  35.004 27.037  1.00 74.94  ? 7    DG  T "C4'" 1 
ATOM   4893 O  "O4'" . DG  C 3 4   ? 21.489  35.140 28.374  1.00 68.64  ? 7    DG  T "O4'" 1 
ATOM   4894 C  "C3'" . DG  C 3 4   ? 21.990  34.248 26.222  1.00 70.27  ? 7    DG  T "C3'" 1 
ATOM   4895 O  "O3'" . DG  C 3 4   ? 22.778  35.177 25.510  1.00 67.92  ? 7    DG  T "O3'" 1 
ATOM   4896 C  "C2'" . DG  C 3 4   ? 22.798  33.482 27.280  1.00 68.27  ? 7    DG  T "C2'" 1 
ATOM   4897 C  "C1'" . DG  C 3 4   ? 22.648  34.346 28.535  1.00 66.52  ? 7    DG  T "C1'" 1 
ATOM   4898 N  N9    . DG  C 3 4   ? 22.487  33.571 29.767  1.00 68.03  ? 7    DG  T N9    1 
ATOM   4899 C  C8    . DG  C 3 4   ? 21.737  32.430 29.937  1.00 71.12  ? 7    DG  T C8    1 
ATOM   4900 N  N7    . DG  C 3 4   ? 21.767  31.964 31.156  1.00 72.24  ? 7    DG  T N7    1 
ATOM   4901 C  C5    . DG  C 3 4   ? 22.589  32.853 31.842  1.00 67.85  ? 7    DG  T C5    1 
ATOM   4902 C  C6    . DG  C 3 4   ? 22.995  32.858 33.199  1.00 71.63  ? 7    DG  T C6    1 
ATOM   4903 O  O6    . DG  C 3 4   ? 22.697  32.051 34.095  1.00 71.90  ? 7    DG  T O6    1 
ATOM   4904 N  N1    . DG  C 3 4   ? 23.832  33.940 33.484  1.00 73.49  ? 7    DG  T N1    1 
ATOM   4905 C  C2    . DG  C 3 4   ? 24.226  34.893 32.569  1.00 74.13  ? 7    DG  T C2    1 
ATOM   4906 N  N2    . DG  C 3 4   ? 25.036  35.863 33.028  1.00 61.92  ? 7    DG  T N2    1 
ATOM   4907 N  N3    . DG  C 3 4   ? 23.851  34.895 31.289  1.00 61.74  ? 7    DG  T N3    1 
ATOM   4908 C  C4    . DG  C 3 4   ? 23.038  33.850 31.000  1.00 65.22  ? 7    DG  T C4    1 
ATOM   4909 P  P     . DT  C 3 5   ? 23.940  34.693 24.516  1.00 66.81  ? 8    DT  T P     1 
ATOM   4910 O  OP1   . DT  C 3 5   ? 24.111  35.775 23.521  1.00 66.68  ? 8    DT  T OP1   1 
ATOM   4911 O  OP2   . DT  C 3 5   ? 23.651  33.299 24.111  1.00 85.45  ? 8    DT  T OP2   1 
ATOM   4912 O  "O5'" . DT  C 3 5   ? 25.253  34.674 25.429  1.00 62.71  ? 8    DT  T "O5'" 1 
ATOM   4913 C  "C5'" . DT  C 3 5   ? 25.594  35.822 26.192  1.00 59.88  ? 8    DT  T "C5'" 1 
ATOM   4914 C  "C4'" . DT  C 3 5   ? 26.787  35.535 27.080  1.00 56.88  ? 8    DT  T "C4'" 1 
ATOM   4915 O  "O4'" . DT  C 3 5   ? 26.351  34.990 28.351  1.00 57.43  ? 8    DT  T "O4'" 1 
ATOM   4916 C  "C3'" . DT  C 3 5   ? 27.785  34.525 26.505  1.00 56.70  ? 8    DT  T "C3'" 1 
ATOM   4917 O  "O3'" . DT  C 3 5   ? 29.033  35.166 26.318  1.00 60.12  ? 8    DT  T "O3'" 1 
ATOM   4918 C  "C2'" . DT  C 3 5   ? 27.854  33.426 27.577  1.00 61.44  ? 8    DT  T "C2'" 1 
ATOM   4919 C  "C1'" . DT  C 3 5   ? 27.365  34.148 28.820  1.00 56.33  ? 8    DT  T "C1'" 1 
ATOM   4920 N  N1    . DT  C 3 5   ? 26.806  33.227 29.864  1.00 58.36  ? 8    DT  T N1    1 
ATOM   4921 C  C2    . DT  C 3 5   ? 27.171  33.393 31.189  1.00 57.60  ? 8    DT  T C2    1 
ATOM   4922 O  O2    . DT  C 3 5   ? 27.922  34.275 31.576  1.00 55.18  ? 8    DT  T O2    1 
ATOM   4923 N  N3    . DT  C 3 5   ? 26.609  32.489 32.055  1.00 59.75  ? 8    DT  T N3    1 
ATOM   4924 C  C4    . DT  C 3 5   ? 25.751  31.449 31.735  1.00 68.10  ? 8    DT  T C4    1 
ATOM   4925 O  O4    . DT  C 3 5   ? 25.302  30.685 32.586  1.00 67.61  ? 8    DT  T O4    1 
ATOM   4926 C  C5    . DT  C 3 5   ? 25.422  31.325 30.329  1.00 64.47  ? 8    DT  T C5    1 
ATOM   4927 C  C7    . DT  C 3 5   ? 24.496  30.240 29.861  1.00 69.02  ? 8    DT  T C7    1 
ATOM   4928 C  C6    . DT  C 3 5   ? 25.960  32.208 29.475  1.00 61.92  ? 8    DT  T C6    1 
ATOM   4929 P  P     . DG  C 3 6   ? 30.274  34.413 25.629  1.00 69.64  ? 9    DG  T P     1 
ATOM   4930 O  OP1   . DG  C 3 6   ? 30.628  35.225 24.442  1.00 64.52  ? 9    DG  T OP1   1 
ATOM   4931 O  OP2   . DG  C 3 6   ? 29.989  32.967 25.494  1.00 70.81  ? 9    DG  T OP2   1 
ATOM   4932 O  "O5'" . DG  C 3 6   ? 31.443  34.542 26.718  1.00 60.02  ? 9    DG  T "O5'" 1 
ATOM   4933 C  "C5'" . DG  C 3 6   ? 31.587  35.748 27.472  1.00 56.97  ? 9    DG  T "C5'" 1 
ATOM   4934 C  "C4'" . DG  C 3 6   ? 32.317  35.482 28.783  1.00 49.37  ? 9    DG  T "C4'" 1 
ATOM   4935 O  "O4'" . DG  C 3 6   ? 31.383  34.987 29.758  1.00 48.49  ? 9    DG  T "O4'" 1 
ATOM   4936 C  "C3'" . DG  C 3 6   ? 33.433  34.456 28.688  1.00 53.12  ? 9    DG  T "C3'" 1 
ATOM   4937 O  "O3'" . DG  C 3 6   ? 34.660  35.136 28.586  1.00 57.84  ? 9    DG  T "O3'" 1 
ATOM   4938 C  "C2'" . DG  C 3 6   ? 33.355  33.682 30.003  1.00 57.02  ? 9    DG  T "C2'" 1 
ATOM   4939 C  "C1'" . DG  C 3 6   ? 31.929  33.903 30.475  1.00 52.89  ? 9    DG  T "C1'" 1 
ATOM   4940 N  N9    . DG  C 3 6   ? 31.057  32.755 30.292  1.00 55.29  ? 9    DG  T N9    1 
ATOM   4941 C  C8    . DG  C 3 6   ? 30.477  32.325 29.121  1.00 54.19  ? 9    DG  T C8    1 
ATOM   4942 N  N7    . DG  C 3 6   ? 29.713  31.279 29.274  1.00 58.36  ? 9    DG  T N7    1 
ATOM   4943 C  C5    . DG  C 3 6   ? 29.796  31.002 30.637  1.00 60.15  ? 9    DG  T C5    1 
ATOM   4944 C  C6    . DG  C 3 6   ? 29.192  29.978 31.397  1.00 70.65  ? 9    DG  T C6    1 
ATOM   4945 O  O6    . DG  C 3 6   ? 28.433  29.081 31.008  1.00 83.47  ? 9    DG  T O6    1 
ATOM   4946 N  N1    . DG  C 3 6   ? 29.553  30.054 32.743  1.00 73.26  ? 9    DG  T N1    1 
ATOM   4947 C  C2    . DG  C 3 6   ? 30.394  31.003 33.278  1.00 68.17  ? 9    DG  T C2    1 
ATOM   4948 N  N2    . DG  C 3 6   ? 30.621  30.925 34.596  1.00 71.36  ? 9    DG  T N2    1 
ATOM   4949 N  N3    . DG  C 3 6   ? 30.967  31.967 32.572  1.00 54.53  ? 9    DG  T N3    1 
ATOM   4950 C  C4    . DG  C 3 6   ? 30.621  31.905 31.269  1.00 54.37  ? 9    DG  T C4    1 
ATOM   4951 P  P     . DA  C 3 7   ? 35.979  34.367 28.104  1.00 60.03  ? 10   DA  T P     1 
ATOM   4952 O  OP1   . DA  C 3 7   ? 36.965  35.417 27.775  1.00 70.93  ? 10   DA  T OP1   1 
ATOM   4953 O  OP2   . DA  C 3 7   ? 35.611  33.345 27.103  1.00 62.14  ? 10   DA  T OP2   1 
ATOM   4954 O  "O5'" . DA  C 3 7   ? 36.471  33.582 29.406  1.00 53.20  ? 10   DA  T "O5'" 1 
ATOM   4955 C  "C5'" . DA  C 3 7   ? 36.667  34.269 30.626  1.00 52.95  ? 10   DA  T "C5'" 1 
ATOM   4956 C  "C4'" . DA  C 3 7   ? 37.036  33.290 31.727  1.00 54.02  ? 10   DA  T "C4'" 1 
ATOM   4957 O  "O4'" . DA  C 3 7   ? 35.885  32.471 32.061  1.00 54.58  ? 10   DA  T "O4'" 1 
ATOM   4958 C  "C3'" . DA  C 3 7   ? 38.160  32.326 31.369  1.00 54.89  ? 10   DA  T "C3'" 1 
ATOM   4959 O  "O3'" . DA  C 3 7   ? 39.028  32.181 32.471  1.00 51.14  ? 10   DA  T "O3'" 1 
ATOM   4960 C  "C2'" . DA  C 3 7   ? 37.433  31.021 31.036  1.00 50.38  ? 10   DA  T "C2'" 1 
ATOM   4961 C  "C1'" . DA  C 3 7   ? 36.202  31.097 31.921  1.00 53.23  ? 10   DA  T "C1'" 1 
ATOM   4962 N  N9    . DA  C 3 7   ? 35.040  30.414 31.358  1.00 53.08  ? 10   DA  T N9    1 
ATOM   4963 C  C8    . DA  C 3 7   ? 34.569  30.500 30.072  1.00 53.19  ? 10   DA  T C8    1 
ATOM   4964 N  N7    . DA  C 3 7   ? 33.492  29.783 29.854  1.00 55.78  ? 10   DA  T N7    1 
ATOM   4965 C  C5    . DA  C 3 7   ? 33.236  29.189 31.077  1.00 57.48  ? 10   DA  T C5    1 
ATOM   4966 C  C6    . DA  C 3 7   ? 32.234  28.301 31.508  1.00 60.88  ? 10   DA  T C6    1 
ATOM   4967 N  N6    . DA  C 3 7   ? 31.263  27.849 30.714  1.00 63.11  ? 10   DA  T N6    1 
ATOM   4968 N  N1    . DA  C 3 7   ? 32.270  27.894 32.795  1.00 70.81  ? 10   DA  T N1    1 
ATOM   4969 C  C2    . DA  C 3 7   ? 33.246  28.351 33.593  1.00 64.50  ? 10   DA  T C2    1 
ATOM   4970 N  N3    . DA  C 3 7   ? 34.242  29.183 33.301  1.00 57.32  ? 10   DA  T N3    1 
ATOM   4971 C  C4    . DA  C 3 7   ? 34.180  29.569 32.017  1.00 55.89  ? 10   DA  T C4    1 
ATOM   4972 P  P     . DT  C 3 8   ? 40.304  31.222 32.369  1.00 56.97  ? 11   DT  T P     1 
ATOM   4973 O  OP1   . DT  C 3 8   ? 41.378  31.865 33.157  1.00 59.58  ? 11   DT  T OP1   1 
ATOM   4974 O  OP2   . DT  C 3 8   ? 40.545  30.876 30.951  1.00 59.07  ? 11   DT  T OP2   1 
ATOM   4975 O  "O5'" . DT  C 3 8   ? 39.824  29.899 33.112  1.00 55.49  ? 11   DT  T "O5'" 1 
ATOM   4976 C  "C5'" . DT  C 3 8   ? 39.198  30.010 34.372  1.00 53.77  ? 11   DT  T "C5'" 1 
ATOM   4977 C  "C4'" . DT  C 3 8   ? 38.806  28.652 34.920  1.00 57.86  ? 11   DT  T "C4'" 1 
ATOM   4978 O  "O4'" . DT  C 3 8   ? 37.568  28.206 34.317  1.00 60.17  ? 11   DT  T "O4'" 1 
ATOM   4979 C  "C3'" . DT  C 3 8   ? 39.821  27.534 34.714  1.00 60.92  ? 11   DT  T "C3'" 1 
ATOM   4980 O  "O3'" . DT  C 3 8   ? 39.972  26.851 35.948  1.00 64.28  ? 11   DT  T "O3'" 1 
ATOM   4981 C  "C2'" . DT  C 3 8   ? 39.167  26.657 33.631  1.00 62.77  ? 11   DT  T "C2'" 1 
ATOM   4982 C  "C1'" . DT  C 3 8   ? 37.688  26.861 33.929  1.00 63.28  ? 11   DT  T "C1'" 1 
ATOM   4983 N  N1    . DT  C 3 8   ? 36.762  26.652 32.767  1.00 64.27  ? 11   DT  T N1    1 
ATOM   4984 C  C2    . DT  C 3 8   ? 35.627  25.892 32.944  1.00 68.61  ? 11   DT  T C2    1 
ATOM   4985 O  O2    . DT  C 3 8   ? 35.353  25.337 33.988  1.00 73.06  ? 11   DT  T O2    1 
ATOM   4986 N  N3    . DT  C 3 8   ? 34.827  25.789 31.849  1.00 66.14  ? 11   DT  T N3    1 
ATOM   4987 C  C4    . DT  C 3 8   ? 35.029  26.367 30.622  1.00 63.84  ? 11   DT  T C4    1 
ATOM   4988 O  O4    . DT  C 3 8   ? 34.246  26.210 29.690  1.00 70.06  ? 11   DT  T O4    1 
ATOM   4989 C  C5    . DT  C 3 8   ? 36.227  27.165 30.500  1.00 60.72  ? 11   DT  T C5    1 
ATOM   4990 C  C7    . DT  C 3 8   ? 36.552  27.839 29.197  1.00 68.94  ? 11   DT  T C7    1 
ATOM   4991 C  C6    . DT  C 3 8   ? 37.024  27.272 31.569  1.00 60.29  ? 11   DT  T C6    1 
ATOM   4992 P  P     . DC  C 3 9   ? 41.184  25.837 36.204  1.00 68.55  ? 12   DC  T P     1 
ATOM   4993 O  OP1   . DC  C 3 9   ? 41.601  25.979 37.619  1.00 72.62  ? 12   DC  T OP1   1 
ATOM   4994 O  OP2   . DC  C 3 9   ? 42.194  25.995 35.142  1.00 66.77  ? 12   DC  T OP2   1 
ATOM   4995 O  "O5'" . DC  C 3 9   ? 40.474  24.423 36.097  1.00 76.36  ? 12   DC  T "O5'" 1 
ATOM   4996 C  "C5'" . DC  C 3 9   ? 39.244  24.237 36.769  1.00 78.55  ? 12   DC  T "C5'" 1 
ATOM   4997 C  "C4'" . DC  C 3 9   ? 38.523  23.020 36.249  1.00 88.06  ? 12   DC  T "C4'" 1 
ATOM   4998 O  "O4'" . DC  C 3 9   ? 37.841  23.333 35.002  1.00 89.37  ? 12   DC  T "O4'" 1 
ATOM   4999 C  "C3'" . DC  C 3 9   ? 39.421  21.825 35.932  1.00 97.33  ? 12   DC  T "C3'" 1 
ATOM   5000 O  "O3'" . DC  C 3 9   ? 38.727  20.657 36.265  1.00 109.24 ? 12   DC  T "O3'" 1 
ATOM   5001 C  "C2'" . DC  C 3 9   ? 39.575  21.935 34.420  1.00 93.33  ? 12   DC  T "C2'" 1 
ATOM   5002 C  "C1'" . DC  C 3 9   ? 38.156  22.324 34.072  1.00 90.74  ? 12   DC  T "C1'" 1 
ATOM   5003 N  N1    . DC  C 3 9   ? 37.967  22.845 32.692  1.00 86.00  ? 12   DC  T N1    1 
ATOM   5004 C  C2    . DC  C 3 9   ? 36.730  22.671 32.068  1.00 80.20  ? 12   DC  T C2    1 
ATOM   5005 O  O2    . DC  C 3 9   ? 35.824  22.091 32.680  1.00 79.27  ? 12   DC  T O2    1 
ATOM   5006 N  N3    . DC  C 3 9   ? 36.558  23.146 30.812  1.00 74.49  ? 12   DC  T N3    1 
ATOM   5007 C  C4    . DC  C 3 9   ? 37.560  23.766 30.187  1.00 71.14  ? 12   DC  T C4    1 
ATOM   5008 N  N4    . DC  C 3 9   ? 37.338  24.214 28.946  1.00 69.50  ? 12   DC  T N4    1 
ATOM   5009 C  C5    . DC  C 3 9   ? 38.833  23.951 30.806  1.00 70.38  ? 12   DC  T C5    1 
ATOM   5010 C  C6    . DC  C 3 9   ? 38.992  23.477 32.047  1.00 84.77  ? 12   DC  T C6    1 
ATOM   5011 P  P     . DG  C 3 10  ? 39.435  19.495 37.109  1.00 119.04 ? 13   DG  T P     1 
ATOM   5012 O  OP1   . DG  C 3 10  ? 39.530  19.962 38.510  1.00 113.79 ? 13   DG  T OP1   1 
ATOM   5013 O  OP2   . DG  C 3 10  ? 40.654  19.092 36.368  1.00 118.79 ? 13   DG  T OP2   1 
ATOM   5014 O  "O5'" . DG  C 3 10  ? 38.382  18.294 37.012  1.00 127.86 ? 13   DG  T "O5'" 1 
ATOM   5015 C  "C5'" . DG  C 3 10  ? 36.996  18.582 36.809  1.00 127.14 ? 13   DG  T "C5'" 1 
ATOM   5016 C  "C4'" . DG  C 3 10  ? 36.388  17.668 35.752  1.00 132.24 ? 13   DG  T "C4'" 1 
ATOM   5017 O  "O4'" . DG  C 3 10  ? 36.450  18.303 34.447  1.00 127.44 ? 13   DG  T "O4'" 1 
ATOM   5018 C  "C3'" . DG  C 3 10  ? 37.066  16.312 35.590  1.00 139.30 ? 13   DG  T "C3'" 1 
ATOM   5019 O  "O3'" . DG  C 3 10  ? 36.090  15.330 35.299  1.00 145.59 ? 13   DG  T "O3'" 1 
ATOM   5020 C  "C2'" . DG  C 3 10  ? 38.002  16.539 34.405  1.00 135.13 ? 13   DG  T "C2'" 1 
ATOM   5021 C  "C1'" . DG  C 3 10  ? 37.188  17.498 33.548  1.00 127.90 ? 13   DG  T "C1'" 1 
ATOM   5022 N  N9    . DG  C 3 10  ? 38.010  18.378 32.730  1.00 118.73 ? 13   DG  T N9    1 
ATOM   5023 C  C8    . DG  C 3 10  ? 39.245  18.884 33.049  1.00 116.44 ? 13   DG  T C8    1 
ATOM   5024 N  N7    . DG  C 3 10  ? 39.744  19.658 32.127  1.00 112.58 ? 13   DG  T N7    1 
ATOM   5025 C  C5    . DG  C 3 10  ? 38.776  19.669 31.134  1.00 109.21 ? 13   DG  T C5    1 
ATOM   5026 C  C6    . DG  C 3 10  ? 38.760  20.336 29.889  1.00 101.08 ? 13   DG  T C6    1 
ATOM   5027 O  O6    . DG  C 3 10  ? 39.628  21.076 29.404  1.00 93.84  ? 13   DG  T O6    1 
ATOM   5028 N  N1    . DG  C 3 10  ? 37.588  20.078 29.182  1.00 103.33 ? 13   DG  T N1    1 
ATOM   5029 C  C2    . DG  C 3 10  ? 36.562  19.276 29.624  1.00 110.21 ? 13   DG  T C2    1 
ATOM   5030 N  N2    . DG  C 3 10  ? 35.512  19.146 28.799  1.00 113.48 ? 13   DG  T N2    1 
ATOM   5031 N  N3    . DG  C 3 10  ? 36.565  18.645 30.792  1.00 111.87 ? 13   DG  T N3    1 
ATOM   5032 C  C4    . DG  C 3 10  ? 37.700  18.886 31.490  1.00 113.29 ? 13   DG  T C4    1 
ATOM   5033 P  P     . DC  C 3 11  ? 36.444  13.769 35.423  1.00 153.80 ? 14   DC  T P     1 
ATOM   5034 O  OP1   . DC  C 3 11  ? 35.494  13.189 36.397  1.00 159.91 ? 14   DC  T OP1   1 
ATOM   5035 O  OP2   . DC  C 3 11  ? 37.901  13.636 35.644  1.00 155.37 ? 14   DC  T OP2   1 
ATOM   5036 O  "O5'" . DC  C 3 11  ? 36.127  13.195 33.965  1.00 154.03 ? 14   DC  T "O5'" 1 
ATOM   5037 C  "C5'" . DC  C 3 11  ? 34.865  13.446 33.363  1.00 150.69 ? 14   DC  T "C5'" 1 
ATOM   5038 C  "C4'" . DC  C 3 11  ? 34.917  13.158 31.876  1.00 151.19 ? 14   DC  T "C4'" 1 
ATOM   5039 O  "O4'" . DC  C 3 11  ? 35.531  14.275 31.181  1.00 144.85 ? 14   DC  T "O4'" 1 
ATOM   5040 C  "C3'" . DC  C 3 11  ? 35.733  11.916 31.485  1.00 161.04 ? 14   DC  T "C3'" 1 
ATOM   5041 O  "O3'" . DC  C 3 11  ? 34.960  11.064 30.645  1.00 166.78 ? 14   DC  T "O3'" 1 
ATOM   5042 C  "C2'" . DC  C 3 11  ? 36.936  12.495 30.738  1.00 156.98 ? 14   DC  T "C2'" 1 
ATOM   5043 C  "C1'" . DC  C 3 11  ? 36.342  13.760 30.157  1.00 149.55 ? 14   DC  T "C1'" 1 
ATOM   5044 N  N1    . DC  C 3 11  ? 37.364  14.773 29.774  1.00 144.86 ? 14   DC  T N1    1 
ATOM   5045 C  C2    . DC  C 3 11  ? 37.164  15.564 28.637  1.00 138.13 ? 14   DC  T C2    1 
ATOM   5046 O  O2    . DC  C 3 11  ? 36.125  15.424 27.980  1.00 138.23 ? 14   DC  T O2    1 
ATOM   5047 N  N3    . DC  C 3 11  ? 38.111  16.471 28.294  1.00 131.86 ? 14   DC  T N3    1 
ATOM   5048 C  C4    . DC  C 3 11  ? 39.216  16.591 29.029  1.00 132.28 ? 14   DC  T C4    1 
ATOM   5049 N  N4    . DC  C 3 11  ? 40.122  17.498 28.651  1.00 126.68 ? 14   DC  T N4    1 
ATOM   5050 C  C5    . DC  C 3 11  ? 39.443  15.788 30.185  1.00 139.83 ? 14   DC  T C5    1 
ATOM   5051 C  C6    . DC  C 3 11  ? 38.502  14.897 30.515  1.00 145.62 ? 14   DC  T C6    1 
ATOM   5052 P  P     . DA  C 3 12  ? 35.639  9.790  29.937  1.00 175.14 ? 15   DA  T P     1 
ATOM   5053 O  OP1   . DA  C 3 12  ? 34.562  8.803  29.700  1.00 182.43 ? 15   DA  T OP1   1 
ATOM   5054 O  OP2   . DA  C 3 12  ? 36.823  9.391  30.731  1.00 175.97 ? 15   DA  T OP2   1 
ATOM   5055 O  "O5'" . DA  C 3 12  ? 36.139  10.350 28.519  1.00 172.00 ? 15   DA  T "O5'" 1 
ATOM   5056 C  "C5'" . DA  C 3 12  ? 35.183  10.708 27.519  1.00 167.95 ? 15   DA  T "C5'" 1 
ATOM   5057 C  "C4'" . DA  C 3 12  ? 35.854  10.988 26.179  1.00 162.38 ? 15   DA  T "C4'" 1 
ATOM   5058 O  "O4'" . DA  C 3 12  ? 36.562  12.245 26.237  1.00 154.36 ? 15   DA  T "O4'" 1 
ATOM   5059 C  "C3'" . DA  C 3 12  ? 36.879  9.941  25.716  1.00 162.87 ? 15   DA  T "C3'" 1 
ATOM   5060 O  "O3'" . DA  C 3 12  ? 36.427  9.311  24.521  1.00 161.07 ? 15   DA  T "O3'" 1 
ATOM   5061 C  "C2'" . DA  C 3 12  ? 38.169  10.745 25.477  1.00 158.97 ? 15   DA  T "C2'" 1 
ATOM   5062 C  "C1'" . DA  C 3 12  ? 37.653  12.173 25.359  1.00 153.46 ? 15   DA  T "C1'" 1 
ATOM   5063 N  N9    . DA  C 3 12  ? 38.627  13.188 25.751  1.00 146.58 ? 15   DA  T N9    1 
ATOM   5064 C  C8    . DA  C 3 12  ? 39.331  13.246 26.922  1.00 145.94 ? 15   DA  T C8    1 
ATOM   5065 N  N7    . DA  C 3 12  ? 40.136  14.280 27.006  1.00 140.35 ? 15   DA  T N7    1 
ATOM   5066 C  C5    . DA  C 3 12  ? 39.944  14.949 25.807  1.00 135.69 ? 15   DA  T C5    1 
ATOM   5067 C  C6    . DA  C 3 12  ? 40.506  16.129 25.275  1.00 122.34 ? 15   DA  T C6    1 
ATOM   5068 N  N6    . DA  C 3 12  ? 41.416  16.865 25.922  1.00 114.86 ? 15   DA  T N6    1 
ATOM   5069 N  N1    . DA  C 3 12  ? 40.097  16.521 24.049  1.00 117.33 ? 15   DA  T N1    1 
ATOM   5070 C  C2    . DA  C 3 12  ? 39.186  15.781 23.405  1.00 122.90 ? 15   DA  T C2    1 
ATOM   5071 N  N3    . DA  C 3 12  ? 38.588  14.656 23.800  1.00 132.85 ? 15   DA  T N3    1 
ATOM   5072 C  C4    . DA  C 3 12  ? 39.015  14.291 25.021  1.00 139.34 ? 15   DA  T C4    1 
HETATM 5073 MG MG    . MG  D 4 .   ? 9.876   44.580 35.085  1.00 30.00  ? 901  MG  A MG    1 
HETATM 5074 S  S     . SO4 E 5 .   ? 13.949  52.708 43.360  1.00 70.66  ? 902  SO4 A S     1 
HETATM 5075 O  O1    . SO4 E 5 .   ? 14.803  53.821 42.946  1.00 73.67  ? 902  SO4 A O1    1 
HETATM 5076 O  O2    . SO4 E 5 .   ? 14.068  51.606 42.406  1.00 75.40  ? 902  SO4 A O2    1 
HETATM 5077 O  O3    . SO4 E 5 .   ? 14.366  52.264 44.687  1.00 70.73  ? 902  SO4 A O3    1 
HETATM 5078 O  O4    . SO4 E 5 .   ? 12.555  53.145 43.396  1.00 70.77  ? 902  SO4 A O4    1 
HETATM 5079 O  O     . HOH F 6 .   ? 30.420  18.063 34.953  1.00 60.47  ? 101  HOH P O     1 
HETATM 5080 O  O     . HOH F 6 .   ? 31.126  39.766 41.430  1.00 36.95  ? 102  HOH P O     1 
HETATM 5081 O  O     . HOH F 6 .   ? 17.766  44.443 38.852  1.00 49.48  ? 103  HOH P O     1 
HETATM 5082 O  O     . HOH G 6 .   ? -12.434 26.159 24.476  1.00 41.58  ? 1001 HOH A O     1 
HETATM 5083 O  O     . HOH G 6 .   ? 18.453  51.227 10.259  1.00 37.84  ? 1002 HOH A O     1 
HETATM 5084 O  O     . HOH G 6 .   ? -0.795  63.258 15.522  1.00 43.24  ? 1003 HOH A O     1 
HETATM 5085 O  O     . HOH G 6 .   ? 28.379  24.234 14.931  1.00 51.22  ? 1004 HOH A O     1 
HETATM 5086 O  O     . HOH G 6 .   ? 13.871  57.532 7.736   1.00 40.42  ? 1005 HOH A O     1 
HETATM 5087 O  O     . HOH G 6 .   ? 25.458  33.176 11.234  1.00 85.40  ? 1006 HOH A O     1 
HETATM 5088 O  O     . HOH G 6 .   ? 22.443  21.142 14.531  1.00 55.45  ? 1007 HOH A O     1 
HETATM 5089 O  O     . HOH G 6 .   ? -3.059  36.692 56.426  1.00 43.61  ? 1008 HOH A O     1 
HETATM 5090 O  O     . HOH G 6 .   ? -1.651  40.111 -5.615  1.00 44.92  ? 1009 HOH A O     1 
HETATM 5091 O  O     . HOH G 6 .   ? 29.331  17.195 17.072  1.00 53.56  ? 1010 HOH A O     1 
HETATM 5092 O  O     . HOH G 6 .   ? 7.857   49.413 14.626  1.00 48.81  ? 1011 HOH A O     1 
HETATM 5093 O  O     . HOH G 6 .   ? 32.795  37.171 32.051  1.00 29.76  ? 1012 HOH A O     1 
HETATM 5094 O  O     . HOH G 6 .   ? 16.844  19.336 15.938  1.00 35.30  ? 1013 HOH A O     1 
HETATM 5095 O  O     . HOH G 6 .   ? 49.204  41.737 36.213  1.00 45.74  ? 1014 HOH A O     1 
HETATM 5096 O  O     . HOH G 6 .   ? 15.996  24.850 -8.577  1.00 50.80  ? 1015 HOH A O     1 
HETATM 5097 O  O     . HOH G 6 .   ? 6.968   33.344 36.198  1.00 43.46  ? 1016 HOH A O     1 
HETATM 5098 O  O     . HOH G 6 .   ? 31.853  59.642 31.075  1.00 58.45  ? 1017 HOH A O     1 
HETATM 5099 O  O     . HOH G 6 .   ? 0.649   53.011 55.045  1.00 51.69  ? 1018 HOH A O     1 
HETATM 5100 O  O     . HOH G 6 .   ? 2.453   14.604 5.352   1.00 26.31  ? 1019 HOH A O     1 
HETATM 5101 O  O     . HOH G 6 .   ? 13.482  26.556 7.805   1.00 41.17  ? 1020 HOH A O     1 
HETATM 5102 O  O     . HOH G 6 .   ? 1.198   53.884 57.702  1.00 39.83  ? 1021 HOH A O     1 
HETATM 5103 O  O     . HOH G 6 .   ? 25.698  47.214 37.723  1.00 41.59  ? 1022 HOH A O     1 
HETATM 5104 O  O     . HOH G 6 .   ? 26.212  39.214 32.300  1.00 43.44  ? 1023 HOH A O     1 
HETATM 5105 O  O     . HOH G 6 .   ? 20.885  21.892 -3.101  1.00 49.58  ? 1024 HOH A O     1 
HETATM 5106 O  O     . HOH G 6 .   ? 23.199  41.446 2.543   1.00 24.36  ? 1025 HOH A O     1 
HETATM 5107 O  O     . HOH G 6 .   ? 7.818   35.583 23.655  1.00 29.89  ? 1026 HOH A O     1 
HETATM 5108 O  O     . HOH G 6 .   ? 10.275  13.147 13.943  1.00 24.96  ? 1027 HOH A O     1 
HETATM 5109 O  O     . HOH G 6 .   ? -4.208  30.106 8.551   1.00 43.70  ? 1028 HOH A O     1 
HETATM 5110 O  O     . HOH G 6 .   ? -2.148  57.839 28.966  1.00 50.62  ? 1029 HOH A O     1 
HETATM 5111 O  O     . HOH G 6 .   ? -8.034  38.079 30.243  1.00 55.91  ? 1030 HOH A O     1 
HETATM 5112 O  O     . HOH G 6 .   ? 33.060  42.190 15.226  1.00 41.40  ? 1031 HOH A O     1 
HETATM 5113 O  O     . HOH G 6 .   ? 11.738  69.985 18.083  1.00 31.20  ? 1032 HOH A O     1 
HETATM 5114 O  O     . HOH G 6 .   ? 1.290   22.800 48.894  1.00 45.74  ? 1033 HOH A O     1 
HETATM 5115 O  O     . HOH G 6 .   ? -2.236  23.768 25.279  1.00 19.92  ? 1034 HOH A O     1 
HETATM 5116 O  O     . HOH G 6 .   ? -0.626  20.218 21.877  1.00 38.44  ? 1035 HOH A O     1 
HETATM 5117 O  O     . HOH G 6 .   ? 22.764  37.642 2.864   1.00 25.21  ? 1036 HOH A O     1 
HETATM 5118 O  O     . HOH G 6 .   ? 4.992   36.031 42.023  1.00 26.76  ? 1037 HOH A O     1 
HETATM 5119 O  O     . HOH G 6 .   ? 14.928  29.033 8.029   1.00 31.11  ? 1038 HOH A O     1 
HETATM 5120 O  O     . HOH G 6 .   ? 22.206  24.478 -0.815  1.00 43.56  ? 1039 HOH A O     1 
HETATM 5121 O  O     . HOH G 6 .   ? 18.006  43.084 55.545  1.00 43.68  ? 1040 HOH A O     1 
HETATM 5122 O  O     . HOH G 6 .   ? 39.715  28.172 56.092  1.00 44.15  ? 1041 HOH A O     1 
HETATM 5123 O  O     . HOH G 6 .   ? -4.214  27.562 47.417  1.00 35.29  ? 1042 HOH A O     1 
HETATM 5124 O  O     . HOH G 6 .   ? 0.463   60.743 49.509  1.00 41.17  ? 1043 HOH A O     1 
HETATM 5125 O  O     . HOH G 6 .   ? 23.932  39.027 15.624  1.00 46.29  ? 1044 HOH A O     1 
HETATM 5126 O  O     . HOH G 6 .   ? 1.648   61.591 26.161  1.00 31.95  ? 1045 HOH A O     1 
HETATM 5127 O  O     . HOH G 6 .   ? 24.409  63.330 15.098  1.00 44.94  ? 1046 HOH A O     1 
HETATM 5128 O  O     . HOH G 6 .   ? -1.129  21.747 24.334  1.00 39.08  ? 1047 HOH A O     1 
HETATM 5129 O  O     . HOH G 6 .   ? -6.438  37.742 52.361  1.00 40.06  ? 1048 HOH A O     1 
HETATM 5130 O  O     . HOH G 6 .   ? 2.903   54.589 41.601  1.00 29.16  ? 1049 HOH A O     1 
HETATM 5131 O  O     . HOH G 6 .   ? 25.250  35.843 10.788  1.00 52.77  ? 1050 HOH A O     1 
HETATM 5132 O  O     . HOH G 6 .   ? 17.556  64.888 11.844  1.00 40.58  ? 1051 HOH A O     1 
HETATM 5133 O  O     . HOH G 6 .   ? 4.906   53.025 39.471  1.00 20.91  ? 1052 HOH A O     1 
HETATM 5134 O  O     . HOH G 6 .   ? 22.474  63.170 17.375  1.00 41.64  ? 1053 HOH A O     1 
HETATM 5135 O  O     . HOH G 6 .   ? -1.860  51.517 22.742  1.00 22.16  ? 1054 HOH A O     1 
HETATM 5136 O  O     . HOH G 6 .   ? -8.875  52.638 44.894  1.00 46.48  ? 1055 HOH A O     1 
HETATM 5137 O  O     . HOH G 6 .   ? 15.590  31.336 15.126  1.00 26.27  ? 1056 HOH A O     1 
HETATM 5138 O  O     . HOH G 6 .   ? 12.376  30.023 8.737   1.00 32.73  ? 1057 HOH A O     1 
HETATM 5139 O  O     . HOH G 6 .   ? 10.451  27.080 25.386  1.00 39.10  ? 1058 HOH A O     1 
HETATM 5140 O  O     . HOH G 6 .   ? 7.867   17.914 21.053  1.00 39.35  ? 1059 HOH A O     1 
HETATM 5141 O  O     . HOH G 6 .   ? -5.756  26.988 8.149   1.00 52.11  ? 1060 HOH A O     1 
HETATM 5142 O  O     . HOH G 6 .   ? 1.572   47.237 14.220  1.00 17.61  ? 1061 HOH A O     1 
HETATM 5143 O  O     . HOH G 6 .   ? 6.730   15.334 6.408   1.00 15.49  ? 1062 HOH A O     1 
HETATM 5144 O  O     . HOH G 6 .   ? 12.712  24.868 10.330  1.00 48.06  ? 1063 HOH A O     1 
HETATM 5145 O  O     . HOH G 6 .   ? 9.569   40.919 26.896  1.00 34.88  ? 1064 HOH A O     1 
HETATM 5146 O  O     . HOH G 6 .   ? 28.057  22.660 5.254   1.00 44.09  ? 1065 HOH A O     1 
HETATM 5147 O  O     . HOH G 6 .   ? 18.731  67.794 11.081  1.00 48.11  ? 1066 HOH A O     1 
HETATM 5148 O  O     . HOH G 6 .   ? 17.800  45.980 17.063  1.00 20.93  ? 1067 HOH A O     1 
HETATM 5149 O  O     . HOH G 6 .   ? -7.715  38.756 45.286  1.00 39.97  ? 1068 HOH A O     1 
HETATM 5150 O  O     . HOH G 6 .   ? -2.684  42.972 15.801  1.00 29.13  ? 1069 HOH A O     1 
HETATM 5151 O  O     . HOH G 6 .   ? 53.838  39.667 49.109  1.00 62.47  ? 1070 HOH A O     1 
HETATM 5152 O  O     . HOH G 6 .   ? 8.130   47.936 35.211  1.00 24.71  ? 1071 HOH A O     1 
HETATM 5153 O  O     . HOH G 6 .   ? 25.249  41.318 16.301  1.00 33.81  ? 1072 HOH A O     1 
HETATM 5154 O  O     . HOH G 6 .   ? -2.741  19.861 38.789  1.00 35.47  ? 1073 HOH A O     1 
HETATM 5155 O  O     . HOH G 6 .   ? 9.302   39.909 -2.074  1.00 27.41  ? 1074 HOH A O     1 
HETATM 5156 O  O     . HOH G 6 .   ? 25.263  34.562 3.670   1.00 41.46  ? 1075 HOH A O     1 
HETATM 5157 O  O     . HOH G 6 .   ? 13.439  17.769 17.351  1.00 29.60  ? 1076 HOH A O     1 
HETATM 5158 O  O     . HOH G 6 .   ? 5.092   43.477 -0.284  1.00 37.69  ? 1077 HOH A O     1 
HETATM 5159 O  O     . HOH G 6 .   ? 11.693  39.586 4.104   1.00 19.60  ? 1078 HOH A O     1 
HETATM 5160 O  O     . HOH G 6 .   ? 12.423  30.169 -12.536 1.00 42.64  ? 1079 HOH A O     1 
HETATM 5161 O  O     . HOH G 6 .   ? -0.443  52.168 10.814  1.00 29.56  ? 1080 HOH A O     1 
HETATM 5162 O  O     . HOH G 6 .   ? -3.732  31.507 10.672  1.00 42.66  ? 1081 HOH A O     1 
HETATM 5163 O  O     . HOH G 6 .   ? -3.101  53.235 31.543  1.00 43.78  ? 1082 HOH A O     1 
HETATM 5164 O  O     . HOH G 6 .   ? 30.114  37.968 21.887  1.00 37.86  ? 1083 HOH A O     1 
HETATM 5165 O  O     . HOH G 6 .   ? 31.722  40.173 38.683  1.00 44.32  ? 1084 HOH A O     1 
HETATM 5166 O  O     . HOH G 6 .   ? 9.709   34.729 16.290  1.00 29.37  ? 1085 HOH A O     1 
HETATM 5167 O  O     . HOH G 6 .   ? -11.102 24.096 18.114  1.00 38.67  ? 1086 HOH A O     1 
HETATM 5168 O  O     . HOH G 6 .   ? -5.834  45.368 50.098  1.00 33.18  ? 1087 HOH A O     1 
HETATM 5169 O  O     . HOH G 6 .   ? 22.117  14.294 7.096   1.00 48.31  ? 1088 HOH A O     1 
HETATM 5170 O  O     . HOH G 6 .   ? 15.203  51.254 48.760  1.00 32.13  ? 1089 HOH A O     1 
HETATM 5171 O  O     . HOH G 6 .   ? 8.583   33.746 13.786  1.00 28.68  ? 1090 HOH A O     1 
HETATM 5172 O  O     . HOH G 6 .   ? 8.900   66.548 17.265  1.00 18.94  ? 1091 HOH A O     1 
HETATM 5173 O  O     . HOH G 6 .   ? 21.422  54.985 31.444  1.00 35.39  ? 1092 HOH A O     1 
HETATM 5174 O  O     . HOH G 6 .   ? 26.649  41.255 7.443   1.00 26.95  ? 1093 HOH A O     1 
HETATM 5175 O  O     . HOH G 6 .   ? 9.087   27.222 7.324   1.00 14.65  ? 1094 HOH A O     1 
HETATM 5176 O  O     . HOH G 6 .   ? 21.301  52.711 16.479  1.00 17.64  ? 1095 HOH A O     1 
HETATM 5177 O  O     . HOH G 6 .   ? -8.513  23.859 26.211  1.00 42.09  ? 1096 HOH A O     1 
HETATM 5178 O  O     . HOH G 6 .   ? 4.326   35.837 -8.914  1.00 33.40  ? 1097 HOH A O     1 
HETATM 5179 O  O     . HOH G 6 .   ? 25.788  57.934 16.185  1.00 50.27  ? 1098 HOH A O     1 
HETATM 5180 O  O     . HOH G 6 .   ? -11.728 21.315 17.545  1.00 53.81  ? 1099 HOH A O     1 
HETATM 5181 O  O     . HOH G 6 .   ? 1.402   17.164 4.389   1.00 26.70  ? 1100 HOH A O     1 
HETATM 5182 O  O     . HOH G 6 .   ? 3.524   45.758 47.063  1.00 25.15  ? 1101 HOH A O     1 
HETATM 5183 O  O     . HOH G 6 .   ? 11.821  49.967 41.510  1.00 38.17  ? 1102 HOH A O     1 
HETATM 5184 O  O     . HOH G 6 .   ? 11.492  25.854 45.670  1.00 48.17  ? 1103 HOH A O     1 
HETATM 5185 O  O     . HOH G 6 .   ? 0.838   33.589 -8.081  1.00 39.86  ? 1104 HOH A O     1 
HETATM 5186 O  O     . HOH G 6 .   ? 2.410   28.332 -3.416  1.00 28.18  ? 1105 HOH A O     1 
HETATM 5187 O  O     . HOH G 6 .   ? 29.229  57.193 22.492  1.00 30.66  ? 1106 HOH A O     1 
HETATM 5188 O  O     . HOH G 6 .   ? 28.925  41.413 8.428   1.00 50.72  ? 1107 HOH A O     1 
HETATM 5189 O  O     . HOH G 6 .   ? 44.545  35.662 37.484  1.00 45.11  ? 1108 HOH A O     1 
HETATM 5190 O  O     . HOH G 6 .   ? -9.411  39.666 39.073  1.00 50.30  ? 1109 HOH A O     1 
HETATM 5191 O  O     . HOH G 6 .   ? 41.688  42.779 29.979  1.00 47.54  ? 1110 HOH A O     1 
HETATM 5192 O  O     . HOH G 6 .   ? 12.648  27.388 10.395  1.00 43.30  ? 1111 HOH A O     1 
HETATM 5193 O  O     . HOH G 6 .   ? 26.840  16.460 9.932   1.00 57.04  ? 1112 HOH A O     1 
HETATM 5194 O  O     . HOH G 6 .   ? 33.503  31.426 53.018  1.00 40.47  ? 1113 HOH A O     1 
HETATM 5195 O  O     . HOH G 6 .   ? 1.088   29.834 26.185  1.00 22.42  ? 1114 HOH A O     1 
HETATM 5196 O  O     . HOH G 6 .   ? 8.032   25.447 35.330  1.00 40.48  ? 1115 HOH A O     1 
HETATM 5197 O  O     . HOH G 6 .   ? -5.985  19.663 17.504  1.00 31.23  ? 1116 HOH A O     1 
HETATM 5198 O  O     . HOH G 6 .   ? -10.877 34.543 28.750  1.00 53.12  ? 1117 HOH A O     1 
HETATM 5199 O  O     . HOH G 6 .   ? 20.658  36.564 4.316   1.00 22.85  ? 1118 HOH A O     1 
HETATM 5200 O  O     . HOH G 6 .   ? 16.374  52.690 50.594  1.00 29.86  ? 1119 HOH A O     1 
HETATM 5201 O  O     . HOH G 6 .   ? -0.484  20.336 34.305  1.00 15.88  ? 1120 HOH A O     1 
HETATM 5202 O  O     . HOH G 6 .   ? 33.806  51.543 32.946  1.00 54.08  ? 1121 HOH A O     1 
HETATM 5203 O  O     . HOH G 6 .   ? 17.782  34.505 20.676  1.00 55.25  ? 1122 HOH A O     1 
HETATM 5204 O  O     . HOH G 6 .   ? -4.061  31.205 5.984   1.00 53.67  ? 1123 HOH A O     1 
HETATM 5205 O  O     . HOH G 6 .   ? -4.282  21.006 31.984  1.00 16.91  ? 1124 HOH A O     1 
HETATM 5206 O  O     . HOH G 6 .   ? 25.699  59.864 19.685  1.00 34.16  ? 1125 HOH A O     1 
HETATM 5207 O  O     . HOH G 6 .   ? 12.812  23.017 11.898  1.00 36.70  ? 1126 HOH A O     1 
HETATM 5208 O  O     . HOH G 6 .   ? 6.763   36.743 10.670  1.00 34.28  ? 1127 HOH A O     1 
HETATM 5209 O  O     . HOH G 6 .   ? 8.824   22.692 39.871  1.00 28.24  ? 1128 HOH A O     1 
HETATM 5210 O  O     . HOH G 6 .   ? 4.817   41.223 -4.309  1.00 33.67  ? 1129 HOH A O     1 
HETATM 5211 O  O     . HOH G 6 .   ? 22.540  29.039 6.326   1.00 24.10  ? 1130 HOH A O     1 
HETATM 5212 O  O     . HOH G 6 .   ? 20.773  53.049 9.862   1.00 39.24  ? 1131 HOH A O     1 
HETATM 5213 O  O     . HOH G 6 .   ? 15.839  44.612 2.866   1.00 29.08  ? 1132 HOH A O     1 
HETATM 5214 O  O     . HOH G 6 .   ? 5.098   22.785 31.852  1.00 37.43  ? 1133 HOH A O     1 
HETATM 5215 O  O     . HOH G 6 .   ? 43.683  46.844 48.528  1.00 36.28  ? 1134 HOH A O     1 
HETATM 5216 O  O     . HOH G 6 .   ? 23.035  37.659 -0.100  1.00 50.69  ? 1135 HOH A O     1 
HETATM 5217 O  O     . HOH G 6 .   ? -4.330  38.569 54.745  1.00 40.70  ? 1136 HOH A O     1 
HETATM 5218 O  O     . HOH G 6 .   ? 8.142   15.394 41.182  1.00 46.08  ? 1137 HOH A O     1 
HETATM 5219 O  O     . HOH G 6 .   ? 20.205  45.688 29.470  1.00 27.78  ? 1138 HOH A O     1 
HETATM 5220 O  O     . HOH G 6 .   ? -3.275  40.230 12.923  1.00 51.61  ? 1139 HOH A O     1 
HETATM 5221 O  O     . HOH G 6 .   ? 8.182   14.496 14.649  1.00 26.27  ? 1140 HOH A O     1 
HETATM 5222 O  O     . HOH G 6 .   ? 19.303  51.270 13.247  1.00 27.11  ? 1141 HOH A O     1 
HETATM 5223 O  O     . HOH G 6 .   ? 20.850  41.562 57.193  1.00 46.76  ? 1142 HOH A O     1 
HETATM 5224 O  O     . HOH G 6 .   ? -0.969  29.864 5.035   1.00 38.34  ? 1143 HOH A O     1 
HETATM 5225 O  O     . HOH G 6 .   ? -9.081  41.575 33.792  1.00 39.10  ? 1144 HOH A O     1 
HETATM 5226 O  O     . HOH G 6 .   ? 4.951   57.987 47.556  1.00 46.15  ? 1145 HOH A O     1 
HETATM 5227 O  O     . HOH G 6 .   ? -6.532  34.558 21.882  1.00 20.38  ? 1146 HOH A O     1 
HETATM 5228 O  O     . HOH G 6 .   ? -3.449  21.467 8.070   1.00 28.03  ? 1147 HOH A O     1 
HETATM 5229 O  O     . HOH G 6 .   ? 2.843   63.299 19.084  1.00 21.37  ? 1148 HOH A O     1 
HETATM 5230 O  O     . HOH G 6 .   ? 14.616  24.965 13.717  1.00 39.52  ? 1149 HOH A O     1 
HETATM 5231 O  O     . HOH G 6 .   ? 12.157  48.704 13.650  1.00 20.33  ? 1150 HOH A O     1 
HETATM 5232 O  O     . HOH G 6 .   ? 1.317   61.292 39.284  1.00 36.63  ? 1151 HOH A O     1 
HETATM 5233 O  O     . HOH G 6 .   ? 18.325  64.776 26.298  1.00 43.31  ? 1152 HOH A O     1 
HETATM 5234 O  O     . HOH G 6 .   ? 3.284   43.439 12.380  1.00 31.14  ? 1153 HOH A O     1 
HETATM 5235 O  O     . HOH G 6 .   ? 13.163  15.169 7.549   1.00 21.97  ? 1154 HOH A O     1 
HETATM 5236 O  O     . HOH G 6 .   ? 24.836  37.544 29.009  1.00 49.96  ? 1155 HOH A O     1 
HETATM 5237 O  O     . HOH G 6 .   ? -2.797  52.364 49.439  1.00 37.71  ? 1156 HOH A O     1 
HETATM 5238 O  O     . HOH G 6 .   ? 13.800  33.547 14.993  1.00 29.99  ? 1157 HOH A O     1 
HETATM 5239 O  O     . HOH G 6 .   ? 15.927  45.942 48.140  1.00 34.36  ? 1158 HOH A O     1 
HETATM 5240 O  O     . HOH G 6 .   ? 30.834  44.197 36.747  1.00 44.38  ? 1159 HOH A O     1 
HETATM 5241 O  O     . HOH G 6 .   ? -1.849  51.852 17.236  1.00 26.42  ? 1160 HOH A O     1 
HETATM 5242 O  O     . HOH G 6 .   ? -5.401  22.254 24.899  1.00 27.55  ? 1161 HOH A O     1 
HETATM 5243 O  O     . HOH G 6 .   ? 19.999  53.584 29.689  1.00 29.56  ? 1162 HOH A O     1 
HETATM 5244 O  O     . HOH G 6 .   ? 5.869   67.467 23.011  1.00 30.87  ? 1163 HOH A O     1 
HETATM 5245 O  O     . HOH G 6 .   ? -4.994  31.580 35.282  1.00 26.71  ? 1164 HOH A O     1 
HETATM 5246 O  O     . HOH G 6 .   ? 5.976   25.213 33.853  1.00 32.87  ? 1165 HOH A O     1 
HETATM 5247 O  O     . HOH G 6 .   ? 10.778  33.866 24.637  1.00 20.11  ? 1166 HOH A O     1 
HETATM 5248 O  O     . HOH G 6 .   ? 28.610  51.117 6.892   1.00 47.66  ? 1167 HOH A O     1 
HETATM 5249 O  O     . HOH G 6 .   ? -5.251  29.938 27.332  1.00 23.57  ? 1168 HOH A O     1 
HETATM 5250 O  O     . HOH G 6 .   ? 7.586   7.014  14.416  1.00 32.21  ? 1169 HOH A O     1 
HETATM 5251 O  O     . HOH G 6 .   ? 3.382   50.949 34.360  1.00 18.30  ? 1170 HOH A O     1 
HETATM 5252 O  O     . HOH G 6 .   ? -6.374  52.308 28.954  1.00 55.76  ? 1171 HOH A O     1 
HETATM 5253 O  O     . HOH G 6 .   ? -4.916  50.967 32.733  1.00 21.17  ? 1172 HOH A O     1 
HETATM 5254 O  O     . HOH G 6 .   ? 4.328   20.675 29.653  1.00 50.47  ? 1173 HOH A O     1 
HETATM 5255 O  O     . HOH G 6 .   ? 10.974  50.052 34.890  1.00 50.26  ? 1174 HOH A O     1 
HETATM 5256 O  O     . HOH G 6 .   ? 12.036  40.518 28.163  1.00 44.98  ? 1175 HOH A O     1 
HETATM 5257 O  O     . HOH G 6 .   ? -0.148  55.789 38.637  1.00 21.80  ? 1176 HOH A O     1 
HETATM 5258 O  O     . HOH G 6 .   ? 20.235  44.646 17.524  1.00 18.73  ? 1177 HOH A O     1 
HETATM 5259 O  O     . HOH G 6 .   ? -11.716 25.050 15.756  1.00 45.59  ? 1178 HOH A O     1 
HETATM 5260 O  O     . HOH G 6 .   ? 25.113  17.162 7.988   1.00 41.30  ? 1179 HOH A O     1 
HETATM 5261 O  O     . HOH G 6 .   ? -6.176  28.612 34.812  1.00 37.49  ? 1180 HOH A O     1 
HETATM 5262 O  O     . HOH G 6 .   ? 10.284  17.144 50.153  1.00 46.47  ? 1181 HOH A O     1 
HETATM 5263 O  O     . HOH G 6 .   ? 9.521   40.594 -8.352  1.00 40.64  ? 1182 HOH A O     1 
HETATM 5264 O  O     . HOH G 6 .   ? 9.706   49.912 37.544  1.00 34.86  ? 1183 HOH A O     1 
HETATM 5265 O  O     . HOH G 6 .   ? 7.634   56.590 37.632  1.00 40.31  ? 1184 HOH A O     1 
HETATM 5266 O  O     . HOH G 6 .   ? 16.730  13.890 4.371   1.00 23.78  ? 1185 HOH A O     1 
HETATM 5267 O  O     . HOH G 6 .   ? 26.340  27.359 11.730  1.00 81.02  ? 1186 HOH A O     1 
HETATM 5268 O  O     . HOH G 6 .   ? -5.863  36.694 23.366  1.00 33.22  ? 1187 HOH A O     1 
HETATM 5269 O  O     . HOH G 6 .   ? 12.788  19.263 12.174  1.00 19.82  ? 1188 HOH A O     1 
HETATM 5270 O  O     . HOH G 6 .   ? 33.409  29.289 51.100  1.00 66.34  ? 1189 HOH A O     1 
HETATM 5271 O  O     . HOH G 6 .   ? -5.021  23.268 6.589   1.00 52.54  ? 1190 HOH A O     1 
HETATM 5272 O  O     . HOH G 6 .   ? 1.926   17.262 1.563   1.00 32.34  ? 1191 HOH A O     1 
HETATM 5273 O  O     . HOH G 6 .   ? -7.487  52.438 35.628  1.00 43.51  ? 1192 HOH A O     1 
HETATM 5274 O  O     . HOH G 6 .   ? -8.691  28.743 31.921  1.00 39.11  ? 1193 HOH A O     1 
HETATM 5275 O  O     . HOH G 6 .   ? 9.233   57.828 48.664  1.00 50.78  ? 1194 HOH A O     1 
HETATM 5276 O  O     . HOH G 6 .   ? 27.266  61.622 23.360  1.00 47.26  ? 1195 HOH A O     1 
HETATM 5277 O  O     . HOH G 6 .   ? 6.586   45.999 39.308  1.00 13.78  ? 1196 HOH A O     1 
HETATM 5278 O  O     . HOH G 6 .   ? 9.720   50.833 14.095  1.00 27.31  ? 1197 HOH A O     1 
HETATM 5279 O  O     . HOH G 6 .   ? -2.740  42.875 19.363  1.00 34.53  ? 1198 HOH A O     1 
HETATM 5280 O  O     . HOH G 6 .   ? 11.502  28.340 6.778   1.00 20.50  ? 1199 HOH A O     1 
HETATM 5281 O  O     . HOH G 6 .   ? 3.921   25.153 30.031  1.00 30.00  ? 1200 HOH A O     1 
HETATM 5282 O  O     . HOH G 6 .   ? 9.153   42.562 8.918   1.00 27.20  ? 1201 HOH A O     1 
HETATM 5283 O  O     . HOH G 6 .   ? 19.214  38.204 29.965  1.00 24.29  ? 1202 HOH A O     1 
HETATM 5284 O  O     . HOH G 6 .   ? -10.764 39.199 41.807  1.00 57.93  ? 1203 HOH A O     1 
HETATM 5285 O  O     . HOH G 6 .   ? 11.191  31.272 31.376  1.00 39.14  ? 1204 HOH A O     1 
HETATM 5286 O  O     . HOH G 6 .   ? 7.359   24.844 23.007  1.00 35.75  ? 1205 HOH A O     1 
HETATM 5287 O  O     . HOH G 6 .   ? 8.272   54.405 11.311  1.00 50.11  ? 1206 HOH A O     1 
HETATM 5288 O  O     . HOH G 6 .   ? 9.093   59.781 51.103  1.00 41.45  ? 1207 HOH A O     1 
HETATM 5289 O  O     . HOH G 6 .   ? -6.891  34.729 52.445  1.00 50.61  ? 1208 HOH A O     1 
HETATM 5290 O  O     . HOH G 6 .   ? 11.593  67.335 18.260  1.00 22.10  ? 1209 HOH A O     1 
HETATM 5291 O  O     . HOH G 6 .   ? 7.161   50.025 63.540  1.00 45.91  ? 1210 HOH A O     1 
HETATM 5292 O  O     . HOH G 6 .   ? 6.902   34.439 46.122  1.00 46.74  ? 1211 HOH A O     1 
HETATM 5293 O  O     . HOH G 6 .   ? 13.043  49.664 11.297  1.00 30.40  ? 1212 HOH A O     1 
HETATM 5294 O  O     . HOH G 6 .   ? 9.742   31.206 34.676  1.00 36.27  ? 1213 HOH A O     1 
HETATM 5295 O  O     . HOH G 6 .   ? 7.244   69.400 23.819  1.00 23.94  ? 1214 HOH A O     1 
HETATM 5296 O  O     . HOH G 6 .   ? -0.411  17.544 22.192  1.00 38.51  ? 1215 HOH A O     1 
HETATM 5297 O  O     . HOH G 6 .   ? 14.332  27.681 13.134  1.00 49.37  ? 1216 HOH A O     1 
HETATM 5298 O  O     . HOH G 6 .   ? 10.958  62.687 31.303  1.00 46.65  ? 1217 HOH A O     1 
HETATM 5299 O  O     . HOH G 6 .   ? -9.544  41.415 46.257  1.00 41.84  ? 1218 HOH A O     1 
HETATM 5300 O  O     . HOH G 6 .   ? 12.962  42.616 -3.924  1.00 48.53  ? 1219 HOH A O     1 
HETATM 5301 O  O     . HOH G 6 .   ? 23.719  21.143 -0.504  1.00 43.56  ? 1220 HOH A O     1 
HETATM 5302 O  O     . HOH G 6 .   ? -8.456  32.714 49.041  1.00 46.07  ? 1221 HOH A O     1 
HETATM 5303 O  O     . HOH G 6 .   ? -7.896  46.643 27.492  1.00 38.94  ? 1222 HOH A O     1 
HETATM 5304 O  O     . HOH G 6 .   ? -8.679  38.258 42.170  1.00 57.41  ? 1223 HOH A O     1 
HETATM 5305 O  O     . HOH G 6 .   ? 8.346   30.650 49.501  1.00 50.80  ? 1224 HOH A O     1 
HETATM 5306 O  O     . HOH G 6 .   ? 0.506   60.763 45.863  1.00 45.30  ? 1225 HOH A O     1 
HETATM 5307 O  O     . HOH G 6 .   ? -4.192  20.872 3.826   1.00 58.75  ? 1226 HOH A O     1 
HETATM 5308 O  O     . HOH G 6 .   ? 3.838   38.093 6.929   1.00 31.61  ? 1227 HOH A O     1 
HETATM 5309 O  O     . HOH G 6 .   ? -11.930 49.910 43.039  1.00 39.26  ? 1228 HOH A O     1 
HETATM 5310 O  O     . HOH G 6 .   ? -2.338  55.417 6.154   1.00 43.12  ? 1229 HOH A O     1 
HETATM 5311 O  O     . HOH G 6 .   ? 6.514   53.386 42.578  1.00 30.21  ? 1230 HOH A O     1 
HETATM 5312 O  O     . HOH G 6 .   ? -1.079  37.061 11.647  1.00 34.72  ? 1231 HOH A O     1 
HETATM 5313 O  O     . HOH G 6 .   ? 10.904  42.226 -2.159  1.00 35.92  ? 1232 HOH A O     1 
HETATM 5314 O  O     . HOH G 6 .   ? 11.116  28.287 34.706  1.00 45.21  ? 1233 HOH A O     1 
HETATM 5315 O  O     . HOH G 6 .   ? 17.282  61.478 8.615   1.00 48.27  ? 1234 HOH A O     1 
HETATM 5316 O  O     . HOH G 6 .   ? -4.266  33.124 57.881  1.00 58.00  ? 1235 HOH A O     1 
HETATM 5317 O  O     . HOH G 6 .   ? 14.437  40.025 47.268  1.00 26.80  ? 1236 HOH A O     1 
HETATM 5318 O  O     . HOH G 6 .   ? 46.400  28.218 35.727  1.00 51.75  ? 1237 HOH A O     1 
HETATM 5319 O  O     . HOH G 6 .   ? 14.976  22.434 54.466  1.00 48.84  ? 1238 HOH A O     1 
HETATM 5320 O  O     . HOH G 6 .   ? 13.478  55.709 30.107  1.00 43.85  ? 1239 HOH A O     1 
HETATM 5321 O  O     . HOH G 6 .   ? 9.571   60.429 32.260  1.00 21.00  ? 1240 HOH A O     1 
HETATM 5322 O  O     . HOH G 6 .   ? -9.792  55.741 44.649  1.00 51.84  ? 1241 HOH A O     1 
HETATM 5323 O  O     . HOH G 6 .   ? 1.263   60.473 28.876  1.00 46.35  ? 1242 HOH A O     1 
HETATM 5324 O  O     . HOH G 6 .   ? 19.423  56.691 36.345  1.00 47.65  ? 1243 HOH A O     1 
HETATM 5325 O  O     . HOH G 6 .   ? 15.376  63.049 28.329  1.00 23.04  ? 1244 HOH A O     1 
HETATM 5326 O  O     . HOH G 6 .   ? 15.521  30.273 59.593  1.00 48.71  ? 1245 HOH A O     1 
HETATM 5327 O  O     . HOH G 6 .   ? -10.064 23.364 7.851   1.00 62.96  ? 1246 HOH A O     1 
HETATM 5328 O  O     . HOH G 6 .   ? -5.843  51.937 50.689  1.00 37.16  ? 1247 HOH A O     1 
HETATM 5329 O  O     . HOH G 6 .   ? 25.350  63.198 7.588   1.00 54.94  ? 1248 HOH A O     1 
HETATM 5330 O  O     . HOH G 6 .   ? -1.225  36.992 6.348   1.00 45.49  ? 1249 HOH A O     1 
HETATM 5331 O  O     . HOH G 6 .   ? 10.034  47.232 13.758  1.00 32.67  ? 1250 HOH A O     1 
HETATM 5332 O  O     . HOH G 6 .   ? 9.804   46.064 41.910  1.00 52.66  ? 1251 HOH A O     1 
HETATM 5333 O  O     . HOH G 6 .   ? 5.012   17.705 -6.786  1.00 42.86  ? 1252 HOH A O     1 
HETATM 5334 O  O     . HOH G 6 .   ? 5.727   22.290 36.652  1.00 24.51  ? 1253 HOH A O     1 
HETATM 5335 O  O     . HOH G 6 .   ? 1.815   40.301 5.636   1.00 37.46  ? 1254 HOH A O     1 
HETATM 5336 O  O     . HOH G 6 .   ? -0.991  65.678 20.034  1.00 39.78  ? 1255 HOH A O     1 
HETATM 5337 O  O     . HOH G 6 .   ? 11.627  16.445 -10.198 1.00 57.93  ? 1256 HOH A O     1 
HETATM 5338 O  O     . HOH G 6 .   ? 1.191   42.851 -0.619  1.00 38.78  ? 1257 HOH A O     1 
HETATM 5339 O  O     . HOH G 6 .   ? 22.062  32.427 -0.025  1.00 31.15  ? 1258 HOH A O     1 
HETATM 5340 O  O     . HOH G 6 .   ? 20.286  22.134 13.477  1.00 42.98  ? 1259 HOH A O     1 
HETATM 5341 O  O     . HOH G 6 .   ? 10.821  24.185 -19.190 1.00 57.18  ? 1260 HOH A O     1 
HETATM 5342 O  O     . HOH G 6 .   ? 11.796  33.510 17.729  1.00 26.82  ? 1261 HOH A O     1 
HETATM 5343 O  O     . HOH G 6 .   ? -8.445  43.761 49.071  1.00 30.00  ? 1262 HOH A O     1 
HETATM 5344 O  O     . HOH G 6 .   ? 25.982  39.522 24.919  1.00 37.85  ? 1263 HOH A O     1 
HETATM 5345 O  O     . HOH G 6 .   ? 44.597  40.146 57.301  1.00 50.77  ? 1264 HOH A O     1 
HETATM 5346 O  O     . HOH G 6 .   ? 27.313  35.138 6.720   1.00 57.05  ? 1265 HOH A O     1 
HETATM 5347 O  O     . HOH G 6 .   ? -2.548  23.786 5.402   1.00 45.90  ? 1266 HOH A O     1 
HETATM 5348 O  O     . HOH G 6 .   ? 7.808   33.984 48.868  1.00 54.02  ? 1267 HOH A O     1 
HETATM 5349 O  O     . HOH G 6 .   ? 19.954  63.618 27.290  1.00 42.87  ? 1268 HOH A O     1 
HETATM 5350 O  O     . HOH G 6 .   ? -3.715  29.196 -6.387  1.00 45.98  ? 1269 HOH A O     1 
HETATM 5351 O  O     . HOH G 6 .   ? -8.891  18.874 16.760  1.00 49.07  ? 1270 HOH A O     1 
HETATM 5352 O  O     . HOH G 6 .   ? -9.211  50.513 46.304  1.00 45.96  ? 1271 HOH A O     1 
HETATM 5353 O  O     . HOH G 6 .   ? 10.107  41.725 5.135   1.00 47.65  ? 1272 HOH A O     1 
HETATM 5354 O  O     . HOH G 6 .   ? -3.617  18.386 2.326   1.00 56.80  ? 1273 HOH A O     1 
HETATM 5355 O  O     . HOH G 6 .   ? 13.752  64.383 9.722   1.00 48.83  ? 1274 HOH A O     1 
HETATM 5356 O  O     . HOH G 6 .   ? 16.363  48.935 8.472   1.00 37.39  ? 1275 HOH A O     1 
HETATM 5357 O  O     . HOH G 6 .   ? 10.243  22.958 -12.514 1.00 57.07  ? 1276 HOH A O     1 
HETATM 5358 O  O     . HOH G 6 .   ? 27.160  36.592 9.197   1.00 37.24  ? 1277 HOH A O     1 
HETATM 5359 O  O     . HOH G 6 .   ? 2.637   62.554 16.525  1.00 34.97  ? 1278 HOH A O     1 
HETATM 5360 O  O     . HOH G 6 .   ? 1.200   11.610 -1.421  1.00 39.61  ? 1279 HOH A O     1 
HETATM 5361 O  O     . HOH G 6 .   ? -8.032  35.974 43.236  1.00 47.35  ? 1280 HOH A O     1 
HETATM 5362 O  O     . HOH G 6 .   ? -7.854  29.462 28.690  1.00 56.47  ? 1281 HOH A O     1 
HETATM 5363 O  O     . HOH G 6 .   ? -11.723 48.444 40.954  1.00 44.17  ? 1282 HOH A O     1 
HETATM 5364 O  O     . HOH G 6 .   ? -10.447 38.140 46.270  1.00 50.88  ? 1283 HOH A O     1 
HETATM 5365 O  O     . HOH G 6 .   ? 11.681  10.862 10.628  1.00 40.34  ? 1284 HOH A O     1 
HETATM 5366 O  O     . HOH G 6 .   ? 6.544   13.644 42.817  1.00 54.43  ? 1285 HOH A O     1 
HETATM 5367 O  O     . HOH G 6 .   ? 16.849  63.255 9.831   1.00 47.03  ? 1286 HOH A O     1 
HETATM 5368 O  O     . HOH G 6 .   ? 0.329   18.151 -2.005  1.00 49.50  ? 1287 HOH A O     1 
HETATM 5369 O  O     . HOH G 6 .   ? 20.392  48.022 8.799   1.00 61.40  ? 1288 HOH A O     1 
HETATM 5370 O  O     . HOH G 6 .   ? 8.205   47.079 11.218  1.00 57.13  ? 1289 HOH A O     1 
HETATM 5371 O  O     . HOH G 6 .   ? 22.410  63.629 25.497  1.00 39.19  ? 1290 HOH A O     1 
HETATM 5372 O  O     . HOH G 6 .   ? 12.760  48.116 32.404  1.00 29.32  ? 1291 HOH A O     1 
HETATM 5373 O  O     . HOH G 6 .   ? 16.500  10.853 12.795  1.00 47.30  ? 1292 HOH A O     1 
HETATM 5374 O  O     . HOH G 6 .   ? 10.473  8.819  10.029  1.00 54.78  ? 1293 HOH A O     1 
HETATM 5375 O  O     . HOH G 6 .   ? 15.077  33.503 16.947  1.00 45.36  ? 1294 HOH A O     1 
HETATM 5376 O  O     . HOH G 6 .   ? 27.093  62.651 9.327   1.00 49.59  ? 1295 HOH A O     1 
HETATM 5377 O  O     . HOH G 6 .   ? -4.605  20.606 26.939  1.00 31.27  ? 1296 HOH A O     1 
HETATM 5378 O  O     . HOH G 6 .   ? 8.681   53.195 43.117  1.00 45.92  ? 1297 HOH A O     1 
HETATM 5379 O  O     . HOH G 6 .   ? -11.429 35.531 46.853  1.00 57.95  ? 1298 HOH A O     1 
HETATM 5380 O  O     . HOH G 6 .   ? 7.341   40.691 26.072  1.00 38.52  ? 1299 HOH A O     1 
HETATM 5381 O  O     . HOH G 6 .   ? 1.084   38.790 11.230  1.00 30.53  ? 1300 HOH A O     1 
HETATM 5382 O  O     . HOH G 6 .   ? 11.133  11.293 8.211   1.00 36.98  ? 1301 HOH A O     1 
HETATM 5383 O  O     . HOH G 6 .   ? 0.748   38.476 7.695   1.00 43.52  ? 1302 HOH A O     1 
HETATM 5384 O  O     . HOH G 6 .   ? 4.378   35.686 11.258  1.00 48.48  ? 1303 HOH A O     1 
HETATM 5385 O  O     . HOH G 6 .   ? 8.369   33.232 -16.188 1.00 51.41  ? 1304 HOH A O     1 
HETATM 5386 O  O     . HOH G 6 .   ? -10.168 47.034 33.845  1.00 45.64  ? 1305 HOH A O     1 
HETATM 5387 O  O     . HOH G 6 .   ? 3.854   15.933 -5.268  1.00 51.89  ? 1306 HOH A O     1 
HETATM 5388 O  O     . HOH G 6 .   ? 24.619  13.738 -3.960  1.00 56.41  ? 1307 HOH A O     1 
HETATM 5389 O  O     . HOH G 6 .   ? -1.296  15.983 10.739  1.00 40.01  ? 1308 HOH A O     1 
HETATM 5390 O  O     . HOH G 6 .   ? 10.116  52.064 38.233  1.00 38.04  ? 1309 HOH A O     1 
HETATM 5391 O  O     . HOH G 6 .   ? 13.735  10.838 6.212   1.00 43.04  ? 1310 HOH A O     1 
HETATM 5392 O  O     . HOH G 6 .   ? 5.740   15.879 22.069  1.00 50.83  ? 1311 HOH A O     1 
HETATM 5393 O  O     . HOH G 6 .   ? 19.069  26.266 12.864  1.00 57.13  ? 1312 HOH A O     1 
HETATM 5394 O  O     . HOH G 6 .   ? 5.545   33.965 43.667  1.00 53.44  ? 1313 HOH A O     1 
HETATM 5395 O  O     . HOH G 6 .   ? 23.142  59.924 8.486   1.00 40.73  ? 1314 HOH A O     1 
HETATM 5396 O  O     . HOH G 6 .   ? 25.333  15.849 -4.222  1.00 59.40  ? 1315 HOH A O     1 
HETATM 5397 O  O     . HOH G 6 .   ? 7.692   36.357 47.381  1.00 56.40  ? 1316 HOH A O     1 
HETATM 5398 O  O     . HOH G 6 .   ? 11.385  44.045 3.742   1.00 51.21  ? 1317 HOH A O     1 
HETATM 5399 O  O     . HOH G 6 .   ? 4.842   45.189 10.980  1.00 40.71  ? 1318 HOH A O     1 
HETATM 5400 O  O     . HOH G 6 .   ? -0.809  53.886 8.547   1.00 40.41  ? 1319 HOH A O     1 
HETATM 5401 O  O     . HOH G 6 .   ? -11.619 45.406 34.802  1.00 53.79  ? 1320 HOH A O     1 
HETATM 5402 O  O     . HOH G 6 .   ? -12.083 52.961 44.813  1.00 51.94  ? 1321 HOH A O     1 
HETATM 5403 O  O     . HOH G 6 .   ? 11.559  15.772 17.859  1.00 42.38  ? 1322 HOH A O     1 
HETATM 5404 O  O     . HOH G 6 .   ? 2.661   65.842 19.504  1.00 26.32  ? 1323 HOH A O     1 
HETATM 5405 O  O     . HOH G 6 .   ? 12.238  47.188 35.519  1.00 48.97  ? 1324 HOH A O     1 
HETATM 5406 O  O     . HOH G 6 .   ? 41.966  24.302 55.299  1.00 54.90  ? 1325 HOH A O     1 
HETATM 5407 O  O     . HOH G 6 .   ? -5.371  35.441 58.161  1.00 56.26  ? 1326 HOH A O     1 
HETATM 5408 O  O     . HOH G 6 .   ? 7.335   23.983 37.709  1.00 43.11  ? 1327 HOH A O     1 
HETATM 5409 O  O     . HOH G 6 .   ? -7.062  18.266 12.720  1.00 58.13  ? 1328 HOH A O     1 
HETATM 5410 O  O     . HOH G 6 .   ? -0.970  19.269 36.412  1.00 36.85  ? 1329 HOH A O     1 
HETATM 5411 O  O     . HOH G 6 .   ? -11.401 18.369 22.583  1.00 49.20  ? 1330 HOH A O     1 
HETATM 5412 O  O     . HOH G 6 .   ? 28.144  46.991 36.472  1.00 58.06  ? 1331 HOH A O     1 
HETATM 5413 O  O     . HOH G 6 .   ? -2.730  53.540 19.083  1.00 50.75  ? 1332 HOH A O     1 
HETATM 5414 O  O     . HOH G 6 .   ? 15.878  68.456 21.533  1.00 58.58  ? 1333 HOH A O     1 
HETATM 5415 O  O     . HOH G 6 .   ? 8.721   13.164 0.349   1.00 53.18  ? 1334 HOH A O     1 
HETATM 5416 O  O     . HOH G 6 .   ? 15.446  44.436 45.866  1.00 32.95  ? 1335 HOH A O     1 
HETATM 5417 O  O     . HOH G 6 .   ? 33.764  47.861 50.623  1.00 53.68  ? 1336 HOH A O     1 
HETATM 5418 O  O     . HOH G 6 .   ? 13.757  45.369 4.628   1.00 51.83  ? 1337 HOH A O     1 
HETATM 5419 O  O     . HOH G 6 .   ? 1.890   41.449 10.155  1.00 55.57  ? 1338 HOH A O     1 
HETATM 5420 O  O     . HOH G 6 .   ? 10.856  25.048 8.627   1.00 41.22  ? 1339 HOH A O     1 
HETATM 5421 O  O     . HOH G 6 .   ? 2.337   35.556 -7.013  1.00 50.55  ? 1340 HOH A O     1 
HETATM 5422 O  O     . HOH G 6 .   ? -1.854  17.474 4.312   1.00 40.25  ? 1341 HOH A O     1 
HETATM 5423 O  O     . HOH G 6 .   ? -13.047 25.363 19.272  1.00 44.88  ? 1342 HOH A O     1 
HETATM 5424 O  O     . HOH G 6 .   ? 12.039  45.438 42.602  1.00 50.08  ? 1343 HOH A O     1 
HETATM 5425 O  O     . HOH G 6 .   ? 25.103  34.292 1.140   1.00 45.92  ? 1344 HOH A O     1 
HETATM 5426 O  O     . HOH G 6 .   ? 3.077   60.711 48.251  1.00 61.22  ? 1345 HOH A O     1 
HETATM 5427 O  O     . HOH G 6 .   ? 16.429  42.074 46.344  1.00 48.60  ? 1346 HOH A O     1 
HETATM 5428 O  O     . HOH G 6 .   ? 30.291  40.579 10.236  1.00 39.92  ? 1347 HOH A O     1 
HETATM 5429 O  O     . HOH G 6 .   ? 14.656  13.658 5.971   1.00 33.11  ? 1348 HOH A O     1 
HETATM 5430 O  O     . HOH G 6 .   ? -0.770  46.717 13.733  1.00 44.38  ? 1349 HOH A O     1 
HETATM 5431 O  O     . HOH G 6 .   ? 11.850  51.699 9.960   1.00 49.95  ? 1350 HOH A O     1 
HETATM 5432 O  O     . HOH G 6 .   ? 2.425   45.430 10.175  1.00 52.51  ? 1351 HOH A O     1 
HETATM 5433 O  O     . HOH G 6 .   ? 6.656   13.844 1.386   1.00 59.14  ? 1352 HOH A O     1 
HETATM 5434 O  O     . HOH G 6 .   ? 18.179  44.458 49.235  1.00 31.08  ? 1353 HOH A O     1 
HETATM 5435 O  O     . HOH G 6 .   ? 24.659  27.688 5.433   1.00 33.20  ? 1354 HOH A O     1 
HETATM 5436 O  O     . HOH G 6 .   ? 1.458   44.829 13.215  1.00 52.11  ? 1355 HOH A O     1 
HETATM 5437 O  O     . HOH G 6 .   ? 27.852  59.732 21.203  1.00 36.75  ? 1356 HOH A O     1 
HETATM 5438 O  O     . HOH G 6 .   ? 19.491  64.960 23.652  1.00 31.62  ? 1357 HOH A O     1 
HETATM 5439 O  O     . HOH G 6 .   ? 5.951   35.030 48.012  1.00 48.63  ? 1358 HOH A O     1 
HETATM 5440 O  O     . HOH G 6 .   ? 6.118   32.122 48.233  1.00 61.24  ? 1359 HOH A O     1 
HETATM 5441 O  O     . HOH G 6 .   ? 15.414  59.243 56.239  1.00 53.68  ? 1360 HOH A O     1 
HETATM 5442 O  O     . HOH G 6 .   ? 15.331  55.303 50.792  1.00 34.03  ? 1361 HOH A O     1 
HETATM 5443 O  O     . HOH G 6 .   ? 53.074  29.207 52.168  1.00 54.22  ? 1362 HOH A O     1 
HETATM 5444 O  O     . HOH G 6 .   ? 7.103   21.806 33.399  1.00 51.53  ? 1363 HOH A O     1 
HETATM 5445 O  O     . HOH G 6 .   ? -6.067  31.627 11.937  1.00 35.33  ? 1364 HOH A O     1 
HETATM 5446 O  O     . HOH G 6 .   ? -3.222  53.622 21.335  1.00 44.32  ? 1365 HOH A O     1 
HETATM 5447 O  O     . HOH G 6 .   ? 0.442   29.803 48.909  1.00 54.96  ? 1366 HOH A O     1 
HETATM 5448 O  O     . HOH G 6 .   ? -1.210  43.825 13.678  1.00 37.98  ? 1367 HOH A O     1 
HETATM 5449 O  O     . HOH G 6 .   ? 11.809  13.617 16.733  1.00 53.13  ? 1368 HOH A O     1 
HETATM 5450 O  O     . HOH G 6 .   ? -1.489  41.980 11.449  1.00 44.05  ? 1369 HOH A O     1 
HETATM 5451 O  O     . HOH G 6 .   ? 0.514   32.040 49.985  1.00 44.23  ? 1370 HOH A O     1 
HETATM 5452 O  O     . HOH G 6 .   ? 16.974  11.390 14.957  1.00 48.46  ? 1371 HOH A O     1 
HETATM 5453 O  O     . HOH G 6 .   ? 25.988  27.659 3.082   1.00 46.61  ? 1372 HOH A O     1 
HETATM 5454 O  O     . HOH H 6 .   ? 20.283  31.345 36.315  1.00 55.42  ? 101  HOH T O     1 
HETATM 5455 O  O     . HOH H 6 .   ? 16.444  26.284 31.760  1.00 47.11  ? 102  HOH T O     1 
HETATM 5456 O  O     . HOH H 6 .   ? 17.510  32.534 22.555  1.00 48.63  ? 103  HOH T O     1 
HETATM 5457 O  O     . HOH H 6 .   ? 21.182  30.586 27.497  1.00 39.35  ? 104  HOH T O     1 
HETATM 5458 O  O     . HOH H 6 .   ? 10.723  34.559 37.852  1.00 55.00  ? 105  HOH T O     1 
HETATM 5459 O  O     . HOH H 6 .   ? 25.187  31.356 25.681  1.00 40.33  ? 106  HOH T O     1 
HETATM 5460 O  O     . HOH H 6 .   ? 34.496  26.647 26.684  1.00 52.31  ? 107  HOH T O     1 
HETATM 5461 O  O     . HOH H 6 .   ? 26.742  35.452 22.005  1.00 52.97  ? 108  HOH T O     1 
HETATM 5462 O  O     . HOH H 6 .   ? 26.808  38.147 22.716  1.00 46.86  ? 109  HOH T O     1 
# 
loop_
_atom_site_anisotrop.id 
_atom_site_anisotrop.type_symbol 
_atom_site_anisotrop.pdbx_label_atom_id 
_atom_site_anisotrop.pdbx_label_alt_id 
_atom_site_anisotrop.pdbx_label_comp_id 
_atom_site_anisotrop.pdbx_label_asym_id 
_atom_site_anisotrop.pdbx_label_seq_id 
_atom_site_anisotrop.pdbx_PDB_ins_code 
_atom_site_anisotrop.U[1][1] 
_atom_site_anisotrop.U[2][2] 
_atom_site_anisotrop.U[3][3] 
_atom_site_anisotrop.U[1][2] 
_atom_site_anisotrop.U[1][3] 
_atom_site_anisotrop.U[2][3] 
_atom_site_anisotrop.pdbx_auth_seq_id 
_atom_site_anisotrop.pdbx_auth_comp_id 
_atom_site_anisotrop.pdbx_auth_asym_id 
_atom_site_anisotrop.pdbx_auth_atom_id 
1    O "O5'" . DG  A 1   ? 1.6318 1.4367 0.8879 0.2072  0.0040  -0.5259 1   DG  P "O5'" 
2    C "C5'" . DG  A 1   ? 1.7409 1.5265 0.9486 0.1625  0.0011  -0.5564 1   DG  P "C5'" 
3    C "C4'" . DG  A 1   ? 1.8063 1.5783 1.0126 0.1476  -0.0234 -0.5498 1   DG  P "C4'" 
4    O "O4'" . DG  A 1   ? 1.8161 1.5106 1.0488 0.1809  -0.0195 -0.5463 1   DG  P "O4'" 
5    C "C3'" . DG  A 1   ? 1.7703 1.6248 0.9938 0.1484  -0.0541 -0.5077 1   DG  P "C3'" 
6    O "O3'" . DG  A 1   ? 1.8583 1.7644 1.0534 0.1025  -0.0719 -0.5159 1   DG  P "O3'" 
7    C "C2'" . DG  A 1   ? 1.7681 1.5834 1.0211 0.1709  -0.0658 -0.4889 1   DG  P "C2'" 
8    C "C1'" . DG  A 1   ? 1.8290 1.5325 1.0728 0.1816  -0.0451 -0.5187 1   DG  P "C1'" 
9    N N9    . DG  A 1   ? 1.8034 1.4646 1.0864 0.2291  -0.0445 -0.4918 1   DG  P N9    
10   C C8    . DG  A 1   ? 1.7393 1.4416 1.0617 0.2717  -0.0398 -0.4705 1   DG  P C8    
11   N N7    . DG  A 1   ? 1.7279 1.3890 1.0830 0.3073  -0.0427 -0.4507 1   DG  P N7    
12   C C5    . DG  A 1   ? 1.7845 1.3615 1.1170 0.2864  -0.0488 -0.4527 1   DG  P C5    
13   C C6    . DG  A 1   ? 1.7972 1.2931 1.1378 0.3071  -0.0553 -0.4324 1   DG  P C6    
14   O O6    . DG  A 1   ? 1.7571 1.2511 1.1342 0.3518  -0.0610 -0.4086 1   DG  P O6    
15   N N1    . DG  A 1   ? 1.8652 1.2756 1.1601 0.2676  -0.0544 -0.4435 1   DG  P N1    
16   C C2    . DG  A 1   ? 1.9013 1.3179 1.1567 0.2125  -0.0477 -0.4753 1   DG  P C2    
17   N N2    . DG  A 1   ? 1.9632 1.2893 1.1749 0.1729  -0.0420 -0.4873 1   DG  P N2    
18   N N3    . DG  A 1   ? 1.8873 1.3920 1.1403 0.1951  -0.0459 -0.4954 1   DG  P N3    
19   C C4    . DG  A 1   ? 1.8298 1.4052 1.1188 0.2354  -0.0470 -0.4802 1   DG  P C4    
20   P P     . DC  A 2   ? 1.9149 1.8036 1.1024 0.0607  -0.0843 -0.5367 2   DC  P P     
21   O OP1   . DC  A 2   ? 2.0507 1.8243 1.2214 0.0575  -0.0606 -0.5707 2   DC  P OP1   
22   O OP2   . DC  A 2   ? 1.9663 1.9202 1.1288 0.0178  -0.0984 -0.5478 2   DC  P OP2   
23   O "O5'" . DC  A 2   ? 1.7637 1.6967 0.9952 0.0789  -0.1089 -0.4966 2   DC  P "O5'" 
24   C "C5'" . DC  A 2   ? 1.7258 1.6830 0.9662 0.0404  -0.1246 -0.5035 2   DC  P "C5'" 
25   C "C4'" . DC  A 2   ? 1.7599 1.6071 0.9856 0.0193  -0.1071 -0.5290 2   DC  P "C4'" 
26   O "O4'" . DC  A 2   ? 1.7676 1.5287 1.0071 0.0669  -0.0919 -0.5053 2   DC  P "O4'" 
27   C "C3'" . DC  A 2   ? 1.7171 1.5739 0.9679 -0.0133 -0.1172 -0.5180 2   DC  P "C3'" 
28   O "O3'" . DC  A 2   ? 1.8195 1.6111 1.0325 -0.0701 -0.1004 -0.5623 2   DC  P "O3'" 
29   C "C2'" . DC  A 2   ? 1.6132 1.4061 0.8945 0.0269  -0.1132 -0.4730 2   DC  P "C2'" 
30   C "C1'" . DC  A 2   ? 1.6510 1.3543 0.9090 0.0632  -0.0929 -0.4821 2   DC  P "C1'" 
31   N N1    . DC  A 2   ? 1.5016 1.1858 0.7955 0.1204  -0.0935 -0.4401 2   DC  P N1    
32   C C2    . DC  A 2   ? 1.4556 1.0532 0.7554 0.1309  -0.0908 -0.4186 2   DC  P C2    
33   O O2    . DC  A 2   ? 1.5237 1.0496 0.7923 0.0915  -0.0848 -0.4329 2   DC  P O2    
34   N N3    . DC  A 2   ? 1.4158 1.0101 0.7499 0.1814  -0.0937 -0.3840 2   DC  P N3    
35   C C4    . DC  A 2   ? 1.3793 1.0487 0.7415 0.2158  -0.0942 -0.3739 2   DC  P C4    
36   N N4    . DC  A 2   ? 1.3205 0.9921 0.7181 0.2594  -0.0944 -0.3456 2   DC  P N4    
37   C C5    . DC  A 2   ? 1.3295 1.0740 0.6785 0.2041  -0.0935 -0.3937 2   DC  P C5    
38   C C6    . DC  A 2   ? 1.3804 1.1311 0.6953 0.1586  -0.0957 -0.4248 2   DC  P C6    
39   P P     . DG  A 3   ? 1.8261 1.6689 1.0565 -0.1292 -0.1091 -0.5740 3   DG  P P     
40   O OP1   . DG  A 3   ? 1.9243 1.7017 1.1202 -0.1810 -0.0872 -0.6121 3   DG  P OP1   
41   O OP2   . DG  A 3   ? 1.7451 1.7374 1.0253 -0.1175 -0.1400 -0.5497 3   DG  P OP2   
42   O "O5'" . DG  A 3   ? 1.7211 1.4965 0.9730 -0.1190 -0.1048 -0.5378 3   DG  P "O5'" 
43   C "C5'" . DG  A 3   ? 1.7820 1.3996 0.9916 -0.1245 -0.0793 -0.5396 3   DG  P "C5'" 
44   C "C4'" . DG  A 3   ? 1.7590 1.3390 0.9953 -0.1047 -0.0841 -0.4918 3   DG  P "C4'" 
45   O "O4'" . DG  A 3   ? 1.6682 1.2401 0.9297 -0.0325 -0.0922 -0.4502 3   DG  P "O4'" 
46   C "C3'" . DG  A 3   ? 1.7360 1.4382 1.0283 -0.1239 -0.1031 -0.4761 3   DG  P "C3'" 
47   O "O3'" . DG  A 3   ? 1.9176 1.5927 1.1916 -0.1948 -0.0895 -0.5044 3   DG  P "O3'" 
48   C "C2'" . DG  A 3   ? 1.5806 1.2798 0.9123 -0.0697 -0.1130 -0.4180 3   DG  P "C2'" 
49   C "C1'" . DG  A 3   ? 1.5892 1.2018 0.8968 -0.0150 -0.1056 -0.4056 3   DG  P "C1'" 
50   N N9    . DG  A 3   ? 1.4767 1.1659 0.8260 0.0426  -0.1181 -0.3757 3   DG  P N9    
51   C C8    . DG  A 3   ? 1.4029 1.2019 0.7710 0.0532  -0.1294 -0.3813 3   DG  P C8    
52   N N7    . DG  A 3   ? 1.3440 1.1772 0.7372 0.1032  -0.1328 -0.3516 3   DG  P N7    
53   C C5    . DG  A 3   ? 1.3331 1.0886 0.7338 0.1279  -0.1257 -0.3269 3   DG  P C5    
54   C C6    . DG  A 3   ? 1.2509 1.0113 0.6797 0.1777  -0.1242 -0.2957 3   DG  P C6    
55   O O6    . DG  A 3   ? 1.2273 1.0546 0.6765 0.2068  -0.1238 -0.2839 3   DG  P O6    
56   N N1    . DG  A 3   ? 1.2931 0.9687 0.7192 0.1905  -0.1217 -0.2792 3   DG  P N1    
57   C C2    . DG  A 3   ? 1.4028 0.9835 0.7922 0.1591  -0.1189 -0.2881 3   DG  P C2    
58   N N2    . DG  A 3   ? 1.5158 1.0157 0.8966 0.1818  -0.1201 -0.2652 3   DG  P N2    
59   N N3    . DG  A 3   ? 1.4451 1.0101 0.8030 0.1072  -0.1145 -0.3188 3   DG  P N3    
60   C C4    . DG  A 3   ? 1.4263 1.0894 0.7971 0.0943  -0.1190 -0.3385 3   DG  P C4    
61   P P     . DA  A 4   ? 2.0372 1.5979 1.2905 -0.2130 -0.0746 -0.4796 4   DA  P P     
62   O OP1   . DA  A 4   ? 2.1529 1.5654 1.3588 -0.1681 -0.0647 -0.4553 4   DA  P OP1   
63   O OP2   . DA  A 4   ? 2.1313 1.6837 1.3658 -0.2937 -0.0555 -0.5204 4   DA  P OP2   
64   O "O5'" . DA  A 4   ? 1.9002 1.5648 1.2283 -0.1852 -0.0955 -0.4346 4   DA  P "O5'" 
65   C "C5'" . DA  A 4   ? 1.8667 1.4872 1.1964 -0.2115 -0.0872 -0.4147 4   DA  P "C5'" 
66   C "C4'" . DA  A 4   ? 1.8672 1.3493 1.1570 -0.1722 -0.0819 -0.3739 4   DA  P "C4'" 
67   O "O4'" . DA  A 4   ? 1.7842 1.2869 1.0955 -0.0975 -0.0963 -0.3486 4   DA  P "O4'" 
68   C "C3'" . DA  A 4   ? 1.7955 1.2723 1.1074 -0.1733 -0.0840 -0.3346 4   DA  P "C3'" 
69   O "O3'" . DA  A 4   ? 1.9068 1.2269 1.1524 -0.1644 -0.0750 -0.3122 4   DA  P "O3'" 
70   C "C2'" . DA  A 4   ? 1.6420 1.2254 1.0232 -0.1085 -0.1047 -0.2982 4   DA  P "C2'" 
71   C "C1'" . DA  A 4   ? 1.6498 1.1958 1.0084 -0.0578 -0.1085 -0.3017 4   DA  P "C1'" 
72   N N9    . DA  A 4   ? 1.5199 1.1819 0.9305 -0.0125 -0.1227 -0.2920 4   DA  P N9    
73   C C8    . DA  A 4   ? 1.4799 1.2489 0.9140 -0.0224 -0.1308 -0.3163 4   DA  P C8    
74   N N7    . DA  A 4   ? 1.3805 1.2228 0.8454 0.0256  -0.1411 -0.2974 4   DA  P N7    
75   C C5    . DA  A 4   ? 1.3923 1.1812 0.8618 0.0664  -0.1374 -0.2627 4   DA  P C5    
76   C C6    . DA  A 4   ? 1.3664 1.1908 0.8620 0.1195  -0.1393 -0.2352 4   DA  P C6    
77   N N6    . DA  A 4   ? 1.2751 1.1848 0.7878 0.1412  -0.1438 -0.2346 4   DA  P N6    
78   N N1    . DA  A 4   ? 1.4122 1.1801 0.9102 0.1475  -0.1356 -0.2097 4   DA  P N1    
79   C C2    . DA  A 4   ? 1.4639 1.1368 0.9323 0.1282  -0.1334 -0.2068 4   DA  P C2    
80   N N3    . DA  A 4   ? 1.5005 1.1157 0.9323 0.0782  -0.1288 -0.2278 4   DA  P N3    
81   C C4    . DA  A 4   ? 1.4610 1.1433 0.8990 0.0468  -0.1294 -0.2580 4   DA  P C4    
82   P P     . DT  A 5   ? 1.9620 1.2235 1.1874 -0.1982 -0.0672 -0.2859 5   DT  P P     
83   O OP1   . DT  A 5   ? 2.1094 1.1851 1.2389 -0.1922 -0.0581 -0.2725 5   DT  P OP1   
84   O OP2   . DT  A 5   ? 1.9435 1.2815 1.1944 -0.2726 -0.0540 -0.3194 5   DT  P OP2   
85   O "O5'" . DT  A 5   ? 1.7491 1.0998 1.0449 -0.1415 -0.0873 -0.2378 5   DT  P "O5'" 
86   C "C5'" . DT  A 5   ? 1.6354 0.9516 0.9291 -0.0691 -0.1016 -0.2060 5   DT  P "C5'" 
87   C "C4'" . DT  A 5   ? 1.4340 0.8612 0.8015 -0.0308 -0.1141 -0.1721 5   DT  P "C4'" 
88   O "O4'" . DT  A 5   ? 1.2027 0.7448 0.6252 -0.0007 -0.1208 -0.1833 5   DT  P "O4'" 
89   C "C3'" . DT  A 5   ? 1.2821 0.7701 0.6851 -0.0747 -0.1074 -0.1620 5   DT  P "C3'" 
90   O "O3'" . DT  A 5   ? 1.2744 0.7113 0.6621 -0.0619 -0.1102 -0.1240 5   DT  P "O3'" 
91   C "C2'" . DT  A 5   ? 1.1000 0.7417 0.5857 -0.0525 -0.1135 -0.1622 5   DT  P "C2'" 
92   C "C1'" . DT  A 5   ? 1.2004 0.8491 0.6865 0.0070  -0.1236 -0.1615 5   DT  P "C1'" 
93   N N1    . DT  A 5   ? 1.1773 0.9375 0.7055 0.0207  -0.1288 -0.1780 5   DT  P N1    
94   C C2    . DT  A 5   ? 1.1052 0.9214 0.6632 0.0735  -0.1334 -0.1595 5   DT  P C2    
95   O O2    . DT  A 5   ? 1.0275 0.8195 0.5891 0.1077  -0.1326 -0.1343 5   DT  P O2    
96   N N3    . DT  A 5   ? 1.0338 0.9375 0.6137 0.0830  -0.1387 -0.1736 5   DT  P N3    
97   C C4    . DT  A 5   ? 1.0113 0.9641 0.5930 0.0494  -0.1441 -0.2045 5   DT  P C4    
98   O O4    . DT  A 5   ? 1.0389 1.0714 0.6352 0.0655  -0.1532 -0.2126 5   DT  P O4    
99   C C5    . DT  A 5   ? 1.1141 1.0181 0.6740 -0.0078 -0.1379 -0.2282 5   DT  P C5    
100  C C7    . DT  A 5   ? 1.1980 1.1641 0.7637 -0.0529 -0.1416 -0.2704 5   DT  P C7    
101  C C6    . DT  A 5   ? 1.1555 0.9593 0.6858 -0.0209 -0.1284 -0.2134 5   DT  P C6    
102  P P     . DC  A 6   ? 1.2210 0.6935 0.6322 -0.1081 -0.0995 -0.1096 6   DC  P P     
103  O OP1   . DC  A 6   ? 1.3723 0.7257 0.7165 -0.1121 -0.1011 -0.0815 6   DC  P OP1   
104  O OP2   . DC  A 6   ? 1.2858 0.8089 0.7161 -0.1703 -0.0847 -0.1467 6   DC  P OP2   
105  O "O5'" . DC  A 6   ? 1.0794 0.6758 0.5716 -0.0644 -0.1052 -0.0858 6   DC  P "O5'" 
106  C "C5'" . DC  A 6   ? 1.0768 0.6706 0.5739 -0.0022 -0.1176 -0.0614 6   DC  P "C5'" 
107  C "C4'" . DC  A 6   ? 0.9591 0.6735 0.5287 0.0265  -0.1145 -0.0494 6   DC  P "C4'" 
108  O "O4'" . DC  A 6   ? 0.9878 0.7685 0.5844 0.0424  -0.1163 -0.0716 6   DC  P "O4'" 
109  C "C3'" . DC  A 6   ? 0.9555 0.7309 0.5661 -0.0102 -0.0997 -0.0403 6   DC  P "C3'" 
110  O "O3'" . DC  A 6   ? 0.8642 0.6705 0.4991 0.0149  -0.0957 -0.0119 6   DC  P "O3'" 
111  C "C2'" . DC  A 6   ? 0.9457 0.8191 0.6066 -0.0114 -0.0962 -0.0607 6   DC  P "C2'" 
112  C "C1'" . DC  A 6   ? 0.9163 0.7974 0.5693 0.0376  -0.1080 -0.0674 6   DC  P "C1'" 
113  N N1    . DC  A 6   ? 0.9304 0.8694 0.5977 0.0347  -0.1136 -0.0954 6   DC  P N1    
114  C C2    . DC  A 6   ? 0.8840 0.8862 0.5715 0.0778  -0.1175 -0.0925 6   DC  P C2    
115  O O2    . DC  A 6   ? 0.8311 0.8399 0.5268 0.1132  -0.1118 -0.0701 6   DC  P O2    
116  N N3    . DC  A 6   ? 0.9579 1.0140 0.6510 0.0767  -0.1266 -0.1161 6   DC  P N3    
117  C C4    . DC  A 6   ? 0.9372 0.9961 0.6248 0.0333  -0.1309 -0.1460 6   DC  P C4    
118  N N4    . DC  A 6   ? 0.8790 1.0044 0.5739 0.0341  -0.1430 -0.1712 6   DC  P N4    
119  C C5    . DC  A 6   ? 0.9120 0.9057 0.5807 -0.0160 -0.1220 -0.1535 6   DC  P C5    
120  C C6    . DC  A 6   ? 0.9514 0.8812 0.6062 -0.0125 -0.1140 -0.1254 6   DC  P C6    
121  P P     . DA  A 7   ? 0.8115 0.6660 0.4830 -0.0190 -0.0761 0.0021  7   DA  P P     
122  O OP1   . DA  A 7   ? 0.7507 0.5799 0.4066 -0.0049 -0.0775 0.0286  7   DA  P OP1   
123  O OP2   . DA  A 7   ? 0.8698 0.7088 0.5349 -0.0784 -0.0668 -0.0163 7   DA  P OP2   
124  O "O5'" . DA  A 7   ? 0.7090 0.6681 0.4431 0.0080  -0.0653 0.0010  7   DA  P "O5'" 
125  C "C5'" . DA  A 7   ? 0.6737 0.6609 0.4172 0.0584  -0.0667 0.0108  7   DA  P "C5'" 
126  C "C4'" . DA  A 7   ? 0.5610 0.6260 0.3440 0.0780  -0.0564 0.0079  7   DA  P "C4'" 
127  O "O4'" . DA  A 7   ? 0.6637 0.7385 0.4396 0.0812  -0.0718 -0.0151 7   DA  P "O4'" 
128  C "C3'" . DA  A 7   ? 0.5173 0.6306 0.3418 0.0525  -0.0364 0.0135  7   DA  P "C3'" 
129  O "O3'" . DA  A 7   ? 0.4707 0.6212 0.3161 0.0773  -0.0156 0.0311  7   DA  P "O3'" 
130  C "C2'" . DA  A 7   ? 0.5214 0.6792 0.3658 0.0490  -0.0460 -0.0080 7   DA  P "C2'" 
131  C "C1'" . DA  A 7   ? 0.6265 0.7719 0.4404 0.0819  -0.0655 -0.0182 7   DA  P "C1'" 
132  N N9    . DA  A 7   ? 0.7158 0.8788 0.5271 0.0672  -0.0824 -0.0465 7   DA  P N9    
133  C C8    . DA  A 7   ? 0.7674 0.9019 0.5679 0.0204  -0.0871 -0.0693 7   DA  P C8    
134  N N7    . DA  A 7   ? 0.8638 1.0344 0.6668 0.0120  -0.1006 -0.0984 7   DA  P N7    
135  C C5    . DA  A 7   ? 0.7850 1.0092 0.5979 0.0601  -0.1087 -0.0906 7   DA  P C5    
136  C C6    . DA  A 7   ? 0.8309 1.1137 0.6453 0.0771  -0.1266 -0.1098 7   DA  P C6    
