data_6DV9
# 
_entry.id   6DV9 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.320 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   6DV9         
WWPDB D_1000234369 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.entry_id                        6DV9 
_pdbx_database_status.recvd_initial_deposition_date   2018-06-23 
_pdbx_database_status.SG_entry                        N 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
_audit_author.identifier_ORCID 
'Lin, W.'       1 ? 
'Das, K.'       2 ? 
'Feng, Y.'      3 ? 
'Ebright, R.H.' 4 ? 
# 
_citation.abstract                  ? 
_citation.abstract_id_CAS           ? 
_citation.book_id_ISBN              ? 
_citation.book_publisher            ? 
_citation.book_publisher_city       ? 
_citation.book_title                ? 
_citation.coordinate_linkage        ? 
_citation.country                   UK 
_citation.database_id_Medline       ? 
_citation.details                   ? 
_citation.id                        primary 
_citation.journal_abbrev            'Nat Commun' 
_citation.journal_id_ASTM           ? 
_citation.journal_id_CSD            ? 
_citation.journal_id_ISSN           2041-1723 
_citation.journal_full              ? 
_citation.journal_issue             ? 
_citation.journal_volume            10 
_citation.language                  ? 
_citation.page_first                710 
_citation.page_last                 710 
_citation.title                     'Structural basis of ECF-sigma-factor-dependent transcription initiation.' 
_citation.year                      2019 
_citation.database_id_CSD           ? 
_citation.pdbx_database_id_DOI      10.1038/s41467-019-08443-3 
_citation.pdbx_database_id_PubMed   30755604 
_citation.unpublished_flag          ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Lin, W.'       1 ?                   
primary 'Mandal, S.'    2 0000-0002-7752-0982 
primary 'Degen, D.'     3 ?                   
primary 'Cho, M.S.'     4 ?                   
primary 'Feng, Y.'      5 ?                   
primary 'Das, K.'       6 0000-0002-8897-324X 
primary 'Ebright, R.H.' 7 0000-0001-8915-7140 
# 
_cell.entry_id           6DV9 
_cell.length_a           143.270 
_cell.length_b           161.440 
_cell.length_c           237.690 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              8 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         6DV9 
_symmetry.space_group_name_H-M             'P 21 21 21' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                19 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1  polymer     man 'DNA-directed RNA polymerase subunit alpha'                                         39315.027  2 2.7.7.6 ? ? ? 
2  polymer     man 'DNA-directed RNA polymerase subunit beta'                                          130018.828 1 2.7.7.6 ? ? ? 
3  polymer     man 
;DNA-directed RNA polymerase subunit beta'
;
146968.969 1 2.7.7.6 ? ? ? 
4  polymer     man 'DNA-directed RNA polymerase subunit omega'                                         11851.140  1 2.7.7.6 ? ? ? 
5  polymer     man 'ECF RNA polymerase sigma factor SigL'                                              19563.074  1 ?       ? ? ? 
6  polymer     syn 
;RNA (5'-R(*CP*UP*CP*GP*A)-3')
;
1545.984   1 ?       ? ? ? 
7  polymer     syn 
;DNA (5'-D(*GP*CP*AP*TP*CP*CP*GP*TP*GP*AP*GP*TP*CP*GP*AP*GP*G)-3')
;
5268.410   1 ?       ? ? ? 
8  polymer     syn 
;DNA (5'-D(P*CP*GP*TP*GP*TP*CP*AP*GP*AP*GP*TP*GP*TP*CP*AP*CP*GP*GP*AP*TP*GP*C)-3')
;
6808.389   1 ?       ? ? ? 
9  non-polymer syn 'MAGNESIUM ION'                                                                     24.305     1 ?       ? ? ? 
10 non-polymer syn 'ZINC ION'                                                                          65.409     2 ?       ? ? ? 
# 
loop_
_entity_name_com.entity_id 
_entity_name_com.name 
1 'RNAP subunit alpha,RNA polymerase subunit alpha,Transcriptase subunit alpha'                                     
2 'RNAP subunit beta,RNA polymerase subunit beta,Transcriptase subunit beta'                                        
3 
;RNAP subunit beta',RNA polymerase subunit beta',Transcriptase subunit beta'
;
4 'RNAP omega subunit,RNA polymerase omega subunit,Transcriptase subunit omega'                                     
5 'ECF sigma factor SigL,Alternative RNA polymerase sigma factor SigL,RNA polymerase sigma-L factor,Sigma-L factor' 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)'        no no 
;MGHHHHHHHHHHMLISQRPTLSEDVLTDNRSQFVIEPLEPGFGYTLGNSLRRTLLSSIPGAAVTSIRIDGVLHEFTTVPG
VKEDVTEIILNLKSLVVSSEEDEPVTMYLRKQGPGEVTAGDIVPPAGVTVHNPGMHIATLNDKGKLEVELVVERGRGYVP
AVQNRASGAEIGRIPVDSIYSPVLKVTYKVDATRVEQRTDFDKLILDVETKNSISPRDALASAGKTLVELFGLARELNVE
AEGIEIGPSPAEADHIASFALPIDDLDLTVRSYNCLKREGVHTVGELVARTESDLLDIRNFGQKSIDEVKIKLHQLGLSL
KDSPPSFDPSEVAGYDVATGTWSTEGAYDEQDYAETEQL
;
;MGHHHHHHHHHHMLISQRPTLSEDVLTDNRSQFVIEPLEPGFGYTLGNSLRRTLLSSIPGAAVTSIRIDGVLHEFTTVPG
VKEDVTEIILNLKSLVVSSEEDEPVTMYLRKQGPGEVTAGDIVPPAGVTVHNPGMHIATLNDKGKLEVELVVERGRGYVP
AVQNRASGAEIGRIPVDSIYSPVLKVTYKVDATRVEQRTDFDKLILDVETKNSISPRDALASAGKTLVELFGLARELNVE
AEGIEIGPSPAEADHIASFALPIDDLDLTVRSYNCLKREGVHTVGELVARTESDLLDIRNFGQKSIDEVKIKLHQLGLSL
KDSPPSFDPSEVAGYDVATGTWSTEGAYDEQDYAETEQL
;
A,B ? 
2 'polypeptide(L)'        no no 
;MLEGCILADSRQSKTAASPSPSRPQSSSNNSVPGAPNRVSFAKLREPLEVPGLLDVQTDSFEWLIGSPRWRESAAERGDV
NPVGGLEEVLYELSPIEDFSGSMSLSFSDPRFDDVKAPVDECKDKDMTYAAPLFVTAEFINNNTGEIKSQTVFMGDFPMM
TEKGTFIINGTERVVVSQLVRSPGVYFDETIDKSTDKTLHSVKVIPSRGAWLEFDVDKRDTVGVRIDRKRRQPVTVLLKA
LGWTSEQIVERFGFSEIMRSTLEKDNTVGTDEALLDIYRKLRPGEPPTKESAQTLLENLFFKEKRYDLARVGRYKVNKKL
GLHVGEPITSSTLTEEDVVATIEYLVRLHEGQTTMTVPGGVEVPVETDDIDHFGNRRLRTVGELIQNQIRVGMSRMERVV
RERMTTQDVEAITPQTLINIRPVVAAIKEFFGTSQLSQFMDQNNPLSGLTHKRRLSALGPGGLSRERAGLEVRDVHPSHY
GRMCPIETPEGPNIGLIGSLSVYARVNPFGFIETPYRKVVDGVVSDEIVYLTADEEDRHVVAQANSPIDADGRFVEPRVL
VRRKAGEVEYVPSSEVDYMDVSPRQMVSVATAMIPFLEHDDANRALMGANMQRQAVPLVRSEAPLVGTGMELRAAIDAGD
VVVAEESGVIEEVSADYITVMHDNGTRRTYRMRKFARSNHGTCANQCPIVDAGDRVEAGQVIADGPCTDDGEMALGKNLL
VAIMPWEGHNYEDAIILSNRLVEEDVLTSIHIEEHEIDARDTKLGAEEITRDIPNISDEVLADLDERGIVRIGAEVRDGD
ILVGKVTPKGETELTPEERLLRAIFGEKAREVRDTSLKVPHGESGKVIGIRVFSREDEDELPAGVNELVRVYVAQKRKIS
DGDKLAGRHGNKGVIGKILPVEDMPFLADGTPVDIILNTHGVPRRMNIGQILETHLGWCAHSGWKVDAAKGVPDWAARLP
DELLEAQPNAIVSTPVFDGAQEAELQGLLSCTLPNRDGDVLVDADGKAMLFDGRSGEPFPYPVTVGYMYIMKLHHLVDDK
IHARSTGPYSMITQQPLGGKAQFGGQRFGEMECWAMQAYGAAYTLQELLTIKSDDTVGRVKVYEAIVKGENIPEPGIPES
FKVLLKELQSLCLNVEVLSSDGAAIELREGEDEDLERAAANLGINLSRNESASVEDLA
;
;MLEGCILADSRQSKTAASPSPSRPQSSSNNSVPGAPNRVSFAKLREPLEVPGLLDVQTDSFEWLIGSPRWRESAAERGDV
NPVGGLEEVLYELSPIEDFSGSMSLSFSDPRFDDVKAPVDECKDKDMTYAAPLFVTAEFINNNTGEIKSQTVFMGDFPMM
TEKGTFIINGTERVVVSQLVRSPGVYFDETIDKSTDKTLHSVKVIPSRGAWLEFDVDKRDTVGVRIDRKRRQPVTVLLKA
LGWTSEQIVERFGFSEIMRSTLEKDNTVGTDEALLDIYRKLRPGEPPTKESAQTLLENLFFKEKRYDLARVGRYKVNKKL
GLHVGEPITSSTLTEEDVVATIEYLVRLHEGQTTMTVPGGVEVPVETDDIDHFGNRRLRTVGELIQNQIRVGMSRMERVV
RERMTTQDVEAITPQTLINIRPVVAAIKEFFGTSQLSQFMDQNNPLSGLTHKRRLSALGPGGLSRERAGLEVRDVHPSHY
GRMCPIETPEGPNIGLIGSLSVYARVNPFGFIETPYRKVVDGVVSDEIVYLTADEEDRHVVAQANSPIDADGRFVEPRVL
VRRKAGEVEYVPSSEVDYMDVSPRQMVSVATAMIPFLEHDDANRALMGANMQRQAVPLVRSEAPLVGTGMELRAAIDAGD
VVVAEESGVIEEVSADYITVMHDNGTRRTYRMRKFARSNHGTCANQCPIVDAGDRVEAGQVIADGPCTDDGEMALGKNLL
VAIMPWEGHNYEDAIILSNRLVEEDVLTSIHIEEHEIDARDTKLGAEEITRDIPNISDEVLADLDERGIVRIGAEVRDGD
ILVGKVTPKGETELTPEERLLRAIFGEKAREVRDTSLKVPHGESGKVIGIRVFSREDEDELPAGVNELVRVYVAQKRKIS
DGDKLAGRHGNKGVIGKILPVEDMPFLADGTPVDIILNTHGVPRRMNIGQILETHLGWCAHSGWKVDAAKGVPDWAARLP
DELLEAQPNAIVSTPVFDGAQEAELQGLLSCTLPNRDGDVLVDADGKAMLFDGRSGEPFPYPVTVGYMYIMKLHHLVDDK
IHARSTGPYSMITQQPLGGKAQFGGQRFGEMECWAMQAYGAAYTLQELLTIKSDDTVGRVKVYEAIVKGENIPEPGIPES
FKVLLKELQSLCLNVEVLSSDGAAIELREGEDEDLERAAANLGINLSRNESASVEDLA
;
C   ? 