137  N N6    . DA  A 7   ? 0.9139 1.2225 0.7285 0.0440  -0.1393 -0.1466 7   DA  P N6    
138  N N1    . DA  A 7   ? 0.8859 1.1996 0.6957 0.1263  -0.1297 -0.0916 7   DA  P N1    
139  C C2    . DA  A 7   ? 0.7359 1.0243 0.5435 0.1520  -0.1115 -0.0602 7   DA  P C2    
140  N N3    . DA  A 7   ? 0.5857 0.8303 0.3990 0.1379  -0.0934 -0.0435 7   DA  P N3    
141  C C4    . DA  A 7   ? 0.7093 0.9235 0.5243 0.0933  -0.0953 -0.0584 7   DA  P C4    
142  P P     . DC  A 8   ? 0.4287 0.6240 0.3169 0.0615  0.0123  0.0396  8   DC  P P     
143  O OP1   . DC  A 8   ? 0.4394 0.6384 0.3274 0.0751  0.0380  0.0581  8   DC  P OP1   
144  O OP2   . DC  A 8   ? 0.4399 0.6253 0.3404 0.0115  0.0137  0.0291  8   DC  P OP2   
145  O "O5'" . DC  A 8   ? 0.4223 0.6688 0.3300 0.0934  0.0071  0.0331  8   DC  P "O5'" 
146  C "C5'" . DC  A 8   ? 0.4290 0.6794 0.3128 0.1376  0.0035  0.0392  8   DC  P "C5'" 
147  C "C4'" . DC  A 8   ? 0.4317 0.7286 0.3291 0.1666  -0.0001 0.0391  8   DC  P "C4'" 
148  O "O4'" . DC  A 8   ? 0.4588 0.7757 0.3523 0.1657  -0.0328 0.0162  8   DC  P "O4'" 
149  C "C3'" . DC  A 8   ? 0.4357 0.7690 0.3790 0.1578  0.0178  0.0436  8   DC  P "C3'" 
150  O "O3'" . DC  A 8   ? 0.4509 0.8017 0.3892 0.2007  0.0287  0.0593  8   DC  P "O3'" 
151  C "C2'" . DC  A 8   ? 0.4999 0.8721 0.4716 0.1361  -0.0080 0.0165  8   DC  P "C2'" 
152  C "C1'" . DC  A 8   ? 0.4523 0.8258 0.3878 0.1607  -0.0381 0.0061  8   DC  P "C1'" 
153  N N1    . DC  A 8   ? 0.5961 0.9857 0.5364 0.1302  -0.0639 -0.0263 8   DC  P N1    
154  C C2    . DC  A 8   ? 0.5505 0.9862 0.4842 0.1513  -0.0913 -0.0436 8   DC  P C2    
155  O O2    . DC  A 8   ? 0.5336 0.9908 0.4531 0.1978  -0.0959 -0.0279 8   DC  P O2    
156  N N3    . DC  A 8   ? 0.6956 1.1479 0.6317 0.1170  -0.1103 -0.0783 8   DC  P N3    
157  C C4    . DC  A 8   ? 0.6841 1.0966 0.6218 0.0646  -0.1008 -0.0931 8   DC  P C4    
158  N N4    . DC  A 8   ? 0.8621 1.2835 0.7940 0.0264  -0.1143 -0.1303 8   DC  P N4    
159  C C5    . DC  A 8   ? 0.5882 0.9466 0.5261 0.0456  -0.0758 -0.0716 8   DC  P C5    
160  C C6    . DC  A 8   ? 0.4826 0.8374 0.4251 0.0793  -0.0591 -0.0397 8   DC  P C6    
161  P P     . DG  A 9   ? 0.5417 0.9010 0.5103 0.2062  0.0656  0.0756  9   DG  P P     
162  O OP1   . DG  A 9   ? 0.5302 0.8454 0.4558 0.2246  0.0965  0.0971  9   DG  P OP1   
163  O OP2   . DG  A 9   ? 0.5024 0.8735 0.5168 0.1586  0.0768  0.0635  9   DG  P OP2   
164  O "O5'" . DG  A 9   ? 0.5840 0.9942 0.5715 0.2498  0.0473  0.0747  9   DG  P "O5'" 
165  C "C5'" . DG  A 9   ? 0.5605 0.9587 0.5010 0.3020  0.0420  0.0924  9   DG  P "C5'" 
166  C "C4'" . DG  A 9   ? 0.6154 1.0764 0.5694 0.3345  0.0004  0.0805  9   DG  P "C4'" 
167  O "O4'" . DG  A 9   ? 0.5525 1.0370 0.5068 0.3068  -0.0337 0.0528  9   DG  P "O4'" 
168  C "C3'" . DG  A 9   ? 0.5581 1.0847 0.5842 0.3377  -0.0033 0.0681  9   DG  P "C3'" 
169  O "O3'" . DG  A 9   ? 0.5230 1.0337 0.5419 0.3846  0.0171  0.0934  9   DG  P "O3'" 
170  C "C2'" . DG  A 9   ? 0.5038 1.1057 0.5453 0.3466  -0.0534 0.0408  9   DG  P "C2'" 
171  C "C1'" . DG  A 9   ? 0.4997 1.0648 0.4981 0.3117  -0.0659 0.0286  9   DG  P "C1'" 
172  N N9    . DG  A 9   ? 0.4785 1.0604 0.5130 0.2522  -0.0719 -0.0039 9   DG  P N9    
173  C C8    . DG  A 9   ? 0.5638 1.1064 0.6153 0.2038  -0.0446 -0.0056 9   DG  P C8    
174  N N7    . DG  A 9   ? 0.5740 1.1276 0.6418 0.1542  -0.0557 -0.0364 9   DG  P N7    
175  C C5    . DG  A 9   ? 0.5203 1.1306 0.5877 0.1681  -0.0907 -0.0600 9   DG  P C5    
176  C C6    . DG  A 9   ? 0.5568 1.1990 0.6336 0.1262  -0.1110 -0.1009 9   DG  P C6    
177  O O6    . DG  A 9   ? 0.5194 1.1343 0.6008 0.0677  -0.1005 -0.1226 9   DG  P O6    
178  N N1    . DG  A 9   ? 0.6506 1.3583 0.7227 0.1549  -0.1448 -0.1176 9   DG  P N1    
179  C C2    . DG  A 9   ? 0.7311 1.4629 0.7844 0.2196  -0.1597 -0.0931 9   DG  P C2    
180  N N2    . DG  A 9   ? 0.7598 1.5586 0.8046 0.2385  -0.1959 -0.1139 9   DG  P N2    
181  N N3    . DG  A 9   ? 0.6413 1.3301 0.6774 0.2599  -0.1389 -0.0521 9   DG  P N3    
182  C C4    . DG  A 9   ? 0.5403 1.1726 0.5879 0.2296  -0.1036 -0.0396 9   DG  P C4    
183  P P     . DT  A 10  ? 0.5181 1.0681 0.6095 0.3850  0.0306  0.0840  10  DT  P P     
184  O OP1   . DT  A 10  ? 0.8315 1.3097 0.8837 0.4160  0.0650  0.1154  10  DT  P OP1   
185  O OP2   . DT  A 10  ? 0.4526 1.0375 0.6096 0.3282  0.0465  0.0590  10  DT  P OP2   
186  O "O5'" . DT  A 10  ? 0.5540 1.1802 0.6713 0.4089  -0.0181 0.0612  10  DT  P "O5'" 
187  C "C5'" . DT  A 10  ? 0.6286 1.2324 0.6821 0.4528  -0.0411 0.0765  10  DT  P "C5'" 
188  C "C4'" . DT  A 10  ? 0.6471 1.3370 0.7289 0.4558  -0.0893 0.0448  10  DT  P "C4'" 
189  O "O4'" . DT  A 10  ? 0.7360 1.4604 0.8303 0.4113  -0.1056 0.0174  10  DT  P "O4'" 
190  C "C3'" . DT  A 10  ? 0.6421 1.4140 0.8113 0.4568  -0.0982 0.0189  10  DT  P "C3'" 
191  O "O3'" . DT  A 10  ? 0.8736 1.6385 1.0270 0.5116  -0.1069 0.0363  10  DT  P "O3'" 
192  C "C2'" . DT  A 10  ? 0.6251 1.4886 0.8300 0.4258  -0.1358 -0.0255 10  DT  P "C2'" 
193  C "C1'" . DT  A 10  ? 0.6156 1.4381 0.7694 0.3945  -0.1365 -0.0238 10  DT  P "C1'" 
194  N N1    . DT  A 10  ? 0.5497 1.4093 0.7535 0.3345  -0.1301 -0.0552 10  DT  P N1    
195  C C2    . DT  A 10  ? 0.5228 1.4492 0.7468 0.2975  -0.1583 -0.0985 10  DT  P C2    
196  O O2    . DT  A 10  ? 0.5765 1.5396 0.7845 0.3128  -0.1878 -0.1129 10  DT  P O2    
197  N N3    . DT  A 10  ? 0.4766 1.4102 0.7314 0.2329  -0.1448 -0.1257 10  DT  P N3    
198  C C4    . DT  A 10  ? 0.4459 1.3035 0.7011 0.1972  -0.1033 -0.1101 10  DT  P C4    
199  O O4    . DT  A 10  ? 0.4344 1.2640 0.6930 0.1307  -0.0887 -0.1323 10  DT  P O4    
200  C C5    . DT  A 10  ? 0.4393 1.2471 0.6821 0.2412  -0.0766 -0.0662 10  DT  P C5    
201  C C7    . DT  A 10  ? 0.5235 1.2565 0.7646 0.2039  -0.0309 -0.0494 10  DT  P C7    
202  C C6    . DT  A 10  ? 0.4725 1.2954 0.6964 0.3117  -0.0921 -0.0421 10  DT  P C6    
203  P P     . DA  A 11  ? 1.3008 0.8892 1.7186 0.4016  0.6046  0.3195  11  DA  P P     
204  O OP1   . DA  A 11  ? 1.5370 1.1103 1.9673 0.3997  0.5878  0.3229  11  DA  P OP1   
205  O OP2   . DA  A 11  ? 1.2964 0.8944 1.7056 0.4032  0.6129  0.3135  11  DA  P OP2   
206  O "O5'" . DA  A 11  ? 1.4060 1.0133 1.8412 0.4065  0.6129  0.3179  11  DA  P "O5'" 
207  C "C5'" . DA  A 11  ? 1.3738 0.9771 1.8175 0.4039  0.6104  0.3213  11  DA  P "C5'" 
208  C "C4'" . DA  A 11  ? 1.3277 0.9227 1.7597 0.3994  0.6152  0.3266  11  DA  P "C4'" 
209  O "O4'" . DA  A 11  ? 1.2931 0.8973 1.7262 0.4026  0.6259  0.3335  11  DA  P "O4'" 
210  C "C3'" . DA  A 11  ? 1.2998 0.8916 1.7447 0.3940  0.6135  0.3247  11  DA  P "C3'" 
211  O "O3'" . DA  A 11  ? 1.3076 0.8935 1.7404 0.3857  0.6079  0.3194  11  DA  P "O3'" 
212  C "C2'" . DA  A 11  ? 1.3002 0.8936 1.7580 0.3945  0.6254  0.3311  11  DA  P "C2'" 
213  C "C1'" . DA  A 11  ? 1.3353 0.9302 1.7799 0.3997  0.6288  0.3371  11  DA  P "C1'" 
214  N N9    . DA  A 11  ? 1.3047 0.9058 1.7581 0.4018  0.6354  0.3527  11  DA  P N9    
215  C C8    . DA  A 11  ? 1.3734 0.9653 1.8491 0.3985  0.6387  0.3631  11  DA  P C8    
216  N N7    . DA  A 11  ? 1.4128 1.0114 1.8911 0.3991  0.6406  0.3851  11  DA  P N7    
217  C C5    . DA  A 11  ? 1.4202 1.0401 1.8744 0.4033  0.6397  0.3845  11  DA  P C5    
218  C C6    . DA  A 11  ? 1.4214 1.0660 1.8631 0.4039  0.6397  0.4019  11  DA  P C6    
219  N N6    . DA  A 11  ? 1.3767 1.0254 1.8262 0.3997  0.6378  0.4317  11  DA  P N6    
220  N N1    . DA  A 11  ? 1.4367 1.1039 1.8590 0.4069  0.6404  0.3889  11  DA  P N1    
221  C C2    . DA  A 11  ? 1.3025 0.9604 1.7210 0.4093  0.6399  0.3651  11  DA  P C2    
222  N N3    . DA  A 11  ? 1.2975 0.9309 1.7234 0.4083  0.6370  0.3542  11  DA  P N3    
223  C C4    . DA  A 11  ? 1.3057 0.9244 1.7478 0.4053  0.6376  0.3629  11  DA  P C4    
224  N N     . ALA B 4   ? 0.8489 0.6488 0.7148 -0.0868 0.0687  -0.1543 300 ALA A N     
225  C CA    . ALA B 4   ? 0.8639 0.6710 0.7018 -0.0925 0.0707  -0.1612 300 ALA A CA    
226  C C     . ALA B 4   ? 0.8439 0.6695 0.6711 -0.0937 0.0638  -0.1509 300 ALA A C     
227  O O     . ALA B 4   ? 0.7683 0.6036 0.5981 -0.0986 0.0497  -0.1420 300 ALA A O     
228  C CB    . ALA B 4   ? 0.8492 0.6533 0.6667 -0.1066 0.0622  -0.1703 300 ALA A CB    
229  N N     . PHE B 5   ? 0.7413 0.5721 0.5577 -0.0894 0.0740  -0.1518 301 PHE A N     
230  C CA    . PHE B 5   ? 0.6625 0.5091 0.4664 -0.0907 0.0687  -0.1417 301 PHE A CA    
231  C C     . PHE B 5   ? 0.7192 0.5695 0.4994 -0.0931 0.0779  -0.1458 301 PHE A C     
232  O O     . PHE B 5   ? 0.7345 0.5770 0.5179 -0.0888 0.0929  -0.1556 301 PHE A O     
233  C CB    . PHE B 5   ? 0.5093 0.3666 0.3437 -0.0764 0.0705  -0.1272 301 PHE A CB    
234  C CG    . PHE B 5   ? 0.5028 0.3550 0.3522 -0.0650 0.0891  -0.1326 301 PHE A CG    
235  C CD1   . PHE B 5   ? 0.5062 0.3682 0.3483 -0.0624 0.0989  -0.1314 301 PHE A CD1   
236  C CD2   . PHE B 5   ? 0.5830 0.4215 0.4564 -0.0566 0.0964  -0.1377 301 PHE A CD2   
237  C CE1   . PHE B 5   ? 0.5344 0.3952 0.3951 -0.0517 0.1159  -0.1366 301 PHE A CE1   
238  C CE2   . PHE B 5   ? 0.6424 0.4795 0.5349 -0.0443 0.1115  -0.1408 301 PHE A CE2   
239  C CZ    . PHE B 5   ? 0.6070 0.4573 0.4951 -0.0418 0.1208  -0.1402 301 PHE A CZ    
240  N N     . THR B 6   ? 0.6220 0.4841 0.3795 -0.1000 0.0685  -0.1372 302 THR A N     
241  C CA    . THR B 6   ? 0.6847 0.5509 0.4173 -0.1038 0.0757  -0.1378 302 THR A CA    
242  C C     . THR B 6   ? 0.7477 0.6205 0.4930 -0.0943 0.0896  -0.1322 302 THR A C     
243  O O     . THR B 6   ? 0.6659 0.5482 0.4154 -0.0920 0.0837  -0.1196 302 THR A O     
244  C CB    . THR B 6   ? 0.7160 0.5916 0.4212 -0.1142 0.0583  -0.1278 302 THR A CB    
245  O OG1   . THR B 6   ? 0.7741 0.6469 0.4727 -0.1227 0.0442  -0.1327 302 THR A OG1   
246  C CG2   . THR B 6   ? 0.7077 0.5855 0.3858 -0.1188 0.0659  -0.1271 302 THR A CG2   
247  N N     . LEU B 7   ? 0.6970 0.5659 0.4506 -0.0888 0.1078  -0.1414 303 LEU A N     
248  C CA    . LEU B 7   ? 0.7377 0.6164 0.5040 -0.0814 0.1212  -0.1364 303 LEU A CA    
249  C C     . LEU B 7   ? 0.7858 0.6708 0.5208 -0.0909 0.1210  -0.1309 303 LEU A C     
250  O O     . LEU B 7   ? 0.8010 0.6824 0.5195 -0.0956 0.1304  -0.1392 303 LEU A O     
251  C CB    . LEU B 7   ? 0.7846 0.6591 0.5746 -0.0718 0.1390  -0.1474 303 LEU A CB    
252  C CG    . LEU B 7   ? 0.8447 0.7329 0.6592 -0.0623 0.1502  -0.1410 303 LEU A CG    
253  C CD1   . LEU B 7   ? 0.7669 0.6544 0.6219 -0.0478 0.1545  -0.1423 303 LEU A CD1   
254  C CD2   . LEU B 7   ? 0.9084 0.8005 0.7133 -0.0650 0.1653  -0.1469 303 LEU A CD2   
255  N N     . ALA B 8   ? 0.8208 0.7141 0.5470 -0.0938 0.1097  -0.1160 304 ALA A N     
256  C CA    . ALA B 8   ? 0.9091 0.8055 0.6023 -0.1039 0.1029  -0.1074 304 ALA A CA    
257  C C     . ALA B 8   ? 0.9894 0.8917 0.6802 -0.1035 0.1184  -0.1042 304 ALA A C     
258  O O     . ALA B 8   ? 1.0507 0.9602 0.7680 -0.0953 0.1291  -0.1018 304 ALA A O     
259  C CB    . ALA B 8   ? 0.8501 0.7523 0.5373 -0.1064 0.0833  -0.0909 304 ALA A CB    
260  N N     . ASP B 9   ? 1.0277 0.9278 0.6870 -0.1130 0.1189  -0.1039 305 ASP A N     
261  C CA    . ASP B 9   ? 1.0469 0.9516 0.6983 -0.1153 0.1326  -0.1002 305 ASP A CA    
262  C C     . ASP B 9   ? 0.9540 0.8628 0.5877 -0.1205 0.1217  -0.0808 305 ASP A C     
263  O O     . ASP B 9   ? 0.9958 0.9099 0.6342 -0.1201 0.1320  -0.0737 305 ASP A O     
264  C CB    . ASP B 9   ? 1.1411 1.0391 0.7675 -0.1226 0.1428  -0.1132 305 ASP A CB    
265  C CG    . ASP B 9   ? 1.2766 1.1668 0.8729 -0.1316 0.1269  -0.1161 305 ASP A CG    
266  O OD1   . ASP B 9   ? 1.3104 1.1976 0.9171 -0.1294 0.1148  -0.1190 305 ASP A OD1   
267  O OD2   . ASP B 9   ? 1.3264 1.2140 0.8891 -0.1413 0.1261  -0.1151 305 ASP A OD2   
268  N N     . ARG B 10  ? 0.8215 0.7279 0.4371 -0.1252 0.1009  -0.0717 306 ARG A N     
269  C CA    . ARG B 10  ? 0.8745 0.7835 0.4777 -0.1281 0.0874  -0.0514 306 ARG A CA    
270  C C     . ARG B 10  ? 0.7635 0.6740 0.3736 -0.1258 0.0653  -0.0434 306 ARG A C     
271  O O     . ARG B 10  ? 0.6249 0.5339 0.2432 -0.1245 0.0602  -0.0542 306 ARG A O     
272  C CB    . ARG B 10  ? 0.9723 0.8774 0.5379 -0.1380 0.0843  -0.0465 306 ARG A CB    
273  C CG    . ARG B 10  ? 1.1491 1.0489 0.6914 -0.1449 0.0794  -0.0596 306 ARG A CG    
274  C CD    . ARG B 10  ? 1.2397 1.1406 0.7700 -0.1482 0.0532  -0.0501 306 ARG A CD    
275  N NE    . ARG B 10  ? 1.2768 1.1737 0.7770 -0.1575 0.0475  -0.0589 306 ARG A NE    
276  C CZ    . ARG B 10  ? 1.2791 1.1783 0.7613 -0.1625 0.0256  -0.0499 306 ARG A CZ    
277  N NH1   . ARG B 10  ? 1.2759 1.1812 0.7689 -0.1582 0.0074  -0.0314 306 ARG A NH1   
278  N NH2   . ARG B 10  ? 1.2893 1.1853 0.7441 -0.1715 0.0217  -0.0594 306 ARG A NH2   
279  N N     . VAL B 11  ? 0.7303 0.6434 0.3388 -0.1252 0.0523  -0.0241 307 VAL A N     
280  C CA    . VAL B 11  ? 0.7110 0.6273 0.3287 -0.1224 0.0305  -0.0139 307 VAL A CA    
281  C C     . VAL B 11  ? 0.7291 0.6453 0.3230 -0.1289 0.0118  -0.0104 307 VAL A C     
282  O O     . VAL B 11  ? 0.7165 0.6304 0.2863 -0.1340 0.0091  -0.0019 307 VAL A O     
283  C CB    . VAL B 11  ? 0.7292 0.6477 0.3603 -0.1174 0.0254  0.0055  307 VAL A CB    
284  C CG1   . VAL B 11  ? 0.6582 0.5805 0.2970 -0.1144 0.0010  0.0182  307 VAL A CG1   
285  C CG2   . VAL B 11  ? 0.6431 0.5640 0.3019 -0.1109 0.0412  0.0014  307 VAL A CG2   
286  N N     . THR B 12  ? 0.6896 0.6089 0.2912 -0.1291 -0.0011 -0.0172 308 THR A N     
287  C CA    . THR B 12  ? 0.6921 0.6150 0.2791 -0.1344 -0.0216 -0.0134 308 THR A CA    
288  C C     . THR B 12  ? 0.7207 0.6528 0.3298 -0.1286 -0.0427 0.0009  308 THR A C     
289  O O     . THR B 12  ? 0.6923 0.6267 0.3272 -0.1217 -0.0410 0.0031  308 THR A O     
290  C CB    . THR B 12  ? 0.7017 0.6226 0.2838 -0.1401 -0.0205 -0.0332 308 THR A CB    
291  O OG1   . THR B 12  ? 0.7408 0.6632 0.3518 -0.1351 -0.0199 -0.0414 308 THR A OG1   
292  C CG2   . THR B 12  ? 0.7138 0.6254 0.2775 -0.1446 0.0013  -0.0485 308 THR A CG2   
293  N N     . GLU B 13  ? 0.6698 0.6079 0.2698 -0.1313 -0.0627 0.0102  309 GLU A N     
294  C CA    . GLU B 13  ? 0.7535 0.7024 0.3784 -0.1246 -0.0833 0.0242  309 GLU A CA    
295  C C     . GLU B 13  ? 0.6640 0.6204 0.3169 -0.1227 -0.0878 0.0137  309 GLU A C     
296  O O     . GLU B 13  ? 0.7003 0.6644 0.3820 -0.1151 -0.0965 0.0225  309 GLU A O     
297  C CB    . GLU B 13  ? 0.9772 0.9326 0.5884 -0.1275 -0.1033 0.0345  309 GLU A CB    
298  C CG    . GLU B 13  ? 1.1504 1.1201 0.7920 -0.1203 -0.1252 0.0463  309 GLU A CG    
299  C CD    . GLU B 13  ? 1.2723 1.2413 0.9335 -0.1095 -0.1276 0.0650  309 GLU A CD    
300  O OE1   . GLU B 13  ? 1.2863 1.2657 0.9821 -0.1013 -0.1381 0.0706  309 GLU A OE1   
301  O OE2   . GLU B 13  ? 1.3026 1.2603 0.9463 -0.1092 -0.1183 0.0736  309 GLU A OE2   
302  N N     . GLU B 14  ? 0.5785 0.5315 0.2242 -0.1295 -0.0809 -0.0052 310 GLU A N     
303  C CA    . GLU B 14  ? 0.5549 0.5118 0.2256 -0.1291 -0.0820 -0.0171 310 GLU A CA    
304  C C     . GLU B 14  ? 0.5522 0.5073 0.2466 -0.1212 -0.0727 -0.0156 310 GLU A C     
305  O O     . GLU B 14  ? 0.5746 0.5384 0.3042 -0.1154 -0.0782 -0.0158 310 GLU A O     
306  C CB    . GLU B 14  ? 0.6300 0.5772 0.2867 -0.1367 -0.0701 -0.0383 310 GLU A CB    
307  C CG    . GLU B 14  ? 1.0084 0.9563 0.6385 -0.1459 -0.0785 -0.0422 310 GLU A CG    
308  C CD    . GLU B 14  ? 1.0808 1.0220 0.6772 -0.1487 -0.0713 -0.0365 310 GLU A CD    
309  O OE1   . GLU B 14  ? 1.0687 1.0154 0.6605 -0.1457 -0.0821 -0.0181 310 GLU A OE1   
310  O OE2   . GLU B 14  ? 1.0850 1.0151 0.6613 -0.1535 -0.0543 -0.0501 310 GLU A OE2   
311  N N     . MET B 15  ? 0.5236 0.4706 0.2131 -0.1165 -0.0554 -0.0134 311 MET A N     
312  C CA    . MET B 15  ? 0.4725 0.4211 0.1992 -0.1039 -0.0442 -0.0110 311 MET A CA    
313  C C     . MET B 15  ? 0.5485 0.5055 0.2971 -0.0951 -0.0548 0.0075  311 MET A C     
314  O O     . MET B 15  ? 0.5861 0.5453 0.3652 -0.0852 -0.0474 0.0096  311 MET A O     
315  C CB    . MET B 15  ? 0.5238 0.4631 0.2424 -0.1024 -0.0218 -0.0168 311 MET A CB    
316  C CG    . MET B 15  ? 0.5600 0.4892 0.2473 -0.1122 -0.0105 -0.0334 311 MET A CG    
317  S SD    . MET B 15  ? 0.6694 0.5914 0.3488 -0.1105 0.0165  -0.0387 311 MET A SD    
318  C CE    . MET B 15  ? 0.5668 0.4785 0.2244 -0.1185 0.0286  -0.0614 311 MET A CE    
319  N N     . LEU B 16  ? 0.5256 0.4867 0.2598 -0.0982 -0.0722 0.0207  312 LEU A N     
320  C CA    . LEU B 16  ? 0.5445 0.5105 0.2988 -0.0891 -0.0814 0.0387  312 LEU A CA    
321  C C     . LEU B 16  ? 0.6044 0.5851 0.3828 -0.0858 -0.1017 0.0441  312 LEU A C     
322  O O     . LEU B 16  ? 0.6312 0.6165 0.4098 -0.0833 -0.1175 0.0596  312 LEU A O     
323  C CB    . LEU B 16  ? 0.5331 0.4908 0.2556 -0.0931 -0.0843 0.0530  312 LEU A CB    
324  C CG    . LEU B 16  ? 0.5663 0.5115 0.2593 -0.0997 -0.0640 0.0464  312 LEU A CG    
325  C CD1   . LEU B 16  ? 0.5773 0.5157 0.2465 -0.1024 -0.0657 0.0604  312 LEU A CD1   
326  C CD2   . LEU B 16  ? 0.5430 0.4862 0.2636 -0.0917 -0.0446 0.0409  312 LEU A CD2   
327  N N     . ALA B 17  ? 0.5817 0.5698 0.3828 -0.0855 -0.1009 0.0322  313 ALA A N     
328  C CA    . ALA B 17  ? 0.5367 0.5411 0.3642 -0.0836 -0.1178 0.0353  313 ALA A CA    
329  C C     . ALA B 17  ? 0.4234 0.4350 0.2890 -0.0702 -0.1184 0.0456  313 ALA A C     
330  O O     . ALA B 17  ? 0.4500 0.4534 0.3230 -0.0632 -0.1050 0.0479  313 ALA A O     
331  C CB    . ALA B 17  ? 0.5694 0.5776 0.4078 -0.0893 -0.1146 0.0188  313 ALA A CB    
332  N N     . ASP B 18  ? 0.4266 0.4549 0.3179 -0.0674 -0.1340 0.0505  314 ASP A N     
333  C CA    . ASP B 18  ? 0.5097 0.5471 0.4394 -0.0550 -0.1357 0.0588  314 ASP A CA    
334  C C     . ASP B 18  ? 0.4138 0.4509 0.3691 -0.0499 -0.1189 0.0492  314 ASP A C     
335  O O     . ASP B 18  ? 0.3634 0.4024 0.3435 -0.0398 -0.1146 0.0543  314 ASP A O     
336  C CB    . ASP B 18  ? 0.7264 0.7847 0.6787 -0.0546 -0.1560 0.0641  314 ASP A CB    
337  C CG    . ASP B 18  ? 1.0485 1.1183 1.0444 -0.0417 -0.1563 0.0702  314 ASP A CG    
338  O OD1   . ASP B 18  ? 1.1783 1.2415 1.1788 -0.0322 -0.1570 0.0822  314 ASP A OD1   
339  O OD2   . ASP B 18  ? 1.1363 1.2206 1.1616 -0.0414 -0.1546 0.0625  314 ASP A OD2   
340  N N     . LYS B 19  ? 0.3403 0.3744 0.2899 -0.0568 -0.1099 0.0355  315 LYS A N     
341  C CA    . LYS B 19  ? 0.3499 0.3829 0.3205 -0.0528 -0.0953 0.0278  315 LYS A CA    
342  C C     . LYS B 19  ? 0.3038 0.3222 0.2529 -0.0583 -0.0818 0.0167  315 LYS A C     
343  O O     . LYS B 19  ? 0.3294 0.3442 0.2586 -0.0679 -0.0848 0.0093  315 LYS A O     
344  C CB    . LYS B 19  ? 0.4327 0.4814 0.4316 -0.0545 -0.1002 0.0235  315 LYS A CB    
345  C CG    . LYS B 19  ? 0.4765 0.5263 0.5003 -0.0481 -0.0869 0.0204  315 LYS A CG    
346  C CD    . LYS B 19  ? 0.5161 0.5824 0.5682 -0.0508 -0.0902 0.0169  315 LYS A CD    
347  C CE    . LYS B 19  ? 0.4684 0.5309 0.5335 -0.0489 -0.0747 0.0115  315 LYS A CE    
348  N NZ    . LYS B 19  ? 0.4213 0.4801 0.4935 -0.0383 -0.0659 0.0161  315 LYS A NZ    
349  N N     . ALA B 20  ? 0.2432 0.2536 0.1974 -0.0524 -0.0674 0.0151  316 ALA A N     
350  C CA    . ALA B 20  ? 0.2892 0.2867 0.2272 -0.0556 -0.0545 0.0055  316 ALA A CA    
351  C C     . ALA B 20  ? 0.3142 0.3090 0.2696 -0.0483 -0.0420 0.0040  316 ALA A C     
352  O O     . ALA B 20  ? 0.2781 0.2773 0.2485 -0.0412 -0.0412 0.0107  316 ALA A O     
353  C CB    . ALA B 20  ? 0.2590 0.2467 0.1682 -0.0583 -0.0509 0.0069  316 ALA A CB    
354  N N     . ALA B 21  ? 0.2367 0.2235 0.1893 -0.0503 -0.0327 -0.0051 317 ALA A N     
355  C CA    . ALA B 21  ? 0.2204 0.2025 0.1824 -0.0438 -0.0210 -0.0062 317 ALA A CA    
356  C C     . ALA B 21  ? 0.2347 0.2099 0.1808 -0.0429 -0.0133 -0.0070 317 ALA A C     
357  O O     . ALA B 21  ? 0.2953 0.2642 0.2210 -0.0486 -0.0117 -0.0123 317 ALA A O     
358  C CB    . ALA B 21  ? 0.1995 0.1750 0.1675 -0.0453 -0.0150 -0.0139 317 ALA A CB    
359  N N     . LEU B 22  ? 0.2269 0.2038 0.1819 -0.0366 -0.0079 -0.0025 318 LEU A N     
360  C CA    . LEU B 22  ? 0.2229 0.1959 0.1664 -0.0365 -0.0003 -0.0023 318 LEU A CA    
361  C C     . LEU B 22  ? 0.2323 0.2057 0.1898 -0.0306 0.0093  -0.0046 318 LEU A C     
362  O O     . LEU B 22  ? 0.2401 0.2185 0.2143 -0.0259 0.0077  -0.0013 318 LEU A O     
363  C CB    . LEU B 22  ? 0.2204 0.1959 0.1600 -0.0363 -0.0053 0.0074  318 LEU A CB    
364  C CG    . LEU B 22  ? 0.2097 0.1821 0.1425 -0.0365 0.0039  0.0091  318 LEU A CG    
365  C CD1   . LEU B 22  ? 0.2362 0.2024 0.1424 -0.0437 0.0077  0.0053  318 LEU A CD1   
366  C CD2   . LEU B 22  ? 0.2309 0.2037 0.1670 -0.0350 -0.0006 0.0197  318 LEU A CD2   
367  N N     . VAL B 23  ? 0.2422 0.2114 0.1932 -0.0310 0.0191  -0.0106 319 VAL A N     
368  C CA    . VAL B 23  ? 0.2158 0.1878 0.1816 -0.0252 0.0274  -0.0121 319 VAL A CA    
369  C C     . VAL B 23  ? 0.2539 0.2280 0.2130 -0.0271 0.0350  -0.0115 319 VAL A C     
370  O O     . VAL B 23  ? 0.2694 0.2386 0.2111 -0.0320 0.0407  -0.0161 319 VAL A O     
371  C CB    . VAL B 23  ? 0.2623 0.2285 0.2332 -0.0224 0.0336  -0.0201 319 VAL A CB    
372  C CG1   . VAL B 23  ? 0.2109 0.1822 0.1975 -0.0160 0.0417  -0.0210 319 VAL A CG1   
373  C CG2   . VAL B 23  ? 0.2879 0.2515 0.2671 -0.0212 0.0271  -0.0190 319 VAL A CG2   
374  N N     . VAL B 24  ? 0.2321 0.2130 0.2038 -0.0245 0.0357  -0.0065 320 VAL A N     
375  C CA    . VAL B 24  ? 0.2572 0.2414 0.2273 -0.0270 0.0439  -0.0056 320 VAL A CA    
376  C C     . VAL B 24  ? 0.2959 0.2892 0.2888 -0.0213 0.0488  -0.0081 320 VAL A C     
377  O O     . VAL B 24  ? 0.3013 0.3002 0.3078 -0.0187 0.0436  -0.0041 320 VAL A O     
378  C CB    . VAL B 24  ? 0.2303 0.2137 0.1956 -0.0305 0.0390  0.0033  320 VAL A CB    
379  C CG1   . VAL B 24  ? 0.2437 0.2300 0.2089 -0.0345 0.0487  0.0045  320 VAL A CG1   
380  C CG2   . VAL B 24  ? 0.2473 0.2231 0.1919 -0.0349 0.0315  0.0074  320 VAL A CG2   
381  N N     . GLU B 25  ? 0.3017 0.2966 0.2994 -0.0190 0.0584  -0.0152 321 GLU A N     
382  C CA    . GLU B 25  ? 0.2254 0.2284 0.2467 -0.0114 0.0599  -0.0173 321 GLU A CA    
383  C C     . GLU B 25  ? 0.2178 0.2342 0.2551 -0.0117 0.0655  -0.0164 321 GLU A C     
384  O O     . GLU B 25  ? 0.2339 0.2533 0.2685 -0.0155 0.0765  -0.0199 321 GLU A O     
385  C CB    . GLU B 25  ? 0.2242 0.2218 0.2481 -0.0070 0.0671  -0.0254 321 GLU A CB    
386  C CG    . GLU B 25  ? 0.2465 0.2514 0.2961 0.0024  0.0669  -0.0254 321 GLU A CG    
387  C CD    . GLU B 25  ? 0.3954 0.3946 0.4475 0.0062  0.0559  -0.0205 321 GLU A CD    
388  O OE1   . GLU B 25  ? 0.4439 0.4377 0.4823 0.0014  0.0487  -0.0170 321 GLU A OE1   
389  O OE2   . GLU B 25  ? 0.4075 0.4077 0.4756 0.0139  0.0549  -0.0198 321 GLU A OE2   
390  N N     . VAL B 26  ? 0.2058 0.2310 0.2595 -0.0086 0.0584  -0.0124 322 VAL A N     
391  C CA    . VAL B 26  ? 0.1885 0.2286 0.2608 -0.0094 0.0609  -0.0118 322 VAL A CA    
392  C C     . VAL B 26  ? 0.1837 0.2335 0.2777 -0.0009 0.0566  -0.0122 322 VAL A C     
393  O O     . VAL B 26  ? 0.2042 0.2524 0.2985 0.0020  0.0463  -0.0083 322 VAL A O     
394  C CB    . VAL B 26  ? 0.1651 0.2057 0.2347 -0.0152 0.0544  -0.0066 322 VAL A CB    
395  C CG1   . VAL B 26  ? 0.1620 0.2179 0.2510 -0.0181 0.0575  -0.0073 322 VAL A CG1   
396  C CG2   . VAL B 26  ? 0.2071 0.2347 0.2540 -0.0219 0.0558  -0.0035 322 VAL A CG2   
397  N N     . VAL B 27  ? 0.2227 0.2830 0.3351 0.0035  0.0646  -0.0165 323 VAL A N     
398  C CA    . VAL B 27  ? 0.2436 0.3116 0.3773 0.0135  0.0600  -0.0158 323 VAL A CA    
399  C C     . VAL B 27  ? 0.2281 0.3155 0.3829 0.0137  0.0524  -0.0123 323 VAL A C     
400  O O     . VAL B 27  ? 0.2390 0.3304 0.4023 0.0195  0.0417  -0.0078 323 VAL A O     
401  C CB    . VAL B 27  ? 0.2492 0.3183 0.3955 0.0199  0.0722  -0.0227 323 VAL A CB    
402  C CG1   . VAL B 27  ? 0.3438 0.4206 0.5158 0.0318  0.0668  -0.0204 323 VAL A CG1   
403  C CG2   . VAL B 27  ? 0.3107 0.3586 0.4330 0.0185  0.0778  -0.0272 323 VAL A CG2   
404  N N     . GLU B 28  ? 0.1606 0.2599 0.3229 0.0064  0.0575  -0.0141 324 GLU A N     
405  C CA    . GLU B 28  ? 0.2145 0.3324 0.3957 0.0040  0.0497  -0.0120 324 GLU A CA    
406  C C     . GLU B 28  ? 0.2662 0.3768 0.4329 0.0018  0.0361  -0.0073 324 GLU A C     
407  O O     . GLU B 28  ? 0.2498 0.3441 0.3936 -0.0029 0.0359  -0.0063 324 GLU A O     
408  C CB    . GLU B 28  ? 0.2778 0.4049 0.4648 -0.0065 0.0584  -0.0147 324 GLU A CB    
409  C CG    . GLU B 28  ? 0.5366 0.6758 0.7421 -0.0050 0.0733  -0.0200 324 GLU A CG    
410  C CD    . GLU B 28  ? 0.7244 0.8756 0.9393 -0.0165 0.0826  -0.0220 324 GLU A CD    
411  O OE1   . GLU B 28  ? 0.7268 0.8849 0.9505 -0.0177 0.0983  -0.0267 324 GLU A OE1   
412  O OE2   . GLU B 28  ? 0.7123 0.8653 0.9258 -0.0249 0.0754  -0.0194 324 GLU A OE2   
413  N N     . GLU B 29  ? 0.1933 0.3165 0.3737 0.0057  0.0247  -0.0045 325 GLU A N     
414  C CA    . GLU B 29  ? 0.2910 0.4080 0.4562 0.0036  0.0129  -0.0011 325 GLU A CA    
415  C C     . GLU B 29  ? 0.2440 0.3576 0.3990 -0.0075 0.0134  -0.0036 325 GLU A C     
416  O O     . GLU B 29  ? 0.2212 0.3194 0.3558 -0.0101 0.0116  -0.0028 325 GLU A O     
417  C CB    . GLU B 29  ? 0.4177 0.5508 0.5979 0.0084  0.0002  0.0027  325 GLU A CB    
418  C CG    . GLU B 29  ? 0.7228 0.8799 0.9259 0.0032  -0.0040 0.0002  325 GLU A CG    
419  C CD    . GLU B 29  ? 0.9512 1.1210 1.1777 0.0028  0.0080  -0.0041 325 GLU A CD    
420  O OE1   . GLU B 29  ? 0.9674 1.1441 1.1991 -0.0075 0.0128  -0.0083 325 GLU A OE1   
421  O OE2   . GLU B 29  ? 1.0078 1.1794 1.2470 0.0124  0.0140  -0.0037 325 GLU A OE2   
422  N N     . ASN B 30  ? 0.1820 0.3092 0.3527 -0.0142 0.0165  -0.0068 326 ASN A N     
423  C CA    . ASN B 30  ? 0.2206 0.3413 0.3831 -0.0252 0.0189  -0.0091 326 ASN A CA    
424  C C     . ASN B 30  ? 0.1657 0.2723 0.3167 -0.0280 0.0314  -0.0088 326 ASN A C     
425  O O     . ASN B 30  ? 0.1681 0.2827 0.3304 -0.0301 0.0412  -0.0103 326 ASN A O     
426  C CB    . ASN B 30  ? 0.1874 0.3280 0.3719 -0.0329 0.0171  -0.0126 326 ASN A CB    
427  C CG    . ASN B 30  ? 0.2551 0.3862 0.4311 -0.0448 0.0180  -0.0154 326 ASN A CG    
428  O OD1   . ASN B 30  ? 0.2116 0.3251 0.3736 -0.0484 0.0263  -0.0141 326 ASN A OD1   
429  N ND2   . ASN B 30  ? 0.2015 0.3429 0.3849 -0.0509 0.0088  -0.0190 326 ASN A ND2   
430  N N     . TYR B 31  ? 0.1120 0.1988 0.2406 -0.0285 0.0311  -0.0067 327 TYR A N     
431  C CA    . TYR B 31  ? 0.1721 0.2454 0.2866 -0.0304 0.0404  -0.0049 327 TYR A CA    
432  C C     . TYR B 31  ? 0.1763 0.2444 0.2883 -0.0406 0.0466  -0.0040 327 TYR A C     
433  O O     . TYR B 31  ? 0.1804 0.2369 0.2780 -0.0431 0.0537  -0.0011 327 TYR A O     
434  C CB    . TYR B 31  ? 0.1421 0.1982 0.2360 -0.0265 0.0363  -0.0021 327 TYR A CB    
435  C CG    . TYR B 31  ? 0.1735 0.2232 0.2619 -0.0273 0.0280  -0.0016 327 TYR A CG    
436  C CD1   . TYR B 31  ? 0.2259 0.2671 0.3106 -0.0339 0.0285  -0.0012 327 TYR A CD1   
437  C CD2   . TYR B 31  ? 0.1584 0.2087 0.2442 -0.0216 0.0209  -0.0017 327 TYR A CD2   
438  C CE1   . TYR B 31  ? 0.2933 0.3276 0.3738 -0.0341 0.0228  -0.0025 327 TYR A CE1   
439  C CE2   . TYR B 31  ? 0.1749 0.2196 0.2545 -0.0227 0.0155  -0.0025 327 TYR A CE2   
440  C CZ    . TYR B 31  ? 0.2442 0.2814 0.3220 -0.0285 0.0168  -0.0037 327 TYR A CZ    
441  O OH    . TYR B 31  ? 0.2292 0.2603 0.3019 -0.0290 0.0132  -0.0062 327 TYR A OH    
442  N N     . HIS B 32  ? 0.1832 0.2586 0.3078 -0.0474 0.0441  -0.0061 328 HIS A N     
443  C CA    . HIS B 32  ? 0.1850 0.2525 0.3078 -0.0582 0.0504  -0.0047 328 HIS A CA    
444  C C     . HIS B 32  ? 0.1710 0.2472 0.3015 -0.0632 0.0631  -0.0044 328 HIS A C     
445  O O     . HIS B 32  ? 0.1637 0.2614 0.3170 -0.0636 0.0655  -0.0085 328 HIS A O     
446  C CB    . HIS B 32  ? 0.1686 0.2416 0.3040 -0.0653 0.0446  -0.0089 328 HIS A CB    
447  C CG    . HIS B 32  ? 0.1529 0.2113 0.2760 -0.0635 0.0362  -0.0097 328 HIS A CG    
448  N ND1   . HIS B 32  ? 0.1975 0.2333 0.3047 -0.0642 0.0381  -0.0057 328 HIS A ND1   
449  C CD2   . HIS B 32  ? 0.2268 0.2902 0.3509 -0.0605 0.0266  -0.0141 328 HIS A CD2   
450  C CE1   . HIS B 32  ? 0.2353 0.2634 0.3371 -0.0614 0.0311  -0.0086 328 HIS A CE1   
451  N NE2   . HIS B 32  ? 0.2155 0.2598 0.3254 -0.0597 0.0246  -0.0140 328 HIS A NE2   
452  N N     . ASP B 33  ? 0.1629 0.2232 0.2748 -0.0672 0.0712  0.0007  329 ASP A N     
453  C CA    . ASP B 33  ? 0.1755 0.2414 0.2888 -0.0734 0.0857  0.0013  329 ASP A CA    
454  C C     . ASP B 33  ? 0.1698 0.2507 0.2915 -0.0654 0.0910  -0.0036 329 ASP A C     
455  O O     . ASP B 33  ? 0.1827 0.2781 0.3185 -0.0689 0.1029  -0.0069 329 ASP A O     
456  C CB    . ASP B 33  ? 0.1816 0.2590 0.3155 -0.0851 0.0918  -0.0005 329 ASP A CB    
457  C CG    . ASP B 33  ? 0.2196 0.2889 0.3413 -0.0946 0.1053  0.0045  329 ASP A CG    
458  O OD1   . ASP B 33  ? 0.2167 0.2698 0.3125 -0.0943 0.1102  0.0099  329 ASP A OD1   
459  O OD2   . ASP B 33  ? 0.2137 0.2928 0.3491 -0.1014 0.1089  0.0036  329 ASP A OD2   
460  N N     . ALA B 34  ? 0.2087 0.2856 0.3232 -0.0549 0.0832  -0.0045 330 ALA A N     
461  C CA    . ALA B 34  ? 0.2661 0.3544 0.3907 -0.0459 0.0867  -0.0095 330 ALA A CA    
462  C C     . ALA B 34  ? 0.2124 0.2873 0.3132 -0.0447 0.0951  -0.0098 330 ALA A C     
463  O O     . ALA B 34  ? 0.2147 0.2712 0.2893 -0.0478 0.0923  -0.0048 330 ALA A O     
464  C CB    . ALA B 34  ? 0.1393 0.2300 0.2703 -0.0357 0.0729  -0.0101 330 ALA A CB    
465  N N     . PRO B 35  ? 0.2645 0.3482 0.3740 -0.0400 0.1049  -0.0159 331 PRO A N     
466  C CA    . PRO B 35  ? 0.2287 0.2992 0.3130 -0.0406 0.1140  -0.0182 331 PRO A CA    
467  C C     . PRO B 35  ? 0.2622 0.3167 0.3274 -0.0346 0.1031  -0.0170 331 PRO A C     
468  O O     . PRO B 35  ? 0.2680 0.3245 0.3445 -0.0267 0.0922  -0.0167 331 PRO A O     
469  C CB    . PRO B 35  ? 0.2457 0.3309 0.3503 -0.0355 0.1275  -0.0273 331 PRO A CB    
470  C CG    . PRO B 35  ? 0.2805 0.3893 0.4220 -0.0346 0.1268  -0.0279 331 PRO A CG    
471  C CD    . PRO B 35  ? 0.2451 0.3515 0.3886 -0.0340 0.1086  -0.0215 331 PRO A CD    
472  N N     . ILE B 36  ? 0.2646 0.3035 0.2995 -0.0394 0.1057  -0.0157 332 ILE A N     
473  C CA    . ILE B 36  ? 0.2365 0.2621 0.2537 -0.0351 0.0981  -0.0167 332 ILE A CA    
474  C C     . ILE B 36  ? 0.2834 0.3084 0.2971 -0.0327 0.1103  -0.0268 332 ILE A C     
475  O O     . ILE B 36  ? 0.3088 0.3326 0.3084 -0.0394 0.1235  -0.0301 332 ILE A O     
476  C CB    . ILE B 36  ? 0.2659 0.2762 0.2534 -0.0418 0.0914  -0.0094 332 ILE A CB    
477  C CG1   . ILE B 36  ? 0.3057 0.3151 0.3002 -0.0425 0.0803  -0.0008 332 ILE A CG1   
478  C CG2   . ILE B 36  ? 0.2246 0.2236 0.1938 -0.0393 0.0848  -0.0120 332 ILE A CG2   
479  C CD1   . ILE B 36  ? 0.3846 0.3803 0.3552 -0.0486 0.0749  0.0081  332 ILE A CD1   
480  N N     . VAL B 37  ? 0.2792 0.3041 0.3057 -0.0233 0.1072  -0.0319 333 VAL A N     
481  C CA    . VAL B 37  ? 0.2872 0.3112 0.3168 -0.0194 0.1200  -0.0429 333 VAL A CA    
482  C C     . VAL B 37  ? 0.2853 0.2911 0.2850 -0.0226 0.1201  -0.0480 333 VAL A C     
483  O O     . VAL B 37  ? 0.3329 0.3343 0.3278 -0.0219 0.1328  -0.0589 333 VAL A O     
484  C CB    . VAL B 37  ? 0.3218 0.3534 0.3831 -0.0069 0.1176  -0.0457 333 VAL A CB    
485  C CG1   . VAL B 37  ? 0.3421 0.3938 0.4332 -0.0044 0.1142  -0.0404 333 VAL A CG1   
486  C CG2   . VAL B 37  ? 0.2938 0.3131 0.3491 -0.0025 0.1035  -0.0423 333 VAL A CG2   
487  N N     . GLY B 38  ? 0.2496 0.2454 0.2304 -0.0261 0.1064  -0.0416 334 GLY A N     
488  C CA    . GLY B 38  ? 0.2594 0.2402 0.2146 -0.0297 0.1044  -0.0468 334 GLY A CA    
489  C C     . GLY B 38  ? 0.2504 0.2256 0.1941 -0.0323 0.0873  -0.0379 334 GLY A C     
490  O O     . GLY B 38  ? 0.2570 0.2381 0.2157 -0.0289 0.0778  -0.0294 334 GLY A O     
491  N N     . ILE B 39  ? 0.3151 0.2794 0.2322 -0.0387 0.0837  -0.0407 335 ILE A N     
492  C CA    . ILE B 39  ? 0.2654 0.2262 0.1711 -0.0421 0.0677  -0.0324 335 ILE A CA    
493  C C     . ILE B 39  ? 0.3614 0.3127 0.2556 -0.0443 0.0629  -0.0400 335 ILE A C     
494  O O     . ILE B 39  ? 0.3157 0.2594 0.1914 -0.0492 0.0711  -0.0503 335 ILE A O     
495  C CB    . ILE B 39  ? 0.3012 0.2607 0.1827 -0.0504 0.0652  -0.0244 335 ILE A CB    
496  C CG1   . ILE B 39  ? 0.3601 0.3274 0.2558 -0.0491 0.0693  -0.0163 335 ILE A CG1   
497  C CG2   . ILE B 39  ? 0.2951 0.2511 0.1647 -0.0534 0.0483  -0.0171 335 ILE A CG2   
498  C CD1   . ILE B 39  ? 0.4127 0.3761 0.2865 -0.0570 0.0678  -0.0065 335 ILE A CD1   
499  N N     . ALA B 40  ? 0.2615 0.2131 0.1663 -0.0418 0.0507  -0.0359 336 ALA A N     
500  C CA    . ALA B 40  ? 0.2935 0.2368 0.1882 -0.0460 0.0447  -0.0422 336 ALA A CA    
501  C C     . ALA B 40  ? 0.2843 0.2319 0.1749 -0.0495 0.0286  -0.0332 336 ALA A C     
502  O O     . ALA B 40  ? 0.2563 0.2116 0.1622 -0.0450 0.0225  -0.0233 336 ALA A O     
503  C CB    . ALA B 40  ? 0.2636 0.2022 0.1789 -0.0397 0.0474  -0.0478 336 ALA A CB    
504  N N     . VAL B 41  ? 0.3175 0.2606 0.1876 -0.0579 0.0220  -0.0373 337 VAL A N     
505  C CA    . VAL B 41  ? 0.3099 0.2586 0.1777 -0.0616 0.0056  -0.0300 337 VAL A CA    
506  C C     . VAL B 41  ? 0.3368 0.2812 0.2047 -0.0668 0.0009  -0.0391 337 VAL A C     
507  O O     . VAL B 41  ? 0.3472 0.2816 0.1971 -0.0731 0.0066  -0.0510 337 VAL A O     
508  C CB    . VAL B 41  ? 0.3834 0.3327 0.2237 -0.0687 -0.0009 -0.0242 337 VAL A CB    
509  C CG1   . VAL B 41  ? 0.3275 0.2842 0.1680 -0.0720 -0.0196 -0.0169 337 VAL A CG1   
510  C CG2   . VAL B 41  ? 0.3474 0.2990 0.1885 -0.0647 0.0047  -0.0145 337 VAL A CG2   
511  N N     . VAL B 42  ? 0.2869 0.2381 0.1746 -0.0650 -0.0086 -0.0344 338 VAL A N     
512  C CA    . VAL B 42  ? 0.2884 0.2377 0.1772 -0.0722 -0.0152 -0.0415 338 VAL A CA    
513  C C     . VAL B 42  ? 0.2990 0.2622 0.1926 -0.0753 -0.0319 -0.0329 338 VAL A C     
514  O O     . VAL B 42  ? 0.2828 0.2561 0.1956 -0.0683 -0.0358 -0.0225 338 VAL A O     
515  C CB    . VAL B 42  ? 0.3236 0.2678 0.2350 -0.0679 -0.0087 -0.0449 338 VAL A CB    
516  C CG1   . VAL B 42  ? 0.2793 0.2245 0.1975 -0.0760 -0.0171 -0.0490 338 VAL A CG1   
517  C CG2   . VAL B 42  ? 0.3277 0.2567 0.2337 -0.0653 0.0062  -0.0548 338 VAL A CG2   
518  N N     . ASN B 43  ? 0.3394 0.3036 0.2161 -0.0857 -0.0420 -0.0375 339 ASN A N     
519  C CA    . ASN B 43  ? 0.3301 0.3099 0.2144 -0.0885 -0.0596 -0.0294 339 ASN A CA    
520  C C     . ASN B 43  ? 0.3870 0.3673 0.2642 -0.1011 -0.0682 -0.0397 339 ASN A C     
521  O O     . ASN B 43  ? 0.3630 0.3294 0.2315 -0.1066 -0.0591 -0.0529 339 ASN A O     
522  C CB    . ASN B 43  ? 0.3599 0.3444 0.2273 -0.0872 -0.0677 -0.0181 339 ASN A CB    
523  C CG    . ASN B 43  ? 0.4293 0.4034 0.2571 -0.0961 -0.0659 -0.0242 339 ASN A CG    
524  O OD1   . ASN B 43  ? 0.4184 0.3873 0.2299 -0.1064 -0.0675 -0.0363 339 ASN A OD1   
525  N ND2   . ASN B 43  ? 0.4090 0.3792 0.2205 -0.0931 -0.0617 -0.0163 339 ASN A ND2   
526  N N     . GLU B 44  ? 0.3846 0.3810 0.2671 -0.1057 -0.0861 -0.0339 340 GLU A N     
527  C CA    . GLU B 44  ? 0.4612 0.4615 0.3403 -0.1190 -0.0966 -0.0434 340 GLU A CA    
528  C C     . GLU B 44  ? 0.4710 0.4570 0.3105 -0.1304 -0.0954 -0.0559 340 GLU A C     
529  O O     . GLU B 44  ? 0.5652 0.5485 0.4005 -0.1414 -0.0987 -0.0679 340 GLU A O     
530  C CB    . GLU B 44  ? 0.5656 0.5894 0.4589 -0.1207 -0.1179 -0.0333 340 GLU A CB    
531  C CG    . GLU B 44  ? 0.7758 0.8034 0.6455 -0.1191 -0.1293 -0.0222 340 GLU A CG    
532  C CD    . GLU B 44  ? 0.9853 1.0315 0.8601 -0.1226 -0.1494 -0.0169 340 GLU A CD    
533  O OE1   . GLU B 44  ? 1.0829 1.1254 0.9354 -0.1313 -0.1529 -0.0254 340 GLU A OE1   
534  O OE2   . GLU B 44  ? 1.0393 1.1034 0.9430 -0.1146 -0.1597 -0.0047 340 GLU A OE2   
535  N N     . HIS B 45  ? 0.5131 0.4902 0.3246 -0.1279 -0.0892 -0.0535 341 HIS A N     
536  C CA    . HIS B 45  ? 0.5211 0.4856 0.2947 -0.1379 -0.0857 -0.0652 341 HIS A CA    
537  C C     . HIS B 45  ? 0.5489 0.4921 0.3132 -0.1375 -0.0637 -0.0801 341 HIS A C     
538  O O     . HIS B 45  ? 0.6082 0.5407 0.3500 -0.1426 -0.0565 -0.0912 341 HIS A O     
539  C CB    . HIS B 45  ? 0.5185 0.4855 0.2650 -0.1364 -0.0902 -0.0541 341 HIS A CB    
540  C CG    . HIS B 45  ? 0.6926 0.6789 0.4490 -0.1345 -0.1116 -0.0382 341 HIS A CG    
541  N ND1   . HIS B 45  ? 0.7221 0.7150 0.4842 -0.1260 -0.1172 -0.0206 341 HIS A ND1   
542  C CD2   . HIS B 45  ? 0.7314 0.7316 0.4958 -0.1389 -0.1282 -0.0374 341 HIS A CD2   
543  C CE1   . HIS B 45  ? 0.7568 0.7661 0.5312 -0.1242 -0.1359 -0.0093 341 HIS A CE1   
544  N NE2   . HIS B 45  ? 0.7715 0.7868 0.5475 -0.1320 -0.1431 -0.0194 341 HIS A NE2   
545  N N     . GLY B 46  ? 0.5096 0.4488 0.3002 -0.1261 -0.0507 -0.0776 342 GLY A N     
546  C CA    . GLY B 46  ? 0.4644 0.3848 0.2539 -0.1235 -0.0310 -0.0906 342 GLY A CA    
547  C C     . GLY B 46  ? 0.4709 0.3911 0.2802 -0.1087 -0.0181 -0.0821 342 GLY A C     
548  O O     . GLY B 46  ? 0.3811 0.3141 0.2116 -0.1006 -0.0239 -0.0680 342 GLY A O     
549  N N     . ARG B 47  ? 0.4244 0.3300 0.2275 -0.1054 -0.0003 -0.0922 343 ARG A N     
550  C CA    . ARG B 47  ? 0.4699 0.3749 0.2938 -0.0919 0.0126  -0.0869 343 ARG A CA    
551  C C     . ARG B 47  ? 0.4216 0.3221 0.2249 -0.0911 0.0259  -0.0912 343 ARG A C     
552  O O     . ARG B 47  ? 0.4266 0.3146 0.2082 -0.0977 0.0350  -0.1061 343 ARG A O     
553  C CB    . ARG B 47  ? 0.4471 0.3397 0.2930 -0.0869 0.0219  -0.0943 343 ARG A CB    
554  C CG    . ARG B 47  ? 0.4784 0.3720 0.3394 -0.0917 0.0111  -0.0932 343 ARG A CG    
555  C CD    . ARG B 47  ? 0.5335 0.4157 0.4184 -0.0847 0.0198  -0.0947 343 ARG A CD    
556  N NE    . ARG B 47  ? 0.5223 0.4028 0.4184 -0.0921 0.0116  -0.0955 343 ARG A NE    
557  C CZ    . ARG B 47  ? 0.5420 0.4073 0.4303 -0.1025 0.0127  -0.1089 343 ARG A CZ    
558  N NH1   . ARG B 47  ? 0.6219 0.4712 0.4898 -0.1060 0.0221  -0.1239 343 ARG A NH1   
559  N NH2   . ARG B 47  ? 0.6611 0.5270 0.5627 -0.1100 0.0053  -0.1083 343 ARG A NH2   
560  N N     . PHE B 48  ? 0.4021 0.3123 0.2125 -0.0836 0.0283  -0.0792 344 PHE A N     
561  C CA    . PHE B 48  ? 0.3937 0.3028 0.1833 -0.0850 0.0396  -0.0807 344 PHE A CA    
562  C C     . PHE B 48  ? 0.4041 0.3176 0.2178 -0.0735 0.0522  -0.0763 344 PHE A C     
563  O O     . PHE B 48  ? 0.3793 0.3017 0.2177 -0.0658 0.0462  -0.0649 344 PHE A O     
564  C CB    . PHE B 48  ? 0.4028 0.3201 0.1707 -0.0911 0.0276  -0.0684 344 PHE A CB    
565  C CG    . PHE B 48  ? 0.5053 0.4224 0.2518 -0.1022 0.0115  -0.0703 344 PHE A CG    
566  C CD1   . PHE B 48  ? 0.4072 0.3346 0.1703 -0.1013 -0.0067 -0.0603 344 PHE A CD1   
567  C CD2   . PHE B 48  ? 0.5203 0.4283 0.2307 -0.1139 0.0148  -0.0828 344 PHE A CD2   
568  C CE1   . PHE B 48  ? 0.4743 0.4048 0.2210 -0.1117 -0.0230 -0.0618 344 PHE A CE1   
569  C CE2   . PHE B 48  ? 0.5557 0.4656 0.2473 -0.1247 -0.0020 -0.0842 344 PHE A CE2   
570  C CZ    . PHE B 48  ? 0.5048 0.4264 0.2142 -0.1242 -0.0217 -0.0740 344 PHE A CZ    
571  N N     . PHE B 49  ? 0.4005 0.3090 0.2074 -0.0727 0.0698  -0.0860 345 PHE A N     
572  C CA    . PHE B 49  ? 0.4265 0.3427 0.2552 -0.0634 0.0812  -0.0817 345 PHE A CA    
573  C C     . PHE B 49  ? 0.4198 0.3395 0.2250 -0.0696 0.0898  -0.0798 345 PHE A C     
574  O O     . PHE B 49  ? 0.4524 0.3642 0.2283 -0.0782 0.0983  -0.0905 345 PHE A O     
575  C CB    . PHE B 49  ? 0.4523 0.3623 0.3021 -0.0551 0.0960  -0.0937 345 PHE A CB    
576  C CG    . PHE B 49  ? 0.4299 0.3502 0.2999 -0.0472 0.1090  -0.0914 345 PHE A CG    
577  C CD1   . PHE B 49  ? 0.3961 0.3167 0.2530 -0.0506 0.1264  -0.1003 345 PHE A CD1   
578  C CD2   . PHE B 49  ? 0.3758 0.3069 0.2780 -0.0372 0.1041  -0.0809 345 PHE A CD2   
579  C CE1   . PHE B 49  ? 0.4611 0.3942 0.3401 -0.0441 0.1385  -0.0983 345 PHE A CE1   
580  C CE2   . PHE B 49  ? 0.3383 0.2811 0.2609 -0.0309 0.1146  -0.0792 345 PHE A CE2   
581  C CZ    . PHE B 49  ? 0.3929 0.3376 0.3059 -0.0343 0.1319  -0.0878 345 PHE A CZ    
582  N N     . LEU B 50  ? 0.4090 0.3394 0.2258 -0.0663 0.0882  -0.0665 346 LEU A N     
583  C CA    . LEU B 50  ? 0.4400 0.3736 0.2373 -0.0727 0.0963  -0.0618 346 LEU A CA    
584  C C     . LEU B 50  ? 0.4059 0.3492 0.2302 -0.0658 0.1109  -0.0615 346 LEU A C     
585  O O     . LEU B 50  ? 0.4590 0.4102 0.3154 -0.0567 0.1060  -0.0558 346 LEU A O     
586  C CB    . LEU B 50  ? 0.4264 0.3625 0.2118 -0.0768 0.0802  -0.0448 346 LEU A CB    
587  C CG    . LEU B 50  ? 0.5148 0.4445 0.2722 -0.0848 0.0648  -0.0438 346 LEU A CG    
588  C CD1   . LEU B 50  ? 0.5740 0.5087 0.3382 -0.0830 0.0456  -0.0271 346 LEU A CD1   
589  C CD2   . LEU B 50  ? 0.6643 0.5872 0.3790 -0.0968 0.0716  -0.0474 346 LEU A CD2   
590  N N     . ARG B 51  ? 0.4437 0.3876 0.2552 -0.0706 0.1289  -0.0684 347 ARG A N     
591  C CA    . ARG B 51  ? 0.4264 0.3829 0.2625 -0.0666 0.1415  -0.0658 347 ARG A CA    
592  C C     . ARG B 51  ? 0.4553 0.4165 0.2888 -0.0707 0.1324  -0.0485 347 ARG A C     
593  O O     . ARG B 51  ? 0.4624 0.4160 0.2638 -0.0797 0.1254  -0.0406 347 ARG A O     
594  C CB    . ARG B 51  ? 0.4433 0.4015 0.2736 -0.0697 0.1588  -0.0750 347 ARG A CB    
595  C CG    . ARG B 51  ? 0.5002 0.4561 0.3482 -0.0618 0.1680  -0.0907 347 ARG A CG    
596  C CD    . ARG B 51  ? 0.6131 0.5665 0.4455 -0.0668 0.1811  -0.0999 347 ARG A CD    
597  N NE    . ARG B 51  ? 0.7037 0.6484 0.5415 -0.0620 0.1869  -0.1151 347 ARG A NE    
598  C CZ    . ARG B 51  ? 0.9002 0.8309 0.7080 -0.0690 0.1847  -0.1234 347 ARG A CZ    
599  N NH1   . ARG B 51  ? 0.9217 0.8470 0.6918 -0.0808 0.1755  -0.1172 347 ARG A NH1   
600  N NH2   . ARG B 51  ? 0.9723 0.8942 0.7886 -0.0642 0.1908  -0.1372 347 ARG A NH2   
601  N N     . PRO B 52  ? 0.4768 0.4495 0.3434 -0.0642 0.1313  -0.0422 348 PRO A N     
602  C CA    . PRO B 52  ? 0.5120 0.4862 0.3785 -0.0675 0.1215  -0.0266 348 PRO A CA    
603  C C     . PRO B 52  ? 0.5235 0.4952 0.3660 -0.0789 0.1317  -0.0206 348 PRO A C     
604  O O     . PRO B 52  ? 0.5627 0.5268 0.3873 -0.0843 0.1216  -0.0074 348 PRO A O     
605  C CB    . PRO B 52  ? 0.5498 0.5375 0.4575 -0.0590 0.1211  -0.0253 348 PRO A CB    
606  C CG    . PRO B 52  ? 0.5730 0.5692 0.4999 -0.0535 0.1362  -0.0387 348 PRO A CG    
607  C CD    . PRO B 52  ? 0.5212 0.5052 0.4271 -0.0533 0.1369  -0.0486 348 PRO A CD    
608  N N     . GLU B 53  ? 0.5266 0.5046 0.3722 -0.0811 0.1497  -0.0291 349 GLU A N     
609  C CA    . GLU B 53  ? 0.7317 0.7080 0.5598 -0.0898 0.1555  -0.0227 349 GLU A CA    
610  C C     . GLU B 53  ? 0.7104 0.6718 0.4948 -0.0975 0.1474  -0.0178 349 GLU A C     
611  O O     . GLU B 53  ? 0.7393 0.6947 0.5052 -0.1043 0.1430  -0.0047 349 GLU A O     
612  C CB    . GLU B 53  ? 0.8779 0.8647 0.7206 -0.0886 0.1732  -0.0339 349 GLU A CB    
613  C CG    . GLU B 53  ? 1.0030 1.0060 0.8911 -0.0783 0.1789  -0.0415 349 GLU A CG    
614  C CD    . GLU B 53  ? 1.0802 1.0813 0.9786 -0.0688 0.1774  -0.0534 349 GLU A CD    
615  O OE1   . GLU B 53  ? 1.1130 1.1255 1.0434 -0.0600 0.1849  -0.0619 349 GLU A OE1   
616  O OE2   . GLU B 53  ? 1.0722 1.0601 0.9474 -0.0699 0.1681  -0.0537 349 GLU A OE2   
617  N N     . THR B 54  ? 0.7059 0.6611 0.4749 -0.0965 0.1440  -0.0277 350 THR A N     
618  C CA    . THR B 54  ? 0.7379 0.6811 0.4678 -0.1036 0.1325  -0.0234 350 THR A CA    
619  C C     . THR B 54  ? 0.6133 0.5512 0.3369 -0.1038 0.1128  -0.0080 350 THR A C     
620  O O     . THR B 54  ? 0.6127 0.5453 0.3197 -0.1087 0.1050  0.0067  350 THR A O     
621  C CB    . THR B 54  ? 0.7781 0.7165 0.4978 -0.1027 0.1325  -0.0391 350 THR A CB    
622  O OG1   . THR B 54  ? 0.8459 0.7878 0.5723 -0.1019 0.1509  -0.0530 350 THR A OG1   
623  C CG2   . THR B 54  ? 0.8083 0.7367 0.4898 -0.1107 0.1181  -0.0348 350 THR A CG2   
624  N N     . ALA B 55  ? 0.5157 0.4546 0.2540 -0.0979 0.1048  -0.0111 351 ALA A N     
625  C CA    . ALA B 55  ? 0.4845 0.4206 0.2252 -0.0948 0.0823  0.0016  351 ALA A CA    
626  C C     . ALA B 55  ? 0.4772 0.4127 0.2266 -0.0948 0.0781  0.0185  351 ALA A C     
627  O O     . ALA B 55  ? 0.5401 0.4685 0.2732 -0.0973 0.0637  0.0325  351 ALA A O     
628  C CB    . ALA B 55  ? 0.5014 0.4432 0.2748 -0.0839 0.0737  -0.0048 351 ALA A CB    
629  N N     . LEU B 56  ? 0.4063 0.3489 0.1822 -0.0920 0.0902  0.0175  352 LEU A N     
630  C CA    . LEU B 56  ? 0.5203 0.4612 0.3092 -0.0919 0.0861  0.0315  352 LEU A CA    
631  C C     . LEU B 56  ? 0.5745 0.5069 0.3371 -0.1024 0.0929  0.0423  352 LEU A C     
632  O O     . LEU B 56  ? 0.6050 0.5317 0.3740 -0.1031 0.0880  0.0555  352 LEU A O     
633  C CB    . LEU B 56  ? 0.4441 0.3970 0.2727 -0.0860 0.0944  0.0258  352 LEU A CB    
634  C CG    . LEU B 56  ? 0.5108 0.4710 0.3673 -0.0745 0.0847  0.0188  352 LEU A CG    
635  C CD1   . LEU B 56  ? 0.5317 0.5032 0.4245 -0.0694 0.0888  0.0165  352 LEU A CD1   
636  C CD2   . LEU B 56  ? 0.4655 0.4187 0.3179 -0.0708 0.0651  0.0276  352 LEU A CD2   
637  N N     . ALA B 57  ? 0.5076 0.4401 0.2487 -0.1072 0.1013  0.0357  353 ALA A N     
638  C CA    . ALA B 57  ? 0.5692 0.4944 0.2865 -0.1142 0.1024  0.0461  353 ALA A CA    
639  C C     . ALA B 57  ? 0.6642 0.5794 0.3483 -0.1167 0.0859  0.0540  353 ALA A C     
640  O O     . ALA B 57  ? 0.7769 0.6848 0.4393 -0.1219 0.0840  0.0650  353 ALA A O     
641  C CB    . ALA B 57  ? 0.5669 0.4984 0.2792 -0.1190 0.1221  0.0350  353 ALA A CB    
642  N N     . ASP B 58  ? 0.6569 0.5726 0.3377 -0.1133 0.0736  0.0489  354 ASP A N     
643  C CA    . ASP B 58  ? 0.6469 0.5567 0.3003 -0.1156 0.0560  0.0551  354 ASP A CA    
644  C C     . ASP B 58  ? 0.6523 0.5568 0.3128 -0.1111 0.0370  0.0737  354 ASP A C     
645  O O     . ASP B 58  ? 0.5999 0.5071 0.2833 -0.1046 0.0291  0.0745  354 ASP A O     
646  C CB    . ASP B 58  ? 0.6727 0.5865 0.3223 -0.1146 0.0505  0.0408  354 ASP A CB    
647  C CG    . ASP B 58  ? 0.8417 0.7525 0.4664 -0.1177 0.0310  0.0462  354 ASP A CG    
648  O OD1   . ASP B 58  ? 0.9399 0.8487 0.5380 -0.1245 0.0346  0.0397  354 ASP A OD1   
649  O OD2   . ASP B 58  ? 0.8250 0.7364 0.4583 -0.1132 0.0120  0.0570  354 ASP A OD2   
650  N N     . PRO B 59  ? 0.7578 0.6545 0.4007 -0.1135 0.0292  0.0888  355 PRO A N     
651  C CA    . PRO B 59  ? 0.5473 0.4383 0.2022 -0.1071 0.0118  0.1064  355 PRO A CA    
652  C C     . PRO B 59  ? 0.5860 0.4821 0.2492 -0.1011 -0.0084 0.1066  355 PRO A C     
653  O O     . PRO B 59  ? 0.6037 0.4991 0.2922 -0.0932 -0.0180 0.1145  355 PRO A O     
654  C CB    . PRO B 59  ? 0.6944 0.5762 0.3231 -0.1113 0.0077  0.1207  355 PRO A CB    
655  C CG    . PRO B 59  ? 0.7151 0.5993 0.3144 -0.1206 0.0197  0.1097  355 PRO A CG    
656  C CD    . PRO B 59  ? 0.7171 0.6094 0.3317 -0.1216 0.0383  0.0911  355 PRO A CD    
657  N N     . GLN B 60  ? 0.5441 0.4459 0.1890 -0.1047 -0.0150 0.0974  356 GLN A N     
658  C CA    . GLN B 60  ? 0.5918 0.5011 0.2482 -0.0998 -0.0341 0.0966  356 GLN A CA    
659  C C     . GLN B 60  ? 0.5427 0.4576 0.2264 -0.0950 -0.0299 0.0873  356 GLN A C     
660  O O     . GLN B 60  ? 0.4996 0.4189 0.2068 -0.0875 -0.0436 0.0931  356 GLN A O     
661  C CB    . GLN B 60  ? 0.6598 0.5741 0.2921 -0.1063 -0.0405 0.0864  356 GLN A CB    
662  C CG    . GLN B 60  ? 0.8387 0.7503 0.4473 -0.1093 -0.0535 0.0984  356 GLN A CG    
663  C CD    . GLN B 60  ? 1.0263 0.9285 0.6090 -0.1161 -0.0384 0.1016  356 GLN A CD    
664  O OE1   . GLN B 60  ? 1.0940 0.9953 0.6660 -0.1221 -0.0196 0.0877  356 GLN A OE1   
665  N NE2   . GLN B 60  ? 1.1044 0.9995 0.6791 -0.1146 -0.0458 0.1200  356 GLN A NE2   
666  N N     . PHE B 61  ? 0.4755 0.3912 0.1584 -0.0984 -0.0106 0.0726  357 PHE A N     
667  C CA    . PHE B 61  ? 0.4537 0.3779 0.1751 -0.0895 -0.0053 0.0611  357 PHE A CA    
668  C C     . PHE B 61  ? 0.4537 0.3776 0.2069 -0.0810 -0.0062 0.0708  357 PHE A C     
669  O O     . PHE B 61  ? 0.3787 0.3091 0.1618 -0.0721 -0.0148 0.0700  357 PHE A O     
670  C CB    . PHE B 61  ? 0.4269 0.3533 0.1492 -0.0920 0.0159  0.0443  357 PHE A CB    
671  C CG    . PHE B 61  ? 0.5080 0.4429 0.2660 -0.0830 0.0185  0.0323  357 PHE A CG    
672  C CD1   . PHE B 61  ? 0.4694 0.4086 0.2584 -0.0761 0.0271  0.0318  357 PHE A CD1   
673  C CD2   . PHE B 61  ? 0.5566 0.4950 0.3166 -0.0820 0.0109  0.0225  357 PHE A CD2   
674  C CE1   . PHE B 61  ? 0.4507 0.3974 0.2698 -0.0680 0.0279  0.0225  357 PHE A CE1   
675  C CE2   . PHE B 61  ? 0.5480 0.4924 0.3391 -0.0742 0.0130  0.0133  357 PHE A CE2   
676  C CZ    . PHE B 61  ? 0.3805 0.3289 0.2001 -0.0669 0.0213  0.0140  357 PHE A CZ    
677  N N     . VAL B 62  ? 0.4828 0.3984 0.2288 -0.0847 0.0033  0.0796  358 VAL A N     
678  C CA    . VAL B 62  ? 0.4777 0.3906 0.2521 -0.0784 0.0037  0.0874  358 VAL A CA    
679  C C     . VAL B 62  ? 0.4496 0.3589 0.2332 -0.0716 -0.0158 0.1011  358 VAL A C     
680  O O     . VAL B 62  ? 0.4923 0.4047 0.3083 -0.0625 -0.0196 0.1007  358 VAL A O     
681  C CB    . VAL B 62  ? 0.5528 0.4562 0.3149 -0.0862 0.0181  0.0944  358 VAL A CB    
682  C CG1   . VAL B 62  ? 0.4821 0.3770 0.2652 -0.0819 0.0146  0.1063  358 VAL A CG1   
683  C CG2   . VAL B 62  ? 0.5259 0.4382 0.2972 -0.0890 0.0382  0.0788  358 VAL A CG2   
684  N N     . ALA B 63  ? 0.4428 0.3460 0.1984 -0.0757 -0.0286 0.1134  359 ALA A N     
685  C CA    . ALA B 63  ? 0.4381 0.3404 0.2056 -0.0680 -0.0488 0.1265  359 ALA A CA    
686  C C     . ALA B 63  ? 0.4594 0.3773 0.2543 -0.0600 -0.0578 0.1158  359 ALA A C     
687  O O     . ALA B 63  ? 0.4102 0.3311 0.2354 -0.0501 -0.0660 0.1200  359 ALA A O     
688  C CB    . ALA B 63  ? 0.4774 0.3772 0.2186 -0.0709 -0.0601 0.1359  359 ALA A CB    
689  N N     . TRP B 64  ? 0.4499 0.3771 0.2353 -0.0646 -0.0550 0.1014  360 TRP A N     
690  C CA    . TRP B 64  ? 0.4374 0.3783 0.2481 -0.0587 -0.0617 0.0911  360 TRP A CA    
691  C C     . TRP B 64  ? 0.4390 0.3837 0.2858 -0.0503 -0.0519 0.0838  360 TRP A C     
692  O O     . TRP B 64  ? 0.3170 0.2691 0.1918 -0.0423 -0.0597 0.0843  360 TRP A O     
693  C CB    . TRP B 64  ? 0.4578 0.4036 0.2492 -0.0666 -0.0581 0.0765  360 TRP A CB    
694  C CG    . TRP B 64  ? 0.4617 0.4195 0.2770 -0.0627 -0.0629 0.0654  360 TRP A CG    
695  C CD1   . TRP B 64  ? 0.3916 0.3593 0.2142 -0.0622 -0.0801 0.0674  360 TRP A CD1   
696  C CD2   . TRP B 64  ? 0.3958 0.3571 0.2313 -0.0596 -0.0502 0.0513  360 TRP A CD2   
697  N NE1   . TRP B 64  ? 0.3324 0.3089 0.1782 -0.0598 -0.0774 0.0549  360 TRP A NE1   
698  C CE2   . TRP B 64  ? 0.4035 0.3750 0.2560 -0.0579 -0.0594 0.0456  360 TRP A CE2   
699  C CE3   . TRP B 64  ? 0.3130 0.2707 0.1548 -0.0582 -0.0325 0.0438  360 TRP A CE3   
700  C CZ2   . TRP B 64  ? 0.3319 0.3072 0.2044 -0.0551 -0.0511 0.0337  360 TRP A CZ2   
701  C CZ3   . TRP B 64  ? 0.3139 0.2766 0.1764 -0.0543 -0.0259 0.0322  360 TRP A CZ3   
702  C CH2   . TRP B 64  ? 0.3875 0.3576 0.2636 -0.0529 -0.0349 0.0277  360 TRP A CH2   
703  N N     . LEU B 65  ? 0.3285 0.2691 0.1751 -0.0525 -0.0349 0.0771  361 LEU A N     
704  C CA    . LEU B 65  ? 0.3306 0.2748 0.2076 -0.0458 -0.0264 0.0707  361 LEU A CA    
705  C C     . LEU B 65  ? 0.4071 0.3473 0.3050 -0.0385 -0.0330 0.0807  361 LEU A C     
706  O O     . LEU B 65  ? 0.3428 0.2893 0.2675 -0.0315 -0.0331 0.0755  361 LEU A O     
707  C CB    . LEU B 65  ? 0.3300 0.2706 0.2024 -0.0502 -0.0093 0.0656  361 LEU A CB    
708  C CG    . LEU B 65  ? 0.3817 0.3281 0.2480 -0.0535 0.0018  0.0515  361 LEU A CG    
709  C CD1   . LEU B 65  ? 0.3165 0.2613 0.1820 -0.0575 0.0182  0.0489  361 LEU A CD1   
710  C CD2   . LEU B 65  ? 0.2622 0.2180 0.1529 -0.0468 0.0005  0.0413  361 LEU A CD2   
711  N N     . GLY B 66  ? 0.3841 0.3127 0.2693 -0.0403 -0.0375 0.0949  362 GLY A N     
712  C CA    . GLY B 66  ? 0.4183 0.3390 0.3231 -0.0333 -0.0419 0.1044  362 GLY A CA    
713  C C     . GLY B 66  ? 0.4779 0.4015 0.3935 -0.0259 -0.0591 0.1135  362 GLY A C     
714  O O     . GLY B 66  ? 0.3995 0.3155 0.3333 -0.0187 -0.0631 0.1217  362 GLY A O     
715  N N     . ASP B 67  ? 0.4334 0.3680 0.3397 -0.0276 -0.0696 0.1121  363 ASP A N     
716  C CA    . ASP B 67  ? 0.4474 0.3890 0.3664 -0.0210 -0.0875 0.1208  363 ASP A CA    
717  C C     . ASP B 67  ? 0.3922 0.3482 0.3470 -0.0131 -0.0869 0.1100  363 ASP A C     
718  O O     . ASP B 67  ? 0.3753 0.3432 0.3317 -0.0162 -0.0840 0.0975  363 ASP A O     
719  C CB    . ASP B 67  ? 0.4612 0.4093 0.3532 -0.0284 -0.0999 0.1236  363 ASP A CB    
720  C CG    . ASP B 67  ? 0.4896 0.4461 0.3935 -0.0224 -0.1211 0.1354  363 ASP A CG    
721  O OD1   . ASP B 67  ? 0.5674 0.5300 0.5075 -0.0115 -0.1247 0.1366  363 ASP A OD1   
722  O OD2   . ASP B 67  ? 0.5921 0.5509 0.4716 -0.0281 -0.1319 0.1405  363 ASP A OD2   
723  N N     . GLU B 68  ? 0.3993 0.3527 0.3820 -0.0031 -0.0887 0.1148  364 GLU A N     
724  C CA    . GLU B 68  ? 0.4008 0.3674 0.4169 0.0043  -0.0863 0.1047  364 GLU A CA    
725  C C     . GLU B 68  ? 0.3498 0.3361 0.3761 0.0049  -0.0985 0.1027  364 GLU A C     
726  O O     . GLU B 68  ? 0.3694 0.3686 0.4172 0.0072  -0.0941 0.0920  364 GLU A O     
727  C CB    . GLU B 68  ? 0.4680 0.4269 0.5111 0.0151  -0.0862 0.1104  364 GLU A CB    
728  N N     . THR B 69  ? 0.4123 0.4013 0.4234 0.0020  -0.1140 0.1130  365 THR A N     
729  C CA    . THR B 69  ? 0.4638 0.4730 0.4858 0.0011  -0.1272 0.1109  365 THR A CA    
730  C C     . THR B 69  ? 0.4874 0.5024 0.4878 -0.0105 -0.1238 0.0988  365 THR A C     
731  O O     . THR B 69  ? 0.4798 0.5115 0.4907 -0.0132 -0.1321 0.0938  365 THR A O     
732  C CB    . THR B 69  ? 0.4669 0.4786 0.4835 0.0031  -0.1476 0.1272  365 THR A CB    
733  O OG1   . THR B 69  ? 0.5424 0.5436 0.5155 -0.0077 -0.1500 0.1312  365 THR A OG1   
734  C CG2   . THR B 69  ? 0.5285 0.5289 0.5629 0.0147  -0.1459 0.1367  365 THR A CG2   
735  N N     . LYS B 70  ? 0.4401 0.4417 0.4124 -0.0176 -0.1114 0.0938  366 LYS A N     
736  C CA    . LYS B 70  ? 0.3688 0.3729 0.3236 -0.0271 -0.1050 0.0806  366 LYS A CA    
737  C C     . LYS B 70  ? 0.3268 0.3325 0.3012 -0.0241 -0.0895 0.0684  366 LYS A C     
738  O O     . LYS B 70  ? 0.3275 0.3230 0.2991 -0.0225 -0.0764 0.0664  366 LYS A O     
739  C CB    . LYS B 70  ? 0.3235 0.3137 0.2386 -0.0359 -0.1000 0.0817  366 LYS A CB    
740  C CG    . LYS B 70  ? 0.4260 0.4120 0.3185 -0.0387 -0.1151 0.0969  366 LYS A CG    
741  C CD    . LYS B 70  ? 0.4298 0.4306 0.3201 -0.0429 -0.1340 0.0975  366 LYS A CD    
742  C CE    . LYS B 70  ? 0.4995 0.4958 0.3616 -0.0467 -0.1490 0.1121  366 LYS A CE    
743  N NZ    . LYS B 70  ? 0.6692 0.6578 0.5463 -0.0360 -0.1509 0.1272  366 LYS A NZ    
744  N N     . LYS B 71  ? 0.2747 0.2940 0.2692 -0.0239 -0.0914 0.0608  367 LYS A N     
745  C CA    . LYS B 71  ? 0.2542 0.2762 0.2693 -0.0202 -0.0788 0.0519  367 LYS A CA    
746  C C     . LYS B 71  ? 0.2848 0.2999 0.2836 -0.0264 -0.0672 0.0413  367 LYS A C     
747  O O     . LYS B 71  ? 0.2851 0.3010 0.2695 -0.0340 -0.0700 0.0359  367 LYS A O     
748  C CB    . LYS B 71  ? 0.2039 0.2431 0.2475 -0.0182 -0.0844 0.0491  367 LYS A CB    
749  C CG    . LYS B 71  ? 0.2708 0.3193 0.3366 -0.0104 -0.0960 0.0591  367 LYS A CG    
750  C CD    . LYS B 71  ? 0.3672 0.4057 0.4430 -0.0011 -0.0883 0.0635  367 LYS A CD    
751  C CE    . LYS B 71  ? 0.4323 0.4769 0.5312 0.0081  -0.0996 0.0741  367 LYS A CE    
752  N NZ    . LYS B 71  ? 0.5047 0.5394 0.6190 0.0173  -0.0901 0.0751  367 LYS A NZ    
753  N N     . LYS B 72  ? 0.2509 0.2596 0.2533 -0.0231 -0.0544 0.0378  368 LYS A N     
754  C CA    . LYS B 72  ? 0.2173 0.2202 0.2089 -0.0268 -0.0436 0.0290  368 LYS A CA    
755  C C     . LYS B 72  ? 0.3032 0.3105 0.3140 -0.0235 -0.0364 0.0234  368 LYS A C     
756  O O     . LYS B 72  ? 0.3192 0.3301 0.3469 -0.0178 -0.0347 0.0257  368 LYS A O     
757  C CB    . LYS B 72  ? 0.2499 0.2422 0.2265 -0.0270 -0.0350 0.0302  368 LYS A CB    
758  C CG    . LYS B 72  ? 0.3031 0.2891 0.2560 -0.0316 -0.0396 0.0362  368 LYS A CG    
759  C CD    . LYS B 72  ? 0.3215 0.3028 0.2775 -0.0277 -0.0418 0.0470  368 LYS A CD    
760  C CE    . LYS B 72  ? 0.3699 0.3439 0.3000 -0.0329 -0.0475 0.0557  368 LYS A CE    
761  N NZ    . LYS B 72  ? 0.2987 0.2694 0.2369 -0.0279 -0.0562 0.0689  368 LYS A NZ    
762  N N     . SER B 73  ? 0.2130 0.2184 0.2195 -0.0274 -0.0319 0.0161  369 SER A N     
763  C CA    . SER B 73  ? 0.1488 0.1551 0.1673 -0.0253 -0.0242 0.0120  369 SER A CA    
764  C C     . SER B 73  ? 0.1747 0.1722 0.1835 -0.0243 -0.0151 0.0089  369 SER A C     
765  O O     . SER B 73  ? 0.2356 0.2267 0.2294 -0.0277 -0.0132 0.0056  369 SER A O     
766  C CB    . SER B 73  ? 0.1804 0.1898 0.2039 -0.0304 -0.0261 0.0075  369 SER A CB    
767  O OG    . SER B 73  ? 0.2720 0.2934 0.3097 -0.0310 -0.0346 0.0104  369 SER A OG    
768  N N     . MET B 74  ? 0.1422 0.1406 0.1598 -0.0198 -0.0094 0.0094  370 MET A N     
769  C CA    . MET B 74  ? 0.1839 0.1774 0.1964 -0.0181 -0.0024 0.0074  370 MET A CA    
770  C C     . MET B 74  ? 0.1396 0.1349 0.1616 -0.0150 0.0015  0.0066  370 MET A C     
771  O O     . MET B 74  ? 0.2462 0.2456 0.2765 -0.0148 0.0002  0.0074  370 MET A O     
772  C CB    . MET B 74  ? 0.1353 0.1283 0.1449 -0.0167 -0.0010 0.0106  370 MET A CB    
773  C CG    . MET B 74  ? 0.1913 0.1811 0.1881 -0.0202 -0.0051 0.0139  370 MET A CG    
774  S SD    . MET B 74  ? 0.2864 0.2727 0.2797 -0.0199 -0.0016 0.0187  370 MET A SD    
775  C CE    . MET B 74  ? 0.2550 0.2400 0.2415 -0.0218 0.0087  0.0129  370 MET A CE    
776  N N     . PHE B 75  ? 0.1866 0.1796 0.2075 -0.0128 0.0064  0.0052  371 PHE A N     
777  C CA    . PHE B 75  ? 0.1687 0.1644 0.1966 -0.0095 0.0085  0.0061  371 PHE A CA    
778  C C     . PHE B 75  ? 0.2167 0.2164 0.2469 -0.0078 0.0101  0.0066  371 PHE A C     
779  O O     . PHE B 75  ? 0.2776 0.2767 0.3060 -0.0077 0.0132  0.0051  371 PHE A O     
780  C CB    . PHE B 75  ? 0.1223 0.1124 0.1502 -0.0080 0.0112  0.0048  371 PHE A CB    
781  C CG    . PHE B 75  ? 0.2002 0.1927 0.2333 -0.0045 0.0114  0.0078  371 PHE A CG    
782  C CD1   . PHE B 75  ? 0.1925 0.1827 0.2257 -0.0054 0.0107  0.0106  371 PHE A CD1   
783  C CD2   . PHE B 75  ? 0.1890 0.1866 0.2265 -0.0011 0.0121  0.0082  371 PHE A CD2   
784  C CE1   . PHE B 75  ? 0.1940 0.1857 0.2281 -0.0027 0.0099  0.0147  371 PHE A CE1   
785  C CE2   . PHE B 75  ? 0.2032 0.2042 0.2444 0.0019  0.0101  0.0117  371 PHE A CE2   
786  C CZ    . PHE B 75  ? 0.1568 0.1540 0.1944 0.0011  0.0087  0.0154  371 PHE A CZ    
787  N N     . ASP B 76  ? 0.2603 0.2645 0.2951 -0.0072 0.0088  0.0076  372 ASP A N     
788  C CA    . ASP B 76  ? 0.2149 0.2229 0.2530 -0.0072 0.0098  0.0071  372 ASP A CA    
789  C C     . ASP B 76  ? 0.1414 0.1464 0.1766 -0.0095 0.0108  0.0079  372 ASP A C     
790  O O     . ASP B 76  ? 0.2275 0.2333 0.2622 -0.0107 0.0141  0.0073  372 ASP A O     
791  C CB    . ASP B 76  ? 0.3038 0.3163 0.3460 -0.0052 0.0111  0.0065  372 ASP A CB    
792  C CG    . ASP B 76  ? 0.4876 0.5071 0.5355 -0.0065 0.0104  0.0054  372 ASP A CG    
793  O OD1   . ASP B 76  ? 0.4985 0.5250 0.5530 -0.0050 0.0101  0.0052  372 ASP A OD1   
794  O OD2   . ASP B 76  ? 0.4336 0.4516 0.4809 -0.0091 0.0100  0.0044  372 ASP A OD2   
795  N N     . SER B 77  ? 0.1761 0.1778 0.2101 -0.0100 0.0081  0.0098  373 SER A N     
796  C CA    . SER B 77  ? 0.1729 0.1695 0.2015 -0.0122 0.0076  0.0129  373 SER A CA    
797  C C     . SER B 77  ? 0.2720 0.2672 0.3041 -0.0139 0.0102  0.0133  373 SER A C     
798  O O     . SER B 77  ? 0.3041 0.2947 0.3304 -0.0170 0.0121  0.0164  373 SER A O     
799  C CB    . SER B 77  ? 0.2136 0.2080 0.2431 -0.0111 0.0023  0.0162  373 SER A CB    
800  O OG    . SER B 77  ? 0.2996 0.2951 0.3397 -0.0086 0.0019  0.0154  373 SER A OG    
801  N N     . LYS B 78  ? 0.2539 0.2527 0.2940 -0.0133 0.0108  0.0101  374 LYS A N     
802  C CA    . LYS B 78  ? 0.2478 0.2451 0.2918 -0.0166 0.0132  0.0090  374 LYS A CA    
803  C C     . LYS B 78  ? 0.1652 0.1675 0.2094 -0.0197 0.0172  0.0086  374 LYS A C     
804  O O     . LYS B 78  ? 0.1289 0.1280 0.1733 -0.0242 0.0205  0.0102  374 LYS A O     
805  C CB    . LYS B 78  ? 0.2447 0.2456 0.2950 -0.0166 0.0124  0.0039  374 LYS A CB    
806  C CG    . LYS B 78  ? 0.1591 0.1593 0.2144 -0.0217 0.0143  0.0009  374 LYS A CG    
807  C CD    . LYS B 78  ? 0.1481 0.1462 0.2061 -0.0224 0.0137  -0.0052 374 LYS A CD    
808  C CE    . LYS B 78  ? 0.1216 0.1303 0.1774 -0.0216 0.0112  -0.0092 374 LYS A CE    
809  N NZ    . LYS B 78  ? 0.1601 0.1801 0.2193 -0.0246 0.0091  -0.0101 374 LYS A NZ    
810  N N     . ARG B 79  ? 0.1814 0.1917 0.2275 -0.0173 0.0176  0.0065  375 ARG A N     
811  C CA    . ARG B 79  ? 0.2035 0.2204 0.2536 -0.0187 0.0225  0.0054  375 ARG A CA    
812  C C     . ARG B 79  ? 0.2156 0.2260 0.2559 -0.0219 0.0275  0.0079  375 ARG A C     
813  O O     . ARG B 79  ? 0.2509 0.2634 0.2933 -0.0265 0.0333  0.0081  375 ARG A O     
814  C CB    . ARG B 79  ? 0.2493 0.2725 0.3034 -0.0136 0.0219  0.0036  375 ARG A CB    
815  C CG    . ARG B 79  ? 0.1540 0.1820 0.2125 -0.0126 0.0283  0.0017  375 ARG A CG    
816  C CD    . ARG B 79  ? 0.1938 0.2265 0.2603 -0.0058 0.0264  0.0007  375 ARG A CD    
817  N NE    . ARG B 79  ? 0.2164 0.2590 0.2935 -0.0044 0.0203  0.0016  375 ARG A NE    
818  C CZ    . ARG B 79  ? 0.1617 0.2178 0.2547 -0.0034 0.0205  0.0005  375 ARG A CZ    
819  N NH1   . ARG B 79  ? 0.1821 0.2435 0.2842 -0.0030 0.0282  -0.0019 375 ARG A NH1   
820  N NH2   . ARG B 79  ? 0.2686 0.3341 0.3686 -0.0033 0.0130  0.0015  375 ARG A NH2   
821  N N     . ALA B 80  ? 0.1902 0.1932 0.2186 -0.0205 0.0253  0.0099  376 ALA A N     
822  C CA    . ALA B 80  ? 0.2428 0.2390 0.2570 -0.0244 0.0285  0.0127  376 ALA A CA    
823  C C     . ALA B 80  ? 0.2357 0.2244 0.2458 -0.0286 0.0279  0.0187  376 ALA A C     
824  O O     . ALA B 80  ? 0.2561 0.2422 0.2598 -0.0340 0.0340  0.0210  376 ALA A O     
825  C CB    . ALA B 80  ? 0.2169 0.2081 0.2197 -0.0228 0.0239  0.0131  376 ALA A CB    
826  N N     . ALA B 81  ? 0.1626 0.1467 0.1770 -0.0262 0.0214  0.0213  377 ALA A N     
827  C CA    . ALA B 81  ? 0.2500 0.2239 0.2628 -0.0288 0.0202  0.0275  377 ALA A CA    
828  C C     . ALA B 81  ? 0.1681 0.1421 0.1868 -0.0347 0.0271  0.0266  377 ALA A C     
829  O O     . ALA B 81  ? 0.2165 0.1817 0.2274 -0.0401 0.0304  0.0327  377 ALA A O     
830  C CB    . ALA B 81  ? 0.1964 0.1673 0.2189 -0.0239 0.0141  0.0274  377 ALA A CB    
831  N N     . VAL B 82  ? 0.1648 0.1492 0.1970 -0.0345 0.0288  0.0196  378 VAL A N     
832  C CA    . VAL B 82  ? 0.1600 0.1471 0.2012 -0.0412 0.0342  0.0180  378 VAL A CA    
833  C C     . VAL B 82  ? 0.1670 0.1601 0.2051 -0.0460 0.0429  0.0186  378 VAL A C     
834  O O     . VAL B 82  ? 0.1962 0.1845 0.2327 -0.0536 0.0490  0.0220  378 VAL A O     
835  C CB    . VAL B 82  ? 0.1486 0.1472 0.2049 -0.0403 0.0317  0.0103  378 VAL A CB    
836  C CG1   . VAL B 82  ? 0.1512 0.1576 0.2192 -0.0481 0.0369  0.0075  378 VAL A CG1   
837  C CG2   . VAL B 82  ? 0.1521 0.1427 0.2102 -0.0381 0.0264  0.0085  378 VAL A CG2   
838  N N     . ALA B 83  ? 0.1599 0.1628 0.1977 -0.0420 0.0446  0.0148  379 ALA A N     
839  C CA    . ALA B 83  ? 0.2046 0.2130 0.2393 -0.0458 0.0548  0.0139  379 ALA A CA    
840  C C     . ALA B 83  ? 0.2162 0.2108 0.2295 -0.0517 0.0588  0.0211  379 ALA A C     
841  O O     . ALA B 83  ? 0.2304 0.2257 0.2412 -0.0593 0.0687  0.0227  379 ALA A O     
842  C CB    . ALA B 83  ? 0.1868 0.2025 0.2218 -0.0392 0.0558  0.0086  379 ALA A CB    
843  N N     . LEU B 84  ? 0.1974 0.1801 0.1954 -0.0488 0.0509  0.0263  380 LEU A N     
844  C CA    . LEU B 84  ? 0.2191 0.1884 0.1949 -0.0541 0.0518  0.0351  380 LEU A CA    
845  C C     . LEU B 84  ? 0.2420 0.2004 0.2196 -0.0598 0.0527  0.0429  380 LEU A C     
846  O O     . LEU B 84  ? 0.2998 0.2496 0.2622 -0.0675 0.0588  0.0500  380 LEU A O     
847  C CB    . LEU B 84  ? 0.2403 0.2026 0.2031 -0.0490 0.0408  0.0389  380 LEU A CB    
848  C CG    . LEU B 84  ? 0.2891 0.2576 0.2436 -0.0466 0.0415  0.0321  380 LEU A CG    
849  C CD1   . LEU B 84  ? 0.2444 0.2095 0.1938 -0.0418 0.0292  0.0343  380 LEU A CD1   
850  C CD2   . LEU B 84  ? 0.3193 0.2850 0.2517 -0.0538 0.0509  0.0323  380 LEU A CD2   
851  N N     . LYS B 85  ? 0.2199 0.1766 0.2144 -0.0569 0.0472  0.0415  381 LYS A N     
852  C CA    . LYS B 85  ? 0.2652 0.2092 0.2636 -0.0626 0.0488  0.0473  381 LYS A CA    
853  C C     . LYS B 85  ? 0.2426 0.1916 0.2454 -0.0729 0.0609  0.0461  381 LYS A C     
854  O O     . LYS B 85  ? 0.2657 0.2013 0.2593 -0.0810 0.0659  0.0547  381 LYS A O     
855  C CB    . LYS B 85  ? 0.2806 0.2239 0.2975 -0.0584 0.0430  0.0419  381 LYS A CB    
856  C CG    . LYS B 85  ? 0.3568 0.2889 0.3719 -0.0505 0.0334  0.0461  381 LYS A CG    
857  C CD    . LYS B 85  ? 0.4553 0.3876 0.4882 -0.0476 0.0309  0.0379  381 LYS A CD    
858  C CE    . LYS B 85  ? 0.4376 0.3658 0.4734 -0.0380 0.0230  0.0382  381 LYS A CE    
859  N NZ    . LYS B 85  ? 0.4503 0.3588 0.4834 -0.0360 0.0197  0.0487  381 LYS A NZ    
860  N N     . TRP B 86  ? 0.2262 0.1948 0.2445 -0.0730 0.0657  0.0362  382 TRP A N     
861  C CA    . TRP B 86  ? 0.3085 0.2863 0.3353 -0.0827 0.0778  0.0342  382 TRP A CA    
862  C C     . TRP B 86  ? 0.3251 0.2989 0.3309 -0.0885 0.0881  0.0398  382 TRP A C     
863  O O     . TRP B 86  ? 0.2696 0.2465 0.2784 -0.0986 0.1001  0.0410  382 TRP A O     
864  C CB    . TRP B 86  ? 0.2385 0.2406 0.2882 -0.0796 0.0795  0.0231  382 TRP A CB    
865  C CG    . TRP B 86  ? 0.1988 0.2074 0.2691 -0.0790 0.0722  0.0173  382 TRP A CG    
866  C CD1   . TRP B 86  ? 0.1827 0.1930 0.2567 -0.0705 0.0613  0.0134  382 TRP A CD1   
867  C CD2   . TRP B 86  ? 0.2026 0.2171 0.2911 -0.0887 0.0754  0.0142  382 TRP A CD2   
868  N NE1   . TRP B 86  ? 0.1775 0.1941 0.2681 -0.0740 0.0574  0.0078  382 TRP A NE1   
869  C CE2   . TRP B 86  ? 0.2111 0.2305 0.3117 -0.0853 0.0652  0.0078  382 TRP A CE2   
870  C CE3   . TRP B 86  ? 0.2183 0.2343 0.3134 -0.1011 0.0864  0.0161  382 TRP A CE3   
871  C CZ2   . TRP B 86  ? 0.1911 0.2170 0.3094 -0.0939 0.0643  0.0022  382 TRP A CZ2   
872  C CZ3   . TRP B 86  ? 0.2188 0.2420 0.3339 -0.1089 0.0850  0.0110  382 TRP A CZ3   
873  C CH2   . TRP B 86  ? 0.2508 0.2787 0.3778 -0.1061 0.0742  0.0036  382 TRP A CH2   
874  N N     . LYS B 87  ? 0.3056 0.2731 0.2895 -0.0833 0.0843  0.0428  383 LYS A N     
875  C CA    . LYS B 87  ? 0.3385 0.2993 0.2958 -0.0898 0.0928  0.0485  383 LYS A CA    
876  C C     . LYS B 87  ? 0.3787 0.3166 0.3123 -0.0932 0.0866  0.0632  383 LYS A C     
877  O O     . LYS B 87  ? 0.3947 0.3249 0.3002 -0.0983 0.0903  0.0697  383 LYS A O     
878  C CB    . LYS B 87  ? 0.3357 0.3034 0.2810 -0.0839 0.0927  0.0419  383 LYS A CB    
879  C CG    . LYS B 87  ? 0.3624 0.3504 0.3267 -0.0821 0.1035  0.0293  383 LYS A CG    
880  C CD    . LYS B 87  ? 0.4205 0.4139 0.3862 -0.0718 0.0974  0.0212  383 LYS A CD    
881  C CE    . LYS B 87  ? 0.4207 0.4277 0.3935 -0.0707 0.1107  0.0104  383 LYS A CE    
882  N NZ    . LYS B 87  ? 0.5615 0.5810 0.5502 -0.0777 0.1258  0.0081  383 LYS A NZ    