3 'polypeptide(L)'        no no 
;MLDVNFFDELRIGLATAEDIRQWSYGEVKKPETINYRTLKPEKDGLFCEKIFGPTRDWECYCGKYKRVRFKGIICERCGV
EVTRAKVRRERMGHIELAAPVTHIWYFKGVPSRLGYLLDLAPKDLEKIIYFAAYVITSVDEEMRHNELSTLEAEMAVERK
AVEDQRDGELEARAQKLEADLAELEAEGAKADARRKVRDGGEREMRQIRDRAQRELDRLEDIWSTFTKLAPKQLIVDENL
YRELVDRYGEYFTGAMGAESIQKLIENFDIDAEAESLRDVIRNGKGQKKLRALKRLKVVAAFQQSGNSPMGMVLDAVPVI
PPELRPMVQLDGGRFATSDLNDLYRRVINRNNRLKRLIDLGAPEIIVNNEKRMLQESVDALFDNGRRGRPVTGPGNRPLK
SLSDLLKGKQGRFRQNLLGKRVDYSGRSVIVVGPQLKLHQCGLPKLMALELFKPFVMKRLVDLNHAQNIKSAKRMVERQR
PQVWDVLEEVIAEHPVLLNRAPTLHRLGIQAFEPMLVEGKAIQLHPLVCEAFNADFDGDQMAVHLPLSAEAQAEARILML
SSNNILSPASGRPLAMPRLDMVTGLYYLTTEVPGDTGEYQPASGDHPETGVYSSPAEAIMAADRGVLSVRAKIKVRLTQL
RPPVEIEAELFGHSGWQPGDAWMAETTLGRVMFNELLPLGYPFVNKQMHKKVQAAIINDLAERYPMIVVAQTVDKLKDAG
FYWATRSGVTVSMADVLVPPRKKEILDHYEERADKVEKQFQRGALNHDERNEALVEIWKEATDEVGQALREHYPDDNPII
TIVDSGATGNFTQTRTLAGMKGLVTNPKGEFIPRPVKSSFREGLTVLEYFINTHGARKGLADTALRTADSGYLTRRLVDV
SQDVIVREHDCQTERGIVVELAERAPDGTLIRDPYIETSAYARTLGTDAVDEAGNVIVERGQDLGDPEIDALLAAGITQV
KVRSVLTCATSTGVCATCYGRSMATGKLVDIGEAVGIVAAQSIGEPGTQLTMRTFHQGGVGEDITGGLPRVQELFEARVP
RGKAPIADVTGRVRLEDGERFYKITIVPDDGGEEVVYDKISKRQRLRVFKHEDGSERVLSDGDHVEVGQQLMEGSADPHE
VLRVQGPREVQIHLVREVQEVYRAQGVSIHDKHIEVIVRQMLRRVTIIDSGSTEFLPGSLIDRAEFEAENRRVVAEGGEP
AAGRPVLMGITKASLATDSWLSAASFQETTRVLTDAAINCRSDKLNGLKENVIIGKLIPAGTGINRYRNIAVQPTEEARA
AAYTIPSYEDQYYSPDFGAATGAAVPLDDYGYSDYR
;
;MLDVNFFDELRIGLATAEDIRQWSYGEVKKPETINYRTLKPEKDGLFCEKIFGPTRDWECYCGKYKRVRFKGIICERCGV
EVTRAKVRRERMGHIELAAPVTHIWYFKGVPSRLGYLLDLAPKDLEKIIYFAAYVITSVDEEMRHNELSTLEAEMAVERK
AVEDQRDGELEARAQKLEADLAELEAEGAKADARRKVRDGGEREMRQIRDRAQRELDRLEDIWSTFTKLAPKQLIVDENL
YRELVDRYGEYFTGAMGAESIQKLIENFDIDAEAESLRDVIRNGKGQKKLRALKRLKVVAAFQQSGNSPMGMVLDAVPVI
PPELRPMVQLDGGRFATSDLNDLYRRVINRNNRLKRLIDLGAPEIIVNNEKRMLQESVDALFDNGRRGRPVTGPGNRPLK
SLSDLLKGKQGRFRQNLLGKRVDYSGRSVIVVGPQLKLHQCGLPKLMALELFKPFVMKRLVDLNHAQNIKSAKRMVERQR
PQVWDVLEEVIAEHPVLLNRAPTLHRLGIQAFEPMLVEGKAIQLHPLVCEAFNADFDGDQMAVHLPLSAEAQAEARILML
SSNNILSPASGRPLAMPRLDMVTGLYYLTTEVPGDTGEYQPASGDHPETGVYSSPAEAIMAADRGVLSVRAKIKVRLTQL
RPPVEIEAELFGHSGWQPGDAWMAETTLGRVMFNELLPLGYPFVNKQMHKKVQAAIINDLAERYPMIVVAQTVDKLKDAG
FYWATRSGVTVSMADVLVPPRKKEILDHYEERADKVEKQFQRGALNHDERNEALVEIWKEATDEVGQALREHYPDDNPII
TIVDSGATGNFTQTRTLAGMKGLVTNPKGEFIPRPVKSSFREGLTVLEYFINTHGARKGLADTALRTADSGYLTRRLVDV
SQDVIVREHDCQTERGIVVELAERAPDGTLIRDPYIETSAYARTLGTDAVDEAGNVIVERGQDLGDPEIDALLAAGITQV
KVRSVLTCATSTGVCATCYGRSMATGKLVDIGEAVGIVAAQSIGEPGTQLTMRTFHQGGVGEDITGGLPRVQELFEARVP
RGKAPIADVTGRVRLEDGERFYKITIVPDDGGEEVVYDKISKRQRLRVFKHEDGSERVLSDGDHVEVGQQLMEGSADPHE
VLRVQGPREVQIHLVREVQEVYRAQGVSIHDKHIEVIVRQMLRRVTIIDSGSTEFLPGSLIDRAEFEAENRRVVAEGGEP
AAGRPVLMGITKASLATDSWLSAASFQETTRVLTDAAINCRSDKLNGLKENVIIGKLIPAGTGINRYRNIAVQPTEEARA
AAYTIPSYEDQYYSPDFGAATGAAVPLDDYGYSDYR
;
D   ? 