883  N N     . GLY B 88  ? 0.3657 0.2921 0.3091 -0.0904 0.0770  0.0686  384 GLY A N     
884  C CA    . GLY B 88  ? 0.4132 0.3172 0.3376 -0.0917 0.0700  0.0837  384 GLY A CA    
885  C C     . GLY B 88  ? 0.3934 0.2935 0.3011 -0.0834 0.0568  0.0881  384 GLY A C     
886  O O     . GLY B 88  ? 0.3974 0.2820 0.2834 -0.0853 0.0511  0.1019  384 GLY A O     
887  N N     . ILE B 89  ? 0.3126 0.2265 0.2303 -0.0748 0.0511  0.0777  385 ILE A N     
888  C CA    . ILE B 89  ? 0.3352 0.2487 0.2391 -0.0685 0.0393  0.0799  385 ILE A CA    
889  C C     . ILE B 89  ? 0.3686 0.2848 0.2945 -0.0579 0.0280  0.0767  385 ILE A C     
890  O O     . ILE B 89  ? 0.3202 0.2473 0.2672 -0.0544 0.0307  0.0659  385 ILE A O     
891  C CB    . ILE B 89  ? 0.3132 0.2398 0.2069 -0.0691 0.0445  0.0696  385 ILE A CB    
892  C CG1   . ILE B 89  ? 0.4415 0.3646 0.3088 -0.0797 0.0563  0.0724  385 ILE A CG1   
893  C CG2   . ILE B 89  ? 0.3358 0.2645 0.2229 -0.0626 0.0315  0.0686  385 ILE A CG2   
894  C CD1   . ILE B 89  ? 0.3842 0.3199 0.2460 -0.0802 0.0651  0.0590  385 ILE A CD1   
895  N N     . GLU B 90  ? 0.3505 0.2578 0.2715 -0.0530 0.0156  0.0862  386 GLU A N     
896  C CA    . GLU B 90  ? 0.3550 0.2649 0.2972 -0.0430 0.0061  0.0836  386 GLU A CA    
897  C C     . GLU B 90  ? 0.3773 0.3004 0.3183 -0.0383 -0.0007 0.0773  386 GLU A C     
898  O O     . GLU B 90  ? 0.3443 0.2677 0.2649 -0.0409 -0.0057 0.0814  386 GLU A O     
899  C CB    . GLU B 90  ? 0.4985 0.3927 0.4423 -0.0390 -0.0034 0.0973  386 GLU A CB    
900  N N     . LEU B 91  ? 0.2847 0.2180 0.2461 -0.0326 -0.0009 0.0672  387 LEU A N     
901  C CA    . LEU B 91  ? 0.2550 0.1995 0.2187 -0.0285 -0.0067 0.0613  387 LEU A CA    
902  C C     . LEU B 91  ? 0.2952 0.2403 0.2764 -0.0206 -0.0162 0.0641  387 LEU A C     
903  O O     . LEU B 91  ? 0.3945 0.3390 0.3942 -0.0166 -0.0134 0.0604  387 LEU A O     
904  C CB    . LEU B 91  ? 0.2181 0.1735 0.1912 -0.0282 0.0009  0.0488  387 LEU A CB    
905  C CG    . LEU B 91  ? 0.2910 0.2560 0.2696 -0.0242 -0.0040 0.0426  387 LEU A CG    
906  C CD1   . LEU B 91  ? 0.3023 0.2673 0.2612 -0.0281 -0.0079 0.0437  387 LEU A CD1   
907  C CD2   . LEU B 91  ? 0.2869 0.2598 0.2755 -0.0232 0.0031  0.0329  387 LEU A CD2   
908  N N     . CYS B 92  ? 0.2731 0.2204 0.2493 -0.0186 -0.0272 0.0701  388 CYS A N     
909  C CA    . CYS B 92  ? 0.3080 0.2589 0.3046 -0.0106 -0.0360 0.0728  388 CYS A CA    
910  C C     . CYS B 92  ? 0.3215 0.2866 0.3211 -0.0098 -0.0430 0.0682  388 CYS A C     
911  O O     . CYS B 92  ? 0.2804 0.2492 0.2627 -0.0157 -0.0429 0.0647  388 CYS A O     
912  C CB    . CYS B 92  ? 0.4131 0.3533 0.4076 -0.0077 -0.0455 0.0876  388 CYS A CB    
913  S SG    . CYS B 92  ? 0.5667 0.4865 0.5558 -0.0105 -0.0375 0.0947  388 CYS A SG    
914  N N     . GLY B 93  ? 0.2645 0.2373 0.2872 -0.0027 -0.0485 0.0681  389 GLY A N     
915  C CA    . GLY B 93  ? 0.3026 0.2898 0.3320 -0.0026 -0.0561 0.0651  389 GLY A CA    
916  C C     . GLY B 93  ? 0.2623 0.2577 0.2950 -0.0053 -0.0481 0.0529  389 GLY A C     
917  O O     . GLY B 93  ? 0.2387 0.2440 0.2724 -0.0081 -0.0530 0.0495  389 GLY A O     
918  N N     . VAL B 94  ? 0.1916 0.1829 0.2261 -0.0052 -0.0367 0.0465  390 VAL A N     
919  C CA    . VAL B 94  ? 0.2354 0.2336 0.2732 -0.0069 -0.0304 0.0369  390 VAL A CA    
920  C C     . VAL B 94  ? 0.3204 0.3288 0.3810 -0.0024 -0.0314 0.0343  390 VAL A C     
921  O O     . VAL B 94  ? 0.3038 0.3113 0.3778 0.0022  -0.0267 0.0327  390 VAL A O     
922  C CB    . VAL B 94  ? 0.2863 0.2794 0.3200 -0.0079 -0.0199 0.0319  390 VAL A CB    
923  C CG1   . VAL B 94  ? 0.1907 0.1900 0.2275 -0.0090 -0.0153 0.0244  390 VAL A CG1   
924  C CG2   . VAL B 94  ? 0.2686 0.2541 0.2831 -0.0127 -0.0173 0.0339  390 VAL A CG2   
925  N N     . SER B 95  ? 0.2217 0.2400 0.2870 -0.0047 -0.0368 0.0330  391 SER A N     
926  C CA    . SER B 95  ? 0.2048 0.2354 0.2938 -0.0013 -0.0376 0.0311  391 SER A CA    
927  C C     . SER B 95  ? 0.2103 0.2452 0.3029 -0.0040 -0.0287 0.0233  391 SER A C     
928  O O     . SER B 95  ? 0.1818 0.2267 0.2934 -0.0020 -0.0259 0.0208  391 SER A O     
929  C CB    . SER B 95  ? 0.2658 0.3072 0.3618 -0.0029 -0.0501 0.0351  391 SER A CB    
930  O OG    . SER B 95  ? 0.3337 0.3751 0.4137 -0.0112 -0.0520 0.0315  391 SER A OG    
931  N N     . PHE B 96  ? 0.1779 0.2056 0.2535 -0.0084 -0.0239 0.0200  392 PHE A N     
932  C CA    . PHE B 96  ? 0.2244 0.2537 0.3012 -0.0109 -0.0164 0.0149  392 PHE A CA    
933  C C     . PHE B 96  ? 0.2817 0.3009 0.3430 -0.0115 -0.0108 0.0133  392 PHE A C     
934  O O     . PHE B 96  ? 0.2086 0.2216 0.2564 -0.0137 -0.0125 0.0137  392 PHE A O     
935  C CB    . PHE B 96  ? 0.2426 0.2764 0.3202 -0.0170 -0.0196 0.0130  392 PHE A CB    
936  C CG    . PHE B 96  ? 0.2349 0.2667 0.3115 -0.0202 -0.0119 0.0095  392 PHE A CG    
937  C CD1   . PHE B 96  ? 0.2501 0.2891 0.3397 -0.0196 -0.0060 0.0084  392 PHE A CD1   
938  C CD2   . PHE B 96  ? 0.2326 0.2541 0.2948 -0.0235 -0.0099 0.0076  392 PHE A CD2   
939  C CE1   . PHE B 96  ? 0.2045 0.2400 0.2902 -0.0233 0.0009  0.0072  392 PHE A CE1   
940  C CE2   . PHE B 96  ? 0.2982 0.3155 0.3595 -0.0258 -0.0036 0.0063  392 PHE A CE2   
941  C CZ    . PHE B 96  ? 0.2211 0.2450 0.2928 -0.0261 0.0013  0.0070  392 PHE A CZ    
942  N N     . ASP B 97  ? 0.1746 0.1934 0.2381 -0.0096 -0.0042 0.0112  393 ASP A N     
943  C CA    . ASP B 97  ? 0.1736 0.1864 0.2264 -0.0098 -0.0001 0.0100  393 ASP A CA    
944  C C     . ASP B 97  ? 0.1774 0.1910 0.2299 -0.0115 0.0038  0.0086  393 ASP A C     
945  O O     . ASP B 97  ? 0.1440 0.1617 0.2015 -0.0112 0.0074  0.0077  393 ASP A O     
946  C CB    . ASP B 97  ? 0.1843 0.1956 0.2379 -0.0071 0.0024  0.0094  393 ASP A CB    
947  C CG    . ASP B 97  ? 0.3017 0.3099 0.3472 -0.0075 0.0048  0.0086  393 ASP A CG    
948  O OD1   . ASP B 97  ? 0.3409 0.3489 0.3830 -0.0081 0.0062  0.0082  393 ASP A OD1   
949  O OD2   . ASP B 97  ? 0.3037 0.3096 0.3479 -0.0073 0.0052  0.0087  393 ASP A OD2   
950  N N     . LEU B 98  ? 0.1867 0.1948 0.2323 -0.0135 0.0038  0.0085  394 LEU A N     
951  C CA    . LEU B 98  ? 0.1832 0.1887 0.2278 -0.0154 0.0070  0.0090  394 LEU A CA    
952  C C     . LEU B 98  ? 0.1448 0.1500 0.1857 -0.0129 0.0100  0.0106  394 LEU A C     
953  O O     . LEU B 98  ? 0.1982 0.2035 0.2380 -0.0145 0.0129  0.0124  394 LEU A O     
954  C CB    . LEU B 98  ? 0.1202 0.1169 0.1590 -0.0173 0.0066  0.0080  394 LEU A CB    
955  C CG    . LEU B 98  ? 0.2118 0.2008 0.2488 -0.0185 0.0097  0.0097  394 LEU A CG    
956  C CD1   . LEU B 98  ? 0.1863 0.1788 0.2291 -0.0236 0.0112  0.0108  394 LEU A CD1   
957  C CD2   . LEU B 98  ? 0.1840 0.1619 0.2163 -0.0193 0.0101  0.0067  394 LEU A CD2   
958  N N     . LEU B 99  ? 0.1509 0.1560 0.1891 -0.0098 0.0092  0.0102  395 LEU A N     
959  C CA    . LEU B 99  ? 0.1807 0.1881 0.2160 -0.0083 0.0099  0.0112  395 LEU A CA    
960  C C     . LEU B 99  ? 0.2093 0.2217 0.2450 -0.0098 0.0122  0.0097  395 LEU A C     
961  O O     . LEU B 99  ? 0.1650 0.1780 0.1948 -0.0112 0.0140  0.0113  395 LEU A O     
962  C CB    . LEU B 99  ? 0.1646 0.1740 0.2006 -0.0062 0.0084  0.0099  395 LEU A CB    
963  C CG    . LEU B 99  ? 0.2689 0.2832 0.3027 -0.0059 0.0074  0.0098  395 LEU A CG    
964  C CD1   . LEU B 99  ? 0.2234 0.2369 0.2532 -0.0045 0.0056  0.0144  395 LEU A CD1   
965  C CD2   . LEU B 99  ? 0.2660 0.2841 0.3037 -0.0057 0.0061  0.0076  395 LEU A CD2   
966  N N     . LEU B 100 ? 0.1388 0.1539 0.1810 -0.0095 0.0127  0.0067  396 LEU A N     
967  C CA    . LEU B 100 ? 0.1568 0.1762 0.2019 -0.0101 0.0167  0.0033  396 LEU A CA    
968  C C     . LEU B 100 ? 0.1338 0.1564 0.1820 -0.0127 0.0207  0.0040  396 LEU A C     
969  O O     . LEU B 100 ? 0.1574 0.1832 0.2026 -0.0145 0.0263  0.0019  396 LEU A O     
970  C CB    . LEU B 100 ? 0.1065 0.1264 0.1613 -0.0077 0.0162  0.0005  396 LEU A CB    
971  C CG    . LEU B 100 ? 0.2094 0.2252 0.2610 -0.0069 0.0138  -0.0001 396 LEU A CG    
972  C CD1   . LEU B 100 ? 0.1782 0.1909 0.2389 -0.0046 0.0133  -0.0011 396 LEU A CD1   
973  C CD2   . LEU B 100 ? 0.1834 0.2002 0.2270 -0.0088 0.0153  -0.0033 396 LEU A CD2   
974  N N     . ALA B 101 ? 0.1773 0.1999 0.2316 -0.0138 0.0186  0.0062  397 ALA A N     
975  C CA    . ALA B 101 ? 0.1404 0.1669 0.1998 -0.0179 0.0228  0.0068  397 ALA A CA    
976  C C     . ALA B 101 ? 0.1445 0.1658 0.1912 -0.0211 0.0263  0.0104  397 ALA A C     
977  O O     . ALA B 101 ? 0.1445 0.1693 0.1897 -0.0246 0.0329  0.0104  397 ALA A O     
978  C CB    . ALA B 101 ? 0.1479 0.1747 0.2149 -0.0201 0.0184  0.0079  397 ALA A CB    
979  N N     . ALA B 102 ? 0.1257 0.1385 0.1634 -0.0197 0.0223  0.0140  398 ALA A N     
980  C CA    . ALA B 102 ? 0.1489 0.1551 0.1753 -0.0215 0.0237  0.0196  398 ALA A CA    
981  C C     . ALA B 102 ? 0.2438 0.2537 0.2595 -0.0217 0.0258  0.0197  398 ALA A C     
982  O O     . ALA B 102 ? 0.2499 0.2583 0.2557 -0.0256 0.0300  0.0235  398 ALA A O     
983  C CB    . ALA B 102 ? 0.1881 0.1854 0.2112 -0.0179 0.0187  0.0229  398 ALA A CB    
984  N N     . TYR B 103 ? 0.2135 0.2277 0.2296 -0.0185 0.0232  0.0152  399 TYR A N     
985  C CA    . TYR B 103 ? 0.2710 0.2888 0.2762 -0.0197 0.0246  0.0129  399 TYR A CA    
986  C C     . TYR B 103 ? 0.2881 0.3105 0.2920 -0.0238 0.0337  0.0086  399 TYR A C     
987  O O     . TYR B 103 ? 0.2514 0.2741 0.2397 -0.0277 0.0372  0.0096  399 TYR A O     
988  C CB    . TYR B 103 ? 0.2125 0.2331 0.2221 -0.0168 0.0209  0.0073  399 TYR A CB    
989  C CG    . TYR B 103 ? 0.2592 0.2830 0.2587 -0.0192 0.0223  0.0020  399 TYR A CG    
990  C CD1   . TYR B 103 ? 0.2582 0.2828 0.2419 -0.0214 0.0182  0.0056  399 TYR A CD1   
991  C CD2   . TYR B 103 ? 0.2618 0.2873 0.2674 -0.0193 0.0270  -0.0066 399 TYR A CD2   
992  C CE1   . TYR B 103 ? 0.2970 0.3248 0.2690 -0.0250 0.0185  -0.0005 399 TYR A CE1   
993  C CE2   . TYR B 103 ? 0.2397 0.2663 0.2352 -0.0224 0.0289  -0.0136 399 TYR A CE2   
994  C CZ    . TYR B 103 ? 0.2961 0.3243 0.2735 -0.0260 0.0245  -0.0111 399 TYR A CZ    
995  O OH    . TYR B 103 ? 0.3491 0.3788 0.3140 -0.0305 0.0256  -0.0193 399 TYR A OH    
996  N N     . LEU B 104 ? 0.1943 0.2212 0.2144 -0.0229 0.0376  0.0039  400 LEU A N     
997  C CA    . LEU B 104 ? 0.2123 0.2456 0.2360 -0.0259 0.0478  -0.0011 400 LEU A CA    
998  C C     . LEU B 104 ? 0.2666 0.2999 0.2850 -0.0320 0.0537  0.0043  400 LEU A C     
999  O O     . LEU B 104 ? 0.2670 0.3041 0.2782 -0.0365 0.0634  0.0018  400 LEU A O     
1000 C CB    . LEU B 104 ? 0.2036 0.2435 0.2507 -0.0223 0.0493  -0.0062 400 LEU A CB    
1001 C CG    . LEU B 104 ? 0.2757 0.3139 0.3290 -0.0169 0.0457  -0.0113 400 LEU A CG    
1002 C CD1   . LEU B 104 ? 0.2219 0.2660 0.2991 -0.0126 0.0457  -0.0135 400 LEU A CD1   
1003 C CD2   . LEU B 104 ? 0.3777 0.4149 0.4194 -0.0183 0.0517  -0.0186 400 LEU A CD2   
1004 N N     . LEU B 105 ? 0.1956 0.2234 0.2166 -0.0329 0.0490  0.0113  401 LEU A N     
1005 C CA    . LEU B 105 ? 0.2520 0.2771 0.2696 -0.0396 0.0546  0.0171  401 LEU A CA    
1006 C C     . LEU B 105 ? 0.3230 0.3402 0.3158 -0.0430 0.0559  0.0242  401 LEU A C     
1007 O O     . LEU B 105 ? 0.3686 0.3856 0.3528 -0.0500 0.0647  0.0274  401 LEU A O     
1008 C CB    . LEU B 105 ? 0.1846 0.2031 0.2113 -0.0400 0.0489  0.0213  401 LEU A CB    
1009 C CG    . LEU B 105 ? 0.2461 0.2740 0.2958 -0.0406 0.0488  0.0162  401 LEU A CG    
1010 C CD1   . LEU B 105 ? 0.2426 0.2625 0.2963 -0.0445 0.0449  0.0198  401 LEU A CD1   
1011 C CD2   . LEU B 105 ? 0.1897 0.2304 0.2501 -0.0453 0.0596  0.0125  401 LEU A CD2   
1012 N N     . ASP B 106 ? 0.2902 0.3018 0.2715 -0.0385 0.0470  0.0273  402 ASP A N     
1013 C CA    . ASP B 106 ? 0.3907 0.3964 0.3480 -0.0408 0.0451  0.0350  402 ASP A CA    
1014 C C     . ASP B 106 ? 0.2764 0.2827 0.2283 -0.0350 0.0344  0.0347  402 ASP A C     
1015 O O     . ASP B 106 ? 0.3402 0.3407 0.2966 -0.0300 0.0261  0.0404  402 ASP A O     
1016 C CB    . ASP B 106 ? 0.3694 0.3625 0.3214 -0.0433 0.0441  0.0471  402 ASP A CB    
1017 C CG    . ASP B 106 ? 0.4479 0.4345 0.3735 -0.0468 0.0432  0.0576  402 ASP A CG    
1018 O OD1   . ASP B 106 ? 0.5470 0.5395 0.4569 -0.0470 0.0408  0.0552  402 ASP A OD1   
1019 O OD2   . ASP B 106 ? 0.5485 0.5230 0.4680 -0.0501 0.0444  0.0685  402 ASP A OD2   
1020 N N     . PRO B 107 ? 0.2670 0.2804 0.2107 -0.0358 0.0349  0.0272  403 PRO A N     
1021 C CA    . PRO B 107 ? 0.2539 0.2698 0.1949 -0.0317 0.0245  0.0261  403 PRO A CA    
1022 C C     . PRO B 107 ? 0.3491 0.3608 0.2761 -0.0308 0.0150  0.0378  403 PRO A C     
1023 O O     . PRO B 107 ? 0.3461 0.3605 0.2789 -0.0258 0.0051  0.0392  403 PRO A O     
1024 C CB    . PRO B 107 ? 0.2570 0.2793 0.1880 -0.0356 0.0287  0.0153  403 PRO A CB    
1025 C CG    . PRO B 107 ? 0.3336 0.3574 0.2667 -0.0396 0.0424  0.0098  403 PRO A CG    
1026 C CD    . PRO B 107 ? 0.2241 0.2430 0.1584 -0.0415 0.0458  0.0196  403 PRO A CD    
1027 N N     . ALA B 108 ? 0.2942 0.2998 0.2035 -0.0354 0.0178  0.0471  404 ALA A N     
1028 C CA    . ALA B 108 ? 0.3800 0.3808 0.2752 -0.0337 0.0073  0.0603  404 ALA A CA    
1029 C C     . ALA B 108 ? 0.5180 0.5105 0.4302 -0.0260 0.0010  0.0687  404 ALA A C     
1030 O O     . ALA B 108 ? 0.4808 0.4711 0.3892 -0.0214 -0.0097 0.0787  404 ALA A O     
1031 C CB    . ALA B 108 ? 0.3218 0.3157 0.1912 -0.0413 0.0124  0.0696  404 ALA A CB    
1032 N N     . GLN B 109 ? 0.4582 0.4461 0.3890 -0.0244 0.0073  0.0646  405 GLN A N     
1033 C CA    . GLN B 109 ? 0.5024 0.4802 0.4475 -0.0180 0.0033  0.0706  405 GLN A CA    
1034 C C     . GLN B 109 ? 0.5000 0.4844 0.4584 -0.0097 -0.0058 0.0682  405 GLN A C     
1035 O O     . GLN B 109 ? 0.5309 0.5078 0.4996 -0.0031 -0.0099 0.0739  405 GLN A O     
1036 C CB    . GLN B 109 ? 0.5526 0.5253 0.5126 -0.0198 0.0114  0.0647  405 GLN A CB    
1037 C CG    . GLN B 109 ? 0.7358 0.7010 0.6886 -0.0281 0.0205  0.0685  405 GLN A CG    
1038 C CD    . GLN B 109 ? 0.8618 0.8100 0.8056 -0.0285 0.0188  0.0828  405 GLN A CD    
1039 O OE1   . GLN B 109 ? 0.8613 0.7966 0.8161 -0.0266 0.0191  0.0851  405 GLN A OE1   
1040 N NE2   . GLN B 109 ? 0.8714 0.8180 0.7936 -0.0313 0.0170  0.0926  405 GLN A NE2   
1041 N N     . GLY B 110 ? 0.4735 0.4713 0.4335 -0.0101 -0.0080 0.0593  406 GLY A N     
1042 C CA    . GLY B 110 ? 0.4755 0.4813 0.4500 -0.0037 -0.0152 0.0566  406 GLY A CA    
1043 C C     . GLY B 110 ? 0.4658 0.4675 0.4596 0.0009  -0.0116 0.0521  406 GLY A C     
1044 O O     . GLY B 110 ? 0.4381 0.4410 0.4447 0.0077  -0.0161 0.0542  406 GLY A O     
1045 N N     . VAL B 111 ? 0.3815 0.3796 0.3779 -0.0027 -0.0037 0.0457  407 VAL A N     
1046 C CA    . VAL B 111 ? 0.4003 0.3934 0.4102 0.0000  -0.0005 0.0414  407 VAL A CA    
1047 C C     . VAL B 111 ? 0.3681 0.3703 0.3887 0.0035  -0.0029 0.0356  407 VAL A C     
1048 O O     . VAL B 111 ? 0.4731 0.4834 0.4938 0.0007  -0.0022 0.0294  407 VAL A O     
1049 C CB    . VAL B 111 ? 0.3951 0.3855 0.4054 -0.0054 0.0062  0.0361  407 VAL A CB    
1050 C CG1   . VAL B 111 ? 0.2631 0.2518 0.2841 -0.0037 0.0076  0.0301  407 VAL A CG1   
1051 C CG2   . VAL B 111 ? 0.3203 0.3001 0.3245 -0.0093 0.0098  0.0423  407 VAL A CG2   
1052 N N     . ASP B 112 ? 0.3516 0.3518 0.3825 0.0096  -0.0048 0.0375  408 ASP A N     
1053 C CA    . ASP B 112 ? 0.5020 0.5115 0.5457 0.0136  -0.0063 0.0336  408 ASP A CA    
1054 C C     . ASP B 112 ? 0.4338 0.4383 0.4846 0.0144  0.0001  0.0273  408 ASP A C     
1055 O O     . ASP B 112 ? 0.2832 0.2954 0.3402 0.0140  0.0019  0.0220  408 ASP A O     
1056 C CB    . ASP B 112 ? 0.6535 0.6658 0.7063 0.0210  -0.0122 0.0405  408 ASP A CB    
1057 C CG    . ASP B 112 ? 0.8459 0.8421 0.8980 0.0250  -0.0112 0.0474  408 ASP A CG    
1058 O OD1   . ASP B 112 ? 0.9467 0.9394 1.0128 0.0327  -0.0107 0.0486  408 ASP A OD1   
1059 O OD2   . ASP B 112 ? 0.8791 0.8656 0.9176 0.0203  -0.0098 0.0513  408 ASP A OD2   
1060 N N     . ASP B 113 ? 0.2852 0.2762 0.3340 0.0147  0.0038  0.0277  409 ASP A N     
1061 C CA    . ASP B 113 ? 0.2326 0.2183 0.2849 0.0146  0.0095  0.0208  409 ASP A CA    
1062 C C     . ASP B 113 ? 0.2093 0.1830 0.2534 0.0094  0.0121  0.0194  409 ASP A C     
1063 O O     . ASP B 113 ? 0.2252 0.1954 0.2638 0.0064  0.0106  0.0241  409 ASP A O     
1064 C CB    . ASP B 113 ? 0.2671 0.2498 0.3316 0.0222  0.0117  0.0203  409 ASP A CB    
1065 C CG    . ASP B 113 ? 0.4559 0.4263 0.5228 0.0270  0.0099  0.0275  409 ASP A CG    
1066 O OD1   . ASP B 113 ? 0.5402 0.5087 0.6205 0.0352  0.0108  0.0283  409 ASP A OD1   
1067 O OD2   . ASP B 113 ? 0.5245 0.4867 0.5813 0.0230  0.0081  0.0325  409 ASP A OD2   
1068 N N     . VAL B 114 ? 0.2376 0.2064 0.2804 0.0071  0.0161  0.0125  410 VAL A N     
1069 C CA    . VAL B 114 ? 0.2248 0.1844 0.2612 0.0009  0.0172  0.0100  410 VAL A CA    
1070 C C     . VAL B 114 ? 0.1668 0.1127 0.2042 0.0014  0.0181  0.0143  410 VAL A C     
1071 O O     . VAL B 114 ? 0.2230 0.1653 0.2567 -0.0045 0.0176  0.0165  410 VAL A O     
1072 C CB    . VAL B 114 ? 0.2624 0.2178 0.2948 -0.0018 0.0205  0.0016  410 VAL A CB    
1073 C CG1   . VAL B 114 ? 0.2372 0.1826 0.2642 -0.0088 0.0205  -0.0017 410 VAL A CG1   
1074 C CG2   . VAL B 114 ? 0.1659 0.1331 0.1947 -0.0040 0.0189  0.0000  410 VAL A CG2   
1075 N N     . ALA B 115 ? 0.1768 0.1150 0.2207 0.0085  0.0196  0.0161  411 ALA A N     
1076 C CA    . ALA B 115 ? 0.2278 0.1487 0.2728 0.0094  0.0206  0.0210  411 ALA A CA    
1077 C C     . ALA B 115 ? 0.3253 0.2476 0.3651 0.0070  0.0169  0.0315  411 ALA A C     
1078 O O     . ALA B 115 ? 0.2588 0.1690 0.2946 0.0015  0.0186  0.0348  411 ALA A O     
1079 C CB    . ALA B 115 ? 0.2320 0.1457 0.2883 0.0198  0.0222  0.0225  411 ALA A CB    
1080 N N     . ALA B 116 ? 0.2946 0.2313 0.3335 0.0100  0.0123  0.0365  412 ALA A N     
1081 C CA    . ALA B 116 ? 0.2807 0.2192 0.3107 0.0069  0.0095  0.0455  412 ALA A CA    
1082 C C     . ALA B 116 ? 0.2371 0.1789 0.2606 -0.0028 0.0128  0.0422  412 ALA A C     
1083 O O     . ALA B 116 ? 0.2681 0.2034 0.2854 -0.0080 0.0149  0.0480  412 ALA A O     
1084 C CB    . ALA B 116 ? 0.2359 0.1901 0.2648 0.0107  0.0037  0.0489  412 ALA A CB    
1085 N N     . ALA B 117 ? 0.1761 0.1281 0.2023 -0.0053 0.0137  0.0335  413 ALA A N     
1086 C CA    . ALA B 117 ? 0.1776 0.1348 0.2023 -0.0131 0.0161  0.0307  413 ALA A CA    
1087 C C     . ALA B 117 ? 0.1859 0.1311 0.2126 -0.0191 0.0191  0.0291  413 ALA A C     
1088 O O     . ALA B 117 ? 0.2138 0.1592 0.2401 -0.0261 0.0219  0.0313  413 ALA A O     
1089 C CB    . ALA B 117 ? 0.1929 0.1625 0.2211 -0.0132 0.0148  0.0235  413 ALA A CB    
1090 N N     . ALA B 118 ? 0.1822 0.1170 0.2116 -0.0172 0.0193  0.0246  414 ALA A N     
1091 C CA    . ALA B 118 ? 0.2146 0.1361 0.2453 -0.0239 0.0219  0.0212  414 ALA A CA    
1092 C C     . ALA B 118 ? 0.2219 0.1288 0.2510 -0.0266 0.0248  0.0297  414 ALA A C     
1093 O O     . ALA B 118 ? 0.2747 0.1762 0.3053 -0.0359 0.0275  0.0291  414 ALA A O     
1094 C CB    . ALA B 118 ? 0.2022 0.1134 0.2337 -0.0208 0.0229  0.0135  414 ALA A CB    
1095 N N     . LYS B 119 ? 0.2492 0.1500 0.2757 -0.0191 0.0237  0.0384  415 LYS A N     
1096 C CA    . LYS B 119 ? 0.3021 0.1872 0.3244 -0.0213 0.0257  0.0493  415 LYS A CA    
1097 C C     . LYS B 119 ? 0.4231 0.3158 0.4398 -0.0310 0.0288  0.0535  415 LYS A C     
1098 O O     . LYS B 119 ? 0.3645 0.2437 0.3792 -0.0384 0.0331  0.0589  415 LYS A O     
1099 C CB    . LYS B 119 ? 0.4374 0.3196 0.4571 -0.0110 0.0214  0.0596  415 LYS A CB    
1100 C CG    . LYS B 119 ? 0.6962 0.5609 0.7243 -0.0022 0.0211  0.0602  415 LYS A CG    
1101 C CD    . LYS B 119 ? 0.8595 0.7082 0.8841 0.0021  0.0188  0.0758  415 LYS A CD    
1102 C CE    . LYS B 119 ? 0.9732 0.8041 1.0104 0.0131  0.0186  0.0767  415 LYS A CE    
1103 N NZ    . LYS B 119 ? 0.9965 0.8003 1.0312 0.0127  0.0197  0.0895  415 LYS A NZ    
1104 N N     . MET B 120 ? 0.3716 0.2853 0.3870 -0.0316 0.0279  0.0504  416 MET A N     
1105 C CA    . MET B 120 ? 0.3080 0.2310 0.3202 -0.0401 0.0327  0.0525  416 MET A CA    
1106 C C     . MET B 120 ? 0.3032 0.2245 0.3249 -0.0505 0.0372  0.0475  416 MET A C     
1107 O O     . MET B 120 ? 0.3242 0.2471 0.3453 -0.0592 0.0434  0.0512  416 MET A O     
1108 C CB    . MET B 120 ? 0.2689 0.2135 0.2816 -0.0380 0.0317  0.0472  416 MET A CB    
1109 C CG    . MET B 120 ? 0.3698 0.3195 0.3731 -0.0304 0.0273  0.0509  416 MET A CG    
1110 S SD    . MET B 120 ? 0.4594 0.4301 0.4667 -0.0279 0.0260  0.0415  416 MET A SD    
1111 C CE    . MET B 120 ? 0.5177 0.4985 0.5248 -0.0364 0.0348  0.0398  416 MET A CE    
1112 N N     . LYS B 121 ? 0.2782 0.1973 0.3083 -0.0508 0.0343  0.0386  417 LYS A N     
1113 C CA    . LYS B 121 ? 0.2318 0.1501 0.2714 -0.0615 0.0364  0.0327  417 LYS A CA    
1114 C C     . LYS B 121 ? 0.2573 0.1512 0.2965 -0.0643 0.0372  0.0315  417 LYS A C     
1115 O O     . LYS B 121 ? 0.3063 0.1984 0.3522 -0.0718 0.0363  0.0228  417 LYS A O     
1116 C CB    . LYS B 121 ? 0.2312 0.1676 0.2795 -0.0617 0.0315  0.0226  417 LYS A CB    
1117 C CG    . LYS B 121 ? 0.2408 0.1991 0.2927 -0.0589 0.0316  0.0230  417 LYS A CG    
1118 C CD    . LYS B 121 ? 0.3452 0.3127 0.4045 -0.0675 0.0385  0.0257  417 LYS A CD    
1119 C CE    . LYS B 121 ? 0.4293 0.4149 0.4900 -0.0632 0.0410  0.0259  417 LYS A CE    
1120 N NZ    . LYS B 121 ? 0.5164 0.5061 0.5768 -0.0702 0.0510  0.0304  417 LYS A NZ    
1121 N N     . GLN B 122 ? 0.2673 0.1422 0.2991 -0.0582 0.0383  0.0398  418 GLN A N     
1122 C CA    . GLN B 122 ? 0.3496 0.1974 0.3822 -0.0595 0.0404  0.0396  418 GLN A CA    
1123 C C     . GLN B 122 ? 0.3969 0.2412 0.4332 -0.0575 0.0379  0.0259  418 GLN A C     
1124 O O     . GLN B 122 ? 0.3363 0.1633 0.3752 -0.0643 0.0402  0.0193  418 GLN A O     
1125 C CB    . GLN B 122 ? 0.4543 0.2908 0.4900 -0.0738 0.0461  0.0420  418 GLN A CB    
1126 C CG    . GLN B 122 ? 0.4885 0.3277 0.5180 -0.0780 0.0508  0.0557  418 GLN A CG    
1127 C CD    . GLN B 122 ? 0.6143 0.4390 0.6318 -0.0677 0.0495  0.0698  418 GLN A CD    
1128 O OE1   . GLN B 122 ? 0.5908 0.3893 0.6056 -0.0677 0.0512  0.0778  418 GLN A OE1   
1129 N NE2   . GLN B 122 ? 0.6353 0.4774 0.6461 -0.0590 0.0454  0.0730  418 GLN A NE2   
1130 N N     . TYR B 123 ? 0.3398 0.2000 0.3749 -0.0493 0.0338  0.0210  419 TYR A N     
1131 C CA    . TYR B 123 ? 0.2629 0.1209 0.2978 -0.0467 0.0323  0.0090  419 TYR A CA    
1132 C C     . TYR B 123 ? 0.2659 0.1154 0.3004 -0.0332 0.0332  0.0117  419 TYR A C     
1133 O O     . TYR B 123 ? 0.2526 0.1158 0.2868 -0.0251 0.0305  0.0179  419 TYR A O     
1134 C CB    . TYR B 123 ? 0.2407 0.1230 0.2749 -0.0481 0.0275  0.0027  419 TYR A CB    
1135 C CG    . TYR B 123 ? 0.2786 0.1596 0.3082 -0.0484 0.0260  -0.0094 419 TYR A CG    
1136 C CD1   . TYR B 123 ? 0.2476 0.1328 0.2759 -0.0592 0.0226  -0.0182 419 TYR A CD1   
1137 C CD2   . TYR B 123 ? 0.2424 0.1198 0.2687 -0.0384 0.0278  -0.0120 419 TYR A CD2   
1138 C CE1   . TYR B 123 ? 0.2540 0.1378 0.2734 -0.0605 0.0209  -0.0291 419 TYR A CE1   
1139 C CE2   . TYR B 123 ? 0.2480 0.1240 0.2672 -0.0396 0.0283  -0.0233 419 TYR A CE2   
1140 C CZ    . TYR B 123 ? 0.2577 0.1361 0.2713 -0.0509 0.0247  -0.0317 419 TYR A CZ    
1141 O OH    . TYR B 123 ? 0.3051 0.1815 0.3071 -0.0532 0.0249  -0.0427 419 TYR A OH    
1142 N N     . GLU B 124 ? 0.2865 0.1140 0.3229 -0.0309 0.0372  0.0063  420 GLU A N     
1143 C CA    . GLU B 124 ? 0.3160 0.1351 0.3573 -0.0172 0.0387  0.0096  420 GLU A CA    
1144 C C     . GLU B 124 ? 0.2995 0.1119 0.3420 -0.0135 0.0431  -0.0047 420 GLU A C     
1145 O O     . GLU B 124 ? 0.3884 0.1900 0.4388 -0.0025 0.0467  -0.0044 420 GLU A O     
1146 C CB    . GLU B 124 ? 0.4144 0.2097 0.4597 -0.0141 0.0407  0.0208  420 GLU A CB    
1147 C CG    . GLU B 124 ? 0.6468 0.4498 0.6870 -0.0182 0.0374  0.0357  420 GLU A CG    
1148 C CD    . GLU B 124 ? 0.8377 0.6251 0.8790 -0.0102 0.0362  0.0518  420 GLU A CD    
1149 O OE1   . GLU B 124 ? 0.9133 0.7086 0.9468 -0.0125 0.0333  0.0642  420 GLU A OE1   
1150 O OE2   . GLU B 124 ? 0.8871 0.6539 0.9365 -0.0017 0.0381  0.0522  420 GLU A OE2   
1151 N N     . ALA B 125 ? 0.3335 0.1534 0.3682 -0.0223 0.0430  -0.0169 421 ALA A N     
1152 C CA    . ALA B 125 ? 0.3054 0.1193 0.3363 -0.0209 0.0481  -0.0315 421 ALA A CA    
1153 C C     . ALA B 125 ? 0.3651 0.1992 0.3952 -0.0131 0.0478  -0.0325 421 ALA A C     
1154 O O     . ALA B 125 ? 0.2936 0.1333 0.3139 -0.0171 0.0496  -0.0434 421 ALA A O     
1155 C CB    . ALA B 125 ? 0.3155 0.1264 0.3351 -0.0355 0.0471  -0.0437 421 ALA A CB    
1156 N N     . VAL B 126 ? 0.3096 0.1550 0.3488 -0.0033 0.0452  -0.0210 422 VAL A N     
1157 C CA    . VAL B 126 ? 0.3043 0.1687 0.3461 0.0038  0.0451  -0.0209 422 VAL A CA    
1158 C C     . VAL B 126 ? 0.2936 0.1592 0.3506 0.0165  0.0444  -0.0108 422 VAL A C     
1159 O O     . VAL B 126 ? 0.3403 0.2008 0.4003 0.0179  0.0399  0.0006  422 VAL A O     
1160 C CB    . VAL B 126 ? 0.3136 0.1995 0.3477 -0.0021 0.0384  -0.0174 422 VAL A CB    
1161 C CG1   . VAL B 126 ? 0.2863 0.1761 0.3224 -0.0039 0.0325  -0.0056 422 VAL A CG1   
1162 C CG2   . VAL B 126 ? 0.2589 0.1625 0.2960 0.0040  0.0387  -0.0170 422 VAL A CG2   
1163 N N     . ARG B 127 ? 0.2896 0.1617 0.3562 0.0251  0.0487  -0.0147 423 ARG A N     
1164 C CA    . ARG B 127 ? 0.2804 0.1575 0.3647 0.0377  0.0463  -0.0052 423 ARG A CA    
1165 C C     . ARG B 127 ? 0.3421 0.2438 0.4268 0.0382  0.0385  0.0031  423 ARG A C     
1166 O O     . ARG B 127 ? 0.3020 0.2173 0.3778 0.0318  0.0383  -0.0014 423 ARG A O     
1167 C CB    . ARG B 127 ? 0.3737 0.2496 0.4734 0.0474  0.0553  -0.0137 423 ARG A CB    
1168 C CG    . ARG B 127 ? 0.5379 0.3905 0.6342 0.0454  0.0657  -0.0271 423 ARG A CG    
1169 C CD    . ARG B 127 ? 0.5074 0.3603 0.6221 0.0566  0.0761  -0.0355 423 ARG A CD    
1170 N NE    . ARG B 127 ? 0.7764 0.6231 0.9135 0.0702  0.0732  -0.0255 423 ARG A NE    
1171 C CZ    . ARG B 127 ? 0.8076 0.6669 0.9647 0.0813  0.0756  -0.0259 423 ARG A CZ    
1172 N NH1   . ARG B 127 ? 0.8016 0.6578 0.9744 0.0919  0.0690  -0.0150 423 ARG A NH1   
1173 N NH2   . ARG B 127 ? 0.7388 0.6142 0.8997 0.0812  0.0845  -0.0369 423 ARG A NH2   
1174 N N     . PRO B 128 ? 0.3684 0.2749 0.4629 0.0455  0.0315  0.0154  424 PRO A N     
1175 C CA    . PRO B 128 ? 0.3163 0.2464 0.4133 0.0467  0.0245  0.0211  424 PRO A CA    
1176 C C     . PRO B 128 ? 0.2698 0.2155 0.3791 0.0506  0.0294  0.0130  424 PRO A C     
1177 O O     . PRO B 128 ? 0.3217 0.2628 0.4456 0.0581  0.0364  0.0076  424 PRO A O     
1178 C CB    . PRO B 128 ? 0.2737 0.2031 0.3797 0.0550  0.0162  0.0350  424 PRO A CB    
1179 C CG    . PRO B 128 ? 0.3764 0.2796 0.4796 0.0558  0.0185  0.0389  424 PRO A CG    
1180 C CD    . PRO B 128 ? 0.3522 0.2416 0.4556 0.0533  0.0295  0.0247  424 PRO A CD    
1181 N N     . ASP B 129 ? 0.2413 0.2054 0.3459 0.0454  0.0267  0.0122  425 ASP A N     
1182 C CA    . ASP B 129 ? 0.2667 0.2470 0.3830 0.0473  0.0315  0.0059  425 ASP A CA    
1183 C C     . ASP B 129 ? 0.3338 0.3234 0.4762 0.0592  0.0305  0.0093  425 ASP A C     
1184 O O     . ASP B 129 ? 0.3064 0.3009 0.4638 0.0638  0.0396  0.0017  425 ASP A O     
1185 C CB    . ASP B 129 ? 0.3153 0.3122 0.4244 0.0401  0.0268  0.0072  425 ASP A CB    
1186 C CG    . ASP B 129 ? 0.4523 0.4437 0.5416 0.0300  0.0303  0.0016  425 ASP A CG    
1187 O OD1   . ASP B 129 ? 0.4675 0.4482 0.5501 0.0279  0.0378  -0.0058 425 ASP A OD1   
1188 O OD2   . ASP B 129 ? 0.4881 0.4858 0.5686 0.0242  0.0252  0.0044  425 ASP A OD2   
1189 N N     . GLU B 130 ? 0.3405 0.3333 0.4890 0.0644  0.0195  0.0210  426 GLU A N     
1190 C CA    . GLU B 130 ? 0.4130 0.4176 0.5889 0.0763  0.0158  0.0258  426 GLU A CA    
1191 C C     . GLU B 130 ? 0.3152 0.3039 0.5070 0.0868  0.0242  0.0225  426 GLU A C     
1192 O O     . GLU B 130 ? 0.4178 0.4181 0.6373 0.0970  0.0269  0.0208  426 GLU A O     
1193 C CB    . GLU B 130 ? 0.4530 0.4629 0.6280 0.0791  0.0005  0.0404  426 GLU A CB    
1194 N N     . ALA B 131 ? 0.3211 0.2835 0.4980 0.0843  0.0288  0.0206  427 ALA A N     
1195 C CA    . ALA B 131 ? 0.3208 0.2650 0.5120 0.0934  0.0385  0.0149  427 ALA A CA    
1196 C C     . ALA B 131 ? 0.3378 0.2856 0.5328 0.0915  0.0538  -0.0021 427 ALA A C     
1197 O O     . ALA B 131 ? 0.3638 0.3074 0.5728 0.0987  0.0617  -0.0089 427 ALA A O     
1198 C CB    . ALA B 131 ? 0.4180 0.3317 0.5919 0.0894  0.0394  0.0167  427 ALA A CB    
1199 N N     . VAL B 132 ? 0.3436 0.3000 0.5191 0.0793  0.0567  -0.0089 428 VAL A N     
1200 C CA    . VAL B 132 ? 0.3933 0.3519 0.5665 0.0757  0.0714  -0.0239 428 VAL A CA    
1201 C C     . VAL B 132 ? 0.2928 0.2786 0.4878 0.0796  0.0749  -0.0256 428 VAL A C     
1202 O O     . VAL B 132 ? 0.2505 0.2398 0.4600 0.0844  0.0872  -0.0351 428 VAL A O     
1203 C CB    . VAL B 132 ? 0.3885 0.3415 0.5295 0.0606  0.0723  -0.0291 428 VAL A CB    
1204 C CG1   . VAL B 132 ? 0.4275 0.3831 0.5617 0.0558  0.0867  -0.0432 428 VAL A CG1   
1205 C CG2   . VAL B 132 ? 0.3561 0.2843 0.4795 0.0559  0.0696  -0.0288 428 VAL A CG2   
1206 N N     . TYR B 133 ? 0.2974 0.3031 0.4938 0.0762  0.0639  -0.0168 429 TYR A N     
1207 C CA    . TYR B 133 ? 0.2836 0.3163 0.4996 0.0768  0.0665  -0.0185 429 TYR A CA    
1208 C C     . TYR B 133 ? 0.3659 0.4161 0.6162 0.0893  0.0585  -0.0106 429 TYR A C     
1209 O O     . TYR B 133 ? 0.4432 0.5154 0.7107 0.0894  0.0610  -0.0134 429 TYR A O     
1210 C CB    . TYR B 133 ? 0.2199 0.2638 0.4182 0.0644  0.0598  -0.0151 429 TYR A CB    
1211 C CG    . TYR B 133 ? 0.2482 0.2773 0.4148 0.0529  0.0656  -0.0212 429 TYR A CG    
1212 C CD1   . TYR B 133 ? 0.2715 0.2923 0.4150 0.0454  0.0562  -0.0156 429 TYR A CD1   
1213 C CD2   . TYR B 133 ? 0.3514 0.3758 0.5115 0.0495  0.0806  -0.0324 429 TYR A CD2   
1214 C CE1   . TYR B 133 ? 0.2577 0.2671 0.3756 0.0357  0.0597  -0.0201 429 TYR A CE1   
1215 C CE2   . TYR B 133 ? 0.3233 0.3351 0.4533 0.0388  0.0838  -0.0367 429 TYR A CE2   
1216 C CZ    . TYR B 133 ? 0.3110 0.3160 0.4216 0.0324  0.0726  -0.0301 429 TYR A CZ    
1217 O OH    . TYR B 133 ? 0.2783 0.2729 0.3620 0.0227  0.0741  -0.0336 429 TYR A OH    
1218 N N     . GLY B 134 ? 0.4007 0.4405 0.6528 0.0966  0.0467  0.0001  430 GLY A N     
1219 C CA    . GLY B 134 ? 0.3988 0.4543 0.6715 0.1051  0.0342  0.0097  430 GLY A CA    
1220 C C     . GLY B 134 ? 0.4679 0.5447 0.7415 0.1002  0.0201  0.0183  430 GLY A C     
1221 O O     . GLY B 134 ? 0.4041 0.4838 0.6599 0.0887  0.0206  0.0158  430 GLY A O     
1222 N N     . LYS B 135 ? 0.5561 0.6462 0.8433 0.1067  0.0062  0.0279  431 LYS A N     
1223 C CA    . LYS B 135 ? 0.5436 0.6533 0.8295 0.1015  -0.0092 0.0360  431 LYS A CA    
1224 C C     . LYS B 135 ? 0.5536 0.6929 0.8645 0.1034  -0.0132 0.0339  431 LYS A C     
1225 O O     . LYS B 135 ? 0.5223 0.6657 0.8525 0.1135  -0.0123 0.0340  431 LYS A O     
1226 C CB    . LYS B 135 ? 0.4887 0.5873 0.7612 0.1052  -0.0251 0.0507  431 LYS A CB    
1227 N N     . GLY B 136 ? 0.4985 0.6580 0.8099 0.0931  -0.0169 0.0314  432 GLY A N     
1228 C CA    . GLY B 136 ? 0.5174 0.7062 0.8504 0.0930  -0.0246 0.0313  432 GLY A CA    
1229 C C     . GLY B 136 ? 0.6264 0.8276 0.9819 0.0947  -0.0096 0.0209  432 GLY A C     
1230 O O     . GLY B 136 ? 0.6407 0.8391 0.9910 0.0868  0.0054  0.0115  432 GLY A O     
1231 N N     . ALA B 137 ? 0.6648 0.8803 1.0447 0.1047  -0.0137 0.0231  433 ALA A N     
1232 C CA    . ALA B 137 ? 0.6657 0.8965 1.0698 0.1067  0.0002  0.0139  433 ALA A CA    
1233 C C     . ALA B 137 ? 0.6708 0.8794 1.0670 0.1085  0.0205  0.0048  433 ALA A C     
1234 O O     . ALA B 137 ? 0.7135 0.9248 1.1068 0.0999  0.0356  -0.0048 433 ALA A O     
1235 C CB    . ALA B 137 ? 0.6165 0.8647 1.0493 0.1195  -0.0086 0.0189  433 ALA A CB    
1236 N N     . LYS B 138 ? 0.6324 0.8173 1.0226 0.1187  0.0209  0.0078  434 LYS A N     
1237 C CA    . LYS B 138 ? 0.5535 0.7161 0.9359 0.1207  0.0390  -0.0016 434 LYS A CA    
1238 C C     . LYS B 138 ? 0.4993 0.6428 0.8514 0.1093  0.0474  -0.0067 434 LYS A C     
1239 O O     . LYS B 138 ? 0.4629 0.5838 0.8022 0.1101  0.0598  -0.0138 434 LYS A O     
1240 C CB    . LYS B 138 ? 0.5463 0.6882 0.9319 0.1342  0.0358  0.0033  434 LYS A CB    
1241 C CG    . LYS B 138 ? 0.5899 0.7498 1.0054 0.1468  0.0257  0.0100  434 LYS A CG    
1242 C CD    . LYS B 138 ? 0.6242 0.7608 1.0418 0.1602  0.0224  0.0160  434 LYS A CD    
1243 C CE    . LYS B 138 ? 0.5993 0.7248 1.0289 0.1670  0.0410  0.0040  434 LYS A CE    
1244 N NZ    . LYS B 138 ? 0.5737 0.7231 1.0399 0.1780  0.0416  0.0030  434 LYS A NZ    
1245 N N     . ARG B 139 ? 0.4643 0.6165 0.8049 0.0985  0.0411  -0.0040 435 ARG A N     
1246 C CA    . ARG B 139 ? 0.4550 0.5913 0.7691 0.0882  0.0487  -0.0084 435 ARG A CA    
1247 C C     . ARG B 139 ? 0.5347 0.6720 0.8449 0.0812  0.0679  -0.0207 435 ARG A C     
1248 O O     . ARG B 139 ? 0.6429 0.8015 0.9659 0.0760  0.0716  -0.0236 435 ARG A O     
1249 C CB    . ARG B 139 ? 0.3606 0.5072 0.6662 0.0788  0.0370  -0.0024 435 ARG A CB    
1250 C CG    . ARG B 139 ? 0.4336 0.5605 0.7094 0.0703  0.0401  -0.0035 435 ARG A CG    
1251 C CD    . ARG B 139 ? 0.5376 0.6626 0.7952 0.0653  0.0229  0.0059  435 ARG A CD    
1252 N NE    . ARG B 139 ? 0.5459 0.6484 0.7677 0.0566  0.0248  0.0048  435 ARG A NE    
1253 C CZ    . ARG B 139 ? 0.5210 0.6226 0.7263 0.0451  0.0300  0.0000  435 ARG A CZ    
1254 N NH1   . ARG B 139 ? 0.5874 0.7075 0.8066 0.0399  0.0345  -0.0040 435 ARG A NH1   
1255 N NH2   . ARG B 139 ? 0.5222 0.6048 0.6987 0.0389  0.0305  -0.0002 435 ARG A NH2   
1256 N N     . ALA B 140 ? 0.4833 0.5972 0.7738 0.0799  0.0799  -0.0277 436 ALA A N     
1257 C CA    . ALA B 140 ? 0.3492 0.4608 0.6305 0.0732  0.0982  -0.0393 436 ALA A CA    
1258 C C     . ALA B 140 ? 0.3831 0.4692 0.6324 0.0668  0.1058  -0.0448 436 ALA A C     
1259 O O     . ALA B 140 ? 0.3795 0.4464 0.6195 0.0711  0.1001  -0.0420 436 ALA A O     
1260 C CB    . ALA B 140 ? 0.3018 0.4155 0.6013 0.0820  0.1079  -0.0459 436 ALA A CB    
1261 N N     . VAL B 141 ? 0.4353 0.5210 0.6667 0.0558  0.1181  -0.0519 437 VAL A N     
1262 C CA    . VAL B 141 ? 0.4038 0.4665 0.6025 0.0489  0.1259  -0.0583 437 VAL A CA    
1263 C C     . VAL B 141 ? 0.3905 0.4379 0.5864 0.0540  0.1361  -0.0681 437 VAL A C     
1264 O O     . VAL B 141 ? 0.3952 0.4522 0.6028 0.0555  0.1462  -0.0740 437 VAL A O     
1265 C CB    . VAL B 141 ? 0.4927 0.5593 0.6698 0.0348  0.1343  -0.0610 437 VAL A CB    
1266 C CG1   . VAL B 141 ? 0.5353 0.5785 0.6745 0.0269  0.1391  -0.0665 437 VAL A CG1   
1267 C CG2   . VAL B 141 ? 0.4566 0.5368 0.6366 0.0289  0.1227  -0.0509 437 VAL A CG2   
1268 N N     . PRO B 142 ? 0.4213 0.4452 0.6033 0.0566  0.1342  -0.0704 438 PRO A N     
1269 C CA    . PRO B 142 ? 0.4739 0.4818 0.6541 0.0609  0.1433  -0.0802 438 PRO A CA    
1270 C C     . PRO B 142 ? 0.4933 0.4929 0.6444 0.0495  0.1574  -0.0922 438 PRO A C     
1271 O O     . PRO B 142 ? 0.4938 0.4989 0.6250 0.0385  0.1594  -0.0916 438 PRO A O     
1272 C CB    . PRO B 142 ? 0.5048 0.4895 0.6776 0.0648  0.1345  -0.0772 438 PRO A CB    
1273 C CG    . PRO B 142 ? 0.4719 0.4561 0.6282 0.0574  0.1259  -0.0705 438 PRO A CG    
1274 C CD    . PRO B 142 ? 0.3599 0.3707 0.5285 0.0550  0.1233  -0.0641 438 PRO A CD    
1275 N N     . ASP B 143 ? 0.5284 0.5143 0.6764 0.0521  0.1668  -0.1027 439 ASP A N     
1276 C CA    . ASP B 143 ? 0.5750 0.5524 0.6944 0.0414  0.1800  -0.1147 439 ASP A CA    
1277 C C     . ASP B 143 ? 0.5309 0.4920 0.6123 0.0293  0.1754  -0.1160 439 ASP A C     
1278 O O     . ASP B 143 ? 0.4408 0.3901 0.5190 0.0308  0.1646  -0.1114 439 ASP A O     
1279 C CB    . ASP B 143 ? 0.6987 0.6625 0.8231 0.0471  0.1898  -0.1263 439 ASP A CB    
1280 C CG    . ASP B 143 ? 0.9502 0.9317 1.1039 0.0551  0.1999  -0.1292 439 ASP A CG    
1281 O OD1   . ASP B 143 ? 1.0718 1.0453 1.2418 0.0645  0.2054  -0.1355 439 ASP A OD1   
1282 O OD2   . ASP B 143 ? 0.9688 0.9720 1.1299 0.0517  0.2025  -0.1252 439 ASP A OD2   
1283 N N     . GLU B 144 ? 0.5335 0.4939 0.5853 0.0170  0.1834  -0.1219 440 GLU A N     
1284 C CA    . GLU B 144 ? 0.5499 0.4977 0.5631 0.0043  0.1780  -0.1223 440 GLU A CA    
1285 C C     . GLU B 144 ? 0.5731 0.4982 0.5746 0.0040  0.1713  -0.1272 440 GLU A C     
1286 O O     . GLU B 144 ? 0.5284 0.4475 0.5160 -0.0008 0.1602  -0.1220 440 GLU A O     
1287 C CB    . GLU B 144 ? 0.6722 0.6197 0.6543 -0.0081 0.1879  -0.1287 440 GLU A CB    
1288 C CG    . GLU B 144 ? 0.7836 0.7184 0.7237 -0.0215 0.1805  -0.1288 440 GLU A CG    
1289 C CD    . GLU B 144 ? 0.9433 0.8829 0.8537 -0.0337 0.1865  -0.1283 440 GLU A CD    
1290 O OE1   . GLU B 144 ? 0.9438 0.8976 0.8585 -0.0358 0.1865  -0.1184 440 GLU A OE1   
1291 O OE2   . GLU B 144 ? 1.0010 0.9296 0.8839 -0.0416 0.1909  -0.1374 440 GLU A OE2   
1292 N N     . PRO B 145 ? 0.5102 0.4220 0.5166 0.0081  0.1773  -0.1372 441 PRO A N     
1293 C CA    . PRO B 145 ? 0.4596 0.3496 0.4571 0.0069  0.1698  -0.1406 441 PRO A CA    
1294 C C     . PRO B 145 ? 0.4512 0.3398 0.4698 0.0150  0.1575  -0.1292 441 PRO A C     
1295 O O     . PRO B 145 ? 0.4456 0.3231 0.4489 0.0087  0.1475  -0.1268 441 PRO A O     
1296 C CB    . PRO B 145 ? 0.5419 0.4204 0.5493 0.0125  0.1802  -0.1521 441 PRO A CB    
1297 C CG    . PRO B 145 ? 0.5374 0.4288 0.5418 0.0104  0.1941  -0.1583 441 PRO A CG    
1298 C CD    . PRO B 145 ? 0.4905 0.4050 0.5080 0.0124  0.1918  -0.1467 441 PRO A CD    
1299 N N     . VAL B 146 ? 0.4422 0.3426 0.4955 0.0284  0.1570  -0.1214 442 VAL A N     
1300 C CA    . VAL B 146 ? 0.3808 0.2799 0.4529 0.0362  0.1445  -0.1091 442 VAL A CA    
1301 C C     . VAL B 146 ? 0.4318 0.3414 0.4943 0.0304  0.1364  -0.1005 442 VAL A C     
1302 O O     . VAL B 146 ? 0.3870 0.2904 0.4432 0.0276  0.1221  -0.0912 442 VAL A O     
1303 C CB    . VAL B 146 ? 0.4491 0.3606 0.5590 0.0514  0.1441  -0.1019 442 VAL A CB    
1304 C CG1   . VAL B 146 ? 0.4178 0.3327 0.5441 0.0582  0.1298  -0.0867 442 VAL A CG1   
1305 C CG2   . VAL B 146 ? 0.4726 0.3691 0.5927 0.0583  0.1507  -0.1095 442 VAL A CG2   
1306 N N     . LEU B 147 ? 0.3273 0.2560 0.3859 0.0262  0.1404  -0.0991 443 LEU A N     
1307 C CA    . LEU B 147 ? 0.2840 0.2259 0.3318 0.0191  0.1270  -0.0862 443 LEU A CA    
1308 C C     . LEU B 147 ? 0.3538 0.2833 0.3682 0.0067  0.1185  -0.0864 443 LEU A C     
1309 O O     . LEU B 147 ? 0.3112 0.2418 0.3229 0.0046  0.1037  -0.0757 443 LEU A O     
1310 C CB    . LEU B 147 ? 0.4411 0.4023 0.4901 0.0157  0.1350  -0.0858 443 LEU A CB    
1311 C CG    . LEU B 147 ? 0.3814 0.3533 0.4176 0.0075  0.1233  -0.0737 443 LEU A CG    
1312 C CD1   . LEU B 147 ? 0.2342 0.2145 0.2909 0.0140  0.1084  -0.0610 443 LEU A CD1   
1313 C CD2   . LEU B 147 ? 0.3210 0.3083 0.3576 0.0029  0.1341  -0.0746 443 LEU A CD2   
1314 N N     . ALA B 148 ? 0.3580 0.2767 0.3470 -0.0016 0.1278  -0.0990 444 ALA A N     
1315 C CA    . ALA B 148 ? 0.4083 0.3185 0.3650 -0.0144 0.1187  -0.0994 444 ALA A CA    
1316 C C     . ALA B 148 ? 0.4012 0.2974 0.3599 -0.0145 0.1078  -0.0981 444 ALA A C     
1317 O O     . ALA B 148 ? 0.3298 0.2274 0.2767 -0.0215 0.0941  -0.0908 444 ALA A O     
1318 C CB    . ALA B 148 ? 0.5042 0.4051 0.4318 -0.0237 0.1311  -0.1144 444 ALA A CB    
1319 N N     . GLU B 149 ? 0.3833 0.2657 0.3583 -0.0070 0.1143  -0.1051 445 GLU A N     
1320 C CA    . GLU B 149 ? 0.3750 0.2431 0.3547 -0.0072 0.1051  -0.1023 445 GLU A CA    
1321 C C     . GLU B 149 ? 0.3042 0.1845 0.2985 -0.0032 0.0913  -0.0848 445 GLU A C     
1322 O O     . GLU B 149 ? 0.3818 0.2599 0.3685 -0.0098 0.0800  -0.0793 445 GLU A O     
1323 C CB    . GLU B 149 ? 0.3535 0.2035 0.3519 0.0022  0.1154  -0.1106 445 GLU A CB    
1324 C CG    . GLU B 149 ? 0.5948 0.4324 0.6073 0.0058  0.1062  -0.1019 445 GLU A CG    
1325 C CD    . GLU B 149 ? 0.7326 0.5456 0.7462 0.0059  0.1122  -0.1122 445 GLU A CD    
1326 O OE1   . GLU B 149 ? 0.6566 0.4557 0.6737 0.0039  0.1050  -0.1070 445 GLU A OE1   
1327 O OE2   . GLU B 149 ? 0.7162 0.5274 0.7273 0.0074  0.1224  -0.1230 445 GLU A OE2   
1328 N N     . HIS B 150 ? 0.3158 0.2101 0.3319 0.0071  0.0923  -0.0767 446 HIS A N     
1329 C CA    . HIS B 150 ? 0.2605 0.1661 0.2885 0.0105  0.0800  -0.0614 446 HIS A CA    
1330 C C     . HIS B 150 ? 0.2949 0.2113 0.3059 0.0010  0.0705  -0.0555 446 HIS A C     
1331 O O     . HIS B 150 ? 0.2660 0.1820 0.2754 -0.0021 0.0603  -0.0482 446 HIS A O     
1332 C CB    . HIS B 150 ? 0.2921 0.2130 0.3446 0.0216  0.0823  -0.0553 446 HIS A CB    
1333 C CG    . HIS B 150 ? 0.2664 0.1985 0.3289 0.0246  0.0701  -0.0411 446 HIS A CG    
1334 N ND1   . HIS B 150 ? 0.2824 0.2048 0.3460 0.0253  0.0619  -0.0338 446 HIS A ND1   
1335 C CD2   . HIS B 150 ? 0.2780 0.2294 0.3479 0.0258  0.0652  -0.0335 446 HIS A CD2   
1336 C CE1   . HIS B 150 ? 0.2468 0.1824 0.3163 0.0270  0.0529  -0.0226 446 HIS A CE1   
1337 N NE2   . HIS B 150 ? 0.2072 0.1602 0.2810 0.0274  0.0543  -0.0228 446 HIS A NE2   
1338 N N     . LEU B 151 ? 0.2683 0.1938 0.2668 -0.0038 0.0744  -0.0584 447 LEU A N     
1339 C CA    . LEU B 151 ? 0.2674 0.2024 0.2526 -0.0110 0.0650  -0.0511 447 LEU A CA    
1340 C C     . LEU B 151 ? 0.2452 0.1716 0.2130 -0.0201 0.0570  -0.0530 447 LEU A C     
1341 O O     . LEU B 151 ? 0.2484 0.1809 0.2167 -0.0225 0.0463  -0.0448 447 LEU A O     
1342 C CB    . LEU B 151 ? 0.2418 0.1851 0.2154 -0.0150 0.0713  -0.0528 447 LEU A CB    
1343 C CG    . LEU B 151 ? 0.2992 0.2554 0.2916 -0.0083 0.0789  -0.0506 447 LEU A CG    
1344 C CD1   . LEU B 151 ? 0.2437 0.2081 0.2223 -0.0152 0.0821  -0.0483 447 LEU A CD1   
1345 C CD2   . LEU B 151 ? 0.2571 0.2224 0.2719 -0.0012 0.0704  -0.0407 447 LEU A CD2   
1346 N N     . VAL B 152 ? 0.2702 0.1836 0.2232 -0.0255 0.0624  -0.0647 448 VAL A N     
1347 C CA    . VAL B 152 ? 0.3743 0.2802 0.3127 -0.0352 0.0540  -0.0678 448 VAL A CA    
1348 C C     . VAL B 152 ? 0.3587 0.2600 0.3134 -0.0331 0.0477  -0.0629 448 VAL A C     
1349 O O     . VAL B 152 ? 0.2644 0.1701 0.2171 -0.0390 0.0372  -0.0583 448 VAL A O     
1350 C CB    . VAL B 152 ? 0.4340 0.3251 0.3529 -0.0421 0.0620  -0.0835 448 VAL A CB    
1351 C CG1   . VAL B 152 ? 0.3273 0.2110 0.2342 -0.0529 0.0524  -0.0878 448 VAL A CG1   
1352 C CG2   . VAL B 152 ? 0.4127 0.3093 0.3099 -0.0465 0.0679  -0.0871 448 VAL A CG2   
1353 N N     . ARG B 153 ? 0.2707 0.1634 0.2424 -0.0247 0.0541  -0.0633 449 ARG A N     
1354 C CA    . ARG B 153 ? 0.2642 0.1511 0.2488 -0.0235 0.0487  -0.0568 449 ARG A CA    
1355 C C     . ARG B 153 ? 0.2380 0.1413 0.2306 -0.0217 0.0398  -0.0435 449 ARG A C     
1356 O O     . ARG B 153 ? 0.2330 0.1369 0.2281 -0.0263 0.0332  -0.0388 449 ARG A O     
1357 C CB    . ARG B 153 ? 0.2722 0.1459 0.2730 -0.0138 0.0563  -0.0573 449 ARG A CB    
1358 C CG    . ARG B 153 ? 0.3025 0.1532 0.2977 -0.0174 0.0641  -0.0710 449 ARG A CG    
1359 C CD    . ARG B 153 ? 0.3131 0.1492 0.3270 -0.0059 0.0718  -0.0707 449 ARG A CD    
1360 N NE    . ARG B 153 ? 0.3450 0.1564 0.3539 -0.0093 0.0804  -0.0852 449 ARG A NE    
1361 C CZ    . ARG B 153 ? 0.5260 0.3197 0.5310 -0.0177 0.0776  -0.0877 449 ARG A CZ    
1362 N NH1   . ARG B 153 ? 0.4694 0.2692 0.4760 -0.0232 0.0672  -0.0761 449 ARG A NH1   
1363 N NH2   . ARG B 153 ? 0.4458 0.2187 0.4460 -0.0211 0.0849  -0.1012 449 ARG A NH2   
1364 N N     . LYS B 154 ? 0.2228 0.1397 0.2200 -0.0157 0.0405  -0.0382 450 LYS A N     
1365 C CA    . LYS B 154 ? 0.2010 0.1322 0.2042 -0.0146 0.0329  -0.0276 450 LYS A CA    
1366 C C     . LYS B 154 ? 0.2491 0.1870 0.2418 -0.0229 0.0254  -0.0268 450 LYS A C     
1367 O O     . LYS B 154 ? 0.2275 0.1712 0.2260 -0.0245 0.0191  -0.0209 450 LYS A O     
1368 C CB    . LYS B 154 ? 0.1892 0.1324 0.1986 -0.0083 0.0354  -0.0241 450 LYS A CB    
1369 C CG    . LYS B 154 ? 0.2169 0.1608 0.2428 0.0012  0.0387  -0.0208 450 LYS A CG    
1370 C CD    . LYS B 154 ? 0.3523 0.3124 0.3857 0.0042  0.0350  -0.0136 450 LYS A CD    
1371 C CE    . LYS B 154 ? 0.3791 0.3473 0.4184 0.0074  0.0415  -0.0170 450 LYS A CE    
1372 N NZ    . LYS B 154 ? 0.3304 0.3137 0.3795 0.0096  0.0379  -0.0110 450 LYS A NZ    
1373 N N     . ALA B 155 ? 0.2144 0.1522 0.1919 -0.0279 0.0259  -0.0323 451 ALA A N     
1374 C CA    . ALA B 155 ? 0.2103 0.1550 0.1782 -0.0350 0.0168  -0.0302 451 ALA A CA    
1375 C C     . ALA B 155 ? 0.2334 0.1740 0.2020 -0.0419 0.0112  -0.0332 451 ALA A C     
1376 O O     . ALA B 155 ? 0.2091 0.1595 0.1834 -0.0448 0.0027  -0.0280 451 ALA A O     
1377 C CB    . ALA B 155 ? 0.2269 0.1706 0.1746 -0.0396 0.0184  -0.0348 451 ALA A CB    
1378 N N     . ALA B 156 ? 0.2702 0.1961 0.2351 -0.0449 0.0164  -0.0421 452 ALA A N     
1379 C CA    . ALA B 156 ? 0.2610 0.1815 0.2287 -0.0528 0.0120  -0.0455 452 ALA A CA    
1380 C C     . ALA B 156 ? 0.2277 0.1525 0.2140 -0.0500 0.0104  -0.0367 452 ALA A C     
1381 O O     . ALA B 156 ? 0.2257 0.1571 0.2181 -0.0566 0.0040  -0.0350 452 ALA A O     
1382 C CB    . ALA B 156 ? 0.2688 0.1691 0.2302 -0.0560 0.0197  -0.0571 452 ALA A CB    
1383 N N     . ALA B 157 ? 0.2183 0.1401 0.2137 -0.0409 0.0162  -0.0314 453 ALA A N     
1384 C CA    . ALA B 157 ? 0.2128 0.1389 0.2212 -0.0391 0.0150  -0.0225 453 ALA A CA    
1385 C C     . ALA B 157 ? 0.2729 0.2179 0.2856 -0.0397 0.0085  -0.0167 453 ALA A C     
1386 O O     . ALA B 157 ? 0.2248 0.1763 0.2459 -0.0442 0.0056  -0.0138 453 ALA A O     
1387 C CB    . ALA B 157 ? 0.2138 0.1353 0.2286 -0.0291 0.0202  -0.0168 453 ALA A CB    
1388 N N     . ILE B 158 ? 0.1968 0.1505 0.2051 -0.0354 0.0070  -0.0153 454 ILE A N     
1389 C CA    . ILE B 158 ? 0.1872 0.1562 0.2010 -0.0348 0.0013  -0.0099 454 ILE A CA    
1390 C C     . ILE B 158 ? 0.1710 0.1468 0.1866 -0.0425 -0.0062 -0.0116 454 ILE A C     
1391 O O     . ILE B 158 ? 0.2484 0.2348 0.2768 -0.0437 -0.0092 -0.0081 454 ILE A O     
1392 C CB    . ILE B 158 ? 0.1874 0.1608 0.1948 -0.0304 0.0011  -0.0083 454 ILE A CB    
1393 C CG1   . ILE B 158 ? 0.2144 0.1862 0.2257 -0.0231 0.0071  -0.0058 454 ILE A CG1   
1394 C CG2   . ILE B 158 ? 0.2082 0.1940 0.2210 -0.0302 -0.0056 -0.0033 454 ILE A CG2   
1395 C CD1   . ILE B 158 ? 0.1746 0.1472 0.1789 -0.0204 0.0100  -0.0067 454 ILE A CD1   
1396 N N     . TRP B 159 ? 0.2230 0.1935 0.2261 -0.0483 -0.0092 -0.0178 455 TRP A N     
1397 C CA    . TRP B 159 ? 0.1959 0.1735 0.1995 -0.0569 -0.0184 -0.0203 455 TRP A CA    
1398 C C     . TRP B 159 ? 0.3184 0.2978 0.3374 -0.0624 -0.0180 -0.0210 455 TRP A C     
1399 O O     . TRP B 159 ? 0.2136 0.2079 0.2462 -0.0658 -0.0246 -0.0185 455 TRP A O     
1400 C CB    . TRP B 159 ? 0.2186 0.1860 0.2020 -0.0635 -0.0195 -0.0290 455 TRP A CB    
1401 C CG    . TRP B 159 ? 0.3540 0.3293 0.3322 -0.0731 -0.0313 -0.0319 455 TRP A CG    
1402 C CD1   . TRP B 159 ? 0.4519 0.4222 0.4268 -0.0840 -0.0343 -0.0407 455 TRP A CD1   
1403 C CD2   . TRP B 159 ? 0.3024 0.2920 0.2779 -0.0731 -0.0428 -0.0258 455 TRP A CD2   
1404 N NE1   . TRP B 159 ? 0.4348 0.4178 0.4052 -0.0912 -0.0481 -0.0407 455 TRP A NE1   
1405 C CE2   . TRP B 159 ? 0.3304 0.3253 0.3012 -0.0840 -0.0539 -0.0308 455 TRP A CE2   
1406 C CE3   . TRP B 159 ? 0.3186 0.3162 0.2961 -0.0651 -0.0454 -0.0163 455 TRP A CE3   
1407 C CZ2   . TRP B 159 ? 0.3744 0.3837 0.3423 -0.0862 -0.0686 -0.0252 455 TRP A CZ2   
1408 C CZ3   . TRP B 159 ? 0.3985 0.4077 0.3734 -0.0669 -0.0587 -0.0106 455 TRP A CZ3   
1409 C CH2   . TRP B 159 ? 0.3054 0.3210 0.2756 -0.0769 -0.0708 -0.0144 455 TRP A CH2   
1410 N N     . ALA B 160 ? 0.2198 0.1839 0.2381 -0.0634 -0.0100 -0.0241 456 ALA A N     
1411 C CA    . ALA B 160 ? 0.2755 0.2380 0.3062 -0.0704 -0.0084 -0.0244 456 ALA A CA    
1412 C C     . ALA B 160 ? 0.2739 0.2465 0.3195 -0.0662 -0.0049 -0.0158 456 ALA A C     
1413 O O     . ALA B 160 ? 0.2854 0.2657 0.3445 -0.0728 -0.0051 -0.0148 456 ALA A O     
1414 C CB    . ALA B 160 ? 0.2349 0.1741 0.2595 -0.0726 -0.0006 -0.0291 456 ALA A CB    
1415 N N     . LEU B 161 ? 0.1777 0.1507 0.2208 -0.0563 -0.0011 -0.0105 457 LEU A N     
1416 C CA    . LEU B 161 ? 0.2114 0.1909 0.2639 -0.0529 0.0035  -0.0037 457 LEU A CA    
1417 C C     . LEU B 161 ? 0.2761 0.2756 0.3402 -0.0508 0.0000  -0.0012 457 LEU A C     
1418 O O     . LEU B 161 ? 0.2156 0.2220 0.2885 -0.0503 0.0049  0.0023  457 LEU A O     
1419 C CB    . LEU B 161 ? 0.2101 0.1814 0.2548 -0.0440 0.0083  0.0004  457 LEU A CB    
1420 C CG    . LEU B 161 ? 0.2800 0.2316 0.3182 -0.0437 0.0128  -0.0001 457 LEU A CG    
1421 C CD1   . LEU B 161 ? 0.3281 0.2763 0.3614 -0.0338 0.0149  0.0035  457 LEU A CD1   
1422 C CD2   . LEU B 161 ? 0.2316 0.1757 0.2744 -0.0496 0.0171  0.0039  457 LEU A CD2   
1423 N N     . GLU B 162 ? 0.2278 0.2357 0.2916 -0.0495 -0.0076 -0.0028 458 GLU A N     
1424 C CA    . GLU B 162 ? 0.1789 0.2033 0.2556 -0.0453 -0.0107 0.0004  458 GLU A CA    
1425 C C     . GLU B 162 ? 0.1847 0.2231 0.2818 -0.0502 -0.0094 0.0004  458 GLU A C     
1426 O O     . GLU B 162 ? 0.1971 0.2443 0.3052 -0.0465 -0.0040 0.0026  458 GLU A O     
1427 C CB    . GLU B 162 ? 0.1799 0.2095 0.2530 -0.0440 -0.0206 0.0004  458 GLU A CB    
1428 C CG    . GLU B 162 ? 0.3139 0.3602 0.4049 -0.0395 -0.0254 0.0041  458 GLU A CG    
1429 C CD    . GLU B 162 ? 0.4967 0.5447 0.5810 -0.0367 -0.0356 0.0071  458 GLU A CD    
1430 O OE1   . GLU B 162 ? 0.4815 0.5182 0.5451 -0.0388 -0.0374 0.0058  458 GLU A OE1   
1431 O OE2   . GLU B 162 ? 0.5147 0.5747 0.6144 -0.0322 -0.0413 0.0112  458 GLU A OE2   
1432 N N     . ARG B 163 ? 0.1628 0.2038 0.2655 -0.0595 -0.0136 -0.0029 459 ARG A N     
1433 C CA    . ARG B 163 ? 0.1794 0.2365 0.3050 -0.0658 -0.0125 -0.0034 459 ARG A CA    
1434 C C     . ARG B 163 ? 0.2677 0.3217 0.3970 -0.0676 0.0005  -0.0012 459 ARG A C     
1435 O O     . ARG B 163 ? 0.2228 0.2918 0.3685 -0.0655 0.0056  0.0001  459 ARG A O     
1436 C CB    . ARG B 163 ? 0.3276 0.3863 0.4563 -0.0772 -0.0202 -0.0083 459 ARG A CB    
1437 C CG    . ARG B 163 ? 0.5364 0.6192 0.6931 -0.0835 -0.0251 -0.0093 459 ARG A CG    
1438 C CD    . ARG B 163 ? 0.7836 0.8660 0.9409 -0.0971 -0.0330 -0.0154 459 ARG A CD    
1439 N NE    . ARG B 163 ? 0.8765 0.9398 1.0062 -0.0984 -0.0385 -0.0194 459 ARG A NE    
1440 C CZ    . ARG B 163 ? 0.8580 0.9250 0.9770 -0.0952 -0.0503 -0.0195 459 ARG A CZ    
1441 N NH1   . ARG B 163 ? 0.8132 0.9013 0.9478 -0.0895 -0.0594 -0.0145 459 ARG A NH1   
1442 N NH2   . ARG B 163 ? 0.8521 0.9010 0.9445 -0.0975 -0.0524 -0.0243 459 ARG A NH2   
1443 N N     . PRO B 164 ? 0.3393 0.3742 0.4544 -0.0715 0.0067  -0.0005 460 PRO A N     
1444 C CA    . PRO B 164 ? 0.3021 0.3336 0.4176 -0.0734 0.0184  0.0037  460 PRO A CA    
1445 C C     . PRO B 164 ? 0.2632 0.2983 0.3737 -0.0639 0.0235  0.0070  460 PRO A C     
1446 O O     . PRO B 164 ? 0.1986 0.2406 0.3146 -0.0658 0.0324  0.0090  460 PRO A O     
1447 C CB    . PRO B 164 ? 0.2973 0.3041 0.3960 -0.0767 0.0214  0.0054  460 PRO A CB    
1448 C CG    . PRO B 164 ? 0.3138 0.3112 0.4016 -0.0732 0.0132  0.0010  460 PRO A CG    
1449 C CD    . PRO B 164 ? 0.3307 0.3460 0.4302 -0.0754 0.0040  -0.0036 460 PRO A CD    
1450 N N     . PHE B 165 ? 0.1696 0.1997 0.2688 -0.0549 0.0187  0.0071  461 PHE A N     
1451 C CA    . PHE B 165 ? 0.2434 0.2766 0.3381 -0.0472 0.0229  0.0089  461 PHE A CA    
1452 C C     . PHE B 165 ? 0.1855 0.2377 0.2990 -0.0447 0.0239  0.0064  461 PHE A C     
1453 O O     . PHE B 165 ? 0.1525 0.2105 0.2688 -0.0439 0.0326  0.0062  461 PHE A O     
1454 C CB    . PHE B 165 ? 0.1330 0.1568 0.2136 -0.0397 0.0177  0.0092  461 PHE A CB    
1455 C CG    . PHE B 165 ? 0.1902 0.1986 0.2545 -0.0383 0.0206  0.0127  461 PHE A CG    
1456 C CD1   . PHE B 165 ? 0.1641 0.1717 0.2199 -0.0340 0.0240  0.0155  461 PHE A CD1   
1457 C CD2   . PHE B 165 ? 0.1903 0.1849 0.2488 -0.0414 0.0194  0.0132  461 PHE A CD2   
1458 C CE1   . PHE B 165 ? 0.2809 0.2762 0.3236 -0.0323 0.0247  0.0202  461 PHE A CE1   
1459 C CE2   . PHE B 165 ? 0.2097 0.1902 0.2568 -0.0387 0.0215  0.0175  461 PHE A CE2   
1460 C CZ    . PHE B 165 ? 0.1850 0.1667 0.2249 -0.0338 0.0234  0.0218  461 PHE A CZ    
1461 N N     . LEU B 166 ? 0.1219 0.1838 0.2485 -0.0434 0.0152  0.0044  462 LEU A N     
1462 C CA    . LEU B 166 ? 0.1800 0.2604 0.3294 -0.0397 0.0154  0.0027  462 LEU A CA    
1463 C C     . LEU B 166 ? 0.2122 0.3062 0.3801 -0.0466 0.0240  0.0011  462 LEU A C     
1464 O O     . LEU B 166 ? 0.2564 0.3627 0.4392 -0.0432 0.0318  -0.0010 462 LEU A O     
1465 C CB    . LEU B 166 ? 0.1759 0.2643 0.3358 -0.0376 0.0021  0.0030  462 LEU A CB    
1466 C CG    . LEU B 166 ? 0.2087 0.2872 0.3541 -0.0300 -0.0049 0.0051  462 LEU A CG    
1467 C CD1   . LEU B 166 ? 0.2652 0.3508 0.4171 -0.0298 -0.0189 0.0070  462 LEU A CD1   
1468 C CD2   . LEU B 166 ? 0.2608 0.3398 0.4099 -0.0213 0.0009  0.0050  462 LEU A CD2   
1469 N N     . ASP B 167 ? 0.2167 0.3078 0.3842 -0.0567 0.0241  0.0015  463 ASP A N     
1470 C CA    . ASP B 167 ? 0.2000 0.3031 0.3845 -0.0654 0.0337  0.0006  463 ASP A CA    
1471 C C     . ASP B 167 ? 0.1537 0.2519 0.3272 -0.0655 0.0486  0.0021  463 ASP A C     
1472 O O     . ASP B 167 ? 0.1405 0.2541 0.3305 -0.0671 0.0591  -0.0003 463 ASP A O     
1473 C CB    . ASP B 167 ? 0.3533 0.4485 0.5352 -0.0775 0.0314  0.0010  463 ASP A CB    
1474 C CG    . ASP B 167 ? 0.5847 0.6951 0.7874 -0.0822 0.0196  -0.0025 463 ASP A CG    
1475 O OD1   . ASP B 167 ? 0.7295 0.8312 0.9275 -0.0920 0.0152  -0.0040 463 ASP A OD1   
1476 O OD2   . ASP B 167 ? 0.6218 0.7522 0.8455 -0.0761 0.0142  -0.0037 463 ASP A OD2   
1477 N N     . GLU B 168 ? 0.1581 0.2357 0.3037 -0.0643 0.0501  0.0059  464 GLU A N     
1478 C CA    . GLU B 168 ? 0.2069 0.2801 0.3385 -0.0653 0.0625  0.0082  464 GLU A CA    
1479 C C     . GLU B 168 ? 0.1471 0.2291 0.2812 -0.0564 0.0660  0.0037  464 GLU A C     
1480 O O     . GLU B 168 ? 0.1701 0.2604 0.3069 -0.0585 0.0785  0.0013  464 GLU A O     
1481 C CB    . GLU B 168 ? 0.2315 0.2817 0.3344 -0.0656 0.0611  0.0146  464 GLU A CB    
1482 C CG    . GLU B 168 ? 0.3764 0.4215 0.4632 -0.0707 0.0732  0.0193  464 GLU A CG    
1483 C CD    . GLU B 168 ? 0.6779 0.7014 0.7375 -0.0695 0.0701  0.0275  464 GLU A CD    
1484 O OE1   . GLU B 168 ? 0.7586 0.7702 0.8151 -0.0661 0.0606  0.0290  464 GLU A OE1   
1485 O OE2   . GLU B 168 ? 0.7725 0.7914 0.8139 -0.0719 0.0772  0.0324  464 GLU A OE2   
1486 N N     . LEU B 169 ? 0.1358 0.2152 0.2685 -0.0473 0.0562  0.0021  465 LEU A N     
1487 C CA    . LEU B 169 ? 0.1310 0.2171 0.2693 -0.0391 0.0591  -0.0028 465 LEU A CA    
1488 C C     . LEU B 169 ? 0.1635 0.2699 0.3315 -0.0388 0.0663  -0.0079 465 LEU A C     
1489 O O     . LEU B 169 ? 0.1534 0.2653 0.3239 -0.0367 0.0778  -0.0130 465 LEU A O     
1490 C CB    . LEU B 169 ? 0.1206 0.2013 0.2577 -0.0308 0.0469  -0.0027 465 LEU A CB    
1491 C CG    . LEU B 169 ? 0.2410 0.3045 0.3517 -0.0291 0.0426  0.0004  465 LEU A CG    
1492 C CD1   . LEU B 169 ? 0.1914 0.2507 0.3025 -0.0233 0.0315  0.0011  465 LEU A CD1   
1493 C CD2   . LEU B 169 ? 0.2098 0.2698 0.3066 -0.0275 0.0504  -0.0022 465 LEU A CD2   
1494 N N     . ARG B 170 ? 0.1252 0.2441 0.3166 -0.0413 0.0601  -0.0073 466 ARG A N     
1495 C CA    . ARG B 170 ? 0.1429 0.2847 0.3683 -0.0403 0.0661  -0.0118 466 ARG A CA    
1496 C C     . ARG B 170 ? 0.2255 0.3741 0.4520 -0.0487 0.0833  -0.0139 466 ARG A C     
1497 O O     . ARG B 170 ? 0.1436 0.3022 0.3805 -0.0444 0.0922  -0.0190 466 ARG A O     
1498 C CB    . ARG B 170 ? 0.2261 0.3818 0.4762 -0.0426 0.0536  -0.0101 466 ARG A CB    
1499 C CG    . ARG B 170 ? 0.4428 0.5962 0.6954 -0.0335 0.0370  -0.0078 466 ARG A CG    
1500 C CD    . ARG B 170 ? 0.5476 0.7217 0.8312 -0.0347 0.0253  -0.0070 466 ARG A CD    
1501 N NE    . ARG B 170 ? 0.5817 0.7491 0.8524 -0.0427 0.0125  -0.0040 466 ARG A NE    
1502 C CZ    . ARG B 170 ? 0.6491 0.8057 0.9041 -0.0390 -0.0016 -0.0008 466 ARG A CZ    
1503 N NH1   . ARG B 170 ? 0.6497 0.8007 0.9006 -0.0277 -0.0051 0.0013  466 ARG A NH1   
1504 N NH2   . ARG B 170 ? 0.7128 0.8632 0.9552 -0.0474 -0.0112 -0.0001 466 ARG A NH2   
1505 N N     . ARG B 171 ? 0.1449 0.2836 0.3543 -0.0598 0.0863  -0.0092 467 ARG A N     
1506 C CA    . ARG B 171 ? 0.2194 0.3591 0.4199 -0.0674 0.1002  -0.0085 467 ARG A CA    
1507 C C     . ARG B 171 ? 0.1733 0.3065 0.3529 -0.0642 0.1122  -0.0115 467 ARG A C     
1508 O O     . ARG B 171 ? 0.2417 0.3823 0.4219 -0.0659 0.1242  -0.0148 467 ARG A O     
1509 C CB    . ARG B 171 ? 0.2585 0.3836 0.4415 -0.0791 0.1000  -0.0011 467 ARG A CB    
1510 C CG    . ARG B 171 ? 0.3335 0.4672 0.5364 -0.0865 0.0935  0.0000  467 ARG A CG    
1511 C CD    . ARG B 171 ? 0.3658 0.4826 0.5506 -0.0985 0.0968  0.0070  467 ARG A CD    
1512 N NE    . ARG B 171 ? 0.4072 0.4997 0.5677 -0.0983 0.0917  0.0119  467 ARG A NE    
1513 C CZ    . ARG B 171 ? 0.3765 0.4608 0.5397 -0.0984 0.0796  0.0114  467 ARG A CZ    
1514 N NH1   . ARG B 171 ? 0.3759 0.4751 0.5627 -0.0994 0.0702  0.0066  467 ARG A NH1   
1515 N NH2   . ARG B 171 ? 0.2749 0.3355 0.4119 -0.0946 0.0735  0.0161  467 ARG A NH2   
1516 N N     . ASN B 172 ? 0.3679 0.3790 0.3453 -0.1747 0.0614  0.0689  468 ASN A N     
1517 C CA    . ASN B 172 ? 0.4121 0.4323 0.3850 -0.1644 0.0720  0.0658  468 ASN A CA    
1518 C C     . ASN B 172 ? 0.3347 0.3870 0.3267 -0.1498 0.0817  0.0564  468 ASN A C     
1519 O O     . ASN B 172 ? 0.4179 0.4779 0.4066 -0.1401 0.0899  0.0525  468 ASN A O     
1520 C CB    . ASN B 172 ? 0.3993 0.3825 0.3523 -0.1523 0.0676  0.0618  468 ASN A CB    
1521 C CG    . ASN B 172 ? 0.3879 0.3372 0.3182 -0.1637 0.0587  0.0704  468 ASN A CG    
1522 O OD1   . ASN B 172 ? 0.4678 0.3870 0.3817 -0.1544 0.0538  0.0677  468 ASN A OD1   
1523 N ND2   . ASN B 172 ? 0.4067 0.3603 0.3361 -0.1832 0.0558  0.0806  468 ASN A ND2   
1524 N N     . GLU B 173 ? 0.3231 0.3914 0.3337 -0.1470 0.0797  0.0522  469 GLU A N     
1525 C CA    . GLU B 173 ? 0.3015 0.3938 0.3290 -0.1308 0.0863  0.0423  469 GLU A CA    
1526 C C     . GLU B 173 ? 0.3103 0.3800 0.3281 -0.1130 0.0861  0.0343  469 GLU A C     
1527 O O     . GLU B 173 ? 0.2800 0.3633 0.3023 -0.1007 0.0935  0.0278  469 GLU A O     
1528 C CB    . GLU B 173 ? 0.4663 0.5986 0.5051 -0.1316 0.0984  0.0424  469 GLU A CB    
1529 C CG    . GLU B 173 ? 0.6070 0.7652 0.6544 -0.1513 0.0998  0.0523  469 GLU A CG    
1530 C CD    . GLU B 173 ? 0.8333 1.0336 0.8901 -0.1515 0.1129  0.0526  469 GLU A CD    
1531 O OE1   . GLU B 173 ? 0.8815 1.0990 0.9402 -0.1667 0.1144  0.0619  469 GLU A OE1   
1532 O OE2   . GLU B 173 ? 0.8513 1.0643 0.9125 -0.1342 0.1200  0.0429  469 GLU A OE2   
1533 N N     . GLN B 174 ? 0.2965 0.3316 0.3004 -0.1116 0.0772  0.0347  470 GLN A N     
1534 C CA    . GLN B 174 ? 0.2870 0.3024 0.2832 -0.0959 0.0763  0.0280  470 GLN A CA    
1535 C C     . GLN B 174 ? 0.2783 0.2839 0.2803 -0.0880 0.0692  0.0232  470 GLN A C     
1536 O O     . GLN B 174 ? 0.2725 0.2599 0.2672 -0.0766 0.0670  0.0189  470 GLN A O     
1537 C CB    . GLN B 174 ? 0.3004 0.2853 0.2741 -0.0978 0.0727  0.0316  470 GLN A CB    
1538 C CG    . GLN B 174 ? 0.3094 0.3014 0.2747 -0.1038 0.0795  0.0362  470 GLN A CG    
1539 C CD    . GLN B 174 ? 0.4492 0.4093 0.3922 -0.1053 0.0743  0.0399  470 GLN A CD    
1540 O OE1   . GLN B 174 ? 0.4280 0.3839 0.3619 -0.0987 0.0783  0.0383  470 GLN A OE1   
1541 N NE2   . GLN B 174 ? 0.3392 0.2755 0.2726 -0.1129 0.0644  0.0444  470 GLN A NE2   
1542 N N     . ASP B 175 ? 0.3305 0.3480 0.3448 -0.0944 0.0653  0.0244  471 ASP A N     
1543 C CA    . ASP B 175 ? 0.3352 0.3434 0.3538 -0.0875 0.0580  0.0203  471 ASP A CA    
1544 C C     . ASP B 175 ? 0.2548 0.2724 0.2828 -0.0714 0.0620  0.0129  471 ASP A C     
1545 O O     . ASP B 175 ? 0.2774 0.2775 0.2998 -0.0620 0.0577  0.0096  471 ASP A O     
1546 C CB    . ASP B 175 ? 0.3983 0.4216 0.4301 -0.0979 0.0531  0.0229  471 ASP A CB    
1547 C CG    . ASP B 175 ? 0.6398 0.7022 0.6916 -0.1010 0.0611  0.0231  471 ASP A CG    
1548 O OD1   . ASP B 175 ? 0.6924 0.7735 0.7611 -0.0951 0.0604  0.0190  471 ASP A OD1   
1549 O OD2   . ASP B 175 ? 0.5961 0.6713 0.6464 -0.1088 0.0679  0.0274  471 ASP A OD2   
1550 N N     . ARG B 176 ? 0.2463 0.2912 0.2880 -0.0679 0.0698  0.0102  472 ARG A N     
1551 C CA    . ARG B 176 ? 0.2670 0.3180 0.3166 -0.0526 0.0724  0.0031  472 ARG A CA    
1552 C C     . ARG B 176 ? 0.2334 0.2663 0.2694 -0.0446 0.0748  0.0010  472 ARG A C     
1553 O O     . ARG B 176 ? 0.2821 0.3057 0.3181 -0.0338 0.0728  -0.0031 472 ARG A O     
1554 C CB    . ARG B 176 ? 0.3625 0.4466 0.4292 -0.0496 0.0792  -0.0003 472 ARG A CB    
1555 C CG    . ARG B 176 ? 0.5049 0.6112 0.5887 -0.0549 0.0765  0.0008  472 ARG A CG    
1556 C CD    . ARG B 176 ? 0.6272 0.7693 0.7279 -0.0508 0.0840  -0.0029 472 ARG A CD    
1557 N NE    . ARG B 176 ? 0.7486 0.8936 0.8566 -0.0337 0.0843  -0.0111 472 ARG A NE    
1558 C CZ    . ARG B 176 ? 0.7874 0.9539 0.9037 -0.0242 0.0908  -0.0171 472 ARG A CZ    
1559 N NH1   . ARG B 176 ? 0.7420 0.9325 0.8608 -0.0298 0.0989  -0.0157 472 ARG A NH1   
1560 N NH2   . ARG B 176 ? 0.7486 0.9122 0.8699 -0.0088 0.0888  -0.0243 472 ARG A NH2   
1561 N N     . LEU B 177 ? 0.2390 0.2670 0.2634 -0.0505 0.0786  0.0042  473 LEU A N     
1562 C CA    . LEU B 177 ? 0.2387 0.2488 0.2495 -0.0438 0.0798  0.0028  473 LEU A CA    
1563 C C     . LEU B 177 ? 0.2384 0.2231 0.2399 -0.0396 0.0726  0.0029  473 LEU A C     
1564 O O     . LEU B 177 ? 0.2361 0.2125 0.2352 -0.0298 0.0723  -0.0005 473 LEU A O     
1565 C CB    . LEU B 177 ? 0.2507 0.2570 0.2486 -0.0526 0.0832  0.0076  473 LEU A CB    
1566 C CG    . LEU B 177 ? 0.3080 0.2968 0.2907 -0.0473 0.0842  0.0070  473 LEU A CG    
1567 C CD1   . LEU B 177 ? 0.3479 0.3461 0.3365 -0.0354 0.0887  0.0000  473 LEU A CD1   
1568 C CD2   . LEU B 177 ? 0.2760 0.2619 0.2455 -0.0578 0.0867  0.0131  473 LEU A CD2   
1569 N N     . LEU B 178 ? 0.2473 0.2199 0.2431 -0.0471 0.0663  0.0068  474 LEU A N     
1570 C CA    . LEU B 178 ? 0.2485 0.1995 0.2354 -0.0419 0.0593  0.0062  474 LEU A CA    
1571 C C     . LEU B 178 ? 0.2677 0.2253 0.2657 -0.0329 0.0577  0.0021  474 LEU A C     
1572 O O     . LEU B 178 ? 0.2329 0.1814 0.2270 -0.0238 0.0567  0.0000  474 LEU A O     
1573 C CB    . LEU B 178 ? 0.2633 0.2004 0.2420 -0.0514 0.0518  0.0101  474 LEU A CB    
1574 C CG    . LEU B 178 ? 0.2664 0.1826 0.2350 -0.0445 0.0445  0.0083  474 LEU A CG    
1575 C CD1   . LEU B 178 ? 0.3015 0.2026 0.2566 -0.0369 0.0457  0.0076  474 LEU A CD1   
1576 C CD2   . LEU B 178 ? 0.2838 0.1846 0.2438 -0.0531 0.0354  0.0109  474 LEU A CD2   
1577 N N     . VAL B 179 ? 0.2681 0.2414 0.2797 -0.0359 0.0565  0.0017  475 VAL A N     
1578 C CA    . VAL B 179 ? 0.2267 0.2024 0.2463 -0.0289 0.0524  -0.0010 475 VAL A CA    
1579 C C     . VAL B 179 ? 0.2151 0.2020 0.2449 -0.0188 0.0564  -0.0050 475 VAL A C     
1580 O O     . VAL B 179 ? 0.2380 0.2189 0.2683 -0.0110 0.0534  -0.0064 475 VAL A O     
1581 C CB    . VAL B 179 ? 0.3297 0.3174 0.3598 -0.0361 0.0483  0.0001  475 VAL A CB    
1582 C CG1   . VAL B 179 ? 0.3609 0.3565 0.4023 -0.0280 0.0450  -0.0029 475 VAL A CG1   
1583 C CG2   . VAL B 179 ? 0.3241 0.2939 0.3418 -0.0445 0.0412  0.0035  475 VAL A CG2   
1584 N N     . GLU B 180 ? 0.2407 0.2432 0.2776 -0.0186 0.0628  -0.0068 476 GLU A N     
1585 C CA    . GLU B 180 ? 0.3070 0.3190 0.3533 -0.0085 0.0653  -0.0116 476 GLU A CA    
1586 C C     . GLU B 180 ? 0.2818 0.2844 0.3195 -0.0034 0.0688  -0.0132 476 GLU A C     
1587 O O     . GLU B 180 ? 0.2565 0.2603 0.2991 0.0052  0.0688  -0.0170 476 GLU A O     
1588 C CB    . GLU B 180 ? 0.2906 0.3287 0.3516 -0.0091 0.0695  -0.0142 476 GLU A CB    
1589 C CG    . GLU B 180 ? 0.3930 0.4440 0.4652 -0.0143 0.0657  -0.0126 476 GLU A CG    
1590 C CD    . GLU B 180 ? 0.5912 0.6722 0.6800 -0.0137 0.0700  -0.0155 476 GLU A CD    
1591 O OE1   . GLU B 180 ? 0.6479 0.7437 0.7467 -0.0202 0.0677  -0.0135 476 GLU A OE1   
1592 O OE2   . GLU B 180 ? 0.7042 0.7947 0.7957 -0.0063 0.0755  -0.0200 476 GLU A OE2   
1593 N N     . LEU B 181 ? 0.2489 0.2410 0.2736 -0.0085 0.0707  -0.0105 477 LEU A N     
1594 C CA    . LEU B 181 ? 0.2226 0.2061 0.2392 -0.0037 0.0731  -0.0121 477 LEU A CA    
1595 C C     . LEU B 181 ? 0.2507 0.2140 0.2541 -0.0035 0.0696  -0.0090 477 LEU A C     
1596 O O     . LEU B 181 ? 0.2486 0.2050 0.2516 0.0030  0.0674  -0.0099 477 LEU A O     
1597 C CB    . LEU B 181 ? 0.2711 0.2634 0.2841 -0.0077 0.0794  -0.0125 477 LEU A CB    
1598 C CG    . LEU B 181 ? 0.4071 0.3930 0.4131 -0.0019 0.0816  -0.0153 477 LEU A CG    
1599 C CD1   . LEU B 181 ? 0.3902 0.3908 0.4058 0.0054  0.0847  -0.0218 477 LEU A CD1   
1600 C CD2   . LEU B 181 ? 0.5335 0.5137 0.5258 -0.0077 0.0845  -0.0123 477 LEU A CD2   
1601 N N     . GLU B 182 ? 0.2350 0.1888 0.2276 -0.0102 0.0684  -0.0052 478 GLU A N     
1602 C CA    . GLU B 182 ? 0.2221 0.1580 0.2012 -0.0081 0.0655  -0.0034 478 GLU A CA    
1603 C C     . GLU B 182 ? 0.2188 0.1478 0.1980 -0.0032 0.0605  -0.0031 478 GLU A C     
1604 O O     . GLU B 182 ? 0.2163 0.1384 0.1908 0.0026  0.0594  -0.0031 478 GLU A O     
1605 C CB    . GLU B 182 ? 0.2348 0.1600 0.2011 -0.0157 0.0642  0.0003  478 GLU A CB    
1606 C CG    . GLU B 182 ? 0.3437 0.2734 0.3056 -0.0208 0.0692  0.0015  478 GLU A CG    
1607 C CD    . GLU B 182 ? 0.5341 0.4623 0.4918 -0.0146 0.0722  -0.0007 478 GLU A CD    
1608 O OE1   . GLU B 182 ? 0.5212 0.4425 0.4778 -0.0073 0.0698  -0.0021 478 GLU A OE1   
1609 O OE2   . GLU B 182 ? 0.5093 0.4442 0.4646 -0.0174 0.0767  -0.0008 478 GLU A OE2   
1610 N N     . GLN B 183 ? 0.2202 0.1514 0.2038 -0.0057 0.0570  -0.0026 479 GLN A N     
1611 C CA    . GLN B 183 ? 0.2591 0.1839 0.2408 -0.0008 0.0522  -0.0024 479 GLN A CA    
1612 C C     . GLN B 183 ? 0.2143 0.1461 0.2051 0.0061  0.0529  -0.0036 479 GLN A C     
1613 O O     . GLN B 183 ? 0.2898 0.2156 0.2755 0.0111  0.0514  -0.0024 479 GLN A O     
1614 C CB    . GLN B 183 ? 0.2407 0.1652 0.2237 -0.0055 0.0474  -0.0018 479 GLN A CB    
1615 C CG    . GLN B 183 ? 0.3507 0.2608 0.3201 -0.0113 0.0440  -0.0001 479 GLN A CG    
1616 C CD    . GLN B 183 ? 0.2863 0.1945 0.2564 -0.0177 0.0381  0.0005  479 GLN A CD    
1617 O OE1   . GLN B 183 ? 0.3138 0.2335 0.2955 -0.0178 0.0366  -0.0004 479 GLN A OE1   
1618 N NE2   . GLN B 183 ? 0.2625 0.1554 0.2200 -0.0233 0.0338  0.0021  479 GLN A NE2   
1619 N N     . PRO B 184 ? 0.2085 0.1526 0.2121 0.0068  0.0548  -0.0056 480 PRO A N     
1620 C CA    . PRO B 184 ? 0.2602 0.2067 0.2706 0.0133  0.0541  -0.0065 480 PRO A CA    
1621 C C     . PRO B 184 ? 0.2276 0.1683 0.2326 0.0160  0.0560  -0.0062 480 PRO A C     
1622 O O     . PRO B 184 ? 0.2059 0.1432 0.2109 0.0197  0.0538  -0.0045 480 PRO A O     
1623 C CB    . PRO B 184 ? 0.2314 0.1912 0.2549 0.0142  0.0557  -0.0099 480 PRO A CB    
1624 C CG    . PRO B 184 ? 0.2645 0.2317 0.2904 0.0079  0.0561  -0.0097 480 PRO A CG    
1625 C CD    . PRO B 184 ? 0.2042 0.1612 0.2172 0.0022  0.0568  -0.0072 480 PRO A CD    
1626 N N     . LEU B 185 ? 0.2648 0.2047 0.2648 0.0134  0.0597  -0.0074 481 LEU A N     
1627 C CA    . LEU B 185 ? 0.2913 0.2259 0.2859 0.0157  0.0609  -0.0073 481 LEU A CA    
1628 C C     . LEU B 185 ? 0.2287 0.1550 0.2145 0.0171  0.0585  -0.0038 481 LEU A C     
1629 O O     . LEU B 185 ? 0.2272 0.1521 0.2128 0.0201  0.0575  -0.0025 481 LEU A O     
1630 C CB    . LEU B 185 ? 0.2263 0.1615 0.2156 0.0127  0.0649  -0.0089 481 LEU A CB    
1631 C CG    . LEU B 185 ? 0.3105 0.2403 0.2936 0.0148  0.0655  -0.0091 481 LEU A CG    
1632 C CD1   . LEU B 185 ? 0.2416 0.1748 0.2327 0.0188  0.0649  -0.0123 481 LEU A CD1   
1633 C CD2   . LEU B 185 ? 0.3017 0.2305 0.2764 0.0112  0.0689  -0.0096 481 LEU A CD2   
1634 N N     . SER B 186 ? 0.2044 0.1257 0.1828 0.0152  0.0571  -0.0025 482 SER A N     
1635 C CA    . SER B 186 ? 0.2073 0.1217 0.1762 0.0184  0.0547  -0.0003 482 SER A CA    
1636 C C     . SER B 186 ? 0.2585 0.1771 0.2320 0.0226  0.0528  0.0017  482 SER A C     
1637 O O     . SER B 186 ? 0.2680 0.1867 0.2378 0.0259  0.0525  0.0038  482 SER A O     
1638 C CB    . SER B 186 ? 0.2595 0.1661 0.2195 0.0165  0.0520  -0.0002 482 SER A CB    
1639 O OG    . SER B 186 ? 0.4587 0.3591 0.4088 0.0217  0.0496  0.0007  482 SER A OG    
1640 N N     . SER B 187 ? 0.2618 0.1849 0.2433 0.0223  0.0511  0.0017  483 SER A N     
1641 C CA    . SER B 187 ? 0.2627 0.1893 0.2478 0.0255  0.0489  0.0047  483 SER A CA    
1642 C C     . SER B 187 ? 0.2616 0.1905 0.2525 0.0260  0.0495  0.0060  483 SER A C     
1643 O O     . SER B 187 ? 0.2328 0.1637 0.2231 0.0274  0.0483  0.0101  483 SER A O     
1644 C CB    . SER B 187 ? 0.2776 0.2076 0.2699 0.0252  0.0462  0.0044  483 SER A CB    
1645 O OG    . SER B 187 ? 0.4162 0.3435 0.4032 0.0237  0.0445  0.0030  483 SER A OG    
1646 N N     . ILE B 188 ? 0.2148 0.1439 0.2113 0.0246  0.0510  0.0028  484 ILE A N     
1647 C CA    . ILE B 188 ? 0.2388 0.1672 0.2396 0.0251  0.0503  0.0030  484 ILE A CA    
1648 C C     . ILE B 188 ? 0.2271 0.1541 0.2213 0.0247  0.0514  0.0049  484 ILE A C     
1649 O O     . ILE B 188 ? 0.1965 0.1244 0.1925 0.0245  0.0494  0.0083  484 ILE A O     
1650 C CB    . ILE B 188 ? 0.2474 0.1767 0.2538 0.0252  0.0517  -0.0024 484 ILE A CB    
1651 C CG1   . ILE B 188 ? 0.2266 0.1591 0.2419 0.0271  0.0493  -0.0038 484 ILE A CG1   
1652 C CG2   . ILE B 188 ? 0.2128 0.1384 0.2201 0.0258  0.0506  -0.0036 484 ILE A CG2   
1653 C CD1   . ILE B 188 ? 0.2213 0.1589 0.2423 0.0284  0.0515  -0.0098 484 ILE A CD1   
1654 N N     . LEU B 189 ? 0.1938 0.1188 0.1801 0.0243  0.0540  0.0032  485 LEU A N     
1655 C CA    . LEU B 189 ? 0.1949 0.1191 0.1748 0.0250  0.0545  0.0047  485 LEU A CA    
1656 C C     . LEU B 189 ? 0.2003 0.1287 0.1776 0.0275  0.0531  0.0092  485 LEU A C     
1657 O O     . LEU B 189 ? 0.2098 0.1424 0.1871 0.0280  0.0526  0.0119  485 LEU A O     
1658 C CB    . LEU B 189 ? 0.1993 0.1184 0.1698 0.0245  0.0566  0.0023  485 LEU A CB    
1659 C CG    . LEU B 189 ? 0.2639 0.1818 0.2355 0.0216  0.0590  -0.0015 485 LEU A CG    
1660 C CD1   . LEU B 189 ? 0.2565 0.1688 0.2178 0.0196  0.0604  -0.0020 485 LEU A CD1   
1661 C CD2   . LEU B 189 ? 0.2013 0.1196 0.1746 0.0218  0.0590  -0.0029 485 LEU A CD2   
1662 N N     . ALA B 190 ? 0.1979 0.1267 0.1729 0.0292  0.0524  0.0100  486 ALA A N     
1663 C CA    . ALA B 190 ? 0.1966 0.1313 0.1678 0.0326  0.0515  0.0137  486 ALA A CA    
1664 C C     . ALA B 190 ? 0.1938 0.1361 0.1729 0.0309  0.0502  0.0190  486 ALA A C     
1665 O O     . ALA B 190 ? 0.2074 0.1584 0.1856 0.0321  0.0504  0.0231  486 ALA A O     
1666 C CB    . ALA B 190 ? 0.2003 0.1328 0.1665 0.0349  0.0503  0.0128  486 ALA A CB    
1667 N N     . GLU B 191 ? 0.1926 0.1324 0.1795 0.0281  0.0484  0.0191  487 GLU A N     
1668 C CA    . GLU B 191 ? 0.1930 0.1364 0.1866 0.0254  0.0458  0.0246  487 GLU A CA    
1669 C C     . GLU B 191 ? 0.3203 0.2639 0.3169 0.0226  0.0452  0.0255  487 GLU A C     
1670 O O     . GLU B 191 ? 0.2688 0.2193 0.2676 0.0201  0.0437  0.0316  487 GLU A O     
1671 C CB    . GLU B 191 ? 0.2633 0.2012 0.2636 0.0244  0.0428  0.0238  487 GLU A CB    
1672 C CG    . GLU B 191 ? 0.4271 0.3650 0.4330 0.0212  0.0384  0.0301  487 GLU A CG    
1673 C CD    . GLU B 191 ? 0.6679 0.6162 0.6707 0.0199  0.0386  0.0383  487 GLU A CD    
1674 O OE1   . GLU B 191 ? 0.5085 0.4617 0.5131 0.0164  0.0380  0.0430  487 GLU A OE1   
1675 O OE2   . GLU B 191 ? 0.7171 0.6699 0.7155 0.0225  0.0393  0.0401  487 GLU A OE2   
1676 N N     . MET B 192 ? 0.1928 0.1299 0.1890 0.0224  0.0462  0.0198  488 MET A N     
1677 C CA    . MET B 192 ? 0.2730 0.2095 0.2704 0.0201  0.0450  0.0198  488 MET A CA    
1678 C C     . MET B 192 ? 0.2467 0.1927 0.2403 0.0209  0.0463  0.0234  488 MET A C     
1679 O O     . MET B 192 ? 0.2773 0.2293 0.2749 0.0177  0.0441  0.0281  488 MET A O     
1680 C CB    . MET B 192 ? 0.1951 0.1245 0.1900 0.0209  0.0467  0.0126  488 MET A CB    
1681 C CG    . MET B 192 ? 0.2783 0.2010 0.2784 0.0208  0.0450  0.0083  488 MET A CG    
1682 S SD    . MET B 192 ? 0.3272 0.2471 0.3226 0.0225  0.0494  0.0004  488 MET A SD    
1683 C CE    . MET B 192 ? 0.2184 0.1366 0.2082 0.0213  0.0489  -0.0004 488 MET A CE    
1684 N N     . GLU B 193 ? 0.1922 0.1396 0.1780 0.0254  0.0494  0.0212  489 GLU A N     
1685 C CA    . GLU B 193 ? 0.2356 0.1924 0.2172 0.0284  0.0504  0.0235  489 GLU A CA    
1686 C C     . GLU B 193 ? 0.2156 0.1862 0.2006 0.0282  0.0500  0.0304  489 GLU A C     
1687 O O     . GLU B 193 ? 0.2145 0.1974 0.2023 0.0275  0.0497  0.0346  489 GLU A O     
1688 C CB    . GLU B 193 ? 0.1952 0.1476 0.1662 0.0342  0.0523  0.0194  489 GLU A CB    
1689 C CG    . GLU B 193 ? 0.2586 0.1988 0.2248 0.0334  0.0530  0.0140  489 GLU A CG    
1690 C CD    . GLU B 193 ? 0.3136 0.2467 0.2687 0.0377  0.0535  0.0111  489 GLU A CD    
1691 O OE1   . GLU B 193 ? 0.3359 0.2590 0.2855 0.0363  0.0539  0.0079  489 GLU A OE1   
1692 O OE2   . GLU B 193 ? 0.2933 0.2301 0.2442 0.0425  0.0530  0.0122  489 GLU A OE2   
1693 N N     . PHE B 194 ? 0.2153 0.1858 0.2001 0.0289  0.0500  0.0320  490 PHE A N     
1694 C CA    . PHE B 194 ? 0.2494 0.2338 0.2362 0.0285  0.0500  0.0392  490 PHE A CA    
1695 C C     . PHE B 194 ? 0.3345 0.3235 0.3309 0.0205  0.0470  0.0461  490 PHE A C     
1696 O O     . PHE B 194 ? 0.2163 0.2212 0.2154 0.0185  0.0473  0.0529  490 PHE A O     
1697 C CB    . PHE B 194 ? 0.1951 0.1761 0.1789 0.0303  0.0498  0.0393  490 PHE A CB    
1698 C CG    . PHE B 194 ? 0.2104 0.2061 0.1940 0.0303  0.0502  0.0468  490 PHE A CG    
1699 C CD1   . PHE B 194 ? 0.2111 0.2224 0.1891 0.0360  0.0531  0.0482  490 PHE A CD1   
1700 C CD2   . PHE B 194 ? 0.2486 0.2433 0.2368 0.0252  0.0474  0.0525  490 PHE A CD2   
1701 C CE1   . PHE B 194 ? 0.2384 0.2665 0.2155 0.0363  0.0542  0.0554  490 PHE A CE1   
1702 C CE2   . PHE B 194 ? 0.2862 0.2956 0.2730 0.0245  0.0479  0.0606  490 PHE A CE2   
1703 C CZ    . PHE B 194 ? 0.2547 0.2818 0.2360 0.0298  0.0518  0.0621  490 PHE A CZ    
1704 N N     . ALA B 195 ? 0.3033 0.2787 0.3046 0.0159  0.0436  0.0444  491 ALA A N     
1705 C CA    . ALA B 195 ? 0.2815 0.2569 0.2905 0.0081  0.0389  0.0506  491 ALA A CA    
1706 C C     . ALA B 195 ? 0.2681 0.2518 0.2797 0.0052  0.0384  0.0522  491 ALA A C     
1707 O O     . ALA B 195 ? 0.2721 0.2670 0.2892 -0.0010 0.0360  0.0605  491 ALA A O     
1708 C CB    . ALA B 195 ? 0.2125 0.1698 0.2248 0.0059  0.0346  0.0464  491 ALA A CB    
1709 N N     . GLY B 196 ? 0.2015 0.1809 0.2091 0.0093  0.0402  0.0450  492 GLY A N     
1710 C CA    . GLY B 196 ? 0.1967 0.1836 0.2060 0.0077  0.0393  0.0455  492 GLY A CA    
1711 C C     . GLY B 196 ? 0.2024 0.1805 0.2178 -0.0001 0.0331  0.0467  492 GLY A C     
1712 O O     . GLY B 196 ? 0.2405 0.2059 0.2582 -0.0034 0.0295  0.0466  492 GLY A O     
1713 N N     . VAL B 197 ? 0.2218 0.2059 0.2393 -0.0027 0.0310  0.0473  493 VAL A N     
1714 C CA    . VAL B 197 ? 0.2488 0.2240 0.2712 -0.0104 0.0239  0.0481  493 VAL A CA    
1715 C C     . VAL B 197 ? 0.2134 0.2067 0.2432 -0.0174 0.0209  0.0567  493 VAL A C     
1716 O O     . VAL B 197 ? 0.2087 0.2183 0.2381 -0.0138 0.0240  0.0572  493 VAL A O     
1717 C CB    . VAL B 197 ? 0.2916 0.2521 0.3085 -0.0075 0.0227  0.0384  493 VAL A CB    
1718 C CG1   . VAL B 197 ? 0.5083 0.4769 0.5196 -0.0015 0.0270  0.0350  493 VAL A CG1   
1719 C CG2   . VAL B 197 ? 0.2245 0.1764 0.2452 -0.0150 0.0142  0.0388  493 VAL A CG2   
1720 N N     . LYS B 198 ? 0.2217 0.2124 0.2582 -0.0273 0.0143  0.0639  494 LYS A N     
1721 C CA    . LYS B 198 ? 0.2494 0.2599 0.2944 -0.0362 0.0113  0.0742  494 LYS A CA    
1722 C C     . LYS B 198 ? 0.2487 0.2598 0.2954 -0.0386 0.0069  0.0709  494 LYS A C     
1723 O O     . LYS B 198 ? 0.2335 0.2236 0.2760 -0.0383 0.0023  0.0631  494 LYS A O     
1724 C CB    . LYS B 198 ? 0.2514 0.2558 0.3021 -0.0478 0.0042  0.0837  494 LYS A CB    
1725 C CG    . LYS B 198 ? 0.2640 0.2889 0.3245 -0.0598 0.0000  0.0957  494 LYS A CG    
1726 C CD    . LYS B 198 ? 0.4758 0.5303 0.5394 -0.0590 0.0073  0.1049  494 LYS A CD    
1727 C CE    . LYS B 198 ? 0.6488 0.6959 0.7078 -0.0570 0.0099  0.1076  494 LYS A CE    
1728 N NZ    . LYS B 198 ? 0.7618 0.8021 0.8254 -0.0708 0.0019  0.1192  494 LYS A NZ    
1729 N N     . VAL B 199 ? 0.2235 0.2601 0.2758 -0.0397 0.0085  0.0761  495 VAL A N     
1730 C CA    . VAL B 199 ? 0.2258 0.2673 0.2804 -0.0415 0.0043  0.0738  495 VAL A CA    
1731 C C     . VAL B 199 ? 0.2324 0.2916 0.2994 -0.0551 -0.0021 0.0853  495 VAL A C     
1732 O O     . VAL B 199 ? 0.3369 0.4203 0.4107 -0.0583 0.0013  0.0952  495 VAL A O     
1733 C CB    . VAL B 199 ? 0.2600 0.3172 0.3105 -0.0298 0.0111  0.0691  495 VAL A CB    
1734 C CG1   . VAL B 199 ? 0.2195 0.2850 0.2736 -0.0322 0.0060  0.0681  495 VAL A CG1   
1735 C CG2   . VAL B 199 ? 0.3211 0.3584 0.3592 -0.0190 0.0159  0.0585  495 VAL A CG2   
1736 N N     . ASP B 200 ? 0.3429 0.3906 0.4123 -0.0633 -0.0117 0.0842  496 ASP A N     
1737 C CA    . ASP B 200 ? 0.3393 0.4028 0.4209 -0.0780 -0.0195 0.0951  496 ASP A CA    
1738 C C     . ASP B 200 ? 0.3291 0.4208 0.4160 -0.0742 -0.0170 0.0954  496 ASP A C     
1739 O O     . ASP B 200 ? 0.2618 0.3470 0.3468 -0.0733 -0.0221 0.0890  496 ASP A O     
1740 C CB    . ASP B 200 ? 0.3361 0.3716 0.4166 -0.0879 -0.0322 0.0929  496 ASP A CB    
1741 C CG    . ASP B 200 ? 0.4162 0.4652 0.5090 -0.1048 -0.0424 0.1038  496 ASP A CG    
1742 O OD1   . ASP B 200 ? 0.3932 0.4767 0.4970 -0.1094 -0.0392 0.1139  496 ASP A OD1   
1743 O OD2   . ASP B 200 ? 0.4720 0.4962 0.5632 -0.1134 -0.0543 0.1020  496 ASP A OD2   
1744 N N     . THR B 201 ? 0.2845 0.4087 0.3775 -0.0710 -0.0094 0.1023  497 THR A N     
1745 C CA    . THR B 201 ? 0.3716 0.5226 0.4683 -0.0635 -0.0062 0.1008  497 THR A CA    
1746 C C     . THR B 201 ? 0.3381 0.5068 0.4479 -0.0763 -0.0151 0.1079  497 THR A C     
1747 O O     . THR B 201 ? 0.2540 0.4336 0.3653 -0.0713 -0.0167 0.1036  497 THR A O     
1748 C CB    . THR B 201 ? 0.2977 0.4795 0.3968 -0.0547 0.0041  0.1052  497 THR A CB    
1749 O OG1   . THR B 201 ? 0.2934 0.4914 0.4016 -0.0668 0.0040  0.1183  497 THR A OG1   
1750 C CG2   . THR B 201 ? 0.2177 0.3820 0.3026 -0.0401 0.0121  0.0962  497 THR A CG2   
1751 N N     . LYS B 202 ? 0.3332 0.5045 0.4524 -0.0934 -0.0217 0.1191  498 LYS A N     
1752 C CA    . LYS B 202 ? 0.3942 0.5793 0.5260 -0.1081 -0.0320 0.1263  498 LYS A CA    
1753 C C     . LYS B 202 ? 0.2925 0.4503 0.4175 -0.1074 -0.0411 0.1155  498 LYS A C     
1754 O O     . LYS B 202 ? 0.3448 0.5186 0.4756 -0.1081 -0.0453 0.1146  498 LYS A O     
1755 C CB    . LYS B 202 ? 0.4331 0.6159 0.5731 -0.1279 -0.0393 0.1397  498 LYS A CB    
1756 C CG    . LYS B 202 ? 0.6249 0.8479 0.7766 -0.1337 -0.0327 0.1544  498 LYS A CG    
1757 C CD    . LYS B 202 ? 0.6922 0.9603 0.8558 -0.1300 -0.0287 0.1575  498 LYS A CD    
1758 C CE    . LYS B 202 ? 0.7177 1.0281 0.8963 -0.1420 -0.0257 0.1748  498 LYS A CE    
1759 N NZ    . LYS B 202 ? 0.7464 1.0447 0.9193 -0.1469 -0.0224 0.1819  498 LYS A NZ    
1760 N N     . ARG B 203 ? 0.3458 0.4634 0.4581 -0.1056 -0.0443 0.1070  499 ARG A N     
1761 C CA    . ARG B 203 ? 0.3939 0.4850 0.4972 -0.1032 -0.0521 0.0956  499 ARG A CA    
1762 C C     . ARG B 203 ? 0.4281 0.5273 0.5246 -0.0874 -0.0456 0.0860  499 ARG A C     
1763 O O     . ARG B 203 ? 0.3931 0.4928 0.4892 -0.0879 -0.0522 0.0819  499 ARG A O     
1764 C CB    . ARG B 203 ? 0.4173 0.4674 0.5077 -0.1012 -0.0547 0.0875  499 ARG A CB    
1765 C CG    . ARG B 203 ? 0.5867 0.6085 0.6670 -0.0999 -0.0638 0.0759  499 ARG A CG    
1766 C CD    . ARG B 203 ? 0.7602 0.7602 0.8427 -0.1151 -0.0787 0.0791  499 ARG A CD    
1767 N NE    . ARG B 203 ? 0.9247 0.8896 0.9959 -0.1111 -0.0805 0.0717  499 ARG A NE    
1768 C CZ    . ARG B 203 ? 1.0229 0.9612 1.0924 -0.1211 -0.0933 0.0724  499 ARG A CZ    
1769 N NH1   . ARG B 203 ? 1.0903 1.0319 1.1688 -0.1374 -0.1062 0.0808  499 ARG A NH1   
1770 N NH2   . ARG B 203 ? 0.9881 0.8965 1.0472 -0.1145 -0.0940 0.0646  499 ARG A NH2   
1771 N N     . LEU B 204 ? 0.3255 0.4296 0.4155 -0.0734 -0.0336 0.0825  500 LEU A N     
1772 C CA    . LEU B 204 ? 0.3449 0.4552 0.4274 -0.0586 -0.0282 0.0744  500 LEU A CA    
1773 C C     . LEU B 204 ? 0.3543 0.5002 0.4488 -0.0592 -0.0298 0.0800  500 LEU A C     
1774 O O     . LEU B 204 ? 0.3749 0.5217 0.4657 -0.0536 -0.0331 0.0742  500 LEU A O     
1775 C CB    . LEU B 204 ? 0.3713 0.4811 0.4455 -0.0449 -0.0162 0.0710  500 LEU A CB    
1776 C CG    . LEU B 204 ? 0.3936 0.4701 0.4523 -0.0375 -0.0129 0.0609  500 LEU A CG    
1777 C CD1   . LEU B 204 ? 0.4000 0.4814 0.4516 -0.0241 -0.0023 0.0581  500 LEU A CD1   
1778 C CD2   . LEU B 204 ? 0.4088 0.4650 0.4572 -0.0348 -0.0182 0.0513  500 LEU A CD2   
1779 N N     . GLU B 205 ? 0.3176 0.4951 0.4265 -0.0656 -0.0276 0.0914  501 GLU A N     
1780 C CA    . GLU B 205 ? 0.4547 0.6706 0.5768 -0.0659 -0.0289 0.0970  501 GLU A CA    
1781 C C     . GLU B 205 ? 0.4811 0.6963 0.6109 -0.0793 -0.0420 0.0990  501 GLU A C     
1782 O O     . GLU B 205 ? 0.4547 0.6888 0.5892 -0.0754 -0.0452 0.0975  501 GLU A O     
1783 C CB    . GLU B 205 ? 0.5511 0.8037 0.6871 -0.0705 -0.0231 0.1094  501 GLU A CB    
1784 C CG    . GLU B 205 ? 0.7194 0.9901 0.8505 -0.0521 -0.0109 0.1063  501 GLU A CG    
1785 C CD    . GLU B 205 ? 0.8841 1.1758 1.0211 -0.0551 -0.0034 0.1159  501 GLU A CD    
1786 O OE1   . GLU B 205 ? 0.8866 1.1788 1.0145 -0.0409 0.0060  0.1117  501 GLU A OE1   
1787 O OE2   . GLU B 205 ? 0.9543 1.2613 1.1042 -0.0721 -0.0074 0.1280  501 GLU A OE2   
1788 N N     . GLN B 206 ? 0.4478 0.6398 0.5782 -0.0946 -0.0507 0.1019  502 GLN A N     
1789 C CA    . GLN B 206 ? 0.5215 0.7076 0.6569 -0.1074 -0.0647 0.1026  502 GLN A CA    
1790 C C     . GLN B 206 ? 0.4956 0.6565 0.6161 -0.0973 -0.0684 0.0886  502 GLN A C     
1791 O O     . GLN B 206 ? 0.4743 0.6450 0.5988 -0.0997 -0.0765 0.0875  502 GLN A O     
1792 C CB    . GLN B 206 ? 0.6611 0.8243 0.7986 -0.1253 -0.0742 0.1084  502 GLN A CB    
1793 C CG    . GLN B 206 ? 0.8081 0.9233 0.9288 -0.1239 -0.0810 0.0967  502 GLN A CG    
1794 C CD    . GLN B 206 ? 0.9507 1.0431 1.0736 -0.1411 -0.0925 0.1024  502 GLN A CD    
1795 O OE1   . GLN B 206 ? 0.9892 1.1009 1.1269 -0.1572 -0.0977 0.1161  502 GLN A OE1   
1796 N NE2   . GLN B 206 ? 1.0104 1.0615 1.1183 -0.1377 -0.0969 0.0921  502 GLN A NE2   
1797 N N     . MET B 207 ? 0.4169 0.5471 0.5200 -0.0860 -0.0626 0.0784  503 MET A N     
1798 C CA    . MET B 207 ? 0.4612 0.5700 0.5487 -0.0756 -0.0644 0.0659  503 MET A CA    
1799 C C     . MET B 207 ? 0.4991 0.6328 0.5874 -0.0635 -0.0602 0.0644  503 MET A C     
1800 O O     . MET B 207 ? 0.5095 0.6430 0.5950 -0.0623 -0.0674 0.0601  503 MET A O     
1801 C CB    . MET B 207 ? 0.4371 0.5145 0.5076 -0.0659 -0.0571 0.0568  503 MET A CB    
1802 C CG    . MET B 207 ? 0.5241 0.5689 0.5885 -0.0742 -0.0643 0.0533  503 MET A CG    
1803 S SD    . MET B 207 ? 0.6769 0.6940 0.7267 -0.0637 -0.0543 0.0455  503 MET A SD    
1804 C CE    . MET B 207 ? 0.7354 0.7217 0.7836 -0.0756 -0.0659 0.0441  503 MET A CE    
1805 N N     . GLY B 208 ? 0.4342 0.5888 0.5257 -0.0538 -0.0493 0.0675  504 GLY A N     
1806 C CA    . GLY B 208 ? 0.3929 0.5716 0.4854 -0.0411 -0.0460 0.0662  504 GLY A CA    
1807 C C     . GLY B 208 ? 0.4723 0.6827 0.5813 -0.0486 -0.0545 0.0725  504 GLY A C     
1808 O O     . GLY B 208 ? 0.4200 0.6389 0.5267 -0.0404 -0.0578 0.0685  504 GLY A O     
1809 N N     . GLU B 209 ? 0.5249 0.7536 0.6508 -0.0647 -0.0586 0.0832  505 GLU A N     
1810 C CA    . GLU B 209 ? 0.5706 0.8309 0.7140 -0.0742 -0.0676 0.0902  505 GLU A CA    
1811 C C     . GLU B 209 ? 0.5506 0.7886 0.6876 -0.0800 -0.0807 0.0839  505 GLU A C     
1812 O O     . GLU B 209 ? 0.5468 0.8049 0.6904 -0.0789 -0.0872 0.0839  505 GLU A O     
1818 N N     . GLU B 210 ? 0.5302 0.7271 0.6536 -0.0852 -0.0849 0.0779  506 GLU A N     
1819 C CA    . GLU B 210 ? 0.5418 0.7139 0.6553 -0.0887 -0.0969 0.0700  506 GLU A CA    
1820 C C     . GLU B 210 ? 0.5233 0.6894 0.6220 -0.0715 -0.0943 0.0600  506 GLU A C     
1821 O O     . GLU B 210 ? 0.5962 0.7701 0.6958 -0.0717 -0.1032 0.0579  506 GLU A O     
1822 C CB    . GLU B 210 ? 0.7015 0.8311 0.8018 -0.0946 -0.1003 0.0644  506 GLU A CB    
1823 C CG    . GLU B 210 ? 0.9079 1.0278 1.0159 -0.1142 -0.1151 0.0690  506 GLU A CG    
1824 C CD    . GLU B 210 ? 1.0872 1.1646 1.1814 -0.1171 -0.1179 0.0627  506 GLU A CD    
1825 O OE1   . GLU B 210 ? 1.1330 1.1991 1.2199 -0.1086 -0.1067 0.0605  506 GLU A OE1   
1826 O OE2   . GLU B 210 ? 1.1342 1.1895 1.2247 -0.1274 -0.1319 0.0596  506 GLU A OE2   
1827 N N     . LEU B 211 ? 0.4282 0.5794 0.5125 -0.0571 -0.0827 0.0540  507 LEU A N     
1828 C CA    . LEU B 211 ? 0.5207 0.6625 0.5887 -0.0415 -0.0802 0.0453  507 LEU A CA    
1829 C C     . LEU B 211 ? 0.5162 0.6923 0.5939 -0.0341 -0.0817 0.0486  507 LEU A C     
1830 O O     . LEU B 211 ? 0.4731 0.6457 0.5427 -0.0285 -0.0880 0.0436  507 LEU A O     
1831 C CB    . LEU B 211 ? 0.4148 0.5399 0.4690 -0.0291 -0.0673 0.0409  507 LEU A CB    
1832 C CG    . LEU B 211 ? 0.5029 0.5918 0.5434 -0.0319 -0.0653 0.0348  507 LEU A CG    
1833 C CD1   . LEU B 211 ? 0.4944 0.5748 0.5257 -0.0208 -0.0525 0.0327  507 LEU A CD1   
1834 C CD2   . LEU B 211 ? 0.5234 0.5868 0.5470 -0.0306 -0.0724 0.0256  507 LEU A CD2   
1835 N N     . ALA B 212 ? 0.5143 0.7248 0.6090 -0.0333 -0.0760 0.0569  508 ALA A N     
1836 C CA    . ALA B 212 ? 0.5307 0.7774 0.6359 -0.0244 -0.0769 0.0597  508 ALA A CA    
1837 C C     . ALA B 212 ? 0.5017 0.7633 0.6174 -0.0342 -0.0907 0.0620  508 ALA A C     
1838 O O     . ALA B 212 ? 0.5303 0.8086 0.6469 -0.0245 -0.0945 0.0600  508 ALA A O     
1839 C CB    . ALA B 212 ? 0.4661 0.7500 0.5889 -0.0235 -0.0687 0.0687  508 ALA A CB    
1840 N N     . GLU B 213 ? 0.5351 0.7899 0.6586 -0.0532 -0.0992 0.0659  509 GLU A N     
1841 C CA    . GLU B 213 ? 0.5990 0.8666 0.7327 -0.0642 -0.1137 0.0681  509 GLU A CA    
1842 C C     . GLU B 213 ? 0.6580 0.8934 0.7712 -0.0592 -0.1219 0.0571  509 GLU A C     
1843 O O     . GLU B 213 ? 0.6376 0.8874 0.7531 -0.0560 -0.1302 0.0558  509 GLU A O     
1844 C CB    . GLU B 213 ? 0.6394 0.9077 0.7871 -0.0871 -0.1216 0.0762  509 GLU A CB    
1845 C CG    . GLU B 213 ? 0.7880 1.0830 0.9536 -0.1007 -0.1360 0.0823  509 GLU A CG    
1846 C CD    . GLU B 213 ? 0.9501 1.2771 1.1407 -0.1192 -0.1376 0.0968  509 GLU A CD    
1847 O OE1   . GLU B 213 ? 1.0022 1.3141 1.1919 -0.1275 -0.1331 0.1010  509 GLU A OE1   
1848 O OE2   . GLU B 213 ? 0.9619 1.3300 1.1730 -0.1256 -0.1435 0.1046  509 GLU A OE2   
1849 N N     . GLN B 214 ? 0.6489 0.8422 0.7419 -0.0585 -0.1198 0.0493  510 GLN A N     
1850 C CA    . GLN B 214 ? 0.6353 0.7994 0.7065 -0.0520 -0.1255 0.0387  510 GLN A CA    
1851 C C     . GLN B 214 ? 0.5796 0.7499 0.6402 -0.0330 -0.1198 0.0349  510 GLN A C     
1852 O O     . GLN B 214 ? 0.5587 0.7268 0.6109 -0.0283 -0.1279 0.0306  510 GLN A O     
1853 C CB    . GLN B 214 ? 0.5711 0.6931 0.6229 -0.0527 -0.1222 0.0311  510 GLN A CB    
1854 C CG    . GLN B 214 ? 0.7239 0.8350 0.7838 -0.0684 -0.1260 0.0345  510 GLN A CG    
1855 C CD    . GLN B 214 ? 0.8935 0.9654 0.9338 -0.0652 -0.1213 0.0260  510 GLN A CD    
1856 O OE1   . GLN B 214 ? 0.9389 1.0062 0.9786 -0.0614 -0.1099 0.0274  510 GLN A OE1   
1857 N NE2   . GLN B 214 ? 0.9640 1.0089 0.9879 -0.0659 -0.1299 0.0168  510 GLN A NE2   
1858 N N     . LEU B 215 ? 0.5021 0.6782 0.5617 -0.0219 -0.1066 0.0363  511 LEU A N     
1859 C CA    . LEU B 215 ? 0.4583 0.6388 0.5077 -0.0038 -0.1022 0.0331  511 LEU A CA    
1860 C C     . LEU B 215 ? 0.4972 0.7143 0.5616 -0.0001 -0.1096 0.0372  511 LEU A C     
1861 O O     . LEU B 215 ? 0.5112 0.7255 0.5645 0.0112  -0.1138 0.0330  511 LEU A O     
1862 C CB    . LEU B 215 ? 0.4586 0.6404 0.5061 0.0065  -0.0882 0.0343  511 LEU A CB    
1863 C CG    . LEU B 215 ? 0.6353 0.8105 0.6668 0.0252  -0.0844 0.0298  511 LEU A CG    
1864 C CD1   . LEU B 215 ? 0.6629 0.8085 0.6767 0.0315  -0.0737 0.0257  511 LEU A CD1   
1865 C CD2   . LEU B 215 ? 0.6918 0.9046 0.7377 0.0362  -0.0831 0.0342  511 LEU A CD2   
1866 N N     . ARG B 216 ? 0.4972 0.7498 0.5869 -0.0097 -0.1115 0.0458  512 ARG A N     
1867 C CA    . ARG B 216 ? 0.4784 0.7689 0.5847 -0.0082 -0.1198 0.0498  512 ARG A CA    
1868 C C     . ARG B 216 ? 0.4933 0.7721 0.5933 -0.0143 -0.1345 0.0458  512 ARG A C     
1869 O O     . ARG B 216 ? 0.4935 0.7859 0.5926 -0.0047 -0.1409 0.0440  512 ARG A O     
1877 N N     . THR B 217 ? 0.5148 0.7660 0.6085 -0.0293 -0.1406 0.0436  513 THR A N     
1878 C CA    . THR B 217 ? 0.6057 0.8447 0.6928 -0.0363 -0.1556 0.0393  513 THR A CA    
1879 C C     . THR B 217 ? 0.5691 0.7778 0.6280 -0.0221 -0.1560 0.0295  513 THR A C     
1880 O O     . THR B 217 ? 0.4972 0.7133 0.5524 -0.0169 -0.1655 0.0273  513 THR A O     
1881 C CB    . THR B 217 ? 0.6553 0.8717 0.7427 -0.0554 -0.1625 0.0391  513 THR A CB    
1882 O OG1   . THR B 217 ? 0.7160 0.9644 0.8310 -0.0715 -0.1676 0.0497  513 THR A OG1   
1883 C CG2   . THR B 217 ? 0.5888 0.7796 0.6600 -0.0592 -0.1765 0.0311  513 THR A CG2   
1884 N N     . VAL B 218 ? 0.4548 0.6304 0.4934 -0.0161 -0.1459 0.0240  514 VAL A N     
1885 C CA    . VAL B 218 ? 0.4910 0.6379 0.5018 -0.0044 -0.1458 0.0158  514 VAL A CA    
1886 C C     . VAL B 218 ? 0.4535 0.6171 0.4620 0.0127  -0.1436 0.0169  514 VAL A C     
1887 O O     . VAL B 218 ? 0.4936 0.6474 0.4862 0.0205  -0.1503 0.0128  514 VAL A O     
1888 C CB    . VAL B 218 ? 0.4731 0.5852 0.4650 -0.0023 -0.1347 0.0107  514 VAL A CB    
1889 C CG1   . VAL B 218 ? 0.5137 0.5969 0.4765 0.0068  -0.1357 0.0029  514 VAL A CG1   
1890 C CG2   . VAL B 218 ? 0.4489 0.5465 0.4450 -0.0176 -0.1373 0.0097  514 VAL A CG2   
1891 N N     . GLU B 219 ? 0.4025 0.5912 0.4260 0.0193  -0.1350 0.0223  515 GLU A N     
1892 C CA    . GLU B 219 ? 0.4253 0.6286 0.4462 0.0373  -0.1335 0.0227  515 GLU A CA    
1893 C C     . GLU B 219 ? 0.4739 0.7051 0.5063 0.0387  -0.1468 0.0244  515 GLU A C     
1894 O O     . GLU B 219 ? 0.5316 0.7598 0.5515 0.0524  -0.1513 0.0217  515 GLU A O     
1895 C CB    . GLU B 219 ? 0.5499 0.7753 0.5849 0.0439  -0.1220 0.0273  515 GLU A CB    
1896 C CG    . GLU B 219 ? 0.7795 1.0238 0.8149 0.0634  -0.1206 0.0276  515 GLU A CG    
1897 C CD    . GLU B 219 ? 0.9659 1.2322 1.0148 0.0693  -0.1092 0.0314  515 GLU A CD    
1898 O OE1   . GLU B 219 ? 0.9732 1.2770 1.0384 0.0786  -0.1102 0.0346  515 GLU A OE1   
1899 O OE2   . GLU B 219 ? 1.0128 1.2597 1.0557 0.0652  -0.0993 0.0311  515 GLU A OE2   
1900 N N     . GLN B 220 ? 0.3715 0.6293 0.4272 0.0240  -0.1540 0.0294  516 GLN A N     
1901 C CA    . GLN B 220 ? 0.4151 0.7010 0.4834 0.0234  -0.1676 0.0313  516 GLN A CA    
1902 C C     . GLN B 220 ? 0.4654 0.7224 0.5119 0.0224  -0.1792 0.0246  516 GLN A C     
1903 O O     . GLN B 220 ? 0.5352 0.8018 0.5778 0.0324  -0.1878 0.0232  516 GLN A O     
1904 C CB    . GLN B 220 ? 0.5327 0.8516 0.6306 0.0049  -0.1733 0.0389  516 GLN A CB    
1905 C CG    . GLN B 220 ? 0.6252 0.9875 0.7487 0.0076  -0.1646 0.0471  516 GLN A CG    
1906 C CD    . GLN B 220 ? 0.6386 1.0299 0.7664 0.0285  -0.1638 0.0469  516 GLN A CD    
1907 O OE1   . GLN B 220 ? 0.6725 1.0923 0.8126 0.0300  -0.1747 0.0485  516 GLN A OE1   
1908 N NE2   . GLN B 220 ? 0.6438 1.0276 0.7613 0.0451  -0.1516 0.0446  516 GLN A NE2   
1909 N N     . ARG B 221 ? 0.4422 0.6644 0.4739 0.0112  -0.1799 0.0202  517 ARG A N     
1910 C CA    . ARG B 221 ? 0.4587 0.6524 0.4670 0.0108  -0.1900 0.0130  517 ARG A CA    
1911 C C     . ARG B 221 ? 0.4716 0.6452 0.4540 0.0290  -0.1856 0.0088  517 ARG A C     
1912 O O     . ARG B 221 ? 0.5138 0.6830 0.4833 0.0349  -0.1958 0.0059  517 ARG A O     
1913 C CB    . ARG B 221 ? 0.4611 0.6214 0.4575 -0.0024 -0.1897 0.0082  517 ARG A CB    
1914 C CG    . ARG B 221 ? 0.7341 0.8650 0.7054 -0.0034 -0.2002 -0.0001 517 ARG A CG    
1915 C CD    . ARG B 221 ? 0.8753 1.0104 0.8565 -0.0198 -0.2164 -0.0009 517 ARG A CD    
1916 N NE    . ARG B 221 ? 0.9397 1.0565 0.8990 -0.0175 -0.2287 -0.0082 517 ARG A NE    
1917 C CZ    . ARG B 221 ? 0.9609 1.0974 0.9246 -0.0145 -0.2412 -0.0069 517 ARG A CZ    
1918 N NH1   . ARG B 221 ? 1.0032 1.1800 0.9936 -0.0131 -0.2427 0.0012  517 ARG A NH1   
1919 N NH2   . ARG B 221 ? 0.8345 0.9525 0.7761 -0.0125 -0.2524 -0.0137 517 ARG A NH2   
1920 N N     . ILE B 222 ? 0.4447 0.6060 0.4189 0.0377  -0.1713 0.0089  518 ILE A N     
1921 C CA    . ILE B 222 ? 0.4256 0.5669 0.3755 0.0538  -0.1674 0.0062  518 ILE A CA    
1922 C C     . ILE B 222 ? 0.4692 0.6356 0.4254 0.0676  -0.1746 0.0088  518 ILE A C     
1923 O O     . ILE B 222 ? 0.5299 0.6815 0.4657 0.0774  -0.1808 0.0062  518 ILE A O     
1924 C CB    . ILE B 222 ? 0.4129 0.5398 0.3569 0.0591  -0.1515 0.0067  518 ILE A CB    
1925 C CG1   . ILE B 222 ? 0.4137 0.5103 0.3450 0.0481  -0.1456 0.0026  518 ILE A CG1   
1926 C CG2   . ILE B 222 ? 0.4210 0.5339 0.3450 0.0762  -0.1484 0.0059  518 ILE A CG2   
1927 C CD1   . ILE B 222 ? 0.3988 0.4856 0.3300 0.0494  -0.1306 0.0036  518 ILE A CD1   
1928 N N     . TYR B 223 ? 0.4351 0.6409 0.4195 0.0687  -0.1745 0.0140  519 TYR A N     
1929 C CA    . TYR B 223 ? 0.5218 0.7546 0.5138 0.0841  -0.1807 0.0159  519 TYR A CA    
1930 C C     . TYR B 223 ? 0.5782 0.8209 0.5710 0.0815  -0.1973 0.0150  519 TYR A C     
1931 O O     . TYR B 223 ? 0.6039 0.8483 0.5870 0.0960  -0.2045 0.0139  519 TYR A O     
1932 C CB    . TYR B 223 ? 0.5434 0.8201 0.5663 0.0861  -0.1757 0.0215  519 TYR A CB    
1933 C CG    . TYR B 223 ? 0.6614 0.9312 0.6820 0.0934  -0.1604 0.0221  519 TYR A CG    
1934 C CD1   . TYR B 223 ? 0.6313 0.9337 0.6772 0.0897  -0.1526 0.0270  519 TYR A CD1   
1935 C CD2   . TYR B 223 ? 0.7172 0.9485 0.7101 0.1032  -0.1540 0.0180  519 TYR A CD2   
1936 C CE1   . TYR B 223 ? 0.6608 0.9566 0.7036 0.0966  -0.1392 0.0271  519 TYR A CE1   
1937 C CE2   . TYR B 223 ? 0.7363 0.9603 0.7269 0.1093  -0.1410 0.0183  519 TYR A CE2   
1938 C CZ    . TYR B 223 ? 0.7211 0.9771 0.7364 0.1065  -0.1338 0.0225  519 TYR A CZ    
1939 O OH    . TYR B 223 ? 0.7574 1.0061 0.7695 0.1129  -0.1214 0.0224  519 TYR A OH    
1940 N N     . GLU B 224 ? 0.6119 0.8608 0.6160 0.0633  -0.2046 0.0154  520 GLU A N     
1941 C CA    . GLU B 224 ? 0.7287 0.9855 0.7325 0.0602  -0.2215 0.0140  520 GLU A CA    
1942 C C     . GLU B 224 ? 0.7038 0.9183 0.6725 0.0631  -0.2264 0.0075  520 GLU A C     
1943 O O     . GLU B 224 ? 0.6958 0.9125 0.6569 0.0671  -0.2397 0.0059  520 GLU A O     
1944 C CB    . GLU B 224 ? 0.8576 1.1329 0.8839 0.0391  -0.2295 0.0166  520 GLU A CB    
1945 C CG    . GLU B 224 ? 1.0243 1.2634 1.0356 0.0242  -0.2291 0.0121  520 GLU A CG    
1946 C CD    . GLU B 224 ? 1.1731 1.4223 1.1983 0.0055  -0.2438 0.0127  520 GLU A CD    
1947 O OE1   . GLU B 224 ? 1.2106 1.4710 1.2557 -0.0095 -0.2415 0.0170  520 GLU A OE1   
1948 O OE2   . GLU B 224 ? 1.2220 1.4662 1.2373 0.0050  -0.2582 0.0090  520 GLU A OE2   
1949 N N     . LEU B 225 ? 0.6779 0.8556 0.6252 0.0610  -0.2158 0.0040  521 LEU A N     
1950 C CA    . LEU B 225 ? 0.6350 0.7748 0.5478 0.0649  -0.2184 -0.0015 521 LEU A CA    
1951 C C     . LEU B 225 ? 0.6118 0.7422 0.5064 0.0839  -0.2160 -0.0006 521 LEU A C     
1952 O O     . LEU B 225 ? 0.6821 0.7971 0.5546 0.0899  -0.2248 -0.0027 521 LEU A O     
1953 C CB    . LEU B 225 ? 0.5842 0.6913 0.4814 0.0563  -0.2077 -0.0055 521 LEU A CB    
1954 C CG    . LEU B 225 ? 0.6968 0.7955 0.5968 0.0390  -0.2136 -0.0096 521 LEU A CG    
1955 C CD1   . LEU B 225 ? 0.8015 0.9350 0.7334 0.0284  -0.2234 -0.0054 521 LEU A CD1   
1956 C CD2   . LEU B 225 ? 0.5537 0.6308 0.4491 0.0322  -0.2004 -0.0118 521 LEU A CD2   
1957 N N     . ALA B 226 ? 0.5323 0.6702 0.4346 0.0933  -0.2049 0.0027  522 ALA A N     
1958 C CA    . ALA B 226 ? 0.6458 0.7746 0.5323 0.1118  -0.2041 0.0038  522 ALA A CA    
1959 C C     . ALA B 226 ? 0.6979 0.8567 0.5968 0.1237  -0.2165 0.0059  522 ALA A C     
1960 O O     . ALA B 226 ? 0.7480 0.8990 0.6333 0.1405  -0.2186 0.0066  522 ALA A O     
1961 C CB    . ALA B 226 ? 0.4833 0.6099 0.3740 0.1185  -0.1894 0.0057  522 ALA A CB    
1962 N N     . GLY B 227 ? 0.6001 0.7930 0.5247 0.1155  -0.2255 0.0071  523 GLY A N     
1963 C CA    . GLY B 227 ? 0.7101 0.9386 0.6516 0.1264  -0.2367 0.0093  523 GLY A CA    
1964 C C     . GLY B 227 ? 0.7568 1.0139 0.7173 0.1407  -0.2297 0.0123  523 GLY A C     
1965 O O     . GLY B 227 ? 0.7648 1.0544 0.7403 0.1524  -0.2384 0.0137  523 GLY A O     
1966 N N     . GLN B 228 ? 0.6848 0.9323 0.6455 0.1410  -0.2146 0.0128  524 GLN A N     
1967 C CA    . GLN B 228 ? 0.7130 0.9842 0.6880 0.1562  -0.2075 0.0146  524 GLN A CA    
1968 C C     . GLN B 228 ? 0.7707 1.0347 0.7506 0.1485  -0.1913 0.0154  524 GLN A C     
1969 O O     . GLN B 228 ? 0.7390 0.9759 0.7084 0.1337  -0.1857 0.0144  524 GLN A O     
1970 C CB    . GLN B 228 ? 0.7918 1.0420 0.7434 0.1786  -0.2105 0.0126  524 GLN A CB    
1971 C CG    . GLN B 228 ? 0.7972 0.9943 0.7148 0.1778  -0.2037 0.0107  524 GLN A CG    
1972 C CD    . GLN B 228 ? 0.8082 0.9823 0.7053 0.1970  -0.2039 0.0099  524 GLN A CD    
1973 O OE1   . GLN B 228 ? 0.8633 1.0134 0.7397 0.2005  -0.2111 0.0095  524 GLN A OE1   
1974 N NE2   . GLN B 228 ? 0.8287 1.0066 0.7319 0.2068  -0.1940 0.0096  524 GLN A NE2   
1975 N N     . GLU B 229 ? 0.7691 1.0583 0.7645 0.1599  -0.1840 0.0169  525 GLU A N     
1976 C CA    . GLU B 229 ? 0.7809 1.0647 0.7800 0.1560  -0.1689 0.0177  525 GLU A CA    
1977 C C     . GLU B 229 ? 0.7346 0.9809 0.7065 0.1706  -0.1630 0.0146  525 GLU A C     
1978 O O     . GLU B 229 ? 0.7847 1.0219 0.7422 0.1880  -0.1701 0.0127  525 GLU A O     
1979 C CB    . GLU B 229 ? 0.8937 1.2280 0.9246 0.1596  -0.1642 0.0213  525 GLU A CB    
1980 C CG    . GLU B 229 ? 1.0207 1.3985 1.0807 0.1466  -0.1722 0.0257  525 GLU A CG    
1981 C CD    . GLU B 229 ? 1.1683 1.5702 1.2342 0.1587  -0.1861 0.0251  525 GLU A CD    
1982 O OE1   . GLU B 229 ? 1.1957 1.6127 1.2728 0.1460  -0.1967 0.0271  525 GLU A OE1   
1983 O OE2   . GLU B 229 ? 1.2164 1.6125 1.2743 0.1773  -0.1836 0.0222  525 GLU A OE2   
1984 N N     . PHE B 230 ? 0.6814 0.9045 0.6457 0.1628  -0.1508 0.0143  526 PHE A N     
1985 C CA    . PHE B 230 ? 0.5991 0.7862 0.5390 0.1735  -0.1446 0.0120  526 PHE A CA    
1986 C C     . PHE B 230 ? 0.5837 0.7607 0.5265 0.1623  -0.1306 0.0126  526 PHE A C     
1987 O O     . PHE B 230 ? 0.5476 0.7379 0.5064 0.1457  -0.1271 0.0145  526 PHE A O     
1988 C CB    . PHE B 230 ? 0.6327 0.7776 0.5410 0.1737  -0.1509 0.0103  526 PHE A CB    
1989 C CG    . PHE B 230 ? 0.5926 0.7165 0.4925 0.1540  -0.1487 0.0100  526 PHE A CG    
1990 C CD1   . PHE B 230 ? 0.5560 0.6959 0.4672 0.1420  -0.1564 0.0102  526 PHE A CD1   
1991 C CD2   . PHE B 230 ? 0.5771 0.6655 0.4576 0.1479  -0.1396 0.0090  526 PHE A CD2   
1992 C CE1   . PHE B 230 ? 0.4697 0.5891 0.3718 0.1256  -0.1552 0.0087  526 PHE A CE1   
1993 C CE2   . PHE B 230 ? 0.5550 0.6259 0.4278 0.1317  -0.1374 0.0078  526 PHE A CE2   
1994 C CZ    . PHE B 230 ? 0.4822 0.5677 0.3650 0.1212  -0.1454 0.0072  526 PHE A CZ    
1995 N N     . ASN B 231 ? 0.5771 0.7297 0.5040 0.1715  -0.1237 0.0110  527 ASN A N     
1996 C CA    . ASN B 231 ? 0.5800 0.7216 0.5082 0.1625  -0.1109 0.0113  527 ASN A CA    
1997 C C     . ASN B 231 ? 0.5507 0.6547 0.4592 0.1486  -0.1086 0.0105  527 ASN A C     
1998 O O     . ASN B 231 ? 0.5894 0.6596 0.4727 0.1535  -0.1093 0.0092  527 ASN A O     
1999 C CB    . ASN B 231 ? 0.5836 0.7163 0.5038 0.1779  -0.1052 0.0096  527 ASN A CB    
2000 C CG    . ASN B 231 ? 0.7298 0.8499 0.6501 0.1689  -0.0926 0.0099  527 ASN A CG    
2001 O OD1   . ASN B 231 ? 0.7569 0.8844 0.6894 0.1524  -0.0875 0.0117  527 ASN A OD1   
2002 N ND2   . ASN B 231 ? 0.7901 0.8901 0.6964 0.1798  -0.0886 0.0079  527 ASN A ND2   
2003 N N     . ILE B 232 ? 0.5176 0.6280 0.4375 0.1312  -0.1063 0.0113  528 ILE A N     
2004 C CA    . ILE B 232 ? 0.5206 0.5995 0.4233 0.1187  -0.1046 0.0096  528 ILE A CA    
2005 C C     . ILE B 232 ? 0.6087 0.6602 0.4973 0.1184  -0.0937 0.0087  528 ILE A C     
2006 O O     . ILE B 232 ? 0.5838 0.6049 0.4510 0.1141  -0.0922 0.0073  528 ILE A O     
2007 C CB    . ILE B 232 ? 0.4975 0.5900 0.4168 0.1015  -0.1054 0.0100  528 ILE A CB    
2008 C CG1   . ILE B 232 ? 0.4528 0.5749 0.3879 0.1010  -0.1172 0.0114  528 ILE A CG1   
2009 C CG2   . ILE B 232 ? 0.5587 0.6201 0.4598 0.0904  -0.1045 0.0068  528 ILE A CG2   
2010 C CD1   . ILE B 232 ? 0.4693 0.6116 0.4264 0.0845  -0.1188 0.0134  528 ILE A CD1   
2011 N N     . ASN B 233 ? 0.5841 0.6469 0.4839 0.1232  -0.0860 0.0098  529 ASN A N     
2012 C CA    . ASN B 233 ? 0.5914 0.6307 0.4800 0.1227  -0.0762 0.0091  529 ASN A CA    
2013 C C     . ASN B 233 ? 0.5801 0.5942 0.4459 0.1358  -0.0780 0.0084  529 ASN A C     
2014 O O     . ASN B 233 ? 0.7341 0.7265 0.5888 0.1352  -0.0711 0.0081  529 ASN A O     
2015 C CB    . ASN B 233 ? 0.6128 0.6736 0.5210 0.1230  -0.0681 0.0104  529 ASN A CB    
2016 C CG    . ASN B 233 ? 0.6844 0.7683 0.6147 0.1090  -0.0667 0.0125  529 ASN A CG    
2017 O OD1   . ASN B 233 ? 0.6405 0.7104 0.5677 0.0957  -0.0654 0.0117  529 ASN A OD1   
2018 N ND2   . ASN B 233 ? 0.7712 0.8910 0.7235 0.1119  -0.0673 0.0152  529 ASN A ND2   
2019 N N     . SER B 234 ? 0.4808 0.4963 0.3391 0.1471  -0.0880 0.0083  530 SER A N     
2020 C CA    . SER B 234 ? 0.5904 0.5786 0.4252 0.1592  -0.0917 0.0082  530 SER A CA    
2021 C C     . SER B 234 ? 0.7981 0.7582 0.6094 0.1531  -0.0965 0.0091  530 SER A C     
2022 O O     . SER B 234 ? 0.7256 0.6923 0.5347 0.1553  -0.1060 0.0093  530 SER A O     
2023 C CB    . SER B 234 ? 0.5137 0.5190 0.3529 0.1777  -0.1005 0.0075  530 SER A CB    
2024 O OG    . SER B 234 ? 0.7012 0.6787 0.5153 0.1864  -0.1093 0.0080  530 SER A OG    
2025 N N     . PRO B 235 ? 0.8928 0.8231 0.6860 0.1456  -0.0905 0.0100  531 PRO A N     
2026 C CA    . PRO B 235 ? 0.9444 0.8507 0.7145 0.1391  -0.0941 0.0114  531 PRO A CA    
2027 C C     . PRO B 235 ? 0.8600 0.7525 0.6112 0.1511  -0.1058 0.0134  531 PRO A C     
2028 O O     . PRO B 235 ? 0.8301 0.7090 0.5639 0.1468  -0.1109 0.0148  531 PRO A O     
2029 C CB    . PRO B 235 ? 1.0003 0.8811 0.7569 0.1306  -0.0844 0.0126  531 PRO A CB    
2030 C CG    . PRO B 235 ? 0.9563 0.8520 0.7335 0.1288  -0.0752 0.0109  531 PRO A CG    
2031 C CD    . PRO B 235 ? 0.9304 0.8495 0.7236 0.1423  -0.0802 0.0099  531 PRO A CD    
2032 N N     . LYS B 236 ? 0.7732 0.6690 0.5265 0.1667  -0.1108 0.0133  532 LYS A N     
2033 C CA    . LYS B 236 ? 0.8613 0.7466 0.5988 0.1798  -0.1237 0.0148  532 LYS A CA    
2034 C C     . LYS B 236 ? 0.8134 0.7281 0.5655 0.1838  -0.1323 0.0133  532 LYS A C     
2035 O O     . LYS B 236 ? 0.8912 0.7967 0.6285 0.1850  -0.1419 0.0149  532 LYS A O     
2036 C CB    . LYS B 236 ? 0.9505 0.8279 0.6842 0.1969  -0.1272 0.0141  532 LYS A CB    
2037 C CG    . LYS B 236 ? 1.0788 0.9162 0.7844 0.1987  -0.1315 0.0169  532 LYS A CG    
2038 C CD    . LYS B 236 ? 1.2327 1.0631 0.9402 0.2111  -0.1320 0.0134  532 LYS A CD    
2039 C CE    . LYS B 236 ? 1.3103 1.1691 1.0350 0.2265  -0.1383 0.0088  532 LYS A CE    
2040 N NZ    . LYS B 236 ? 1.3391 1.1790 1.0535 0.2383  -0.1436 0.0055  532 LYS A NZ    
2041 N N     . GLN B 237 ? 0.6402 0.5912 0.4211 0.1852  -0.1296 0.0109  533 GLN A N     
2042 C CA    . GLN B 237 ? 0.6665 0.6482 0.4637 0.1869  -0.1379 0.0101  533 GLN A CA    
2043 C C     . GLN B 237 ? 0.6266 0.6052 0.4206 0.1702  -0.1384 0.0103  533 GLN A C     
2044 O O     . GLN B 237 ? 0.5966 0.5764 0.3835 0.1715  -0.1489 0.0105  533 GLN A O     
2045 C CB    . GLN B 237 ? 0.6899 0.7127 0.5193 0.1895  -0.1338 0.0087  533 GLN A CB    
2046 C CG    . GLN B 237 ? 0.7314 0.7637 0.5652 0.2090  -0.1349 0.0073  533 GLN A CG    
2047 C CD    . GLN B 237 ? 0.7892 0.8691 0.6553 0.2125  -0.1324 0.0065  533 GLN A CD    
2048 O OE1   . GLN B 237 ? 0.8023 0.9118 0.6853 0.2090  -0.1381 0.0073  533 GLN A OE1   
2049 N NE2   . GLN B 237 ? 0.8524 0.9407 0.7269 0.2185  -0.1240 0.0052  533 GLN A NE2   
2050 N N     . LEU B 238 ? 0.5686 0.5428 0.3669 0.1553  -0.1276 0.0096  534 LEU A N     
2051 C CA    . LEU B 238 ? 0.5853 0.5531 0.3780 0.1405  -0.1278 0.0085  534 LEU A CA    
2052 C C     . LEU B 238 ? 0.5955 0.5326 0.3566 0.1411  -0.1333 0.0099  534 LEU A C     
2053 O O     . LEU B 238 ? 0.5991 0.5368 0.3534 0.1366  -0.1406 0.0089  534 LEU A O     
2054 C CB    . LEU B 238 ? 0.5261 0.4889 0.3248 0.1271  -0.1151 0.0073  534 LEU A CB    
2055 C CG    . LEU B 238 ? 0.5187 0.4763 0.3131 0.1129  -0.1151 0.0048  534 LEU A CG    
2056 C CD1   . LEU B 238 ? 0.5584 0.5419 0.3699 0.1103  -0.1250 0.0035  534 LEU A CD1   
2057 C CD2   . LEU B 238 ? 0.5979 0.5519 0.4000 0.1018  -0.1031 0.0032  534 LEU A CD2   
2058 N N     . GLY B 239 ? 0.5732 0.4834 0.3141 0.1463  -0.1304 0.0125  535 GLY A N     
2059 C CA    . GLY B 239 ? 0.5662 0.4474 0.2761 0.1465  -0.1357 0.0154  535 GLY A CA    
2060 C C     . GLY B 239 ? 0.6604 0.5465 0.3638 0.1566  -0.1506 0.0163  535 GLY A C     
2061 O O     . GLY B 239 ? 0.7979 0.6717 0.4822 0.1525  -0.1564 0.0173  535 GLY A O     
2062 N N     . VAL B 240 ? 0.7495 0.6554 0.4688 0.1704  -0.1571 0.0157  536 VAL A N     
2063 C CA    . VAL B 240 ? 0.7409 0.6538 0.4557 0.1814  -0.1720 0.0163  536 VAL A CA    
2064 C C     . VAL B 240 ? 0.7251 0.6633 0.4543 0.1735  -0.1773 0.0137  536 VAL A C     
2065 O O     . VAL B 240 ? 0.6892 0.6235 0.4063 0.1747  -0.1878 0.0142  536 VAL A O     
2066 C CB    . VAL B 240 ? 0.7896 0.7188 0.5219 0.1970  -0.1741 0.0151  536 VAL A CB    
2067 C CG1   . VAL B 240 ? 0.7023 0.6575 0.4486 0.2038  -0.1849 0.0137  536 VAL A CG1   
2068 C CG2   . VAL B 240 ? 0.8311 0.7276 0.5444 0.2035  -0.1726 0.0169  536 VAL A CG2   
2069 N N     . ILE B 241 ? 0.7072 0.6706 0.4628 0.1641  -0.1701 0.0109  537 ILE A N     
2070 C CA    . ILE B 241 ? 0.6197 0.6057 0.3899 0.1549  -0.1760 0.0086  537 ILE A CA    
2071 C C     . ILE B 241 ? 0.5628 0.5254 0.3103 0.1429  -0.1763 0.0073  537 ILE A C     
2072 O O     . ILE B 241 ? 0.5779 0.5425 0.3177 0.1420  -0.1875 0.0063  537 ILE A O     
2073 C CB    . ILE B 241 ? 0.6349 0.6496 0.4369 0.1462  -0.1682 0.0070  537 ILE A CB    
2074 C CG1   . ILE B 241 ? 0.5989 0.6451 0.4252 0.1586  -0.1696 0.0081  537 ILE A CG1   
2075 C CG2   . ILE B 241 ? 0.6640 0.6937 0.4770 0.1329  -0.1740 0.0046  537 ILE A CG2   
2076 C CD1   . ILE B 241 ? 0.6373 0.7090 0.4733 0.1675  -0.1841 0.0084  537 ILE A CD1   
2077 N N     . LEU B 242 ? 0.5918 0.5329 0.3277 0.1341  -0.1643 0.0070  538 LEU A N     
2078 C CA    . LEU B 242 ? 0.5913 0.5136 0.3070 0.1229  -0.1628 0.0049  538 LEU A CA    
2079 C C     . LEU B 242 ? 0.6171 0.5146 0.2998 0.1281  -0.1698 0.0079  538 LEU A C     
2080 O O     . LEU B 242 ? 0.6168 0.5109 0.2862 0.1244  -0.1775 0.0061  538 LEU A O     
2081 C CB    . LEU B 242 ? 0.5803 0.4894 0.2941 0.1135  -0.1476 0.0038  538 LEU A CB    
2082 C CG    . LEU B 242 ? 0.5780 0.5077 0.3210 0.1061  -0.1404 0.0009  538 LEU A CG    
2083 C CD1   . LEU B 242 ? 0.5846 0.4983 0.3218 0.0976  -0.1265 -0.0003 538 LEU A CD1   
2084 C CD2   . LEU B 242 ? 0.5254 0.4735 0.2825 0.0985  -0.1485 -0.0031 538 LEU A CD2   
2085 N N     . PHE B 243 ? 0.6589 0.5375 0.3268 0.1362  -0.1678 0.0129  539 PHE A N     
2086 C CA    . PHE B 243 ? 0.7324 0.5820 0.3657 0.1377  -0.1716 0.0173  539 PHE A CA    
2087 C C     . PHE B 243 ? 0.7296 0.5797 0.3622 0.1478  -0.1818 0.0200  539 PHE A C     
2088 O O     . PHE B 243 ? 0.7528 0.5841 0.3642 0.1457  -0.1840 0.0232  539 PHE A O     
2089 C CB    . PHE B 243 ? 0.7103 0.5361 0.3305 0.1349  -0.1601 0.0214  539 PHE A CB    
2090 C CG    . PHE B 243 ? 0.6865 0.5149 0.3154 0.1225  -0.1458 0.0181  539 PHE A CG    
2091 C CD1   . PHE B 243 ? 0.6640 0.4887 0.2814 0.1117  -0.1421 0.0152  539 PHE A CD1   
2092 C CD2   . PHE B 243 ? 0.6510 0.4870 0.3002 0.1224  -0.1365 0.0173  539 PHE A CD2   
2093 C CE1   . PHE B 243 ? 0.6611 0.4888 0.2874 0.1015  -0.1295 0.0114  539 PHE A CE1   
2094 C CE2   . PHE B 243 ? 0.6214 0.4603 0.2797 0.1113  -0.1238 0.0141  539 PHE A CE2   
2095 C CZ    . PHE B 243 ? 0.6659 0.5005 0.3130 0.1012  -0.1205 0.0112  539 PHE A CZ    
2096 N N     . GLU B 244 ? 0.7931 0.6654 0.4483 0.1585  -0.1880 0.0188  540 GLU A N     
2097 C CA    . GLU B 244 ? 0.8490 0.7257 0.5056 0.1685  -0.1986 0.0201  540 GLU A CA    
2098 C C     . GLU B 244 ? 0.7753 0.6823 0.4498 0.1692  -0.2089 0.0166  540 GLU A C     
2099 O O     . GLU B 244 ? 0.9036 0.8080 0.5683 0.1689  -0.2175 0.0172  540 GLU A O     
2100 C CB    . GLU B 244 ? 0.8849 0.7637 0.5527 0.1821  -0.1981 0.0211  540 GLU A CB    
2101 C CG    . GLU B 244 ? 1.0169 0.8612 0.6635 0.1831  -0.1930 0.0252  540 GLU A CG    
2102 C CD    . GLU B 244 ? 1.0421 0.8884 0.7009 0.1956  -0.1912 0.0242  540 GLU A CD    
2103 O OE1   . GLU B 244 ? 1.0432 0.8687 0.6933 0.1934  -0.1835 0.0259  540 GLU A OE1   
2104 O OE2   . GLU B 244 ? 1.0478 0.9176 0.7251 0.2073  -0.1976 0.0214  540 GLU A OE2   
2105 N N     . LYS B 245 ? 0.7391 0.6759 0.4404 0.1693  -0.2087 0.0135  541 LYS A N     
2106 C CA    . LYS B 245 ? 0.7706 0.7386 0.4917 0.1687  -0.2193 0.0109  541 LYS A CA    
2107 C C     . LYS B 245 ? 0.6392 0.6019 0.3489 0.1554  -0.2231 0.0080  541 LYS A C     
2108 O O     . LYS B 245 ? 0.6772 0.6424 0.3816 0.1545  -0.2328 0.0075  541 LYS A O     
2109 C CB    . LYS B 245 ? 0.7795 0.7830 0.5338 0.1709  -0.2178 0.0092  541 LYS A CB    
2110 C CG    . LYS B 245 ? 0.8560 0.8948 0.6337 0.1683  -0.2288 0.0075  541 LYS A CG    
2111 C CD    . LYS B 245 ? 0.8728 0.9514 0.6854 0.1738  -0.2274 0.0078  541 LYS A CD    
2112 C CE    . LYS B 245 ? 0.8852 1.0001 0.7217 0.1706  -0.2387 0.0073  541 LYS A CE    
2113 N NZ    . LYS B 245 ? 0.9435 1.1002 0.8148 0.1758  -0.2360 0.0086  541 LYS A NZ    
2114 N N     . LEU B 246 ? 0.6268 0.5815 0.3324 0.1450  -0.2152 0.0055  542 LEU A N     
2115 C CA    . LEU B 246 ? 0.6818 0.6305 0.3783 0.1317  -0.2166 0.0012  542 LEU A CA    
2116 C C     . LEU B 246 ? 0.6684 0.5836 0.3284 0.1289  -0.2135 0.0023  542 LEU A C     
2117 O O     . LEU B 246 ? 0.6663 0.5750 0.3140 0.1202  -0.2156 -0.0019 542 LEU A O     
2118 C CB    . LEU B 246 ? 0.6067 0.5647 0.3236 0.1188  -0.2054 -0.0025 542 LEU A CB    
2119 C CG    . LEU B 246 ? 0.6040 0.5978 0.3588 0.1176  -0.2076 -0.0028 542 LEU A CG    
2120 C CD1   . LEU B 246 ? 0.5590 0.5563 0.3306 0.1063  -0.1947 -0.0048 542 LEU A CD1   
2121 C CD2   . LEU B 246 ? 0.5903 0.6044 0.3556 0.1138  -0.2230 -0.0052 542 LEU A CD2   
2122 N N     . GLN B 247 ? 0.6656 0.5608 0.3114 0.1346  -0.2066 0.0076  543 GLN A N     
2123 C CA    . GLN B 247 ? 0.7178 0.5856 0.3337 0.1312  -0.2031 0.0106  543 GLN A CA    
2124 C C     . GLN B 247 ? 0.7006 0.5556 0.3010 0.1194  -0.1939 0.0073  543 GLN A C     
2125 O O     . GLN B 247 ? 0.7161 0.5588 0.2954 0.1142  -0.1938 0.0069  543 GLN A O     
2126 C CB    . GLN B 247 ? 0.7139 0.5835 0.3217 0.1337  -0.2148 0.0111  543 GLN A CB    
2127 C CG    . GLN B 247 ? 0.8652 0.7447 0.4852 0.1463  -0.2232 0.0146  543 GLN A CG    
2128 C CD    . GLN B 247 ? 0.8583 0.7133 0.4621 0.1521  -0.2187 0.0209  543 GLN A CD    
2129 O OE1   . GLN B 247 ? 0.8913 0.7229 0.4698 0.1466  -0.2150 0.0243  543 GLN A OE1   
2130 N NE2   . GLN B 247 ? 0.7919 0.6524 0.4104 0.1627  -0.2188 0.0225  543 GLN A NE2   
2131 N N     . LEU B 248 ? 0.6676 0.5268 0.2783 0.1156  -0.1861 0.0045  544 LEU A N     
2132 C CA    . LEU B 248 ? 0.7386 0.5865 0.3386 0.1047  -0.1743 0.0011  544 LEU A CA    
2133 C C     . LEU B 248 ? 0.7561 0.5797 0.3311 0.1040  -0.1651 0.0074  544 LEU A C     
2134 O O     . LEU B 248 ? 0.7023 0.5185 0.2774 0.1103  -0.1644 0.0139  544 LEU A O     
2135 C CB    . LEU B 248 ? 0.6336 0.4952 0.2623 0.0987  -0.1637 -0.0027 544 LEU A CB    
2136 C CG    . LEU B 248 ? 0.6184 0.5064 0.2763 0.0978  -0.1724 -0.0068 544 LEU A CG    
2137 C CD1   . LEU B 248 ? 0.6494 0.5519 0.3367 0.0921  -0.1627 -0.0089 544 LEU A CD1   
2138 C CD2   . LEU B 248 ? 0.6330 0.5223 0.2824 0.0922  -0.1820 -0.0129 544 LEU A CD2   
2139 N N     . PRO B 249 ? 0.7528 0.5655 0.3095 0.0956  -0.1570 0.0055  545 PRO A N     
2140 C CA    . PRO B 249 ? 0.8074 0.6016 0.3448 0.0924  -0.1473 0.0125  545 PRO A CA    
2141 C C     . PRO B 249 ? 0.7574 0.5455 0.3020 0.0924  -0.1374 0.0163  545 PRO A C     
2142 O O     . PRO B 249 ? 0.7962 0.5944 0.3589 0.0912  -0.1327 0.0119  545 PRO A O     
2143 C CB    . PRO B 249 ? 0.8403 0.6320 0.3621 0.0836  -0.1399 0.0079  545 PRO A CB    
2144 C CG    . PRO B 249 ? 0.8408 0.6453 0.3695 0.0836  -0.1493 -0.0014 545 PRO A CG    
2145 C CD    . PRO B 249 ? 0.7621 0.5800 0.3157 0.0887  -0.1567 -0.0033 545 PRO A CD    
2146 N N     . VAL B 250 ? 0.7958 0.5682 0.3294 0.0926  -0.1341 0.0246  546 VAL A N     
2147 C CA    . VAL B 250 ? 0.8637 0.6273 0.4014 0.0913  -0.1248 0.0288  546 VAL A CA    
2148 C C     . VAL B 250 ? 0.9162 0.6726 0.4400 0.0800  -0.1116 0.0301  546 VAL A C     
2149 O O     . VAL B 250 ? 0.9948 0.7407 0.5010 0.0752  -0.1096 0.0360  546 VAL A O     
2150 C CB    . VAL B 250 ? 0.8643 0.6139 0.3994 0.0976  -0.1296 0.0365  546 VAL A CB    
2151 C CG1   . VAL B 250 ? 0.8542 0.5962 0.3970 0.0971  -0.1216 0.0391  546 VAL A CG1   
2152 C CG2   . VAL B 250 ? 0.8216 0.5812 0.3691 0.1098  -0.1431 0.0347  546 VAL A CG2   
2153 N N     . LEU B 251 ? 0.9765 0.7403 0.5090 0.0758  -0.1026 0.0247  547 LEU A N     
2154 C CA    . LEU B 251 ? 1.0591 0.8212 0.5824 0.0659  -0.0893 0.0242  547 LEU A CA    
2155 C C     . LEU B 251 ? 1.1488 0.9027 0.6754 0.0619  -0.0794 0.0299  547 LEU A C     
2156 O O     . LEU B 251 ? 1.2296 0.9830 0.7492 0.0533  -0.0681 0.0313  547 LEU A O     
2157 C CB    . LEU B 251 ? 1.0127 0.7893 0.5463 0.0635  -0.0853 0.0133  547 LEU A CB    
2158 C CG    . LEU B 251 ? 1.0830 0.8647 0.6046 0.0632  -0.0911 0.0067  547 LEU A CG    
2159 C CD1   . LEU B 251 ? 1.0873 0.8634 0.5879 0.0585  -0.0871 0.0119  547 LEU A CD1   
2160 C CD2   . LEU B 251 ? 1.0639 0.8508 0.5924 0.0704  -0.1067 0.0045  547 LEU A CD2   
2161 N N     . LYS B 252 ? 1.1232 0.8722 0.6610 0.0680  -0.0833 0.0329  548 LYS A N     
2162 C CA    . LYS B 252 ? 1.1142 0.8548 0.6563 0.0646  -0.0751 0.0374  548 LYS A CA    
2163 C C     . LYS B 252 ? 1.0471 0.7797 0.5976 0.0740  -0.0834 0.0409  548 LYS A C     
2164 O O     . LYS B 252 ? 0.9384 0.6834 0.5062 0.0829  -0.0902 0.0361  548 LYS A O     
2165 C CB    . LYS B 252 ? 1.1109 0.8678 0.6768 0.0598  -0.0635 0.0301  548 LYS A CB    
2166 C CG    . LYS B 252 ? 1.1729 0.9235 0.7377 0.0517  -0.0517 0.0343  548 LYS A CG    
2167 C CD    . LYS B 252 ? 1.1204 0.8880 0.7083 0.0479  -0.0412 0.0264  548 LYS A CD    
2168 C CE    . LYS B 252 ? 1.1248 0.8898 0.7078 0.0384  -0.0288 0.0297  548 LYS A CE    
2169 N NZ    . LYS B 252 ? 1.1092 0.8883 0.7171 0.0364  -0.0199 0.0231  548 LYS A NZ    
2170 N N     . LYS B 253 ? 1.0777 0.7934 0.6215 0.0715  -0.0823 0.0483  549 LYS A N     
2171 C CA    . LYS B 253 ? 1.1673 0.8733 0.7181 0.0808  -0.0897 0.0505  549 LYS A CA    
2172 C C     . LYS B 253 ? 1.2548 0.9558 0.8141 0.0780  -0.0818 0.0513  549 LYS A C     
2173 O O     . LYS B 253 ? 1.2926 0.9899 0.8467 0.0664  -0.0719 0.0542  549 LYS A O     
2174 C CB    . LYS B 253 ? 1.1822 0.8694 0.7179 0.0811  -0.0972 0.0575  549 LYS A CB    
2175 N N     . THR B 254 ? 1.2840 0.9874 0.8575 0.0887  -0.0860 0.0485  550 THR A N     
2176 C CA    . THR B 254 ? 1.3341 1.0311 0.9154 0.0877  -0.0804 0.0491  550 THR A CA    
2177 C C     . THR B 254 ? 1.3751 1.0508 0.9503 0.0916  -0.0873 0.0532  550 THR A C     
2178 O O     . THR B 254 ? 1.3638 1.0300 0.9287 0.0950  -0.0960 0.0557  550 THR A O     
2182 N N     . LYS B 255 ? 1.4008 1.0683 0.9820 0.0912  -0.0839 0.0533  551 LYS A N     
2183 C CA    . LYS B 255 ? 1.4096 1.0553 0.9849 0.0946  -0.0910 0.0557  551 LYS A CA    
2184 C C     . LYS B 255 ? 1.4505 1.0968 1.0283 0.1109  -0.1029 0.0521  551 LYS A C     
2185 O O     . LYS B 255 ? 1.4119 1.0407 0.9770 0.1125  -0.1112 0.0551  551 LYS A O     
2186 C CB    . LYS B 255 ? 1.3645 1.0056 0.9492 0.0945  -0.0865 0.0537  551 LYS A CB    
2187 C CG    . LYS B 255 ? 1.3187 0.9664 0.9070 0.0811  -0.0738 0.0554  551 LYS A CG    
2188 C CD    . LYS B 255 ? 1.3266 0.9578 0.9020 0.0653  -0.0707 0.0627  551 LYS A CD    
2189 C CE    . LYS B 255 ? 1.3326 0.9515 0.9123 0.0620  -0.0694 0.0630  551 LYS A CE    
2190 N NZ    . LYS B 255 ? 1.4091 1.0057 0.9749 0.0525  -0.0743 0.0697  551 LYS A NZ    
2191 N N     . THR B 256 ? 1.4939 1.1619 1.0884 0.1228  -0.1039 0.0458  552 THR A N     
2192 C CA    . THR B 256 ? 1.5039 1.1781 1.1048 0.1393  -0.1141 0.0415  552 THR A CA    
2193 C C     . THR B 256 ? 1.4541 1.1418 1.0539 0.1426  -0.1200 0.0413  552 THR A C     
2194 O O     . THR B 256 ? 1.4747 1.1610 1.0734 0.1535  -0.1298 0.0399  552 THR A O     
2195 C CB    . THR B 256 ? 1.4698 1.1639 1.0917 0.1510  -0.1121 0.0350  552 THR A CB    
2196 O OG1   . THR B 256 ? 1.3811 1.0926 1.0131 0.1441  -0.1026 0.0345  552 THR A OG1   
2197 C CG2   . THR B 256 ? 1.4738 1.1511 1.0948 0.1544  -0.1121 0.0332  552 THR A CG2   
2198 N N     . GLY B 257 ? 1.3961 1.0966 0.9957 0.1337  -0.1147 0.0421  553 GLY A N     
2199 C CA    . GLY B 257 ? 1.3186 1.0323 0.9172 0.1364  -0.1210 0.0412  553 GLY A CA    
2200 C C     . GLY B 257 ? 1.1635 0.8902 0.7606 0.1260  -0.1152 0.0405  553 GLY A C     
2201 O O     . GLY B 257 ? 1.1103 0.8265 0.6947 0.1130  -0.1076 0.0438  553 GLY A O     
2202 N N     . TYR B 258 ? 1.0599 0.8109 0.6705 0.1316  -0.1191 0.0357  554 TYR A N     
2203 C CA    . TYR B 258 ? 0.9782 0.7438 0.5917 0.1218  -0.1152 0.0325  554 TYR A CA    
2204 C C     . TYR B 258 ? 0.8405 0.6219 0.4754 0.1127  -0.1019 0.0278  554 TYR A C     
2205 O O     . TYR B 258 ? 0.7848 0.5855 0.4446 0.1172  -0.1001 0.0238  554 TYR A O     
2206 C CB    . TYR B 258 ? 0.9869 0.7737 0.6116 0.1292  -0.1254 0.0287  554 TYR A CB    
2207 C CG    . TYR B 258 ? 0.9821 0.7589 0.5921 0.1373  -0.1379 0.0319  554 TYR A CG    
2208 C CD1   . TYR B 258 ? 0.9559 0.7161 0.5442 0.1297  -0.1386 0.0356  554 TYR A CD1   
2209 C CD2   . TYR B 258 ? 0.9643 0.7530 0.5882 0.1512  -0.1468 0.0303  554 TYR A CD2   
2210 C CE1   . TYR B 258 ? 1.0142 0.7674 0.5937 0.1354  -0.1485 0.0381  554 TYR A CE1   
2211 C CE2   . TYR B 258 ? 1.0414 0.8233 0.6571 0.1574  -0.1565 0.0321  554 TYR A CE2   
2212 C CZ    . TYR B 258 ? 1.0430 0.8060 0.6360 0.1493  -0.1577 0.0362  554 TYR A CZ    
2213 O OH    . TYR B 258 ? 1.1243 0.8799 0.7083 0.1554  -0.1677 0.0385  554 TYR A OH    
2214 N N     . SER B 259 ? 0.7913 0.5659 0.4165 0.1002  -0.0929 0.0282  555 SER A N     
2215 C CA    . SER B 259 ? 0.7372 0.5262 0.3814 0.0919  -0.0812 0.0233  555 SER A CA    
2216 C C     . SER B 259 ? 0.7130 0.5259 0.3763 0.0914  -0.0836 0.0166  555 SER A C     
2217 O O     . SER B 259 ? 0.6362 0.4515 0.2907 0.0914  -0.0908 0.0152  555 SER A O     
2218 C CB    . SER B 259 ? 0.8213 0.5992 0.4498 0.0801  -0.0716 0.0249  555 SER A CB    
2219 O OG    . SER B 259 ? 0.8665 0.6587 0.5133 0.0733  -0.0615 0.0192  555 SER A OG    
2220 N N     . THR B 260 ? 0.6409 0.4711 0.3300 0.0903  -0.0782 0.0128  556 THR A N     
2221 C CA    . THR B 260 ? 0.7225 0.5747 0.4316 0.0875  -0.0801 0.0072  556 THR A CA    
2222 C C     . THR B 260 ? 0.7421 0.6003 0.4653 0.0785  -0.0692 0.0035  556 THR A C     
2223 O O     . THR B 260 ? 0.6235 0.5000 0.3692 0.0765  -0.0693 0.0003  556 THR A O     
2224 C CB    . THR B 260 ? 0.7235 0.5959 0.4534 0.0962  -0.0874 0.0071  556 THR A CB    
2225 O OG1   . THR B 260 ? 0.7512 0.6295 0.4966 0.0989  -0.0806 0.0079  556 THR A OG1   
2226 C CG2   . THR B 260 ? 0.6359 0.5023 0.3522 0.1073  -0.0988 0.0105  556 THR A CG2   
2227 N N     . SER B 261 ? 0.7762 0.6199 0.4868 0.0727  -0.0601 0.0044  557 SER A N     
2228 C CA    . SER B 261 ? 0.7949 0.6439 0.5177 0.0651  -0.0504 0.0005  557 SER A CA    
2229 C C     . SER B 261 ? 0.7986 0.6553 0.5245 0.0601  -0.0529 -0.0059 557 SER A C     
2230 O O     . SER B 261 ? 0.7735 0.6277 0.4860 0.0609  -0.0604 -0.0072 557 SER A O     
2231 C CB    . SER B 261 ? 0.8817 0.7157 0.5896 0.0601  -0.0407 0.0028  557 SER A CB    
2232 O OG    . SER B 261 ? 0.9531 0.7771 0.6374 0.0573  -0.0417 0.0032  557 SER A OG    
2233 N N     . ALA B 262 ? 0.7136 0.5786 0.4566 0.0550  -0.0475 -0.0100 558 ALA A N     
2234 C CA    . ALA B 262 ? 0.7245 0.5940 0.4706 0.0503  -0.0507 -0.0168 558 ALA A CA    
2235 C C     . ALA B 262 ? 0.7233 0.5807 0.4447 0.0484  -0.0494 -0.0200 558 ALA A C     
2236 O O     . ALA B 262 ? 0.6563 0.5144 0.3720 0.0473  -0.0564 -0.0252 558 ALA A O     
2237 C CB    . ALA B 262 ? 0.6077 0.4836 0.3732 0.0453  -0.0446 -0.0202 558 ALA A CB    
2238 N N     . ASP B 263 ? 0.8580 0.7051 0.5641 0.0477  -0.0409 -0.0168 559 ASP A N     
2239 C CA    . ASP B 263 ? 0.9866 0.8248 0.6677 0.0460  -0.0386 -0.0185 559 ASP A CA    
2240 C C     . ASP B 263 ? 0.8832 0.7172 0.5471 0.0494  -0.0493 -0.0170 559 ASP A C     
2241 O O     . ASP B 263 ? 0.8454 0.6781 0.4960 0.0487  -0.0530 -0.0224 559 ASP A O     
2242 C CB    . ASP B 263 ? 1.2139 1.0438 0.8829 0.0437  -0.0284 -0.0127 559 ASP A CB    
2243 C CG    . ASP B 263 ? 1.4503 1.2829 1.1193 0.0392  -0.0176 -0.0176 559 ASP A CG    
2244 O OD1   . ASP B 263 ? 1.5233 1.3611 1.1965 0.0389  -0.0186 -0.0262 559 ASP A OD1   
2245 O OD2   . ASP B 263 ? 1.5211 1.3506 1.1858 0.0361  -0.0086 -0.0129 559 ASP A OD2   
2246 N N     . VAL B 264 ? 0.7574 0.5888 0.4206 0.0541  -0.0550 -0.0101 560 VAL A N     
2247 C CA    . VAL B 264 ? 0.7015 0.5286 0.3487 0.0583  -0.0661 -0.0079 560 VAL A CA    
2248 C C     . VAL B 264 ? 0.6837 0.5230 0.3437 0.0595  -0.0767 -0.0138 560 VAL A C     
2249 O O     . VAL B 264 ? 0.7263 0.5631 0.3712 0.0600  -0.0844 -0.0166 560 VAL A O     
2250 C CB    . VAL B 264 ? 0.7106 0.5312 0.3550 0.0644  -0.0700 0.0005  560 VAL A CB    
2251 C CG1   . VAL B 264 ? 0.7607 0.5758 0.3875 0.0695  -0.0820 0.0032  560 VAL A CG1   
2252 C CG2   . VAL B 264 ? 0.7783 0.5851 0.4104 0.0614  -0.0604 0.0066  560 VAL A CG2   
2253 N N     . LEU B 265 ? 0.6363 0.4890 0.3235 0.0594  -0.0776 -0.0153 561 LEU A N     
2254 C CA    . LEU B 265 ? 0.6557 0.5215 0.3570 0.0591  -0.0886 -0.0193 561 LEU A CA    
2255 C C     . LEU B 265 ? 0.5513 0.4146 0.2468 0.0536  -0.0905 -0.0277 561 LEU A C     
2256 O O     . LEU B 265 ? 0.6052 0.4712 0.2967 0.0535  -0.1018 -0.0311 561 LEU A O     
2257 C CB    . LEU B 265 ? 0.5962 0.4785 0.3280 0.0587  -0.0879 -0.0180 561 LEU A CB    
2258 C CG    . LEU B 265 ? 0.6061 0.4929 0.3452 0.0659  -0.0868 -0.0111 561 LEU A CG    
2259 C CD1   . LEU B 265 ? 0.5354 0.4417 0.3042 0.0651  -0.0857 -0.0104 561 LEU A CD1   
2260 C CD2   . LEU B 265 ? 0.5012 0.3880 0.2295 0.0737  -0.0978 -0.0078 561 LEU A CD2   
2261 N N     . GLU B 266 ? 0.6864 0.5446 0.3814 0.0494  -0.0804 -0.0318 562 GLU A N     
2262 C CA    . GLU B 266 ? 0.7092 0.5630 0.3958 0.0461  -0.0825 -0.0411 562 GLU A CA    
2263 C C     . GLU B 266 ? 0.6709 0.5161 0.3288 0.0486  -0.0878 -0.0429 562 GLU A C     
2264 O O     . GLU B 266 ? 0.6915 0.5359 0.3438 0.0478  -0.0976 -0.0496 562 GLU A O     
2265 C CB    . GLU B 266 ? 0.8709 0.7203 0.5578 0.0435  -0.0699 -0.0449 562 GLU A CB    
2266 C CG    . GLU B 266 ? 1.0949 0.9518 0.8094 0.0404  -0.0659 -0.0445 562 GLU A CG    
2267 C CD    . GLU B 266 ? 1.2648 1.1179 0.9791 0.0392  -0.0524 -0.0458 562 GLU A CD    
2268 O OE1   . GLU B 266 ? 1.2473 1.1045 0.9756 0.0388  -0.0455 -0.0404 562 GLU A OE1   
2269 O OE2   . GLU B 266 ? 1.3676 1.2148 1.0677 0.0393  -0.0490 -0.0527 562 GLU A OE2   
2270 N N     . LYS B 267 ? 0.6387 0.4765 0.2774 0.0513  -0.0824 -0.0364 563 LYS A N     
2271 C CA    . LYS B 267 ? 0.7442 0.5739 0.3537 0.0535  -0.0871 -0.0364 563 LYS A CA    
2272 C C     . LYS B 267 ? 0.7131 0.5459 0.3222 0.0569  -0.1025 -0.0349 563 LYS A C     
2273 O O     . LYS B 267 ? 0.7896 0.6177 0.3783 0.0581  -0.1101 -0.0382 563 LYS A O     
2274 C CB    . LYS B 267 ? 0.8096 0.6303 0.4001 0.0542  -0.0785 -0.0277 563 LYS A CB    
2275 C CG    . LYS B 267 ? 0.9369 0.7539 0.5113 0.0509  -0.0662 -0.0303 563 LYS A CG    
2276 C CD    . LYS B 267 ? 1.0772 0.8989 0.6714 0.0479  -0.0544 -0.0312 563 LYS A CD    
2277 C CE    . LYS B 267 ? 1.0981 0.9162 0.6778 0.0448  -0.0412 -0.0262 563 LYS A CE    
2278 N NZ    . LYS B 267 ? 1.1502 0.9743 0.7491 0.0420  -0.0303 -0.0285 563 LYS A NZ    
2279 N N     . LEU B 268 ? 0.6771 0.5193 0.3082 0.0589  -0.1075 -0.0302 564 LEU A N     
2280 C CA    . LEU B 268 ? 0.7031 0.5515 0.3357 0.0629  -0.1221 -0.0284 564 LEU A CA    
2281 C C     . LEU B 268 ? 0.6453 0.5055 0.2959 0.0593  -0.1324 -0.0353 564 LEU A C     
2282 O O     . LEU B 268 ? 0.6410 0.5080 0.2924 0.0615  -0.1457 -0.0349 564 LEU A O     
2283 C CB    . LEU B 268 ? 0.7094 0.5642 0.3557 0.0686  -0.1232 -0.0200 564 LEU A CB    
2284 C CG    . LEU B 268 ? 0.7703 0.6106 0.3976 0.0726  -0.1169 -0.0122 564 LEU A CG    
2285 C CD1   . LEU B 268 ? 0.5830 0.4295 0.2277 0.0787  -0.1171 -0.0061 564 LEU A CD1   
2286 C CD2   . LEU B 268 ? 0.6281 0.4567 0.2257 0.0761  -0.1252 -0.0095 564 LEU A CD2   
2287 N N     . ALA B 269 ? 0.6143 0.4768 0.2792 0.0534  -0.1274 -0.0410 565 ALA A N     
2288 C CA    . ALA B 269 ? 0.6644 0.5367 0.3483 0.0482  -0.1377 -0.0464 565 ALA A CA    
2289 C C     . ALA B 269 ? 0.6794 0.5490 0.3493 0.0478  -0.1525 -0.0519 565 ALA A C     
2290 O O     . ALA B 269 ? 0.6129 0.4956 0.3001 0.0454  -0.1648 -0.0514 565 ALA A O     
2291 C CB    . ALA B 269 ? 0.6796 0.5478 0.3729 0.0423  -0.1302 -0.0526 565 ALA A CB    
2292 N N     . PRO B 270 ? 0.6587 0.5138 0.2984 0.0499  -0.1526 -0.0570 566 PRO A N     
2293 C CA    . PRO B 270 ? 0.7046 0.5571 0.3307 0.0496  -0.1680 -0.0629 566 PRO A CA    
2294 C C     . PRO B 270 ? 0.7841 0.6452 0.4098 0.0538  -0.1797 -0.0566 566 PRO A C     
2295 O O     . PRO B 270 ? 0.6805 0.5441 0.3031 0.0525  -0.1947 -0.0608 566 PRO A O     
2296 C CB    . PRO B 270 ? 0.6738 0.5101 0.2652 0.0525  -0.1625 -0.0685 566 PRO A CB    
2297 C CG    . PRO B 270 ? 0.7024 0.5346 0.2954 0.0518  -0.1450 -0.0681 566 PRO A CG    
2298 C CD    . PRO B 270 ? 0.6824 0.5245 0.2999 0.0517  -0.1388 -0.0582 566 PRO A CD    
2299 N N     . TYR B 271 ? 0.6485 0.5133 0.2760 0.0594  -0.1744 -0.0470 567 TYR A N     
2300 C CA    . TYR B 271 ? 0.6593 0.5305 0.2833 0.0654  -0.1861 -0.0414 567 TYR A CA    
2301 C C     . TYR B 271 ? 0.6426 0.5365 0.2992 0.0643  -0.1956 -0.0391 567 TYR A C     
2302 O O     . TYR B 271 ? 0.6607 0.5637 0.3179 0.0671  -0.2098 -0.0382 567 TYR A O     
2303 C CB    . TYR B 271 ? 0.6956 0.5591 0.3063 0.0727  -0.1784 -0.0323 567 TYR A CB    
2304 C CG    . TYR B 271 ? 0.7235 0.5671 0.3002 0.0730  -0.1708 -0.0326 567 TYR A CG    
2305 C CD1   . TYR B 271 ? 0.7338 0.5699 0.2854 0.0749  -0.1784 -0.0335 567 TYR A CD1   
2306 C CD2   . TYR B 271 ? 0.7508 0.5863 0.3239 0.0703  -0.1546 -0.0317 567 TYR A CD2   
2307 C CE1   . TYR B 271 ? 0.7602 0.5842 0.2884 0.0732  -0.1679 -0.0325 567 TYR A CE1   
2308 C CE2   . TYR B 271 ? 0.8531 0.6741 0.3959 0.0698  -0.1470 -0.0314 567 TYR A CE2   
2309 C CZ    . TYR B 271 ? 0.8302 0.6474 0.3538 0.0707  -0.1526 -0.0314 567 TYR A CZ    
2310 O OH    . TYR B 271 ? 0.8100 0.6195 0.3126 0.0683  -0.1421 -0.0298 567 TYR A OH    
2311 N N     . HIS B 272 ? 0.6161 0.5214 0.3001 0.0604  -0.1883 -0.0377 568 HIS A N     
2312 C CA    . HIS B 272 ? 0.7170 0.6475 0.4320 0.0594  -0.1964 -0.0343 568 HIS A CA    
2313 C C     . HIS B 272 ? 0.6067 0.5464 0.3481 0.0506  -0.1900 -0.0355 568 HIS A C     
2314 O O     . HIS B 272 ? 0.6128 0.5430 0.3534 0.0496  -0.1761 -0.0356 568 HIS A O     
2315 C CB    . HIS B 272 ? 0.5937 0.5349 0.3149 0.0699  -0.1951 -0.0259 568 HIS A CB    
2316 C CG    . HIS B 272 ? 0.6868 0.6572 0.4358 0.0712  -0.2058 -0.0227 568 HIS A CG    
2317 N ND1   . HIS B 272 ? 0.6821 0.6619 0.4272 0.0783  -0.2195 -0.0207 568 HIS A ND1   
2318 C CD2   . HIS B 272 ? 0.6063 0.6007 0.3879 0.0659  -0.2050 -0.0209 568 HIS A CD2   
2319 C CE1   . HIS B 272 ? 0.6428 0.6529 0.4181 0.0778  -0.2261 -0.0181 568 HIS A CE1   
2320 N NE2   . HIS B 272 ? 0.6257 0.6455 0.4233 0.0699  -0.2173 -0.0178 568 HIS A NE2   
2321 N N     . GLU B 273 ? 0.5904 0.5491 0.3552 0.0438  -0.2008 -0.0359 569 GLU A N     
2322 C CA    . GLU B 273 ? 0.5840 0.5513 0.3736 0.0337  -0.1973 -0.0364 569 GLU A CA    
2323 C C     . GLU B 273 ? 0.5436 0.5253 0.3534 0.0369  -0.1851 -0.0292 569 GLU A C     
2324 O O     . GLU B 273 ? 0.5369 0.5192 0.3609 0.0301  -0.1776 -0.0292 569 GLU A O     
2325 C CB    . GLU B 273 ? 0.6966 0.6823 0.5065 0.0244  -0.2133 -0.0369 569 GLU A CB    
2326 C CG    . GLU B 273 ? 0.9590 0.9300 0.7501 0.0199  -0.2278 -0.0451 569 GLU A CG    
2327 C CD    . GLU B 273 ? 1.1824 1.1393 0.9417 0.0302  -0.2309 -0.0475 569 GLU A CD    
2328 O OE1   . GLU B 273 ? 1.2471 1.1796 0.9794 0.0306  -0.2292 -0.0549 569 GLU A OE1   
2329 O OE2   . GLU B 273 ? 1.2040 1.1744 0.9647 0.0383  -0.2349 -0.0417 569 GLU A OE2   
2330 N N     . ILE B 274 ? 0.5246 0.5165 0.3346 0.0479  -0.1836 -0.0234 570 ILE A N     
2331 C CA    . ILE B 274 ? 0.5392 0.5427 0.3647 0.0531  -0.1722 -0.0175 570 ILE A CA    
2332 C C     . ILE B 274 ? 0.4951 0.4778 0.3105 0.0519  -0.1570 -0.0190 570 ILE A C     
2333 O O     . ILE B 274 ? 0.4750 0.4663 0.3075 0.0505  -0.1477 -0.0160 570 ILE A O     
2334 C CB    . ILE B 274 ? 0.5997 0.6099 0.4196 0.0674  -0.1742 -0.0127 570 ILE A CB    
2335 C CG1   . ILE B 274 ? 0.6466 0.6725 0.4850 0.0736  -0.1647 -0.0075 570 ILE A CG1   
2336 C CG2   . ILE B 274 ? 0.5631 0.5442 0.3494 0.0746  -0.1706 -0.0136 570 ILE A CG2   
2337 C CD1   . ILE B 274 ? 0.7185 0.7809 0.5863 0.0748  -0.1714 -0.0037 570 ILE A CD1   
2338 N N     . VAL B 275 ? 0.5112 0.4681 0.2988 0.0525  -0.1541 -0.0234 571 VAL A N     
2339 C CA    . VAL B 275 ? 0.5046 0.4445 0.2817 0.0534  -0.1393 -0.0235 571 VAL A CA    
2340 C C     . VAL B 275 ? 0.5790 0.5193 0.3713 0.0441  -0.1329 -0.0266 571 VAL A C     
2341 O O     . VAL B 275 ? 0.5144 0.4552 0.3156 0.0445  -0.1216 -0.0239 571 VAL A O     
2342 C CB    . VAL B 275 ? 0.5266 0.4425 0.2705 0.0559  -0.1374 -0.0268 571 VAL A CB    
2343 C CG1   . VAL B 275 ? 0.6115 0.5135 0.3475 0.0558  -0.1220 -0.0262 571 VAL A CG1   
2344 C CG2   . VAL B 275 ? 0.5431 0.4568 0.2710 0.0651  -0.1442 -0.0224 571 VAL A CG2   
2345 N N     . GLU B 276 ? 0.4975 0.4362 0.2925 0.0358  -0.1411 -0.0322 572 GLU A N     
2346 C CA    . GLU B 276 ? 0.4863 0.4239 0.2960 0.0269  -0.1374 -0.0349 572 GLU A CA    
2347 C C     . GLU B 276 ? 0.4632 0.4234 0.3027 0.0242  -0.1348 -0.0278 572 GLU A C     
2348 O O     . GLU B 276 ? 0.5333 0.4921 0.3823 0.0215  -0.1250 -0.0267 572 GLU A O     
2349 C CB    . GLU B 276 ? 0.6116 0.5433 0.4194 0.0187  -0.1501 -0.0419 572 GLU A CB    
2350 C CG    . GLU B 276 ? 0.8639 0.7908 0.6853 0.0093  -0.1488 -0.0449 572 GLU A CG    
2351 C CD    . GLU B 276 ? 1.1132 1.0292 0.9292 0.0018  -0.1629 -0.0529 572 GLU A CD    
2352 O OE1   . GLU B 276 ? 1.1549 1.0554 0.9687 -0.0026 -0.1616 -0.0589 572 GLU A OE1   
2353 O OE2   . GLU B 276 ? 1.1658 1.0878 0.9791 0.0008  -0.1761 -0.0535 572 GLU A OE2   
2354 N N     . ASN B 277 ? 0.5198 0.5027 0.3742 0.0252  -0.1435 -0.0230 573 ASN A N     
2355 C CA    . ASN B 277 ? 0.5157 0.5243 0.3985 0.0231  -0.1409 -0.0160 573 ASN A CA    
2356 C C     . ASN B 277 ? 0.4255 0.4355 0.3082 0.0324  -0.1275 -0.0119 573 ASN A C     
2357 O O     . ASN B 277 ? 0.4384 0.4592 0.3385 0.0297  -0.1202 -0.0083 573 ASN A O     
2358 C CB    . ASN B 277 ? 0.5348 0.5705 0.4331 0.0233  -0.1530 -0.0120 573 ASN A CB    
2359 C CG    . ASN B 277 ? 0.6081 0.6473 0.5146 0.0106  -0.1666 -0.0145 573 ASN A CG    
2360 O OD1   . ASN B 277 ? 0.5445 0.5924 0.4702 -0.0007 -0.1676 -0.0122 573 ASN A OD1   
2361 N ND2   . ASN B 277 ? 0.4732 0.5043 0.3642 0.0118  -0.1780 -0.0189 573 ASN A ND2   
2362 N N     . ILE B 278 ? 0.4345 0.4323 0.2967 0.0432  -0.1248 -0.0122 574 ILE A N     
2363 C CA    . ILE B 278 ? 0.4593 0.4531 0.3182 0.0515  -0.1131 -0.0090 574 ILE A CA    
2364 C C     . ILE B 278 ? 0.4153 0.3937 0.2719 0.0462  -0.1015 -0.0111 574 ILE A C     
2365 O O     . ILE B 278 ? 0.4565 0.4420 0.3256 0.0470  -0.0929 -0.0079 574 ILE A O     
2366 C CB    . ILE B 278 ? 0.5159 0.4941 0.3500 0.0622  -0.1139 -0.0087 574 ILE A CB    
2367 C CG1   . ILE B 278 ? 0.6352 0.6300 0.4728 0.0696  -0.1257 -0.0063 574 ILE A CG1   
2368 C CG2   . ILE B 278 ? 0.4334 0.4019 0.2617 0.0689  -0.1024 -0.0059 574 ILE A CG2   
2369 C CD1   . ILE B 278 ? 0.6150 0.6390 0.4782 0.0744  -0.1259 -0.0018 574 ILE A CD1   
2370 N N     . LEU B 279 ? 0.4754 0.4329 0.3147 0.0416  -0.1009 -0.0168 575 LEU A N     
2371 C CA    . LEU B 279 ? 0.4940 0.4383 0.3316 0.0370  -0.0907 -0.0196 575 LEU A CA    
2372 C C     . LEU B 279 ? 0.4036 0.3612 0.2662 0.0292  -0.0900 -0.0180 575 LEU A C     
2373 O O     . LEU B 279 ? 0.5327 0.4909 0.4033 0.0290  -0.0803 -0.0157 575 LEU A O     
2374 C CB    . LEU B 279 ? 0.4374 0.3621 0.2550 0.0336  -0.0926 -0.0271 575 LEU A CB    
2375 C CG    . LEU B 279 ? 0.5542 0.4640 0.3444 0.0402  -0.0905 -0.0279 575 LEU A CG    
2376 C CD1   . LEU B 279 ? 0.5967 0.4942 0.3677 0.0379  -0.0971 -0.0352 575 LEU A CD1   
2377 C CD2   . LEU B 279 ? 0.5511 0.4502 0.3334 0.0423  -0.0767 -0.0264 575 LEU A CD2   
2378 N N     . HIS B 280 ? 0.5043 0.4724 0.3791 0.0219  -0.1009 -0.0185 576 HIS A N     
2379 C CA    . HIS B 280 ? 0.4750 0.4557 0.3732 0.0127  -0.1018 -0.0157 576 HIS A CA    
2380 C C     . HIS B 280 ? 0.4567 0.4606 0.3738 0.0161  -0.0959 -0.0078 576 HIS A C     
2381 O O     . HIS B 280 ? 0.4290 0.4369 0.3587 0.0122  -0.0891 -0.0050 576 HIS A O     
2382 C CB    . HIS B 280 ? 0.5398 0.5285 0.4472 0.0036  -0.1164 -0.0166 576 HIS A CB    
2383 C CG    . HIS B 280 ? 0.6948 0.6896 0.6221 -0.0085 -0.1190 -0.0141 576 HIS A CG    
2384 N ND1   . HIS B 280 ? 0.7200 0.7344 0.6664 -0.0179 -0.1303 -0.0096 576 HIS A ND1   
2385 C CD2   . HIS B 280 ? 0.7176 0.7011 0.6484 -0.0132 -0.1126 -0.0149 576 HIS A CD2   
2386 C CE1   . HIS B 280 ? 0.7325 0.7462 0.6926 -0.0287 -0.1307 -0.0071 576 HIS A CE1   
2387 N NE2   . HIS B 280 ? 0.7272 0.7216 0.6779 -0.0254 -0.1203 -0.0105 576 HIS A NE2   
2388 N N     . TYR B 281 ? 0.4144 0.4337 0.3328 0.0244  -0.0988 -0.0045 577 TYR A N     
2389 C CA    . TYR B 281 ? 0.3611 0.4025 0.2947 0.0305  -0.0931 0.0017  577 TYR A CA    