4 'polypeptide(L)'        no no 
;MSISQSDASLAAVPAVDQFDPSSGASGGYDTPLGITNPPIDELLDRVSSKYALVIYAAKRARQINDYYNQLGEGILEYVG
PLVEPGLQEKPLSIALREIHADLLEHTEGE
;
;MSISQSDASLAAVPAVDQFDPSSGASGGYDTPLGITNPPIDELLDRVSSKYALVIYAAKRARQINDYYNQLGEGILEYVG
PLVEPGLQEKPLSIALREIHADLLEHTEGE
;
E   ? 
5 'polypeptide(L)'        no no 
;MARVSGAAAAEAALMRALYDEHAAVLWRYALRLTGDAAQAEDVVQETLLRAWQHPEVIGDTARPARAWLFTVARNMIIDE
RRSARFRNVVGSTDQSGTPEQSTPDEVNAALDRLLIADALAQLSAEHRAVIQRSYYRGWSTAQIATDLGIAEGTVKSRLH
YAVRALRLTLQELGVTR
;
;MARVSGAAAAEAALMRALYDEHAAVLWRYALRLTGDAAQAEDVVQETLLRAWQHPEVIGDTARPARAWLFTVARNMIIDE
RRSARFRNVVGSTDQSGTPEQSTPDEVNAALDRLLIADALAQLSAEHRAVIQRSYYRGWSTAQIATDLGIAEGTVKSRLH
YAVRALRLTLQELGVTR
;
F   ? 
6 polyribonucleotide      no no CUCGA CUCGA I   ? 
7 polydeoxyribonucleotide no no '(DG)(DC)(DA)(DT)(DC)(DC)(DG)(DT)(DG)(DA)(DG)(DT)(DC)(DG)(DA)(DG)(DG)' GCATCCGTGAGTCGAGG G   ? 
8 polydeoxyribonucleotide no no 
;(DC)(DG)(DT)(DG)(DT)(DC)(DA)(DG)(DA)(DG)(DT)(DG)(DT)(DC)(DA)(DC)(DG)(DG)(DA)(DT)
(DG)(DC)
;
CGTGTCAGAGTGTCACGGATGC H   ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1    MET n 
1 2    GLY n 
1 3    HIS n 
1 4    HIS n 
1 5    HIS n 
1 6    HIS n 
1 7    HIS n 
1 8    HIS n 
1 9    HIS n 
1 10   HIS n 
1 11   HIS n 
1 12   HIS n 
1 13   MET n 
1 14   LEU n 
1 15   ILE n 
1 16   SER n 
1 17   GLN n 
1 18   ARG n 
1 19   PRO n 
1 20   THR n 
1 21   LEU n 
1 22   SER n 
1 23   GLU n 
1 24   ASP n 
1 25   VAL n 
1 26   LEU n 
1 27   THR n 
1 28   ASP n 
1 29   ASN n 
1 30   ARG n 
1 31   SER n 
1 32   GLN n 
1 33   PHE n 
1 34   VAL n 
1 35   ILE n 
1 36   GLU n 
1 37   PRO n 
1 38   LEU n 
1 39   GLU n 
1 40   PRO n 
1 41   GLY n 
1 42   PHE n 
1 43   GLY n 
1 44   TYR n 
1 45   THR n 
1 46   LEU n 
1 47   GLY n 
1 48   ASN n 
1 49   SER n 
1 50   LEU n 
1 51   ARG n 
1 52   ARG n 
1 53   THR n 
1 54   LEU n 
1 55   LEU n 
1 56   SER n 
1 57   SER n 
1 58   ILE n 
1 59   PRO n 
1 60   GLY n 
1 61   ALA n 
1 62   ALA n 
1 63   VAL n 
1 64   THR n 
1 65   SER n 
1 66   ILE n 
1 67   ARG n 
1 68   ILE n 
1 69   ASP n 
1 70   GLY n 
1 71   VAL n 
1 72   LEU n 
1 73   HIS n 
1 74   GLU n 
1 75   PHE n 
1 76   THR n 
1 77   THR n 
1 78   VAL n 
1 79   PRO n 
1 80   GLY n 
1 81   VAL n 
1 82   LYS n 
1 83   GLU n 
1 84   ASP n 
1 85   VAL n 
1 86   THR n 
1 87   GLU n 
1 88   ILE n 
1 89   ILE n 
1 90   LEU n 
1 91   ASN n 
1 92   LEU n 
1 93   LYS n 
1 94   SER n 
1 95   LEU n 
1 96   VAL n 
1 97   VAL n 
1 98   SER n 
1 99   SER n 
1 100  GLU n 
1 101  GLU n 
1 102  ASP n 
1 103  GLU n 
1 104  PRO n 
1 105  VAL n 
1 106  THR n 
1 107  MET n 
1 108  TYR n 
1 109  LEU n 
1 110  ARG n 
1 111  LYS n 
1 112  GLN n 
1 113  GLY n 
1 114  PRO n 
1 115  GLY n 
1 116  GLU n 
1 117  VAL n 
1 118  THR n 
1 119  ALA n 
1 120  GLY n 
1 121  ASP n 
1 122  ILE n 
1 123  VAL n 
1 124  PRO n 
1 125  PRO n 
1 126  ALA n 
1 127  GLY n 
1 128  VAL n 
1 129  THR n 
1 130  VAL n 
1 131  HIS n 
1 132  ASN n 
1 133  PRO n 
1 134  GLY n 
1 135  MET n 
1 136  HIS n 
1 137  ILE n 
1 138  ALA n 
1 139  THR n 
1 140  LEU n 
1 141  ASN n 
1 142  ASP n 