2390 C C     . TYR B 281 ? 0.4471 0.4744 0.3717 0.0367  -0.0802 0.0015  577 TYR A C     
2391 O O     . TYR B 281 ? 0.4899 0.5296 0.4283 0.0370  -0.0733 0.0054  577 TYR A O     
2392 C CB    . TYR B 281 ? 0.3669 0.4244 0.3003 0.0406  -0.0996 0.0038  577 TYR A CB    
2393 C CG    . TYR B 281 ? 0.4099 0.4915 0.3575 0.0496  -0.0946 0.0090  577 TYR A CG    
2394 C CD1   . TYR B 281 ? 0.4073 0.5231 0.3805 0.0458  -0.0978 0.0141  577 TYR A CD1   
2395 C CD2   . TYR B 281 ? 0.4671 0.5376 0.4021 0.0618  -0.0869 0.0086  577 TYR A CD2   
2396 C CE1   . TYR B 281 ? 0.4597 0.6001 0.4452 0.0556  -0.0928 0.0182  577 TYR A CE1   
2397 C CE2   . TYR B 281 ? 0.5787 0.6699 0.5249 0.0716  -0.0830 0.0121  577 TYR A CE2   
2398 C CZ    . TYR B 281 ? 0.5741 0.7011 0.5454 0.0692  -0.0856 0.0165  577 TYR A CZ    
2399 O OH    . TYR B 281 ? 0.7049 0.8547 0.6866 0.0804  -0.0812 0.0192  577 TYR A OH    
2400 N N     . ARG B 282 ? 0.4749 0.4770 0.3762 0.0412  -0.0770 -0.0026 578 ARG A N     
2401 C CA    . ARG B 282 ? 0.5002 0.4883 0.3924 0.0459  -0.0656 -0.0025 578 ARG A CA    
2402 C C     . ARG B 282 ? 0.4586 0.4420 0.3593 0.0377  -0.0585 -0.0034 578 ARG A C     
2403 O O     . ARG B 282 ? 0.4590 0.4436 0.3645 0.0401  -0.0500 -0.0011 578 ARG A O     
2404 C CB    . ARG B 282 ? 0.6027 0.5663 0.4684 0.0500  -0.0642 -0.0058 578 ARG A CB    
2405 C CG    . ARG B 282 ? 0.5822 0.5455 0.4362 0.0603  -0.0691 -0.0037 578 ARG A CG    
2406 C CD    . ARG B 282 ? 0.6158 0.5670 0.4593 0.0676  -0.0613 -0.0016 578 ARG A CD    
2407 N NE    . ARG B 282 ? 0.5858 0.5338 0.4171 0.0783  -0.0671 0.0006  578 ARG A NE    
2408 C CZ    . ARG B 282 ? 0.6067 0.5340 0.4139 0.0805  -0.0691 0.0005  578 ARG A CZ    
2409 N NH1   . ARG B 282 ? 0.5841 0.4950 0.3774 0.0731  -0.0648 -0.0020 578 ARG A NH1   
2410 N NH2   . ARG B 282 ? 0.6849 0.6085 0.4815 0.0906  -0.0755 0.0030  578 ARG A NH2   
2411 N N     . GLN B 283 ? 0.4856 0.4616 0.3868 0.0286  -0.0626 -0.0072 579 GLN A N     
2412 C CA    . GLN B 283 ? 0.5811 0.5504 0.4891 0.0219  -0.0569 -0.0083 579 GLN A CA    
2413 C C     . GLN B 283 ? 0.4486 0.4390 0.3808 0.0166  -0.0572 -0.0024 579 GLN A C     
2414 O O     . GLN B 283 ? 0.5527 0.5437 0.4916 0.0160  -0.0492 -0.0002 579 GLN A O     
2415 C CB    . GLN B 283 ? 0.7917 0.7442 0.6909 0.0153  -0.0618 -0.0151 579 GLN A CB    
2416 C CG    . GLN B 283 ? 1.0001 0.9600 0.9075 0.0081  -0.0748 -0.0157 579 GLN A CG    
2417 C CD    . GLN B 283 ? 1.1513 1.0963 1.0584 -0.0002 -0.0793 -0.0212 579 GLN A CD    
2418 O OE1   . GLN B 283 ? 1.1475 1.0891 1.0632 -0.0041 -0.0746 -0.0204 579 GLN A OE1   
2419 N NE2   . GLN B 283 ? 1.1876 1.1228 1.0838 -0.0024 -0.0892 -0.0272 579 GLN A NE2   
2420 N N     . LEU B 284 ? 0.4093 0.4187 0.3547 0.0124  -0.0665 0.0009  580 LEU A N     
2421 C CA    . LEU B 284 ? 0.5284 0.5624 0.4973 0.0067  -0.0667 0.0080  580 LEU A CA    
2422 C C     . LEU B 284 ? 0.5139 0.5632 0.4879 0.0162  -0.0579 0.0124  580 LEU A C     
2423 O O     . LEU B 284 ? 0.4922 0.5513 0.4785 0.0134  -0.0521 0.0167  580 LEU A O     
2424 C CB    . LEU B 284 ? 0.5053 0.5603 0.4874 0.0008  -0.0785 0.0113  580 LEU A CB    
2425 C CG    . LEU B 284 ? 0.5912 0.6351 0.5717 -0.0102 -0.0903 0.0077  580 LEU A CG    
2426 C CD1   . LEU B 284 ? 0.5595 0.6299 0.5562 -0.0160 -0.1016 0.0127  580 LEU A CD1   
2427 C CD2   . LEU B 284 ? 0.6183 0.6481 0.6033 -0.0210 -0.0900 0.0073  580 LEU A CD2   
2428 N N     . GLY B 285 ? 0.4413 0.4917 0.4050 0.0279  -0.0576 0.0113  581 GLY A N     
2429 C CA    . GLY B 285 ? 0.3473 0.4100 0.3140 0.0385  -0.0507 0.0143  581 GLY A CA    
2430 C C     . GLY B 285 ? 0.4189 0.4631 0.3763 0.0412  -0.0403 0.0127  581 GLY A C     
2431 O O     . GLY B 285 ? 0.3348 0.3902 0.2996 0.0456  -0.0340 0.0157  581 GLY A O     
2432 N N     . LYS B 286 ? 0.4135 0.4307 0.3546 0.0388  -0.0384 0.0078  582 LYS A N     
2433 C CA    . LYS B 286 ? 0.4411 0.4422 0.3755 0.0394  -0.0290 0.0065  582 LYS A CA    
2434 C C     . LYS B 286 ? 0.4146 0.4241 0.3653 0.0315  -0.0255 0.0093  582 LYS A C     
2435 O O     . LYS B 286 ? 0.3757 0.3889 0.3304 0.0345  -0.0184 0.0115  582 LYS A O     
2436 C CB    . LYS B 286 ? 0.4958 0.4710 0.4118 0.0372  -0.0281 0.0009  582 LYS A CB    
2437 C CG    . LYS B 286 ? 0.5634 0.5235 0.4727 0.0372  -0.0187 -0.0006 582 LYS A CG    
2438 C CD    . LYS B 286 ? 0.5860 0.5422 0.4867 0.0462  -0.0139 0.0012  582 LYS A CD    
2439 C CE    . LYS B 286 ? 0.4964 0.4314 0.3817 0.0455  -0.0075 -0.0014 582 LYS A CE    
2440 N NZ    . LYS B 286 ? 0.5149 0.4426 0.3905 0.0527  -0.0042 0.0006  582 LYS A NZ    
2441 N N     . LEU B 287 ? 0.3243 0.3359 0.2837 0.0212  -0.0313 0.0093  583 LEU A N     
2442 C CA    . LEU B 287 ? 0.4362 0.4538 0.4103 0.0125  -0.0297 0.0129  583 LEU A CA    
2443 C C     . LEU B 287 ? 0.4756 0.5211 0.4660 0.0140  -0.0274 0.0202  583 LEU A C     
2444 O O     . LEU B 287 ? 0.4522 0.5009 0.4481 0.0138  -0.0206 0.0231  583 LEU A O     
2445 C CB    . LEU B 287 ? 0.4639 0.4781 0.4437 0.0012  -0.0390 0.0121  583 LEU A CB    
2446 C CG    . LEU B 287 ? 0.5836 0.5706 0.5478 -0.0004 -0.0411 0.0039  583 LEU A CG    
2447 C CD1   . LEU B 287 ? 0.5824 0.5647 0.5528 -0.0114 -0.0515 0.0029  583 LEU A CD1   
2448 C CD2   . LEU B 287 ? 0.6232 0.5946 0.5808 0.0022  -0.0317 0.0012  583 LEU A CD2   
2449 N N     . GLN B 288 ? 0.3894 0.4569 0.3878 0.0160  -0.0329 0.0232  584 GLN A N     
2450 C CA    . GLN B 288 ? 0.4095 0.5087 0.4251 0.0169  -0.0312 0.0304  584 GLN A CA    
2451 C C     . GLN B 288 ? 0.4903 0.5933 0.5006 0.0300  -0.0225 0.0300  584 GLN A C     
2452 O O     . GLN B 288 ? 0.4742 0.5887 0.4928 0.0296  -0.0164 0.0340  584 GLN A O     
2453 C CB    . GLN B 288 ? 0.4748 0.5987 0.5005 0.0167  -0.0395 0.0332  584 GLN A CB    
2454 C CG    . GLN B 288 ? 0.6338 0.7956 0.6772 0.0199  -0.0371 0.0403  584 GLN A CG    
2455 C CD    . GLN B 288 ? 0.6812 0.8628 0.7444 0.0043  -0.0398 0.0484  584 GLN A CD    
2456 O OE1   . GLN B 288 ? 0.7371 0.9036 0.8006 -0.0053 -0.0379 0.0498  584 GLN A OE1   
2457 N NE2   . GLN B 288 ? 0.6746 0.8904 0.7545 0.0013  -0.0450 0.0542  584 GLN A NE2   
2458 N N     . SER B 289 ? 0.4493 0.5413 0.4447 0.0417  -0.0225 0.0254  585 SER A N     
2459 C CA    . SER B 289 ? 0.5352 0.6275 0.5236 0.0549  -0.0163 0.0243  585 SER A CA    
2460 C C     . SER B 289 ? 0.5903 0.6616 0.5708 0.0534  -0.0085 0.0226  585 SER A C     
2461 O O     . SER B 289 ? 0.6190 0.7003 0.6052 0.0561  -0.0027 0.0250  585 SER A O     
2462 C CB    . SER B 289 ? 0.6873 0.7674 0.6595 0.0663  -0.0200 0.0201  585 SER A CB    
2463 O OG    . SER B 289 ? 0.8281 0.8779 0.7839 0.0623  -0.0206 0.0159  585 SER A OG    
2464 N N     . THR B 290 ? 0.4989 0.5424 0.4662 0.0492  -0.0083 0.0183  586 THR A N     
2465 C CA    . THR B 290 ? 0.4952 0.5190 0.4537 0.0494  -0.0013 0.0161  586 THR A CA    
2466 C C     . THR B 290 ? 0.5629 0.5903 0.5334 0.0399  0.0020  0.0187  586 THR A C     
2467 O O     . THR B 290 ? 0.5640 0.5920 0.5360 0.0420  0.0080  0.0199  586 THR A O     
2468 C CB    . THR B 290 ? 0.6152 0.6120 0.5565 0.0481  -0.0016 0.0111  586 THR A CB    
2469 O OG1   . THR B 290 ? 0.6962 0.6848 0.6230 0.0579  -0.0030 0.0095  586 THR A OG1   
2470 C CG2   . THR B 290 ? 0.5471 0.5275 0.4840 0.0444  0.0051  0.0092  586 THR A CG2   
2471 N N     . TYR B 291 ? 0.4619 0.4900 0.4400 0.0295  -0.0027 0.0195  587 TYR A N     
2472 C CA    . TYR B 291 ? 0.4605 0.4843 0.4463 0.0205  -0.0008 0.0212  587 TYR A CA    
2473 C C     . TYR B 291 ? 0.4503 0.4983 0.4542 0.0141  -0.0023 0.0289  587 TYR A C     
2474 O O     . TYR B 291 ? 0.6338 0.6845 0.6430 0.0120  0.0023  0.0321  587 TYR A O     
2475 C CB    . TYR B 291 ? 0.3778 0.3825 0.3586 0.0130  -0.0054 0.0168  587 TYR A CB    
2476 C CG    . TYR B 291 ? 0.4573 0.4401 0.4204 0.0182  -0.0023 0.0100  587 TYR A CG    
2477 C CD1   . TYR B 291 ? 0.5050 0.4758 0.4625 0.0205  0.0050  0.0081  587 TYR A CD1   
2478 C CD2   . TYR B 291 ? 0.5612 0.5367 0.5131 0.0205  -0.0067 0.0061  587 TYR A CD2   
2479 C CE1   . TYR B 291 ? 0.5891 0.5427 0.5312 0.0240  0.0082  0.0030  587 TYR A CE1   
2480 C CE2   . TYR B 291 ? 0.5779 0.5351 0.5129 0.0244  -0.0034 0.0010  587 TYR A CE2   
2481 C CZ    . TYR B 291 ? 0.5710 0.5181 0.5017 0.0257  0.0042  -0.0002 587 TYR A CZ    
2482 O OH    . TYR B 291 ? 0.5130 0.4446 0.4278 0.0282  0.0077  -0.0042 587 TYR A OH    
2483 N N     . ILE B 292 ? 0.3835 0.4502 0.3971 0.0105  -0.0087 0.0324  588 ILE A N     
2484 C CA    . ILE B 292 ? 0.3982 0.4910 0.4297 0.0030  -0.0099 0.0410  588 ILE A CA    
2485 C C     . ILE B 292 ? 0.4285 0.5435 0.4633 0.0131  -0.0030 0.0442  588 ILE A C     
2486 O O     . ILE B 292 ? 0.3967 0.5167 0.4354 0.0121  0.0027  0.0478  588 ILE A O     
2487 C CB    . ILE B 292 ? 0.3597 0.4693 0.4021 -0.0047 -0.0192 0.0446  588 ILE A CB    
2488 C CG1   . ILE B 292 ? 0.4613 0.5467 0.4990 -0.0144 -0.0273 0.0406  588 ILE A CG1   
2489 C CG2   . ILE B 292 ? 0.3393 0.4796 0.4010 -0.0131 -0.0197 0.0550  588 ILE A CG2   
2490 C CD1   . ILE B 292 ? 0.4234 0.4837 0.4557 -0.0190 -0.0250 0.0382  588 ILE A CD1   
2491 N N     . GLU B 293 ? 0.3525 0.4804 0.3849 0.0238  -0.0038 0.0423  589 GLU A N     
2492 C CA    . GLU B 293 ? 0.3480 0.4975 0.3825 0.0355  0.0019  0.0441  589 GLU A CA    
2493 C C     . GLU B 293 ? 0.3862 0.5159 0.4077 0.0432  0.0091  0.0399  589 GLU A C     
2494 O O     . GLU B 293 ? 0.4448 0.5881 0.4701 0.0468  0.0147  0.0428  589 GLU A O     
2495 C CB    . GLU B 293 ? 0.3123 0.4747 0.3444 0.0474  -0.0016 0.0414  589 GLU A CB    
2496 C CG    . GLU B 293 ? 0.4347 0.6248 0.4828 0.0406  -0.0086 0.0465  589 GLU A CG    
2497 C CD    . GLU B 293 ? 0.7129 0.9146 0.7582 0.0530  -0.0131 0.0434  589 GLU A CD    
2498 O OE1   . GLU B 293 ? 0.7881 0.9764 0.8186 0.0675  -0.0107 0.0377  589 GLU A OE1   
2499 O OE2   . GLU B 293 ? 0.7736 0.9971 0.8312 0.0481  -0.0198 0.0468  589 GLU A OE2   
2500 N N     . GLY B 294 ? 0.3281 0.4266 0.3341 0.0451  0.0090  0.0335  590 GLY A N     
2501 C CA    . GLY B 294 ? 0.3013 0.3808 0.2954 0.0509  0.0150  0.0299  590 GLY A CA    
2502 C C     . GLY B 294 ? 0.3489 0.4270 0.3493 0.0431  0.0193  0.0331  590 GLY A C     
2503 O O     . GLY B 294 ? 0.3839 0.4638 0.3816 0.0487  0.0246  0.0333  590 GLY A O     
2504 N N     . LEU B 295 ? 0.3408 0.4143 0.3485 0.0304  0.0164  0.0355  591 LEU A N     
2505 C CA    . LEU B 295 ? 0.2913 0.3624 0.3047 0.0231  0.0193  0.0390  591 LEU A CA    
2506 C C     . LEU B 295 ? 0.3280 0.4286 0.3537 0.0222  0.0216  0.0469  591 LEU A C     
2507 O O     . LEU B 295 ? 0.3407 0.4430 0.3658 0.0240  0.0267  0.0488  591 LEU A O     
2508 C CB    . LEU B 295 ? 0.3903 0.4479 0.4077 0.0107  0.0141  0.0395  591 LEU A CB    
2509 C CG    . LEU B 295 ? 0.4513 0.4793 0.4567 0.0113  0.0152  0.0321  591 LEU A CG    
2510 C CD1   . LEU B 295 ? 0.5077 0.5226 0.5156 0.0014  0.0087  0.0308  591 LEU A CD1   
2511 C CD2   . LEU B 295 ? 0.3168 0.3380 0.3200 0.0135  0.0214  0.0322  591 LEU A CD2   
2512 N N     . LEU B 296 ? 0.3461 0.4717 0.3830 0.0195  0.0179  0.0518  592 LEU A N     
2513 C CA    . LEU B 296 ? 0.3347 0.4926 0.3845 0.0173  0.0204  0.0605  592 LEU A CA    
2514 C C     . LEU B 296 ? 0.3737 0.5441 0.4177 0.0321  0.0273  0.0585  592 LEU A C     
2515 O O     . LEU B 296 ? 0.4106 0.6008 0.4604 0.0317  0.0317  0.0642  592 LEU A O     
2516 C CB    . LEU B 296 ? 0.3021 0.4870 0.3656 0.0117  0.0148  0.0659  592 LEU A CB    
2517 C CG    . LEU B 296 ? 0.4120 0.5879 0.4834 -0.0053 0.0069  0.0698  592 LEU A CG    
2518 C CD1   . LEU B 296 ? 0.3862 0.5865 0.4699 -0.0105 0.0001  0.0740  592 LEU A CD1   
2519 C CD2   . LEU B 296 ? 0.3913 0.5691 0.4702 -0.0175 0.0078  0.0782  592 LEU A CD2   
2520 N N     . LYS B 297 ? 0.3051 0.4631 0.3364 0.0452  0.0277  0.0504  593 LYS A N     
2521 C CA    . LYS B 297 ? 0.3483 0.5138 0.3718 0.0604  0.0326  0.0472  593 LYS A CA    
2522 C C     . LYS B 297 ? 0.2030 0.3522 0.2187 0.0607  0.0377  0.0460  593 LYS A C     
2523 O O     . LYS B 297 ? 0.3783 0.5412 0.3920 0.0693  0.0421  0.0464  593 LYS A O     
2524 C CB    . LYS B 297 ? 0.4197 0.5700 0.4295 0.0733  0.0301  0.0391  593 LYS A CB    
2525 C CG    . LYS B 297 ? 0.5834 0.7555 0.5994 0.0789  0.0256  0.0396  593 LYS A CG    
2526 C CD    . LYS B 297 ? 0.6027 0.7558 0.6026 0.0927  0.0225  0.0318  593 LYS A CD    
2527 C CE    . LYS B 297 ? 0.6436 0.8001 0.6460 0.0919  0.0155  0.0313  593 LYS A CE    
2528 N NZ    . LYS B 297 ? 0.6220 0.8120 0.6329 0.1030  0.0135  0.0324  593 LYS A NZ    
2529 N N     . VAL B 298 ? 0.2300 0.3513 0.2413 0.0522  0.0369  0.0442  594 VAL A N     
2530 C CA    . VAL B 298 ? 0.2957 0.3996 0.2989 0.0533  0.0408  0.0420  594 VAL A CA    
2531 C C     . VAL B 298 ? 0.3522 0.4582 0.3646 0.0410  0.0417  0.0485  594 VAL A C     
2532 O O     . VAL B 298 ? 0.2799 0.3713 0.2870 0.0406  0.0442  0.0471  594 VAL A O     
2533 C CB    . VAL B 298 ? 0.2413 0.3124 0.2312 0.0551  0.0399  0.0344  594 VAL A CB    
2534 C CG1   . VAL B 298 ? 0.3071 0.3742 0.2865 0.0670  0.0381  0.0291  594 VAL A CG1   
2535 C CG2   . VAL B 298 ? 0.2367 0.2936 0.2300 0.0439  0.0364  0.0344  594 VAL A CG2   
2536 N N     . VAL B 299 ? 0.2308 0.3537 0.2565 0.0306  0.0388  0.0558  595 VAL A N     
2537 C CA    . VAL B 299 ? 0.2347 0.3627 0.2686 0.0196  0.0391  0.0637  595 VAL A CA    
2538 C C     . VAL B 299 ? 0.2154 0.3681 0.2505 0.0254  0.0447  0.0684  595 VAL A C     
2539 O O     . VAL B 299 ? 0.2470 0.4275 0.2863 0.0315  0.0464  0.0705  595 VAL A O     
2540 C CB    . VAL B 299 ? 0.3108 0.4492 0.3580 0.0058  0.0332  0.0711  595 VAL A CB    
2541 C CG1   . VAL B 299 ? 0.2278 0.3706 0.2825 -0.0061 0.0326  0.0806  595 VAL A CG1   
2542 C CG2   . VAL B 299 ? 0.3082 0.4207 0.3521 0.0012  0.0272  0.0652  595 VAL A CG2   
2543 N N     . ARG B 300 ? 0.2695 0.4132 0.3005 0.0242  0.0474  0.0697  596 ARG A N     
2544 C CA    . ARG B 300 ? 0.2872 0.4538 0.3181 0.0290  0.0526  0.0745  596 ARG A CA    
2545 C C     . ARG B 300 ? 0.3012 0.4942 0.3458 0.0166  0.0519  0.0871  596 ARG A C     
2546 O O     . ARG B 300 ? 0.2949 0.4761 0.3445 0.0034  0.0482  0.0929  596 ARG A O     
2547 C CB    . ARG B 300 ? 0.2537 0.4012 0.2753 0.0311  0.0549  0.0719  596 ARG A CB    
2548 C CG    . ARG B 300 ? 0.3166 0.4335 0.3267 0.0377  0.0541  0.0611  596 ARG A CG    
2549 C CD    . ARG B 300 ? 0.4908 0.6020 0.4893 0.0478  0.0576  0.0565  596 ARG A CD    
2550 N NE    . ARG B 300 ? 0.6135 0.7090 0.6006 0.0586  0.0573  0.0468  596 ARG A NE    
2551 C CZ    . ARG B 300 ? 0.5791 0.6772 0.5556 0.0714  0.0592  0.0420  596 ARG A CZ    
2552 N NH1   . ARG B 300 ? 0.4765 0.5946 0.4525 0.0756  0.0625  0.0456  596 ARG A NH1   
2553 N NH2   . ARG B 300 ? 0.6192 0.6994 0.5846 0.0799  0.0574  0.0338  596 ARG A NH2   
2554 N N     . PRO B 301 ? 0.2648 0.4938 0.3159 0.0204  0.0549  0.0920  597 PRO A N     
2555 C CA    . PRO B 301 ? 0.2029 0.4594 0.2684 0.0064  0.0538  0.1055  597 PRO A CA    
2556 C C     . PRO B 301 ? 0.3267 0.5842 0.3915 -0.0015 0.0557  0.1141  597 PRO A C     
2557 O O     . PRO B 301 ? 0.3715 0.6377 0.4466 -0.0175 0.0522  0.1258  597 PRO A O     
2558 C CB    . PRO B 301 ? 0.2508 0.5486 0.3220 0.0156  0.0580  0.1073  597 PRO A CB    
2559 C CG    . PRO B 301 ? 0.2433 0.5336 0.2999 0.0362  0.0622  0.0951  597 PRO A CG    
2560 C CD    . PRO B 301 ? 0.3073 0.5534 0.3531 0.0375  0.0586  0.0854  597 PRO A CD    
2561 N N     . ASP B 302 ? 0.3946 0.6422 0.4471 0.0085  0.0602  0.1091  598 ASP A N     
2562 C CA    . ASP B 302 ? 0.4360 0.6804 0.4863 0.0012  0.0611  0.1168  598 ASP A CA    
2563 C C     . ASP B 302 ? 0.6036 0.8161 0.6566 -0.0126 0.0539  0.1190  598 ASP A C     
2564 O O     . ASP B 302 ? 0.7321 0.9500 0.7937 -0.0278 0.0499  0.1307  598 ASP A O     
2565 C CB    . ASP B 302 ? 0.2822 0.5180 0.3177 0.0153  0.0660  0.1092  598 ASP A CB    
2566 C CG    . ASP B 302 ? 0.5382 0.7455 0.5637 0.0268  0.0650  0.0948  598 ASP A CG    
2567 O OD1   . ASP B 302 ? 0.5443 0.7532 0.5725 0.0306  0.0636  0.0899  598 ASP A OD1   
2568 O OD2   . ASP B 302 ? 0.5276 0.7113 0.5427 0.0312  0.0652  0.0889  598 ASP A OD2   
2569 N N     . THR B 303 ? 0.5600 0.7390 0.6054 -0.0074 0.0516  0.1079  599 THR A N     
2570 C CA    . THR B 303 ? 0.4288 0.5764 0.4747 -0.0169 0.0452  0.1075  599 THR A CA    
2571 C C     . THR B 303 ? 0.4196 0.5578 0.4735 -0.0260 0.0383  0.1073  599 THR A C     
2572 O O     . THR B 303 ? 0.3477 0.4629 0.4032 -0.0351 0.0318  0.1085  599 THR A O     
2573 C CB    . THR B 303 ? 0.5099 0.6294 0.5446 -0.0070 0.0464  0.0956  599 THR A CB    
2574 O OG1   . THR B 303 ? 0.5031 0.6159 0.5341 0.0015  0.0472  0.0854  599 THR A OG1   
2575 C CG2   . THR B 303 ? 0.6551 0.7818 0.6808 0.0023  0.0521  0.0947  599 THR A CG2   
2576 N N     . LYS B 304 ? 0.3030 0.4581 0.3612 -0.0230 0.0389  0.1055  600 LYS A N     
2577 C CA    . LYS B 304 ? 0.2049 0.3485 0.2676 -0.0284 0.0324  0.1022  600 LYS A CA    
2578 C C     . LYS B 304 ? 0.2050 0.3120 0.2591 -0.0249 0.0298  0.0912  600 LYS A C     
2579 O O     . LYS B 304 ? 0.2530 0.3421 0.3095 -0.0325 0.0228  0.0897  600 LYS A O     
2580 C CB    . LYS B 304 ? 0.5786 0.7285 0.6531 -0.0457 0.0250  0.1135  600 LYS A CB    
2581 C CG    . LYS B 304 ? 0.6074 0.7636 0.6889 -0.0498 0.0198  0.1123  600 LYS A CG    
2582 C CD    . LYS B 304 ? 0.6494 0.8245 0.7445 -0.0667 0.0137  0.1259  600 LYS A CD    
2583 C CE    . LYS B 304 ? 0.6661 0.8099 0.7619 -0.0795 0.0026  0.1264  600 LYS A CE    
2584 N NZ    . LYS B 304 ? 0.6773 0.8320 0.7841 -0.0918 -0.0057 0.1319  600 LYS A NZ    
2585 N N     . LYS B 305 ? 0.2005 0.2967 0.2442 -0.0134 0.0351  0.0834  601 LYS A N     
2586 C CA    . LYS B 305 ? 0.2187 0.2854 0.2544 -0.0092 0.0340  0.0730  601 LYS A CA    
2587 C C     . LYS B 305 ? 0.2500 0.3160 0.2776 0.0027  0.0377  0.0640  601 LYS A C     
2588 O O     . LYS B 305 ? 0.1934 0.2782 0.2191 0.0106  0.0418  0.0645  601 LYS A O     
2589 C CB    . LYS B 305 ? 0.3044 0.3564 0.3350 -0.0075 0.0357  0.0718  601 LYS A CB    
2590 C CG    . LYS B 305 ? 0.3197 0.3663 0.3564 -0.0188 0.0306  0.0801  601 LYS A CG    
2591 C CD    . LYS B 305 ? 0.3727 0.4082 0.4040 -0.0153 0.0326  0.0791  601 LYS A CD    
2592 C CE    . LYS B 305 ? 0.3287 0.3519 0.3644 -0.0252 0.0261  0.0857  601 LYS A CE    
2593 N NZ    . LYS B 305 ? 0.4798 0.4888 0.5101 -0.0207 0.0270  0.0827  601 LYS A NZ    
2594 N N     . VAL B 306 ? 0.2672 0.3114 0.2891 0.0045  0.0359  0.0558  602 VAL A N     
2595 C CA    . VAL B 306 ? 0.2874 0.3245 0.2988 0.0152  0.0394  0.0475  602 VAL A CA    
2596 C C     . VAL B 306 ? 0.2695 0.2897 0.2737 0.0185  0.0422  0.0432  602 VAL A C     
2597 O O     . VAL B 306 ? 0.2440 0.2517 0.2507 0.0129  0.0404  0.0434  602 VAL A O     
2598 C CB    . VAL B 306 ? 0.2433 0.2691 0.2513 0.0152  0.0362  0.0418  602 VAL A CB    
2599 C CG1   . VAL B 306 ? 0.2269 0.2720 0.2420 0.0131  0.0331  0.0459  602 VAL A CG1   
2600 C CG2   . VAL B 306 ? 0.2468 0.2533 0.2559 0.0081  0.0323  0.0391  602 VAL A CG2   
2601 N N     . HIS B 307 ? 0.1933 0.2138 0.1889 0.0279  0.0460  0.0394  603 HIS A N     
2602 C CA    . HIS B 307 ? 0.1932 0.1995 0.1819 0.0310  0.0483  0.0355  603 HIS A CA    
2603 C C     . HIS B 307 ? 0.2402 0.2329 0.2184 0.0369  0.0490  0.0282  603 HIS A C     
2604 O O     . HIS B 307 ? 0.2092 0.2050 0.1798 0.0450  0.0503  0.0262  603 HIS A O     
2605 C CB    . HIS B 307 ? 0.1931 0.2115 0.1798 0.0358  0.0511  0.0386  603 HIS A CB    
2606 C CG    . HIS B 307 ? 0.2114 0.2436 0.2073 0.0290  0.0505  0.0472  603 HIS A CG    
2607 N ND1   . HIS B 307 ? 0.2255 0.2491 0.2237 0.0240  0.0496  0.0495  603 HIS A ND1   
2608 C CD2   . HIS B 307 ? 0.2194 0.2737 0.2228 0.0258  0.0503  0.0548  603 HIS A CD2   
2609 C CE1   . HIS B 307 ? 0.2810 0.3188 0.2863 0.0178  0.0485  0.0585  603 HIS A CE1   
2610 N NE2   . HIS B 307 ? 0.2186 0.2761 0.2276 0.0181  0.0492  0.0621  603 HIS A NE2   
2611 N N     . THR B 308 ? 0.2312 0.2093 0.2084 0.0330  0.0477  0.0244  604 THR A N     
2612 C CA    . THR B 308 ? 0.2393 0.2046 0.2060 0.0369  0.0483  0.0187  604 THR A CA    
2613 C C     . THR B 308 ? 0.2233 0.1797 0.1823 0.0408  0.0504  0.0161  604 THR A C     
2614 O O     . THR B 308 ? 0.2689 0.2275 0.2310 0.0401  0.0515  0.0178  604 THR A O     
2615 C CB    . THR B 308 ? 0.2316 0.1849 0.1985 0.0315  0.0471  0.0153  604 THR A CB    
2616 O OG1   . THR B 308 ? 0.2554 0.1999 0.2120 0.0344  0.0472  0.0115  604 THR A OG1   
2617 C CG2   . THR B 308 ? 0.2753 0.2197 0.2444 0.0284  0.0486  0.0134  604 THR A CG2   
2618 N N     . ILE B 309 ? 0.2598 0.2055 0.2081 0.0445  0.0503  0.0124  605 ILE A N     
2619 C CA    . ILE B 309 ? 0.2964 0.2302 0.2366 0.0462  0.0511  0.0098  605 ILE A CA    
2620 C C     . ILE B 309 ? 0.2354 0.1561 0.1716 0.0413  0.0516  0.0069  605 ILE A C     
2621 O O     . ILE B 309 ? 0.2655 0.1811 0.1953 0.0419  0.0506  0.0059  605 ILE A O     
2622 C CB    . ILE B 309 ? 0.3173 0.2485 0.2463 0.0549  0.0494  0.0085  605 ILE A CB    
2623 C CG1   . ILE B 309 ? 0.3046 0.2519 0.2372 0.0607  0.0499  0.0108  605 ILE A CG1   
2624 C CG2   . ILE B 309 ? 0.2921 0.2062 0.2110 0.0547  0.0486  0.0056  605 ILE A CG2   
2625 C CD1   . ILE B 309 ? 0.3847 0.3301 0.3057 0.0713  0.0478  0.0083  605 ILE A CD1   
2626 N N     . PHE B 310 ? 0.2146 0.1313 0.1546 0.0368  0.0533  0.0059  606 PHE A N     
2627 C CA    . PHE B 310 ? 0.2436 0.1514 0.1805 0.0321  0.0547  0.0034  606 PHE A CA    
2628 C C     . PHE B 310 ? 0.3470 0.2437 0.2728 0.0325  0.0541  0.0026  606 PHE A C     
2629 O O     . PHE B 310 ? 0.4181 0.3128 0.3428 0.0338  0.0532  0.0027  606 PHE A O     
2630 C CB    . PHE B 310 ? 0.2734 0.1841 0.2202 0.0279  0.0565  0.0023  606 PHE A CB    
2631 C CG    . PHE B 310 ? 0.3722 0.2886 0.3276 0.0264  0.0558  0.0022  606 PHE A CG    
2632 C CD1   . PHE B 310 ? 0.3326 0.2555 0.2971 0.0264  0.0543  0.0049  606 PHE A CD1   
2633 C CD2   . PHE B 310 ? 0.4597 0.3737 0.4129 0.0248  0.0559  -0.0001 606 PHE A CD2   
2634 C CE1   . PHE B 310 ? 0.3634 0.2886 0.3350 0.0241  0.0522  0.0053  606 PHE A CE1   
2635 C CE2   . PHE B 310 ? 0.5212 0.4379 0.4812 0.0235  0.0539  -0.0008 606 PHE A CE2   
2636 C CZ    . PHE B 310 ? 0.4340 0.3555 0.4033 0.0228  0.0517  0.0021  606 PHE A CZ    
2637 N N     . ASN B 311 ? 0.3462 0.2345 0.2625 0.0311  0.0537  0.0021  607 ASN A N     
2638 C CA    . ASN B 311 ? 0.3342 0.2094 0.2391 0.0296  0.0521  0.0023  607 ASN A CA    
2639 C C     . ASN B 311 ? 0.3952 0.2701 0.3028 0.0215  0.0554  0.0019  607 ASN A C     
2640 O O     . ASN B 311 ? 0.3677 0.2436 0.2738 0.0181  0.0576  0.0016  607 ASN A O     
2641 C CB    . ASN B 311 ? 0.3409 0.2059 0.2323 0.0326  0.0490  0.0031  607 ASN A CB    
2642 C CG    . ASN B 311 ? 0.4781 0.3262 0.3563 0.0318  0.0452  0.0038  607 ASN A CG    
2643 O OD1   . ASN B 311 ? 0.4852 0.3299 0.3646 0.0264  0.0456  0.0041  607 ASN A OD1   
2644 N ND2   . ASN B 311 ? 0.4689 0.3059 0.3344 0.0373  0.0405  0.0042  607 ASN A ND2   
2645 N N     . GLN B 312 ? 0.3074 0.1831 0.2197 0.0189  0.0557  0.0018  608 GLN A N     
2646 C CA    . GLN B 312 ? 0.3633 0.2430 0.2809 0.0117  0.0589  0.0014  608 GLN A CA    
2647 C C     . GLN B 312 ? 0.2794 0.1487 0.1861 0.0053  0.0578  0.0037  608 GLN A C     
2648 O O     . GLN B 312 ? 0.3710 0.2458 0.2808 -0.0017 0.0610  0.0042  608 GLN A O     
2649 C CB    . GLN B 312 ? 0.3546 0.2406 0.2826 0.0118  0.0587  0.0006  608 GLN A CB    
2650 C CG    . GLN B 312 ? 0.3276 0.2221 0.2646 0.0061  0.0617  -0.0003 608 GLN A CG    
2651 C CD    . GLN B 312 ? 0.3210 0.2211 0.2678 0.0074  0.0603  -0.0009 608 GLN A CD    
2652 O OE1   . GLN B 312 ? 0.3175 0.2151 0.2634 0.0123  0.0574  -0.0004 608 GLN A OE1   
2653 N NE2   . GLN B 312 ? 0.2663 0.1753 0.2221 0.0033  0.0623  -0.0019 608 GLN A NE2   
2654 N N     . ALA B 313 ? 0.2711 0.1258 0.1647 0.0075  0.0530  0.0052  609 ALA A N     
2655 C CA    . ALA B 313 ? 0.3695 0.2106 0.2518 0.0006  0.0500  0.0082  609 ALA A CA    
2656 C C     . ALA B 313 ? 0.3936 0.2213 0.2606 0.0018  0.0471  0.0103  609 ALA A C     
2657 O O     . ALA B 313 ? 0.4131 0.2227 0.2668 0.0014  0.0409  0.0122  609 ALA A O     
2658 C CB    . ALA B 313 ? 0.4186 0.2493 0.2973 0.0018  0.0443  0.0078  609 ALA A CB    
2659 N N     . LEU B 314 ? 0.3837 0.2186 0.2516 0.0033  0.0505  0.0099  610 LEU A N     
2660 C CA    . LEU B 314 ? 0.4468 0.2698 0.3002 0.0054  0.0472  0.0119  610 LEU A CA    
2661 C C     . LEU B 314 ? 0.4550 0.2800 0.3031 -0.0028 0.0508  0.0147  610 LEU A C     
2662 O O     . LEU B 314 ? 0.4484 0.2591 0.2825 -0.0081 0.0476  0.0191  610 LEU A O     
2663 C CB    . LEU B 314 ? 0.4261 0.2547 0.2821 0.0155  0.0463  0.0092  610 LEU A CB    
2664 C CG    . LEU B 314 ? 0.6837 0.5000 0.5252 0.0204  0.0412  0.0107  610 LEU A CG    
2665 C CD1   . LEU B 314 ? 0.7532 0.5746 0.5979 0.0318  0.0384  0.0081  610 LEU A CD1   
2666 C CD2   . LEU B 314 ? 0.7505 0.5695 0.5873 0.0163  0.0437  0.0121  610 LEU A CD2   
2667 N N     . THR B 315 ? 0.3548 0.1963 0.2126 -0.0037 0.0571  0.0123  611 THR A N     
2668 C CA    . THR B 315 ? 0.3720 0.2173 0.2234 -0.0089 0.0607  0.0139  611 THR A CA    
2669 C C     . THR B 315 ? 0.3688 0.2160 0.2177 -0.0201 0.0637  0.0180  611 THR A C     
2670 O O     . THR B 315 ? 0.3608 0.2136 0.2192 -0.0239 0.0649  0.0180  611 THR A O     
2671 C CB    . THR B 315 ? 0.3557 0.2179 0.2180 -0.0057 0.0659  0.0088  611 THR A CB    
2672 O OG1   . THR B 315 ? 0.3160 0.1914 0.1924 -0.0082 0.0704  0.0065  611 THR A OG1   
2673 C CG2   . THR B 315 ? 0.3845 0.2472 0.2522 0.0035  0.0627  0.0056  611 THR A CG2   
2674 N N     . GLN B 316 ? 0.3584 0.2026 0.1948 -0.0259 0.0649  0.0221  612 GLN A N     
2675 C CA    . GLN B 316 ? 0.3666 0.2158 0.2005 -0.0380 0.0684  0.0273  612 GLN A CA    
2676 C C     . GLN B 316 ? 0.4272 0.3017 0.2734 -0.0399 0.0774  0.0239  612 GLN A C     
2677 O O     . GLN B 316 ? 0.4962 0.3812 0.3439 -0.0496 0.0815  0.0277  612 GLN A O     
2678 C CB    . GLN B 316 ? 0.4188 0.2540 0.2326 -0.0442 0.0655  0.0343  612 GLN A CB    
2679 C CG    . GLN B 316 ? 0.5387 0.3471 0.3402 -0.0449 0.0556  0.0388  612 GLN A CG    
2680 C CD    . GLN B 316 ? 0.6734 0.4695 0.4591 -0.0580 0.0530  0.0483  612 GLN A CD    
2681 O OE1   . GLN B 316 ? 0.6904 0.4916 0.4802 -0.0694 0.0545  0.0526  612 GLN A OE1   
2682 N NE2   . GLN B 316 ? 0.7100 0.4909 0.4777 -0.0572 0.0487  0.0523  612 GLN A NE2   
2683 N N     . THR B 317 ? 0.4004 0.2851 0.2555 -0.0308 0.0800  0.0167  613 THR A N     
2684 C CA    . THR B 317 ? 0.4340 0.3408 0.3008 -0.0299 0.0874  0.0117  613 THR A CA    
2685 C C     . THR B 317 ? 0.3603 0.2764 0.2454 -0.0266 0.0880  0.0075  613 THR A C     
2686 O O     . THR B 317 ? 0.4620 0.3968 0.3576 -0.0268 0.0935  0.0041  613 THR A O     
2687 C CB    . THR B 317 ? 0.3583 0.2689 0.2228 -0.0219 0.0887  0.0058  613 THR A CB    
2688 O OG1   . THR B 317 ? 0.3435 0.2438 0.2118 -0.0138 0.0830  0.0029  613 THR A OG1   
2689 C CG2   . THR B 317 ? 0.4494 0.3543 0.2954 -0.0253 0.0889  0.0098  613 THR A CG2   
2690 N N     . GLY B 318 ? 0.3086 0.2130 0.1973 -0.0229 0.0823  0.0074  614 GLY A N     
2691 C CA    . GLY B 318 ? 0.3383 0.2506 0.2432 -0.0185 0.0823  0.0033  614 GLY A CA    
2692 C C     . GLY B 318 ? 0.3930 0.3064 0.3043 -0.0090 0.0812  -0.0023 614 GLY A C     
2693 O O     . GLY B 318 ? 0.3005 0.2183 0.2240 -0.0052 0.0802  -0.0049 614 GLY A O     
2694 N N     . ARG B 319 ? 0.2840 0.1933 0.1870 -0.0057 0.0806  -0.0036 615 ARG A N     
2695 C CA    . ARG B 319 ? 0.3524 0.2603 0.2605 0.0018  0.0778  -0.0075 615 ARG A CA    
2696 C C     . ARG B 319 ? 0.3472 0.2463 0.2574 0.0047  0.0727  -0.0052 615 ARG A C     
2697 O O     . ARG B 319 ? 0.3306 0.2198 0.2323 0.0029  0.0700  -0.0012 615 ARG A O     
2698 C CB    . ARG B 319 ? 0.3465 0.2504 0.2438 0.0037  0.0769  -0.0086 615 ARG A CB    
2699 C CG    . ARG B 319 ? 0.3931 0.3070 0.2877 0.0028  0.0819  -0.0123 615 ARG A CG    
2700 C CD    . ARG B 319 ? 0.4747 0.3943 0.3790 0.0090  0.0813  -0.0193 615 ARG A CD    
2701 N NE    . ARG B 319 ? 0.5310 0.4588 0.4307 0.0107  0.0850  -0.0246 615 ARG A NE    
2702 C CZ    . ARG B 319 ? 0.4352 0.3668 0.3411 0.0166  0.0841  -0.0319 615 ARG A CZ    
2703 N NH1   . ARG B 319 ? 0.5018 0.4290 0.4189 0.0200  0.0794  -0.0334 615 ARG A NH1   
2704 N NH2   . ARG B 319 ? 0.4336 0.3725 0.3333 0.0194  0.0874  -0.0377 615 ARG A NH2   
2705 N N     . LEU B 320 ? 0.3067 0.2094 0.2275 0.0095  0.0710  -0.0078 616 LEU A N     
2706 C CA    . LEU B 320 ? 0.2848 0.1826 0.2070 0.0132  0.0666  -0.0057 616 LEU A CA    
2707 C C     . LEU B 320 ? 0.3269 0.2196 0.2408 0.0161  0.0636  -0.0048 616 LEU A C     
2708 O O     . LEU B 320 ? 0.3909 0.2855 0.3030 0.0164  0.0638  -0.0071 616 LEU A O     
2709 C CB    . LEU B 320 ? 0.3027 0.2069 0.2383 0.0162  0.0656  -0.0075 616 LEU A CB    
2710 C CG    . LEU B 320 ? 0.4167 0.3264 0.3617 0.0148  0.0674  -0.0084 616 LEU A CG    
2711 C CD1   . LEU B 320 ? 0.3758 0.2895 0.3319 0.0178  0.0653  -0.0097 616 LEU A CD1   
2712 C CD2   . LEU B 320 ? 0.3578 0.2632 0.2998 0.0133  0.0662  -0.0051 616 LEU A CD2   
2713 N N     . SER B 321 ? 0.3319 0.2187 0.2406 0.0189  0.0602  -0.0019 617 SER A N     
2714 C CA    . SER B 321 ? 0.3285 0.2146 0.2337 0.0233  0.0566  -0.0012 617 SER A CA    
2715 C C     . SER B 321 ? 0.3824 0.2752 0.2970 0.0275  0.0546  -0.0002 617 SER A C     
2716 O O     . SER B 321 ? 0.3583 0.2532 0.2788 0.0273  0.0556  0.0002  617 SER A O     
2717 C CB    . SER B 321 ? 0.3119 0.1870 0.2021 0.0248  0.0538  0.0011  617 SER A CB    
2718 O OG    . SER B 321 ? 0.4869 0.3555 0.3738 0.0270  0.0519  0.0027  617 SER A OG    
2719 N N     . SER B 322 ? 0.3549 0.2528 0.2712 0.0308  0.0518  0.0005  618 SER A N     
2720 C CA    . SER B 322 ? 0.3561 0.2637 0.2814 0.0341  0.0504  0.0025  618 SER A CA    
2721 C C     . SER B 322 ? 0.3626 0.2744 0.2842 0.0394  0.0470  0.0041  618 SER A C     
2722 O O     . SER B 322 ? 0.3235 0.2318 0.2386 0.0397  0.0451  0.0034  618 SER A O     
2723 C CB    . SER B 322 ? 0.3980 0.3137 0.3362 0.0306  0.0505  0.0025  618 SER A CB    
2724 O OG    . SER B 322 ? 0.4269 0.3424 0.3652 0.0284  0.0488  0.0007  618 SER A OG    
2725 N N     . THR B 323 ? 0.2919 0.2125 0.2172 0.0444  0.0462  0.0061  619 THR A N     
2726 C CA    . THR B 323 ? 0.3233 0.2514 0.2462 0.0512  0.0433  0.0073  619 THR A CA    
2727 C C     . THR B 323 ? 0.3097 0.2569 0.2442 0.0531  0.0436  0.0104  619 THR A C     
2728 O O     . THR B 323 ? 0.3009 0.2519 0.2417 0.0507  0.0458  0.0118  619 THR A O     
2729 C CB    . THR B 323 ? 0.4154 0.3329 0.3247 0.0587  0.0415  0.0060  619 THR A CB    
2730 O OG1   . THR B 323 ? 0.4489 0.3644 0.3582 0.0600  0.0431  0.0057  619 THR A OG1   
2731 C CG2   . THR B 323 ? 0.4991 0.3978 0.3954 0.0560  0.0404  0.0046  619 THR A CG2   
2732 N N     . GLU B 324 ? 0.2414 0.2016 0.1783 0.0576  0.0411  0.0120  620 GLU A N     
2733 C CA    . GLU B 324 ? 0.2994 0.2814 0.2458 0.0608  0.0416  0.0156  620 GLU A CA    
2734 C C     . GLU B 324 ? 0.2908 0.2825 0.2507 0.0518  0.0429  0.0197  620 GLU A C     
2735 O O     . GLU B 324 ? 0.3701 0.3691 0.3337 0.0522  0.0453  0.0221  620 GLU A O     
2736 C CB    . GLU B 324 ? 0.3597 0.3419 0.2993 0.0696  0.0431  0.0144  620 GLU A CB    
2737 C CG    . GLU B 324 ? 0.5853 0.5587 0.5113 0.0802  0.0402  0.0107  620 GLU A CG    
2738 C CD    . GLU B 324 ? 0.8837 0.8612 0.8037 0.0909  0.0405  0.0090  620 GLU A CD    
2739 O OE1   . GLU B 324 ? 0.9507 0.9516 0.8776 0.0967  0.0416  0.0110  620 GLU A OE1   
2740 O OE2   . GLU B 324 ? 0.9660 0.9240 0.8743 0.0934  0.0396  0.0056  620 GLU A OE2   
2741 N N     . PRO B 325 ? 0.3841 0.3746 0.3502 0.0438  0.0407  0.0205  621 PRO A N     
2742 C CA    . PRO B 325 ? 0.3526 0.3351 0.3140 0.0428  0.0376  0.0177  621 PRO A CA    
2743 C C     . PRO B 325 ? 0.3852 0.3468 0.3383 0.0398  0.0389  0.0132  621 PRO A C     
2744 O O     . PRO B 325 ? 0.2694 0.2243 0.2240 0.0368  0.0416  0.0125  621 PRO A O     
2745 C CB    . PRO B 325 ? 0.3484 0.3418 0.3218 0.0350  0.0341  0.0211  621 PRO A CB    
2746 C CG    . PRO B 325 ? 0.2939 0.2864 0.2749 0.0289  0.0358  0.0237  621 PRO A CG    
2747 C CD    . PRO B 325 ? 0.3350 0.3312 0.3129 0.0351  0.0402  0.0245  621 PRO A CD    
2748 N N     . ASN B 326 ? 0.3028 0.2554 0.2471 0.0407  0.0370  0.0103  622 ASN A N     
2749 C CA    . ASN B 326 ? 0.3048 0.2417 0.2423 0.0367  0.0383  0.0065  622 ASN A CA    
2750 C C     . ASN B 326 ? 0.3914 0.3297 0.3367 0.0302  0.0360  0.0056  622 ASN A C     
2751 O O     . ASN B 326 ? 0.4365 0.3782 0.3823 0.0290  0.0317  0.0055  622 ASN A O     
2752 C CB    . ASN B 326 ? 0.3658 0.2926 0.2893 0.0398  0.0370  0.0044  622 ASN A CB    
2753 C CG    . ASN B 326 ? 0.4741 0.3887 0.3906 0.0352  0.0387  0.0010  622 ASN A CG    
2754 O OD1   . ASN B 326 ? 0.4635 0.3760 0.3848 0.0312  0.0416  -0.0006 622 ASN A OD1   
2755 N ND2   . ASN B 326 ? 0.3949 0.3025 0.2996 0.0363  0.0368  -0.0001 622 ASN A ND2   
2756 N N     . LEU B 327 ? 0.2848 0.2195 0.2357 0.0263  0.0379  0.0047  623 LEU A N     
2757 C CA    . LEU B 327 ? 0.3347 0.2677 0.2921 0.0209  0.0345  0.0034  623 LEU A CA    
2758 C C     . LEU B 327 ? 0.4247 0.3457 0.3739 0.0203  0.0351  -0.0028 623 LEU A C     
2759 O O     . LEU B 327 ? 0.5669 0.4837 0.5189 0.0173  0.0316  -0.0057 623 LEU A O     
2760 C CB    . LEU B 327 ? 0.3708 0.3062 0.3387 0.0179  0.0348  0.0059  623 LEU A CB    
2761 C CG    . LEU B 327 ? 0.4650 0.4156 0.4410 0.0176  0.0339  0.0128  623 LEU A CG    
2762 C CD1   . LEU B 327 ? 0.4264 0.3796 0.4110 0.0146  0.0345  0.0165  623 LEU A CD1   
2763 C CD2   . LEU B 327 ? 0.4443 0.4038 0.4257 0.0140  0.0281  0.0155  623 LEU A CD2   
2764 N N     . GLN B 328 ? 0.3529 0.2681 0.2910 0.0232  0.0390  -0.0048 624 GLN A N     
2765 C CA    . GLN B 328 ? 0.3710 0.2779 0.3000 0.0226  0.0405  -0.0100 624 GLN A CA    
2766 C C     . GLN B 328 ? 0.5105 0.4156 0.4316 0.0228  0.0364  -0.0118 624 GLN A C     
2767 O O     . GLN B 328 ? 0.5371 0.4364 0.4498 0.0225  0.0372  -0.0165 624 GLN A O     
2768 C CB    . GLN B 328 ? 0.5392 0.4416 0.4594 0.0237  0.0461  -0.0100 624 GLN A CB    
2769 C CG    . GLN B 328 ? 0.7195 0.6221 0.6458 0.0225  0.0503  -0.0111 624 GLN A CG    
2770 C CD    . GLN B 328 ? 0.8395 0.7418 0.7647 0.0234  0.0530  -0.0076 624 GLN A CD    
2771 O OE1   . GLN B 328 ? 0.9165 0.8145 0.8319 0.0246  0.0529  -0.0056 624 GLN A OE1   
2772 N NE2   . GLN B 328 ? 0.8559 0.7613 0.7904 0.0229  0.0543  -0.0069 624 GLN A NE2   
2773 N N     . ASN B 329 ? 0.4923 0.4034 0.4153 0.0237  0.0318  -0.0085 625 ASN A N     
2774 C CA    . ASN B 329 ? 0.5263 0.4353 0.4422 0.0235  0.0270  -0.0108 625 ASN A CA    
2775 C C     . ASN B 329 ? 0.5330 0.4495 0.4594 0.0205  0.0199  -0.0092 625 ASN A C     
2776 O O     . ASN B 329 ? 0.5700 0.4901 0.4936 0.0210  0.0148  -0.0086 625 ASN A O     
2777 C CB    . ASN B 329 ? 0.3834 0.2904 0.2868 0.0273  0.0269  -0.0091 625 ASN A CB    
2778 C CG    . ASN B 329 ? 0.4760 0.3910 0.3838 0.0313  0.0262  -0.0040 625 ASN A CG    
2779 O OD1   . ASN B 329 ? 0.4717 0.3956 0.3919 0.0308  0.0268  -0.0014 625 ASN A OD1   
2780 N ND2   . ASN B 329 ? 0.3870 0.2986 0.2836 0.0359  0.0246  -0.0027 625 ASN A ND2   
2781 N N     . ILE B 330 ? 0.5697 0.4886 0.5082 0.0167  0.0186  -0.0082 626 ILE A N     
2782 C CA    . ILE B 330 ? 0.5607 0.4845 0.5085 0.0116  0.0107  -0.0065 626 ILE A CA    
2783 C C     . ILE B 330 ? 0.6088 0.5217 0.5484 0.0102  0.0055  -0.0131 626 ILE A C     
2784 O O     . ILE B 330 ? 0.6111 0.5128 0.5448 0.0114  0.0077  -0.0192 626 ILE A O     
2785 C CB    . ILE B 330 ? 0.4859 0.4116 0.4467 0.0070  0.0099  -0.0033 626 ILE A CB    
2786 C CG1   . ILE B 330 ? 0.4775 0.4143 0.4443 0.0092  0.0156  0.0027  626 ILE A CG1   
2787 C CG2   . ILE B 330 ? 0.3522 0.2830 0.3227 -0.0001 0.0009  0.0001  626 ILE A CG2   
2788 C CD1   . ILE B 330 ? 0.4588 0.4120 0.4288 0.0113  0.0148  0.0080  626 ILE A CD1   
2789 N N     . PRO B 331 ? 0.5983 0.5149 0.5371 0.0084  -0.0017 -0.0127 627 PRO A N     
2790 C CA    . PRO B 331 ? 0.5772 0.4830 0.5044 0.0086  -0.0066 -0.0198 627 PRO A CA    
2791 C C     . PRO B 331 ? 0.6058 0.4988 0.5336 0.0059  -0.0104 -0.0257 627 PRO A C     
2792 O O     . PRO B 331 ? 0.5983 0.4908 0.5378 0.0016  -0.0129 -0.0231 627 PRO A O     
2793 C CB    . PRO B 331 ? 0.5972 0.5119 0.5282 0.0055  -0.0152 -0.0167 627 PRO A CB    
2794 C CG    . PRO B 331 ? 0.6083 0.5397 0.5477 0.0074  -0.0118 -0.0089 627 PRO A CG    
2795 C CD    . PRO B 331 ? 0.5933 0.5261 0.5410 0.0070  -0.0053 -0.0059 627 PRO A CD    
2796 N N     . ILE B 332 ? 0.6931 0.5751 0.6069 0.0091  -0.0113 -0.0340 628 ILE A N     
2797 C CA    . ILE B 332 ? 0.7258 0.5942 0.6371 0.0092  -0.0152 -0.0418 628 ILE A CA    
2798 C C     . ILE B 332 ? 0.7292 0.5885 0.6267 0.0107  -0.0222 -0.0498 628 ILE A C     
2799 O O     . ILE B 332 ? 0.7563 0.6042 0.6539 0.0086  -0.0314 -0.0551 628 ILE A O     
2800 C CB    . ILE B 332 ? 0.8021 0.6675 0.7102 0.0145  -0.0056 -0.0457 628 ILE A CB    
2801 C CG1   . ILE B 332 ? 0.9101 0.7626 0.8188 0.0159  -0.0103 -0.0533 628 ILE A CG1   
2802 C CG2   . ILE B 332 ? 0.7060 0.5730 0.5985 0.0198  0.0021  -0.0491 628 ILE A CG2   
2803 C CD1   . ILE B 332 ? 0.9379 0.7894 0.8619 0.0122  -0.0122 -0.0484 628 ILE A CD1   
2804 N N     . ARG B 333 ? 0.6132 0.4759 0.4976 0.0143  -0.0187 -0.0508 629 ARG A N     
2805 C CA    . ARG B 333 ? 0.7354 0.5897 0.6037 0.0167  -0.0241 -0.0589 629 ARG A CA    
2806 C C     . ARG B 333 ? 0.7493 0.6009 0.6219 0.0111  -0.0378 -0.0587 629 ARG A C     
2807 O O     . ARG B 333 ? 0.7984 0.6373 0.6665 0.0105  -0.0464 -0.0663 629 ARG A O     
2808 C CB    . ARG B 333 ? 0.6220 0.4811 0.4753 0.0207  -0.0178 -0.0579 629 ARG A CB    
2809 N N     . LEU B 334 ? 0.7637 0.6276 0.6452 0.0070  -0.0404 -0.0502 630 LEU A N     
2810 C CA    . LEU B 334 ? 0.7233 0.5887 0.6107 0.0006  -0.0534 -0.0487 630 LEU A CA    
2811 C C     . LEU B 334 ? 0.7267 0.5926 0.6326 -0.0074 -0.0589 -0.0440 630 LEU A C     
2812 O O     . LEU B 334 ? 0.6340 0.5094 0.5524 -0.0087 -0.0523 -0.0368 630 LEU A O     
2813 C CB    . LEU B 334 ? 0.6040 0.4854 0.4939 0.0005  -0.0539 -0.0415 630 LEU A CB    
2814 N N     . GLU B 335 ? 0.7443 0.5989 0.6508 -0.0131 -0.0718 -0.0480 631 GLU A N     
2815 C CA    . GLU B 335 ? 0.9329 0.7858 0.8557 -0.0225 -0.0789 -0.0426 631 GLU A CA    
2816 C C     . GLU B 335 ? 0.9769 0.8532 0.9177 -0.0295 -0.0786 -0.0298 631 GLU A C     
2817 O O     . GLU B 335 ? 0.9332 0.8158 0.8883 -0.0346 -0.0765 -0.0223 631 GLU A O     
2818 C CB    . GLU B 335 ? 1.0660 0.9011 0.9846 -0.0283 -0.0949 -0.0487 631 GLU A CB    
2819 C CG    . GLU B 335 ? 1.1965 1.0280 1.1313 -0.0403 -0.1046 -0.0419 631 GLU A CG    
2820 C CD    . GLU B 335 ? 1.3154 1.1388 1.2550 -0.0384 -0.0985 -0.0410 631 GLU A CD    
2821 O OE1   . GLU B 335 ? 1.3377 1.1711 1.2935 -0.0463 -0.0980 -0.0301 631 GLU A OE1   
2822 O OE2   . GLU B 335 ? 1.3634 1.1717 1.2904 -0.0288 -0.0941 -0.0510 631 GLU A OE2   
2823 N N     . GLU B 336 ? 0.9652 0.8558 0.9054 -0.0292 -0.0806 -0.0273 632 GLU A N     
2824 C CA    . GLU B 336 ? 0.9533 0.8696 0.9104 -0.0337 -0.0799 -0.0160 632 GLU A CA    
2825 C C     . GLU B 336 ? 0.8286 0.7560 0.7924 -0.0292 -0.0665 -0.0102 632 GLU A C     
2826 O O     . GLU B 336 ? 0.7423 0.6858 0.7226 -0.0350 -0.0657 -0.0010 632 GLU A O     
2827 C CB    . GLU B 336 ? 1.0215 0.9505 0.9738 -0.0300 -0.0824 -0.0158 632 GLU A CB    
2828 C CG    . GLU B 336 ? 1.1175 1.0428 1.0685 -0.0370 -0.0976 -0.0186 632 GLU A CG    
2829 C CD    . GLU B 336 ? 1.2145 1.1355 1.1476 -0.0293 -0.0995 -0.0252 632 GLU A CD    
2830 O OE1   . GLU B 336 ? 1.2272 1.1327 1.1421 -0.0209 -0.0929 -0.0329 632 GLU A OE1   
2831 O OE2   . GLU B 336 ? 1.2258 1.1603 1.1631 -0.0320 -0.1077 -0.0224 632 GLU A OE2   
2832 N N     . GLY B 337 ? 0.6870 0.6064 0.6379 -0.0193 -0.0563 -0.0153 633 GLY A N     
2833 C CA    . GLY B 337 ? 0.6385 0.5660 0.5934 -0.0145 -0.0443 -0.0109 633 GLY A CA    
2834 C C     . GLY B 337 ? 0.6585 0.5759 0.6176 -0.0162 -0.0404 -0.0113 633 GLY A C     
2835 O O     . GLY B 337 ? 0.6329 0.5608 0.6020 -0.0167 -0.0345 -0.0048 633 GLY A O     
2836 N N     . ARG B 338 ? 0.6588 0.5559 0.6095 -0.0162 -0.0442 -0.0194 634 ARG A N     
2837 C CA    . ARG B 338 ? 0.6294 0.5159 0.5830 -0.0161 -0.0408 -0.0207 634 ARG A CA    
2838 C C     . ARG B 338 ? 0.4484 0.3404 0.4187 -0.0256 -0.0461 -0.0120 634 ARG A C     
2839 O O     . ARG B 338 ? 0.5216 0.4130 0.4977 -0.0255 -0.0411 -0.0088 634 ARG A O     
2840 C CB    . ARG B 338 ? 0.7938 0.6584 0.7350 -0.0129 -0.0453 -0.0320 634 ARG A CB    
2841 C CG    . ARG B 338 ? 0.9620 0.8136 0.9069 -0.0129 -0.0454 -0.0343 634 ARG A CG    
2842 C CD    . ARG B 338 ? 1.0988 0.9296 1.0306 -0.0077 -0.0505 -0.0468 634 ARG A CD    
2843 N NE    . ARG B 338 ? 1.2754 1.0989 1.2063 -0.0013 -0.0443 -0.0512 634 ARG A NE    
2844 C CZ    . ARG B 338 ? 1.3666 1.1807 1.2849 0.0078  -0.0414 -0.0624 634 ARG A CZ    
2845 N NH1   . ARG B 338 ? 1.3806 1.1903 1.2845 0.0116  -0.0439 -0.0703 634 ARG A NH1   
2846 N NH2   . ARG B 338 ? 1.3767 1.1874 1.2967 0.0135  -0.0359 -0.0656 634 ARG A NH2   
2847 N N     . LYS B 339 ? 0.4299 0.3283 0.4079 -0.0345 -0.0564 -0.0073 635 LYS A N     
2848 C CA    . LYS B 339 ? 0.5586 0.4661 0.5529 -0.0454 -0.0614 0.0031  635 LYS A CA    
2849 C C     . LYS B 339 ? 0.5932 0.5234 0.5977 -0.0440 -0.0510 0.0124  635 LYS A C     
2850 O O     . LYS B 339 ? 0.6115 0.5495 0.6283 -0.0521 -0.0528 0.0214  635 LYS A O     
2851 C CB    . LYS B 339 ? 0.6549 0.5705 0.6561 -0.0554 -0.0735 0.0072  635 LYS A CB    
2852 C CG    . LYS B 339 ? 0.7197 0.6101 0.7140 -0.0608 -0.0874 0.0002  635 LYS A CG    
2853 C CD    . LYS B 339 ? 0.7740 0.6734 0.7778 -0.0734 -0.1005 0.0062  635 LYS A CD    
2854 C CE    . LYS B 339 ? 0.7957 0.6678 0.7893 -0.0773 -0.1154 -0.0028 635 LYS A CE    
2855 N NZ    . LYS B 339 ? 0.8029 0.6632 0.8058 -0.0915 -0.1282 0.0034  635 LYS A NZ    
2856 N N     . ILE B 340 ? 0.4911 0.4312 0.4898 -0.0340 -0.0409 0.0107  636 ILE A N     
2857 C CA    . ILE B 340 ? 0.3860 0.3443 0.3920 -0.0309 -0.0314 0.0178  636 ILE A CA    
2858 C C     . ILE B 340 ? 0.3996 0.3479 0.4074 -0.0313 -0.0272 0.0186  636 ILE A C     
2859 O O     . ILE B 340 ? 0.3475 0.3090 0.3652 -0.0344 -0.0242 0.0270  636 ILE A O     
2860 C CB    . ILE B 340 ? 0.3161 0.2803 0.3126 -0.0196 -0.0229 0.0143  636 ILE A CB    
2861 C CG1   . ILE B 340 ? 0.4243 0.4034 0.4221 -0.0192 -0.0275 0.0158  636 ILE A CG1   
2862 C CG2   . ILE B 340 ? 0.3431 0.3198 0.3434 -0.0144 -0.0130 0.0191  636 ILE A CG2   
2863 C CD1   . ILE B 340 ? 0.6000 0.5777 0.5848 -0.0084 -0.0222 0.0112  636 ILE A CD1   
2864 N N     . ARG B 341 ? 0.4466 0.3722 0.4447 -0.0280 -0.0277 0.0101  637 ARG A N     
2865 C CA    . ARG B 341 ? 0.3625 0.2781 0.3620 -0.0271 -0.0244 0.0100  637 ARG A CA    
2866 C C     . ARG B 341 ? 0.3206 0.2334 0.3308 -0.0377 -0.0326 0.0173  637 ARG A C     
2867 O O     . ARG B 341 ? 0.3474 0.2559 0.3608 -0.0378 -0.0301 0.0200  637 ARG A O     
2868 C CB    . ARG B 341 ? 0.4591 0.3539 0.4465 -0.0204 -0.0235 -0.0014 637 ARG A CB    
2869 C CG    . ARG B 341 ? 0.5659 0.4643 0.5427 -0.0113 -0.0145 -0.0067 637 ARG A CG    
2870 C CD    . ARG B 341 ? 0.6877 0.5703 0.6514 -0.0065 -0.0161 -0.0176 637 ARG A CD    
2871 N NE    . ARG B 341 ? 0.7151 0.5892 0.6753 -0.0009 -0.0102 -0.0229 637 ARG A NE    
2872 C CZ    . ARG B 341 ? 0.5331 0.4094 0.4853 0.0059  -0.0009 -0.0267 637 ARG A CZ    
2873 N NH1   . ARG B 341 ? 0.5564 0.4400 0.5013 0.0080  0.0030  -0.0259 637 ARG A NH1   
2874 N NH2   . ARG B 341 ? 0.5076 0.3785 0.4590 0.0102  0.0037  -0.0310 637 ARG A NH2   
2875 N N     . GLN B 342 ? 0.3157 0.2304 0.3313 -0.0472 -0.0430 0.0211  638 GLN A N     
2876 C CA    . GLN B 342 ? 0.3686 0.2832 0.3951 -0.0593 -0.0509 0.0307  638 GLN A CA    
2877 C C     . GLN B 342 ? 0.3982 0.3375 0.4355 -0.0620 -0.0436 0.0424  638 GLN A C     
2878 O O     . GLN B 342 ? 0.3387 0.2778 0.3836 -0.0708 -0.0474 0.0511  638 GLN A O     
2879 C CB    . GLN B 342 ? 0.4955 0.4108 0.5268 -0.0706 -0.0637 0.0337  638 GLN A CB    
2880 C CG    . GLN B 342 ? 0.6438 0.5355 0.6631 -0.0678 -0.0720 0.0216  638 GLN A CG    
2881 C CD    . GLN B 342 ? 0.6453 0.5352 0.6694 -0.0802 -0.0866 0.0249  638 GLN A CD    
2882 O OE1   . GLN B 342 ? 0.6677 0.5817 0.7040 -0.0888 -0.0880 0.0351  638 GLN A OE1   
2883 N NE2   . GLN B 342 ? 0.7057 0.5677 0.7202 -0.0810 -0.0978 0.0160  638 GLN A NE2   
2884 N N     . ALA B 343 ? 0.3364 0.2960 0.3734 -0.0542 -0.0336 0.0427  639 ALA A N     
2885 C CA    . ALA B 343 ? 0.3211 0.3059 0.3673 -0.0554 -0.0270 0.0529  639 ALA A CA    
2886 C C     . ALA B 343 ? 0.2784 0.2575 0.3214 -0.0496 -0.0191 0.0527  639 ALA A C     
2887 O O     . ALA B 343 ? 0.3809 0.3778 0.4305 -0.0513 -0.0146 0.0614  639 ALA A O     
2888 C CB    . ALA B 343 ? 0.3473 0.3558 0.3940 -0.0482 -0.0207 0.0529  639 ALA A CB    
2889 N N     . PHE B 344 ? 0.2908 0.2472 0.3242 -0.0429 -0.0177 0.0432  640 PHE A N     
2890 C CA    . PHE B 344 ? 0.2529 0.2032 0.2835 -0.0372 -0.0110 0.0422  640 PHE A CA    
2891 C C     . PHE B 344 ? 0.2651 0.1980 0.2984 -0.0440 -0.0185 0.0447  640 PHE A C     
2892 O O     . PHE B 344 ? 0.3215 0.2327 0.3500 -0.0442 -0.0254 0.0376  640 PHE A O     
2893 C CB    . PHE B 344 ? 0.2487 0.1878 0.2682 -0.0261 -0.0047 0.0311  640 PHE A CB    
2894 C CG    . PHE B 344 ? 0.3074 0.2606 0.3228 -0.0196 0.0017  0.0294  640 PHE A CG    
2895 C CD1   . PHE B 344 ? 0.3387 0.3032 0.3530 -0.0133 0.0101  0.0314  640 PHE A CD1   
2896 C CD2   . PHE B 344 ? 0.3144 0.2688 0.3265 -0.0195 -0.0019 0.0261  640 PHE A CD2   
2897 C CE1   . PHE B 344 ? 0.3282 0.3030 0.3376 -0.0066 0.0146  0.0297  640 PHE A CE1   
2898 C CE2   . PHE B 344 ? 0.3559 0.3219 0.3635 -0.0129 0.0030  0.0249  640 PHE A CE2   
2899 C CZ    . PHE B 344 ? 0.2762 0.2516 0.2823 -0.0062 0.0111  0.0267  640 PHE A CZ    
2900 N N     . VAL B 345 ? 0.2813 0.2234 0.3212 -0.0489 -0.0175 0.0546  641 VAL A N     
2901 C CA    . VAL B 345 ? 0.2771 0.2050 0.3207 -0.0580 -0.0265 0.0605  641 VAL A CA    
2902 C C     . VAL B 345 ? 0.2722 0.1969 0.3144 -0.0533 -0.0213 0.0621  641 VAL A C     
2903 O O     . VAL B 345 ? 0.2575 0.1955 0.2976 -0.0453 -0.0111 0.0607  641 VAL A O     
2904 C CB    . VAL B 345 ? 0.2831 0.2270 0.3369 -0.0722 -0.0326 0.0741  641 VAL A CB    
2905 C CG1   . VAL B 345 ? 0.3361 0.2826 0.3916 -0.0767 -0.0388 0.0717  641 VAL A CG1   
2906 C CG2   . VAL B 345 ? 0.2685 0.2437 0.3280 -0.0716 -0.0232 0.0832  641 VAL A CG2   
2907 N N     . PRO B 346 ? 0.2860 0.1912 0.3283 -0.0574 -0.0290 0.0641  642 PRO A N     
2908 C CA    . PRO B 346 ? 0.3069 0.2107 0.3486 -0.0540 -0.0253 0.0673  642 PRO A CA    
2909 C C     . PRO B 346 ? 0.3177 0.2465 0.3651 -0.0601 -0.0208 0.0807  642 PRO A C     
2910 O O     . PRO B 346 ? 0.3102 0.2538 0.3639 -0.0701 -0.0238 0.0898  642 PRO A O     
2911 C CB    . PRO B 346 ? 0.3388 0.2156 0.3797 -0.0584 -0.0372 0.0678  642 PRO A CB    
2912 C CG    . PRO B 346 ? 0.3340 0.1952 0.3730 -0.0617 -0.0465 0.0619  642 PRO A CG    
2913 C CD    . PRO B 346 ? 0.3280 0.2104 0.3702 -0.0652 -0.0427 0.0638  642 PRO A CD    
2914 N N     . SER B 347 ? 0.3275 0.2627 0.3728 -0.0540 -0.0136 0.0818  643 SER A N     
2915 C CA    . SER B 347 ? 0.3811 0.3421 0.4297 -0.0572 -0.0079 0.0929  643 SER A CA    
2916 C C     . SER B 347 ? 0.4252 0.3844 0.4772 -0.0682 -0.0143 0.1062  643 SER A C     
2917 O O     . SER B 347 ? 0.4020 0.3846 0.4567 -0.0724 -0.0100 0.1169  643 SER A O     
2918 C CB    . SER B 347 ? 0.3038 0.2736 0.3471 -0.0451 0.0027  0.0877  643 SER A CB    
2919 O OG    . SER B 347 ? 0.3834 0.3341 0.4227 -0.0403 0.0013  0.0831  643 SER A OG    
2920 N N     . GLU B 348 ? 0.3937 0.3259 0.4447 -0.0726 -0.0248 0.1059  644 GLU A N     
2921 C CA    . GLU B 348 ? 0.3960 0.3222 0.4488 -0.0839 -0.0328 0.1192  644 GLU A CA    
2922 C C     . GLU B 348 ? 0.4618 0.3645 0.5163 -0.0942 -0.0470 0.1207  644 GLU A C     
2923 O O     . GLU B 348 ? 0.3952 0.2791 0.4470 -0.0889 -0.0511 0.1085  644 GLU A O     
2924 C CB    . GLU B 348 ? 0.5241 0.4363 0.5716 -0.0772 -0.0327 0.1178  644 GLU A CB    
2925 C CG    . GLU B 348 ? 0.7097 0.6376 0.7538 -0.0646 -0.0201 0.1117  644 GLU A CG    
2926 C CD    . GLU B 348 ? 0.9374 0.8608 0.9776 -0.0618 -0.0200 0.1160  644 GLU A CD    
2927 O OE1   . GLU B 348 ? 1.0411 0.9401 1.0799 -0.0631 -0.0294 0.1161  644 GLU A OE1   
2928 O OE2   . GLU B 348 ? 1.0149 0.9587 1.0530 -0.0577 -0.0112 0.1188  644 GLU A OE2   
2929 N N     . SER B 349 ? 0.4649 0.3693 0.5232 -0.1095 -0.0549 0.1361  645 SER A N     
2930 C CA    . SER B 349 ? 0.5530 0.4330 0.6117 -0.1202 -0.0702 0.1383  645 SER A CA    
2931 C C     . SER B 349 ? 0.4126 0.2571 0.4633 -0.1115 -0.0783 0.1279  645 SER A C     
2932 O O     . SER B 349 ? 0.4532 0.2929 0.5002 -0.1042 -0.0753 0.1274  645 SER A O     
2933 C CB    . SER B 349 ? 0.6292 0.5243 0.6911 -0.1339 -0.0749 0.1524  645 SER A CB    
2934 O OG    . SER B 349 ? 0.6221 0.5206 0.6802 -0.1319 -0.0720 0.1587  645 SER A OG    
2935 N N     . ASP B 350 ? 0.4946 0.3157 0.5425 -0.1116 -0.0890 0.1191  646 ASP A N     
2936 C CA    . ASP B 350 ? 0.4949 0.2843 0.5350 -0.1015 -0.0971 0.1073  646 ASP A CA    
2937 C C     . ASP B 350 ? 0.4640 0.2471 0.5013 -0.0855 -0.0890 0.0944  646 ASP A C     
2938 O O     . ASP B 350 ? 0.4081 0.1720 0.4401 -0.0749 -0.0925 0.0855  646 ASP A O     
2939 C CB    . ASP B 350 ? 0.6027 0.3834 0.6395 -0.1040 -0.1035 0.1145  646 ASP A CB    
2940 C CG    . ASP B 350 ? 0.9193 0.6904 0.9553 -0.1166 -0.1172 0.1213  646 ASP A CG    
2941 O OD1   . ASP B 350 ? 1.0774 0.8366 1.1094 -0.1187 -0.1248 0.1263  646 ASP A OD1   
2942 O OD2   . ASP B 350 ? 0.9349 0.7097 0.9739 -0.1246 -0.1212 0.1220  646 ASP A OD2   
2943 N N     . TRP B 351 ? 0.3076 0.1932 0.3700 -0.0537 0.1408  0.0390  647 TRP A N     
2944 C CA    . TRP B 351 ? 0.2917 0.1844 0.3501 -0.0460 0.1295  0.0365  647 TRP A CA    
2945 C C     . TRP B 351 ? 0.3022 0.2066 0.3828 -0.0449 0.1206  0.0312  647 TRP A C     
2946 O O     . TRP B 351 ? 0.2853 0.1957 0.3868 -0.0501 0.1235  0.0286  647 TRP A O     
2947 C CB    . TRP B 351 ? 0.2880 0.1882 0.3415 -0.0437 0.1336  0.0342  647 TRP A CB    
2948 C CG    . TRP B 351 ? 0.3406 0.2284 0.3660 -0.0430 0.1382  0.0392  647 TRP A CG    
2949 C CD1   . TRP B 351 ? 0.3354 0.2082 0.3454 -0.0473 0.1457  0.0452  647 TRP A CD1   
2950 C CD2   . TRP B 351 ? 0.3051 0.1935 0.3135 -0.0383 0.1348  0.0390  647 TRP A CD2   
2951 N NE1   . TRP B 351 ? 0.3821 0.2462 0.3658 -0.0453 0.1467  0.0488  647 TRP A NE1   
2952 C CE2   . TRP B 351 ? 0.3538 0.2278 0.3366 -0.0400 0.1400  0.0448  647 TRP A CE2   
2953 C CE3   . TRP B 351 ? 0.3091 0.2083 0.3209 -0.0333 0.1278  0.0346  647 TRP A CE3   
2954 C CZ2   . TRP B 351 ? 0.4299 0.3005 0.3909 -0.0370 0.1377  0.0459  647 TRP A CZ2   
2955 C CZ3   . TRP B 351 ? 0.3527 0.2486 0.3439 -0.0306 0.1262  0.0355  647 TRP A CZ3   
2956 C CH2   . TRP B 351 ? 0.4214 0.3035 0.3877 -0.0325 0.1308  0.0410  647 TRP A CH2   
2957 N N     . LEU B 352 ? 0.2613 0.1689 0.3371 -0.0385 0.1093  0.0296  648 LEU A N     
2958 C CA    . LEU B 352 ? 0.2453 0.1630 0.3382 -0.0371 0.1001  0.0247  648 LEU A CA    
2959 C C     . LEU B 352 ? 0.2305 0.1586 0.3224 -0.0312 0.0938  0.0218  648 LEU A C     
2960 O O     . LEU B 352 ? 0.2489 0.1744 0.3243 -0.0274 0.0941  0.0237  648 LEU A O     
2961 C CB    . LEU B 352 ? 0.2972 0.2058 0.3853 -0.0359 0.0924  0.0257  648 LEU A CB    
2962 C CG    . LEU B 352 ? 0.3425 0.2399 0.4335 -0.0423 0.0976  0.0281  648 LEU A CG    
2963 C CD1   . LEU B 352 ? 0.3594 0.2449 0.4424 -0.0402 0.0905  0.0291  648 LEU A CD1   
2964 C CD2   . LEU B 352 ? 0.3291 0.2357 0.4448 -0.0493 0.1009  0.0243  648 LEU A CD2   
2965 N N     . ILE B 353 ? 0.2169 0.1562 0.3261 -0.0307 0.0878  0.0172  649 ILE A N     
2966 C CA    . ILE B 353 ? 0.2037 0.1513 0.3118 -0.0253 0.0805  0.0146  649 ILE A CA    
2967 C C     . ILE B 353 ? 0.2106 0.1538 0.3089 -0.0215 0.0708  0.0148  649 ILE A C     
2968 O O     . ILE B 353 ? 0.2316 0.1712 0.3347 -0.0233 0.0670  0.0140  649 ILE A O     
2969 C CB    . ILE B 353 ? 0.1924 0.1533 0.3227 -0.0262 0.0779  0.0102  649 ILE A CB    
2970 C CG1   . ILE B 353 ? 0.2001 0.1665 0.3424 -0.0292 0.0885  0.0096  649 ILE A CG1   
2971 C CG2   . ILE B 353 ? 0.1941 0.1615 0.3213 -0.0207 0.0698  0.0081  649 ILE A CG2   
2972 C CD1   . ILE B 353 ? 0.2284 0.1896 0.3535 -0.0276 0.0966  0.0116  649 ILE A CD1   
2973 N N     . PHE B 354 ? 0.2005 0.1438 0.2852 -0.0164 0.0673  0.0156  650 PHE A N     
2974 C CA    . PHE B 354 ? 0.2023 0.1437 0.2789 -0.0121 0.0588  0.0154  650 PHE A CA    
2975 C C     . PHE B 354 ? 0.2328 0.1844 0.3126 -0.0091 0.0533  0.0123  650 PHE A C     
2976 O O     . PHE B 354 ? 0.2200 0.1755 0.2964 -0.0079 0.0559  0.0124  650 PHE A O     
2977 C CB    . PHE B 354 ? 0.2020 0.1346 0.2599 -0.0090 0.0596  0.0198  650 PHE A CB    
2978 C CG    . PHE B 354 ? 0.2041 0.1349 0.2552 -0.0042 0.0521  0.0197  650 PHE A CG    
2979 C CD1   . PHE B 354 ? 0.2406 0.1615 0.2882 -0.0036 0.0510  0.0214  650 PHE A CD1   
2980 C CD2   . PHE B 354 ? 0.2142 0.1527 0.2625 -0.0004 0.0470  0.0181  650 PHE A CD2   
2981 C CE1   . PHE B 354 ? 0.2420 0.1615 0.2843 0.0013  0.0452  0.0209  650 PHE A CE1   
2982 C CE2   . PHE B 354 ? 0.1877 0.1254 0.2308 0.0039  0.0413  0.0178  650 PHE A CE2   
2983 C CZ    . PHE B 354 ? 0.1963 0.1247 0.2367 0.0050  0.0406  0.0191  650 PHE A CZ    
2984 N N     . ALA B 355 ? 0.1922 0.1469 0.2777 -0.0082 0.0460  0.0095  651 ALA A N     
2985 C CA    . ALA B 355 ? 0.1659 0.1290 0.2540 -0.0058 0.0406  0.0070  651 ALA A CA    
2986 C C     . ALA B 355 ? 0.3225 0.2834 0.4010 -0.0023 0.0342  0.0065  651 ALA A C     
2987 O O     . ALA B 355 ? 0.2962 0.2516 0.3741 -0.0029 0.0318  0.0058  651 ALA A O     
2988 C CB    . ALA B 355 ? 0.2012 0.1714 0.3066 -0.0084 0.0378  0.0039  651 ALA A CB    
2989 N N     . ALA B 356 ? 0.1567 0.1214 0.2279 0.0009  0.0320  0.0067  652 ALA A N     
2990 C CA    . ALA B 356 ? 0.1551 0.1193 0.2182 0.0042  0.0270  0.0061  652 ALA A CA    
2991 C C     . ALA B 356 ? 0.2394 0.2107 0.3038 0.0051  0.0229  0.0042  652 ALA A C     
2992 O O     . ALA B 356 ? 0.2217 0.1972 0.2866 0.0052  0.0247  0.0046  652 ALA A O     
2993 C CB    . ALA B 356 ? 0.2076 0.1684 0.2589 0.0074  0.0288  0.0093  652 ALA A CB    
2994 N N     . ASP B 357 ? 0.2077 0.1793 0.2716 0.0056  0.0177  0.0020  653 ASP A N     
2995 C CA    . ASP B 357 ? 0.2635 0.2405 0.3279 0.0060  0.0135  0.0006  653 ASP A CA    
2996 C C     . ASP B 357 ? 0.2247 0.2011 0.2796 0.0082  0.0106  -0.0002 653 ASP A C     
2997 O O     . ASP B 357 ? 0.2361 0.2077 0.2874 0.0089  0.0100  -0.0013 653 ASP A O     
2998 C CB    . ASP B 357 ? 0.4620 0.4406 0.5365 0.0033  0.0094  -0.0014 653 ASP A CB    
2999 C CG    . ASP B 357 ? 0.8847 0.8585 0.9580 0.0019  0.0056  -0.0036 653 ASP A CG    
3000 O OD1   . ASP B 357 ? 1.0046 0.9740 1.0816 0.0001  0.0078  -0.0038 653 ASP A OD1   
3001 O OD2   . ASP B 357 ? 1.0229 0.9962 1.0902 0.0023  0.0008  -0.0052 653 ASP A OD2   
3002 N N     . TYR B 358 ? 0.1823 0.1632 0.2334 0.0092  0.0094  0.0001  654 TYR A N     
3003 C CA    . TYR B 358 ? 0.2166 0.1979 0.2600 0.0107  0.0073  -0.0008 654 TYR A CA    
3004 C C     . TYR B 358 ? 0.2188 0.1977 0.2621 0.0090  0.0027  -0.0033 654 TYR A C     
3005 O O     . TYR B 358 ? 0.2951 0.2751 0.3442 0.0069  -0.0004 -0.0035 654 TYR A O     
3006 C CB    . TYR B 358 ? 0.1336 0.1200 0.1735 0.0112  0.0072  0.0002  654 TYR A CB    
3007 C CG    . TYR B 358 ? 0.2273 0.2161 0.2644 0.0128  0.0105  0.0022  654 TYR A CG    
3008 C CD1   . TYR B 358 ? 0.1892 0.1794 0.2280 0.0118  0.0126  0.0034  654 TYR A CD1   
3009 C CD2   . TYR B 358 ? 0.1342 0.1238 0.1669 0.0154  0.0114  0.0027  654 TYR A CD2   
3010 C CE1   . TYR B 358 ? 0.2067 0.1985 0.2411 0.0128  0.0146  0.0052  654 TYR A CE1   
3011 C CE2   . TYR B 358 ? 0.1442 0.1365 0.1746 0.0168  0.0130  0.0049  654 TYR A CE2   
3012 C CZ    . TYR B 358 ? 0.2097 0.2029 0.2401 0.0152  0.0142  0.0062  654 TYR A CZ    
3013 O OH    . TYR B 358 ? 0.1904 0.1856 0.2167 0.0161  0.0149  0.0083  654 TYR A OH    
3014 N N     . SER B 359 ? 0.1496 0.1247 0.1861 0.0099  0.0023  -0.0051 655 SER A N     
3015 C CA    . SER B 359 ? 0.2461 0.2177 0.2785 0.0080  -0.0021 -0.0077 655 SER A CA    
3016 C C     . SER B 359 ? 0.1533 0.1276 0.1779 0.0082  -0.0033 -0.0076 655 SER A C     
3017 O O     . SER B 359 ? 0.1931 0.1688 0.2120 0.0103  0.0001  -0.0076 655 SER A O     
3018 C CB    . SER B 359 ? 0.3140 0.2785 0.3416 0.0086  -0.0011 -0.0105 655 SER A CB    
3019 O OG    . SER B 359 ? 0.3470 0.3072 0.3681 0.0063  -0.0055 -0.0134 655 SER A OG    
3020 N N     . GLN B 360 ? 0.1540 0.1287 0.1789 0.0060  -0.0080 -0.0072 656 GLN A N     
3021 C CA    . GLN B 360 ? 0.1565 0.1319 0.1729 0.0054  -0.0096 -0.0066 656 GLN A CA    
3022 C C     . GLN B 360 ? 0.2183 0.1989 0.2335 0.0070  -0.0049 -0.0047 656 GLN A C     
3023 O O     . GLN B 360 ? 0.1808 0.1621 0.1881 0.0072  -0.0029 -0.0051 656 GLN A O     
3024 C CB    . GLN B 360 ? 0.2806 0.2504 0.2850 0.0044  -0.0107 -0.0093 656 GLN A CB    
3025 C CG    . GLN B 360 ? 0.2117 0.1754 0.2153 0.0020  -0.0163 -0.0116 656 GLN A CG    
3026 C CD    . GLN B 360 ? 0.2949 0.2590 0.3016 -0.0003 -0.0237 -0.0099 656 GLN A CD    
3027 O OE1   . GLN B 360 ? 0.3771 0.3429 0.3807 -0.0004 -0.0249 -0.0074 656 GLN A OE1   
3028 N NE2   . GLN B 360 ? 0.3346 0.2969 0.3481 -0.0023 -0.0291 -0.0111 656 GLN A NE2   
3029 N N     . ILE B 361 ? 0.1608 0.1454 0.1838 0.0078  -0.0031 -0.0029 657 ILE A N     
3030 C CA    . ILE B 361 ? 0.2145 0.2039 0.2357 0.0087  0.0005  -0.0015 657 ILE A CA    
3031 C C     . ILE B 361 ? 0.1672 0.1572 0.1830 0.0068  -0.0010 -0.0006 657 ILE A C     
3032 O O     . ILE B 361 ? 0.1479 0.1412 0.1593 0.0066  0.0016  -0.0003 657 ILE A O     
3033 C CB    . ILE B 361 ? 0.1629 0.1550 0.1909 0.0094  0.0027  -0.0001 657 ILE A CB    
3034 C CG1   . ILE B 361 ? 0.2254 0.2224 0.2507 0.0099  0.0054  0.0011  657 ILE A CG1   
3035 C CG2   . ILE B 361 ? 0.1538 0.1451 0.1877 0.0080  0.0007  0.0006  657 ILE A CG2   
3036 C CD1   . ILE B 361 ? 0.3400 0.3386 0.3686 0.0100  0.0074  0.0023  657 ILE A CD1   
3037 N N     . GLU B 362 ? 0.1558 0.1427 0.1722 0.0052  -0.0053 0.0001  658 GLU A N     
3038 C CA    . GLU B 362 ? 0.1781 0.1640 0.1887 0.0034  -0.0065 0.0017  658 GLU A CA    
3039 C C     . GLU B 362 ? 0.2446 0.2286 0.2439 0.0021  -0.0059 0.0009  658 GLU A C     
3040 O O     . GLU B 362 ? 0.2022 0.1884 0.1968 0.0009  -0.0030 0.0017  658 GLU A O     
3041 C CB    . GLU B 362 ? 0.1488 0.1311 0.1630 0.0027  -0.0119 0.0031  658 GLU A CB    
3042 C CG    . GLU B 362 ? 0.2400 0.2244 0.2665 0.0041  -0.0112 0.0034  658 GLU A CG    
3043 C CD    . GLU B 362 ? 0.4245 0.4096 0.4592 0.0050  -0.0118 0.0019  658 GLU A CD    
3044 O OE1   . GLU B 362 ? 0.3366 0.3234 0.3821 0.0058  -0.0109 0.0020  658 GLU A OE1   
3045 O OE2   . GLU B 362 ? 0.3407 0.3243 0.3712 0.0047  -0.0127 0.0004  658 GLU A OE2   
3046 N N     . LEU B 363 ? 0.1855 0.1652 0.1802 0.0020  -0.0082 -0.0009 659 LEU A N     
3047 C CA    . LEU B 363 ? 0.1747 0.1516 0.1571 0.0008  -0.0064 -0.0022 659 LEU A CA    
3048 C C     . LEU B 363 ? 0.1672 0.1494 0.1503 0.0026  0.0004  -0.0037 659 LEU A C     
3049 O O     . LEU B 363 ? 0.1928 0.1761 0.1687 0.0015  0.0041  -0.0040 659 LEU A O     
3050 C CB    . LEU B 363 ? 0.1804 0.1502 0.1561 0.0000  -0.0104 -0.0045 659 LEU A CB    
3051 C CG    . LEU B 363 ? 0.2407 0.2053 0.2141 -0.0021 -0.0184 -0.0027 659 LEU A CG    
3052 C CD1   . LEU B 363 ? 0.2318 0.1902 0.2001 -0.0032 -0.0231 -0.0055 659 LEU A CD1   
3053 C CD2   . LEU B 363 ? 0.3092 0.2704 0.2708 -0.0045 -0.0190 -0.0002 659 LEU A CD2   
3054 N N     . ARG B 364 ? 0.1597 0.1455 0.1517 0.0055  0.0023  -0.0043 660 ARG A N     
3055 C CA    . ARG B 364 ? 0.1599 0.1516 0.1543 0.0079  0.0078  -0.0050 660 ARG A CA    
3056 C C     . ARG B 364 ? 0.1661 0.1648 0.1626 0.0066  0.0098  -0.0029 660 ARG A C     
3057 O O     . ARG B 364 ? 0.1709 0.1746 0.1662 0.0066  0.0139  -0.0033 660 ARG A O     
3058 C CB    . ARG B 364 ? 0.1514 0.1444 0.1541 0.0111  0.0085  -0.0052 660 ARG A CB    
3059 C CG    . ARG B 364 ? 0.1908 0.1769 0.1910 0.0126  0.0085  -0.0081 660 ARG A CG    
3060 C CD    . ARG B 364 ? 0.2104 0.1952 0.2185 0.0147  0.0083  -0.0075 660 ARG A CD    
3061 N NE    . ARG B 364 ? 0.1620 0.1386 0.1678 0.0146  0.0071  -0.0103 660 ARG A NE    
3062 C CZ    . ARG B 364 ? 0.1802 0.1527 0.1826 0.0170  0.0101  -0.0129 660 ARG A CZ    
3063 N NH1   . ARG B 364 ? 0.1832 0.1603 0.1863 0.0205  0.0146  -0.0128 660 ARG A NH1   
3064 N NH2   . ARG B 364 ? 0.2318 0.1956 0.2314 0.0160  0.0085  -0.0158 660 ARG A NH2   
3065 N N     . VAL B 365 ? 0.1576 0.1570 0.1582 0.0053  0.0072  -0.0008 661 VAL A N     
3066 C CA    . VAL B 365 ? 0.1505 0.1548 0.1519 0.0031  0.0085  0.0009  661 VAL A CA    
3067 C C     . VAL B 365 ? 0.1517 0.1541 0.1447 -0.0002 0.0094  0.0013  661 VAL A C     
3068 O O     . VAL B 365 ? 0.1523 0.1603 0.1451 -0.0019 0.0130  0.0016  661 VAL A O     
3069 C CB    . VAL B 365 ? 0.1600 0.1629 0.1658 0.0022  0.0060  0.0023  661 VAL A CB    
3070 C CG1   . VAL B 365 ? 0.1607 0.1649 0.1646 -0.0012 0.0065  0.0037  661 VAL A CG1   
3071 C CG2   . VAL B 365 ? 0.2074 0.2138 0.2201 0.0048  0.0069  0.0022  661 VAL A CG2   
3072 N N     . LEU B 366 ? 0.1591 0.1534 0.1448 -0.0015 0.0062  0.0015  662 LEU A N     
3073 C CA    . LEU B 366 ? 0.1695 0.1598 0.1443 -0.0049 0.0070  0.0023  662 LEU A CA    
3074 C C     . LEU B 366 ? 0.3295 0.3231 0.2998 -0.0048 0.0129  0.0002  662 LEU A C     
3075 O O     . LEU B 366 ? 0.1856 0.1816 0.1518 -0.0077 0.0169  0.0010  662 LEU A O     
3076 C CB    . LEU B 366 ? 0.2315 0.2119 0.1982 -0.0060 0.0013  0.0031  662 LEU A CB    
3077 C CG    . LEU B 366 ? 0.1928 0.1668 0.1447 -0.0097 0.0016  0.0044  662 LEU A CG    
3078 C CD1   . LEU B 366 ? 0.2305 0.2051 0.1817 -0.0129 0.0032  0.0075  662 LEU A CD1   
3079 C CD2   . LEU B 366 ? 0.2026 0.1670 0.1467 -0.0102 -0.0057 0.0052  662 LEU A CD2   
3080 N N     . ALA B 367 ? 0.1999 0.1933 0.1712 -0.0015 0.0140  -0.0027 663 ALA A N     
3081 C CA    . ALA B 367 ? 0.2425 0.2388 0.2108 -0.0004 0.0205  -0.0053 663 ALA A CA    
3082 C C     . ALA B 367 ? 0.2042 0.2122 0.1821 0.0001  0.0253  -0.0046 663 ALA A C     
3083 O O     . ALA B 367 ? 0.2872 0.2992 0.2627 -0.0014 0.0311  -0.0053 663 ALA A O     
3084 C CB    . ALA B 367 ? 0.1815 0.1752 0.1518 0.0038  0.0208  -0.0084 663 ALA A CB    
3085 N N     . HIS B 368 ? 0.1626 0.1763 0.1515 0.0020  0.0231  -0.0033 664 HIS A N     
3086 C CA    . HIS B 368 ? 0.1991 0.2243 0.1977 0.0024  0.0259  -0.0025 664 HIS A CA    
3087 C C     . HIS B 368 ? 0.2321 0.2600 0.2286 -0.0031 0.0268  -0.0006 664 HIS A C     
3088 O O     . HIS B 368 ? 0.2475 0.2834 0.2472 -0.0047 0.0317  -0.0009 664 HIS A O     
3089 C CB    . HIS B 368 ? 0.1737 0.2020 0.1811 0.0050  0.0222  -0.0013 664 HIS A CB    
3090 C CG    . HIS B 368 ? 0.2365 0.2755 0.2524 0.0043  0.0228  0.0000  664 HIS A CG    
3091 N ND1   . HIS B 368 ? 0.2190 0.2675 0.2437 0.0079  0.0250  -0.0004 664 HIS A ND1   
3092 C CD2   . HIS B 368 ? 0.2336 0.2752 0.2508 0.0003  0.0208  0.0016  664 HIS A CD2   
3093 C CE1   . HIS B 368 ? 0.2884 0.3458 0.3196 0.0058  0.0237  0.0011  664 HIS A CE1   
3094 N NE2   . HIS B 368 ? 0.2526 0.3056 0.2788 0.0009  0.0215  0.0020  664 HIS A NE2   
3095 N N     . ILE B 369 ? 0.1791 0.2002 0.1713 -0.0061 0.0225  0.0013  665 ILE A N     
3096 C CA    . ILE B 369 ? 0.2378 0.2600 0.2286 -0.0114 0.0231  0.0033  665 ILE A CA    
3097 C C     . ILE B 369 ? 0.2859 0.3047 0.2667 -0.0151 0.0272  0.0035  665 ILE A C     
3098 O O     . ILE B 369 ? 0.2455 0.2698 0.2278 -0.0192 0.0311  0.0043  665 ILE A O     
3099 C CB    . ILE B 369 ? 0.2793 0.2935 0.2680 -0.0128 0.0177  0.0051  665 ILE A CB    
3100 C CG1   . ILE B 369 ? 0.1847 0.2034 0.1826 -0.0107 0.0155  0.0048  665 ILE A CG1   
3101 C CG2   . ILE B 369 ? 0.4046 0.4152 0.3881 -0.0184 0.0183  0.0072  665 ILE A CG2   
3102 C CD1   . ILE B 369 ? 0.3877 0.3984 0.3846 -0.0113 0.0115  0.0059  665 ILE A CD1   
3103 N N     . ALA B 370 ? 0.2508 0.2603 0.2209 -0.0143 0.0263  0.0030  666 ALA A N     
3104 C CA    . ALA B 370 ? 0.3108 0.3152 0.2682 -0.0180 0.0304  0.0032  666 ALA A CA    
3105 C C     . ALA B 370 ? 0.3281 0.3397 0.2872 -0.0166 0.0382  0.0002  666 ALA A C     
3106 O O     . ALA B 370 ? 0.2826 0.2931 0.2334 -0.0203 0.0440  0.0002  666 ALA A O     
3107 C CB    . ALA B 370 ? 0.2452 0.2360 0.1888 -0.0180 0.0255  0.0037  666 ALA A CB    
3108 N N     . GLU B 371 ? 0.2596 0.2783 0.2294 -0.0111 0.0389  -0.0023 667 GLU A N     
3109 C CA    . GLU B 371 ? 0.2879 0.3125 0.2604 -0.0083 0.0463  -0.0056 667 GLU A CA    
3110 C C     . GLU B 371 ? 0.3050 0.3187 0.2602 -0.0098 0.0497  -0.0076 667 GLU A C     
3111 O O     . GLU B 371 ? 0.3189 0.3352 0.2706 -0.0112 0.0580  -0.0094 667 GLU A O     
3112 C CB    . GLU B 371 ? 0.3099 0.3484 0.2935 -0.0101 0.0524  -0.0052 667 GLU A CB    
3113 C CG    . GLU B 371 ? 0.6424 0.6907 0.6409 -0.0093 0.0479  -0.0034 667 GLU A CG    
3114 C CD    . GLU B 371 ? 0.8964 0.9607 0.9092 -0.0102 0.0528  -0.0035 667 GLU A CD    
3115 O OE1   . GLU B 371 ? 0.9772 1.0494 0.9985 -0.0055 0.0576  -0.0058 667 GLU A OE1   
3116 O OE2   . GLU B 371 ? 0.9926 1.0613 1.0088 -0.0155 0.0516  -0.0014 667 GLU A OE2   
3117 N N     . ASP B 372 ? 0.2364 0.2376 0.1805 -0.0100 0.0433  -0.0073 668 ASP A N     
3118 C CA    . ASP B 372 ? 0.2923 0.2819 0.2182 -0.0116 0.0448  -0.0094 668 ASP A CA    
3119 C C     . ASP B 372 ? 0.3128 0.3028 0.2406 -0.0066 0.0492  -0.0144 668 ASP A C     
3120 O O     . ASP B 372 ? 0.2770 0.2669 0.2128 -0.0023 0.0449  -0.0156 668 ASP A O     
3121 C CB    . ASP B 372 ? 0.2849 0.2624 0.2008 -0.0131 0.0350  -0.0074 668 ASP A CB    
3122 C CG    . ASP B 372 ? 0.3654 0.3300 0.2603 -0.0156 0.0349  -0.0091 668 ASP A CG    
3123 O OD1   . ASP B 372 ? 0.4148 0.3729 0.2960 -0.0205 0.0350  -0.0063 668 ASP A OD1   
3124 O OD2   . ASP B 372 ? 0.3813 0.3412 0.2723 -0.0130 0.0348  -0.0133 668 ASP A OD2   
3125 N N     . ASP B 373 ? 0.3269 0.3165 0.2473 -0.0072 0.0584  -0.0176 669 ASP A N     
3126 C CA    . ASP B 373 ? 0.2758 0.2663 0.2001 -0.0017 0.0639  -0.0227 669 ASP A CA    
3127 C C     . ASP B 373 ? 0.3322 0.3092 0.2458 -0.0003 0.0581  -0.0255 669 ASP A C     
3128 O O     . ASP B 373 ? 0.3474 0.3248 0.2698 0.0049  0.0575  -0.0281 669 ASP A O     
3129 C CB    . ASP B 373 ? 0.3576 0.3493 0.2750 -0.0028 0.0759  -0.0261 669 ASP A CB    
3130 C CG    . ASP B 373 ? 0.6253 0.6330 0.5578 -0.0038 0.0825  -0.0240 669 ASP A CG    
3131 O OD1   . ASP B 373 ? 0.6762 0.6942 0.6255 -0.0024 0.0776  -0.0208 669 ASP A OD1   
3132 O OD2   . ASP B 373 ? 0.7326 0.7424 0.6600 -0.0062 0.0927  -0.0257 669 ASP A OD2   
3133 N N     . ASN B 374 ? 0.3563 0.3209 0.2510 -0.0052 0.0533  -0.0248 670 ASN A N     
3134 C CA    . ASN B 374 ? 0.3219 0.2739 0.2062 -0.0048 0.0469  -0.0277 670 ASN A CA    
3135 C C     . ASN B 374 ? 0.3832 0.3377 0.2818 -0.0022 0.0378  -0.0256 670 ASN A C     
3136 O O     . ASN B 374 ? 0.3032 0.2540 0.2053 0.0009  0.0361  -0.0288 670 ASN A O     
3137 C CB    . ASN B 374 ? 0.3832 0.3224 0.2447 -0.0109 0.0422  -0.0265 670 ASN A CB    
3138 C CG    . ASN B 374 ? 0.6394 0.5648 0.4858 -0.0114 0.0384  -0.0312 670 ASN A CG    
3139 O OD1   . ASN B 374 ? 0.8108 0.7345 0.6596 -0.0078 0.0431  -0.0366 670 ASN A OD1   
3140 N ND2   . ASN B 374 ? 0.7562 0.6714 0.5872 -0.0160 0.0293  -0.0291 670 ASN A ND2   
3141 N N     . LEU B 375 ? 0.2499 0.2103 0.1568 -0.0037 0.0327  -0.0204 671 LEU A N     
3142 C CA    . LEU B 375 ? 0.2352 0.1980 0.1551 -0.0016 0.0251  -0.0184 671 LEU A CA    
3143 C C     . LEU B 375 ? 0.2223 0.1939 0.1591 0.0038  0.0289  -0.0195 671 LEU A C     
3144 O O     . LEU B 375 ? 0.2320 0.2016 0.1755 0.0063  0.0251  -0.0203 671 LEU A O     
3145 C CB    . LEU B 375 ? 0.2546 0.2211 0.1789 -0.0042 0.0202  -0.0130 671 LEU A CB    
3146 C CG    . LEU B 375 ? 0.3350 0.3008 0.2683 -0.0035 0.0116  -0.0108 671 LEU A CG    
3147 C CD1   . LEU B 375 ? 0.3229 0.2781 0.2470 -0.0048 0.0047  -0.0125 671 LEU A CD1   
3148 C CD2   . LEU B 375 ? 0.3258 0.2940 0.2620 -0.0059 0.0082  -0.0060 671 LEU A CD2   
3149 N N     . MET B 376 ? 0.2178 0.1994 0.1622 0.0055  0.0360  -0.0192 672 MET A N     
3150 C CA    . MET B 376 ? 0.2520 0.2421 0.2121 0.0110  0.0387  -0.0197 672 MET A CA    
3151 C C     . MET B 376 ? 0.3156 0.2990 0.2734 0.0150  0.0417  -0.0244 672 MET A C     
3152 O O     . MET B 376 ? 0.2568 0.2400 0.2238 0.0190  0.0397  -0.0245 672 MET A O     
3153 C CB    . MET B 376 ? 0.2674 0.2704 0.2366 0.0118  0.0453  -0.0187 672 MET A CB    
3154 C CG    . MET B 376 ? 0.3502 0.3605 0.3249 0.0082  0.0420  -0.0141 672 MET A CG    
3155 S SD    . MET B 376 ? 0.4028 0.4302 0.3921 0.0090  0.0483  -0.0130 672 MET A SD    
3156 C CE    . MET B 376 ? 0.4478 0.4736 0.4258 0.0057  0.0578  -0.0157 672 MET A CE    
3157 N N     . GLU B 377 ? 0.2836 0.2601 0.2281 0.0138  0.0470  -0.0284 673 GLU A N     
3158 C CA    . GLU B 377 ? 0.3500 0.3181 0.2905 0.0173  0.0506  -0.0337 673 GLU A CA    
3159 C C     . GLU B 377 ? 0.3113 0.2683 0.2471 0.0161  0.0425  -0.0347 673 GLU A C     
3160 O O     . GLU B 377 ? 0.3120 0.2651 0.2536 0.0201  0.0427  -0.0368 673 GLU A O     
3161 C CB    . GLU B 377 ? 0.3090 0.2709 0.2336 0.0153  0.0582  -0.0382 673 GLU A CB    
3162 C CG    . GLU B 377 ? 0.4550 0.4054 0.3722 0.0185  0.0626  -0.0448 673 GLU A CG    
3163 C CD    . GLU B 377 ? 0.5550 0.5125 0.4875 0.0261  0.0710  -0.0470 673 GLU A CD    
3164 O OE1   . GLU B 377 ? 0.5880 0.5594 0.5388 0.0295  0.0709  -0.0429 673 GLU A OE1   
3165 O OE2   . GLU B 377 ? 0.6794 0.6280 0.6053 0.0289  0.0773  -0.0530 673 GLU A OE2   
3166 N N     . ALA B 378 ? 0.2594 0.2113 0.1859 0.0108  0.0352  -0.0328 674 ALA A N     
3167 C CA    . ALA B 378 ? 0.2488 0.1922 0.1736 0.0093  0.0270  -0.0334 674 ALA A CA    
3168 C C     . ALA B 378 ? 0.3038 0.2528 0.2463 0.0127  0.0244  -0.0309 674 ALA A C     
3169 O O     . ALA B 378 ? 0.2587 0.2010 0.2033 0.0138  0.0223  -0.0331 674 ALA A O     
3170 C CB    . ALA B 378 ? 0.2550 0.1950 0.1711 0.0037  0.0188  -0.0307 674 ALA A CB    
3171 N N     . PHE B 379 ? 0.2395 0.1999 0.1938 0.0140  0.0246  -0.0263 675 PHE A N     
3172 C CA    . PHE B 379 ? 0.2506 0.2154 0.2193 0.0170  0.0225  -0.0237 675 PHE A CA    
3173 C C     . PHE B 379 ? 0.2855 0.2529 0.2619 0.0228  0.0285  -0.0249 675 PHE A C     
3174 O O     . PHE B 379 ? 0.2825 0.2476 0.2661 0.0254  0.0271  -0.0243 675 PHE A O     
3175 C CB    . PHE B 379 ? 0.1994 0.1740 0.1760 0.0158  0.0201  -0.0187 675 PHE A CB    
3176 C CG    . PHE B 379 ? 0.2266 0.1981 0.2002 0.0114  0.0132  -0.0168 675 PHE A CG    
3177 C CD1   . PHE B 379 ? 0.1897 0.1554 0.1656 0.0105  0.0081  -0.0174 675 PHE A CD1   
3178 C CD2   . PHE B 379 ? 0.2243 0.1984 0.1933 0.0082  0.0120  -0.0145 675 PHE A CD2   
3179 C CE1   . PHE B 379 ? 0.2477 0.2117 0.2231 0.0070  0.0015  -0.0156 675 PHE A CE1   
3180 C CE2   . PHE B 379 ? 0.2060 0.1768 0.1731 0.0050  0.0053  -0.0125 675 PHE A CE2   
3181 C CZ    . PHE B 379 ? 0.1885 0.1550 0.1595 0.0047  -0.0001 -0.0131 675 PHE A CZ    
3182 N N     . ARG B 380 ? 0.2089 0.1807 0.1842 0.0251  0.0352  -0.0266 676 ARG A N     
3183 C CA    . ARG B 380 ? 0.2347 0.2084 0.2182 0.0315  0.0406  -0.0280 676 ARG A CA    
3184 C C     . ARG B 380 ? 0.2806 0.2404 0.2579 0.0331  0.0416  -0.0327 676 ARG A C     
3185 O O     . ARG B 380 ? 0.2684 0.2262 0.2535 0.0383  0.0433  -0.0328 676 ARG A O     
3186 C CB    . ARG B 380 ? 0.2464 0.2284 0.2315 0.0335  0.0482  -0.0293 676 ARG A CB    
3187 C CG    . ARG B 380 ? 0.2759 0.2723 0.2710 0.0326  0.0472  -0.0245 676 ARG A CG    
3188 C CD    . ARG B 380 ? 0.2973 0.3030 0.2944 0.0328  0.0545  -0.0257 676 ARG A CD    
3189 N NE    . ARG B 380 ? 0.3669 0.3867 0.3755 0.0319  0.0528  -0.0212 676 ARG A NE    
3190 C CZ    . ARG B 380 ? 0.4090 0.4392 0.4214 0.0303  0.0577  -0.0210 676 ARG A CZ    
3191 N NH1   . ARG B 380 ? 0.3791 0.4071 0.3843 0.0296  0.0655  -0.0248 676 ARG A NH1   
3192 N NH2   . ARG B 380 ? 0.3209 0.3634 0.3439 0.0289  0.0552  -0.0171 676 ARG A NH2   
3193 N N     . ARG B 381 ? 0.2816 0.2310 0.2443 0.0286  0.0402  -0.0365 677 ARG A N     
3194 C CA    . ARG B 381 ? 0.2499 0.1848 0.2051 0.0287  0.0400  -0.0414 677 ARG A CA    
3195 C C     . ARG B 381 ? 0.2453 0.1750 0.2033 0.0256  0.0319  -0.0397 677 ARG A C     
3196 O O     . ARG B 381 ? 0.3212 0.2387 0.2738 0.0245  0.0305  -0.0436 677 ARG A O     
3197 C CB    . ARG B 381 ? 0.2680 0.1934 0.2046 0.0247  0.0418  -0.0468 677 ARG A CB    
3198 C CG    . ARG B 381 ? 0.2961 0.2250 0.2283 0.0272  0.0515  -0.0496 677 ARG A CG    
3199 C CD    . ARG B 381 ? 0.3580 0.2772 0.2685 0.0218  0.0530  -0.0540 677 ARG A CD    
3200 N NE    . ARG B 381 ? 0.4126 0.3155 0.3110 0.0198  0.0503  -0.0596 677 ARG A NE    
3201 C CZ    . ARG B 381 ? 0.5155 0.4069 0.3931 0.0142  0.0482  -0.0635 677 ARG A CZ    
3202 N NH1   . ARG B 381 ? 0.4638 0.3574 0.3294 0.0102  0.0490  -0.0621 677 ARG A NH1   
3203 N NH2   . ARG B 381 ? 0.5050 0.3816 0.3728 0.0122  0.0452  -0.0688 677 ARG A NH2   
3204 N N     . ASP B 382 ? 0.2807 0.2190 0.2471 0.0239  0.0269  -0.0343 678 ASP A N     
3205 C CA    . ASP B 382 ? 0.3724 0.3076 0.3431 0.0206  0.0200  -0.0324 678 ASP A CA    
3206 C C     . ASP B 382 ? 0.3807 0.3056 0.3402 0.0152  0.0149  -0.0363 678 ASP A C     
3207 O O     . ASP B 382 ? 0.3159 0.2332 0.2772 0.0133  0.0115  -0.0378 678 ASP A O     
3208 C CB    . ASP B 382 ? 0.4364 0.3683 0.4167 0.0242  0.0212  -0.0314 678 ASP A CB    
3209 C CG    . ASP B 382 ? 0.5622 0.4961 0.5510 0.0213  0.0159  -0.0275 678 ASP A CG    
3210 O OD1   . ASP B 382 ? 0.5630 0.5050 0.5544 0.0188  0.0125  -0.0244 678 ASP A OD1   
3211 O OD2   . ASP B 382 ? 0.5735 0.5006 0.5665 0.0215  0.0155  -0.0277 678 ASP A OD2   
3212 N N     . LEU B 383 ? 0.3874 0.3117 0.3349 0.0121  0.0139  -0.0376 679 LEU A N     
3213 C CA    . LEU B 383 ? 0.3740 0.2889 0.3094 0.0066  0.0076  -0.0406 679 LEU A CA    
3214 C C     . LEU B 383 ? 0.3573 0.2763 0.3005 0.0028  -0.0014 -0.0368 679 LEU A C     
3215 O O     . LEU B 383 ? 0.4117 0.3406 0.3667 0.0042  -0.0019 -0.0318 679 LEU A O     
3216 C CB    . LEU B 383 ? 0.3875 0.3000 0.3061 0.0043  0.0091  -0.0423 679 LEU A CB    
3217 C CG    . LEU B 383 ? 0.3781 0.2878 0.2894 0.0079  0.0193  -0.0464 679 LEU A CG    
3218 C CD1   . LEU B 383 ? 0.4822 0.3879 0.3746 0.0044  0.0211  -0.0482 679 LEU A CD1   
3219 C CD2   . LEU B 383 ? 0.4544 0.3524 0.3632 0.0093  0.0214  -0.0522 679 LEU A CD2   
3220 N N     . ASP B 384 ? 0.3287 0.2398 0.2655 -0.0019 -0.0086 -0.0393 680 ASP A N     
3221 C CA    . ASP B 384 ? 0.3674 0.2827 0.3099 -0.0056 -0.0178 -0.0359 680 ASP A CA    
3222 C C     . ASP B 384 ? 0.2585 0.1769 0.1914 -0.0067 -0.0194 -0.0332 680 ASP A C     
3223 O O     . ASP B 384 ? 0.2945 0.2053 0.2096 -0.0091 -0.0201 -0.0359 680 ASP A O     
3224 C CB    . ASP B 384 ? 0.4432 0.3497 0.3816 -0.0107 -0.0257 -0.0396 680 ASP A CB    
3225 C CG    . ASP B 384 ? 0.6151 0.5273 0.5634 -0.0140 -0.0357 -0.0361 680 ASP A CG    
3226 O OD1   . ASP B 384 ? 0.5331 0.4505 0.4797 -0.0140 -0.0388 -0.0322 680 ASP A OD1   
3227 O OD2   . ASP B 384 ? 0.6477 0.5592 0.6066 -0.0166 -0.0403 -0.0371 680 ASP A OD2   
3228 N N     . ILE B 385 ? 0.2399 0.1683 0.1832 -0.0051 -0.0193 -0.0280 681 ILE A N     
3229 C CA    . ILE B 385 ? 0.3162 0.2469 0.2506 -0.0057 -0.0188 -0.0252 681 ILE A CA    
3230 C C     . ILE B 385 ? 0.2545 0.1792 0.1778 -0.0101 -0.0281 -0.0245 681 ILE A C     
3231 O O     . ILE B 385 ? 0.3690 0.2896 0.2765 -0.0119 -0.0277 -0.0240 681 ILE A O     
3232 C CB    . ILE B 385 ? 0.2237 0.1652 0.1716 -0.0033 -0.0168 -0.0201 681 ILE A CB    
3233 C CG1   . ILE B 385 ? 0.2772 0.2202 0.2159 -0.0043 -0.0154 -0.0173 681 ILE A CG1   
3234 C CG2   . ILE B 385 ? 0.2890 0.2342 0.2507 -0.0042 -0.0239 -0.0172 681 ILE A CG2   
3235 C CD1   . ILE B 385 ? 0.3700 0.3110 0.2966 -0.0038 -0.0073 -0.0198 681 ILE A CD1   
3236 N N     . HIS B 386 ? 0.2539 0.1783 0.1855 -0.0122 -0.0368 -0.0242 682 HIS A N     
3237 C CA    . HIS B 386 ? 0.3253 0.2449 0.2478 -0.0161 -0.0474 -0.0229 682 HIS A CA    
3238 C C     . HIS B 386 ? 0.3046 0.2120 0.2056 -0.0196 -0.0491 -0.0279 682 HIS A C     
3239 O O     . HIS B 386 ? 0.3050 0.2062 0.1883 -0.0223 -0.0533 -0.0269 682 HIS A O     
3240 C CB    . HIS B 386 ? 0.2597 0.1840 0.1997 -0.0171 -0.0562 -0.0213 682 HIS A CB    
3241 C CG    . HIS B 386 ? 0.3067 0.2418 0.2663 -0.0138 -0.0538 -0.0168 682 HIS A CG    
3242 N ND1   . HIS B 386 ? 0.2612 0.1998 0.2192 -0.0118 -0.0508 -0.0128 682 HIS A ND1   
3243 C CD2   . HIS B 386 ? 0.2587 0.2008 0.2385 -0.0123 -0.0528 -0.0162 682 HIS A CD2   
3244 C CE1   . HIS B 386 ? 0.2754 0.2224 0.2513 -0.0092 -0.0487 -0.0101 682 HIS A CE1   
3245 N NE2   . HIS B 386 ? 0.3229 0.2723 0.3120 -0.0094 -0.0496 -0.0121 682 HIS A NE2   
3246 N N     . THR B 387 ? 0.2935 0.1962 0.1942 -0.0196 -0.0454 -0.0334 683 THR A N     
3247 C CA    . THR B 387 ? 0.3668 0.2566 0.2458 -0.0228 -0.0456 -0.0391 683 THR A CA    
3248 C C     . THR B 387 ? 0.3256 0.2118 0.1870 -0.0216 -0.0365 -0.0399 683 THR A C     
3249 O O     . THR B 387 ? 0.3702 0.2470 0.2095 -0.0252 -0.0390 -0.0414 683 THR A O     
3250 C CB    . THR B 387 ? 0.3350 0.2199 0.2189 -0.0224 -0.0421 -0.0449 683 THR A CB    
3251 O OG1   . THR B 387 ? 0.3665 0.2543 0.2655 -0.0250 -0.0511 -0.0442 683 THR A OG1   
3252 C CG2   . THR B 387 ? 0.3444 0.2146 0.2046 -0.0254 -0.0404 -0.0518 683 THR A CG2   
3253 N N     . LYS B 388 ? 0.3186 0.2123 0.1895 -0.0168 -0.0258 -0.0389 684 LYS A N     
3254 C CA    . LYS B 388 ? 0.3447 0.2373 0.2024 -0.0157 -0.0163 -0.0395 684 LYS A CA    
3255 C C     . LYS B 388 ? 0.3220 0.2157 0.1704 -0.0183 -0.0199 -0.0342 684 LYS A C     
3256 O O     . LYS B 388 ? 0.3560 0.2433 0.1848 -0.0204 -0.0156 -0.0353 684 LYS A O     
3257 C CB    . LYS B 388 ? 0.3817 0.2845 0.2551 -0.0100 -0.0059 -0.0386 684 LYS A CB    
3258 C CG    . LYS B 388 ? 0.4276 0.3314 0.2910 -0.0089 0.0045  -0.0394 684 LYS A CG    
3259 C CD    . LYS B 388 ? 0.5204 0.4121 0.3653 -0.0098 0.0101  -0.0465 684 LYS A CD    
3260 C CE    . LYS B 388 ? 0.6834 0.5783 0.5232 -0.0076 0.0229  -0.0479 684 LYS A CE    
3261 N NZ    . LYS B 388 ? 0.7265 0.6107 0.5533 -0.0066 0.0308  -0.0558 684 LYS A NZ    
3262 N N     . THR B 389 ? 0.3079 0.2091 0.1698 -0.0181 -0.0270 -0.0284 685 THR A N     
3263 C CA    . THR B 389 ? 0.3137 0.2138 0.1662 -0.0205 -0.0313 -0.0232 685 THR A CA    
3264 C C     . THR B 389 ? 0.3721 0.2596 0.2029 -0.0255 -0.0405 -0.0241 685 THR A C     
3265 O O     . THR B 389 ? 0.3601 0.2411 0.1717 -0.0283 -0.0400 -0.0221 685 THR A O     
3266 C CB    . THR B 389 ? 0.2953 0.2046 0.1673 -0.0189 -0.0371 -0.0173 685 THR A CB    
3267 O OG1   . THR B 389 ? 0.3385 0.2582 0.2269 -0.0149 -0.0285 -0.0165 685 THR A OG1   
3268 C CG2   . THR B 389 ? 0.3032 0.2096 0.1653 -0.0211 -0.0419 -0.0116 685 THR A CG2   
3269 N N     . ALA B 390 ? 0.3435 0.2271 0.1765 -0.0272 -0.0491 -0.0271 686 ALA A N     
3270 C CA    . ALA B 390 ? 0.3689 0.2403 0.1805 -0.0324 -0.0589 -0.0286 686 ALA A CA    
3271 C C     . ALA B 390 ? 0.4310 0.2906 0.2161 -0.0347 -0.0507 -0.0341 686 ALA A C     
3272 O O     . ALA B 390 ? 0.4344 0.2842 0.1955 -0.0386 -0.0537 -0.0329 686 ALA A O     
3273 C CB    . ALA B 390 ? 0.3883 0.2587 0.2094 -0.0343 -0.0689 -0.0317 686 ALA A CB    
3274 N N     . MET B 391 ? 0.4174 0.2771 0.2063 -0.0321 -0.0400 -0.0401 687 MET A N     
3275 C CA    . MET B 391 ? 0.4654 0.3142 0.2312 -0.0335 -0.0305 -0.0462 687 MET A CA    
3276 C C     . MET B 391 ? 0.5039 0.3524 0.2558 -0.0342 -0.0231 -0.0427 687 MET A C     
3277 O O     . MET B 391 ? 0.5504 0.3868 0.2751 -0.0384 -0.0219 -0.0447 687 MET A O     
3278 C CB    . MET B 391 ? 0.4349 0.2864 0.2123 -0.0289 -0.0189 -0.0519 687 MET A CB    
3279 C CG    . MET B 391 ? 0.5318 0.3780 0.3150 -0.0296 -0.0243 -0.0570 687 MET A CG    
3280 S SD    . MET B 391 ? 0.5360 0.3882 0.3406 -0.0228 -0.0127 -0.0606 687 MET A SD    
3281 C CE    . MET B 391 ? 0.5047 0.3508 0.2917 -0.0205 0.0034  -0.0658 687 MET A CE    
3282 N N     . ASP B 392 ? 0.4238 0.2853 0.1935 -0.0307 -0.0184 -0.0373 688 ASP A N     
3283 C CA    . ASP B 392 ? 0.4722 0.3347 0.2319 -0.0316 -0.0105 -0.0338 688 ASP A CA    
3284 C C     . ASP B 392 ? 0.5373 0.3921 0.2795 -0.0365 -0.0204 -0.0280 688 ASP A C     
3285 O O     . ASP B 392 ? 0.5618 0.4072 0.2796 -0.0403 -0.0161 -0.0278 688 ASP A O     
3286 C CB    . ASP B 392 ? 0.5523 0.4306 0.3370 -0.0271 -0.0043 -0.0298 688 ASP A CB    
3287 C CG    . ASP B 392 ? 0.7242 0.6095 0.5223 -0.0222 0.0074  -0.0348 688 ASP A CG    
3288 O OD1   . ASP B 392 ? 0.7792 0.6567 0.5654 -0.0222 0.0135  -0.0414 688 ASP A OD1   
3289 O OD2   . ASP B 392 ? 0.7985 0.6967 0.6189 -0.0183 0.0102  -0.0322 688 ASP A OD2   
3290 N N     . ILE B 393 ? 0.4560 0.3143 0.2104 -0.0363 -0.0334 -0.0230 689 ILE A N     
3291 C CA    . ILE B 393 ? 0.5467 0.3985 0.2876 -0.0399 -0.0433 -0.0163 689 ILE A CA    
3292 C C     . ILE B 393 ? 0.5854 0.4209 0.2962 -0.0453 -0.0502 -0.0190 689 ILE A C     
3293 O O     . ILE B 393 ? 0.7118 0.5371 0.3981 -0.0492 -0.0501 -0.0159 689 ILE A O     
3294 C CB    . ILE B 393 ? 0.6083 0.4680 0.3715 -0.0377 -0.0556 -0.0109 689 ILE A CB    
3295 C CG1   . ILE B 393 ? 0.5209 0.3934 0.3065 -0.0336 -0.0491 -0.0068 689 ILE A CG1   
3296 C CG2   . ILE B 393 ? 0.7463 0.5967 0.4943 -0.0411 -0.0690 -0.0048 689 ILE A CG2   
3297 C CD1   . ILE B 393 ? 0.5868 0.4673 0.3959 -0.0308 -0.0591 -0.0028 689 ILE A CD1   
3298 N N     . PHE B 394 ? 0.4906 0.3226 0.2019 -0.0460 -0.0562 -0.0247 690 PHE A N     
3299 C CA    . PHE B 394 ? 0.6033 0.4196 0.2863 -0.0516 -0.0644 -0.0279 690 PHE A CA    
3300 C C     . PHE B 394 ? 0.6941 0.4998 0.3543 -0.0536 -0.0519 -0.0361 690 PHE A C     
3301 O O     . PHE B 394 ? 0.7617 0.5525 0.3945 -0.0588 -0.0572 -0.0397 690 PHE A O     
3302 C CB    . PHE B 394 ? 0.4972 0.3146 0.1923 -0.0524 -0.0784 -0.0302 690 PHE A CB    
3303 C CG    . PHE B 394 ? 0.5524 0.3805 0.2714 -0.0501 -0.0905 -0.0228 690 PHE A CG    
3304 C CD1   . PHE B 394 ? 0.5293 0.3714 0.2810 -0.0458 -0.0900 -0.0231 690 PHE A CD1   
3305 C CD2   . PHE B 394 ? 0.6529 0.4766 0.3615 -0.0522 -0.1018 -0.0153 690 PHE A CD2   
3306 C CE1   . PHE B 394 ? 0.5314 0.3833 0.3054 -0.0435 -0.0997 -0.0167 690 PHE A CE1   
3307 C CE2   . PHE B 394 ? 0.6601 0.4936 0.3921 -0.0493 -0.1121 -0.0087 690 PHE A CE2   
3308 C CZ    . PHE B 394 ? 0.6311 0.4790 0.3961 -0.0450 -0.1106 -0.0097 690 PHE A CZ    
3309 N N     . GLN B 395 ? 0.6489 0.4617 0.3193 -0.0496 -0.0356 -0.0391 691 GLN A N     
3310 C CA    . GLN B 395 ? 0.7781 0.5820 0.4293 -0.0505 -0.0217 -0.0469 691 GLN A CA    
3311 C C     . GLN B 395 ? 0.7745 0.5671 0.4149 -0.0527 -0.0259 -0.0555 691 GLN A C     
3312 O O     . GLN B 395 ? 0.7767 0.5533 0.3863 -0.0575 -0.0251 -0.0603 691 GLN A O     
3313 C CB    . GLN B 395 ? 0.8747 0.6675 0.4946 -0.0554 -0.0168 -0.0447 691 GLN A CB    
3314 C CG    . GLN B 395 ? 1.0098 0.8127 0.6389 -0.0537 -0.0081 -0.0379 691 GLN A CG    
3315 C CD    . GLN B 395 ? 1.2214 1.0131 0.8227 -0.0595 -0.0112 -0.0317 691 GLN A CD    
3316 O OE1   . GLN B 395 ? 1.3253 1.1046 0.9061 -0.0639 -0.0233 -0.0306 691 GLN A OE1   
3317 N NE2   . GLN B 395 ? 1.2493 1.0463 0.8523 -0.0596 -0.0006 -0.0273 691 GLN A NE2   
3318 N N     . VAL B 396 ? 0.6172 0.4173 0.2823 -0.0495 -0.0307 -0.0575 692 VAL A N     
3319 C CA    . VAL B 396 ? 0.6049 0.3950 0.2639 -0.0516 -0.0345 -0.0657 692 VAL A CA    
3320 C C     . VAL B 396 ? 0.7023 0.5002 0.3854 -0.0455 -0.0241 -0.0702 692 VAL A C     
3321 O O     . VAL B 396 ? 0.7086 0.5208 0.4144 -0.0399 -0.0169 -0.0661 692 VAL A O     
3322 C CB    . VAL B 396 ? 0.6689 0.4580 0.3327 -0.0555 -0.0540 -0.0634 692 VAL A CB    
3323 C CG1   . VAL B 396 ? 0.6134 0.3972 0.2580 -0.0602 -0.0659 -0.0568 692 VAL A CG1   
3324 C CG2   . VAL B 396 ? 0.5658 0.3720 0.2670 -0.0508 -0.0580 -0.0590 692 VAL A CG2   
3325 N N     . SER B 397 ? 0.6347 0.4221 0.3117 -0.0467 -0.0238 -0.0786 693 SER A N     
3326 C CA    . SER B 397 ? 0.6565 0.4493 0.3558 -0.0410 -0.0153 -0.0824 693 SER A CA    
3327 C C     . SER B 397 ? 0.7067 0.5076 0.4313 -0.0407 -0.0268 -0.0795 693 SER A C     
3328 O O     . SER B 397 ? 0.6653 0.4664 0.3893 -0.0454 -0.0414 -0.0761 693 SER A O     
3329 C CB    . SER B 397 ? 0.7333 0.5097 0.4146 -0.0418 -0.0074 -0.0931 693 SER A CB    
3330 O OG    . SER B 397 ? 0.8061 0.5695 0.4730 -0.0486 -0.0201 -0.0974 693 SER A OG    
3331 N N     . GLU B 398 ? 0.7068 0.5146 0.4543 -0.0352 -0.0198 -0.0806 694 GLU A N     
3332 C CA    . GLU B 398 ? 0.6840 0.5010 0.4575 -0.0345 -0.0281 -0.0772 694 GLU A CA    
3333 C C     . GLU B 398 ? 0.6975 0.5048 0.4650 -0.0412 -0.0410 -0.0810 694 GLU A C     
3334 O O     . GLU B 398 ? 0.6320 0.4471 0.4148 -0.0434 -0.0526 -0.0765 694 GLU A O     
3335 C CB    . GLU B 398 ? 0.6668 0.4890 0.4607 -0.0279 -0.0178 -0.0784 694 GLU A CB    
3336 C CG    . GLU B 398 ? 0.7072 0.5385 0.5272 -0.0273 -0.0245 -0.0746 694 GLU A CG    
3337 C CD    . GLU B 398 ? 0.9032 0.7417 0.7432 -0.0202 -0.0144 -0.0734 694 GLU A CD    
3338 O OE1   . GLU B 398 ? 1.0025 0.8499 0.8637 -0.0191 -0.0180 -0.0691 694 GLU A OE1   
3339 O OE2   . GLU B 398 ? 0.9586 0.7936 0.7928 -0.0157 -0.0029 -0.0767 694 GLU A OE2   
3340 N N     . ASP B 399 ? 0.6853 0.4756 0.4315 -0.0446 -0.0391 -0.0897 695 ASP A N     
3341 C CA    . ASP B 399 ? 0.7113 0.4915 0.4502 -0.0520 -0.0520 -0.0941 695 ASP A CA    
3342 C C     . ASP B 399 ? 0.6728 0.4521 0.3973 -0.0582 -0.0667 -0.0905 695 ASP A C     
3343 O O     . ASP B 399 ? 0.6936 0.4697 0.4188 -0.0643 -0.0805 -0.0918 695 ASP A O     
3344 C CB    . ASP B 399 ? 0.8722 0.6325 0.5890 -0.0544 -0.0458 -0.1050 695 ASP A CB    
3345 C CG    . ASP B 399 ? 1.0723 0.8213 0.7569 -0.0557 -0.0394 -0.1084 695 ASP A CG    
3346 O OD1   . ASP B 399 ? 1.1465 0.9047 0.8303 -0.0526 -0.0348 -0.1024 695 ASP A OD1   
3347 O OD2   . ASP B 399 ? 1.1819 0.9153 0.8450 -0.0596 -0.0382 -0.1163 695 ASP A OD2   
3348 N N     . GLU B 400 ? 0.6174 0.3991 0.3290 -0.0571 -0.0643 -0.0858 696 GLU A N     
3349 C CA    . GLU B 400 ? 0.6291 0.4085 0.3250 -0.0625 -0.0780 -0.0814 696 GLU A CA    
3350 C C     . GLU B 400 ? 0.6607 0.4573 0.3808 -0.0602 -0.0865 -0.0713 696 GLU A C     
3351 O O     . GLU B 400 ? 0.6193 0.4154 0.3303 -0.0636 -0.0989 -0.0664 696 GLU A O     
3352 C CB    . GLU B 400 ? 0.7376 0.5070 0.4021 -0.0634 -0.0707 -0.0820 696 GLU A CB    
3353 C CG    . GLU B 400 ? 0.9421 0.6942 0.5791 -0.0675 -0.0668 -0.0907 696 GLU A CG    
3354 C CD    . GLU B 400 ? 1.1507 0.8976 0.7711 -0.0643 -0.0486 -0.0936 696 GLU A CD    
3355 O OE1   . GLU B 400 ? 1.2514 0.9898 0.8649 -0.0635 -0.0385 -0.1016 696 GLU A OE1   
3356 O OE2   . GLU B 400 ? 1.1962 0.9481 0.8118 -0.0627 -0.0441 -0.0877 696 GLU A OE2   
3357 N N     . VAL B 401 ? 0.5529 0.3639 0.3029 -0.0543 -0.0803 -0.0680 697 VAL A N     
3358 C CA    . VAL B 401 ? 0.5029 0.3294 0.2759 -0.0519 -0.0871 -0.0591 697 VAL A CA    
3359 C C     . VAL B 401 ? 0.4755 0.3059 0.2645 -0.0557 -0.1018 -0.0588 697 VAL A C     
3360 O O     . VAL B 401 ? 0.4823 0.3139 0.2865 -0.0559 -0.1002 -0.0629 697 VAL A O     
3361 C CB    . VAL B 401 ? 0.5049 0.3448 0.3019 -0.0447 -0.0750 -0.0558 697 VAL A CB    
3362 C CG1   . VAL B 401 ? 0.3972 0.2517 0.2170 -0.0425 -0.0820 -0.0474 697 VAL A CG1   
3363 C CG2   . VAL B 401 ? 0.5201 0.3580 0.3029 -0.0414 -0.0616 -0.0556 697 VAL A CG2   
3364 N N     . THR B 402 ? 0.4815 0.3136 0.2675 -0.0588 -0.1160 -0.0540 698 THR A N     
3365 C CA    . THR B 402 ? 0.4505 0.2884 0.2541 -0.0623 -0.1309 -0.0530 698 THR A CA    
3366 C C     . THR B 402 ? 0.4191 0.2753 0.2568 -0.0572 -0.1305 -0.0463 698 THR A C     
3367 O O     . THR B 402 ? 0.4029 0.2656 0.2460 -0.0516 -0.1216 -0.0415 698 THR A O     
3368 C CB    . THR B 402 ? 0.4750 0.3064 0.2598 -0.0676 -0.1476 -0.0505 698 THR A CB    
3369 O OG1   . THR B 402 ? 0.5176 0.3539 0.3004 -0.0638 -0.1481 -0.0421 698 THR A OG1   
3370 C CG2   . THR B 402 ? 0.5089 0.3208 0.2564 -0.0731 -0.1473 -0.0575 698 THR A CG2   
3371 N N     . PRO B 403 ? 0.4105 0.2751 0.2722 -0.0591 -0.1391 -0.0462 699 PRO A N     
3372 C CA    . PRO B 403 ? 0.3823 0.2638 0.2761 -0.0543 -0.1377 -0.0402 699 PRO A CA    
3373 C C     . PRO B 403 ? 0.3777 0.2651 0.2724 -0.0509 -0.1425 -0.0321 699 PRO A C     
3374 O O     . PRO B 403 ? 0.3773 0.2743 0.2878 -0.0453 -0.1347 -0.0276 699 PRO A O     
3375 C CB    . PRO B 403 ? 0.3817 0.2695 0.2968 -0.0588 -0.1487 -0.0419 699 PRO A CB    
3376 C CG    . PRO B 403 ? 0.4014 0.2756 0.3001 -0.0646 -0.1484 -0.0505 699 PRO A CG    
3377 C CD    . PRO B 403 ? 0.4894 0.3483 0.3516 -0.0657 -0.1468 -0.0527 699 PRO A CD    
3378 N N     . ASN B 404 ? 0.3995 0.2799 0.2756 -0.0542 -0.1551 -0.0301 700 ASN A N     
3379 C CA    . ASN B 404 ? 0.3973 0.2816 0.2737 -0.0509 -0.1601 -0.0218 700 ASN A CA    
3380 C C     . ASN B 404 ? 0.3954 0.2745 0.2544 -0.0474 -0.1469 -0.0199 700 ASN A C     
3381 O O     . ASN B 404 ? 0.3820 0.2677 0.2506 -0.0428 -0.1442 -0.0136 700 ASN A O     
3382 C CB    . ASN B 404 ? 0.4235 0.3007 0.2836 -0.0554 -0.1781 -0.0193 700 ASN A CB    
3383 C CG    . ASN B 404 ? 0.4188 0.3026 0.2887 -0.0513 -0.1860 -0.0100 700 ASN A CG    
3384 O OD1   . ASN B 404 ? 0.4218 0.3194 0.3217 -0.0465 -0.1843 -0.0065 700 ASN A OD1   
3385 N ND2   . ASN B 404 ? 0.4419 0.3147 0.2855 -0.0530 -0.1937 -0.0060 700 ASN A ND2   
3386 N N     . MET B 405 ? 0.4668 0.3340 0.3006 -0.0496 -0.1384 -0.0254 701 MET A N     
3387 C CA    . MET B 405 ? 0.4063 0.2707 0.2273 -0.0464 -0.1245 -0.0241 701 MET A CA    
3388 C C     . MET B 405 ? 0.3763 0.2531 0.2224 -0.0406 -0.1122 -0.0231 701 MET A C     
3389 O O     . MET B 405 ? 0.3746 0.2558 0.2232 -0.0370 -0.1056 -0.0185 701 MET A O     
3390 C CB    . MET B 405 ? 0.4267 0.2772 0.2194 -0.0494 -0.1162 -0.0311 701 MET A CB    
3391 C CG    . MET B 405 ? 0.6539 0.4899 0.4146 -0.0549 -0.1252 -0.0311 701 MET A CG    
3392 S SD    . MET B 405 ? 0.7497 0.5694 0.4827 -0.0596 -0.1187 -0.0420 701 MET A SD    
3393 C CE    . MET B 405 ? 0.5405 0.3577 0.2602 -0.0559 -0.0984 -0.0425 701 MET A CE    
3394 N N     . ARG B 406 ? 0.3642 0.2460 0.2280 -0.0402 -0.1091 -0.0275 702 ARG A N     
3395 C CA    . ARG B 406 ? 0.3378 0.2307 0.2240 -0.0350 -0.0982 -0.0263 702 ARG A CA    
3396 C C     . ARG B 406 ? 0.3207 0.2255 0.2294 -0.0320 -0.1031 -0.0196 702 ARG A C     
3397 O O     . ARG B 406 ? 0.3037 0.2154 0.2222 -0.0277 -0.0947 -0.0165 702 ARG A O     
3398 C CB    . ARG B 406 ? 0.3316 0.2255 0.2304 -0.0356 -0.0945 -0.0319 702 ARG A CB    
3399 C CG    . ARG B 406 ? 0.3076 0.2108 0.2253 -0.0304 -0.0825 -0.0308 702 ARG A CG    
3400 C CD    . ARG B 406 ? 0.3656 0.2686 0.2957 -0.0314 -0.0800 -0.0354 702 ARG A CD    
3401 N NE    . ARG B 406 ? 0.3132 0.2236 0.2593 -0.0267 -0.0691 -0.0341 702 ARG A NE    
3402 C CZ    . ARG B 406 ? 0.3188 0.2404 0.2865 -0.0244 -0.0689 -0.0298 702 ARG A CZ    
3403 N NH1   . ARG B 406 ? 0.3650 0.2928 0.3435 -0.0257 -0.0784 -0.0264 702 ARG A NH1   
3404 N NH2   . ARG B 406 ? 0.3439 0.2703 0.3222 -0.0206 -0.0590 -0.0290 702 ARG A NH2   
3405 N N     . ARG B 407 ? 0.3261 0.2334 0.2434 -0.0342 -0.1169 -0.0176 703 ARG A N     
3406 C CA    . ARG B 407 ? 0.3392 0.2574 0.2788 -0.0310 -0.1219 -0.0115 703 ARG A CA    
3407 C C     . ARG B 407 ? 0.3290 0.2451 0.2584 -0.0281 -0.1202 -0.0056 703 ARG A C     
3408 O O     . ARG B 407 ? 0.3072 0.2311 0.2518 -0.0238 -0.1146 -0.0020 703 ARG A O     
3409 C CB    . ARG B 407 ? 0.3789 0.2995 0.3278 -0.0340 -0.1381 -0.0104 703 ARG A CB    
3410 C CG    . ARG B 407 ? 0.4288 0.3586 0.3973 -0.0304 -0.1457 -0.0035 703 ARG A CG    
3411 C CD    . ARG B 407 ? 0.4208 0.3563 0.4052 -0.0332 -0.1613 -0.0032 703 ARG A CD    
3412 N NE    . ARG B 407 ? 0.4918 0.4313 0.4893 -0.0365 -0.1588 -0.0093 703 ARG A NE    
3413 C CZ    . ARG B 407 ? 0.5924 0.5245 0.5774 -0.0427 -0.1651 -0.0146 703 ARG A CZ    
3414 N NH1   . ARG B 407 ? 0.5099 0.4304 0.4680 -0.0463 -0.1746 -0.0147 703 ARG A NH1   
3415 N NH2   . ARG B 407 ? 0.4805 0.4158 0.4786 -0.0457 -0.1618 -0.0198 703 ARG A NH2   
3416 N N     . GLN B 408 ? 0.3352 0.2399 0.2376 -0.0310 -0.1246 -0.0048 704 GLN A N     
3417 C CA    . GLN B 408 ? 0.3390 0.2401 0.2300 -0.0292 -0.1229 0.0010  704 GLN A CA    
3418 C C     . GLN B 408 ? 0.3261 0.2289 0.2150 -0.0266 -0.1067 0.0001  704 GLN A C     
3419 O O     . GLN B 408 ? 0.3366 0.2432 0.2324 -0.0235 -0.1029 0.0048  704 GLN A O     
3420 C CB    . GLN B 408 ? 0.4848 0.3719 0.3451 -0.0336 -0.1307 0.0020  704 GLN A CB    
3421 C CG    . GLN B 408 ? 0.5359 0.4221 0.3992 -0.0362 -0.1484 0.0033  704 GLN A CG    
3422 C CD    . GLN B 408 ? 0.6799 0.5535 0.5160 -0.0393 -0.1585 0.0076  704 GLN A CD    
3423 O OE1   . GLN B 408 ? 0.7483 0.6095 0.5550 -0.0435 -0.1556 0.0044  704 GLN A OE1   
3424 N NE2   . GLN B 408 ? 0.6275 0.5033 0.4724 -0.0371 -0.1702 0.0150  704 GLN A NE2   
3425 N N     . ALA B 409 ? 0.3271 0.2270 0.2071 -0.0278 -0.0974 -0.0059 705 ALA A N     
3426 C CA    . ALA B 409 ? 0.3139 0.2174 0.1955 -0.0250 -0.0827 -0.0069 705 ALA A CA    
3427 C C     . ALA B 409 ? 0.3323 0.2484 0.2415 -0.0207 -0.0787 -0.0052 705 ALA A C     
3428 O O     . ALA B 409 ? 0.3004 0.2211 0.2144 -0.0181 -0.0711 -0.0026 705 ALA A O     
3429 C CB    . ALA B 409 ? 0.3198 0.2185 0.1904 -0.0262 -0.0742 -0.0139 705 ALA A CB    
3430 N N     . LYS B 410 ? 0.3352 0.2567 0.2623 -0.0205 -0.0834 -0.0070 706 LYS A N     
3431 C CA    . LYS B 410 ? 0.2587 0.1912 0.2108 -0.0168 -0.0792 -0.0056 706 LYS A CA    
3432 C C     . LYS B 410 ? 0.3639 0.3004 0.3249 -0.0144 -0.0829 0.0005  706 LYS A C     
3433 O O     . LYS B 410 ? 0.2875 0.2300 0.2593 -0.0113 -0.0756 0.0022  706 LYS A O     
3434 C CB    . LYS B 410 ? 0.2545 0.1912 0.2233 -0.0179 -0.0838 -0.0084 706 LYS A CB    
3435 C CG    . LYS B 410 ? 0.2645 0.2116 0.2574 -0.0147 -0.0778 -0.0076 706 LYS A CG    
3436 C CD    . LYS B 410 ? 0.3805 0.3319 0.3906 -0.0166 -0.0833 -0.0097 706 LYS A CD    
3437 C CE    . LYS B 410 ? 0.4779 0.4374 0.5079 -0.0143 -0.0749 -0.0100 706 LYS A CE    
3438 N NZ    . LYS B 410 ? 0.5776 0.5424 0.6268 -0.0166 -0.0805 -0.0111 706 LYS A NZ    
3439 N N     . ALA B 411 ? 0.2665 0.1991 0.2227 -0.0158 -0.0946 0.0037  707 ALA A N     
3440 C CA    . ALA B 411 ? 0.2640 0.1986 0.2280 -0.0131 -0.0985 0.0097  707 ALA A CA    
3441 C C     . ALA B 411 ? 0.3530 0.2829 0.3028 -0.0125 -0.0907 0.0124  707 ALA A C     
3442 O O     . ALA B 411 ? 0.3440 0.2774 0.3041 -0.0096 -0.0878 0.0157  707 ALA A O     
3443 C CB    . ALA B 411 ? 0.2811 0.2110 0.2408 -0.0146 -0.1136 0.0132  707 ALA A CB    
3444 N N     . VAL B 412 ? 0.3369 0.2588 0.2633 -0.0156 -0.0871 0.0107  708 VAL A N     
3445 C CA    . VAL B 412 ? 0.2796 0.1981 0.1938 -0.0157 -0.0787 0.0129  708 VAL A CA    
3446 C C     . VAL B 412 ? 0.2685 0.1961 0.1966 -0.0131 -0.0669 0.0107  708 VAL A C     
3447 O O     . VAL B 412 ? 0.3327 0.2625 0.2652 -0.0117 -0.0624 0.0137  708 VAL A O     
3448 C CB    . VAL B 412 ? 0.3490 0.2576 0.2359 -0.0197 -0.0760 0.0110  708 VAL A CB    
3449 C CG1   . VAL B 412 ? 0.3337 0.2411 0.2112 -0.0203 -0.0655 0.0126  708 VAL A CG1   
3450 C CG2   . VAL B 412 ? 0.3733 0.2714 0.2432 -0.0227 -0.0886 0.0139  708 VAL A CG2   
3451 N N     . ASN B 413 ? 0.2522 0.1845 0.1871 -0.0125 -0.0623 0.0057  709 ASN A N     
3452 C CA    . ASN B 413 ? 0.2681 0.2086 0.2158 -0.0099 -0.0524 0.0040  709 ASN A CA    
3453 C C     . ASN B 413 ? 0.2379 0.1852 0.2058 -0.0071 -0.0537 0.0067  709 ASN A C     
3454 O O     . ASN B 413 ? 0.2458 0.1971 0.2191 -0.0055 -0.0471 0.0078  709 ASN A O     
3455 C CB    . ASN B 413 ? 0.2286 0.1711 0.1797 -0.0097 -0.0487 -0.0012 709 ASN A CB    
3456 C CG    . ASN B 413 ? 0.3277 0.2645 0.2606 -0.0114 -0.0433 -0.0046 709 ASN A CG    
3457 O OD1   . ASN B 413 ? 0.3210 0.2548 0.2506 -0.0120 -0.0428 -0.0090 709 ASN A OD1   
3458 N ND2   . ASN B 413 ? 0.2453 0.1800 0.1662 -0.0123 -0.0388 -0.0027 709 ASN A ND2   
3459 N N     . PHE B 414 ? 0.2470 0.1958 0.2266 -0.0065 -0.0620 0.0074  710 PHE A N     
3460 C CA    . PHE B 414 ? 0.2897 0.2444 0.2887 -0.0036 -0.0630 0.0097  710 PHE A CA    
3461 C C     . PHE B 414 ? 0.3528 0.3041 0.3478 -0.0026 -0.0632 0.0142  710 PHE A C     
3462 O O     . PHE B 414 ? 0.3257 0.2808 0.3307 -0.0004 -0.0578 0.0150  710 PHE A O     
3463 C CB    . PHE B 414 ? 0.3428 0.2998 0.3548 -0.0034 -0.0729 0.0100  710 PHE A CB    
3464 C CG    . PHE B 414 ? 0.5253 0.4874 0.5569 -0.0001 -0.0751 0.0129  710 PHE A CG    
3465 C CD1   . PHE B 414 ? 0.6093 0.5671 0.6389 0.0013  -0.0817 0.0176  710 PHE A CD1   
3466 C CD2   . PHE B 414 ? 0.5862 0.5567 0.6380 0.0018  -0.0702 0.0110  710 PHE A CD2   
3467 C CE1   . PHE B 414 ? 0.6033 0.5653 0.6516 0.0050  -0.0832 0.0200  710 PHE A CE1   
3468 C CE2   . PHE B 414 ? 0.5950 0.5700 0.6649 0.0051  -0.0711 0.0131  710 PHE A CE2   
3469 C CZ    . PHE B 414 ? 0.5882 0.5590 0.6569 0.0070  -0.0775 0.0174  710 PHE A CZ    
3470 N N     . GLY B 415 ? 0.2812 0.2241 0.2602 -0.0046 -0.0694 0.0172  711 GLY A N     
3471 C CA    . GLY B 415 ? 0.3073 0.2449 0.2807 -0.0041 -0.0698 0.0219  711 GLY A CA    
3472 C C     . GLY B 415 ? 0.4164 0.3548 0.3845 -0.0049 -0.0589 0.0213  711 GLY A C     
3473 O O     . GLY B 415 ? 0.3553 0.2931 0.3286 -0.0037 -0.0565 0.0237  711 GLY A O     
3474 N N     . ILE B 416 ? 0.3789 0.3188 0.3376 -0.0070 -0.0522 0.0178  712 ILE A N     
3475 C CA    . ILE B 416 ? 0.3741 0.3172 0.3310 -0.0076 -0.0422 0.0169  712 ILE A CA    
3476 C C     . ILE B 416 ? 0.3307 0.2823 0.3058 -0.0048 -0.0377 0.0152  712 ILE A C     
3477 O O     . ILE B 416 ? 0.3765 0.3290 0.3549 -0.0047 -0.0336 0.0165  712 ILE A O     
3478 C CB    . ILE B 416 ? 0.4587 0.4025 0.4038 -0.0096 -0.0363 0.0134  712 ILE A CB    
3479 C CG1   . ILE B 416 ? 0.4236 0.3577 0.3477 -0.0131 -0.0393 0.0150  712 ILE A CG1   
3480 C CG2   . ILE B 416 ? 0.5583 0.5080 0.5056 -0.0099 -0.0266 0.0124  712 ILE A CG2   
3481 C CD1   . ILE B 416 ? 0.4699 0.4030 0.3831 -0.0144 -0.0356 0.0107  712 ILE A CD1   
3482 N N     . VAL B 417 ? 0.2789 0.2357 0.2649 -0.0030 -0.0381 0.0123  713 VAL A N     
3483 C CA    . VAL B 417 ? 0.2885 0.2525 0.2892 -0.0007 -0.0329 0.0106  713 VAL A CA    
3484 C C     . VAL B 417 ? 0.3261 0.2899 0.3375 0.0011  -0.0343 0.0129  713 VAL A C     
3485 O O     . VAL B 417 ? 0.3039 0.2708 0.3211 0.0019  -0.0286 0.0123  713 VAL A O     
3486 C CB    . VAL B 417 ? 0.2414 0.2093 0.2511 0.0004  -0.0338 0.0077  713 VAL A CB    
3487 C CG1   . VAL B 417 ? 0.3017 0.2756 0.3270 0.0026  -0.0293 0.0067  713 VAL A CG1   
3488 C CG2   . VAL B 417 ? 0.2945 0.2620 0.2943 -0.0008 -0.0303 0.0047  713 VAL A CG2   
3489 N N     . TYR B 418 ? 0.2777 0.2374 0.2917 0.0019  -0.0420 0.0155  714 TYR A N     
3490 C CA    . TYR B 418 ? 0.2802 0.2393 0.3063 0.0046  -0.0434 0.0176  714 TYR A CA    
3491 C C     . TYR B 418 ? 0.3319 0.2823 0.3485 0.0039  -0.0463 0.0217  714 TYR A C     
3492 O O     . TYR B 418 ? 0.4406 0.3885 0.4662 0.0064  -0.0481 0.0237  714 TYR A O     
3493 C CB    . TYR B 418 ? 0.2992 0.2616 0.3408 0.0070  -0.0498 0.0176  714 TYR A CB    
3494 C CG    . TYR B 418 ? 0.4230 0.3932 0.4756 0.0074  -0.0455 0.0138  714 TYR A CG    
3495 C CD1   . TYR B 418 ? 0.4921 0.4667 0.5541 0.0088  -0.0375 0.0119  714 TYR A CD1   
3496 C CD2   . TYR B 418 ? 0.4774 0.4493 0.5291 0.0058  -0.0493 0.0120  714 TYR A CD2   
3497 C CE1   . TYR B 418 ? 0.5326 0.5130 0.6029 0.0087  -0.0332 0.0090  714 TYR A CE1   
3498 C CE2   . TYR B 418 ? 0.5371 0.5148 0.5982 0.0057  -0.0451 0.0089  714 TYR A CE2   
3499 C CZ    . TYR B 418 ? 0.5530 0.5349 0.6233 0.0072  -0.0371 0.0077  714 TYR A CZ    
3500 O OH    . TYR B 418 ? 0.5905 0.5769 0.6686 0.0068  -0.0329 0.0052  714 TYR A OH    
3501 N N     . GLY B 419 ? 0.2810 0.2264 0.2798 0.0005  -0.0460 0.0229  715 GLY A N     
3502 C CA    . GLY B 419 ? 0.3475 0.2838 0.3353 -0.0011 -0.0474 0.0270  715 GLY A CA    
3503 C C     . GLY B 419 ? 0.4534 0.3824 0.4428 0.0010  -0.0572 0.0316  715 GLY A C     
3504 O O     . GLY B 419 ? 0.4233 0.3462 0.4150 0.0023  -0.0577 0.0346  715 GLY A O     
3505 N N     . ILE B 420 ? 0.3853 0.3143 0.3739 0.0014  -0.0655 0.0322  716 ILE A N     
3506 C CA    . ILE B 420 ? 0.3882 0.3110 0.3791 0.0037  -0.0764 0.0371  716 ILE A CA    
3507 C C     . ILE B 420 ? 0.3837 0.2941 0.3513 0.0004  -0.0804 0.0419  716 ILE A C     
3508 O O     . ILE B 420 ? 0.4137 0.3214 0.3636 -0.0040 -0.0754 0.0408  716 ILE A O     
3509 C CB    . ILE B 420 ? 0.4961 0.4248 0.4977 0.0053  -0.0850 0.0359  716 ILE A CB    
3510 C CG1   . ILE B 420 ? 0.5638 0.4895 0.5467 0.0010  -0.0886 0.0348  716 ILE A CG1   
3511 C CG2   . ILE B 420 ? 0.5296 0.4702 0.5522 0.0075  -0.0795 0.0310  716 ILE A CG2   
3512 C CD1   . ILE B 420 ? 0.6026 0.5325 0.5939 0.0015  -0.0985 0.0336  716 ILE A CD1   
3513 N N     . SER B 421 ? 0.4668 0.3692 0.4348 0.0026  -0.0894 0.0475  717 SER A N     
3514 C CA    . SER B 421 ? 0.5016 0.3903 0.4469 -0.0004 -0.0942 0.0532  717 SER A CA    
3515 C C     . SER B 421 ? 0.5060 0.3921 0.4369 -0.0030 -0.1030 0.0538  717 SER A C     
3516 O O     . SER B 421 ? 0.4392 0.3337 0.3804 -0.0018 -0.1073 0.0503  717 SER A O     
3517 C CB    . SER B 421 ? 0.5636 0.4434 0.5145 0.0034  -0.1013 0.0596  717 SER A CB    
3518 O OG    . SER B 421 ? 0.4585 0.3438 0.4277 0.0084  -0.1116 0.0604  717 SER A OG    
3519 N N     . ASP B 422 ? 0.5602 0.4335 0.4659 -0.0069 -0.1056 0.0582  718 ASP A N     
3520 C CA    . ASP B 422 ? 0.5784 0.4455 0.4670 -0.0093 -0.1161 0.0601  718 ASP A CA    
3521 C C     . ASP B 422 ? 0.5018 0.3704 0.4052 -0.0048 -0.1310 0.0634  718 ASP A C     
3522 O O     . ASP B 422 ? 0.5736 0.4457 0.4766 -0.0056 -0.1391 0.0612  718 ASP A O     
3523 C CB    . ASP B 422 ? 0.7452 0.5961 0.6042 -0.0140 -0.1165 0.0657  718 ASP A CB    
3524 C CG    . ASP B 422 ? 0.9540 0.7955 0.8148 -0.0119 -0.1177 0.0726  718 ASP A CG    
3525 O OD1   . ASP B 422 ? 0.9483 0.7959 0.8337 -0.0064 -0.1184 0.0727  718 ASP A OD1   
3526 O OD2   . ASP B 422 ? 1.0623 0.8897 0.8997 -0.0159 -0.1173 0.0779  718 ASP A OD2   
3527 N N     . TYR B 423 ? 0.4654 0.3312 0.3824 0.0001  -0.1350 0.0684  719 TYR A N     
3528 C CA    . TYR B 423 ? 0.5354 0.4052 0.4719 0.0055  -0.1484 0.0713  719 TYR A CA    
3529 C C     . TYR B 423 ? 0.4671 0.3540 0.4289 0.0075  -0.1468 0.0644  719 TYR A C     
3530 O O     . TYR B 423 ? 0.5154 0.4077 0.4860 0.0084  -0.1581 0.0643  719 TYR A O     
3531 C CB    . TYR B 423 ? 0.5577 0.4231 0.5090 0.0114  -0.1501 0.0767  719 TYR A CB    
3532 C CG    . TYR B 423 ? 0.8926 0.7395 0.8228 0.0105  -0.1548 0.0852  719 TYR A CG    
3533 C CD1   . TYR B 423 ? 0.9969 0.8351 0.9172 0.0085  -0.1436 0.0863  719 TYR A CD1   
3534 C CD2   . TYR B 423 ? 0.9495 0.7884 0.8708 0.0114  -0.1696 0.0916  719 TYR A CD2   
3535 C CE1   . TYR B 423 ? 0.9981 0.8183 0.8990 0.0072  -0.1473 0.0943  719 TYR A CE1   
3536 C CE2   . TYR B 423 ? 0.9637 0.7876 0.8668 0.0101  -0.1705 0.0978  719 TYR A CE2   
3537 C CZ    . TYR B 423 ? 1.0176 0.8309 0.9098 0.0081  -0.1602 0.0999  719 TYR A CZ    
3538 O OH    . TYR B 423 ? 1.1061 0.9043 0.9806 0.0063  -0.1605 0.1060  719 TYR A OH    
3539 N N     . GLY B 424 ? 0.4670 0.3625 0.4406 0.0080  -0.1331 0.0589  720 GLY A N     
3540 C CA    . GLY B 424 ? 0.4221 0.3325 0.4184 0.0096  -0.1303 0.0527  720 GLY A CA    
3541 C C     . GLY B 424 ? 0.4393 0.3532 0.4254 0.0049  -0.1317 0.0481  720 GLY A C     
3542 O O     . GLY B 424 ? 0.4604 0.3837 0.4626 0.0056  -0.1367 0.0452  720 GLY A O     
3543 N N     . LEU B 425 ? 0.3965 0.3027 0.3564 -0.0002 -0.1266 0.0470  721 LEU A N     
3544 C CA    . LEU B 425 ? 0.4441 0.3510 0.3916 -0.0046 -0.1279 0.0425  721 LEU A CA    
3545 C C     . LEU B 425 ? 0.4556 0.3576 0.3959 -0.0059 -0.1441 0.0454  721 LEU A C     
3546 O O     . LEU B 425 ? 0.5170 0.4253 0.4653 -0.0070 -0.1498 0.0417  721 LEU A O     
3547 C CB    . LEU B 425 ? 0.4572 0.3566 0.3785 -0.0092 -0.1182 0.0407  721 LEU A CB    
3548 C CG    . LEU B 425 ? 0.5250 0.4223 0.4298 -0.0137 -0.1186 0.0358  721 LEU A CG    
3549 C CD1   . LEU B 425 ? 0.4529 0.3620 0.3755 -0.0129 -0.1130 0.0289  721 LEU A CD1   
3550 C CD2   . LEU B 425 ? 0.4852 0.3736 0.3631 -0.0180 -0.1097 0.0351  721 LEU A CD2   
3551 N N     . ALA B 426 ? 0.4224 0.3127 0.3472 -0.0060 -0.1520 0.0524  722 ALA A N     
3552 C CA    . ALA B 426 ? 0.4684 0.3534 0.3863 -0.0067 -0.1693 0.0564  722 ALA A CA    
3553 C C     . ALA B 426 ? 0.4720 0.3700 0.4216 -0.0026 -0.1788 0.0559  722 ALA A C     
3554 O O     . ALA B 426 ? 0.5572 0.4575 0.5070 -0.0049 -0.1901 0.0544  722 ALA A O     
3555 C CB    . ALA B 426 ? 0.4983 0.3692 0.4004 -0.0058 -0.1759 0.0653  722 ALA A CB    
3556 N N     . GLN B 427 ? 0.5438 0.4502 0.5205 0.0032  -0.1742 0.0567  723 GLN A N     
3557 C CA    . GLN B 427 ? 0.6010 0.5207 0.6103 0.0075  -0.1819 0.0564  723 GLN A CA    
3558 C C     . GLN B 427 ? 0.6407 0.5725 0.6627 0.0048  -0.1774 0.0485  723 GLN A C     
3559 O O     . GLN B 427 ? 0.5910 0.5312 0.6294 0.0046  -0.1878 0.0476  723 GLN A O     
3560 C CB    . GLN B 427 ? 0.7492 0.6735 0.7823 0.0144  -0.1754 0.0585  723 GLN A CB    
3561 C CG    . GLN B 427 ? 0.9235 0.8623 0.9931 0.0195  -0.1808 0.0580  723 GLN A CG    
3562 C CD    . GLN B 427 ? 1.0373 0.9762 1.1258 0.0270  -0.1776 0.0618  723 GLN A CD    
3563 O OE1   . GLN B 427 ? 1.1020 1.0434 1.2042 0.0305  -0.1839 0.0645  723 GLN A OE1   
3564 N NE2   . GLN B 427 ? 0.9667 0.9034 1.0531 0.0277  -0.1622 0.0593  723 GLN A NE2   
3565 N N     . ASN B 428 ? 0.6337 0.5665 0.6492 0.0026  -0.1623 0.0431  724 ASN A N     
3566 C CA    . ASN B 428 ? 0.5950 0.5374 0.6208 0.0000  -0.1574 0.0361  724 ASN A CA    
3567 C C     . ASN B 428 ? 0.5670 0.5039 0.5731 -0.0061 -0.1652 0.0333  724 ASN A C     
3568 O O     . ASN B 428 ? 0.5938 0.5382 0.6125 -0.0083 -0.1691 0.0292  724 ASN A O     
3569 C CB    . ASN B 428 ? 0.5707 0.5148 0.5945 -0.0001 -0.1398 0.0318  724 ASN A CB    
3570 C CG    . ASN B 428 ? 0.6012 0.5507 0.6446 0.0053  -0.1320 0.0335  724 ASN A CG    
3571 O OD1   . ASN B 428 ? 0.6505 0.6040 0.7130 0.0095  -0.1387 0.0369  724 ASN A OD1   
3572 N ND2   . ASN B 428 ? 0.5399 0.4893 0.5788 0.0052  -0.1181 0.0309  724 ASN A ND2   
3573 N N     . LEU B 429 ? 0.5873 0.5105 0.5621 -0.0093 -0.1673 0.0354  725 LEU A N     
3574 C CA    . LEU B 429 ? 0.4609 0.3766 0.4134 -0.0153 -0.1748 0.0326  725 LEU A CA    
3575 C C     . LEU B 429 ? 0.5657 0.4781 0.5158 -0.0161 -0.1942 0.0374  725 LEU A C     
3576 O O     . LEU B 429 ? 0.5312 0.4369 0.4623 -0.0215 -0.2027 0.0352  725 LEU A O     
3577 C CB    . LEU B 429 ? 0.4209 0.3233 0.3396 -0.0188 -0.1663 0.0319  725 LEU A CB    
3578 C CG    . LEU B 429 ? 0.4452 0.3522 0.3663 -0.0191 -0.1492 0.0256  725 LEU A CG    
3579 C CD1   . LEU B 429 ? 0.4535 0.3494 0.3446 -0.0223 -0.1401 0.0245  725 LEU A CD1   
3580 C CD2   . LEU B 429 ? 0.4610 0.3743 0.3922 -0.0215 -0.1506 0.0188  725 LEU A CD2   
3581 N N     . ASN B 430 ? 0.5574 0.4739 0.5260 -0.0107 -0.2017 0.0438  726 ASN A N     
3582 C CA    . ASN B 430 ? 0.5918 0.5057 0.5601 -0.0105 -0.2161 0.0486  726 ASN A CA    
3583 C C     . ASN B 430 ? 0.5790 0.4757 0.5087 -0.0154 -0.2195 0.0507  726 ASN A C     
3584 O O     . ASN B 430 ? 0.6099 0.5030 0.5287 -0.0195 -0.2280 0.0495  726 ASN A O     
3585 C CB    . ASN B 430 ? 0.6944 0.6200 0.6840 -0.0123 -0.2236 0.0445  726 ASN A CB    
3586 C CG    . ASN B 430 ? 0.8405 0.7684 0.8412 -0.0100 -0.2353 0.0494  726 ASN A CG    
3587 O OD1   . ASN B 430 ? 0.8785 0.8030 0.8819 -0.0051 -0.2365 0.0557  726 ASN A OD1   
3588 N ND2   . ASN B 430 ? 0.8020 0.7350 0.8091 -0.0136 -0.2440 0.0466  726 ASN A ND2   
3589 N N     . ILE B 431 ? 0.5608 0.4464 0.4692 -0.0152 -0.2119 0.0539  727 ILE A N     
3590 C CA    . ILE B 431 ? 0.5847 0.4535 0.4563 -0.0199 -0.2123 0.0563  727 ILE A CA    
3591 C C     . ILE B 431 ? 0.6138 0.4745 0.4802 -0.0164 -0.2104 0.0642  727 ILE A C     
3592 O O     . ILE B 431 ? 0.5980 0.4656 0.4883 -0.0104 -0.2083 0.0671  727 ILE A O     
3593 C CB    . ILE B 431 ? 0.6379 0.4994 0.4828 -0.0253 -0.2021 0.0506  727 ILE A CB    
3594 C CG1   . ILE B 431 ? 0.6646 0.5307 0.5184 -0.0224 -0.1862 0.0494  727 ILE A CG1   
3595 C CG2   . ILE B 431 ? 0.5440 0.4112 0.3921 -0.0291 -0.2044 0.0425  727 ILE A CG2   
3596 C CD1   . ILE B 431 ? 0.6379 0.5004 0.4726 -0.0267 -0.1708 0.0426  727 ILE A CD1   
3597 N N     . SER B 432 ? 0.5781 0.4235 0.4130 -0.0203 -0.2104 0.0674  728 SER A N     
3598 C CA    . SER B 432 ? 0.5801 0.4162 0.4081 -0.0179 -0.2085 0.0749  728 SER A CA    
3599 C C     . SER B 432 ? 0.6781 0.5122 0.5024 -0.0174 -0.1945 0.0749  728 SER A C     
3600 O O     . SER B 432 ? 0.6672 0.5044 0.4866 -0.0199 -0.1861 0.0693  728 SER A O     
3601 C CB    . SER B 432 ? 0.6452 0.4655 0.4404 -0.0227 -0.2121 0.0785  728 SER A CB    
3602 O OG    . SER B 432 ? 0.6889 0.4994 0.4555 -0.0280 -0.2003 0.0763  728 SER A OG    
3603 N N     . ARG B 433 ? 0.7928 0.6213 0.6198 -0.0141 -0.1921 0.0812  729 ARG A N     
3604 C CA    . ARG B 433 ? 0.7344 0.5592 0.5561 -0.0145 -0.1789 0.0818  729 ARG A CA    
3605 C C     . ARG B 433 ? 0.7163 0.5296 0.5030 -0.0218 -0.1701 0.0806  729 ARG A C     
3606 O O     . ARG B 433 ? 0.7409 0.5573 0.5245 -0.0239 -0.1569 0.0762  729 ARG A O     
3607 C CB    . ARG B 433 ? 0.8055 0.6252 0.6367 -0.0100 -0.1782 0.0886  729 ARG A CB    
3608 C CG    . ARG B 433 ? 0.9463 0.7677 0.7865 -0.0084 -0.1659 0.0881  729 ARG A CG    
3609 C CD    . ARG B 433 ? 1.0922 0.9007 0.9234 -0.0084 -0.1616 0.0945  729 ARG A CD    
3610 N NE    . ARG B 433 ? 1.2307 1.0256 1.0315 -0.0139 -0.1630 0.0981  729 ARG A NE    
3611 C CZ    . ARG B 433 ? 1.2856 1.0732 1.0593 -0.0210 -0.1539 0.0966  729 ARG A CZ    
3612 N NH1   . ARG B 433 ? 1.3088 1.0841 1.0565 -0.0256 -0.1550 0.0998  729 ARG A NH1   
3613 N NH2   . ARG B 433 ? 1.2833 1.0768 1.0572 -0.0233 -0.1427 0.0916  729 ARG A NH2   
3614 N N     . LYS B 434 ? 0.6594 0.4616 0.4229 -0.0256 -0.1749 0.0831  730 LYS A N     
3615 C CA    . LYS B 434 ? 0.7059 0.4976 0.4366 -0.0327 -0.1658 0.0811  730 LYS A CA    
3616 C C     . LYS B 434 ? 0.7258 0.5236 0.4515 -0.0358 -0.1612 0.0725  730 LYS A C     
3617 O O     . LYS B 434 ? 0.8485 0.6436 0.5585 -0.0397 -0.1483 0.0690  730 LYS A O     
3618 C CB    . LYS B 434 ? 0.6970 0.4761 0.4052 -0.0360 -0.1732 0.0850  730 LYS A CB    
3619 N N     . GLU B 435 ? 0.6944 0.5006 0.4340 -0.0342 -0.1713 0.0687  731 GLU A N     
3620 C CA    . GLU B 435 ? 0.6626 0.4737 0.3980 -0.0372 -0.1676 0.0600  731 GLU A CA    
3621 C C     . GLU B 435 ? 0.6068 0.4306 0.3631 -0.0345 -0.1549 0.0551  731 GLU A C     
3622 O O     . GLU B 435 ? 0.6203 0.4455 0.3680 -0.0373 -0.1418 0.0485  731 GLU A O     
3623 C CB    . GLU B 435 ? 0.7808 0.5985 0.5291 -0.0366 -0.1809 0.0570  731 GLU A CB    
3624 C CG    . GLU B 435 ? 0.9425 0.7503 0.6742 -0.0392 -0.1913 0.0604  731 GLU A CG    
3625 C CD    . GLU B 435 ? 1.0947 0.9107 0.8440 -0.0382 -0.2056 0.0587  731 GLU A CD    
3626 O OE1   . GLU B 435 ? 1.0980 0.9240 0.8763 -0.0327 -0.2133 0.0621  731 GLU A OE1   
3627 O OE2   . GLU B 435 ? 1.1410 0.9532 0.8754 -0.0429 -0.2086 0.0537  731 GLU A OE2   
3628 N N     . ALA B 436 ? 0.5314 0.3662 0.3191 -0.0285 -0.1560 0.0572  732 ALA A N     
3629 C CA    . ALA B 436 ? 0.5841 0.4321 0.3944 -0.0258 -0.1415 0.0521  732 ALA A CA    
3630 C C     . ALA B 436 ? 0.6594 0.5024 0.4545 -0.0285 -0.1262 0.0520  732 ALA A C     
3631 O O     . ALA B 436 ? 0.6011 0.4514 0.4000 -0.0293 -0.1133 0.0456  732 ALA A O     
3632 C CB    . ALA B 436 ? 0.5750 0.4326 0.4173 -0.0193 -0.1448 0.0551  732 ALA A CB    
3633 N N     . ALA B 437 ? 0.7404 0.5708 0.5183 -0.0301 -0.1276 0.0593  733 ALA A N     
3634 C CA    . ALA B 437 ? 0.7451 0.5706 0.5086 -0.0336 -0.1134 0.0598  733 ALA A CA    
3635 C C     . ALA B 437 ? 0.6732 0.4958 0.4144 -0.0389 -0.1045 0.0539  733 ALA A C     
3636 O O     . ALA B 437 ? 0.5811 0.4102 0.3255 -0.0399 -0.0899 0.0493  733 ALA A O     
3637 C CB    . ALA B 437 ? 0.7527 0.5627 0.4986 -0.0353 -0.1179 0.0692  733 ALA A CB    
3638 N N     . GLU B 438 ? 0.6128 0.4257 0.3317 -0.0421 -0.1132 0.0536  734 GLU A N     
3639 C CA    . GLU B 438 ? 0.6982 0.5066 0.3942 -0.0471 -0.1042 0.0475  734 GLU A CA    
3640 C C     . GLU B 438 ? 0.6590 0.4808 0.3727 -0.0450 -0.0976 0.0380  734 GLU A C     
3641 O O     . GLU B 438 ? 0.7541 0.5764 0.4579 -0.0474 -0.0849 0.0322  734 GLU A O     
3642 C CB    . GLU B 438 ? 0.8668 0.6595 0.5317 -0.0516 -0.1156 0.0495  734 GLU A CB    
3643 C CG    . GLU B 438 ? 1.0280 0.8126 0.6646 -0.0572 -0.1044 0.0438  734 GLU A CG    
3644 C CD    . GLU B 438 ? 1.1396 0.9259 0.7721 -0.0591 -0.0855 0.0429  734 GLU A CD    
3645 O OE1   . GLU B 438 ? 1.1395 0.9300 0.7692 -0.0603 -0.0730 0.0350  734 GLU A OE1   
3646 O OE2   . GLU B 438 ? 1.1671 0.9507 0.8006 -0.0594 -0.0828 0.0498  734 GLU A OE2   
3647 N N     . PHE B 439 ? 0.6113 0.4437 0.3512 -0.0406 -0.1058 0.0365  735 PHE A N     
3648 C CA    . PHE B 439 ? 0.6319 0.4774 0.3918 -0.0381 -0.0985 0.0285  735 PHE A CA    
3649 C C     . PHE B 439 ? 0.6858 0.5401 0.4578 -0.0364 -0.0827 0.0269  735 PHE A C     
3650 O O     . PHE B 439 ? 0.6110 0.4697 0.3824 -0.0369 -0.0715 0.0207  735 PHE A O     
3651 C CB    . PHE B 439 ? 0.7749 0.6307 0.5633 -0.0338 -0.1089 0.0286  735 PHE A CB    
3652 C CG    . PHE B 439 ? 0.9021 0.7571 0.6885 -0.0354 -0.1182 0.0239  735 PHE A CG    
3653 C CD1   . PHE B 439 ? 0.9620 0.8132 0.7477 -0.0359 -0.1352 0.0278  735 PHE A CD1   
3654 C CD2   . PHE B 439 ? 1.0122 0.8705 0.7988 -0.0365 -0.1104 0.0157  735 PHE A CD2   
3655 C CE1   . PHE B 439 ? 0.9756 0.8265 0.7602 -0.0382 -0.1446 0.0233  735 PHE A CE1   
3656 C CE2   . PHE B 439 ? 1.0781 0.9346 0.8628 -0.0386 -0.1190 0.0111  735 PHE A CE2   
3657 C CZ    . PHE B 439 ? 1.0546 0.9077 0.8382 -0.0399 -0.1363 0.0148  735 PHE A CZ    
3658 N N     . ILE B 440 ? 0.6095 0.4664 0.3933 -0.0343 -0.0822 0.0326  736 ILE A N     
3659 C CA    . ILE B 440 ? 0.5912 0.4566 0.3875 -0.0330 -0.0690 0.0316  736 ILE A CA    
3660 C C     . ILE B 440 ? 0.5918 0.4523 0.3673 -0.0375 -0.0568 0.0300  736 ILE A C     
3661 O O     . ILE B 440 ? 0.5291 0.3986 0.3127 -0.0370 -0.0448 0.0253  736 ILE A O     
3662 C CB    . ILE B 440 ? 0.6129 0.4785 0.4215 -0.0308 -0.0720 0.0381  736 ILE A CB    
3663 C CG1   . ILE B 440 ? 0.5722 0.4441 0.4040 -0.0258 -0.0825 0.0390  736 ILE A CG1   
3664 C CG2   . ILE B 440 ? 0.6704 0.5440 0.4903 -0.0305 -0.0591 0.0370  736 ILE A CG2   
3665 C CD1   . ILE B 440 ? 0.6529 0.5394 0.5097 -0.0222 -0.0767 0.0335  736 ILE A CD1   
3666 N N     . GLU B 441 ? 0.6121 0.4582 0.3606 -0.0421 -0.0595 0.0341  737 GLU A N     
3667 C CA    . GLU B 441 ? 0.6231 0.4644 0.3517 -0.0468 -0.0467 0.0329  737 GLU A CA    
3668 C C     . GLU B 441 ? 0.6497 0.4935 0.3718 -0.0474 -0.0395 0.0245  737 GLU A C     
3669 O O     . GLU B 441 ? 0.6659 0.5151 0.3883 -0.0484 -0.0256 0.0207  737 GLU A O     
3670 C CB    . GLU B 441 ? 0.8177 0.6414 0.5163 -0.0520 -0.0512 0.0394  737 GLU A CB    
3671 C CG    . GLU B 441 ? 1.0342 0.8544 0.7325 -0.0539 -0.0467 0.0463  737 GLU A CG    
3672 C CD    . GLU B 441 ? 1.1640 0.9972 0.8788 -0.0539 -0.0314 0.0429  737 GLU A CD    
3673 O OE1   . GLU B 441 ? 1.1562 0.9966 0.8921 -0.0514 -0.0315 0.0452  737 GLU A OE1   
3674 O OE2   . GLU B 441 ? 1.2074 1.0437 0.9145 -0.0565 -0.0193 0.0378  737 GLU A OE2   
3675 N N     . ARG B 442 ? 0.6410 0.4810 0.3582 -0.0468 -0.0490 0.0213  738 ARG A N     
3676 C CA    . ARG B 442 ? 0.6597 0.5012 0.3722 -0.0470 -0.0424 0.0127  738 ARG A CA    
3677 C C     . ARG B 442 ? 0.5339 0.3916 0.2746 -0.0421 -0.0337 0.0080  738 ARG A C     
3678 O O     . ARG B 442 ? 0.5886 0.4497 0.3280 -0.0419 -0.0219 0.0021  738 ARG A O     
3679 C CB    . ARG B 442 ? 0.7417 0.5761 0.4460 -0.0476 -0.0555 0.0103  738 ARG A CB    
3680 C CG    . ARG B 442 ? 0.8624 0.6791 0.5316 -0.0533 -0.0615 0.0122  738 ARG A CG    
3681 C CD    . ARG B 442 ? 1.0957 0.9053 0.7417 -0.0569 -0.0478 0.0060  738 ARG A CD    
3682 N NE    . ARG B 442 ? 1.2346 1.0543 0.8972 -0.0534 -0.0382 -0.0025 738 ARG A NE    
3683 C CZ    . ARG B 442 ? 1.3648 1.1841 1.0188 -0.0542 -0.0229 -0.0084 738 ARG A CZ    
3684 N NH1   . ARG B 442 ? 1.4007 1.2105 1.0295 -0.0588 -0.0145 -0.0071 738 ARG A NH1   
3685 N NH2   . ARG B 442 ? 1.3992 1.2275 1.0704 -0.0502 -0.0156 -0.0155 738 ARG A NH2   
3686 N N     . TYR B 443 ? 0.4857 0.3531 0.2519 -0.0381 -0.0393 0.0106  739 TYR A N     
3687 C CA    . TYR B 443 ? 0.5458 0.4278 0.3373 -0.0338 -0.0317 0.0071  739 TYR A CA    
3688 C C     . TYR B 443 ? 0.5491 0.4367 0.3418 -0.0346 -0.0181 0.0074  739 TYR A C     
3689 O O     . TYR B 443 ? 0.4828 0.3788 0.2848 -0.0324 -0.0084 0.0024  739 TYR A O     
3690 C CB    . TYR B 443 ? 0.4558 0.3456 0.2715 -0.0300 -0.0396 0.0105  739 TYR A CB    
3691 C CG    . TYR B 443 ? 0.4418 0.3452 0.2812 -0.0259 -0.0325 0.0073  739 TYR A CG    
3692 C CD1   . TYR B 443 ? 0.3709 0.2789 0.2213 -0.0233 -0.0335 0.0023  739 TYR A CD1   
3693 C CD2   . TYR B 443 ? 0.3859 0.2968 0.2355 -0.0252 -0.0249 0.0094  739 TYR A CD2   
3694 C CE1   . TYR B 443 ? 0.4074 0.3267 0.2777 -0.0196 -0.0273 0.0000  739 TYR A CE1   
3695 C CE2   . TYR B 443 ? 0.3960 0.3188 0.2655 -0.0217 -0.0191 0.0067  739 TYR A CE2   
3696 C CZ    . TYR B 443 ? 0.4085 0.3352 0.2878 -0.0187 -0.0203 0.0023  739 TYR A CZ    
3697 O OH    . TYR B 443 ? 0.3995 0.3368 0.2967 -0.0153 -0.0150 0.0003  739 TYR A OH    
3698 N N     . PHE B 444 ? 0.4983 0.3812 0.2825 -0.0377 -0.0173 0.0132  740 PHE A N     
3699 C CA    . PHE B 444 ? 0.4864 0.3760 0.2747 -0.0391 -0.0049 0.0136  740 PHE A CA    
3700 C C     . PHE B 444 ? 0.4953 0.3820 0.2666 -0.0420 0.0065  0.0094  740 PHE A C     
3701 O O     . PHE B 444 ? 0.5229 0.4193 0.3033 -0.0418 0.0181  0.0072  740 PHE A O     
3702 C CB    . PHE B 444 ? 0.3922 0.2766 0.1763 -0.0421 -0.0070 0.0209  740 PHE A CB    
3703 C CG    . PHE B 444 ? 0.4050 0.2947 0.2098 -0.0387 -0.0142 0.0242  740 PHE A CG    
3704 C CD1   . PHE B 444 ? 0.4423 0.3456 0.2713 -0.0343 -0.0120 0.0208  740 PHE A CD1   
3705 C CD2   . PHE B 444 ? 0.5148 0.3952 0.3144 -0.0398 -0.0227 0.0309  740 PHE A CD2   
3706 C CE1   . PHE B 444 ? 0.4140 0.3214 0.2607 -0.0313 -0.0177 0.0233  740 PHE A CE1   
3707 C CE2   . PHE B 444 ? 0.4407 0.3252 0.2595 -0.0363 -0.0283 0.0335  740 PHE A CE2   
3708 C CZ    . PHE B 444 ? 0.4320 0.3302 0.2742 -0.0322 -0.0255 0.0294  740 PHE A CZ    
3709 N N     . GLU B 445 ? 0.4930 0.3665 0.2399 -0.0448 0.0035  0.0080  741 GLU A N     
3710 C CA    . GLU B 445 ? 0.4977 0.3679 0.2285 -0.0470 0.0153  0.0025  741 GLU A CA    
3711 C C     . GLU B 445 ? 0.5798 0.4592 0.3255 -0.0421 0.0205  -0.0052 741 GLU A C     
3712 O O     . GLU B 445 ? 0.5498 0.4334 0.2947 -0.0418 0.0335  -0.0098 741 GLU A O     
3713 C CB    . GLU B 445 ? 0.6902 0.5423 0.3887 -0.0516 0.0102  0.0026  741 GLU A CB    
3714 C CG    . GLU B 445 ? 0.8933 0.7336 0.5744 -0.0562 0.0028  0.0110  741 GLU A CG    
3715 C CD    . GLU B 445 ? 1.1903 1.0364 0.8797 -0.0580 0.0106  0.0162  741 GLU A CD    
3716 O OE1   . GLU B 445 ? 1.2841 1.1309 0.9842 -0.0571 0.0024  0.0224  741 GLU A OE1   
3717 O OE2   . GLU B 445 ? 1.2999 1.1495 0.9857 -0.0605 0.0252  0.0138  741 GLU A OE2   
3718 N N     . SER B 446 ? 0.5734 0.4556 0.3328 -0.0382 0.0110  -0.0066 742 SER A N     
3719 C CA    . SER B 446 ? 0.5569 0.4468 0.3311 -0.0335 0.0157  -0.0132 742 SER A CA    
3720 C C     . SER B 446 ? 0.4986 0.4049 0.2997 -0.0294 0.0216  -0.0125 742 SER A C     
3721 O O     . SER B 446 ? 0.4858 0.3996 0.2978 -0.0257 0.0297  -0.0172 742 SER A O     
3722 C CB    . SER B 446 ? 0.6974 0.5835 0.4756 -0.0317 0.0036  -0.0150 742 SER A CB    
3723 O OG    . SER B 446 ? 0.8780 0.7491 0.6310 -0.0359 -0.0035 -0.0156 742 SER A OG    
3724 N N     . PHE B 447 ? 0.4054 0.3169 0.2174 -0.0298 0.0174  -0.0065 743 PHE A N     
3725 C CA    . PHE B 447 ? 0.3834 0.3096 0.2197 -0.0264 0.0213  -0.0057 743 PHE A CA    
3726 C C     . PHE B 447 ? 0.3861 0.3151 0.2216 -0.0301 0.0257  -0.0010 743 PHE A C     
3727 O O     . PHE B 447 ? 0.3364 0.2671 0.1805 -0.0305 0.0201  0.0036  743 PHE A O     
3728 C CB    . PHE B 447 ? 0.4124 0.3424 0.2657 -0.0229 0.0115  -0.0043 743 PHE A CB    
3729 C CG    . PHE B 447 ? 0.4131 0.3401 0.2676 -0.0202 0.0075  -0.0090 743 PHE A CG    
3730 C CD1   . PHE B 447 ? 0.3934 0.3098 0.2363 -0.0220 -0.0025 -0.0087 743 PHE A CD1   
3731 C CD2   . PHE B 447 ? 0.3399 0.2742 0.2070 -0.0159 0.0135  -0.0134 743 PHE A CD2   
3732 C CE1   . PHE B 447 ? 0.4300 0.3433 0.2743 -0.0204 -0.0063 -0.0133 743 PHE A CE1   
3733 C CE2   . PHE B 447 ? 0.3812 0.3111 0.2488 -0.0138 0.0102  -0.0178 743 PHE A CE2   
3734 C CZ    . PHE B 447 ? 0.4599 0.3794 0.3162 -0.0165 0.0005  -0.0179 743 PHE A CZ    
3735 N N     . PRO B 448 ? 0.3525 0.2814 0.1780 -0.0332 0.0365  -0.0023 744 PRO A N     
3736 C CA    . PRO B 448 ? 0.3900 0.3207 0.2137 -0.0379 0.0411  0.0023  744 PRO A CA    
3737 C C     . PRO B 448 ? 0.3423 0.2873 0.1903 -0.0361 0.0424  0.0037  744 PRO A C     
3738 O O     . PRO B 448 ? 0.3025 0.2471 0.1517 -0.0397 0.0414  0.0084  744 PRO A O     
3739 C CB    . PRO B 448 ? 0.4153 0.3455 0.2267 -0.0408 0.0542  -0.0009 744 PRO A CB    
3740 C CG    . PRO B 448 ? 0.4176 0.3534 0.2371 -0.0352 0.0583  -0.0079 744 PRO A CG    
3741 C CD    . PRO B 448 ? 0.3483 0.2766 0.1659 -0.0323 0.0460  -0.0084 744 PRO A CD    
3742 N N     . GLY B 449 ? 0.2899 0.2466 0.1562 -0.0308 0.0445  -0.0002 745 GLY A N     
3743 C CA    . GLY B 449 ? 0.2806 0.2504 0.1685 -0.0292 0.0446  0.0011  745 GLY A CA    
3744 C C     . GLY B 449 ? 0.3035 0.2698 0.1965 -0.0286 0.0341  0.0049  745 GLY A C     
3745 O O     . GLY B 449 ? 0.2491 0.2199 0.1507 -0.0306 0.0337  0.0077  745 GLY A O     
3746 N N     . VAL B 450 ? 0.3274 0.2854 0.2154 -0.0263 0.0258  0.0046  746 VAL A N     
3747 C CA    . VAL B 450 ? 0.2548 0.2094 0.1484 -0.0255 0.0163  0.0081  746 VAL A CA    
3748 C C     . VAL B 450 ? 0.2642 0.2096 0.1462 -0.0304 0.0141  0.0134  746 VAL A C     
3749 O O     . VAL B 450 ? 0.3092 0.2553 0.1993 -0.0309 0.0111  0.0165  746 VAL A O     
3750 C CB    . VAL B 450 ? 0.2906 0.2392 0.1824 -0.0224 0.0081  0.0067  746 VAL A CB    
3751 C CG1   . VAL B 450 ? 0.2884 0.2330 0.1857 -0.0217 -0.0014 0.0106  746 VAL A CG1   
3752 C CG2   . VAL B 450 ? 0.2391 0.1959 0.1441 -0.0176 0.0102  0.0021  746 VAL A CG2   
3753 N N     . LYS B 451 ? 0.2847 0.2201 0.1465 -0.0341 0.0157  0.0144  747 LYS A N     
3754 C CA    . LYS B 451 ? 0.3147 0.2400 0.1635 -0.0391 0.0141  0.0200  747 LYS A CA    
3755 C C     . LYS B 451 ? 0.3038 0.2360 0.1611 -0.0425 0.0213  0.0216  747 LYS A C     
3756 O O     . LYS B 451 ? 0.3365 0.2640 0.1951 -0.0445 0.0178  0.0260  747 LYS A O     
3757 C CB    . LYS B 451 ? 0.3407 0.2544 0.1644 -0.0432 0.0165  0.0206  747 LYS A CB    
3758 C CG    . LYS B 451 ? 0.4097 0.3109 0.2175 -0.0486 0.0147  0.0272  747 LYS A CG    
3759 C CD    . LYS B 451 ? 0.5140 0.4022 0.2940 -0.0529 0.0166  0.0281  747 LYS A CD    
3760 C CE    . LYS B 451 ? 0.6194 0.4922 0.3821 -0.0575 0.0118  0.0358  747 LYS A CE    
3761 N NZ    . LYS B 451 ? 0.6748 0.5374 0.4113 -0.0640 0.0197  0.0371  747 LYS A NZ    
3762 N N     . ARG B 452 ? 0.3415 0.2849 0.2050 -0.0432 0.0313  0.0180  748 ARG A N     
3763 C CA    . ARG B 452 ? 0.3753 0.3271 0.2485 -0.0470 0.0380  0.0191  748 ARG A CA    
3764 C C     . ARG B 452 ? 0.4010 0.3598 0.2929 -0.0445 0.0331  0.0195  748 ARG A C     
3765 O O     . ARG B 452 ? 0.3121 0.2705 0.2076 -0.0484 0.0336  0.0222  748 ARG A O     
3766 C CB    . ARG B 452 ? 0.3543 0.3189 0.2341 -0.0472 0.0489  0.0148  748 ARG A CB    
3767 C CG    . ARG B 452 ? 0.6077 0.5652 0.4679 -0.0513 0.0567  0.0145  748 ARG A CG    
3768 C CD    . ARG B 452 ? 0.7515 0.7230 0.6210 -0.0518 0.0691  0.0105  748 ARG A CD    
3769 N NE    . ARG B 452 ? 0.8685 0.8496 0.7509 -0.0446 0.0695  0.0052  748 ARG A NE    
3770 C CZ    . ARG B 452 ? 0.8907 0.8682 0.7639 -0.0417 0.0732  0.0010  748 ARG A CZ    
3771 N NH1   . ARG B 452 ? 0.8324 0.7970 0.6822 -0.0457 0.0768  0.0013  748 ARG A NH1   
3772 N NH2   . ARG B 452 ? 0.8826 0.8680 0.7688 -0.0350 0.0732  -0.0034 748 ARG A NH2   
3773 N N     . TYR B 453 ? 0.3131 0.2778 0.2166 -0.0384 0.0289  0.0164  749 TYR A N     
3774 C CA    . TYR B 453 ? 0.2863 0.2561 0.2052 -0.0361 0.0245  0.0166  749 TYR A CA    
3775 C C     . TYR B 453 ? 0.3033 0.2610 0.2173 -0.0370 0.0171  0.0208  749 TYR A C     
3776 O O     . TYR B 453 ? 0.2825 0.2408 0.2040 -0.0384 0.0162  0.0221  749 TYR A O     
3777 C CB    . TYR B 453 ? 0.2373 0.2138 0.1673 -0.0296 0.0216  0.0131  749 TYR A CB    
3778 C CG    . TYR B 453 ? 0.2370 0.2130 0.1770 -0.0271 0.0154  0.0140  749 TYR A CG    
3779 C CD1   . TYR B 453 ? 0.2339 0.2177 0.1856 -0.0279 0.0169  0.0136  749 TYR A CD1   
3780 C CD2   . TYR B 453 ? 0.2299 0.1974 0.1675 -0.0244 0.0080  0.0151  749 TYR A CD2   
3781 C CE1   . TYR B 453 ? 0.3144 0.2966 0.2735 -0.0260 0.0123  0.0140  749 TYR A CE1   
3782 C CE2   . TYR B 453 ? 0.2770 0.2443 0.2247 -0.0221 0.0036  0.0157  749 TYR A CE2   
3783 C CZ    . TYR B 453 ? 0.2777 0.2517 0.2352 -0.0228 0.0062  0.0150  749 TYR A CZ    
3784 O OH    . TYR B 453 ? 0.3216 0.2943 0.2874 -0.0207 0.0029  0.0150  749 TYR A OH    
3785 N N     . MET B 454 ? 0.2511 0.1975 0.1529 -0.0360 0.0115  0.0227  750 MET A N     
3786 C CA    . MET B 454 ? 0.2968 0.2317 0.1951 -0.0360 0.0038  0.0271  750 MET A CA    
3787 C C     . MET B 454 ? 0.3933 0.3210 0.2840 -0.0419 0.0067  0.0312  750 MET A C     
3788 O O     . MET B 454 ? 0.4007 0.3251 0.2979 -0.0422 0.0043  0.0332  750 MET A O     
3789 C CB    . MET B 454 ? 0.3926 0.3170 0.2782 -0.0344 -0.0034 0.0288  750 MET A CB    
3790 C CG    . MET B 454 ? 0.6397 0.5688 0.5327 -0.0291 -0.0079 0.0252  750 MET A CG    
3791 S SD    . MET B 454 ? 0.8507 0.7888 0.7670 -0.0239 -0.0106 0.0231  750 MET A SD    
3792 C CE    . MET B 454 ? 0.9114 0.8459 0.8295 -0.0197 -0.0203 0.0226  750 MET A CE    
3793 N N     . GLU B 455 ? 0.3041 0.2288 0.1808 -0.0469 0.0127  0.0323  751 GLU A N     
3794 C CA    . GLU B 455 ? 0.3034 0.2209 0.1722 -0.0535 0.0165  0.0364  751 GLU A CA    
3795 C C     . GLU B 455 ? 0.3610 0.2890 0.2454 -0.0559 0.0216  0.0345  751 GLU A C     
3796 O O     . GLU B 455 ? 0.3506 0.2718 0.2356 -0.0592 0.0205  0.0375  751 GLU A O     
3797 C CB    . GLU B 455 ? 0.3379 0.2519 0.1893 -0.0587 0.0237  0.0373  751 GLU A CB    
3798 C CG    . GLU B 455 ? 0.4724 0.3738 0.3043 -0.0575 0.0184  0.0393  751 GLU A CG    
3799 C CD    . GLU B 455 ? 0.6200 0.5205 0.4355 -0.0616 0.0271  0.0379  751 GLU A CD    
3800 O OE1   . GLU B 455 ? 0.6714 0.5591 0.4663 -0.0624 0.0233  0.0401  751 GLU A OE1   
3801 O OE2   . GLU B 455 ? 0.6082 0.5207 0.4314 -0.0638 0.0375  0.0344  751 GLU A OE2   
3802 N N     . ASN B 456 ? 0.2772 0.2212 0.1741 -0.0545 0.0267  0.0297  752 ASN A N     
3803 C CA    . ASN B 456 ? 0.2946 0.2498 0.2056 -0.0575 0.0310  0.0279  752 ASN A CA    
3804 C C     . ASN B 456 ? 0.2912 0.2457 0.2132 -0.0546 0.0250  0.0274  752 ASN A C     
3805 O O     . ASN B 456 ? 0.2865 0.2408 0.2134 -0.0589 0.0261  0.0279  752 ASN A O     
3806 C CB    . ASN B 456 ? 0.3857 0.3584 0.3082 -0.0555 0.0367  0.0232  752 ASN A CB    
3807 C CG    . ASN B 456 ? 0.4116 0.3870 0.3261 -0.0595 0.0455  0.0229  752 ASN A CG    
3808 O OD1   . ASN B 456 ? 0.4176 0.3828 0.3183 -0.0652 0.0482  0.0265  752 ASN A OD1   
3809 N ND2   . ASN B 456 ? 0.4327 0.4211 0.3553 -0.0563 0.0503  0.0189  752 ASN A ND2   
3810 N N     . ILE B 457 ? 0.2645 0.2186 0.1908 -0.0478 0.0191  0.0260  753 ILE A N     
3811 C CA    . ILE B 457 ? 0.2646 0.2186 0.2015 -0.0450 0.0147  0.0250  753 ILE A CA    
3812 C C     . ILE B 457 ? 0.2917 0.2302 0.2222 -0.0468 0.0108  0.0289  753 ILE A C     
3813 O O     . ILE B 457 ? 0.2827 0.2192 0.2196 -0.0478 0.0102  0.0284  753 ILE A O     
3814 C CB    . ILE B 457 ? 0.2181 0.1761 0.1619 -0.0377 0.0104  0.0225  753 ILE A CB    
3815 C CG1   . ILE B 457 ? 0.2170 0.1783 0.1729 -0.0353 0.0085  0.0204  753 ILE A CG1   
3816 C CG2   . ILE B 457 ? 0.2305 0.1772 0.1663 -0.0346 0.0043  0.0252  753 ILE A CG2   
3817 C CD1   . ILE B 457 ? 0.2941 0.2685 0.2589 -0.0371 0.0127  0.0173  753 ILE A CD1   
3818 N N     . VAL B 458 ? 0.2676 0.1941 0.1846 -0.0473 0.0082  0.0331  754 VAL A N     
3819 C CA    . VAL B 458 ? 0.2703 0.1812 0.1814 -0.0487 0.0043  0.0376  754 VAL A CA    
3820 C C     . VAL B 458 ? 0.3181 0.2256 0.2259 -0.0565 0.0098  0.0390  754 VAL A C     
3821 O O     . VAL B 458 ? 0.2938 0.1936 0.2048 -0.0577 0.0085  0.0399  754 VAL A O     
3822 C CB    . VAL B 458 ? 0.3393 0.2379 0.2358 -0.0473 -0.0010 0.0423  754 VAL A CB    
3823 C CG1   . VAL B 458 ? 0.3647 0.2458 0.2519 -0.0502 -0.0038 0.0482  754 VAL A CG1   
3824 C CG2   . VAL B 458 ? 0.2901 0.1907 0.1935 -0.0397 -0.0083 0.0409  754 VAL A CG2   
3825 N N     . GLN B 459 ? 0.3372 0.2507 0.2396 -0.0620 0.0166  0.0388  755 GLN A N     
3826 C CA    . GLN B 459 ? 0.3680 0.2805 0.2694 -0.0703 0.0225  0.0398  755 GLN A CA    
3827 C C     . GLN B 459 ? 0.3921 0.3148 0.3093 -0.0712 0.0235  0.0354  755 GLN A C     
3828 O O     . GLN B 459 ? 0.2956 0.2117 0.2135 -0.0764 0.0244  0.0362  755 GLN A O     
3829 C CB    . GLN B 459 ? 0.4896 0.4095 0.3850 -0.0756 0.0305  0.0398  755 GLN A CB    
3830 C CG    . GLN B 459 ? 0.7510 0.6603 0.6347 -0.0846 0.0354  0.0443  755 GLN A CG    
3831 C CD    . GLN B 459 ? 0.8691 0.7562 0.7379 -0.0843 0.0295  0.0505  755 GLN A CD    
3832 O OE1   . GLN B 459 ? 0.9225 0.8022 0.7824 -0.0788 0.0236  0.0526  755 GLN A OE1   
3833 N NE2   . GLN B 459 ? 0.8344 0.7103 0.7006 -0.0903 0.0305  0.0535  755 GLN A NE2   
3834 N N     . GLU B 460 ? 0.3210 0.2587 0.2498 -0.0665 0.0233  0.0308  756 GLU A N     
3835 C CA    . GLU B 460 ? 0.3399 0.2868 0.2818 -0.0672 0.0234  0.0268  756 GLU A CA    
3836 C C     . GLU B 460 ? 0.2952 0.2306 0.2386 -0.0645 0.0184  0.0267  756 GLU A C     
3837 O O     . GLU B 460 ? 0.3068 0.2407 0.2542 -0.0686 0.0190  0.0249  756 GLU A O     
3838 C CB    . GLU B 460 ? 0.3837 0.3474 0.3362 -0.0620 0.0235  0.0227  756 GLU A CB    
3839 C CG    . GLU B 460 ? 0.5952 0.5688 0.5596 -0.0628 0.0230  0.0189  756 GLU A CG    
3840 C CD    . GLU B 460 ? 0.8823 0.8723 0.8564 -0.0581 0.0234  0.0158  756 GLU A CD    
3841 O OE1   . GLU B 460 ? 0.9393 0.9320 0.9112 -0.0538 0.0242  0.0161  756 GLU A OE1   
3842 O OE2   . GLU B 460 ? 0.9440 0.9433 0.9271 -0.0588 0.0226  0.0130  756 GLU A OE2   
3843 N N     . ALA B 461 ? 0.2859 0.2133 0.2266 -0.0578 0.0134  0.0282  757 ALA A N     
3844 C CA    . ALA B 461 ? 0.3296 0.2460 0.2730 -0.0545 0.0094  0.0281  757 ALA A CA    
3845 C C     . ALA B 461 ? 0.3260 0.2265 0.2619 -0.0599 0.0099  0.0315  757 ALA A C     
3846 O O     . ALA B 461 ? 0.2734 0.1674 0.2130 -0.0608 0.0097  0.0296  757 ALA A O     
3847 C CB    . ALA B 461 ? 0.2947 0.2062 0.2379 -0.0466 0.0039  0.0298  757 ALA A CB    
3848 N N     . LYS B 462 ? 0.3353 0.2281 0.2595 -0.0636 0.0108  0.0364  758 LYS A N     
3849 C CA    . LYS B 462 ? 0.3905 0.2668 0.3062 -0.0694 0.0117  0.0403  758 LYS A CA    
3850 C C     . LYS B 462 ? 0.3030 0.1840 0.2225 -0.0780 0.0171  0.0374  758 LYS A C     
3851 O O     . LYS B 462 ? 0.5105 0.3800 0.4297 -0.0813 0.0171  0.0372  758 LYS A O     
3852 C CB    . LYS B 462 ? 0.3776 0.2449 0.2780 -0.0721 0.0120  0.0465  758 LYS A CB    
3853 C CG    . LYS B 462 ? 0.6073 0.4643 0.5015 -0.0647 0.0046  0.0506  758 LYS A CG    
3854 C CD    . LYS B 462 ? 0.8045 0.6499 0.6801 -0.0684 0.0044  0.0572  758 LYS A CD    
3855 C CE    . LYS B 462 ? 0.8754 0.7189 0.7449 -0.0617 -0.0026 0.0597  758 LYS A CE    
3856 N NZ    . LYS B 462 ? 0.8369 0.6695 0.7103 -0.0542 -0.0117 0.0623  758 LYS A NZ    
3857 N N     . GLN B 463 ? 0.3651 0.2631 0.2890 -0.0817 0.0216  0.0349  759 GLN A N     
3858 C CA    . GLN B 463 ? 0.3656 0.2704 0.2947 -0.0905 0.0262  0.0323  759 GLN A CA    
3859 C C     . GLN B 463 ? 0.3820 0.2909 0.3213 -0.0893 0.0239  0.0269  759 GLN A C     
3860 O O     . GLN B 463 ? 0.3550 0.2564 0.2943 -0.0955 0.0247  0.0256  759 GLN A O     
3861 C CB    . GLN B 463 ? 0.4104 0.3342 0.3441 -0.0934 0.0312  0.0310  759 GLN A CB    
3862 C CG    . GLN B 463 ? 0.4723 0.4069 0.4147 -0.1023 0.0354  0.0283  759 GLN A CG    
3863 C CD    . GLN B 463 ? 0.4930 0.4464 0.4499 -0.0994 0.0337  0.0227  759 GLN A CD    
3864 O OE1   . GLN B 463 ? 0.4477 0.4148 0.4098 -0.0940 0.0341  0.0215  759 GLN A OE1   
3865 N NE2   . GLN B 463 ? 0.4468 0.4000 0.4091 -0.1033 0.0316  0.0194  759 GLN A NE2   
3866 N N     . LYS B 464 ? 0.2965 0.2165 0.2436 -0.0819 0.0213  0.0235  760 LYS A N     
3867 C CA    . LYS B 464 ? 0.3141 0.2396 0.2694 -0.0809 0.0197  0.0182  760 LYS A CA    
3868 C C     . LYS B 464 ? 0.3206 0.2310 0.2741 -0.0761 0.0166  0.0173  760 LYS A C     
3869 O O     . LYS B 464 ? 0.3221 0.2315 0.2788 -0.0775 0.0162  0.0129  760 LYS A O     
3870 C CB    . LYS B 464 ? 0.3029 0.2461 0.2664 -0.0752 0.0188  0.0154  760 LYS A CB    
3871 C CG    . LYS B 464 ? 0.4849 0.4464 0.4546 -0.0791 0.0218  0.0145  760 LYS A CG    
3872 C CD    . LYS B 464 ? 0.5843 0.5605 0.5634 -0.0752 0.0197  0.0105  760 LYS A CD    
3873 C CE    . LYS B 464 ? 0.6789 0.6729 0.6669 -0.0805 0.0217  0.0090  760 LYS A CE    
3874 N NZ    . LYS B 464 ? 0.7410 0.7399 0.7340 -0.0834 0.0185  0.0050  760 LYS A NZ    
3875 N N     . GLY B 465 ? 0.3060 0.2056 0.2552 -0.0700 0.0142  0.0209  761 GLY A N     
3876 C CA    . GLY B 465 ? 0.3046 0.1927 0.2555 -0.0637 0.0115  0.0199  761 GLY A CA    
3877 C C     . GLY B 465 ? 0.2556 0.1532 0.2141 -0.0553 0.0095  0.0174  761 GLY A C     
3878 O O     . GLY B 465 ? 0.2572 0.1464 0.2186 -0.0492 0.0076  0.0170  761 GLY A O     
3879 N N     . TYR B 466 ? 0.2416 0.1561 0.2042 -0.0545 0.0101  0.0158  762 TYR A N     
3880 C CA    . TYR B 466 ? 0.3182 0.2411 0.2877 -0.0473 0.0087  0.0133  762 TYR A CA    
3881 C C     . TYR B 466 ? 0.2847 0.2220 0.2558 -0.0460 0.0089  0.0141  762 TYR A C     