1 143  LYS n 
1 144  GLY n 
1 145  LYS n 
1 146  LEU n 
1 147  GLU n 
1 148  VAL n 
1 149  GLU n 
1 150  LEU n 
1 151  VAL n 
1 152  VAL n 
1 153  GLU n 
1 154  ARG n 
1 155  GLY n 
1 156  ARG n 
1 157  GLY n 
1 158  TYR n 
1 159  VAL n 
1 160  PRO n 
1 161  ALA n 
1 162  VAL n 
1 163  GLN n 
1 164  ASN n 
1 165  ARG n 
1 166  ALA n 
1 167  SER n 
1 168  GLY n 
1 169  ALA n 
1 170  GLU n 
1 171  ILE n 
1 172  GLY n 
1 173  ARG n 
1 174  ILE n 
1 175  PRO n 
1 176  VAL n 
1 177  ASP n 
1 178  SER n 
1 179  ILE n 
1 180  TYR n 
1 181  SER n 
1 182  PRO n 
1 183  VAL n 
1 184  LEU n 
1 185  LYS n 
1 186  VAL n 
1 187  THR n 
1 188  TYR n 
1 189  LYS n 
1 190  VAL n 
1 191  ASP n 
1 192  ALA n 
1 193  THR n 
1 194  ARG n 
1 195  VAL n 
1 196  GLU n 
1 197  GLN n 
1 198  ARG n 
1 199  THR n 
1 200  ASP n 
1 201  PHE n 
1 202  ASP n 
1 203  LYS n 
1 204  LEU n 
1 205  ILE n 
1 206  LEU n 
1 207  ASP n 
1 208  VAL n 
1 209  GLU n 
1 210  THR n 
1 211  LYS n 
1 212  ASN n 
1 213  SER n 
1 214  ILE n 
1 215  SER n 
1 216  PRO n 
1 217  ARG n 
1 218  ASP n 
1 219  ALA n 
1 220  LEU n 
1 221  ALA n 
1 222  SER n 
1 223  ALA n 
1 224  GLY n 
1 225  LYS n 
1 226  THR n 
1 227  LEU n 
1 228  VAL n 
1 229  GLU n 
1 230  LEU n 
1 231  PHE n 
1 232  GLY n 
1 233  LEU n 
1 234  ALA n 
1 235  ARG n 
1 236  GLU n 
1 237  LEU n 
1 238  ASN n 
1 239  VAL n 
1 240  GLU n 
1 241  ALA n 
1 242  GLU n 
1 243  GLY n 
1 244  ILE n 
1 245  GLU n 
1 246  ILE n 
1 247  GLY n 
1 248  PRO n 
1 249  SER n 
1 250  PRO n 
1 251  ALA n 
1 252  GLU n 
1 253  ALA n 
1 254  ASP n 
1 255  HIS n 
1 256  ILE n 
1 257  ALA n 
1 258  SER n 
1 259  PHE n 
1 260  ALA n 
1 261  LEU n 
1 262  PRO n 
1 263  ILE n 
1 264  ASP n 
1 265  ASP n 
1 266  LEU n 
1 267  ASP n 
1 268  LEU n 
1 269  THR n 
1 270  VAL n 
1 271  ARG n 
1 272  SER n 
1 273  TYR n 
1 274  ASN n 
1 275  CYS n 
1 276  LEU n 
1 277  LYS n 
1 278  ARG n 
1 279  GLU n 
1 280  GLY n 
1 281  VAL n 
1 282  HIS n 
1 283  THR n 
1 284  VAL n 
1 285  GLY n 
1 286  GLU n 
1 287  LEU n 
1 288  VAL n 
1 289  ALA n 
1 290  ARG n 
1 291  THR n 
1 292  GLU n 
1 293  SER n 
1 294  ASP n 
1 295  LEU n 
1 296  LEU n 
1 297  ASP n 
1 298  ILE n 
1 299  ARG n 
1 300  ASN n 
1 301  PHE n 
1 302  GLY n 
1 303  GLN n 
1 304  LYS n 
1 305  SER n 
1 306  ILE n 
1 307  ASP n 
1 308  GLU n 
1 309  VAL n 
1 310  LYS n 
1 311  ILE n 
1 312  LYS n 
1 313  LEU n 
1 314  HIS n 
1 315  GLN n 
1 316  LEU n 
1 317  GLY n 
1 318  LEU n 
1 319  SER n 
1 320  LEU n 
1 321  LYS n 
1 322  ASP n 
1 323  SER n 
1 324  PRO n 
1 325  PRO n 
1 326  SER n 
1 327  PHE n 
1 328  ASP n 
1 329  PRO n 
1 330  SER n 
1 331  GLU n 
1 332  VAL n 
1 333  ALA n 
1 334  GLY n 
1 335  TYR n 
1 336  ASP n 
1 337  VAL n 
1 338  ALA n 
1 339  THR n 
1 340  GLY n 
1 341  THR n 
1 342  TRP n 
1 343  SER n 
1 344  THR n 
1 345  GLU n 
1 346  GLY n 
1 347  ALA n 
1 348  TYR n 
1 349  ASP n 
1 350  GLU n 
1 351  GLN n 
1 352  ASP n 
1 353  TYR n 
1 354  ALA n 
1 355  GLU n 
1 356  THR n 
1 357  GLU n 
1 358  GLN n 
1 359  LEU n 
2 1    MET n 