3882 O O     . TYR B 466 ? 0.2260 0.1686 0.1941 -0.0509 0.0110  0.0155  762 TYR A O     
3883 C CB    . TYR B 466 ? 0.2235 0.1503 0.1973 -0.0479 0.0100  0.0080  762 TYR A CB    
3884 C CG    . TYR B 466 ? 0.2210 0.1590 0.1951 -0.0546 0.0115  0.0060  762 TYR A CG    
3885 C CD1   . TYR B 466 ? 0.2181 0.1722 0.1970 -0.0531 0.0114  0.0051  762 TYR A CD1   
3886 C CD2   . TYR B 466 ? 0.2957 0.2281 0.2662 -0.0627 0.0128  0.0052  762 TYR A CD2   
3887 C CE1   . TYR B 466 ? 0.2214 0.1872 0.2028 -0.0587 0.0121  0.0036  762 TYR A CE1   
3888 C CE2   . TYR B 466 ? 0.2977 0.2422 0.2706 -0.0692 0.0136  0.0035  762 TYR A CE2   
3889 C CZ    . TYR B 466 ? 0.2904 0.2521 0.2693 -0.0668 0.0130  0.0027  762 TYR A CZ    
3890 O OH    . TYR B 466 ? 0.2469 0.2222 0.2305 -0.0726 0.0131  0.0013  762 TYR A OH    
3891 N N     . VAL B 467 ? 0.2338 0.1772 0.2102 -0.0395 0.0074  0.0128  763 VAL A N     
3892 C CA    . VAL B 467 ? 0.2338 0.1905 0.2126 -0.0377 0.0079  0.0125  763 VAL A CA    
3893 C C     . VAL B 467 ? 0.2676 0.2331 0.2531 -0.0349 0.0082  0.0089  763 VAL A C     
3894 O O     . VAL B 467 ? 0.1860 0.1465 0.1736 -0.0332 0.0079  0.0068  763 VAL A O     
3895 C CB    . VAL B 467 ? 0.2050 0.1594 0.1817 -0.0330 0.0054  0.0152  763 VAL A CB    
3896 C CG1   . VAL B 467 ? 0.2109 0.1564 0.1783 -0.0363 0.0050  0.0192  763 VAL A CG1   
3897 C CG2   . VAL B 467 ? 0.2345 0.1828 0.2159 -0.0271 0.0022  0.0149  763 VAL A CG2   
3898 N N     . THR B 468 ? 0.2580 0.2361 0.2465 -0.0343 0.0091  0.0082  764 THR A N     
3899 C CA    . THR B 468 ? 0.2236 0.2103 0.2172 -0.0321 0.0091  0.0055  764 THR A CA    
3900 C C     . THR B 468 ? 0.3179 0.3111 0.3148 -0.0265 0.0086  0.0058  764 THR A C     
3901 O O     . THR B 468 ? 0.2585 0.2523 0.2535 -0.0256 0.0088  0.0075  764 THR A O     
3902 C CB    . THR B 468 ? 0.2913 0.2880 0.2869 -0.0370 0.0100  0.0042  764 THR A CB    
3903 O OG1   . THR B 468 ? 0.4192 0.4250 0.4166 -0.0378 0.0115  0.0056  764 THR A OG1   
3904 C CG2   . THR B 468 ? 0.2496 0.2395 0.2416 -0.0437 0.0104  0.0036  764 THR A CG2   
3905 N N     . THR B 469 ? 0.2380 0.2347 0.2385 -0.0232 0.0082  0.0041  765 THR A N     
3906 C CA    . THR B 469 ? 0.2107 0.2133 0.2146 -0.0185 0.0081  0.0042  765 THR A CA    
3907 C C     . THR B 469 ? 0.2589 0.2729 0.2657 -0.0190 0.0085  0.0036  765 THR A C     
3908 O O     . THR B 469 ? 0.2467 0.2648 0.2536 -0.0232 0.0085  0.0030  765 THR A O     
3909 C CB    . THR B 469 ? 0.2230 0.2214 0.2292 -0.0146 0.0077  0.0032  765 THR A CB    
3910 O OG1   . THR B 469 ? 0.2609 0.2603 0.2662 -0.0162 0.0084  0.0014  765 THR A OG1   
3911 C CG2   . THR B 469 ? 0.2013 0.1896 0.2074 -0.0137 0.0069  0.0037  765 THR A CG2   
3912 N N     . LEU B 470 ? 0.2185 0.2376 0.2284 -0.0146 0.0086  0.0038  766 LEU A N     
3913 C CA    . LEU B 470 ? 0.2516 0.2816 0.2655 -0.0139 0.0087  0.0038  766 LEU A CA    
3914 C C     . LEU B 470 ? 0.2227 0.2554 0.2367 -0.0154 0.0069  0.0031  766 LEU A C     
3915 O O     . LEU B 470 ? 0.2522 0.2944 0.2696 -0.0171 0.0058  0.0033  766 LEU A O     
3916 C CB    . LEU B 470 ? 0.4149 0.4469 0.4315 -0.0083 0.0091  0.0042  766 LEU A CB    
3917 C CG    . LEU B 470 ? 0.4509 0.4830 0.4667 -0.0074 0.0110  0.0043  766 LEU A CG    
3918 C CD1   . LEU B 470 ? 0.4399 0.4728 0.4579 -0.0022 0.0115  0.0040  766 LEU A CD1   
3919 C CD2   . LEU B 470 ? 0.5165 0.5568 0.5344 -0.0107 0.0132  0.0044  766 LEU A CD2   
3920 N N     . LEU B 471 ? 0.1851 0.2099 0.1954 -0.0150 0.0066  0.0023  767 LEU A N     
3921 C CA    . LEU B 471 ? 0.3223 0.3476 0.3296 -0.0169 0.0052  0.0013  767 LEU A CA    
3922 C C     . LEU B 471 ? 0.3906 0.4101 0.3934 -0.0225 0.0052  -0.0006 767 LEU A C     
3923 O O     . LEU B 471 ? 0.3576 0.3737 0.3553 -0.0243 0.0046  -0.0022 767 LEU A O     
3924 C CB    . LEU B 471 ? 0.3297 0.3497 0.3346 -0.0131 0.0060  0.0012  767 LEU A CB    
3925 C CG    . LEU B 471 ? 0.3949 0.4194 0.4031 -0.0081 0.0057  0.0031  767 LEU A CG    
3926 C CD1   . LEU B 471 ? 0.4084 0.4283 0.4125 -0.0062 0.0063  0.0034  767 LEU A CD1   
3927 C CD2   . LEU B 471 ? 0.3651 0.4010 0.3778 -0.0077 0.0034  0.0044  767 LEU A CD2   
3928 N N     . HIS B 472 ? 0.2515 0.2685 0.2548 -0.0254 0.0061  -0.0004 768 HIS A N     
3929 C CA    . HIS B 472 ? 0.2569 0.2684 0.2564 -0.0314 0.0061  -0.0019 768 HIS A CA    
3930 C C     . HIS B 472 ? 0.1786 0.1765 0.1736 -0.0309 0.0077  -0.0035 768 HIS A C     
3931 O O     . HIS B 472 ? 0.2162 0.2076 0.2069 -0.0355 0.0079  -0.0056 768 HIS A O     
3932 C CB    . HIS B 472 ? 0.2599 0.2777 0.2582 -0.0361 0.0037  -0.0034 768 HIS A CB    
3933 C CG    . HIS B 472 ? 0.3876 0.4201 0.3929 -0.0367 0.0020  -0.0019 768 HIS A CG    
3934 N ND1   . HIS B 472 ? 0.4060 0.4476 0.4131 -0.0402 -0.0016 -0.0026 768 HIS A ND1   
3935 C CD2   . HIS B 472 ? 0.3965 0.4363 0.4082 -0.0341 0.0034  0.0001  768 HIS A CD2   
3936 C CE1   . HIS B 472 ? 0.4711 0.5260 0.4873 -0.0393 -0.0021 -0.0008 768 HIS A CE1   
3937 N NE2   . HIS B 472 ? 0.4213 0.4749 0.4398 -0.0356 0.0015  0.0006  768 HIS A NE2   
3938 N N     . ARG B 473 ? 0.1835 0.1770 0.1804 -0.0257 0.0089  -0.0028 769 ARG A N     
3939 C CA    . ARG B 473 ? 0.2515 0.2332 0.2474 -0.0246 0.0106  -0.0038 769 ARG A CA    
3940 C C     . ARG B 473 ? 0.3004 0.2768 0.2957 -0.0271 0.0100  -0.0022 769 ARG A C     
3941 O O     . ARG B 473 ? 0.2445 0.2259 0.2409 -0.0275 0.0090  0.0002  769 ARG A O     
3942 C CB    . ARG B 473 ? 0.2735 0.2537 0.2740 -0.0186 0.0115  -0.0031 769 ARG A CB    
3943 C CG    . ARG B 473 ? 0.4224 0.3927 0.4242 -0.0167 0.0139  -0.0048 769 ARG A CG    
3944 C CD    . ARG B 473 ? 0.4300 0.4014 0.4388 -0.0113 0.0144  -0.0038 769 ARG A CD    
3945 N NE    . ARG B 473 ? 0.3576 0.3363 0.3662 -0.0100 0.0150  -0.0037 769 ARG A NE    
3946 C CZ    . ARG B 473 ? 0.4248 0.4021 0.4305 -0.0099 0.0180  -0.0057 769 ARG A CZ    
3947 N NH1   . ARG B 473 ? 0.3696 0.3390 0.3727 -0.0110 0.0212  -0.0084 769 ARG A NH1   
3948 N NH2   . ARG B 473 ? 0.4081 0.3909 0.4127 -0.0086 0.0181  -0.0048 769 ARG A NH2   
3949 N N     . ARG B 474 ? 0.1835 0.1487 0.1763 -0.0287 0.0110  -0.0034 770 ARG A N     
3950 C CA    . ARG B 474 ? 0.1881 0.1467 0.1792 -0.0311 0.0103  -0.0011 770 ARG A CA    
3951 C C     . ARG B 474 ? 0.2248 0.1716 0.2179 -0.0271 0.0104  -0.0004 770 ARG A C     
3952 O O     . ARG B 474 ? 0.2235 0.1663 0.2195 -0.0237 0.0122  -0.0027 770 ARG A O     
3953 C CB    . ARG B 474 ? 0.2505 0.2066 0.2368 -0.0386 0.0107  -0.0022 770 ARG A CB    
3954 C CG    . ARG B 474 ? 0.4719 0.4189 0.4542 -0.0414 0.0121  -0.0060 770 ARG A CG    
3955 C CD    . ARG B 474 ? 0.4696 0.4134 0.4474 -0.0497 0.0119  -0.0064 770 ARG A CD    
3956 N NE    . ARG B 474 ? 0.3477 0.3056 0.3268 -0.0546 0.0105  -0.0067 770 ARG A NE    
3957 C CZ    . ARG B 474 ? 0.3093 0.2680 0.2867 -0.0626 0.0101  -0.0074 770 ARG A CZ    
3958 N NH1   . ARG B 474 ? 0.3037 0.2482 0.2764 -0.0669 0.0113  -0.0079 770 ARG A NH1   
3959 N NH2   . ARG B 474 ? 0.2790 0.2522 0.2601 -0.0664 0.0085  -0.0075 770 ARG A NH2   
3960 N N     . ARG B 475 ? 0.2132 0.1551 0.2051 -0.0272 0.0085  0.0031  771 ARG A N     
3961 C CA    . ARG B 475 ? 0.2153 0.1458 0.2095 -0.0235 0.0072  0.0049  771 ARG A CA    
3962 C C     . ARG B 475 ? 0.2457 0.1663 0.2333 -0.0280 0.0064  0.0075  771 ARG A C     
3963 O O     . ARG B 475 ? 0.2129 0.1366 0.1959 -0.0310 0.0053  0.0106  771 ARG A O     
3964 C CB    . ARG B 475 ? 0.2086 0.1428 0.2076 -0.0181 0.0041  0.0077  771 ARG A CB    
3965 C CG    . ARG B 475 ? 0.2667 0.1902 0.2692 -0.0141 0.0013  0.0102  771 ARG A CG    
3966 C CD    . ARG B 475 ? 0.3113 0.2395 0.3194 -0.0092 -0.0027 0.0124  771 ARG A CD    
3967 N NE    . ARG B 475 ? 0.2806 0.2003 0.2955 -0.0045 -0.0057 0.0143  771 ARG A NE    
3968 C CZ    . ARG B 475 ? 0.3025 0.2255 0.3262 0.0004  -0.0095 0.0156  771 ARG A CZ    
3969 N NH1   . ARG B 475 ? 0.2064 0.1396 0.2316 0.0009  -0.0102 0.0148  771 ARG A NH1   
3970 N NH2   . ARG B 475 ? 0.3183 0.2342 0.3500 0.0049  -0.0125 0.0174  771 ARG A NH2   
3971 N N     . TYR B 476 ? 0.2439 0.1519 0.2306 -0.0287 0.0077  0.0063  772 TYR A N     
3972 C CA    . TYR B 476 ? 0.2558 0.1515 0.2359 -0.0329 0.0071  0.0091  772 TYR A CA    
3973 C C     . TYR B 476 ? 0.2428 0.1307 0.2240 -0.0280 0.0031  0.0142  772 TYR A C     
3974 O O     . TYR B 476 ? 0.2418 0.1288 0.2310 -0.0211 0.0015  0.0141  772 TYR A O     
3975 C CB    . TYR B 476 ? 0.3108 0.1943 0.2892 -0.0354 0.0100  0.0054  772 TYR A CB    
3976 C CG    . TYR B 476 ? 0.3257 0.2159 0.3006 -0.0418 0.0125  0.0008  772 TYR A CG    
3977 C CD1   . TYR B 476 ? 0.2525 0.1435 0.2216 -0.0500 0.0127  0.0017  772 TYR A CD1   
3978 C CD2   . TYR B 476 ? 0.2992 0.1956 0.2766 -0.0400 0.0145  -0.0041 772 TYR A CD2   
3979 C CE1   . TYR B 476 ? 0.4167 0.3156 0.3842 -0.0561 0.0138  -0.0021 772 TYR A CE1   
3980 C CE2   . TYR B 476 ? 0.3068 0.2096 0.2801 -0.0461 0.0155  -0.0078 772 TYR A CE2   
3981 C CZ    . TYR B 476 ? 0.2988 0.2030 0.2679 -0.0541 0.0147  -0.0068 772 TYR A CZ    
3982 O OH    . TYR B 476 ? 0.3391 0.2505 0.3055 -0.0606 0.0145  -0.0102 772 TYR A OH    
3983 N N     . LEU B 477 ? 0.2515 0.1341 0.2247 -0.0318 0.0013  0.0189  773 LEU A N     
3984 C CA    . LEU B 477 ? 0.2943 0.1685 0.2660 -0.0278 -0.0036 0.0245  773 LEU A CA    
3985 C C     . LEU B 477 ? 0.3006 0.1578 0.2638 -0.0317 -0.0038 0.0282  773 LEU A C     
3986 O O     . LEU B 477 ? 0.3708 0.2250 0.3238 -0.0365 -0.0045 0.0325  773 LEU A O     
3987 C CB    . LEU B 477 ? 0.2882 0.1715 0.2557 -0.0278 -0.0062 0.0274  773 LEU A CB    
3988 C CG    . LEU B 477 ? 0.4015 0.2998 0.3773 -0.0235 -0.0062 0.0241  773 LEU A CG    
3989 C CD1   . LEU B 477 ? 0.3265 0.2344 0.2963 -0.0261 -0.0061 0.0252  773 LEU A CD1   
3990 C CD2   . LEU B 477 ? 0.3247 0.2213 0.3097 -0.0158 -0.0107 0.0250  773 LEU A CD2   
3991 N N     . PRO B 478 ? 0.3489 0.1938 0.3155 -0.0301 -0.0027 0.0265  774 PRO A N     
3992 C CA    . PRO B 478 ? 0.4325 0.2588 0.3911 -0.0334 -0.0032 0.0304  774 PRO A CA    
3993 C C     . PRO B 478 ? 0.4020 0.2192 0.3563 -0.0297 -0.0094 0.0381  774 PRO A C     
3994 O O     . PRO B 478 ? 0.3822 0.1861 0.3255 -0.0344 -0.0099 0.0430  774 PRO A O     
3995 C CB    . PRO B 478 ? 0.4274 0.2430 0.3927 -0.0301 -0.0006 0.0262  774 PRO A CB    
3996 C CG    . PRO B 478 ? 0.3458 0.1728 0.3235 -0.0226 -0.0006 0.0223  774 PRO A CG    
3997 C CD    . PRO B 478 ? 0.3151 0.1613 0.2925 -0.0247 -0.0005 0.0211  774 PRO A CD    
3998 N N     . ASP B 479 ? 0.3958 0.2192 0.3573 -0.0222 -0.0144 0.0397  775 ASP A N     
3999 C CA    . ASP B 479 ? 0.4230 0.2375 0.3793 -0.0189 -0.0217 0.0472  775 ASP A CA    
4000 C C     . ASP B 479 ? 0.4503 0.2685 0.3924 -0.0245 -0.0230 0.0513  775 ASP A C     
4001 O O     . ASP B 479 ? 0.4118 0.2218 0.3460 -0.0229 -0.0293 0.0578  775 ASP A O     
4002 C CB    . ASP B 479 ? 0.4690 0.2896 0.4390 -0.0094 -0.0274 0.0474  775 ASP A CB    
4003 C CG    . ASP B 479 ? 0.6800 0.4964 0.6652 -0.0030 -0.0255 0.0437  775 ASP A CG    
4004 O OD1   . ASP B 479 ? 0.7561 0.5820 0.7559 0.0038  -0.0275 0.0417  775 ASP A OD1   
4005 O OD2   . ASP B 479 ? 0.8012 0.6049 0.7841 -0.0051 -0.0215 0.0425  775 ASP A OD2   
4006 N N     . ILE B 480 ? 0.3723 0.2023 0.3105 -0.0309 -0.0172 0.0476  776 ILE A N     
4007 C CA    . ILE B 480 ? 0.3784 0.2126 0.3040 -0.0358 -0.0171 0.0507  776 ILE A CA    
4008 C C     . ILE B 480 ? 0.4594 0.2769 0.3690 -0.0417 -0.0172 0.0573  776 ILE A C     
4009 O O     . ILE B 480 ? 0.5166 0.3333 0.4134 -0.0446 -0.0183 0.0613  776 ILE A O     
4010 C CB    . ILE B 480 ? 0.3843 0.2353 0.3119 -0.0408 -0.0104 0.0452  776 ILE A CB    
4011 C CG1   . ILE B 480 ? 0.4712 0.3313 0.3913 -0.0420 -0.0106 0.0465  776 ILE A CG1   
4012 C CG2   . ILE B 480 ? 0.4482 0.2951 0.3708 -0.0495 -0.0043 0.0445  776 ILE A CG2   
4013 C CD1   . ILE B 480 ? 0.5432 0.4153 0.4721 -0.0355 -0.0138 0.0436  776 ILE A CD1   
4014 N N     . THR B 481 ? 0.5394 0.3425 0.4483 -0.0438 -0.0157 0.0584  777 THR A N     
4015 C CA    . THR B 481 ? 0.7005 0.4854 0.5939 -0.0493 -0.0160 0.0653  777 THR A CA    
4016 C C     . THR B 481 ? 0.6909 0.4571 0.5828 -0.0429 -0.0235 0.0716  777 THR A C     
4017 O O     . THR B 481 ? 0.6336 0.3818 0.5121 -0.0469 -0.0244 0.0781  777 THR A O     
4018 C CB    . THR B 481 ? 0.7543 0.5338 0.6455 -0.0581 -0.0086 0.0630  777 THR A CB    
4019 O OG1   . THR B 481 ? 0.8506 0.6302 0.7551 -0.0549 -0.0072 0.0571  777 THR A OG1   
4020 C CG2   . THR B 481 ? 0.8564 0.6522 0.7454 -0.0662 -0.0018 0.0596  777 THR A CG2   
4021 N N     . SER B 482 ? 0.5945 0.3644 0.5002 -0.0332 -0.0290 0.0700  778 SER A N     
4022 C CA    . SER B 482 ? 0.6810 0.4348 0.5891 -0.0260 -0.0366 0.0757  778 SER A CA    
4023 C C     . SER B 482 ? 0.6515 0.3935 0.5421 -0.0271 -0.0436 0.0851  778 SER A C     
4024 O O     . SER B 482 ? 0.6206 0.3708 0.5006 -0.0305 -0.0443 0.0864  778 SER A O     
4025 C CB    . SER B 482 ? 0.6951 0.4594 0.6224 -0.0156 -0.0413 0.0724  778 SER A CB    
4026 O OG    . SER B 482 ? 0.6212 0.3729 0.5517 -0.0081 -0.0503 0.0789  778 SER A OG    
4027 N N     . ARG B 483 ? 0.5929 0.3145 0.4796 -0.0241 -0.0488 0.0919  779 ARG A N     
4028 C CA    . ARG B 483 ? 0.6044 0.3127 0.4731 -0.0248 -0.0566 0.1017  779 ARG A CA    
4029 C C     . ARG B 483 ? 0.6867 0.3989 0.5628 -0.0151 -0.0685 0.1050  779 ARG A C     
4030 O O     . ARG B 483 ? 0.6990 0.4079 0.5613 -0.0154 -0.0748 0.1109  779 ARG A O     
4031 C CB    . ARG B 483 ? 0.6788 0.3676 0.5403 -0.0262 -0.0556 0.1069  779 ARG A CB    
4032 C CG    . ARG B 483 ? 0.7658 0.4489 0.6068 -0.0377 -0.0486 0.1093  779 ARG A CG    
4033 C CD    . ARG B 483 ? 0.8610 0.5503 0.7043 -0.0463 -0.0379 0.1025  779 ARG A CD    
4034 N NE    . ARG B 483 ? 0.8325 0.5122 0.6846 -0.0468 -0.0333 0.0995  779 ARG A NE    
4035 C CZ    . ARG B 483 ? 0.8097 0.4942 0.6705 -0.0507 -0.0263 0.0920  779 ARG A CZ    
4036 N NH1   . ARG B 483 ? 0.6411 0.3487 0.5086 -0.0528 -0.0221 0.0850  779 ARG A NH1   
4037 N NH2   . ARG B 483 ? 0.8366 0.5107 0.7037 -0.0510 -0.0226 0.0893  779 ARG A NH2   
4038 N N     . ASN B 484 ? 0.5861 0.3102 0.4855 -0.0068 -0.0702 0.0996  780 ASN A N     
4039 C CA    . ASN B 484 ? 0.6246 0.3564 0.5341 0.0016  -0.0811 0.1016  780 ASN A CA    
4040 C C     . ASN B 484 ? 0.5896 0.3402 0.4952 -0.0017 -0.0805 0.0976  780 ASN A C     
4041 O O     . ASN B 484 ? 0.5582 0.3244 0.4719 -0.0041 -0.0720 0.0894  780 ASN A O     
4042 C CB    . ASN B 484 ? 0.7475 0.4857 0.6846 0.0113  -0.0818 0.0971  780 ASN A CB    
4043 C CG    . ASN B 484 ? 0.8085 0.5579 0.7595 0.0195  -0.0926 0.0985  780 ASN A CG    
4044 O OD1   . ASN B 484 ? 0.8134 0.5807 0.7714 0.0194  -0.0923 0.0935  780 ASN A OD1   
4045 N ND2   . ASN B 484 ? 0.7871 0.5318 0.7432 0.0259  -0.0997 0.1032  780 ASN A ND2   
4046 N N     . PHE B 485 ? 0.5747 0.3230 0.4673 -0.0017 -0.0899 0.1033  781 PHE A N     
4047 C CA    . PHE B 485 ? 0.6281 0.3905 0.5123 -0.0059 -0.0888 0.0999  781 PHE A CA    
4048 C C     . PHE B 485 ? 0.5739 0.3574 0.4806 -0.0011 -0.0880 0.0919  781 PHE A C     
4049 O O     . PHE B 485 ? 0.5495 0.3466 0.4554 -0.0051 -0.0808 0.0856  781 PHE A O     
4050 C CB    . PHE B 485 ? 0.5135 0.2675 0.3789 -0.0064 -0.1002 0.1075  781 PHE A CB    
4051 C CG    . PHE B 485 ? 0.5709 0.3382 0.4286 -0.0096 -0.1002 0.1035  781 PHE A CG    
4052 C CD1   . PHE B 485 ? 0.5965 0.3772 0.4691 -0.0040 -0.1078 0.1004  781 PHE A CD1   
4053 C CD2   . PHE B 485 ? 0.6553 0.4219 0.4918 -0.0184 -0.0920 0.1024  781 PHE A CD2   
4054 C CE1   . PHE B 485 ? 0.6804 0.4719 0.5455 -0.0072 -0.1076 0.0963  781 PHE A CE1   
4055 C CE2   . PHE B 485 ? 0.7022 0.4801 0.5316 -0.0210 -0.0913 0.0982  781 PHE A CE2   
4056 C CZ    . PHE B 485 ? 0.7463 0.5360 0.5894 -0.0154 -0.0992 0.0950  781 PHE A CZ    
4057 N N     . ASN B 486 ? 0.5120 0.2982 0.4391 0.0077  -0.0953 0.0923  782 ASN A N     
4058 C CA    . ASN B 486 ? 0.5556 0.3613 0.5041 0.0120  -0.0947 0.0853  782 ASN A CA    
4059 C C     . ASN B 486 ? 0.4788 0.2932 0.4390 0.0108  -0.0819 0.0772  782 ASN A C     
4060 O O     . ASN B 486 ? 0.4946 0.3246 0.4608 0.0094  -0.0769 0.0708  782 ASN A O     
4061 C CB    . ASN B 486 ? 0.6597 0.4666 0.6290 0.0215  -0.1050 0.0879  782 ASN A CB    
4062 C CG    . ASN B 486 ? 0.8512 0.6547 0.8116 0.0228  -0.1195 0.0946  782 ASN A CG    
4063 O OD1   . ASN B 486 ? 0.8823 0.6861 0.8226 0.0168  -0.1212 0.0954  782 ASN A OD1   
4064 N ND2   . ASN B 486 ? 0.8278 0.6303 0.8035 0.0303  -0.1285 0.0982  782 ASN A ND2   
4065 N N     . VAL B 487 ? 0.4789 0.2823 0.4414 0.0111  -0.0768 0.0776  783 VAL A N     
4066 C CA    . VAL B 487 ? 0.5044 0.3141 0.4751 0.0091  -0.0652 0.0701  783 VAL A CA    
4067 C C     . VAL B 487 ? 0.5018 0.3180 0.4578 0.0003  -0.0576 0.0669  783 VAL A C     
4068 O O     . VAL B 487 ? 0.3880 0.2186 0.3514 -0.0009 -0.0512 0.0601  783 VAL A O     
4069 C CB    . VAL B 487 ? 0.5638 0.3574 0.5365 0.0103  -0.0619 0.0714  783 VAL A CB    
4070 C CG1   . VAL B 487 ? 0.5788 0.3755 0.5514 0.0050  -0.0501 0.0644  783 VAL A CG1   
4071 C CG2   . VAL B 487 ? 0.5841 0.3760 0.5783 0.0204  -0.0664 0.0717  783 VAL A CG2   
4072 N N     . ARG B 488 ? 0.4643 0.2703 0.3994 -0.0059 -0.0582 0.0720  784 ARG A N     
4073 C CA    . ARG B 488 ? 0.4302 0.2424 0.3527 -0.0144 -0.0502 0.0691  784 ARG A CA    
4074 C C     . ARG B 488 ? 0.3796 0.2074 0.3016 -0.0145 -0.0510 0.0660  784 ARG A C     
4075 O O     . ARG B 488 ? 0.3856 0.2255 0.3086 -0.0183 -0.0435 0.0605  784 ARG A O     
4076 C CB    . ARG B 488 ? 0.4549 0.2516 0.3554 -0.0211 -0.0499 0.0757  784 ARG A CB    
4077 C CG    . ARG B 488 ? 0.4890 0.2924 0.3783 -0.0301 -0.0407 0.0729  784 ARG A CG    
4078 C CD    . ARG B 488 ? 0.5767 0.3645 0.4441 -0.0372 -0.0396 0.0796  784 ARG A CD    
4079 N NE    . ARG B 488 ? 0.5930 0.3730 0.4457 -0.0358 -0.0481 0.0860  784 ARG A NE    
4080 C CZ    . ARG B 488 ? 0.6855 0.4469 0.5288 -0.0339 -0.0559 0.0942  784 ARG A CZ    
4081 N NH1   . ARG B 488 ? 0.6608 0.4091 0.5090 -0.0328 -0.0556 0.0967  784 ARG A NH1   
4082 N NH2   . ARG B 488 ? 0.5649 0.3200 0.3934 -0.0330 -0.0643 0.0998  784 ARG A NH2   
4083 N N     . SER B 489 ? 0.3897 0.2172 0.3103 -0.0106 -0.0605 0.0694  785 SER A N     
4084 C CA    . SER B 489 ? 0.3679 0.2082 0.2870 -0.0110 -0.0616 0.0661  785 SER A CA    
4085 C C     . SER B 489 ? 0.4376 0.2941 0.3772 -0.0073 -0.0579 0.0589  785 SER A C     
4086 O O     . SER B 489 ? 0.3851 0.2532 0.3240 -0.0097 -0.0529 0.0541  785 SER A O     
4087 C CB    . SER B 489 ? 0.4105 0.2462 0.3243 -0.0079 -0.0738 0.0711  785 SER A CB    
4088 O OG    . SER B 489 ? 0.6001 0.4188 0.4943 -0.0108 -0.0782 0.0787  785 SER A OG    
4089 N N     . PHE B 490 ? 0.4362 0.2929 0.3939 -0.0013 -0.0599 0.0581  786 PHE A N     
4090 C CA    . PHE B 490 ? 0.4341 0.3045 0.4101 0.0019  -0.0553 0.0515  786 PHE A CA    
4091 C C     . PHE B 490 ? 0.3612 0.2371 0.3347 -0.0029 -0.0445 0.0465  786 PHE A C     
4092 O O     . PHE B 490 ? 0.3221 0.2105 0.2991 -0.0038 -0.0406 0.0418  786 PHE A O     
4093 C CB    . PHE B 490 ? 0.4300 0.2981 0.4249 0.0088  -0.0573 0.0514  786 PHE A CB    
4094 C CG    . PHE B 490 ? 0.4978 0.3793 0.5104 0.0117  -0.0520 0.0448  786 PHE A CG    
4095 C CD1   . PHE B 490 ? 0.4943 0.3877 0.5157 0.0138  -0.0554 0.0429  786 PHE A CD1   
4096 C CD2   . PHE B 490 ? 0.5299 0.4116 0.5487 0.0114  -0.0433 0.0404  786 PHE A CD2   
4097 C CE1   . PHE B 490 ? 0.5652 0.4703 0.6017 0.0159  -0.0499 0.0372  786 PHE A CE1   
4098 C CE2   . PHE B 490 ? 0.5102 0.4033 0.5427 0.0137  -0.0380 0.0345  786 PHE A CE2   
4099 C CZ    . PHE B 490 ? 0.4489 0.3537 0.4905 0.0159  -0.0410 0.0332  786 PHE A CZ    
4100 N N     . ALA B 491 ? 0.2907 0.1567 0.2577 -0.0064 -0.0403 0.0477  787 ALA A N     
4101 C CA    . ALA B 491 ? 0.2716 0.1428 0.2364 -0.0116 -0.0312 0.0432  787 ALA A CA    
4102 C C     . ALA B 491 ? 0.2675 0.1470 0.2213 -0.0169 -0.0282 0.0423  787 ALA A C     
4103 O O     . ALA B 491 ? 0.3040 0.1947 0.2615 -0.0189 -0.0223 0.0375  787 ALA A O     
4104 C CB    . ALA B 491 ? 0.2850 0.1428 0.2437 -0.0154 -0.0280 0.0450  787 ALA A CB    
4105 N N     . GLU B 492 ? 0.3503 0.2237 0.2899 -0.0191 -0.0321 0.0470  788 GLU A N     
4106 C CA    . GLU B 492 ? 0.3017 0.1823 0.2306 -0.0237 -0.0285 0.0458  788 GLU A CA    
4107 C C     . GLU B 492 ? 0.3198 0.2136 0.2569 -0.0200 -0.0295 0.0416  788 GLU A C     
4108 O O     . GLU B 492 ? 0.2903 0.1948 0.2278 -0.0222 -0.0238 0.0376  788 GLU A O     
4109 C CB    . GLU B 492 ? 0.3700 0.2393 0.2800 -0.0267 -0.0324 0.0518  788 GLU A CB    
4110 C CG    . GLU B 492 ? 0.4359 0.2943 0.3332 -0.0334 -0.0279 0.0554  788 GLU A CG    
4111 C CD    . GLU B 492 ? 0.5833 0.4275 0.4601 -0.0361 -0.0324 0.0623  788 GLU A CD    
4112 O OE1   . GLU B 492 ? 0.6067 0.4375 0.4733 -0.0404 -0.0310 0.0670  788 GLU A OE1   
4113 O OE2   . GLU B 492 ? 0.6526 0.4981 0.5222 -0.0344 -0.0374 0.0631  788 GLU A OE2   
4114 N N     . ARG B 493 ? 0.2893 0.1825 0.2336 -0.0146 -0.0370 0.0426  789 ARG A N     
4115 C CA    . ARG B 493 ? 0.3465 0.2517 0.2998 -0.0116 -0.0378 0.0384  789 ARG A CA    
4116 C C     . ARG B 493 ? 0.3258 0.2412 0.2934 -0.0101 -0.0315 0.0332  789 ARG A C     
4117 O O     . ARG B 493 ? 0.2922 0.2179 0.2631 -0.0099 -0.0285 0.0294  789 ARG A O     
4118 C CB    . ARG B 493 ? 0.3185 0.2215 0.2786 -0.0066 -0.0474 0.0406  789 ARG A CB    
4119 C CG    . ARG B 493 ? 0.4098 0.3054 0.3534 -0.0086 -0.0543 0.0446  789 ARG A CG    
4120 C CD    . ARG B 493 ? 0.4663 0.3542 0.4138 -0.0045 -0.0653 0.0495  789 ARG A CD    
4121 N NE    . ARG B 493 ? 0.5100 0.4064 0.4799 0.0011  -0.0680 0.0469  789 ARG A NE    
4122 C CZ    . ARG B 493 ? 0.5278 0.4206 0.5108 0.0061  -0.0732 0.0497  789 ARG A CZ    
4123 N NH1   . ARG B 493 ? 0.4393 0.3189 0.4145 0.0063  -0.0772 0.0555  789 ARG A NH1   
4124 N NH2   . ARG B 493 ? 0.7133 0.6154 0.7178 0.0108  -0.0741 0.0467  789 ARG A NH2   
4125 N N     . MET B 494 ? 0.2600 0.1718 0.2348 -0.0093 -0.0291 0.0329  790 MET A N     
4126 C CA    . MET B 494 ? 0.2163 0.1367 0.2018 -0.0084 -0.0231 0.0279  790 MET A CA    
4127 C C     . MET B 494 ? 0.2120 0.1382 0.1909 -0.0136 -0.0165 0.0256  790 MET A C     
4128 O O     . MET B 494 ? 0.2355 0.1717 0.2203 -0.0131 -0.0128 0.0217  790 MET A O     
4129 C CB    . MET B 494 ? 0.2617 0.1757 0.2558 -0.0061 -0.0222 0.0275  790 MET A CB    
4130 C CG    . MET B 494 ? 0.3320 0.2437 0.3380 0.0001  -0.0278 0.0289  790 MET A CG    
4131 S SD    . MET B 494 ? 0.4858 0.4113 0.5060 0.0041  -0.0280 0.0251  790 MET A SD    
4132 C CE    . MET B 494 ? 0.4826 0.4113 0.4948 0.0031  -0.0347 0.0273  790 MET A CE    
4133 N N     . ALA B 495 ? 0.2228 0.1427 0.1901 -0.0186 -0.0151 0.0282  791 ALA A N     
4134 C CA    . ALA B 495 ? 0.2197 0.1465 0.1821 -0.0238 -0.0091 0.0264  791 ALA A CA    
4135 C C     . ALA B 495 ? 0.2320 0.1690 0.1932 -0.0230 -0.0082 0.0246  791 ALA A C     
4136 O O     . ALA B 495 ? 0.2307 0.1782 0.1958 -0.0240 -0.0037 0.0214  791 ALA A O     
4137 C CB    . ALA B 495 ? 0.2555 0.1732 0.2057 -0.0297 -0.0077 0.0301  791 ALA A CB    
4138 N N     . MET B 496 ? 0.2762 0.2097 0.2320 -0.0210 -0.0128 0.0266  792 MET A N     
4139 C CA    . MET B 496 ? 0.2477 0.1890 0.2012 -0.0204 -0.0116 0.0244  792 MET A CA    
4140 C C     . MET B 496 ? 0.2227 0.1725 0.1890 -0.0158 -0.0120 0.0207  792 MET A C     
4141 O O     . MET B 496 ? 0.2748 0.2337 0.2437 -0.0155 -0.0081 0.0177  792 MET A O     
4142 C CB    . MET B 496 ? 0.2260 0.1595 0.1677 -0.0203 -0.0168 0.0272  792 MET A CB    
4143 C CG    . MET B 496 ? 0.4565 0.3791 0.3827 -0.0251 -0.0168 0.0317  792 MET A CG    
4144 S SD    . MET B 496 ? 0.5989 0.5114 0.5072 -0.0256 -0.0233 0.0351  792 MET A SD    
4145 C CE    . MET B 496 ? 0.6325 0.5354 0.5458 -0.0214 -0.0343 0.0395  792 MET A CE    
4146 N N     . ASN B 497 ? 0.2300 0.1769 0.2050 -0.0121 -0.0163 0.0212  793 ASN A N     
4147 C CA    . ASN B 497 ? 0.2101 0.1636 0.1965 -0.0081 -0.0172 0.0184  793 ASN A CA    
4148 C C     . ASN B 497 ? 0.2415 0.2016 0.2365 -0.0075 -0.0119 0.0153  793 ASN A C     
4149 O O     . ASN B 497 ? 0.2141 0.1814 0.2146 -0.0057 -0.0101 0.0128  793 ASN A O     
4150 C CB    . ASN B 497 ? 0.2504 0.1989 0.2441 -0.0046 -0.0236 0.0202  793 ASN A CB    
4151 C CG    . ASN B 497 ? 0.3787 0.3337 0.3844 -0.0011 -0.0246 0.0176  793 ASN A CG    
4152 O OD1   . ASN B 497 ? 0.3482 0.3051 0.3659 0.0014  -0.0232 0.0164  793 ASN A OD1   
4153 N ND2   . ASN B 497 ? 0.3343 0.2921 0.3365 -0.0013 -0.0265 0.0166  793 ASN A ND2   
4154 N N     . THR B 498 ? 0.2179 0.1746 0.2134 -0.0092 -0.0097 0.0156  794 THR A N     
4155 C CA    . THR B 498 ? 0.2768 0.2382 0.2791 -0.0087 -0.0056 0.0126  794 THR A CA    
4156 C C     . THR B 498 ? 0.1620 0.1329 0.1627 -0.0105 -0.0018 0.0106  794 THR A C     
4157 O O     . THR B 498 ? 0.1833 0.1596 0.1898 -0.0084 -0.0001 0.0084  794 THR A O     
4158 C CB    . THR B 498 ? 0.3222 0.2765 0.3238 -0.0107 -0.0042 0.0128  794 THR A CB    
4159 O OG1   . THR B 498 ? 0.3517 0.2983 0.3586 -0.0073 -0.0074 0.0143  794 THR A OG1   
4160 C CG2   . THR B 498 ? 0.2524 0.2109 0.2578 -0.0113 0.0001  0.0093  794 THR A CG2   
4161 N N     . PRO B 499 ? 0.1978 0.1712 0.1915 -0.0138 -0.0004 0.0114  795 PRO A N     
4162 C CA    . PRO B 499 ? 0.1922 0.1757 0.1871 -0.0142 0.0028  0.0095  795 PRO A CA    
4163 C C     . PRO B 499 ? 0.3111 0.2986 0.3091 -0.0103 0.0021  0.0084  795 PRO A C     
4164 O O     . PRO B 499 ? 0.2653 0.2603 0.2669 -0.0090 0.0043  0.0069  795 PRO A O     
4165 C CB    . PRO B 499 ? 0.1646 0.1492 0.1524 -0.0184 0.0049  0.0108  795 PRO A CB    
4166 C CG    . PRO B 499 ? 0.1890 0.1634 0.1718 -0.0217 0.0036  0.0131  795 PRO A CG    
4167 C CD    . PRO B 499 ? 0.2131 0.1800 0.1980 -0.0177 -0.0008 0.0141  795 PRO A CD    
4168 N N     . ILE B 500 ? 0.2645 0.2470 0.2613 -0.0083 -0.0013 0.0093  796 ILE A N     
4169 C CA    . ILE B 500 ? 0.2205 0.2055 0.2200 -0.0052 -0.0022 0.0080  796 ILE A CA    
4170 C C     . ILE B 500 ? 0.2187 0.2045 0.2277 -0.0024 -0.0027 0.0069  796 ILE A C     
4171 O O     . ILE B 500 ? 0.1804 0.1711 0.1933 -0.0008 -0.0003 0.0055  796 ILE A O     
4172 C CB    . ILE B 500 ? 0.2373 0.2165 0.2308 -0.0052 -0.0063 0.0090  796 ILE A CB    
4173 C CG1   . ILE B 500 ? 0.2960 0.2740 0.2781 -0.0083 -0.0043 0.0098  796 ILE A CG1   
4174 C CG2   . ILE B 500 ? 0.2506 0.2312 0.2481 -0.0024 -0.0079 0.0072  796 ILE A CG2   
4175 C CD1   . ILE B 500 ? 0.3194 0.2890 0.2919 -0.0093 -0.0090 0.0115  796 ILE A CD1   
4176 N N     . GLN B 501 ? 0.1478 0.1284 0.1608 -0.0017 -0.0054 0.0079  797 GLN A N     
4177 C CA    . GLN B 501 ? 0.2166 0.1979 0.2395 0.0009  -0.0050 0.0068  797 GLN A CA    
4178 C C     . GLN B 501 ? 0.2591 0.2432 0.2836 0.0005  -0.0003 0.0054  797 GLN A C     
4179 O O     . GLN B 501 ? 0.2333 0.2204 0.2625 0.0020  0.0020  0.0041  797 GLN A O     
4180 C CB    . GLN B 501 ? 0.2413 0.2170 0.2695 0.0021  -0.0086 0.0082  797 GLN A CB    
4181 C CG    . GLN B 501 ? 0.3114 0.2856 0.3414 0.0033  -0.0145 0.0093  797 GLN A CG    
4182 C CD    . GLN B 501 ? 0.4280 0.4067 0.4672 0.0050  -0.0143 0.0075  797 GLN A CD    
4183 O OE1   . GLN B 501 ? 0.5324 0.5147 0.5758 0.0056  -0.0093 0.0058  797 GLN A OE1   
4184 N NE2   . GLN B 501 ? 0.3747 0.3526 0.4161 0.0054  -0.0199 0.0080  797 GLN A NE2   
4185 N N     . GLY B 502 ? 0.2304 0.2131 0.2499 -0.0021 0.0011  0.0056  798 GLY A N     
4186 C CA    . GLY B 502 ? 0.1872 0.1718 0.2064 -0.0033 0.0046  0.0040  798 GLY A CA    
4187 C C     . GLY B 502 ? 0.2400 0.2320 0.2572 -0.0036 0.0062  0.0034  798 GLY A C     
4188 O O     . GLY B 502 ? 0.2392 0.2332 0.2570 -0.0033 0.0083  0.0023  798 GLY A O     
4189 N N     . SER B 503 ? 0.1718 0.1677 0.1862 -0.0040 0.0054  0.0042  799 SER A N     
4190 C CA    . SER B 503 ? 0.1323 0.1355 0.1467 -0.0032 0.0067  0.0039  799 SER A CA    
4191 C C     . SER B 503 ? 0.1290 0.1323 0.1473 0.0004  0.0070  0.0036  799 SER A C     
4192 O O     . SER B 503 ? 0.1756 0.1822 0.1946 0.0016  0.0082  0.0035  799 SER A O     
4193 C CB    . SER B 503 ? 0.1864 0.1937 0.1979 -0.0042 0.0070  0.0044  799 SER A CB    
4194 O OG    . SER B 503 ? 0.2103 0.2183 0.2188 -0.0084 0.0075  0.0048  799 SER A OG    
4195 N N     . ALA B 504 ? 0.1685 0.1677 0.1890 0.0018  0.0053  0.0036  800 ALA A N     
4196 C CA    . ALA B 504 ? 0.2204 0.2190 0.2454 0.0043  0.0056  0.0031  800 ALA A CA    
4197 C C     . ALA B 504 ? 0.2620 0.2594 0.2906 0.0046  0.0080  0.0028  800 ALA A C     
4198 O O     . ALA B 504 ? 0.2275 0.2258 0.2573 0.0059  0.0099  0.0029  800 ALA A O     
4199 C CB    . ALA B 504 ? 0.1791 0.1740 0.2064 0.0048  0.0025  0.0031  800 ALA A CB    
4200 N N     . ALA B 505 ? 0.1944 0.1888 0.2242 0.0035  0.0083  0.0025  801 ALA A N     
4201 C CA    . ALA B 505 ? 0.2248 0.2174 0.2565 0.0035  0.0118  0.0015  801 ALA A CA    
4202 C C     . ALA B 505 ? 0.1525 0.1475 0.1775 0.0024  0.0136  0.0015  801 ALA A C     
4203 O O     . ALA B 505 ? 0.1766 0.1711 0.2010 0.0031  0.0163  0.0014  801 ALA A O     
4204 C CB    . ALA B 505 ? 0.2545 0.2425 0.2882 0.0028  0.0122  0.0007  801 ALA A CB    
4205 N N     . ASP B 506 ? 0.1653 0.1631 0.1854 0.0004  0.0120  0.0017  802 ASP A N     
4206 C CA    . ASP B 506 ? 0.1882 0.1899 0.2031 -0.0008 0.0123  0.0019  802 ASP A CA    
4207 C C     . ASP B 506 ? 0.2277 0.2326 0.2432 0.0020  0.0123  0.0033  802 ASP A C     
4208 O O     . ASP B 506 ? 0.2067 0.2114 0.2184 0.0020  0.0132  0.0038  802 ASP A O     
4209 C CB    . ASP B 506 ? 0.1975 0.2039 0.2102 -0.0033 0.0102  0.0021  802 ASP A CB    
4210 C CG    . ASP B 506 ? 0.4746 0.4767 0.4849 -0.0069 0.0103  0.0009  802 ASP A CG    
4211 O OD1   . ASP B 506 ? 0.3833 0.3884 0.3924 -0.0095 0.0090  0.0013  802 ASP A OD1   
4212 O OD2   . ASP B 506 ? 0.4070 0.4024 0.4168 -0.0071 0.0121  -0.0004 802 ASP A OD2   
4213 N N     . ILE B 507 ? 0.1281 0.1346 0.1470 0.0041  0.0112  0.0039  803 ILE A N     
4214 C CA    . ILE B 507 ? 0.1925 0.2009 0.2121 0.0070  0.0113  0.0052  803 ILE A CA    
4215 C C     . ILE B 507 ? 0.1344 0.1378 0.1548 0.0079  0.0137  0.0056  803 ILE A C     
4216 O O     . ILE B 507 ? 0.1968 0.1998 0.2144 0.0092  0.0144  0.0072  803 ILE A O     
4217 C CB    . ILE B 507 ? 0.1696 0.1789 0.1919 0.0087  0.0104  0.0050  803 ILE A CB    
4218 C CG1   . ILE B 507 ? 0.2488 0.2640 0.2699 0.0078  0.0094  0.0048  803 ILE A CG1   
4219 C CG2   . ILE B 507 ? 0.1822 0.1903 0.2058 0.0120  0.0111  0.0058  803 ILE A CG2   
4220 C CD1   . ILE B 507 ? 0.2226 0.2369 0.2437 0.0082  0.0092  0.0039  803 ILE A CD1   
4221 N N     . ILE B 508 ? 0.1750 0.1743 0.1998 0.0075  0.0148  0.0045  804 ILE A N     
4222 C CA    . ILE B 508 ? 0.2328 0.2281 0.2602 0.0078  0.0179  0.0046  804 ILE A CA    
4223 C C     . ILE B 508 ? 0.2049 0.1983 0.2263 0.0065  0.0210  0.0049  804 ILE A C     
4224 O O     . ILE B 508 ? 0.1766 0.1673 0.1949 0.0070  0.0234  0.0063  804 ILE A O     
4225 C CB    . ILE B 508 ? 0.2255 0.2188 0.2612 0.0074  0.0182  0.0032  804 ILE A CB    
4226 C CG1   . ILE B 508 ? 0.2824 0.2763 0.3221 0.0083  0.0148  0.0031  804 ILE A CG1   
4227 C CG2   . ILE B 508 ? 0.3218 0.3121 0.3618 0.0071  0.0228  0.0030  804 ILE A CG2   
4228 C CD1   . ILE B 508 ? 0.2585 0.2517 0.3050 0.0078  0.0123  0.0021  804 ILE A CD1   
4229 N N     . LYS B 509 ? 0.1741 0.1675 0.1922 0.0046  0.0209  0.0035  805 LYS A N     
4230 C CA    . LYS B 509 ? 0.1826 0.1732 0.1925 0.0028  0.0235  0.0030  805 LYS A CA    
4231 C C     . LYS B 509 ? 0.1702 0.1630 0.1724 0.0031  0.0213  0.0054  805 LYS A C     
4232 O O     . LYS B 509 ? 0.1645 0.1535 0.1594 0.0025  0.0235  0.0064  805 LYS A O     
4233 C CB    . LYS B 509 ? 0.1476 0.1371 0.1546 0.0003  0.0232  0.0007  805 LYS A CB    
4234 C CG    . LYS B 509 ? 0.1974 0.1833 0.2117 0.0005  0.0258  -0.0013 805 LYS A CG    
4235 C CD    . LYS B 509 ? 0.3112 0.2947 0.3224 -0.0017 0.0252  -0.0033 805 LYS A CD    
4236 C CE    . LYS B 509 ? 0.4282 0.4068 0.4468 -0.0007 0.0281  -0.0052 805 LYS A CE    
4237 N NZ    . LYS B 509 ? 0.3683 0.3423 0.3829 -0.0029 0.0280  -0.0072 805 LYS A NZ    
4238 N N     . LYS B 510 ? 0.1618 0.1608 0.1652 0.0039  0.0169  0.0063  806 LYS A N     
4239 C CA    . LYS B 510 ? 0.2110 0.2135 0.2097 0.0050  0.0140  0.0088  806 LYS A CA    
4240 C C     . LYS B 510 ? 0.2478 0.2469 0.2466 0.0080  0.0153  0.0114  806 LYS A C     
4241 O O     . LYS B 510 ? 0.1819 0.1793 0.1738 0.0086  0.0144  0.0140  806 LYS A O     
4242 C CB    . LYS B 510 ? 0.2126 0.2234 0.2156 0.0057  0.0100  0.0091  806 LYS A CB    
4243 C CG    . LYS B 510 ? 0.3617 0.3780 0.3617 0.0068  0.0062  0.0116  806 LYS A CG    
4244 C CD    . LYS B 510 ? 0.4468 0.4731 0.4526 0.0067  0.0030  0.0114  806 LYS A CD    
4245 C CE    . LYS B 510 ? 0.4641 0.4972 0.4700 0.0087  -0.0014 0.0142  806 LYS A CE    
4246 N NZ    . LYS B 510 ? 0.4140 0.4429 0.4191 0.0136  -0.0012 0.0174  806 LYS A NZ    
4247 N N     . ALA B 511 ? 0.1747 0.1722 0.1809 0.0096  0.0169  0.0109  807 ALA A N     
4248 C CA    . ALA B 511 ? 0.2465 0.2396 0.2537 0.0119  0.0185  0.0130  807 ALA A CA    
4249 C C     . ALA B 511 ? 0.1864 0.1725 0.1883 0.0102  0.0229  0.0138  807 ALA A C     
4250 O O     . ALA B 511 ? 0.1779 0.1598 0.1747 0.0113  0.0236  0.0169  807 ALA A O     
4251 C CB    . ALA B 511 ? 0.1700 0.1621 0.1859 0.0128  0.0190  0.0114  807 ALA A CB    
4252 N N     . MET B 512 ? 0.1808 0.1651 0.1837 0.0076  0.0263  0.0113  808 MET A N     
4253 C CA    . MET B 512 ? 0.1940 0.1719 0.1918 0.0057  0.0320  0.0116  808 MET A CA    
4254 C C     . MET B 512 ? 0.1972 0.1724 0.1805 0.0045  0.0314  0.0135  808 MET A C     
4255 O O     . MET B 512 ? 0.2023 0.1712 0.1779 0.0040  0.0346  0.0159  808 MET A O     
4256 C CB    . MET B 512 ? 0.1765 0.1535 0.1795 0.0037  0.0363  0.0080  808 MET A CB    
4257 C CG    . MET B 512 ? 0.2339 0.2131 0.2511 0.0046  0.0365  0.0065  808 MET A CG    
4258 S SD    . MET B 512 ? 0.3153 0.2947 0.3395 0.0035  0.0395  0.0026  808 MET A SD    
4259 C CE    . MET B 512 ? 0.2868 0.2603 0.3090 0.0017  0.0492  0.0021  808 MET A CE    
4260 N N     . ILE B 513 ? 0.1947 0.1743 0.1736 0.0037  0.0270  0.0126  809 ILE A N     
4261 C CA    . ILE B 513 ? 0.1875 0.1654 0.1527 0.0024  0.0244  0.0144  809 ILE A CA    
4262 C C     . ILE B 513 ? 0.2191 0.1974 0.1815 0.0054  0.0205  0.0193  809 ILE A C     
4263 O O     . ILE B 513 ? 0.2494 0.2214 0.1999 0.0049  0.0210  0.0224  809 ILE A O     
4264 C CB    . ILE B 513 ? 0.2153 0.1991 0.1790 0.0004  0.0198  0.0121  809 ILE A CB    
4265 C CG1   . ILE B 513 ? 0.2720 0.2524 0.2361 -0.0026 0.0243  0.0075  809 ILE A CG1   
4266 C CG2   . ILE B 513 ? 0.2340 0.2180 0.1849 -0.0010 0.0149  0.0144  809 ILE A CG2   
4267 C CD1   . ILE B 513 ? 0.2590 0.2446 0.2261 -0.0044 0.0205  0.0050  809 ILE A CD1   
4268 N N     . ASP B 514 ? 0.1822 0.1668 0.1545 0.0088  0.0167  0.0202  810 ASP A N     
4269 C CA    . ASP B 514 ? 0.1863 0.1709 0.1580 0.0127  0.0132  0.0247  810 ASP A CA    
4270 C C     . ASP B 514 ? 0.2271 0.2021 0.1964 0.0135  0.0178  0.0272  810 ASP A C     
4271 O O     . ASP B 514 ? 0.2230 0.1930 0.1847 0.0153  0.0162  0.0317  810 ASP A O     
4272 C CB    . ASP B 514 ? 0.1999 0.1923 0.1838 0.0163  0.0101  0.0240  810 ASP A CB    
4273 C CG    . ASP B 514 ? 0.4231 0.4257 0.4104 0.0152  0.0059  0.0220  810 ASP A CG    
4274 O OD1   . ASP B 514 ? 0.4830 0.4869 0.4630 0.0119  0.0041  0.0214  810 ASP A OD1   
4275 O OD2   . ASP B 514 ? 0.4553 0.4641 0.4520 0.0174  0.0048  0.0209  810 ASP A OD2   
4276 N N     . LEU B 515 ? 0.1876 0.1598 0.1641 0.0123  0.0232  0.0245  811 LEU A N     
4277 C CA    . LEU B 515 ? 0.1941 0.1576 0.1701 0.0121  0.0281  0.0266  811 LEU A CA    
4278 C C     . LEU B 515 ? 0.2662 0.2217 0.2284 0.0091  0.0323  0.0286  811 LEU A C     
4279 O O     . LEU B 515 ? 0.3123 0.2600 0.2669 0.0097  0.0334  0.0331  811 LEU A O     
4280 C CB    . LEU B 515 ? 0.2417 0.2058 0.2299 0.0106  0.0323  0.0229  811 LEU A CB    
4281 C CG    . LEU B 515 ? 0.2766 0.2330 0.2673 0.0096  0.0374  0.0244  811 LEU A CG    
4282 C CD1   . LEU B 515 ? 0.2951 0.2465 0.2829 0.0128  0.0347  0.0286  811 LEU A CD1   
4283 C CD2   . LEU B 515 ? 0.3734 0.3327 0.3786 0.0085  0.0392  0.0206  811 LEU A CD2   
4284 N N     . ASN B 516 ? 0.2297 0.1860 0.1874 0.0058  0.0349  0.0255  812 ASN A N     
4285 C CA    . ASN B 516 ? 0.2793 0.2275 0.2221 0.0025  0.0397  0.0266  812 ASN A CA    
4286 C C     . ASN B 516 ? 0.2566 0.2009 0.1837 0.0034  0.0343  0.0317  812 ASN A C     
4287 O O     . ASN B 516 ? 0.2724 0.2070 0.1875 0.0022  0.0376  0.0355  812 ASN A O     
4288 C CB    . ASN B 516 ? 0.2926 0.2423 0.2327 -0.0007 0.0425  0.0216  812 ASN A CB    
4289 C CG    . ASN B 516 ? 0.4084 0.3492 0.3298 -0.0042 0.0470  0.0221  812 ASN A CG    
4290 O OD1   . ASN B 516 ? 0.4514 0.3918 0.3596 -0.0056 0.0423  0.0223  812 ASN A OD1   
4291 N ND2   . ASN B 516 ? 0.3179 0.2515 0.2378 -0.0062 0.0562  0.0221  812 ASN A ND2   
4292 N N     . ALA B 517 ? 0.2482 0.2003 0.1757 0.0054  0.0258  0.0321  813 ALA A N     
4293 C CA    . ALA B 517 ? 0.2491 0.1990 0.1639 0.0068  0.0191  0.0374  813 ALA A CA    
4294 C C     . ALA B 517 ? 0.2528 0.1984 0.1702 0.0112  0.0176  0.0430  813 ALA A C     
4295 O O     . ALA B 517 ? 0.2704 0.2079 0.1741 0.0116  0.0159  0.0485  813 ALA A O     
4296 C CB    . ALA B 517 ? 0.2866 0.2476 0.2043 0.0077  0.0103  0.0364  813 ALA A CB    
4297 N N     . ARG B 518 ? 0.2535 0.2033 0.1871 0.0144  0.0181  0.0417  814 ARG A N     
4298 C CA    . ARG B 518 ? 0.2669 0.2113 0.2032 0.0187  0.0170  0.0464  814 ARG A CA    
4299 C C     . ARG B 518 ? 0.2565 0.1874 0.1848 0.0162  0.0243  0.0491  814 ARG A C     
4300 O O     . ARG B 518 ? 0.3036 0.2256 0.2236 0.0182  0.0229  0.0551  814 ARG A O     
4301 C CB    . ARG B 518 ? 0.3871 0.3376 0.3410 0.0220  0.0167  0.0434  814 ARG A CB    
4302 C CG    . ARG B 518 ? 0.5242 0.4861 0.4856 0.0259  0.0096  0.0428  814 ARG A CG    
4303 C CD    . ARG B 518 ? 0.6549 0.6160 0.6094 0.0299  0.0028  0.0488  814 ARG A CD    
4304 N NE    . ARG B 518 ? 0.6790 0.6293 0.6319 0.0336  0.0038  0.0537  814 ARG A NE    
4305 C CZ    . ARG B 518 ? 0.7181 0.6681 0.6823 0.0382  0.0041  0.0533  814 ARG A CZ    
4306 N NH1   . ARG B 518 ? 0.6434 0.6036 0.6207 0.0396  0.0038  0.0483  814 ARG A NH1   
4307 N NH2   . ARG B 518 ? 0.7297 0.6680 0.6910 0.0412  0.0051  0.0578  814 ARG A NH2   
4308 N N     . LEU B 519 ? 0.2635 0.1930 0.1952 0.0118  0.0322  0.0450  815 LEU A N     
4309 C CA    . LEU B 519 ? 0.3064 0.2242 0.2315 0.0084  0.0403  0.0472  815 LEU A CA    
4310 C C     . LEU B 519 ? 0.3153 0.2236 0.2186 0.0065  0.0405  0.0522  815 LEU A C     
4311 O O     . LEU B 519 ? 0.3395 0.2361 0.2339 0.0061  0.0433  0.0575  815 LEU A O     
4312 C CB    . LEU B 519 ? 0.3107 0.2308 0.2442 0.0041  0.0485  0.0415  815 LEU A CB    
4313 C CG    . LEU B 519 ? 0.2584 0.1852 0.2121 0.0053  0.0487  0.0375  815 LEU A CG    
4314 C CD1   . LEU B 519 ? 0.2861 0.2159 0.2487 0.0015  0.0558  0.0325  815 LEU A CD1   
4315 C CD2   . LEU B 519 ? 0.2439 0.1636 0.2020 0.0066  0.0495  0.0408  815 LEU A CD2   
4316 N N     . LYS B 520 ? 0.3663 0.2784 0.2595 0.0051  0.0372  0.0506  816 LYS A N     
4317 C CA    . LYS B 520 ? 0.4289 0.3317 0.2989 0.0028  0.0364  0.0550  816 LYS A CA    
4318 C C     . LYS B 520 ? 0.3640 0.2641 0.2271 0.0074  0.0267  0.0623  816 LYS A C     
4319 O O     . LYS B 520 ? 0.3862 0.2738 0.2324 0.0067  0.0273  0.0686  816 LYS A O     
4320 C CB    . LYS B 520 ? 0.4078 0.3151 0.2687 -0.0005 0.0347  0.0506  816 LYS A CB    
4321 C CG    . LYS B 520 ? 0.6228 0.5314 0.4884 -0.0047 0.0442  0.0435  816 LYS A CG    
4322 C CD    . LYS B 520 ? 0.7945 0.6967 0.6662 -0.0066 0.0555  0.0433  816 LYS A CD    
4323 C CE    . LYS B 520 ? 0.9240 0.8136 0.7754 -0.0116 0.0644  0.0443  816 LYS A CE    
4324 N NZ    . LYS B 520 ? 0.9478 0.8325 0.8072 -0.0141 0.0763  0.0438  816 LYS A NZ    
4325 N N     . GLU B 521 ? 0.3426 0.2541 0.2185 0.0123  0.0180  0.0618  817 GLU A N     
4326 C CA    . GLU B 521 ? 0.3316 0.2422 0.2052 0.0179  0.0087  0.0685  817 GLU A CA    
4327 C C     . GLU B 521 ? 0.4022 0.3008 0.2762 0.0205  0.0121  0.0738  817 GLU A C     
4328 O O     . GLU B 521 ? 0.4443 0.3335 0.3058 0.0228  0.0079  0.0813  817 GLU A O     
4329 C CB    . GLU B 521 ? 0.4889 0.4148 0.3809 0.0230  0.0013  0.0661  817 GLU A CB    
4330 C CG    . GLU B 521 ? 0.8408 0.7794 0.7342 0.0211  -0.0041 0.0619  817 GLU A CG    
4331 C CD    . GLU B 521 ? 1.0555 1.0086 0.9703 0.0252  -0.0075 0.0583  817 GLU A CD    
4332 O OE1   . GLU B 521 ? 1.0578 1.0195 0.9801 0.0222  -0.0057 0.0521  817 GLU A OE1   
4333 O OE2   . GLU B 521 ? 1.0868 1.0417 1.0105 0.0313  -0.0115 0.0618  817 GLU A OE2   
4334 N N     . GLU B 522 ? 0.3331 0.2315 0.2215 0.0201  0.0191  0.0701  818 GLU A N     
4335 C CA    . GLU B 522 ? 0.3706 0.2573 0.2609 0.0219  0.0226  0.0743  818 GLU A CA    
4336 C C     . GLU B 522 ? 0.3914 0.2632 0.2665 0.0162  0.0313  0.0774  818 GLU A C     
4337 O O     . GLU B 522 ? 0.4287 0.2890 0.3038 0.0165  0.0352  0.0812  818 GLU A O     
4338 C CB    . GLU B 522 ? 0.4130 0.3049 0.3240 0.0229  0.0263  0.0688  818 GLU A CB    
4339 C CG    . GLU B 522 ? 0.5193 0.4248 0.4448 0.0281  0.0195  0.0653  818 GLU A CG    
4340 C CD    . GLU B 522 ? 0.8120 0.7160 0.7371 0.0353  0.0116  0.0710  818 GLU A CD    
4341 O OE1   . GLU B 522 ? 0.8940 0.8072 0.8179 0.0380  0.0040  0.0721  818 GLU A OE1   
4342 O OE2   . GLU B 522 ? 0.9880 0.8813 0.9147 0.0382  0.0130  0.0744  818 GLU A OE2   
4343 N N     . ARG B 523 ? 0.3875 0.2589 0.2498 0.0109  0.0352  0.0756  819 ARG A N     
4344 C CA    . ARG B 523 ? 0.4375 0.2958 0.2853 0.0047  0.0453  0.0775  819 ARG A CA    
4345 C C     . ARG B 523 ? 0.4086 0.2639 0.2709 0.0020  0.0551  0.0750  819 ARG A C     
4346 O O     . ARG B 523 ? 0.5368 0.3787 0.3916 -0.0008 0.0617  0.0794  819 ARG A O     
4347 C CB    . ARG B 523 ? 0.5694 0.4125 0.3948 0.0054  0.0422  0.0870  819 ARG A CB    
4348 C CG    . ARG B 523 ? 0.5455 0.3885 0.3499 0.0039  0.0365  0.0886  819 ARG A CG    
4349 C CD    . ARG B 523 ? 0.5734 0.4261 0.3825 0.0104  0.0224  0.0906  819 ARG A CD    
4350 N NE    . ARG B 523 ? 0.5565 0.4068 0.3440 0.0093  0.0147  0.0942  819 ARG A NE    
4351 C CZ    . ARG B 523 ? 0.5131 0.3740 0.2986 0.0073  0.0104  0.0891  819 ARG A CZ    
4352 N NH1   . ARG B 523 ? 0.4418 0.3156 0.2451 0.0063  0.0138  0.0805  819 ARG A NH1   
4353 N NH2   . ARG B 523 ? 0.6027 0.4604 0.3673 0.0059  0.0024  0.0926  819 ARG A NH2   
4354 N N     . LEU B 524 ? 0.3679 0.2357 0.2508 0.0024  0.0560  0.0678  820 LEU A N     
4355 C CA    . LEU B 524 ? 0.3869 0.2543 0.2851 -0.0008 0.0644  0.0643  820 LEU A CA    
4356 C C     . LEU B 524 ? 0.4500 0.3184 0.3463 -0.0070 0.0746  0.0603  820 LEU A C     
4357 O O     . LEU B 524 ? 0.4134 0.2874 0.3034 -0.0077 0.0740  0.0572  820 LEU A O     
4358 C CB    . LEU B 524 ? 0.3807 0.2605 0.3008 0.0025  0.0599  0.0588  820 LEU A CB    
4359 C CG    . LEU B 524 ? 0.3744 0.2515 0.2991 0.0082  0.0528  0.0620  820 LEU A CG    
4360 C CD1   . LEU B 524 ? 0.3591 0.2491 0.3005 0.0119  0.0474  0.0564  820 LEU A CD1   
4361 C CD2   . LEU B 524 ? 0.4475 0.3121 0.3748 0.0063  0.0581  0.0649  820 LEU A CD2   
4362 N N     . GLN B 525 ? 0.4198 0.2826 0.3222 -0.0115 0.0844  0.0602  821 GLN A N     
4363 C CA    . GLN B 525 ? 0.4349 0.3004 0.3413 -0.0169 0.0952  0.0556  821 GLN A CA    
4364 C C     . GLN B 525 ? 0.3981 0.2785 0.3285 -0.0161 0.0947  0.0480  821 GLN A C     
4365 O O     . GLN B 525 ? 0.3974 0.2828 0.3336 -0.0192 0.1021  0.0434  821 GLN A O     
4366 C CB    . GLN B 525 ? 0.5289 0.3835 0.4341 -0.0224 0.1063  0.0587  821 GLN A CB    
4367 C CG    . GLN B 525 ? 0.4661 0.3038 0.3446 -0.0242 0.1086  0.0667  821 GLN A CG    
4368 C CD    . GLN B 525 ? 0.5534 0.3806 0.4309 -0.0308 0.1213  0.0692  821 GLN A CD    
4369 O OE1   . GLN B 525 ? 0.5823 0.3978 0.4557 -0.0314 0.1213  0.0753  821 GLN A OE1   
4370 N NE2   . GLN B 525 ? 0.5555 0.3870 0.4381 -0.0357 0.1328  0.0645  821 GLN A NE2   
4371 N N     . ALA B 526 ? 0.3149 0.2018 0.2590 -0.0121 0.0864  0.0467  822 ALA A N     
4372 C CA    . ALA B 526 ? 0.3223 0.2224 0.2873 -0.0113 0.0846  0.0401  822 ALA A CA    
4373 C C     . ALA B 526 ? 0.3554 0.2635 0.3186 -0.0109 0.0844  0.0358  822 ALA A C     
4374 O O     . ALA B 526 ? 0.4356 0.3423 0.3832 -0.0093 0.0804  0.0373  822 ALA A O     
4375 C CB    . ALA B 526 ? 0.3165 0.2209 0.2896 -0.0065 0.0745  0.0398  822 ALA A CB    
4376 N N     . ARG B 527 ? 0.3056 0.2223 0.2853 -0.0124 0.0883  0.0304  823 ARG A N     
4377 C CA    . ARG B 527 ? 0.4045 0.3282 0.3835 -0.0112 0.0868  0.0261  823 ARG A CA    
4378 C C     . ARG B 527 ? 0.3884 0.3234 0.3887 -0.0098 0.0839  0.0210  823 ARG A C     
4379 O O     . ARG B 527 ? 0.2215 0.1595 0.2385 -0.0111 0.0862  0.0198  823 ARG A O     
4387 N N     . LEU B 528 ? 0.3000 0.2407 0.2988 -0.0073 0.0782  0.0184  824 LEU A N     
4388 C CA    . LEU B 528 ? 0.3174 0.2676 0.3328 -0.0058 0.0750  0.0141  824 LEU A CA    
4389 C C     . LEU B 528 ? 0.2711 0.2237 0.2984 -0.0078 0.0836  0.0105  824 LEU A C     
4390 O O     . LEU B 528 ? 0.2926 0.2411 0.3110 -0.0095 0.0911  0.0095  824 LEU A O     
4391 C CB    . LEU B 528 ? 0.2695 0.2229 0.2772 -0.0036 0.0688  0.0125  824 LEU A CB    
4392 C CG    . LEU B 528 ? 0.5037 0.4598 0.5084 -0.0007 0.0591  0.0144  824 LEU A CG    
4393 C CD1   . LEU B 528 ? 0.4713 0.4297 0.4660 0.0001  0.0548  0.0134  824 LEU A CD1   
4394 C CD2   . LEU B 528 ? 0.5063 0.4687 0.5276 0.0008  0.0548  0.0125  824 LEU A CD2   
4395 N N     . LEU B 529 ? 0.2113 0.1707 0.2589 -0.0076 0.0825  0.0085  825 LEU A N     
4396 C CA    . LEU B 529 ? 0.2240 0.1881 0.2874 -0.0085 0.0893  0.0050  825 LEU A CA    
4397 C C     . LEU B 529 ? 0.2974 0.2690 0.3722 -0.0056 0.0836  0.0017  825 LEU A C     
4398 O O     . LEU B 529 ? 0.2473 0.2206 0.3273 -0.0050 0.0887  -0.0013 825 LEU A O     
4399 C CB    . LEU B 529 ? 0.2397 0.2065 0.3205 -0.0111 0.0927  0.0055  825 LEU A CB    
4400 C CG    . LEU B 529 ? 0.2760 0.2349 0.3489 -0.0150 0.1007  0.0087  825 LEU A CG    
4401 C CD1   . LEU B 529 ? 0.2872 0.2504 0.3808 -0.0180 0.1029  0.0084  825 LEU A CD1   
4402 C CD2   . LEU B 529 ? 0.2972 0.2506 0.3589 -0.0170 0.1121  0.0083  825 LEU A CD2   
4403 N N     . LEU B 530 ? 0.2290 0.2043 0.3076 -0.0036 0.0735  0.0022  826 LEU A N     
4404 C CA    . LEU B 530 ? 0.1775 0.1594 0.2682 -0.0013 0.0678  -0.0002 826 LEU A CA    
4405 C C     . LEU B 530 ? 0.1628 0.1451 0.2452 0.0006  0.0579  0.0009  826 LEU A C     
4406 O O     . LEU B 530 ? 0.1927 0.1728 0.2685 0.0004  0.0544  0.0031  826 LEU A O     
4407 C CB    . LEU B 530 ? 0.1982 0.1867 0.3112 -0.0018 0.0667  -0.0012 826 LEU A CB    
4408 C CG    . LEU B 530 ? 0.3654 0.3570 0.4937 -0.0032 0.0762  -0.0029 826 LEU A CG    
4409 C CD1   . LEU B 530 ? 0.2909 0.2905 0.4425 -0.0040 0.0724  -0.0035 826 LEU A CD1   
4410 C CD2   . LEU B 530 ? 0.3018 0.2936 0.4308 -0.0008 0.0807  -0.0057 826 LEU A CD2   
4411 N N     . GLN B 531 ? 0.1769 0.1614 0.2595 0.0026  0.0541  -0.0008 827 GLN A N     
4412 C CA    . GLN B 531 ? 0.2102 0.1966 0.2897 0.0041  0.0450  -0.0002 827 GLN A CA    
4413 C C     . GLN B 531 ? 0.2236 0.2147 0.3187 0.0053  0.0410  -0.0016 827 GLN A C     
4414 O O     . GLN B 531 ? 0.2203 0.2123 0.3225 0.0063  0.0438  -0.0033 827 GLN A O     
4415 C CB    . GLN B 531 ? 0.2112 0.1955 0.2765 0.0047  0.0436  -0.0004 827 GLN A CB    
4416 C CG    . GLN B 531 ? 0.2889 0.2748 0.3482 0.0056  0.0358  0.0008  827 GLN A CG    
4417 C CD    . GLN B 531 ? 0.3385 0.3272 0.4054 0.0066  0.0304  -0.0002 827 GLN A CD    
4418 O OE1   . GLN B 531 ? 0.3046 0.2926 0.3714 0.0069  0.0306  -0.0013 827 GLN A OE1   
4419 N NE2   . GLN B 531 ? 0.4673 0.4579 0.5397 0.0069  0.0254  0.0004  827 GLN A NE2   
4420 N N     . VAL B 532 ? 0.2226 0.2160 0.3233 0.0051  0.0346  -0.0010 828 VAL A N     
4421 C CA    . VAL B 532 ? 0.3480 0.3458 0.4632 0.0059  0.0292  -0.0017 828 VAL A CA    
4422 C C     . VAL B 532 ? 0.3458 0.3429 0.4532 0.0064  0.0206  -0.0010 828 VAL A C     
4423 O O     . VAL B 532 ? 0.2780 0.2736 0.3803 0.0054  0.0183  -0.0005 828 VAL A O     
4424 C CB    . VAL B 532 ? 0.4567 0.4581 0.5880 0.0042  0.0302  -0.0021 828 VAL A CB    
4425 C CG1   . VAL B 532 ? 0.5412 0.5476 0.6871 0.0050  0.0228  -0.0026 828 VAL A CG1   
4426 C CG2   . VAL B 532 ? 0.5172 0.5193 0.6560 0.0033  0.0404  -0.0029 828 VAL A CG2   
4427 N N     . HIS B 533 ? 0.2884 0.2856 0.3943 0.0080  0.0164  -0.0010 829 HIS A N     
4428 C CA    . HIS B 533 ? 0.3100 0.3059 0.4068 0.0081  0.0093  -0.0002 829 HIS A CA    
4429 C C     . HIS B 533 ? 0.1674 0.1611 0.2497 0.0076  0.0105  0.0003  829 HIS A C     
4430 O O     . HIS B 533 ? 0.3565 0.3491 0.4299 0.0078  0.0133  0.0006  829 HIS A O     
4431 C CB    . HIS B 533 ? 0.5114 0.5088 0.6151 0.0074  0.0023  -0.0002 829 HIS A CB    
4432 C CG    . HIS B 533 ? 0.8688 0.8703 0.9908 0.0076  0.0013  -0.0006 829 HIS A CG    
4433 N ND1   . HIS B 533 ? 0.9482 0.9512 1.0792 0.0098  0.0021  -0.0004 829 HIS A ND1   
4434 C CD2   . HIS B 533 ? 0.9259 0.9306 1.0603 0.0059  -0.0003 -0.0013 829 HIS A CD2   
4435 C CE1   . HIS B 533 ? 0.9243 0.9325 1.0738 0.0099  0.0010  -0.0009 829 HIS A CE1   
4436 N NE2   . HIS B 533 ? 0.9279 0.9376 1.0800 0.0072  -0.0006 -0.0014 829 HIS A NE2   
4437 N N     . ASP B 534 ? 0.2173 0.2103 0.2976 0.0068  0.0079  0.0002  830 ASP A N     
4438 C CA    . ASP B 534 ? 0.2252 0.2165 0.2939 0.0071  0.0087  0.0007  830 ASP A CA    
4439 C C     . ASP B 534 ? 0.1941 0.1834 0.2638 0.0067  0.0128  0.0010  830 ASP A C     
4440 O O     . ASP B 534 ? 0.1658 0.1529 0.2284 0.0073  0.0126  0.0013  830 ASP A O     
4441 C CB    . ASP B 534 ? 0.2005 0.1906 0.2636 0.0070  0.0032  0.0001  830 ASP A CB    
4442 C CG    . ASP B 534 ? 0.3313 0.3218 0.3914 0.0070  -0.0010 0.0005  830 ASP A CG    
4443 O OD1   . ASP B 534 ? 0.3703 0.3592 0.4276 0.0063  -0.0061 0.0000  830 ASP A OD1   
4444 O OD2   . ASP B 534 ? 0.2340 0.2254 0.2934 0.0074  0.0009  0.0012  830 ASP A OD2   
4445 N N     . GLU B 535 ? 0.1646 0.1543 0.2435 0.0056  0.0167  0.0009  831 GLU A N     
4446 C CA    . GLU B 535 ? 0.2338 0.2208 0.3145 0.0044  0.0209  0.0015  831 GLU A CA    
4447 C C     . GLU B 535 ? 0.2510 0.2368 0.3281 0.0043  0.0280  0.0027  831 GLU A C     
4448 O O     . GLU B 535 ? 0.2362 0.2239 0.3161 0.0045  0.0304  0.0020  831 GLU A O     
4449 C CB    . GLU B 535 ? 0.3014 0.2898 0.3967 0.0021  0.0202  0.0004  831 GLU A CB    
4450 C CG    . GLU B 535 ? 0.4730 0.4575 0.5703 0.0000  0.0245  0.0011  831 GLU A CG    
4451 C CD    . GLU B 535 ? 0.6474 0.6337 0.7594 -0.0031 0.0224  -0.0004 831 GLU A CD    
4452 O OE1   . GLU B 535 ? 0.6728 0.6550 0.7830 -0.0046 0.0192  -0.0011 831 GLU A OE1   
4453 O OE2   . GLU B 535 ? 0.6108 0.6025 0.7369 -0.0042 0.0242  -0.0010 831 GLU A OE2   
4454 N N     . LEU B 536 ? 0.1715 0.1528 0.2408 0.0042  0.0311  0.0046  832 LEU A N     
4455 C CA    . LEU B 536 ? 0.1702 0.1483 0.2344 0.0033  0.0380  0.0061  832 LEU A CA    
4456 C C     . LEU B 536 ? 0.2188 0.1938 0.2902 0.0008  0.0425  0.0068  832 LEU A C     
4457 O O     . LEU B 536 ? 0.1750 0.1469 0.2473 0.0004  0.0402  0.0074  832 LEU A O     
4458 C CB    . LEU B 536 ? 0.2287 0.2035 0.2781 0.0049  0.0375  0.0086  832 LEU A CB    
4459 C CG    . LEU B 536 ? 0.2973 0.2757 0.3397 0.0067  0.0335  0.0081  832 LEU A CG    
4460 C CD1   . LEU B 536 ? 0.2757 0.2518 0.3053 0.0080  0.0332  0.0108  832 LEU A CD1   
4461 C CD2   . LEU B 536 ? 0.4465 0.4269 0.4910 0.0056  0.0362  0.0062  832 LEU A CD2   
4462 N N     . ILE B 537 ? 0.1915 0.1666 0.2678 -0.0012 0.0495  0.0065  833 ILE A N     
4463 C CA    . ILE B 537 ? 0.1664 0.1389 0.2500 -0.0044 0.0552  0.0073  833 ILE A CA    
4464 C C     . ILE B 537 ? 0.2885 0.2544 0.3595 -0.0055 0.0629  0.0098  833 ILE A C     
4465 O O     . ILE B 537 ? 0.2048 0.1711 0.2698 -0.0051 0.0667  0.0091  833 ILE A O     
4466 C CB    . ILE B 537 ? 0.1764 0.1556 0.2797 -0.0062 0.0575  0.0047  833 ILE A CB    
4467 C CG1   . ILE B 537 ? 0.2314 0.2160 0.3450 -0.0052 0.0482  0.0028  833 ILE A CG1   
4468 C CG2   . ILE B 537 ? 0.1950 0.1719 0.3068 -0.0103 0.0639  0.0056  833 ILE A CG2   
4469 C CD1   . ILE B 537 ? 0.3853 0.3761 0.5055 -0.0029 0.0453  0.0009  833 ILE A CD1   
4470 N N     . LEU B 538 ? 0.1807 0.1394 0.2464 -0.0071 0.0651  0.0128  834 LEU A N     
4471 C CA    . LEU B 538 ? 0.2189 0.1694 0.2707 -0.0086 0.0719  0.0162  834 LEU A CA    
4472 C C     . LEU B 538 ? 0.2363 0.1829 0.2963 -0.0131 0.0792  0.0172  834 LEU A C     
4473 O O     . LEU B 538 ? 0.1972 0.1469 0.2723 -0.0147 0.0772  0.0156  834 LEU A O     
4474 C CB    . LEU B 538 ? 0.2331 0.1768 0.2688 -0.0060 0.0671  0.0200  834 LEU A CB    
4475 C CG    . LEU B 538 ? 0.2834 0.2308 0.3104 -0.0019 0.0599  0.0197  834 LEU A CG    
4476 C CD1   . LEU B 538 ? 0.3524 0.3057 0.3889 0.0004  0.0524  0.0171  834 LEU A CD1   
4477 C CD2   . LEU B 538 ? 0.3647 0.3046 0.3756 0.0001  0.0579  0.0244  834 LEU A CD2   
4478 N N     . GLU B 539 ? 0.2183 0.1579 0.2679 -0.0156 0.0878  0.0198  835 GLU A N     
4479 C CA    . GLU B 539 ? 0.2270 0.1599 0.2797 -0.0202 0.0949  0.0223  835 GLU A CA    
4480 C C     . GLU B 539 ? 0.3024 0.2223 0.3327 -0.0201 0.0965  0.0279  835 GLU A C     
4481 O O     . GLU B 539 ? 0.3088 0.2264 0.3226 -0.0177 0.0952  0.0293  835 GLU A O     
4482 C CB    . GLU B 539 ? 0.2384 0.1749 0.3020 -0.0244 0.1062  0.0202  835 GLU A CB    
4483 C CG    . GLU B 539 ? 0.3276 0.2610 0.3764 -0.0244 0.1137  0.0203  835 GLU A CG    
4484 C CD    . GLU B 539 ? 0.3932 0.3292 0.4528 -0.0285 0.1267  0.0180  835 GLU A CD    
4485 O OE1   . GLU B 539 ? 0.3983 0.3406 0.4798 -0.0314 0.1295  0.0165  835 GLU A OE1   
4486 O OE2   . GLU B 539 ? 0.3782 0.3101 0.4245 -0.0291 0.1344  0.0176  835 GLU A OE2   
4487 N N     . ALA B 540 ? 0.2734 0.1845 0.3031 -0.0228 0.0987  0.0313  836 ALA A N     
4488 C CA    . ALA B 540 ? 0.2695 0.1670 0.2784 -0.0221 0.0988  0.0375  836 ALA A CA    
4489 C C     . ALA B 540 ? 0.2833 0.1706 0.2944 -0.0273 0.1055  0.0407  836 ALA A C     
4490 O O     . ALA B 540 ? 0.2814 0.1729 0.3115 -0.0305 0.1065  0.0378  836 ALA A O     
4491 C CB    . ALA B 540 ? 0.2793 0.1757 0.2820 -0.0161 0.0875  0.0389  836 ALA A CB    
4492 N N     . PRO B 541 ? 0.3600 0.2334 0.3519 -0.0285 0.1095  0.0470  837 PRO A N     
4493 C CA    . PRO B 541 ? 0.3345 0.1956 0.3264 -0.0331 0.1148  0.0510  837 PRO A CA    
4494 C C     . PRO B 541 ? 0.3111 0.1710 0.3137 -0.0310 0.1067  0.0499  837 PRO A C     
4495 O O     . PRO B 541 ? 0.3020 0.1647 0.3021 -0.0248 0.0970  0.0491  837 PRO A O     
4496 C CB    . PRO B 541 ? 0.4123 0.2578 0.3773 -0.0322 0.1161  0.0587  837 PRO A CB    
4497 C CG    . PRO B 541 ? 0.4702 0.3212 0.4229 -0.0300 0.1161  0.0577  837 PRO A CG    
4498 C CD    . PRO B 541 ? 0.3617 0.2294 0.3301 -0.0261 0.1091  0.0508  837 PRO A CD    
4499 N N     . LYS B 542 ? 0.3159 0.1718 0.3309 -0.0367 0.1113  0.0495  838 LYS A N     
4500 C CA    . LYS B 542 ? 0.3119 0.1647 0.3356 -0.0356 0.1041  0.0479  838 LYS A CA    
4501 C C     . LYS B 542 ? 0.4190 0.2586 0.4251 -0.0296 0.0981  0.0531  838 LYS A C     
4502 O O     . LYS B 542 ? 0.3686 0.2094 0.3783 -0.0248 0.0896  0.0507  838 LYS A O     
4503 C CB    . LYS B 542 ? 0.3908 0.2381 0.4274 -0.0437 0.1105  0.0475  838 LYS A CB    
4504 C CG    . LYS B 542 ? 0.4739 0.3040 0.4968 -0.0484 0.1196  0.0546  838 LYS A CG    
4505 C CD    . LYS B 542 ? 0.6249 0.4505 0.6630 -0.0571 0.1256  0.0536  838 LYS A CD    
4506 C CE    . LYS B 542 ? 0.7352 0.5490 0.7606 -0.0621 0.1345  0.0592  838 LYS A CE    
4507 N NZ    . LYS B 542 ? 0.8452 0.6435 0.8432 -0.0573 0.1335  0.0670  838 LYS A NZ    
4508 N N     . GLU B 543 ? 0.3905 0.2178 0.3772 -0.0295 0.1022  0.0601  839 GLU A N     
4509 C CA    . GLU B 543 ? 0.4900 0.3046 0.4598 -0.0234 0.0963  0.0662  839 GLU A CA    
4510 C C     . GLU B 543 ? 0.4666 0.2909 0.4325 -0.0150 0.0864  0.0647  839 GLU A C     
4511 O O     . GLU B 543 ? 0.4785 0.2948 0.4344 -0.0089 0.0803  0.0690  839 GLU A O     
4512 C CB    . GLU B 543 ? 0.4529 0.2534 0.4017 -0.0257 0.1026  0.0743  839 GLU A CB    
4513 C CG    . GLU B 543 ? 0.6295 0.4168 0.5791 -0.0341 0.1127  0.0775  839 GLU A CG    
4514 C CD    . GLU B 543 ? 0.7572 0.5530 0.7148 -0.0420 0.1238  0.0742  839 GLU A CD    
4515 O OE1   . GLU B 543 ? 0.7401 0.5280 0.6975 -0.0490 0.1325  0.0765  839 GLU A OE1   
4516 O OE2   . GLU B 543 ? 0.4920 0.3043 0.4572 -0.0406 0.1230  0.0687  839 GLU A OE2   
4517 N N     . GLU B 544 ? 0.3391 0.1800 0.3130 -0.0143 0.0847  0.0590  840 GLU A N     
4518 C CA    . GLU B 544 ? 0.3091 0.1593 0.2802 -0.0072 0.0758  0.0575  840 GLU A CA    
4519 C C     . GLU B 544 ? 0.2903 0.1507 0.2777 -0.0047 0.0699  0.0509  840 GLU A C     
4520 O O     . GLU B 544 ? 0.2883 0.1575 0.2754 0.0007  0.0631  0.0490  840 GLU A O     
4521 C CB    . GLU B 544 ? 0.3579 0.2175 0.3227 -0.0077 0.0773  0.0564  840 GLU A CB    
4522 C CG    . GLU B 544 ? 0.4878 0.3370 0.4326 -0.0101 0.0826  0.0626  840 GLU A CG    
4523 C CD    . GLU B 544 ? 0.6709 0.5283 0.6069 -0.0099 0.0826  0.0610  840 GLU A CD    
4524 O OE1   . GLU B 544 ? 0.6710 0.5198 0.5876 -0.0114 0.0856  0.0657  840 GLU A OE1   
4525 O OE2   . GLU B 544 ? 0.6668 0.5380 0.6140 -0.0084 0.0795  0.0549  840 GLU A OE2   
4526 N N     . MET B 545 ? 0.3493 0.2093 0.3507 -0.0091 0.0723  0.0473  841 MET A N     
4527 C CA    . MET B 545 ? 0.3232 0.1932 0.3385 -0.0076 0.0666  0.0406  841 MET A CA    
4528 C C     . MET B 545 ? 0.2994 0.1661 0.3103 -0.0006 0.0593  0.0408  841 MET A C     
4529 O O     . MET B 545 ? 0.2725 0.1497 0.2870 0.0033  0.0539  0.0370  841 MET A O     
4530 C CB    . MET B 545 ? 0.2993 0.1680 0.3293 -0.0141 0.0696  0.0370  841 MET A CB    
4531 C CG    . MET B 545 ? 0.3986 0.2763 0.4395 -0.0203 0.0758  0.0348  841 MET A CG    
4532 S SD    . MET B 545 ? 0.3962 0.2933 0.4451 -0.0180 0.0725  0.0297  841 MET A SD    
4533 C CE    . MET B 545 ? 0.3762 0.2722 0.4106 -0.0176 0.0790  0.0340  841 MET A CE    
4534 N N     . GLU B 546 ? 0.2906 0.1425 0.2933 0.0015  0.0596  0.0456  842 GLU A N     
4535 C CA    . GLU B 546 ? 0.2872 0.1357 0.2882 0.0087  0.0535  0.0452  842 GLU A CA    
4536 C C     . GLU B 546 ? 0.2811 0.1382 0.2752 0.0154  0.0485  0.0471  842 GLU A C     
4537 O O     . GLU B 546 ? 0.2713 0.1358 0.2698 0.0203  0.0435  0.0436  842 GLU A O     
4538 C CB    . GLU B 546 ? 0.3620 0.1914 0.3566 0.0096  0.0552  0.0500  842 GLU A CB    
4539 C CG    . GLU B 546 ? 0.3563 0.1772 0.3585 0.0018  0.0602  0.0477  842 GLU A CG    
4540 C CD    . GLU B 546 ? 0.4738 0.2747 0.4712 0.0029  0.0612  0.0510  842 GLU A CD    
4541 O OE1   . GLU B 546 ? 0.4367 0.2338 0.4352 0.0088  0.0568  0.0487  842 GLU A OE1   
4542 O OE2   . GLU B 546 ? 0.5075 0.2960 0.5001 -0.0022 0.0670  0.0559  842 GLU A OE2   
4543 N N     . ARG B 547 ? 0.2871 0.1441 0.2706 0.0151  0.0499  0.0523  843 ARG A N     
4544 C CA    . ARG B 547 ? 0.3327 0.1993 0.3104 0.0202  0.0447  0.0537  843 ARG A CA    
4545 C C     . ARG B 547 ? 0.2610 0.1442 0.2474 0.0192  0.0429  0.0472  843 ARG A C     
4546 O O     . ARG B 547 ? 0.3166 0.2087 0.3047 0.0241  0.0375  0.0456  843 ARG A O     
4547 C CB    . ARG B 547 ? 0.2942 0.1561 0.2568 0.0186  0.0467  0.0600  843 ARG A CB    
4548 C CG    . ARG B 547 ? 0.3605 0.2088 0.3111 0.0233  0.0440  0.0680  843 ARG A CG    
4549 C CD    . ARG B 547 ? 0.4902 0.3319 0.4236 0.0203  0.0465  0.0743  843 ARG A CD    
4550 N NE    . ARG B 547 ? 0.7024 0.5351 0.6337 0.0124  0.0560  0.0747  843 ARG A NE    
4551 C CZ    . ARG B 547 ? 0.6737 0.5003 0.5908 0.0077  0.0613  0.0787  843 ARG A CZ    
4552 N NH1   . ARG B 547 ? 0.6570 0.4846 0.5588 0.0099  0.0572  0.0826  843 ARG A NH1   
4553 N NH2   . ARG B 547 ? 0.5160 0.3354 0.4339 0.0004  0.0710  0.0787  843 ARG A NH2   
4554 N N     . LEU B 548 ? 0.2543 0.1419 0.2469 0.0131  0.0475  0.0436  844 LEU A N     
4555 C CA    . LEU B 548 ? 0.3013 0.2033 0.3020 0.0123  0.0455  0.0380  844 LEU A CA    
4556 C C     . LEU B 548 ? 0.3019 0.2082 0.3123 0.0147  0.0412  0.0331  844 LEU A C     
4557 O O     . LEU B 548 ? 0.2152 0.1320 0.2282 0.0171  0.0373  0.0301  844 LEU A O     
4558 C CB    . LEU B 548 ? 0.2569 0.1621 0.2641 0.0059  0.0514  0.0355  844 LEU A CB    
4559 C CG    . LEU B 548 ? 0.3088 0.2112 0.3053 0.0034  0.0566  0.0391  844 LEU A CG    
4560 C CD1   . LEU B 548 ? 0.4487 0.3532 0.4543 -0.0028 0.0638  0.0364  844 LEU A CD1   
4561 C CD2   . LEU B 548 ? 0.2396 0.1505 0.2292 0.0061  0.0529  0.0387  844 LEU A CD2   
4562 N N     . CYS B 549 ? 0.2328 0.1305 0.2479 0.0134  0.0423  0.0320  845 CYS A N     
4563 C CA    . CYS B 549 ? 0.2499 0.1492 0.2714 0.0155  0.0385  0.0271  845 CYS A CA    
4564 C C     . CYS B 549 ? 0.2913 0.1943 0.3087 0.0227  0.0341  0.0277  845 CYS A C     
4565 O O     . CYS B 549 ? 0.3717 0.2816 0.3933 0.0244  0.0311  0.0232  845 CYS A O     
4566 C CB    . CYS B 549 ? 0.2828 0.1689 0.3066 0.0136  0.0403  0.0266  845 CYS A CB    
4567 S SG    . CYS B 549 ? 0.3723 0.2590 0.4069 0.0046  0.0437  0.0233  845 CYS A SG    
4568 N N     . ARG B 550 ? 0.2421 0.1405 0.2515 0.0268  0.0336  0.0333  846 ARG A N     
4569 C CA    . ARG B 550 ? 0.3484 0.2524 0.3565 0.0337  0.0293  0.0340  846 ARG A CA    
4570 C C     . ARG B 550 ? 0.3929 0.3101 0.3991 0.0339  0.0268  0.0345  846 ARG A C     
4571 O O     . ARG B 550 ? 0.3529 0.2799 0.3627 0.0369  0.0237  0.0318  846 ARG A O     
4572 C CB    . ARG B 550 ? 0.3519 0.2454 0.3540 0.0390  0.0284  0.0401  846 ARG A CB    
4573 C CG    . ARG B 550 ? 0.5096 0.3935 0.5153 0.0424  0.0289  0.0382  846 ARG A CG    
4574 C CD    . ARG B 550 ? 0.4623 0.3336 0.4620 0.0471  0.0285  0.0448  846 ARG A CD    
4575 N NE    . ARG B 550 ? 0.5488 0.4263 0.5477 0.0549  0.0238  0.0485  846 ARG A NE    
4576 C CZ    . ARG B 550 ? 0.5631 0.4439 0.5687 0.0617  0.0219  0.0460  846 ARG A CZ    
4577 N NH1   . ARG B 550 ? 0.4028 0.2803 0.4139 0.0612  0.0245  0.0395  846 ARG A NH1   
4578 N NH2   . ARG B 550 ? 0.5781 0.4656 0.5851 0.0687  0.0175  0.0498  846 ARG A NH2   
4579 N N     . LEU B 551 ? 0.3146 0.2312 0.3144 0.0304  0.0287  0.0377  847 LEU A N     
4580 C CA    . LEU B 551 ? 0.3145 0.2410 0.3099 0.0305  0.0262  0.0386  847 LEU A CA    
4581 C C     . LEU B 551 ? 0.2497 0.1874 0.2516 0.0275  0.0261  0.0329  847 LEU A C     
4582 O O     . LEU B 551 ? 0.2677 0.2153 0.2709 0.0295  0.0225  0.0315  847 LEU A O     
4583 C CB    . LEU B 551 ? 0.3258 0.2461 0.3103 0.0270  0.0292  0.0430  847 LEU A CB    
4584 C CG    . LEU B 551 ? 0.4637 0.3915 0.4405 0.0268  0.0263  0.0442  847 LEU A CG    
4585 C CD1   . LEU B 551 ? 0.6274 0.5610 0.6046 0.0330  0.0194  0.0463  847 LEU A CD1   
4586 C CD2   . LEU B 551 ? 0.4345 0.3533 0.3976 0.0238  0.0295  0.0490  847 LEU A CD2   
4587 N N     . VAL B 552 ? 0.2008 0.1373 0.2072 0.0225  0.0300  0.0300  848 VAL A N     
4588 C CA    . VAL B 552 ? 0.2194 0.1655 0.2311 0.0197  0.0298  0.0257  848 VAL A CA    
4589 C C     . VAL B 552 ? 0.2612 0.2141 0.2790 0.0220  0.0260  0.0218  848 VAL A C     
4590 O O     . VAL B 552 ? 0.2407 0.2024 0.2584 0.0223  0.0237  0.0204  848 VAL A O     
4591 C CB    . VAL B 552 ? 0.1877 0.1314 0.2053 0.0145  0.0345  0.0237  848 VAL A CB    
4592 C CG1   . VAL B 552 ? 0.2052 0.1583 0.2293 0.0125  0.0337  0.0195  848 VAL A CG1   
4593 C CG2   . VAL B 552 ? 0.2568 0.1942 0.2673 0.0118  0.0397  0.0273  848 VAL A CG2   
4594 N N     . PRO B 553 ? 0.3126 0.2612 0.3346 0.0232  0.0254  0.0199  849 PRO A N     
4595 C CA    . PRO B 553 ? 0.2621 0.2165 0.2876 0.0251  0.0225  0.0161  849 PRO A CA    
4596 C C     . PRO B 553 ? 0.2797 0.2405 0.3027 0.0297  0.0201  0.0175  849 PRO A C     
4597 O O     . PRO B 553 ? 0.3043 0.2734 0.3290 0.0297  0.0183  0.0150  849 PRO A O     
4598 C CB    . PRO B 553 ? 0.2964 0.2419 0.3241 0.0259  0.0231  0.0142  849 PRO A CB    
4599 C CG    . PRO B 553 ? 0.3759 0.3134 0.4046 0.0221  0.0261  0.0157  849 PRO A CG    
4600 C CD    . PRO B 553 ? 0.3780 0.3156 0.4013 0.0223  0.0279  0.0206  849 PRO A CD    
4601 N N     . GLU B 554 ? 0.2252 0.1822 0.2444 0.0333  0.0197  0.0217  850 GLU A N     
4602 C CA    . GLU B 554 ? 0.3253 0.2898 0.3442 0.0378  0.0167  0.0235  850 GLU A CA    
4603 C C     . GLU B 554 ? 0.3294 0.3037 0.3462 0.0352  0.0149  0.0237  850 GLU A C     
4604 O O     . GLU B 554 ? 0.2713 0.2552 0.2912 0.0362  0.0129  0.0221  850 GLU A O     
4605 C CB    . GLU B 554 ? 0.3717 0.3299 0.3869 0.0423  0.0157  0.0289  850 GLU A CB    
4606 C CG    . GLU B 554 ? 0.5586 0.5255 0.5764 0.0478  0.0118  0.0308  850 GLU A CG    
4607 C CD    . GLU B 554 ? 0.8470 0.8184 0.8728 0.0515  0.0125  0.0268  850 GLU A CD    
4608 O OE1   . GLU B 554 ? 0.9261 0.9086 0.9568 0.0545  0.0102  0.0267  850 GLU A OE1   
4609 O OE2   . GLU B 554 ? 0.9529 0.9167 0.9800 0.0512  0.0154  0.0234  850 GLU A OE2   
4610 N N     . VAL B 555 ? 0.1882 0.1595 0.1994 0.0316  0.0161  0.0256  851 VAL A N     
4611 C CA    . VAL B 555 ? 0.1712 0.1499 0.1792 0.0288  0.0147  0.0253  851 VAL A CA    
4612 C C     . VAL B 555 ? 0.1740 0.1589 0.1873 0.0261  0.0151  0.0206  851 VAL A C     
4613 O O     . VAL B 555 ? 0.2369 0.2301 0.2508 0.0257  0.0128  0.0195  851 VAL A O     
4614 C CB    . VAL B 555 ? 0.1783 0.1508 0.1782 0.0253  0.0173  0.0274  851 VAL A CB    
4615 C CG1   . VAL B 555 ? 0.2095 0.1880 0.2059 0.0218  0.0168  0.0256  851 VAL A CG1   
4616 C CG2   . VAL B 555 ? 0.2365 0.2030 0.2283 0.0277  0.0159  0.0329  851 VAL A CG2   
4617 N N     . MET B 556 ? 0.2081 0.1889 0.2254 0.0241  0.0175  0.0180  852 MET A N     
4618 C CA    . MET B 556 ? 0.1822 0.1677 0.2038 0.0218  0.0170  0.0142  852 MET A CA    
4619 C C     . MET B 556 ? 0.2448 0.2357 0.2689 0.0243  0.0149  0.0125  852 MET A C     
4620 O O     . MET B 556 ? 0.2115 0.2088 0.2360 0.0229  0.0136  0.0110  852 MET A O     
4621 C CB    . MET B 556 ? 0.2421 0.2224 0.2683 0.0194  0.0190  0.0122  852 MET A CB    
4622 C CG    . MET B 556 ? 0.2534 0.2302 0.2789 0.0165  0.0223  0.0133  852 MET A CG    
4623 S SD    . MET B 556 ? 0.2816 0.2544 0.3160 0.0135  0.0244  0.0111  852 MET A SD    
4624 C CE    . MET B 556 ? 0.2480 0.2273 0.2879 0.0123  0.0209  0.0075  852 MET A CE    
4625 N N     . GLU B 557 ? 0.1757 0.1633 0.2010 0.0278  0.0151  0.0127  853 GLU A N     
4626 C CA    . GLU B 557 ? 0.2325 0.2247 0.2601 0.0303  0.0145  0.0106  853 GLU A CA    
4627 C C     . GLU B 557 ? 0.3546 0.3563 0.3831 0.0324  0.0128  0.0123  853 GLU A C     
4628 O O     . GLU B 557 ? 0.3167 0.3249 0.3475 0.0328  0.0129  0.0103  853 GLU A O     
4629 C CB    . GLU B 557 ? 0.2397 0.2247 0.2683 0.0340  0.0158  0.0099  853 GLU A CB    
4630 C CG    . GLU B 557 ? 0.4198 0.3971 0.4483 0.0313  0.0167  0.0067  853 GLU A CG    
4631 C CD    . GLU B 557 ? 0.5780 0.5453 0.6064 0.0341  0.0182  0.0061  853 GLU A CD    
4632 O OE1   . GLU B 557 ? 0.5496 0.5150 0.5782 0.0386  0.0188  0.0090  853 GLU A OE1   
4633 O OE2   . GLU B 557 ? 0.6251 0.5860 0.6532 0.0317  0.0184  0.0028  853 GLU A OE2   
4634 N N     . GLN B 558 ? 0.2671 0.2698 0.2935 0.0334  0.0112  0.0160  854 GLN A N     