2 2    LEU n 
2 3    GLU n 
2 4    GLY n 
2 5    CYS n 
2 6    ILE n 
2 7    LEU n 
2 8    ALA n 
2 9    ASP n 
2 10   SER n 
2 11   ARG n 
2 12   GLN n 
2 13   SER n 
2 14   LYS n 
2 15   THR n 
2 16   ALA n 
2 17   ALA n 
2 18   SER n 
2 19   PRO n 
2 20   SER n 
2 21   PRO n 
2 22   SER n 
2 23   ARG n 
2 24   PRO n 
2 25   GLN n 
2 26   SER n 
2 27   SER n 
2 28   SER n 
2 29   ASN n 
2 30   ASN n 
2 31   SER n 
2 32   VAL n 
2 33   PRO n 
2 34   GLY n 
2 35   ALA n 
2 36   PRO n 
2 37   ASN n 
2 38   ARG n 
2 39   VAL n 
2 40   SER n 
2 41   PHE n 
2 42   ALA n 
2 43   LYS n 
2 44   LEU n 
2 45   ARG n 
2 46   GLU n 
2 47   PRO n 
2 48   LEU n 
2 49   GLU n 
2 50   VAL n 
2 51   PRO n 
2 52   GLY n 
2 53   LEU n 
2 54   LEU n 
2 55   ASP n 
2 56   VAL n 
2 57   GLN n 
2 58   THR n 
2 59   ASP n 
2 60   SER n 
2 61   PHE n 
2 62   GLU n 
2 63   TRP n 
2 64   LEU n 
2 65   ILE n 
2 66   GLY n 
2 67   SER n 
2 68   PRO n 
2 69   ARG n 
2 70   TRP n 
2 71   ARG n 
2 72   GLU n 
2 73   SER n 
2 74   ALA n 
2 75   ALA n 
2 76   GLU n 
2 77   ARG n 
2 78   GLY n 
2 79   ASP n 
2 80   VAL n 
2 81   ASN n 
2 82   PRO n 
2 83   VAL n 
2 84   GLY n 
2 85   GLY n 
2 86   LEU n 
2 87   GLU n 
2 88   GLU n 
2 89   VAL n 
2 90   LEU n 
2 91   TYR n 
2 92   GLU n 
2 93   LEU n 
2 94   SER n 
2 95   PRO n 
2 96   ILE n 
2 97   GLU n 
2 98   ASP n 
2 99   PHE n 
2 100  SER n 
2 101  GLY n 
2 102  SER n 
2 103  MET n 
2 104  SER n 
2 105  LEU n 
2 106  SER n 
2 107  PHE n 
2 108  SER n 
2 109  ASP n 
2 110  PRO n 
2 111  ARG n 
2 112  PHE n 
2 113  ASP n 
2 114  ASP n 
2 115  VAL n 
2 116  LYS n 
2 117  ALA n 
2 118  PRO n 
2 119  VAL n 
2 120  ASP n 
2 121  GLU n 
2 122  CYS n 
2 123  LYS n 
2 124  ASP n 
2 125  LYS n 
2 126  ASP n 
2 127  MET n 
2 128  THR n 
2 129  TYR n 
2 130  ALA n 
2 131  ALA n 
2 132  PRO n 
2 133  LEU n 
2 134  PHE n 
2 135  VAL n 
2 136  THR n 
2 137  ALA n 
2 138  GLU n 
2 139  PHE n 
2 140  ILE n 
2 141  ASN n 
2 142  ASN n 
2 143  ASN n 
2 144  THR n 
2 145  GLY n 
2 146  GLU n 
2 147  ILE n 
2 148  LYS n 
2 149  SER n 
2 150  GLN n 
2 151  THR n 
2 152  VAL n 
2 153  PHE n 
2 154  MET n 
2 155  GLY n 
2 156  ASP n 
2 157  PHE n 
2 158  PRO n 
2 159  MET n 
2 160  MET n 
2 161  THR n 
2 162  GLU n 
2 163  LYS n 
2 164  GLY n 
2 165  THR n 
2 166  PHE n 
2 167  ILE n 
2 168  ILE n 
2 169  ASN n 
2 170  GLY n 
2 171  THR n 
2 172  GLU n 
2 173  ARG n 
2 174  VAL n 
2 175  VAL n 
2 176  VAL n 
2 177  SER n 
2 178  GLN n 
2 179  LEU n 
2 180  VAL n 
2 181  ARG n 
2 182  SER n 
2 183  PRO n 
2 184  GLY n 
2 185  VAL n 
2 186  TYR n 
2 187  PHE n 
2 188  ASP n 
2 189  GLU n 
2 190  THR n 
2 191  ILE n 
2 192  ASP n 
2 193  LYS n 
2 194  SER n 
2 195  THR n 
2 196  ASP n 
2 197  LYS n 
2 198  THR n 
2 199  LEU n 
2 200  HIS n 
2 201  SER n 
2 202  VAL n 
2 203  LYS n 
2 204  VAL n 
2 205  ILE n 
2 206  PRO n 
2 207  SER n 
2 208  ARG n 
2 209  GLY n 
2 210  ALA n 
2 211  TRP n 
2 212  LEU n 
2 213  GLU n 
2 214  PHE n 
2 215  ASP n 
2 216  VAL n 
2 217  ASP n 
2 218  LYS n 
2 219  ARG n 