4635 C CA    . GLN B 558 ? 0.3171 0.3298 0.3454 0.0350  0.0085  0.0176  854 GLN A CA    
4636 C C     . GLN B 558 ? 0.2713 0.2893 0.2966 0.0301  0.0070  0.0173  854 GLN A C     
4637 O O     . GLN B 558 ? 0.2560 0.2824 0.2826 0.0303  0.0040  0.0187  854 GLN A O     
4638 C CB    . GLN B 558 ? 0.3374 0.3485 0.3649 0.0393  0.0062  0.0221  854 GLN A CB    
4639 C CG    . GLN B 558 ? 0.4635 0.4701 0.4955 0.0452  0.0076  0.0224  854 GLN A CG    
4640 C CD    . GLN B 558 ? 0.6441 0.6576 0.6832 0.0471  0.0095  0.0186  854 GLN A CD    
4641 O OE1   . GLN B 558 ? 0.6464 0.6714 0.6912 0.0484  0.0080  0.0188  854 GLN A OE1   
4642 N NE2   . GLN B 558 ? 0.7445 0.7511 0.7830 0.0468  0.0129  0.0150  854 GLN A NE2   
4643 N N     . ALA B 559 ? 0.2327 0.2462 0.2549 0.0258  0.0087  0.0154  855 ALA A N     
4644 C CA    . ALA B 559 ? 0.3090 0.3251 0.3274 0.0215  0.0078  0.0150  855 ALA A CA    
4645 C C     . ALA B 559 ? 0.3477 0.3736 0.3693 0.0200  0.0060  0.0136  855 ALA A C     
4646 O O     . ALA B 559 ? 0.2557 0.2862 0.2749 0.0176  0.0037  0.0143  855 ALA A O     
4647 C CB    . ALA B 559 ? 0.3028 0.3128 0.3201 0.0181  0.0104  0.0128  855 ALA A CB    
4648 N N     . VAL B 560 ? 0.2644 0.2930 0.2905 0.0207  0.0073  0.0116  856 VAL A N     
4649 C CA    . VAL B 560 ? 0.3162 0.3543 0.3462 0.0195  0.0067  0.0107  856 VAL A CA    
4650 C C     . VAL B 560 ? 0.3024 0.3432 0.3377 0.0237  0.0086  0.0099  856 VAL A C     
4651 O O     . VAL B 560 ? 0.3960 0.4298 0.4307 0.0266  0.0102  0.0095  856 VAL A O     
4652 C CB    . VAL B 560 ? 0.3323 0.3696 0.3601 0.0145  0.0076  0.0085  856 VAL A CB    
4653 C CG1   . VAL B 560 ? 0.2083 0.2417 0.2309 0.0108  0.0065  0.0086  856 VAL A CG1   
4654 C CG2   . VAL B 560 ? 0.3099 0.3404 0.3366 0.0148  0.0097  0.0067  856 VAL A CG2   
4655 N N     . THR B 561 ? 0.2429 0.2938 0.2837 0.0237  0.0088  0.0095  857 THR A N     
4656 C CA    . THR B 561 ? 0.3549 0.4091 0.4010 0.0273  0.0121  0.0080  857 THR A CA    
4657 C C     . THR B 561 ? 0.3174 0.3725 0.3614 0.0232  0.0150  0.0054  857 THR A C     
4658 O O     . THR B 561 ? 0.3592 0.4221 0.4054 0.0194  0.0148  0.0054  857 THR A O     
4659 C CB    . THR B 561 ? 0.4823 0.5483 0.5382 0.0311  0.0110  0.0096  857 THR A CB    
4660 O OG1   . THR B 561 ? 0.6035 0.6676 0.6593 0.0344  0.0070  0.0130  857 THR A OG1   
4661 C CG2   . THR B 561 ? 0.4379 0.5058 0.4997 0.0359  0.0155  0.0077  857 THR A CG2   
4662 N N     . LEU B 562 ? 0.2565 0.3029 0.2952 0.0233  0.0174  0.0033  858 LEU A N     
4663 C CA    . LEU B 562 ? 0.2318 0.2776 0.2664 0.0199  0.0202  0.0011  858 LEU A CA    
4664 C C     . LEU B 562 ? 0.2702 0.3187 0.3075 0.0234  0.0250  -0.0011 858 LEU A C     
4665 O O     . LEU B 562 ? 0.2839 0.3334 0.3265 0.0289  0.0259  -0.0011 858 LEU A O     
4666 C CB    . LEU B 562 ? 0.2320 0.2664 0.2581 0.0174  0.0190  0.0001  858 LEU A CB    
4667 C CG    . LEU B 562 ? 0.3096 0.3402 0.3342 0.0148  0.0153  0.0018  858 LEU A CG    
4668 C CD1   . LEU B 562 ? 0.3576 0.3784 0.3767 0.0133  0.0140  0.0007  858 LEU A CD1   
4669 C CD2   . LEU B 562 ? 0.3115 0.3479 0.3365 0.0106  0.0145  0.0028  858 LEU A CD2   
4670 N N     . ARG B 563 ? 0.2702 0.3188 0.3030 0.0201  0.0285  -0.0029 859 ARG A N     
4671 C CA    . ARG B 563 ? 0.2352 0.2841 0.2675 0.0226  0.0344  -0.0058 859 ARG A CA    
4672 C C     . ARG B 563 ? 0.2490 0.2852 0.2736 0.0251  0.0348  -0.0083 859 ARG A C     
4673 O O     . ARG B 563 ? 0.2259 0.2602 0.2489 0.0277  0.0399  -0.0114 859 ARG A O     
4674 C CB    . ARG B 563 ? 0.2474 0.2982 0.2742 0.0174  0.0383  -0.0068 859 ARG A CB    
4675 C CG    . ARG B 563 ? 0.2910 0.3547 0.3264 0.0143  0.0388  -0.0049 859 ARG A CG    
4676 C CD    . ARG B 563 ? 0.3978 0.4613 0.4262 0.0081  0.0428  -0.0053 859 ARG A CD    
4677 N NE    . ARG B 563 ? 0.4558 0.5324 0.4942 0.0047  0.0440  -0.0039 859 ARG A NE    
4678 C CZ    . ARG B 563 ? 0.6093 0.6863 0.6461 -0.0011 0.0406  -0.0018 859 ARG A CZ    
4679 N NH1   . ARG B 563 ? 0.4195 0.4845 0.4456 -0.0035 0.0362  -0.0007 859 ARG A NH1   
4680 N NH2   . ARG B 563 ? 0.7016 0.7909 0.7482 -0.0046 0.0417  -0.0009 859 ARG A NH2   
4681 N N     . VAL B 564 ? 0.1753 0.2028 0.1950 0.0238  0.0299  -0.0074 860 VAL A N     
4682 C CA    . VAL B 564 ? 0.2151 0.2312 0.2295 0.0256  0.0293  -0.0096 860 VAL A CA    
4683 C C     . VAL B 564 ? 0.2064 0.2204 0.2262 0.0280  0.0255  -0.0073 860 VAL A C     
4684 O O     . VAL B 564 ? 0.2214 0.2404 0.2452 0.0267  0.0226  -0.0042 860 VAL A O     
4685 C CB    . VAL B 564 ? 0.2293 0.2361 0.2322 0.0208  0.0270  -0.0110 860 VAL A CB    
4686 C CG1   . VAL B 564 ? 0.2623 0.2699 0.2574 0.0181  0.0312  -0.0128 860 VAL A CG1   
4687 C CG2   . VAL B 564 ? 0.1717 0.1784 0.1751 0.0173  0.0218  -0.0081 860 VAL A CG2   
4688 N N     . PRO B 565 ? 0.2558 0.2617 0.2750 0.0311  0.0259  -0.0087 861 PRO A N     
4689 C CA    . PRO B 565 ? 0.1935 0.1962 0.2167 0.0328  0.0229  -0.0062 861 PRO A CA    
4690 C C     . PRO B 565 ? 0.1522 0.1512 0.1726 0.0280  0.0190  -0.0051 861 PRO A C     
4691 O O     . PRO B 565 ? 0.2279 0.2232 0.2428 0.0244  0.0178  -0.0069 861 PRO A O     
4692 C CB    . PRO B 565 ? 0.2754 0.2680 0.2970 0.0361  0.0248  -0.0086 861 PRO A CB    
4693 C CG    . PRO B 565 ? 0.2779 0.2700 0.2957 0.0373  0.0292  -0.0127 861 PRO A CG    
4694 C CD    . PRO B 565 ? 0.2454 0.2431 0.2588 0.0326  0.0291  -0.0130 861 PRO A CD    
4695 N N     . LEU B 566 ? 0.2045 0.2041 0.2285 0.0282  0.0172  -0.0020 862 LEU A N     
4696 C CA    . LEU B 566 ? 0.2251 0.2198 0.2484 0.0248  0.0147  -0.0015 862 LEU A CA    
4697 C C     . LEU B 566 ? 0.2902 0.2756 0.3138 0.0259  0.0149  -0.0024 862 LEU A C     
4698 O O     . LEU B 566 ? 0.3401 0.3232 0.3654 0.0298  0.0166  -0.0015 862 LEU A O     
4699 C CB    . LEU B 566 ? 0.1715 0.1707 0.1974 0.0239  0.0136  0.0017  862 LEU A CB    
4700 C CG    . LEU B 566 ? 0.2812 0.2880 0.3063 0.0215  0.0130  0.0021  862 LEU A CG    
4701 C CD1   . LEU B 566 ? 0.2655 0.2762 0.2919 0.0209  0.0122  0.0047  862 LEU A CD1   
4702 C CD2   . LEU B 566 ? 0.3068 0.3108 0.3294 0.0177  0.0115  0.0007  862 LEU A CD2   
4703 N N     . LYS B 567 ? 0.2873 0.2672 0.3100 0.0225  0.0129  -0.0040 863 LYS A N     
4704 C CA    . LYS B 567 ? 0.2018 0.1729 0.2256 0.0223  0.0129  -0.0051 863 LYS A CA    
4705 C C     . LYS B 567 ? 0.2506 0.2210 0.2794 0.0192  0.0116  -0.0033 863 LYS A C     
4706 O O     . LYS B 567 ? 0.2489 0.2231 0.2795 0.0164  0.0096  -0.0032 863 LYS A O     
4707 C CB    . LYS B 567 ? 0.2851 0.2500 0.3042 0.0205  0.0115  -0.0093 863 LYS A CB    
4708 C CG    . LYS B 567 ? 0.3404 0.2953 0.3598 0.0206  0.0120  -0.0112 863 LYS A CG    
4709 C CD    . LYS B 567 ? 0.5267 0.4748 0.5407 0.0174  0.0093  -0.0157 863 LYS A CD    
4710 C CE    . LYS B 567 ? 0.6200 0.5570 0.6333 0.0177  0.0105  -0.0182 863 LYS A CE    
4711 N NZ    . LYS B 567 ? 0.7119 0.6412 0.7185 0.0140  0.0074  -0.0232 863 LYS A NZ    
4712 N N     . VAL B 568 ? 0.1952 0.1601 0.2265 0.0198  0.0134  -0.0019 864 VAL A N     
4713 C CA    . VAL B 568 ? 0.2655 0.2297 0.3020 0.0170  0.0139  -0.0001 864 VAL A CA    
4714 C C     . VAL B 568 ? 0.2457 0.2012 0.2849 0.0149  0.0141  -0.0016 864 VAL A C     
4715 O O     . VAL B 568 ? 0.2777 0.2262 0.3143 0.0171  0.0158  -0.0015 864 VAL A O     
4716 C CB    . VAL B 568 ? 0.2913 0.2570 0.3268 0.0189  0.0167  0.0040  864 VAL A CB    
4717 C CG1   . VAL B 568 ? 0.3347 0.2978 0.3744 0.0157  0.0189  0.0056  864 VAL A CG1   
4718 C CG2   . VAL B 568 ? 0.2330 0.2074 0.2663 0.0198  0.0159  0.0050  864 VAL A CG2   
4719 N N     . ASP B 569 ? 0.1974 0.1535 0.2426 0.0107  0.0120  -0.0031 865 ASP A N     
4720 C CA    . ASP B 569 ? 0.2984 0.2478 0.3489 0.0074  0.0123  -0.0041 865 ASP A CA    
4721 C C     . ASP B 569 ? 0.2897 0.2402 0.3466 0.0056  0.0162  -0.0009 865 ASP A C     
4722 O O     . ASP B 569 ? 0.2816 0.2389 0.3411 0.0055  0.0172  0.0006  865 ASP A O     
4723 C CB    . ASP B 569 ? 0.3045 0.2548 0.3595 0.0034  0.0072  -0.0076 865 ASP A CB    
4724 C CG    . ASP B 569 ? 0.6917 0.6394 0.7377 0.0044  0.0036  -0.0110 865 ASP A CG    
4725 O OD1   . ASP B 569 ? 0.7173 0.6582 0.7563 0.0068  0.0056  -0.0123 865 ASP A OD1   
4726 O OD2   . ASP B 569 ? 0.7756 0.7275 0.8212 0.0028  -0.0010 -0.0123 865 ASP A OD2   
4727 N N     . TYR B 570 ? 0.2394 0.1821 0.2983 0.0038  0.0190  -0.0002 866 TYR A N     
4728 C CA    . TYR B 570 ? 0.2093 0.1516 0.2724 0.0018  0.0240  0.0030  866 TYR A CA    
4729 C C     . TYR B 570 ? 0.2841 0.2196 0.3542 -0.0030 0.0256  0.0022  866 TYR A C     
4730 O O     . TYR B 570 ? 0.2676 0.1953 0.3357 -0.0035 0.0236  0.0001  866 TYR A O     
4731 C CB    . TYR B 570 ? 0.2379 0.1767 0.2918 0.0055  0.0276  0.0073  866 TYR A CB    
4732 C CG    . TYR B 570 ? 0.3431 0.2725 0.3905 0.0086  0.0274  0.0078  866 TYR A CG    
4733 C CD1   . TYR B 570 ? 0.3073 0.2259 0.3538 0.0073  0.0308  0.0101  866 TYR A CD1   
4734 C CD2   . TYR B 570 ? 0.3956 0.3263 0.4381 0.0129  0.0243  0.0059  866 TYR A CD2   
4735 C CE1   . TYR B 570 ? 0.3780 0.2866 0.4190 0.0107  0.0307  0.0105  866 TYR A CE1   
4736 C CE2   . TYR B 570 ? 0.4218 0.3437 0.4596 0.0164  0.0247  0.0059  866 TYR A CE2   
4737 C CZ    . TYR B 570 ? 0.4348 0.3453 0.4719 0.0156  0.0276  0.0083  866 TYR A CZ    
4738 O OH    . TYR B 570 ? 0.5544 0.4550 0.5872 0.0197  0.0281  0.0084  866 TYR A OH    
4739 N N     . HIS B 571 ? 0.2214 0.1599 0.3002 -0.0066 0.0294  0.0036  867 HIS A N     
4740 C CA    . HIS B 571 ? 0.2719 0.2056 0.3597 -0.0121 0.0319  0.0032  867 HIS A CA    
4741 C C     . HIS B 571 ? 0.2771 0.2117 0.3680 -0.0142 0.0397  0.0067  867 HIS A C     
4742 O O     . HIS B 571 ? 0.2194 0.1598 0.3076 -0.0120 0.0421  0.0084  867 HIS A O     
4743 C CB    . HIS B 571 ? 0.3170 0.2570 0.4182 -0.0164 0.0267  -0.0010 867 HIS A CB    
4744 C CG    . HIS B 571 ? 0.5499 0.4887 0.6457 -0.0149 0.0190  -0.0047 867 HIS A CG    
4745 N ND1   . HIS B 571 ? 0.5739 0.5199 0.6664 -0.0117 0.0144  -0.0058 867 HIS A ND1   
4746 C CD2   . HIS B 571 ? 0.6240 0.5539 0.7157 -0.0164 0.0158  -0.0076 867 HIS A CD2   
4747 C CE1   . HIS B 571 ? 0.5987 0.5407 0.6848 -0.0114 0.0089  -0.0091 867 HIS A CE1   
4748 N NE2   . HIS B 571 ? 0.6033 0.5354 0.6887 -0.0141 0.0096  -0.0106 867 HIS A NE2   
4749 N N     . TYR B 572 ? 0.2454 0.1732 0.3411 -0.0189 0.0441  0.0078  868 TYR A N     
4750 C CA    . TYR B 572 ? 0.2480 0.1761 0.3470 -0.0219 0.0525  0.0109  868 TYR A CA    
4751 C C     . TYR B 572 ? 0.2427 0.1709 0.3575 -0.0291 0.0550  0.0093  868 TYR A C     
4752 O O     . TYR B 572 ? 0.2638 0.1876 0.3827 -0.0317 0.0504  0.0067  868 TYR A O     
4753 C CB    . TYR B 572 ? 0.2168 0.1336 0.2995 -0.0197 0.0576  0.0161  868 TYR A CB    
4754 C CG    . TYR B 572 ? 0.3182 0.2210 0.3956 -0.0207 0.0575  0.0176  868 TYR A CG    
4755 C CD1   . TYR B 572 ? 0.3323 0.2270 0.4139 -0.0267 0.0637  0.0195  868 TYR A CD1   
4756 C CD2   . TYR B 572 ? 0.3798 0.2768 0.4482 -0.0156 0.0518  0.0170  868 TYR A CD2   
4757 C CE1   . TYR B 572 ? 0.4646 0.3447 0.5410 -0.0278 0.0638  0.0209  868 TYR A CE1   
4758 C CE2   . TYR B 572 ? 0.4062 0.2890 0.4698 -0.0160 0.0521  0.0180  868 TYR A CE2   
4759 C CZ    . TYR B 572 ? 0.5000 0.3737 0.5673 -0.0222 0.0579  0.0201  868 TYR A CZ    
4760 O OH    . TYR B 572 ? 0.5409 0.3987 0.6032 -0.0228 0.0584  0.0213  868 TYR A OH    
4761 N N     . GLY B 573 ? 0.2331 0.1668 0.3575 -0.0325 0.0623  0.0103  869 GLY A N     
4762 C CA    . GLY B 573 ? 0.2156 0.1510 0.3573 -0.0398 0.0657  0.0091  869 GLY A CA    
4763 C C     . GLY B 573 ? 0.2353 0.1758 0.3845 -0.0426 0.0762  0.0109  869 GLY A C     
4764 O O     . GLY B 573 ? 0.2252 0.1653 0.3630 -0.0390 0.0809  0.0133  869 GLY A O     
4765 N N     . SER B 574 ? 0.2204 0.1656 0.3889 -0.0493 0.0800  0.0095  870 SER A N     
4766 C CA    . SER B 574 ? 0.2815 0.2314 0.4589 -0.0527 0.0917  0.0109  870 SER A CA    
4767 C C     . SER B 574 ? 0.2628 0.2290 0.4556 -0.0502 0.0917  0.0079  870 SER A C     
4768 O O     . SER B 574 ? 0.2926 0.2632 0.4920 -0.0518 0.1022  0.0085  870 SER A O     
4769 C CB    . SER B 574 ? 0.3827 0.3312 0.5760 -0.0616 0.0972  0.0109  870 SER A CB    
4770 O OG    . SER B 574 ? 0.4749 0.4345 0.6905 -0.0645 0.0890  0.0064  870 SER A OG    
4771 N N     . THR B 575 ? 0.1994 0.1739 0.3983 -0.0464 0.0806  0.0048  871 THR A N     
4772 C CA    . THR B 575 ? 0.1883 0.1762 0.3992 -0.0426 0.0792  0.0025  871 THR A CA    
4773 C C     . THR B 575 ? 0.1795 0.1670 0.3776 -0.0362 0.0684  0.0016  871 THR A C     
4774 O O     . THR B 575 ? 0.1812 0.1606 0.3661 -0.0354 0.0617  0.0019  871 THR A O     
4775 C CB    . THR B 575 ? 0.2699 0.2719 0.5107 -0.0461 0.0759  -0.0007 871 THR A CB    
4776 O OG1   . THR B 575 ? 0.3752 0.3780 0.6178 -0.0460 0.0622  -0.0028 871 THR A OG1   
4777 C CG2   . THR B 575 ? 0.1923 0.1952 0.4487 -0.0539 0.0848  -0.0002 871 THR A CG2   
4778 N N     . TRP B 576 ? 0.1710 0.1672 0.3738 -0.0318 0.0674  0.0003  872 TRP A N     
4779 C CA    . TRP B 576 ? 0.2503 0.2473 0.4435 -0.0265 0.0572  -0.0006 872 TRP A CA    
4780 C C     . TRP B 576 ? 0.1964 0.1956 0.3969 -0.0281 0.0455  -0.0026 872 TRP A C     
4781 O O     . TRP B 576 ? 0.2139 0.2073 0.3997 -0.0259 0.0382  -0.0028 872 TRP A O     
4782 C CB    . TRP B 576 ? 0.1840 0.1898 0.3849 -0.0224 0.0582  -0.0018 872 TRP A CB    
4783 C CG    . TRP B 576 ? 0.2361 0.2411 0.4242 -0.0172 0.0505  -0.0020 872 TRP A CG    
4784 C CD1   . TRP B 576 ? 0.2283 0.2263 0.3983 -0.0155 0.0440  -0.0012 872 TRP A CD1   
4785 C CD2   . TRP B 576 ? 0.1854 0.1965 0.3781 -0.0130 0.0491  -0.0030 872 TRP A CD2   
4786 N NE1   . TRP B 576 ? 0.1973 0.1973 0.3605 -0.0110 0.0388  -0.0016 872 TRP A NE1   
4787 C CE2   . TRP B 576 ? 0.1886 0.1958 0.3649 -0.0095 0.0417  -0.0026 872 TRP A CE2   
4788 C CE3   . TRP B 576 ? 0.2282 0.2471 0.4377 -0.0118 0.0541  -0.0043 872 TRP A CE3   
4789 C CZ2   . TRP B 576 ? 0.2430 0.2533 0.4185 -0.0055 0.0387  -0.0031 872 TRP A CZ2   
4790 C CZ3   . TRP B 576 ? 0.2168 0.2382 0.4256 -0.0070 0.0509  -0.0050 872 TRP A CZ3   
4791 C CH2   . TRP B 576 ? 0.2744 0.2911 0.4658 -0.0042 0.0431  -0.0043 872 TRP A CH2   
4792 N N     . TYR B 577 ? 0.1686 0.1762 0.3919 -0.0323 0.0439  -0.0044 873 TYR A N     
4793 C CA    . TYR B 577 ? 0.2819 0.2914 0.5122 -0.0348 0.0323  -0.0066 873 TYR A CA    
4794 C C     . TYR B 577 ? 0.3960 0.3925 0.6103 -0.0374 0.0303  -0.0066 873 TYR A C     
4795 O O     . TYR B 577 ? 0.2914 0.2836 0.4951 -0.0361 0.0211  -0.0081 873 TYR A O     
4796 C CB    . TYR B 577 ? 0.2816 0.3024 0.5404 -0.0399 0.0321  -0.0082 873 TYR A CB    
4797 C CG    . TYR B 577 ? 0.3741 0.3965 0.6412 -0.0442 0.0202  -0.0106 873 TYR A CG    
4798 C CD1   . TYR B 577 ? 0.5190 0.5474 0.7894 -0.0416 0.0076  -0.0120 873 TYR A CD1   
4799 C CD2   . TYR B 577 ? 0.4913 0.5082 0.7618 -0.0513 0.0213  -0.0115 873 TYR A CD2   
4800 C CE1   . TYR B 577 ? 0.6344 0.6636 0.9103 -0.0460 -0.0039 -0.0145 873 TYR A CE1   
4801 C CE2   . TYR B 577 ? 0.6316 0.6491 0.9085 -0.0560 0.0101  -0.0144 873 TYR A CE2   
4802 C CZ    . TYR B 577 ? 0.6477 0.6715 0.9269 -0.0534 -0.0027 -0.0160 873 TYR A CZ    
4803 O OH    . TYR B 577 ? 0.7053 0.7288 0.9888 -0.0585 -0.0144 -0.0190 873 TYR A OH    
4804 N N     . ASP B 578 ? 0.3635 0.3525 0.5749 -0.0410 0.0395  -0.0048 874 ASP A N     
4805 C CA    . ASP B 578 ? 0.4171 0.3923 0.6145 -0.0433 0.0383  -0.0046 874 ASP A CA    
4806 C C     . ASP B 578 ? 0.4471 0.4127 0.6199 -0.0372 0.0376  -0.0029 874 ASP A C     
4807 O O     . ASP B 578 ? 0.4587 0.4138 0.6196 -0.0373 0.0342  -0.0035 874 ASP A O     
4808 C CB    . ASP B 578 ? 0.4220 0.3909 0.6233 -0.0490 0.0486  -0.0025 874 ASP A CB    
4809 C CG    . ASP B 578 ? 0.6033 0.5831 0.8313 -0.0556 0.0505  -0.0042 874 ASP A CG    
4810 O OD1   . ASP B 578 ? 0.7052 0.6912 0.9433 -0.0565 0.0603  -0.0026 874 ASP A OD1   
4811 O OD2   . ASP B 578 ? 0.6421 0.6243 0.8812 -0.0599 0.0421  -0.0073 874 ASP A OD2   
4812 N N     . ALA B 579 ? 0.2735 0.2427 0.4390 -0.0320 0.0408  -0.0011 875 ALA A N     
4813 C CA    . ALA B 579 ? 0.2459 0.2082 0.3902 -0.0263 0.0394  0.0004  875 ALA A CA    
4814 C C     . ALA B 579 ? 0.5079 0.4730 0.6488 -0.0235 0.0289  -0.0024 875 ALA A C     
4815 O O     . ALA B 579 ? 0.4271 0.3963 0.5616 -0.0190 0.0265  -0.0022 875 ALA A O     
4816 C CB    . ALA B 579 ? 0.3390 0.3040 0.4766 -0.0227 0.0457  0.0030  875 ALA A CB    
4817 N N     . LYS B 580 ? 0.7776 0.7395 0.9222 -0.0270 0.0230  -0.0052 876 LYS A N     
4818 C CA    . LYS B 580 ? 0.9619 0.9255 1.1038 -0.0260 0.0128  -0.0083 876 LYS A CA    
4819 C C     . LYS B 580 ? 1.0776 1.0292 1.2081 -0.0272 0.0098  -0.0105 876 LYS A C     
4820 O O     . LYS B 580 ? 1.1037 1.0463 1.2328 -0.0297 0.0145  -0.0097 876 LYS A O     
4821 C CB    . LYS B 580 ? 0.9962 0.9698 1.1574 -0.0299 0.0068  -0.0105 876 LYS A CB    
4822 C CG    . LYS B 580 ? 0.9990 0.9697 1.1712 -0.0370 0.0055  -0.0127 876 LYS A CG    
4823 C CD    . LYS B 580 ? 0.9928 0.9751 1.1856 -0.0408 -0.0020 -0.0147 876 LYS A CD    
4824 C CE    . LYS B 580 ? 1.0202 1.0011 1.2269 -0.0488 -0.0020 -0.0166 876 LYS A CE    
4825 N NZ    . LYS B 580 ? 1.0331 1.0108 1.2440 -0.0511 0.0104  -0.0140 876 LYS A NZ    
4826 O OXT   . LYS B 580 ? 1.1230 1.0726 1.2449 -0.0256 0.0029  -0.0130 876 LYS A OXT   
4827 P P     . DT  C 1   ? 1.5303 1.6164 1.3238 -0.5707 0.6592  -0.4115 4   DT  T P     
4828 O OP1   . DT  C 1   ? 1.4700 1.5431 1.2444 -0.6136 0.6905  -0.4239 4   DT  T OP1   
4829 O OP2   . DT  C 1   ? 1.3662 1.4963 1.1870 -0.4988 0.6189  -0.3916 4   DT  T OP2   
4830 O "O5'" . DT  C 1   ? 1.4350 1.6247 1.3439 -0.5842 0.6548  -0.4586 4   DT  T "O5'" 
4831 C "C5'" . DT  C 1   ? 1.2445 1.4920 1.2065 -0.5402 0.6202  -0.4603 4   DT  T "C5'" 
4832 C "C4'" . DT  C 1   ? 1.1891 1.5767 1.2856 -0.5399 0.6047  -0.5084 4   DT  T "C4'" 
4833 O "O4'" . DT  C 1   ? 1.1161 1.5940 1.2919 -0.5070 0.5869  -0.5181 4   DT  T "O4'" 
4834 C "C3'" . DT  C 1   ? 1.0891 1.5440 1.2427 -0.4933 0.5592  -0.5109 4   DT  T "C3'" 
4835 O "O3'" . DT  C 1   ? 1.1861 1.5967 1.3175 -0.5297 0.5611  -0.5273 4   DT  T "O3'" 
4836 C "C2'" . DT  C 1   ? 1.0059 1.6108 1.2890 -0.4658 0.5338  -0.5409 4   DT  T "C2'" 
4837 C "C1'" . DT  C 1   ? 1.0631 1.6523 1.3370 -0.4505 0.5408  -0.5243 4   DT  T "C1'" 
4838 N N1    . DT  C 1   ? 1.0152 1.5900 1.2717 -0.3865 0.5116  -0.4824 4   DT  T N1    
4839 C C2    . DT  C 1   ? 0.9401 1.6006 1.2724 -0.3245 0.4646  -0.4736 4   DT  T C2    
4840 O O2    . DT  C 1   ? 0.9737 1.7244 1.3835 -0.3151 0.4414  -0.4955 4   DT  T O2    
4841 N N3    . DT  C 1   ? 0.8702 1.5035 1.1786 -0.2735 0.4438  -0.4361 4   DT  T N3    
4842 C C4    . DT  C 1   ? 0.8869 1.4246 1.1060 -0.2766 0.4623  -0.4108 4   DT  T C4    
4843 O O4    . DT  C 1   ? 0.8268 1.3504 1.0335 -0.2299 0.4405  -0.3824 4   DT  T O4    
4844 C C5    . DT  C 1   ? 0.9448 1.3981 1.0819 -0.3390 0.5071  -0.4187 4   DT  T C5    
4845 C C7    . DT  C 1   ? 1.0302 1.3767 1.0572 -0.3444 0.5237  -0.3887 4   DT  T C7    
4846 C C6    . DT  C 1   ? 0.9911 1.4639 1.1506 -0.3908 0.5305  -0.4519 4   DT  T C6    
4847 P P     . DA  C 2   ? 1.1669 1.5217 1.2576 -0.4852 0.5091  -0.5019 5   DA  T P     
4848 O OP1   . DA  C 2   ? 1.2626 1.5581 1.3282 -0.5391 0.5272  -0.5282 5   DA  T OP1   
4849 O OP2   . DA  C 2   ? 1.1851 1.4391 1.1852 -0.4388 0.4876  -0.4455 5   DA  T OP2   
4850 O "O5'" . DA  C 2   ? 1.1410 1.6557 1.3464 -0.4313 0.4626  -0.5192 5   DA  T "O5'" 
4851 C "C5'" . DA  C 2   ? 1.1360 1.7912 1.4521 -0.4565 0.4713  -0.5727 5   DA  T "C5'" 
4852 C "C4'" . DA  C 2   ? 1.0317 1.8254 1.4390 -0.3907 0.4211  -0.5710 5   DA  T "C4'" 
4853 O "O4'" . DA  C 2   ? 0.9620 1.7805 1.3906 -0.3488 0.4177  -0.5430 5   DA  T "O4'" 
4854 C "C3'" . DA  C 2   ? 0.9662 1.7369 1.3391 -0.3413 0.3695  -0.5439 5   DA  T "C3'" 
4855 O "O3'" . DA  C 2   ? 0.9952 1.8669 1.4316 -0.3505 0.3502  -0.5853 5   DA  T "O3'" 
4856 C "C2'" . DA  C 2   ? 0.8441 1.6625 1.2434 -0.2685 0.3337  -0.5028 5   DA  T "C2'" 
4857 C "C1'" . DA  C 2   ? 0.8465 1.6627 1.2623 -0.2794 0.3691  -0.4999 5   DA  T "C1'" 
4858 N N9    . DA  C 2   ? 0.8359 1.5282 1.1593 -0.2655 0.3764  -0.4564 5   DA  T N9    
4859 C C8    . DA  C 2   ? 0.9227 1.4895 1.1519 -0.3092 0.4131  -0.4487 5   DA  T C8    
4860 N N7    . DA  C 2   ? 0.9146 1.3994 1.0746 -0.2813 0.4070  -0.4079 5   DA  T N7    
4861 C C5    . DA  C 2   ? 0.8265 1.3846 1.0430 -0.2181 0.3667  -0.3892 5   DA  T C5    
4862 C C6    . DA  C 2   ? 0.7902 1.3198 0.9828 -0.1679 0.3439  -0.3502 5   DA  T C6    
4863 N N6    . DA  C 2   ? 0.7847 1.2077 0.8865 -0.1714 0.3557  -0.3246 5   DA  T N6    
4864 N N1    . DA  C 2   ? 0.8145 1.4308 1.0791 -0.1147 0.3080  -0.3380 5   DA  T N1    
4865 C C2    . DA  C 2   ? 0.7293 1.4571 1.0799 -0.1088 0.2931  -0.3611 5   DA  T C2    
4866 N N3    . DA  C 2   ? 0.7005 1.4752 1.0837 -0.1509 0.3088  -0.4015 5   DA  T N3    
4867 C C4    . DA  C 2   ? 0.7817 1.4645 1.0958 -0.2068 0.3475  -0.4153 5   DA  T C4    
4868 P P     . DC  C 3   ? 1.0540 1.8868 1.4445 -0.3348 0.3153  -0.5833 6   DC  T P     
4869 O OP1   . DC  C 3   ? 1.0813 2.0242 1.5435 -0.3674 0.3122  -0.6427 6   DC  T OP1   
4870 O OP2   . DC  C 3   ? 1.1543 1.8089 1.4304 -0.3515 0.3323  -0.5568 6   DC  T OP2   
4871 O "O5'" . DC  C 3   ? 0.9107 1.8029 1.3162 -0.2536 0.2622  -0.5404 6   DC  T "O5'" 
4872 C "C5'" . DC  C 3   ? 0.7756 1.8182 1.2778 -0.2186 0.2402  -0.5430 6   DC  T "C5'" 
4873 C "C4'" . DC  C 3   ? 0.6850 1.7461 1.1780 -0.1465 0.1952  -0.4926 6   DC  T "C4'" 
4874 O "O4'" . DC  C 3   ? 0.6599 1.6341 1.1118 -0.1248 0.2069  -0.4485 6   DC  T "O4'" 
4875 C "C3'" . DC  C 3   ? 0.6288 1.6399 1.0570 -0.1290 0.1665  -0.4812 6   DC  T "C3'" 
4876 O "O3'" . DC  C 3   ? 0.5446 1.6688 1.0154 -0.0794 0.1221  -0.4676 6   DC  T "O3'" 
4877 C "C2'" . DC  C 3   ? 0.6441 1.5114 0.9830 -0.1110 0.1726  -0.4345 6   DC  T "C2'" 
4878 C "C1'" . DC  C 3   ? 0.6307 1.5213 1.0070 -0.0905 0.1829  -0.4087 6   DC  T "C1'" 
4879 N N1    . DC  C 3   ? 0.7316 1.4898 1.0336 -0.1003 0.2093  -0.3826 6   DC  T N1    
4880 C C2    . DC  C 3   ? 0.7002 1.4433 0.9982 -0.0580 0.1999  -0.3416 6   DC  T C2    
4881 O O2    . DC  C 3   ? 0.6418 1.4722 0.9976 -0.0131 0.1714  -0.3239 6   DC  T O2    
4882 N N3    . DC  C 3   ? 0.7186 1.3510 0.9477 -0.0682 0.2223  -0.3222 6   DC  T N3    
4883 C C4    . DC  C 3   ? 0.8314 1.3673 0.9932 -0.1159 0.2523  -0.3359 6   DC  T C4    
4884 N N4    . DC  C 3   ? 0.8884 1.3217 0.9774 -0.1226 0.2712  -0.3129 6   DC  T N4    
4885 C C5    . DC  C 3   ? 0.8455 1.3851 1.0104 -0.1601 0.2647  -0.3737 6   DC  T C5    
4886 C C6    . DC  C 3   ? 0.8023 1.4559 1.0402 -0.1516 0.2429  -0.3990 6   DC  T C6    
4887 P P     . DG  C 4   ? 0.5470 1.6586 0.9665 -0.0547 0.0880  -0.4601 7   DG  T P     
4888 O OP1   . DG  C 4   ? 0.5037 1.7695 0.9855 -0.0282 0.0515  -0.4699 7   DG  T OP1   
4889 O OP2   . DG  C 4   ? 0.6251 1.6274 0.9812 -0.0994 0.1094  -0.4908 7   DG  T OP2   
4890 O "O5'" . DG  C 4   ? 0.5171 1.5558 0.8862 -0.0044 0.0738  -0.3977 7   DG  T "O5'" 
4891 C "C5'" . DG  C 4   ? 0.4701 1.5535 0.8835 0.0312  0.0677  -0.3610 7   DG  T "C5'" 
4892 C "C4'" . DG  C 4   ? 0.4822 1.5147 0.8504 0.0784  0.0474  -0.3084 7   DG  T "C4'" 
4893 O "O4'" . DG  C 4   ? 0.4584 1.3710 0.7787 0.0707  0.0731  -0.2885 7   DG  T "O4'" 
4894 C "C3'" . DG  C 4   ? 0.4518 1.4570 0.7612 0.0905  0.0250  -0.3072 7   DG  T "C3'" 
4895 O "O3'" . DG  C 4   ? 0.4096 1.4521 0.7188 0.1394  -0.0053 -0.2632 7   DG  T "O3'" 
4896 C "C2'" . DG  C 4   ? 0.5044 1.3567 0.7327 0.0713  0.0471  -0.3040 7   DG  T "C2'" 
4897 C "C1'" . DG  C 4   ? 0.4948 1.3021 0.7305 0.0710  0.0700  -0.2796 7   DG  T "C1'" 
4898 N N9    . DG  C 4   ? 0.5678 1.2634 0.7535 0.0284  0.1053  -0.2945 7   DG  T N9    
4899 C C8    . DG  C 4   ? 0.6199 1.2872 0.7952 -0.0222 0.1289  -0.3354 7   DG  T C8    
4900 N N7    . DG  C 4   ? 0.6890 1.2459 0.8099 -0.0535 0.1605  -0.3334 7   DG  T N7    
4901 C C5    . DG  C 4   ? 0.6558 1.1720 0.7503 -0.0205 0.1556  -0.2921 7   DG  T C5    
4902 C C6    . DG  C 4   ? 0.7600 1.1701 0.7916 -0.0319 0.1785  -0.2724 7   DG  T C6    
4903 O O6    . DG  C 4   ? 0.8093 1.1331 0.7896 -0.0742 0.2094  -0.2827 7   DG  T O6    
4904 N N1    . DG  C 4   ? 0.7842 1.1949 0.8131 0.0101  0.1631  -0.2369 7   DG  T N1    
4905 C C2    . DG  C 4   ? 0.7473 1.2420 0.8275 0.0554  0.1323  -0.2191 7   DG  T C2    
4906 N N2    . DG  C 4   ? 0.6012 1.0782 0.6733 0.0869  0.1247  -0.1874 7   DG  T N2    
4907 N N3    . DG  C 4   ? 0.5406 1.1310 0.6741 0.0673  0.1110  -0.2313 7   DG  T N3    
4908 C C4    . DG  C 4   ? 0.5806 1.1796 0.7180 0.0287  0.1229  -0.2693 7   DG  T C4    
4909 P P     . DT  C 5   ? 0.4133 1.4537 0.6714 0.1617  -0.0313 -0.2565 8   DT  T P     
4910 O OP1   . DT  C 5   ? 0.4192 1.4585 0.6558 0.1860  -0.0534 -0.2085 8   DT  T OP1   
4911 O OP2   . DT  C 5   ? 0.6534 1.6969 0.8964 0.1286  -0.0274 -0.3106 8   DT  T OP2   
4912 O "O5'" . DT  C 5   ? 0.4220 1.3418 0.6187 0.1750  -0.0223 -0.2294 8   DT  T "O5'" 
4913 C "C5'" . DT  C 5   ? 0.3925 1.2836 0.5989 0.1963  -0.0163 -0.1884 8   DT  T "C5'" 
4914 C "C4'" . DT  C 5   ? 0.4178 1.1880 0.5554 0.2004  -0.0085 -0.1733 8   DT  T "C4'" 
4915 O "O4'" . DT  C 5   ? 0.4639 1.1436 0.5746 0.1650  0.0214  -0.1902 8   DT  T "O4'" 
4916 C "C3'" . DT  C 5   ? 0.4459 1.1806 0.5278 0.2076  -0.0233 -0.1854 8   DT  T "C3'" 
4917 O "O3'" . DT  C 5   ? 0.4968 1.2268 0.5607 0.2443  -0.0395 -0.1511 8   DT  T "O3'" 
4918 C "C2'" . DT  C 5   ? 0.5661 1.1770 0.5912 0.1773  -0.0014 -0.2057 8   DT  T "C2'" 
4919 C "C1'" . DT  C 5   ? 0.5099 1.0847 0.5459 0.1645  0.0220  -0.1895 8   DT  T "C1'" 
4920 N N1    . DT  C 5   ? 0.5786 1.0619 0.5770 0.1218  0.0515  -0.2115 8   DT  T N1    
4921 C C2    . DT  C 5   ? 0.6142 1.0064 0.5679 0.1164  0.0687  -0.1927 8   DT  T C2    
4922 O O2    . DT  C 5   ? 0.5877 0.9728 0.5361 0.1443  0.0608  -0.1632 8   DT  T O2    
4923 N N3    . DT  C 5   ? 0.6818 0.9928 0.5958 0.0742  0.0969  -0.2105 8   DT  T N3    
4924 C C4    . DT  C 5   ? 0.7871 1.0944 0.7061 0.0354  0.1113  -0.2464 8   DT  T C4    
4925 O O4    . DT  C 5   ? 0.8215 1.0467 0.7008 -0.0046 0.1401  -0.2576 8   DT  T O4    
4926 C C5    . DT  C 5   ? 0.6896 1.0980 0.6620 0.0430  0.0912  -0.2705 8   DT  T C5    
4927 C C7    . DT  C 5   ? 0.7383 1.1584 0.7259 0.0002  0.1047  -0.3169 8   DT  T C7    
4928 C C6    . DT  C 5   ? 0.6182 1.1101 0.6242 0.0863  0.0617  -0.2509 8   DT  T C6    
4929 P P     . DG  C 6   ? 0.6388 1.3516 0.6557 0.2633  -0.0580 -0.1585 9   DG  T P     
4930 O OP1   . DG  C 6   ? 0.5575 1.3169 0.5769 0.2728  -0.0683 -0.1331 9   DG  T OP1   
4931 O OP2   . DG  C 6   ? 0.6767 1.3487 0.6649 0.2379  -0.0529 -0.2028 9   DG  T OP2   
4932 O "O5'" . DG  C 6   ? 0.5665 1.1776 0.5364 0.2778  -0.0538 -0.1360 9   DG  T "O5'" 
4933 C "C5'" . DG  C 6   ? 0.5242 1.1277 0.5126 0.2878  -0.0468 -0.1024 9   DG  T "C5'" 
4934 C "C4'" . DG  C 6   ? 0.4822 0.9761 0.4176 0.2864  -0.0377 -0.0969 9   DG  T "C4'" 
4935 O "O4'" . DG  C 6   ? 0.4965 0.9296 0.4163 0.2525  -0.0144 -0.1123 9   DG  T "O4'" 
4936 C "C3'" . DG  C 6   ? 0.5670 1.0044 0.4467 0.3006  -0.0512 -0.1082 9   DG  T "C3'" 
4937 O "O3'" . DG  C 6   ? 0.6219 1.0758 0.5001 0.3318  -0.0655 -0.0859 9   DG  T "O3'" 
4938 C "C2'" . DG  C 6   ? 0.6735 0.9953 0.4978 0.2814  -0.0361 -0.1148 9   DG  T "C2'" 
4939 C "C1'" . DG  C 6   ? 0.6097 0.9387 0.4610 0.2457  -0.0114 -0.1216 9   DG  T "C1'" 
4940 N N9    . DG  C 6   ? 0.6520 0.9560 0.4928 0.2139  0.0004  -0.1529 9   DG  T N9    
4941 C C8    . DG  C 6   ? 0.6034 0.9769 0.4786 0.2058  -0.0059 -0.1793 9   DG  T C8    
4942 N N7    . DG  C 6   ? 0.6757 1.0055 0.5363 0.1705  0.0105  -0.2091 9   DG  T N7    
4943 C C5    . DG  C 6   ? 0.7521 0.9725 0.5607 0.1549  0.0296  -0.1967 9   DG  T C5    
4944 C C6    . DG  C 6   ? 0.9298 1.0568 0.6979 0.1148  0.0550  -0.2126 9   DG  T C6    
4945 O O6    . DG  C 6   ? 1.0914 1.2123 0.8678 0.0824  0.0674  -0.2455 9   DG  T O6    
4946 N N1    . DG  C 6   ? 1.0126 1.0467 0.7241 0.1121  0.0674  -0.1866 9   DG  T N1    
4947 C C2    . DG  C 6   ? 0.9507 0.9881 0.6513 0.1437  0.0554  -0.1554 9   DG  T C2    
4948 N N2    . DG  C 6   ? 1.0407 0.9898 0.6810 0.1350  0.0687  -0.1365 9   DG  T N2    
4949 N N3    . DG  C 6   ? 0.7350 0.8576 0.4794 0.1790  0.0331  -0.1439 9   DG  T N3    
4950 C C4    . DG  C 6   ? 0.6876 0.8956 0.4825 0.1825  0.0220  -0.1631 9   DG  T C4    
4951 P P     . DA  C 7   ? 0.6722 1.0951 0.5134 0.3475  -0.0776 -0.0977 10  DA  T P     
4952 O OP1   . DA  C 7   ? 0.8073 1.2283 0.6595 0.3330  -0.0638 -0.0776 10  DA  T OP1   
4953 O OP2   . DA  C 7   ? 0.6856 1.1486 0.5270 0.3514  -0.0904 -0.1286 10  DA  T OP2   
4954 O "O5'" . DA  C 7   ? 0.6406 0.9590 0.4217 0.3577  -0.0824 -0.1003 10  DA  T "O5'" 
4955 C "C5'" . DA  C 7   ? 0.6563 0.9321 0.4235 0.3563  -0.0748 -0.0789 10  DA  T "C5'" 
4956 C "C4'" . DA  C 7   ? 0.7301 0.8939 0.4284 0.3556  -0.0750 -0.0826 10  DA  T "C4'" 
4957 O "O4'" . DA  C 7   ? 0.7628 0.8710 0.4400 0.3213  -0.0556 -0.0959 10  DA  T "O4'" 
4958 C "C3'" . DA  C 7   ? 0.7625 0.8951 0.4281 0.3859  -0.0971 -0.0949 10  DA  T "C3'" 
4959 O "O3'" . DA  C 7   ? 0.7545 0.8176 0.3711 0.4035  -0.1066 -0.0821 10  DA  T "O3'" 
4960 C "C2'" . DA  C 7   ? 0.7290 0.8112 0.3740 0.3669  -0.0897 -0.1197 10  DA  T "C2'" 
4961 C "C1'" . DA  C 7   ? 0.7836 0.8219 0.4171 0.3266  -0.0632 -0.1131 10  DA  T "C1'" 
4962 N N9    . DA  C 7   ? 0.7748 0.8173 0.4246 0.2938  -0.0476 -0.1381 10  DA  T N9    
4963 C C8    . DA  C 7   ? 0.7277 0.8629 0.4302 0.2897  -0.0509 -0.1588 10  DA  T C8    
4964 N N7    . DA  C 7   ? 0.7623 0.8856 0.4715 0.2550  -0.0347 -0.1842 10  DA  T N7    
4965 C C5    . DA  C 7   ? 0.8394 0.8491 0.4957 0.2332  -0.0169 -0.1769 10  DA  T C5    
4966 C C6    . DA  C 7   ? 0.9120 0.8536 0.5477 0.1898  0.0086  -0.1940 10  DA  T C6    
4967 N N6    . DA  C 7   ? 0.9126 0.8986 0.5868 0.1599  0.0193  -0.2284 10  DA  T N6    
4968 N N1    . DA  C 7   ? 1.0965 0.9252 0.6690 0.1762  0.0234  -0.1749 10  DA  T N1    
4969 C C2    . DA  C 7   ? 1.0412 0.8347 0.5749 0.2066  0.0101  -0.1435 10  DA  T C2    
4970 N N3    . DA  C 7   ? 0.9235 0.7777 0.4768 0.2478  -0.0148 -0.1298 10  DA  T N3    
4971 C C4    . DA  C 7   ? 0.8495 0.8089 0.4652 0.2581  -0.0257 -0.1469 10  DA  T C4    
4972 P P     . DT  C 8   ? 0.8511 0.8699 0.4435 0.4327  -0.1246 -0.0942 11  DT  T P     
4973 O OP1   . DT  C 8   ? 0.8821 0.8968 0.4849 0.4272  -0.1182 -0.0853 11  DT  T OP1   
4974 O OP2   . DT  C 8   ? 0.8451 0.9250 0.4744 0.4417  -0.1300 -0.1186 11  DT  T OP2   
4975 O "O5'" . DT  C 8   ? 0.8986 0.7947 0.4151 0.4291  -0.1254 -0.0948 11  DT  T "O5'" 
4976 C "C5'" . DT  C 8   ? 0.9135 0.7423 0.3872 0.4030  -0.1084 -0.0749 11  DT  T "C5'" 
4977 C "C4'" . DT  C 8   ? 1.0276 0.7336 0.4373 0.3900  -0.1007 -0.0754 11  DT  T "C4'" 
4978 O "O4'" . DT  C 8   ? 1.0485 0.7558 0.4818 0.3505  -0.0766 -0.0955 11  DT  T "O4'" 
4979 C "C3'" . DT  C 8   ? 1.0977 0.7415 0.4754 0.4299  -0.1258 -0.0830 11  DT  T "C3'" 
4980 O "O3'" . DT  C 8   ? 1.2068 0.7309 0.5046 0.4329  -0.1274 -0.0588 11  DT  T "O3'" 
4981 C "C2'" . DT  C 8   ? 1.1135 0.7535 0.5178 0.4129  -0.1152 -0.1152 11  DT  T "C2'" 
4982 C "C1'" . DT  C 8   ? 1.1205 0.7545 0.5292 0.3567  -0.0812 -0.1135 11  DT  T "C1'" 
4983 N N1    . DT  C 8   ? 1.0952 0.7885 0.5582 0.3287  -0.0670 -0.1471 11  DT  T N1    
4984 C C2    . DT  C 8   ? 1.1754 0.8073 0.6240 0.2835  -0.0400 -0.1598 11  DT  T C2    
4985 O O2    . DT  C 8   ? 1.2876 0.8111 0.6772 0.2645  -0.0251 -0.1422 11  DT  T O2    
4986 N N3    . DT  C 8   ? 1.1014 0.8059 0.6056 0.2597  -0.0307 -0.1943 11  DT  T N3    
4987 C C4    . DT  C 8   ? 1.0107 0.8396 0.5755 0.2773  -0.0459 -0.2128 11  DT  T C4    
4988 O O4    . DT  C 8   ? 1.0534 0.9469 0.6616 0.2542  -0.0382 -0.2439 11  DT  T O4    
4989 C C5    . DT  C 8   ? 0.9507 0.8330 0.5235 0.3230  -0.0710 -0.1936 11  DT  T C5    
4990 C C7    . DT  C 8   ? 0.9914 1.0060 0.6222 0.3422  -0.0860 -0.2070 11  DT  T C7    
4991 C C6    . DT  C 8   ? 0.9838 0.7978 0.5093 0.3453  -0.0798 -0.1642 11  DT  T C6    
4992 P P     . DC  C 9   ? 1.3039 0.7466 0.5540 0.4845  -0.1590 -0.0532 12  DC  T P     
4993 O OP1   . DC  C 9   ? 1.3990 0.7814 0.5789 0.4955  -0.1687 -0.0174 12  DC  T OP1   
4994 O OP2   . DC  C 9   ? 1.2337 0.7626 0.5405 0.5263  -0.1840 -0.0784 12  DC  T OP2   
4995 O "O5'" . DC  C 9   ? 1.4536 0.7785 0.6691 0.4633  -0.1424 -0.0615 12  DC  T "O5'" 
4996 C "C5'" . DC  C 9   ? 1.5151 0.7751 0.6942 0.4092  -0.1082 -0.0478 12  DC  T "C5'" 
4997 C "C4'" . DC  C 9   ? 1.6630 0.8440 0.8391 0.3829  -0.0890 -0.0699 12  DC  T "C4'" 
4998 O "O4'" . DC  C 9   ? 1.6182 0.9031 0.8743 0.3582  -0.0759 -0.1099 12  DC  T "O4'" 
4999 C "C3'" . DC  C 9   ? 1.8150 0.9119 0.9710 0.4278  -0.1128 -0.0792 12  DC  T "C3'" 
5000 O "O3'" . DC  C 9   ? 2.0264 0.9881 1.1360 0.3970  -0.0898 -0.0757 12  DC  T "O3'" 
5001 C "C2'" . DC  C 9   ? 1.7004 0.9056 0.9403 0.4390  -0.1201 -0.1275 12  DC  T "C2'" 
5002 C "C1'" . DC  C 9   ? 1.6383 0.8960 0.9135 0.3762  -0.0852 -0.1434 12  DC  T "C1'" 
5003 N N1    . DC  C 9   ? 1.5048 0.9009 0.8619 0.3727  -0.0870 -0.1826 12  DC  T N1    
5004 C C2    . DC  C 9   ? 1.4088 0.8365 0.8020 0.3226  -0.0603 -0.2123 12  DC  T C2    
5005 O O2    . DC  C 9   ? 1.4371 0.7768 0.7979 0.2794  -0.0331 -0.2076 12  DC  T O2    
5006 N N3    . DC  C 9   ? 1.2701 0.8284 0.7317 0.3215  -0.0647 -0.2450 12  DC  T N3    
5007 C C4    . DC  C 9   ? 1.1876 0.8366 0.6788 0.3650  -0.0908 -0.2469 12  DC  T C4    
5008 N N4    . DC  C 9   ? 1.1047 0.8804 0.6556 0.3610  -0.0934 -0.2753 12  DC  T N4    
5009 C C5    . DC  C 9   ? 1.1985 0.8171 0.6587 0.4133  -0.1151 -0.2199 12  DC  T C5    
5010 C C6    . DC  C 9   ? 1.4439 0.9383 0.8387 0.4170  -0.1141 -0.1896 12  DC  T C6    
5011 P P     . DG  C 10  ? 2.2335 1.0301 1.2595 0.4325  -0.1060 -0.0432 13  DG  T P     
5012 O OP1   . DG  C 10  ? 2.2050 0.9628 1.1556 0.4310  -0.1078 0.0095  13  DG  T OP1   
5013 O OP2   . DG  C 10  ? 2.2135 1.0277 1.2723 0.4980  -0.1429 -0.0663 13  DG  T OP2   
5014 O "O5'" . DG  C 10  ? 2.3929 1.0663 1.3988 0.3817  -0.0694 -0.0556 13  DG  T "O5'" 
5015 C "C5'" . DG  C 10  ? 2.3602 1.0753 1.3953 0.3099  -0.0281 -0.0746 13  DG  T "C5'" 
5016 C "C4'" . DG  C 10  ? 2.4160 1.1095 1.4991 0.2817  -0.0091 -0.1262 13  DG  T "C4'" 
5017 O "O4'" . DG  C 10  ? 2.2718 1.1242 1.4460 0.2912  -0.0207 -0.1743 13  DG  T "O4'" 
5018 C "C3'" . DG  C 10  ? 2.5593 1.1173 1.6163 0.3170  -0.0224 -0.1331 13  DG  T "C3'" 
5019 O "O3'" . DG  C 10  ? 2.6651 1.1387 1.7278 0.2625  0.0139  -0.1616 13  DG  T "O3'" 
5020 C "C2'" . DG  C 10  ? 2.4456 1.1149 1.5738 0.3710  -0.0560 -0.1754 13  DG  T "C2'" 
5021 C "C1'" . DG  C 10  ? 2.2745 1.1084 1.4766 0.3307  -0.0408 -0.2108 13  DG  T "C1'" 
5022 N N9    . DG  C 10  ? 2.0897 1.0729 1.3486 0.3746  -0.0709 -0.2288 13  DG  T N9    
5023 C C8    . DG  C 10  ? 2.0554 1.0674 1.3013 0.4342  -0.1054 -0.2032 13  DG  T C8    
5024 N N7    . DG  C 10  ? 1.9381 1.0941 1.2455 0.4576  -0.1225 -0.2279 13  DG  T N7    
5025 C C5    . DG  C 10  ? 1.8539 1.0815 1.2141 0.4137  -0.1005 -0.2697 13  DG  T C5    
5026 C C6    . DG  C 10  ? 1.6757 1.0591 1.1056 0.4143  -0.1059 -0.3052 13  DG  T C6    
5027 O O6    . DG  C 10  ? 1.5394 1.0266 0.9994 0.4519  -0.1284 -0.3061 13  DG  T O6    
5028 N N1    . DG  C 10  ? 1.6815 1.0988 1.1456 0.3631  -0.0811 -0.3421 13  DG  T N1    
5029 C C2    . DG  C 10  ? 1.8111 1.1254 1.2510 0.3140  -0.0520 -0.3478 13  DG  T C2    
5030 N N2    . DG  C 10  ? 1.8159 1.1941 1.3017 0.2675  -0.0320 -0.3908 13  DG  T N2    
5031 N N3    . DG  C 10  ? 1.9049 1.0669 1.2789 0.3094  -0.0428 -0.3133 13  DG  T N3    
5032 C C4    . DG  C 10  ? 1.9477 1.0744 1.2823 0.3624  -0.0694 -0.2736 13  DG  T C4    
5033 P P     . DC  C 11  ? 2.8463 1.1302 1.8671 0.2793  0.0153  -0.1607 14  DC  T P     
5034 O OP1   . DC  C 11  ? 2.9928 1.1379 1.9452 0.2183  0.0563  -0.1264 14  DC  T OP1   
5035 O OP2   . DC  C 11  ? 2.8819 1.1405 1.8810 0.3626  -0.0309 -0.1350 14  DC  T OP2   
5036 O "O5'" . DC  C 11  ? 2.8044 1.1368 1.9112 0.2634  0.0245  -0.2406 14  DC  T "O5'" 
5037 C "C5'" . DC  C 11  ? 2.7151 1.1348 1.8758 0.1927  0.0586  -0.2836 14  DC  T "C5'" 
5038 C "C4'" . DC  C 11  ? 2.6630 1.1734 1.9081 0.1985  0.0517  -0.3603 14  DC  T "C4'" 
5039 O "O4'" . DC  C 11  ? 2.5068 1.1957 1.8011 0.2399  0.0198  -0.3714 14  DC  T "O4'" 
5040 C "C3'" . DC  C 11  ? 2.8275 1.2200 2.0712 0.2411  0.0384  -0.3872 14  DC  T "C3'" 
5041 O "O3'" . DC  C 11  ? 2.8908 1.2642 2.1818 0.1926  0.0666  -0.4544 14  DC  T "O3'" 
5042 C "C2'" . DC  C 11  ? 2.7206 1.2383 2.0057 0.3137  -0.0051 -0.4047 14  DC  T "C2'" 
5043 C "C1'" . DC  C 11  ? 2.5439 1.2578 1.8804 0.2842  -0.0024 -0.4201 14  DC  T "C1'" 
5044 N N1    . DC  C 11  ? 2.4302 1.2817 1.7921 0.3425  -0.0395 -0.4120 14  DC  T N1    
5045 C C2    . DC  C 11  ? 2.2619 1.2950 1.6914 0.3344  -0.0444 -0.4520 14  DC  T C2    
5046 O O2    . DC  C 11  ? 2.2336 1.3172 1.7012 0.2815  -0.0210 -0.4942 14  DC  T O2    
5047 N N3    . DC  C 11  ? 2.1363 1.2871 1.5868 0.3837  -0.0745 -0.4424 14  DC  T N3    
5048 C C4    . DC  C 11  ? 2.1710 1.2713 1.5839 0.4388  -0.0999 -0.4012 14  DC  T C4    
5049 N N4    . DC  C 11  ? 2.0482 1.2748 1.4903 0.4796  -0.1259 -0.3950 14  DC  T N4    
5050 C C5    . DC  C 11  ? 2.3483 1.2714 1.6931 0.4517  -0.0994 -0.3619 14  DC  T C5    
5051 C C6    . DC  C 11  ? 2.4713 1.2715 1.7900 0.4030  -0.0686 -0.3662 14  DC  T C6    
5052 P P     . DA  C 12  ? 2.9976 1.3182 2.3386 0.2223  0.0575  -0.4980 15  DA  T P     
5053 O OP1   . DA  C 12  ? 3.1061 1.3534 2.4722 0.1520  0.0972  -0.5405 15  DA  T OP1   
5054 O OP2   . DA  C 12  ? 3.0474 1.2835 2.3551 0.2849  0.0305  -0.4375 15  DA  T OP2   
5055 O "O5'" . DA  C 12  ? 2.8718 1.3764 2.2871 0.2550  0.0333  -0.5629 15  DA  T "O5'" 
5056 C "C5'" . DA  C 12  ? 2.7665 1.3883 2.2266 0.2065  0.0493  -0.6295 15  DA  T "C5'" 
5057 C "C4'" . DA  C 12  ? 2.6162 1.4061 2.1473 0.2422  0.0257  -0.6832 15  DA  T "C4'" 
5058 O "O4'" . DA  C 12  ? 2.4752 1.3884 2.0012 0.2886  -0.0061 -0.6434 15  DA  T "O4'" 
5059 C "C3'" . DA  C 12  ? 2.6258 1.3729 2.1897 0.2804  0.0214  -0.7035 15  DA  T "C3'" 
5060 O "O3'" . DA  C 12  ? 2.5720 1.3679 2.1801 0.2455  0.0417  -0.7779 15  DA  T "O3'" 
5061 C "C2'" . DA  C 12  ? 2.5322 1.3993 2.1086 0.3470  -0.0162 -0.6745 15  DA  T "C2'" 
5062 C "C1'" . DA  C 12  ? 2.4159 1.4253 1.9897 0.3329  -0.0259 -0.6623 15  DA  T "C1'" 
5063 N N9    . DA  C 12  ? 2.3099 1.3900 1.8697 0.3850  -0.0573 -0.6082 15  DA  T N9    
5064 C C8    . DA  C 12  ? 2.3502 1.3351 1.8597 0.4229  -0.0734 -0.5443 15  DA  T C8    
5065 N N7    . DA  C 12  ? 2.2436 1.3329 1.7563 0.4610  -0.1001 -0.5110 15  DA  T N7    
5066 C C5    . DA  C 12  ? 2.1098 1.3684 1.6773 0.4471  -0.1004 -0.5505 15  DA  T C5    
5067 C C6    . DA  C 12  ? 1.8758 1.2987 1.4738 0.4671  -0.1199 -0.5381 15  DA  T C6    
5068 N N6    . DA  C 12  ? 1.7797 1.2240 1.3604 0.5056  -0.1432 -0.4881 15  DA  T N6    
5069 N N1    . DA  C 12  ? 1.7482 1.3142 1.3955 0.4423  -0.1142 -0.5768 15  DA  T N1    
5070 C C2    . DA  C 12  ? 1.8166 1.3705 1.4824 0.4006  -0.0921 -0.6289 15  DA  T C2    
5071 N N3    . DA  C 12  ? 1.9977 1.4073 1.6429 0.3759  -0.0711 -0.6524 15  DA  T N3    
5072 C C4    . DA  C 12  ? 2.1464 1.4064 1.7416 0.4015  -0.0758 -0.6089 15  DA  T C4    
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   DG  1   1   1   DG  DG  P . n 
A 1 2   DC  2   2   2   DC  DC  P . n 
A 1 3   DG  3   3   3   DG  DG  P . n 
A 1 4   DA  4   4   4   DA  DA  P . n 
A 1 5   DT  5   5   5   DT  DT  P . n 
A 1 6   DC  6   6   6   DC  DC  P . n 
A 1 7   DA  7   7   7   DA  DA  P . n 
A 1 8   DC  8   8   8   DC  DC  P . n 
A 1 9   DG  9   9   9   DG  DG  P . n 
A 1 10  DT  10  10  10  DT  DT  P . n 
A 1 11  DA  11  11  11  DA  DA  P . n 
B 2 1   ALA 1   297 ?   ?   ?   A . n 
B 2 2   LYS 2   298 ?   ?   ?   A . n 
B 2 3   MET 3   299 ?   ?   ?   A . n 
B 2 4   ALA 4   300 300 ALA ALA A . n 
B 2 5   PHE 5   301 301 PHE PHE A . n 
B 2 6   THR 6   302 302 THR THR A . n 
B 2 7   LEU 7   303 303 LEU LEU A . n 
B 2 8   ALA 8   304 304 ALA ALA A . n 
B 2 9   ASP 9   305 305 ASP ASP A . n 
B 2 10  ARG 10  306 306 ARG ARG A . n 
B 2 11  VAL 11  307 307 VAL VAL A . n 
B 2 12  THR 12  308 308 THR THR A . n 
B 2 13  GLU 13  309 309 GLU GLU A . n 
B 2 14  GLU 14  310 310 GLU GLU A . n 
B 2 15  MET 15  311 311 MET MET A . n 
B 2 16  LEU 16  312 312 LEU LEU A . n 
B 2 17  ALA 17  313 313 ALA ALA A . n 
B 2 18  ASP 18  314 314 ASP ASP A . n 
B 2 19  LYS 19  315 315 LYS LYS A . n 
B 2 20  ALA 20  316 316 ALA ALA A . n 
B 2 21  ALA 21  317 317 ALA ALA A . n 
B 2 22  LEU 22  318 318 LEU LEU A . n 
B 2 23  VAL 23  319 319 VAL VAL A . n 
B 2 24  VAL 24  320 320 VAL VAL A . n 
B 2 25  GLU 25  321 321 GLU GLU A . n 
B 2 26  VAL 26  322 322 VAL VAL A . n 
B 2 27  VAL 27  323 323 VAL VAL A . n 
B 2 28  GLU 28  324 324 GLU GLU A . n 
B 2 29  GLU 29  325 325 GLU GLU A . n 
B 2 30  ASN 30  326 326 ASN ASN A . n 
B 2 31  TYR 31  327 327 TYR TYR A . n 
B 2 32  HIS 32  328 328 HIS HIS A . n 
B 2 33  ASP 33  329 329 ASP ASP A . n 
B 2 34  ALA 34  330 330 ALA ALA A . n 
B 2 35  PRO 35  331 331 PRO PRO A . n 
B 2 36  ILE 36  332 332 ILE ILE A . n 
B 2 37  VAL 37  333 333 VAL VAL A . n 
B 2 38  GLY 38  334 334 GLY GLY A . n 
B 2 39  ILE 39  335 335 ILE ILE A . n 
B 2 40  ALA 40  336 336 ALA ALA A . n 
B 2 41  VAL 41  337 337 VAL VAL A . n 
B 2 42  VAL 42  338 338 VAL VAL A . n 
B 2 43  ASN 43  339 339 ASN ASN A . n 
B 2 44  GLU 44  340 340 GLU GLU A . n 
B 2 45  HIS 45  341 341 HIS HIS A . n 
B 2 46  GLY 46  342 342 GLY GLY A . n 
B 2 47  ARG 47  343 343 ARG ARG A . n 
B 2 48  PHE 48  344 344 PHE PHE A . n 
B 2 49  PHE 49  345 345 PHE PHE A . n 
B 2 50  LEU 50  346 346 LEU LEU A . n 
B 2 51  ARG 51  347 347 ARG ARG A . n 
B 2 52  PRO 52  348 348 PRO PRO A . n 
B 2 53  GLU 53  349 349 GLU GLU A . n 
B 2 54  THR 54  350 350 THR THR A . n 
B 2 55  ALA 55  351 351 ALA ALA A . n 
B 2 56  LEU 56  352 352 LEU LEU A . n 
B 2 57  ALA 57  353 353 ALA ALA A . n 
B 2 58  ASP 58  354 354 ASP ASP A . n 
B 2 59  PRO 59  355 355 PRO PRO A . n 
B 2 60  GLN 60  356 356 GLN GLN A . n 
B 2 61  PHE 61  357 357 PHE PHE A . n 
B 2 62  VAL 62  358 358 VAL VAL A . n 
B 2 63  ALA 63  359 359 ALA ALA A . n 
B 2 64  TRP 64  360 360 TRP TRP A . n 
B 2 65  LEU 65  361 361 LEU LEU A . n 
B 2 66  GLY 66  362 362 GLY GLY A . n 
B 2 67  ASP 67  363 363 ASP ASP A . n 
B 2 68  GLU 68  364 364 GLU ALA A . n 
B 2 69  THR 69  365 365 THR THR A . n 
B 2 70  LYS 70  366 366 LYS LYS A . n 
B 2 71  LYS 71  367 367 LYS LYS A . n 
B 2 72  LYS 72  368 368 LYS LYS A . n 
B 2 73  SER 73  369 369 SER SER A . n 
B 2 74  MET 74  370 370 MET MET A . n 
B 2 75  PHE 75  371 371 PHE PHE A . n 
B 2 76  ASP 76  372 372 ASP ASP A . n 
B 2 77  SER 77  373 373 SER SER A . n 
B 2 78  LYS 78  374 374 LYS LYS A . n 
B 2 79  ARG 79  375 375 ARG ARG A . n 
B 2 80  ALA 80  376 376 ALA ALA A . n 
B 2 81  ALA 81  377 377 ALA ALA A . n 
B 2 82  VAL 82  378 378 VAL VAL A . n 
B 2 83  ALA 83  379 379 ALA ALA A . n 
B 2 84  LEU 84  380 380 LEU LEU A . n 
B 2 85  LYS 85  381 381 LYS LYS A . n 
B 2 86  TRP 86  382 382 TRP TRP A . n 
B 2 87  LYS 87  383 383 LYS LYS A . n 
B 2 88  GLY 88  384 384 GLY GLY A . n 
B 2 89  ILE 89  385 385 ILE ILE A . n 
B 2 90  GLU 90  386 386 GLU ALA A . n 
B 2 91  LEU 91  387 387 LEU LEU A . n 
B 2 92  CYS 92  388 388 CYS CYS A . n 
B 2 93  GLY 93  389 389 GLY GLY A . n 
B 2 94  VAL 94  390 390 VAL VAL A . n 
B 2 95  SER 95  391 391 SER SER A . n 
B 2 96  PHE 96  392 392 PHE PHE A . n 
B 2 97  ASP 97  393 393 ASP ASP A . n 
B 2 98  LEU 98  394 394 LEU LEU A . n 
B 2 99  LEU 99  395 395 LEU LEU A . n 
B 2 100 LEU 100 396 396 LEU LEU A . n 
B 2 101 ALA 101 397 397 ALA ALA A . n 
B 2 102 ALA 102 398 398 ALA ALA A . n 
B 2 103 TYR 103 399 399 TYR TYR A . n 
B 2 104 LEU 104 400 400 LEU LEU A . n 
B 2 105 LEU 105 401 401 LEU LEU A . n 
B 2 106 ASP 106 402 402 ASP ASP A . n 
B 2 107 PRO 107 403 403 PRO PRO A . n 
B 2 108 ALA 108 404 404 ALA ALA A . n 
B 2 109 GLN 109 405 405 GLN GLN A . n 
B 2 110 GLY 110 406 406 GLY GLY A . n 
B 2 111 VAL 111 407 407 VAL VAL A . n 
B 2 112 ASP 112 408 408 ASP ASP A . n 
B 2 113 ASP 113 409 409 ASP ASP A . n 
B 2 114 VAL 114 410 410 VAL VAL A . n 
B 2 115 ALA 115 411 411 ALA ALA A . n 
B 2 116 ALA 116 412 412 ALA ALA A . n 
B 2 117 ALA 117 413 413 ALA ALA A . n 
B 2 118 ALA 118 414 414 ALA ALA A . n 
B 2 119 LYS 119 415 415 LYS LYS A . n 
B 2 120 MET 120 416 416 MET MET A . n 
B 2 121 LYS 121 417 417 LYS LYS A . n 
B 2 122 GLN 122 418 418 GLN GLN A . n 
B 2 123 TYR 123 419 419 TYR TYR A . n 
B 2 124 GLU 124 420 420 GLU GLU A . n 
B 2 125 ALA 125 421 421 ALA ALA A . n 
B 2 126 VAL 126 422 422 VAL VAL A . n 
B 2 127 ARG 127 423 423 ARG ARG A . n 
B 2 128 PRO 128 424 424 PRO PRO A . n 
B 2 129 ASP 129 425 425 ASP ASP A . n 
B 2 130 GLU 130 426 426 GLU ALA A . n 
B 2 131 ALA 131 427 427 ALA ALA A . n 
B 2 132 VAL 132 428 428 VAL VAL A . n 
B 2 133 TYR 133 429 429 TYR TYR A . n 
B 2 134 GLY 134 430 430 GLY GLY A . n 
B 2 135 LYS 135 431 431 LYS ALA A . n 
B 2 136 GLY 136 432 432 GLY GLY A . n 
B 2 137 ALA 137 433 433 ALA ALA A . n 
B 2 138 LYS 138 434 434 LYS LYS A . n 
B 2 139 ARG 139 435 435 ARG ARG A . n 
B 2 140 ALA 140 436 436 ALA ALA A . n 
B 2 141 VAL 141 437 437 VAL VAL A . n 
B 2 142 PRO 142 438 438 PRO PRO A . n 
B 2 143 ASP 143 439 439 ASP ASP A . n 
B 2 144 GLU 144 440 440 GLU GLU A . n 
B 2 145 PRO 145 441 441 PRO PRO A . n 
B 2 146 VAL 146 442 442 VAL VAL A . n 
B 2 147 LEU 147 443 443 LEU LEU A . n 
B 2 148 ALA 148 444 444 ALA ALA A . n 
B 2 149 GLU 149 445 445 GLU GLU A . n 
B 2 150 HIS 150 446 446 HIS HIS A . n 
B 2 151 LEU 151 447 447 LEU LEU A . n 
B 2 152 VAL 152 448 448 VAL VAL A . n 
B 2 153 ARG 153 449 449 ARG ARG A . n 
B 2 154 LYS 154 450 450 LYS LYS A . n 
B 2 155 ALA 155 451 451 ALA ALA A . n 
B 2 156 ALA 156 452 452 ALA ALA A . n 
B 2 157 ALA 157 453 453 ALA ALA A . n 
B 2 158 ILE 158 454 454 ILE ILE A . n 
B 2 159 TRP 159 455 455 TRP TRP A . n 
B 2 160 ALA 160 456 456 ALA ALA A . n 
B 2 161 LEU 161 457 457 LEU LEU A . n 
B 2 162 GLU 162 458 458 GLU GLU A . n 
B 2 163 ARG 163 459 459 ARG ARG A . n 
B 2 164 PRO 164 460 460 PRO PRO A . n 
B 2 165 PHE 165 461 461 PHE PHE A . n 
B 2 166 LEU 166 462 462 LEU LEU A . n 
B 2 167 ASP 167 463 463 ASP ASP A . n 
B 2 168 GLU 168 464 464 GLU GLU A . n 
B 2 169 LEU 169 465 465 LEU LEU A . n 
B 2 170 ARG 170 466 466 ARG ARG A . n 
B 2 171 ARG 171 467 467 ARG ARG A . n 
B 2 172 ASN 172 468 468 ASN ASN A . n 
B 2 173 GLU 173 469 469 GLU GLU A . n 
B 2 174 GLN 174 470 470 GLN GLN A . n 
B 2 175 ASP 175 471 471 ASP ASP A . n 
B 2 176 ARG 176 472 472 ARG ARG A . n 
B 2 177 LEU 177 473 473 LEU LEU A . n 
B 2 178 LEU 178 474 474 LEU LEU A . n 
B 2 179 VAL 179 475 475 VAL VAL A . n 
B 2 180 GLU 180 476 476 GLU GLU A . n 
B 2 181 LEU 181 477 477 LEU LEU A . n 
B 2 182 GLU 182 478 478 GLU GLU A . n 
B 2 183 GLN 183 479 479 GLN GLN A . n 
B 2 184 PRO 184 480 480 PRO PRO A . n 
B 2 185 LEU 185 481 481 LEU LEU A . n 
B 2 186 SER 186 482 482 SER SER A . n 
B 2 187 SER 187 483 483 SER SER A . n 
B 2 188 ILE 188 484 484 ILE ILE A . n 
B 2 189 LEU 189 485 485 LEU LEU A . n 
B 2 190 ALA 190 486 486 ALA ALA A . n 
B 2 191 GLU 191 487 487 GLU GLU A . n 
B 2 192 MET 192 488 488 MET MET A . n 
B 2 193 GLU 193 489 489 GLU GLU A . n 
B 2 194 PHE 194 490 490 PHE PHE A . n 
B 2 195 ALA 195 491 491 ALA ALA A . n 
B 2 196 GLY 196 492 492 GLY GLY A . n 
B 2 197 VAL 197 493 493 VAL VAL A . n 
B 2 198 LYS 198 494 494 LYS LYS A . n 
B 2 199 VAL 199 495 495 VAL VAL A . n 
B 2 200 ASP 200 496 496 ASP ASP A . n 
B 2 201 THR 201 497 497 THR THR A . n 
B 2 202 LYS 202 498 498 LYS LYS A . n 
B 2 203 ARG 203 499 499 ARG ARG A . n 
B 2 204 LEU 204 500 500 LEU LEU A . n 
B 2 205 GLU 205 501 501 GLU GLU A . n 
B 2 206 GLN 206 502 502 GLN GLN A . n 
B 2 207 MET 207 503 503 MET MET A . n 
B 2 208 GLY 208 504 504 GLY GLY A . n 
B 2 209 GLU 209 505 505 GLU GLU A . n 
B 2 210 GLU 210 506 506 GLU GLU A . n 
B 2 211 LEU 211 507 507 LEU LEU A . n 
B 2 212 ALA 212 508 508 ALA ALA A . n 
B 2 213 GLU 213 509 509 GLU GLU A . n 
B 2 214 GLN 214 510 510 GLN GLN A . n 
B 2 215 LEU 215 511 511 LEU LEU A . n 
B 2 216 ARG 216 512 512 ARG ARG A . n 
B 2 217 THR 217 513 513 THR THR A . n 
B 2 218 VAL 218 514 514 VAL VAL A . n 
B 2 219 GLU 219 515 515 GLU GLU A . n 
B 2 220 GLN 220 516 516 GLN GLN A . n 
B 2 221 ARG 221 517 517 ARG ARG A . n 
B 2 222 ILE 222 518 518 ILE ILE A . n 
B 2 223 TYR 223 519 519 TYR TYR A . n 
B 2 224 GLU 224 520 520 GLU GLU A . n 
B 2 225 LEU 225 521 521 LEU LEU A . n 
B 2 226 ALA 226 522 522 ALA ALA A . n 
B 2 227 GLY 227 523 523 GLY GLY A . n 
B 2 228 GLN 228 524 524 GLN GLN A . n 
B 2 229 GLU 229 525 525 GLU GLU A . n 
B 2 230 PHE 230 526 526 PHE PHE A . n 
B 2 231 ASN 231 527 527 ASN ASN A . n 
B 2 232 ILE 232 528 528 ILE ILE A . n 
B 2 233 ASN 233 529 529 ASN ASN A . n 
B 2 234 SER 234 530 530 SER SER A . n 
B 2 235 PRO 235 531 531 PRO PRO A . n 
B 2 236 LYS 236 532 532 LYS LYS A . n 
B 2 237 GLN 237 533 533 GLN GLN A . n 
B 2 238 LEU 238 534 534 LEU LEU A . n 
B 2 239 GLY 239 535 535 GLY GLY A . n 
B 2 240 VAL 240 536 536 VAL VAL A . n 
B 2 241 ILE 241 537 537 ILE ILE A . n 
B 2 242 LEU 242 538 538 LEU LEU A . n 
B 2 243 PHE 243 539 539 PHE PHE A . n 
B 2 244 GLU 244 540 540 GLU GLU A . n 
B 2 245 LYS 245 541 541 LYS LYS A . n 
B 2 246 LEU 246 542 542 LEU LEU A . n 
B 2 247 GLN 247 543 543 GLN GLN A . n 
B 2 248 LEU 248 544 544 LEU LEU A . n 
B 2 249 PRO 249 545 545 PRO PRO A . n 
B 2 250 VAL 250 546 546 VAL VAL A . n 
B 2 251 LEU 251 547 547 LEU LEU A . n 
B 2 252 LYS 252 548 548 LYS LYS A . n 
B 2 253 LYS 253 549 549 LYS ALA A . n 
B 2 254 THR 254 550 550 THR THR A . n 
B 2 255 LYS 255 551 551 LYS LYS A . n 
B 2 256 THR 256 552 552 THR THR A . n 
B 2 257 GLY 257 553 553 GLY GLY A . n 
B 2 258 TYR 258 554 554 TYR TYR A . n 
B 2 259 SER 259 555 555 SER SER A . n 
B 2 260 THR 260 556 556 THR THR A . n 
B 2 261 SER 261 557 557 SER SER A . n 
B 2 262 ALA 262 558 558 ALA ALA A . n 
B 2 263 ASP 263 559 559 ASP ASP A . n 
B 2 264 VAL 264 560 560 VAL VAL A . n 
B 2 265 LEU 265 561 561 LEU LEU A . n 
B 2 266 GLU 266 562 562 GLU GLU A . n 
B 2 267 LYS 267 563 563 LYS LYS A . n 
B 2 268 LEU 268 564 564 LEU LEU A . n 
B 2 269 ALA 269 565 565 ALA ALA A . n 
B 2 270 PRO 270 566 566 PRO PRO A . n 
B 2 271 TYR 271 567 567 TYR TYR A . n 
B 2 272 HIS 272 568 568 HIS HIS A . n 
B 2 273 GLU 273 569 569 GLU GLU A . n 
B 2 274 ILE 274 570 570 ILE ILE A . n 
B 2 275 VAL 275 571 571 VAL VAL A . n 
B 2 276 GLU 276 572 572 GLU GLU A . n 
B 2 277 ASN 277 573 573 ASN ASN A . n 
B 2 278 ILE 278 574 574 ILE ILE A . n 
B 2 279 LEU 279 575 575 LEU LEU A . n 
B 2 280 HIS 280 576 576 HIS HIS A . n 
B 2 281 TYR 281 577 577 TYR TYR A . n 
B 2 282 ARG 282 578 578 ARG ARG A . n 
B 2 283 GLN 283 579 579 GLN GLN A . n 
B 2 284 LEU 284 580 580 LEU LEU A . n 
B 2 285 GLY 285 581 581 GLY GLY A . n 
B 2 286 LYS 286 582 582 LYS LYS A . n 
B 2 287 LEU 287 583 583 LEU LEU A . n 
B 2 288 GLN 288 584 584 GLN GLN A . n 
B 2 289 SER 289 585 585 SER SER A . n 
B 2 290 THR 290 586 586 THR THR A . n 
B 2 291 TYR 291 587 587 TYR TYR A . n 
B 2 292 ILE 292 588 588 ILE ILE A . n 
B 2 293 GLU 293 589 589 GLU GLU A . n 
B 2 294 GLY 294 590 590 GLY GLY A . n 
B 2 295 LEU 295 591 591 LEU LEU A . n 
B 2 296 LEU 296 592 592 LEU LEU A . n 
B 2 297 LYS 297 593 593 LYS LYS A . n 
B 2 298 VAL 298 594 594 VAL VAL A . n 
B 2 299 VAL 299 595 595 VAL VAL A . n 
B 2 300 ARG 300 596 596 ARG ARG A . n 
B 2 301 PRO 301 597 597 PRO PRO A . n 
B 2 302 ASP 302 598 598 ASP ASP A . n 
B 2 303 THR 303 599 599 THR THR A . n 
B 2 304 LYS 304 600 600 LYS LYS A . n 
B 2 305 LYS 305 601 601 LYS LYS A . n 
B 2 306 VAL 306 602 602 VAL VAL A . n 
B 2 307 HIS 307 603 603 HIS HIS A . n 
B 2 308 THR 308 604 604 THR THR A . n 
B 2 309 ILE 309 605 605 ILE ILE A . n 
B 2 310 PHE 310 606 606 PHE PHE A . n 
B 2 311 ASN 311 607 607 ASN ASN A . n 
B 2 312 GLN 312 608 608 GLN GLN A . n 
B 2 313 ALA 313 609 609 ALA ALA A . n 
B 2 314 LEU 314 610 610 LEU LEU A . n 
B 2 315 THR 315 611 611 THR THR A . n 
B 2 316 GLN 316 612 612 GLN GLN A . n 
B 2 317 THR 317 613 613 THR THR A . n 
B 2 318 GLY 318 614 614 GLY GLY A . n 
B 2 319 ARG 319 615 615 ARG ARG A . n 
B 2 320 LEU 320 616 616 LEU LEU A . n 
B 2 321 SER 321 617 617 SER SER A . n 
B 2 322 SER 322 618 618 SER SER A . n 
B 2 323 THR 323 619 619 THR THR A . n 
B 2 324 GLU 324 620 620 GLU GLU A . n 
B 2 325 PRO 325 621 621 PRO PRO A . n 
B 2 326 ASN 326 622 622 ASN ASN A . n 
B 2 327 LEU 327 623 623 LEU LEU A . n 
B 2 328 GLN 328 624 624 GLN GLN A . n 
B 2 329 ASN 329 625 625 ASN ASN A . n 
B 2 330 ILE 330 626 626 ILE ILE A . n 
B 2 331 PRO 331 627 627 PRO PRO A . n 
B 2 332 ILE 332 628 628 ILE ILE A . n 
B 2 333 ARG 333 629 629 ARG ALA A . n 
B 2 334 LEU 334 630 630 LEU ALA A . n 
B 2 335 GLU 335 631 631 GLU GLU A . n 
B 2 336 GLU 336 632 632 GLU GLU A . n 
B 2 337 GLY 337 633 633 GLY GLY A . n 
B 2 338 ARG 338 634 634 ARG ARG A . n 
B 2 339 LYS 339 635 635 LYS LYS A . n 
B 2 340 ILE 340 636 636 ILE ILE A . n 
B 2 341 ARG 341 637 637 ARG ARG A . n 
B 2 342 GLN 342 638 638 GLN GLN A . n 
B 2 343 ALA 343 639 639 ALA ALA A . n 
B 2 344 PHE 344 640 640 PHE PHE A . n 
B 2 345 VAL 345 641 641 VAL VAL A . n 
B 2 346 PRO 346 642 642 PRO PRO A . n 
B 2 347 SER 347 643 643 SER SER A . n 
B 2 348 GLU 348 644 644 GLU GLU A . n 
B 2 349 SER 349 645 645 SER SER A . n 
B 2 350 ASP 350 646 646 ASP ASP A . n 
B 2 351 TRP 351 647 647 TRP TRP A . n 
B 2 352 LEU 352 648 648 LEU LEU A . n 
B 2 353 ILE 353 649 649 ILE ILE A . n 
B 2 354 PHE 354 650 650 PHE PHE A . n 
B 2 355 ALA 355 651 651 ALA ALA A . n 
B 2 356 ALA 356 652 652 ALA ALA A . n 
B 2 357 ASP 357 653 653 ASP ASP A . n 
B 2 358 TYR 358 654 654 TYR TYR A . n 
B 2 359 SER 359 655 655 SER SER A . n 
B 2 360 GLN 360 656 656 GLN GLN A . n 
B 2 361 ILE 361 657 657 ILE ILE A . n 
B 2 362 GLU 362 658 658 GLU GLU A . n 
B 2 363 LEU 363 659 659 LEU LEU A . n 
B 2 364 ARG 364 660 660 ARG ARG A . n 
B 2 365 VAL 365 661 661 VAL VAL A . n 
B 2 366 LEU 366 662 662 LEU LEU A . n 
B 2 367 ALA 367 663 663 ALA ALA A . n 
B 2 368 HIS 368 664 664 HIS HIS A . n 
B 2 369 ILE 369 665 665 ILE ILE A . n 
B 2 370 ALA 370 666 666 ALA ALA A . n 
B 2 371 GLU 371 667 667 GLU GLU A . n 
B 2 372 ASP 372 668 668 ASP ASP A . n 
B 2 373 ASP 373 669 669 ASP ASP A . n 
B 2 374 ASN 374 670 670 ASN ASN A . n 
B 2 375 LEU 375 671 671 LEU LEU A . n 
B 2 376 MET 376 672 672 MET MET A . n 
B 2 377 GLU 377 673 673 GLU GLU A . n 
B 2 378 ALA 378 674 674 ALA ALA A . n 
B 2 379 PHE 379 675 675 PHE PHE A . n 
B 2 380 ARG 380 676 676 ARG ARG A . n 
B 2 381 ARG 381 677 677 ARG ARG A . n 
B 2 382 ASP 382 678 678 ASP ASP A . n 
B 2 383 LEU 383 679 679 LEU LEU A . n 
B 2 384 ASP 384 680 680 ASP ASP A . n 
B 2 385 ILE 385 681 681 ILE ILE A . n 
B 2 386 HIS 386 682 682 HIS HIS A . n 
B 2 387 THR 387 683 683 THR THR A . n 
B 2 388 LYS 388 684 684 LYS LYS A . n 
B 2 389 THR 389 685 685 THR THR A . n 
B 2 390 ALA 390 686 686 ALA ALA A . n 
B 2 391 MET 391 687 687 MET MET A . n 
B 2 392 ASP 392 688 688 ASP ASP A . n 
B 2 393 ILE 393 689 689 ILE ILE A . n 
B 2 394 PHE 394 690 690 PHE PHE A . n 
B 2 395 GLN 395 691 691 GLN GLN A . n 
B 2 396 VAL 396 692 692 VAL VAL A . n 
B 2 397 SER 397 693 693 SER SER A . n 
B 2 398 GLU 398 694 694 GLU GLU A . n 
B 2 399 ASP 399 695 695 ASP ASP A . n 
B 2 400 GLU 400 696 696 GLU GLU A . n 
B 2 401 VAL 401 697 697 VAL VAL A . n 
B 2 402 THR 402 698 698 THR THR A . n 
B 2 403 PRO 403 699 699 PRO PRO A . n 
B 2 404 ASN 404 700 700 ASN ASN A . n 
B 2 405 MET 405 701 701 MET MET A . n 
B 2 406 ARG 406 702 702 ARG ARG A . n 
B 2 407 ARG 407 703 703 ARG ARG A . n 
B 2 408 GLN 408 704 704 GLN GLN A . n 
B 2 409 ALA 409 705 705 ALA ALA A . n 
B 2 410 LYS 410 706 706 LYS LYS A . n 
B 2 411 ALA 411 707 707 ALA ALA A . n 
B 2 412 VAL 412 708 708 VAL VAL A . n 
B 2 413 ASN 413 709 709 ASN ASN A . n 
B 2 414 PHE 414 710 710 PHE PHE A . n 
B 2 415 GLY 415 711 711 GLY GLY A . n 
B 2 416 ILE 416 712 712 ILE ILE A . n 
B 2 417 VAL 417 713 713 VAL VAL A . n 
B 2 418 TYR 418 714 714 TYR TYR A . n 
B 2 419 GLY 419 715 715 GLY GLY A . n 
B 2 420 ILE 420 716 716 ILE ILE A . n 
B 2 421 SER 421 717 717 SER SER A . n 
B 2 422 ASP 422 718 718 ASP ASP A . n 
B 2 423 TYR 423 719 719 TYR TYR A . n 
B 2 424 GLY 424 720 720 GLY GLY A . n 
B 2 425 LEU 425 721 721 LEU LEU A . n 
B 2 426 ALA 426 722 722 ALA ALA A . n 
B 2 427 GLN 427 723 723 GLN GLN A . n 
B 2 428 ASN 428 724 724 ASN ASN A . n 
B 2 429 LEU 429 725 725 LEU LEU A . n 
B 2 430 ASN 430 726 726 ASN ASN A . n 
B 2 431 ILE 431 727 727 ILE ILE A . n 
B 2 432 SER 432 728 728 SER SER A . n 
B 2 433 ARG 433 729 729 ARG ARG A . n 
B 2 434 LYS 434 730 730 LYS ALA A . n 
B 2 435 GLU 435 731 731 GLU GLU A . n 
B 2 436 ALA 436 732 732 ALA ALA A . n 
B 2 437 ALA 437 733 733 ALA ALA A . n 
B 2 438 GLU 438 734 734 GLU GLU A . n 
B 2 439 PHE 439 735 735 PHE PHE A . n 
B 2 440 ILE 440 736 736 ILE ILE A . n 
B 2 441 GLU 441 737 737 GLU GLU A . n 
B 2 442 ARG 442 738 738 ARG ARG A . n 
B 2 443 TYR 443 739 739 TYR TYR A . n 
B 2 444 PHE 444 740 740 PHE PHE A . n 
B 2 445 GLU 445 741 741 GLU GLU A . n 
B 2 446 SER 446 742 742 SER SER A . n 
B 2 447 PHE 447 743 743 PHE PHE A . n 
B 2 448 PRO 448 744 744 PRO PRO A . n 
B 2 449 GLY 449 745 745 GLY GLY A . n 
B 2 450 VAL 450 746 746 VAL VAL A . n 
B 2 451 LYS 451 747 747 LYS LYS A . n 
B 2 452 ARG 452 748 748 ARG ARG A . n 
B 2 453 TYR 453 749 749 TYR TYR A . n 
B 2 454 MET 454 750 750 MET MET A . n 
B 2 455 GLU 455 751 751 GLU GLU A . n 
B 2 456 ASN 456 752 752 ASN ASN A . n 
B 2 457 ILE 457 753 753 ILE ILE A . n 
B 2 458 VAL 458 754 754 VAL VAL A . n 
B 2 459 GLN 459 755 755 GLN GLN A . n 
B 2 460 GLU 460 756 756 GLU GLU A . n 
B 2 461 ALA 461 757 757 ALA ALA A . n 
B 2 462 LYS 462 758 758 LYS LYS A . n 
B 2 463 GLN 463 759 759 GLN GLN A . n 
B 2 464 LYS 464 760 760 LYS LYS A . n 
B 2 465 GLY 465 761 761 GLY GLY A . n 
B 2 466 TYR 466 762 762 TYR TYR A . n 
B 2 467 VAL 467 763 763 VAL VAL A . n 
B 2 468 THR 468 764 764 THR THR A . n 
B 2 469 THR 469 765 765 THR THR A . n 
B 2 470 LEU 470 766 766 LEU LEU A . n 
B 2 471 LEU 471 767 767 LEU LEU A . n 
B 2 472 HIS 472 768 768 HIS HIS A . n 
B 2 473 ARG 473 769 769 ARG ARG A . n 
B 2 474 ARG 474 770 770 ARG ARG A . n 
B 2 475 ARG 475 771 771 ARG ARG A . n 
B 2 476 TYR 476 772 772 TYR TYR A . n 
B 2 477 LEU 477 773 773 LEU LEU A . n 
B 2 478 PRO 478 774 774 PRO PRO A . n 
B 2 479 ASP 479 775 775 ASP ASP A . n 
B 2 480 ILE 480 776 776 ILE ILE A . n 
B 2 481 THR 481 777 777 THR THR A . n 
B 2 482 SER 482 778 778 SER SER A . n 
B 2 483 ARG 483 779 779 ARG ARG A . n 
B 2 484 ASN 484 780 780 ASN ASN A . n 
B 2 485 PHE 485 781 781 PHE PHE A . n 
B 2 486 ASN 486 782 782 ASN ASN A . n 
B 2 487 VAL 487 783 783 VAL VAL A . n 
B 2 488 ARG 488 784 784 ARG ARG A . n 
B 2 489 SER 489 785 785 SER SER A . n 
B 2 490 PHE 490 786 786 PHE PHE A . n 
B 2 491 ALA 491 787 787 ALA ALA A . n 
B 2 492 GLU 492 788 788 GLU GLU A . n 
B 2 493 ARG 493 789 789 ARG ARG A . n 
B 2 494 MET 494 790 790 MET MET A . n 
B 2 495 ALA 495 791 791 ALA ALA A . n 
B 2 496 MET 496 792 792 MET MET A . n 
B 2 497 ASN 497 793 793 ASN ASN A . n 
B 2 498 THR 498 794 794 THR THR A . n 
B 2 499 PRO 499 795 795 PRO PRO A . n 
B 2 500 ILE 500 796 796 ILE ILE A . n 
B 2 501 GLN 501 797 797 GLN GLN A . n 
B 2 502 GLY 502 798 798 GLY GLY A . n 
B 2 503 SER 503 799 799 SER SER A . n 
B 2 504 ALA 504 800 800 ALA ALA A . n 
B 2 505 ALA 505 801 801 ALA ALA A . n 
B 2 506 ASP 506 802 802 ASP ASP A . n 
B 2 507 ILE 507 803 803 ILE ILE A . n 
B 2 508 ILE 508 804 804 ILE ILE A . n 
B 2 509 LYS 509 805 805 LYS LYS A . n 
B 2 510 LYS 510 806 806 LYS LYS A . n 
B 2 511 ALA 511 807 807 ALA ALA A . n 
B 2 512 MET 512 808 808 MET MET A . n 
B 2 513 ILE 513 809 809 ILE ILE A . n 
B 2 514 ASP 514 810 810 ASP ASP A . n 
B 2 515 LEU 515 811 811 LEU LEU A . n 
B 2 516 ASN 516 812 812 ASN ASN A . n 
B 2 517 ALA 517 813 813 ALA ALA A . n 
B 2 518 ARG 518 814 814 ARG ARG A . n 
B 2 519 LEU 519 815 815 LEU LEU A . n 
B 2 520 LYS 520 816 816 LYS LYS A . n 
B 2 521 GLU 521 817 817 GLU GLU A . n 
B 2 522 GLU 522 818 818 GLU GLU A . n 
B 2 523 ARG 523 819 819 ARG ARG A . n 
B 2 524 LEU 524 820 820 LEU LEU A . n 
B 2 525 GLN 525 821 821 GLN GLN A . n 
B 2 526 ALA 526 822 822 ALA ALA A . n 
B 2 527 ARG 527 823 823 ARG ARG A . n 
B 2 528 LEU 528 824 824 LEU LEU A . n 
B 2 529 LEU 529 825 825 LEU LEU A . n 
B 2 530 LEU 530 826 826 LEU LEU A . n 
B 2 531 GLN 531 827 827 GLN GLN A . n 
B 2 532 VAL 532 828 828 VAL VAL A . n 
B 2 533 HIS 533 829 829 HIS HIS A . n 
B 2 534 ASP 534 830 830 ASP ASP A . n 
B 2 535 GLU 535 831 831 GLU GLU A . n 
B 2 536 LEU 536 832 832 LEU LEU A . n 
B 2 537 ILE 537 833 833 ILE ILE A . n 
B 2 538 LEU 538 834 834 LEU LEU A . n 
B 2 539 GLU 539 835 835 GLU GLU A . n 
B 2 540 ALA 540 836 836 ALA ALA A . n 
B 2 541 PRO 541 837 837 PRO PRO A . n 
B 2 542 LYS 542 838 838 LYS LYS A . n 
B 2 543 GLU 543 839 839 GLU GLU A . n 
B 2 544 GLU 544 840 840 GLU GLU A . n 
B 2 545 MET 545 841 841 MET MET A . n 
B 2 546 GLU 546 842 842 GLU GLU A . n 
B 2 547 ARG 547 843 843 ARG ARG A . n 
B 2 548 LEU 548 844 844 LEU LEU A . n 
B 2 549 CYS 549 845 845 CYS CYS A . n 
B 2 550 ARG 550 846 846 ARG ARG A . n 
B 2 551 LEU 551 847 847 LEU LEU A . n 
B 2 552 VAL 552 848 848 VAL VAL A . n 
B 2 553 PRO 553 849 849 PRO PRO A . n 
B 2 554 GLU 554 850 850 GLU GLU A . n 
B 2 555 VAL 555 851 851 VAL VAL A . n 
B 2 556 MET 556 852 852 MET MET A . n 
B 2 557 GLU 557 853 853 GLU GLU A . n 
B 2 558 GLN 558 854 854 GLN GLN A . n 
B 2 559 ALA 559 855 855 ALA ALA A . n 
B 2 560 VAL 560 856 856 VAL VAL A . n 
B 2 561 THR 561 857 857 THR THR A . n 
B 2 562 LEU 562 858 858 LEU LEU A . n 
B 2 563 ARG 563 859 859 ARG ARG A . n 
B 2 564 VAL 564 860 860 VAL VAL A . n 
B 2 565 PRO 565 861 861 PRO PRO A . n 
B 2 566 LEU 566 862 862 LEU LEU A . n 
B 2 567 LYS 567 863 863 LYS LYS A . n 
B 2 568 VAL 568 864 864 VAL VAL A . n 
B 2 569 ASP 569 865 865 ASP ASP A . n 
B 2 570 TYR 570 866 866 TYR TYR A . n 
B 2 571 HIS 571 867 867 HIS HIS A . n 
B 2 572 TYR 572 868 868 TYR TYR A . n 
B 2 573 GLY 573 869 869 GLY GLY A . n 
B 2 574 SER 574 870 870 SER SER A . n 
B 2 575 THR 575 871 871 THR THR A . n 
B 2 576 TRP 576 872 872 TRP TRP A . n 
B 2 577 TYR 577 873 873 TYR TYR A . n 
B 2 578 ASP 578 874 874 ASP ASP A . n 
B 2 579 ALA 579 875 875 ALA ALA A . n 
B 2 580 LYS 580 876 876 LYS LYS A . n 
C 3 1   DT  1   4   4   DT  DT  T . n 
C 3 2   DA  2   5   5   DA  DA  T . n 
C 3 3   DC  3   6   6   DC  DC  T . n 
C 3 4   DG  4   7   7   DG  DG  T . n 
C 3 5   DT  5   8   8   DT  DT  T . n 
C 3 6   DG  6   9   9   DG  DG  T . n 
C 3 7   DA  7   10  10  DA  DA  T . n 
C 3 8   DT  8   11  11  DT  DT  T . n 
C 3 9   DC  9   12  12  DC  DC  T . n 
C 3 10  DG  10  13  13  DG  DG  T . n 
C 3 11  DC  11  14  14  DC  DC  T . n 
C 3 12  DA  12  15  15  DA  DA  T . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
D 4 MG  1   901  901 MG  MG  A . 
E 5 SO4 1   902  910 SO4 SO4 A . 
F 6 HOH 1   101  298 HOH HOH P . 
F 6 HOH 2   102  202 HOH HOH P . 
F 6 HOH 3   103  283 HOH HOH P . 
G 6 HOH 1   1001 335 HOH HOH A . 
G 6 HOH 2   1002 152 HOH HOH A . 
G 6 HOH 3   1003 175 HOH HOH A . 
G 6 HOH 4   1004 271 HOH HOH A . 
G 6 HOH 5   1005 101 HOH HOH A . 
G 6 HOH 6   1006 154 HOH HOH A . 
G 6 HOH 7   1007 168 HOH HOH A . 
G 6 HOH 8   1008 188 HOH HOH A . 
G 6 HOH 9   1009 193 HOH HOH A . 
G 6 HOH 10  1010 299 HOH HOH A . 
G 6 HOH 11  1011 281 HOH HOH A . 
G 6 HOH 12  1012 108 HOH HOH A . 
G 6 HOH 13  1013 161 HOH HOH A . 
G 6 HOH 14  1014 258 HOH HOH A . 
G 6 HOH 15  1015 197 HOH HOH A . 
G 6 HOH 16  1016 139 HOH HOH A . 
G 6 HOH 17  1017 265 HOH HOH A . 
G 6 HOH 18  1018 303 HOH HOH A . 
G 6 HOH 19  1019 48  HOH HOH A . 
G 6 HOH 20  1020 321 HOH HOH A . 
G 6 HOH 21  1021 158 HOH HOH A . 
G 6 HOH 22  1022 291 HOH HOH A . 
G 6 HOH 23  1023 134 HOH HOH A . 
G 6 HOH 24  1024 328 HOH HOH A . 
G 6 HOH 25  1025 43  HOH HOH A . 
G 6 HOH 26  1026 69  HOH HOH A . 
G 6 HOH 27  1027 39  HOH HOH A . 
G 6 HOH 28  1028 295 HOH HOH A . 
G 6 HOH 29  1029 214 HOH HOH A . 
G 6 HOH 30  1030 373 HOH HOH A . 
G 6 HOH 31  1031 136 HOH HOH A . 
G 6 HOH 32  1032 74  HOH HOH A . 
G 6 HOH 33  1033 149 HOH HOH A . 
G 6 HOH 34  1034 9   HOH HOH A . 
G 6 HOH 35  1035 159 HOH HOH A . 
G 6 HOH 36  1036 18  HOH HOH A . 
G 6 HOH 37  1037 58  HOH HOH A . 
G 6 HOH 38  1038 65  HOH HOH A . 
G 6 HOH 39  1039 236 HOH HOH A . 
G 6 HOH 40  1040 163 HOH HOH A . 
G 6 HOH 41  1041 252 HOH HOH A . 
G 6 HOH 42  1042 98  HOH HOH A . 
G 6 HOH 43  1043 96  HOH HOH A . 
G 6 HOH 44  1044 360 HOH HOH A . 
G 6 HOH 45  1045 183 HOH HOH A . 
G 6 HOH 46  1046 232 HOH HOH A . 
G 6 HOH 47  1047 238 HOH HOH A . 
G 6 HOH 48  1048 142 HOH HOH A . 
G 6 HOH 49  1049 59  HOH HOH A . 
G 6 HOH 50  1050 92  HOH HOH A . 
G 6 HOH 51  1051 235 HOH HOH A . 
G 6 HOH 52  1052 8   HOH HOH A . 
G 6 HOH 53  1053 212 HOH HOH A . 
G 6 HOH 54  1054 16  HOH HOH A . 
G 6 HOH 55  1055 205 HOH HOH A . 
G 6 HOH 56  1056 37  HOH HOH A . 
G 6 HOH 57  1057 41  HOH HOH A . 
G 6 HOH 58  1058 124 HOH HOH A . 
G 6 HOH 59  1059 209 HOH HOH A . 
G 6 HOH 60  1060 312 HOH HOH A . 
G 6 HOH 61  1061 17  HOH HOH A . 
G 6 HOH 62  1062 2   HOH HOH A . 
G 6 HOH 63  1063 224 HOH HOH A . 
G 6 HOH 64  1064 352 HOH HOH A . 
G 6 HOH 65  1065 170 HOH HOH A . 
G 6 HOH 66  1066 179 HOH HOH A . 
G 6 HOH 67  1067 13  HOH HOH A . 
G 6 HOH 68  1068 111 HOH HOH A . 
G 6 HOH 69  1069 22  HOH HOH A . 
G 6 HOH 70  1070 388 HOH HOH A . 
G 6 HOH 71  1071 30  HOH HOH A . 
G 6 HOH 72  1072 47  HOH HOH A . 
G 6 HOH 73  1073 131 HOH HOH A . 
G 6 HOH 74  1074 49  HOH HOH A . 
G 6 HOH 75  1075 122 HOH HOH A . 
G 6 HOH 76  1076 99  HOH HOH A . 
G 6 HOH 77  1077 117 HOH HOH A . 
G 6 HOH 78  1078 6   HOH HOH A . 
G 6 HOH 79  1079 137 HOH HOH A . 
G 6 HOH 80  1080 86  HOH HOH A . 
G 6 HOH 81  1081 204 HOH HOH A . 
G 6 HOH 82  1082 282 HOH HOH A . 
G 6 HOH 83  1083 146 HOH HOH A . 
G 6 HOH 84  1084 88  HOH HOH A . 
G 6 HOH 85  1085 95  HOH HOH A . 
G 6 HOH 86  1086 116 HOH HOH A . 
G 6 HOH 87  1087 53  HOH HOH A . 
G 6 HOH 88  1088 310 HOH HOH A . 
G 6 HOH 89  1089 109 HOH HOH A . 
G 6 HOH 90  1090 52  HOH HOH A . 
G 6 HOH 91  1091 1   HOH HOH A . 
G 6 HOH 92  1092 160 HOH HOH A . 
G 6 HOH 93  1093 70  HOH HOH A . 
G 6 HOH 94  1094 11  HOH HOH A . 
G 6 HOH 95  1095 4   HOH HOH A . 
G 6 HOH 96  1096 150 HOH HOH A . 
G 6 HOH 97  1097 90  HOH HOH A . 
G 6 HOH 98  1098 120 HOH HOH A . 
G 6 HOH 99  1099 233 HOH HOH A . 
G 6 HOH 100 1100 36  HOH HOH A . 
G 6 HOH 101 1101 82  HOH HOH A . 
G 6 HOH 102 1102 78  HOH HOH A . 
G 6 HOH 103 1103 264 HOH HOH A . 
G 6 HOH 104 1104 143 HOH HOH A . 
G 6 HOH 105 1105 57  HOH HOH A . 
G 6 HOH