2 220  ASP n 
2 221  THR n 
2 222  VAL n 
2 223  GLY n 
2 224  VAL n 
2 225  ARG n 
2 226  ILE n 
2 227  ASP n 
2 228  ARG n 
2 229  LYS n 
2 230  ARG n 
2 231  ARG n 
2 232  GLN n 
2 233  PRO n 
2 234  VAL n 
2 235  THR n 
2 236  VAL n 
2 237  LEU n 
2 238  LEU n 
2 239  LYS n 
2 240  ALA n 
2 241  LEU n 
2 242  GLY n 
2 243  TRP n 
2 244  THR n 
2 245  SER n 
2 246  GLU n 
2 247  GLN n 
2 248  ILE n 
2 249  VAL n 
2 250  GLU n 
2 251  ARG n 
2 252  PHE n 
2 253  GLY n 
2 254  PHE n 
2 255  SER n 
2 256  GLU n 
2 257  ILE n 
2 258  MET n 
2 259  ARG n 
2 260  SER n 
2 261  THR n 
2 262  LEU n 
2 263  GLU n 
2 264  LYS n 
2 265  ASP n 
2 266  ASN n 
2 267  THR n 
2 268  VAL n 
2 269  GLY n 
2 270  THR n 
2 271  ASP n 
2 272  GLU n 
2 273  ALA n 
2 274  LEU n 
2 275  LEU n 
2 276  ASP n 
2 277  ILE n 
2 278  TYR n 
2 279  ARG n 
2 280  LYS n 
2 281  LEU n 
2 282  ARG n 
2 283  PRO n 
2 284  GLY n 
2 285  GLU n 
2 286  PRO n 
2 287  PRO n 
2 288  THR n 
2 289  LYS n 
2 290  GLU n 
2 291  SER n 
2 292  ALA n 
2 293  GLN n 
2 294  THR n 
2 295  LEU n 
2 296  LEU n 
2 297  GLU n 
2 298  ASN n 
2 299  LEU n 
2 300  PHE n 
2 301  PHE n 
2 302  LYS n 
2 303  GLU n 
2 304  LYS n 
2 305  ARG n 
2 306  TYR n 
2 307  ASP n 
2 308  LEU n 
2 309  ALA n 
2 310  ARG n 
2 311  VAL n 
2 312  GLY n 
2 313  ARG n 
2 314  TYR n 
2 315  LYS n 
2 316  VAL n 
2 317  ASN n 
2 318  LYS n 
2 319  LYS n 
2 320  LEU n 
2 321  GLY n 
2 322  LEU n 
2 323  HIS n 
2 324  VAL n 
2 325  GLY n 
2 326  GLU n 
2 327  PRO n 
2 328  ILE n 
2 329  THR n 
2 330  SER n 
2 331  SER n 
2 332  THR n 
2 333  LEU n 
2 334  THR n 
2 335  GLU n 
2 336  GLU n 
2 337  ASP n 
2 338  VAL n 
2 339  VAL n 
2 340  ALA n 
2 341  THR n 
2 342  ILE n 
2 343  GLU n 
2 344  TYR n 
2 345  LEU n 
2 346  VAL n 
2 347  ARG n 
2 348  LEU n 
2 349  HIS n 
2 350  GLU n 
2 351  GLY n 
2 352  GLN n 
2 353  THR n 
2 354  THR n 
2 355  MET n 
2 356  THR n 
2 357  VAL n 
2 358  PRO n 
2 359  GLY n 
2 360  GLY n 
2 361  VAL n 
2 362  GLU n 
2 363  VAL n 
2 364  PRO n 
2 365  VAL n 
2 366  GLU n 
2 367  THR n 
2 368  ASP n 
2 369  ASP n 
2 370  ILE n 
2 371  ASP n 
2 372  HIS n 
2 373  PHE n 
2 374  GLY n 
2 375  ASN n 
2 376  ARG n 
2 377  ARG n 
2 378  LEU n 
2 379  ARG n 
2 380  THR n 
2 381  VAL n 
2 382  GLY n 
2 383  GLU n 
2 384  LEU n 
2 385  ILE n 
2 386  GLN n 
2 387  ASN n 
2 388  GLN n 
2 389  ILE n 
2 390  ARG n 
2 391  VAL n 
2 392  GLY n 
2 393  MET n 
2 394  SER n 
2 395  ARG n 
2 396  MET n 
2 397  GLU n 
2 398  ARG n 
2 399  VAL n 
2 400  VAL n 
2 401  ARG n 
2 402  GLU n 
2 403  ARG n 
2 404  MET n 
2 405  THR n 
2 406  THR n 
2 407  GLN n 
2 408  ASP n 
2 409  VAL n 
2 410  GLU n 
2 411  ALA n 
2 412  ILE n 
2 413  THR n 
2 414  PRO n 
2 415  GLN n 
2 416  THR n 
2 417  LEU n 
2 418  ILE n 
2 419  ASN n 
2 420  ILE n 
2 421  ARG n 
2 422  PRO n 
2 423  VAL n 
2 424  VAL n 
2 425  ALA n 
2 426  ALA n 
2 427  ILE n 
2 428  LYS n 
2 429  GLU n 
2 430  PHE n 
2 431  PHE n 
2 432  GLY n 
2 433  THR n 
2 434  SER n 
2 435  GLN n 
2 436  LEU n 
2 437  SER n 
2 438  GLN n 
2 439  PHE n 
2 440  MET n 
2 441  ASP n 
2 442  GLN n 
2 443  ASN n 
2 444  ASN n 
2 445  PRO n 
2 446  LEU n 
2 447  SER n 
2 448  GLY n 
2 449  LEU n 
2 450  THR n 
2 451  HIS n 
2 452  LYS n 
2 453  ARG n 
2 454  ARG n 
2 455  LEU n 
2 456  SER n 
2 457  ALA n 
2 458  LEU n 
2 459  GLY n 
2 460  PRO n 
2 461  GLY n 
2 462  GLY n 
2 463  LEU n 
2 464  SER n 
2 465  ARG n 
2 466  GLU n 
2 467  ARG n 
2 468  ALA n 
2 469  GLY n 
2 470  LEU n 
2 471  GLU n 
2 472  VAL n 
2 473  ARG n 
2 474  ASP n 
2 475  VAL n 
2 476  HIS n 
2 477  PRO n 
2 478  SER n 
2 479  HIS n 
2 480  TYR n 
2 481  GLY n 
2 482  ARG n 
2 483  MET n 
2 484  CYS n 
2 485  PRO n 
2 486  ILE n 
2 487  GLU n 
2 488  THR n 
2 489  PRO n 
2 490  GLU n 
2 491  GLY n 
2 492  PRO n 
2 493  ASN n 
2 494  ILE n 
2 495  GLY n 
2 496  LEU n 
2 497  ILE n 
2 498  GLY n 
2 499  SER n 
2 500  LEU n 
2 501  SER n 
2 502  VAL n 
2 503  TYR n 
2 504  ALA n 
2 505  ARG n 
2 506  VAL n 
2 507  ASN n 
2 508  PRO n 
2 509  PHE n 
2 510  GLY n 
2 511  PHE n 
2 512  ILE n 
2 513  GLU n 
2 514  THR n 
2 515  PRO n 
2 516  TYR n 
2 517  ARG n 
2 518  LYS n 
2 519  VAL n 
2 520  VAL n 
2 521  ASP n 
2 522  GLY n 
2 523  VAL n 
2 524  VAL n 
2 525  SER n 
2 526  ASP n 
2 527  GLU n 
2 528  ILE n 
2 529  VAL n 
2 530  TYR n 
2 531  LEU n 
2 532  THR n 
2 533  ALA n 
2 534  ASP n 
2 535  GLU n 
2 536  GLU n 
2 537  ASP n 
2 538  ARG n 
2 539  HIS n 
2 540  VAL n 
2 541  VAL n 
2 542  ALA n 
2 543  GLN n 
2 544  ALA n 
2 545  ASN n 
2 546  SER n 
2 547  PRO n 
2 548  ILE n 
2 549  ASP n 
2 550  ALA n 
2 551  ASP n 
2 552  GLY n 
2 553  ARG n 
2 554  PHE n 
2 555  VAL n 
2 556  GLU n 
2 557  PRO n 
2 558  ARG n 
2 559  VAL n 
2 560  LEU n 
2 561  VAL n 
2 562  ARG n 
2 563  ARG n 
2 564  LYS n 
2 565  ALA n 
2 566  GLY n 
2 567  GLU n 
2 568  VAL n 
2 569  GLU n 
2 570  TYR n 
2 571  VAL n 
2 572  PRO n 
2 573  SER n 
2 574  SER n 
2 575  GLU n 
2 576  VAL n 
2 577  ASP n 
2 578  TYR n 
2 579  MET n 
2 580  ASP n 
2 581  VAL n 
2 582  SER n 
2 583  PRO n 
2 584  ARG n 
2 585  GLN n 
2 586  MET n 
2 587  VAL n 
2 588  SER n 
2 589  VAL n 
2 590  ALA n 
2 591  THR n 
2 592  ALA n 
2 593  MET n 
2 594  ILE n 
2 595  PRO n 
2 596  PHE n 
2 597  LEU n 
2 598  GLU n 
2 599  HIS n 
2 600  ASP n 
2 601  ASP n 
2 602  ALA n 
2 603  ASN n 
2 604  ARG n 
2 605  ALA n 
2 606  LEU n 
2 607  MET n 
2 608  GLY n 
2 609  ALA n 
2 610  ASN n 
2 611  MET n 
2 612  GLN n 
2 613  ARG n 
2 614  GLN n 
2 615  ALA n 
2 616  VAL n 
2 617  PRO n 
2 618  LEU n 
2 619  VAL n 
2 620  ARG n 
2 621  SER n 
2 622  GLU n 
2 623  ALA n 
2 624  PRO n 
2 625  LEU n 
2 626  VAL n 
2 627  GLY n 
2 628  THR n 
2 629  GLY n 
2 630  MET n 
2 631  GLU n 
2 632  LEU n 
2 633  ARG n 
2 634  ALA n 
2 635  ALA n 
2 636  ILE n 
2 637  ASP n 
2 638  ALA n 
2 639  GLY n 
2 640  ASP n 
2 641  VAL n 
2 642  VAL n 
2 643  VAL n 
2 644  ALA n 
2 645  GLU n 
2 646  GLU n 
2 647  SER n 
2 648  GLY n 
2 649  VAL n 
2 650  ILE n 
2 651  GLU n 
2 652  GLU n 
2 653  VAL n 
2 654  SER n 
2 655  ALA n 
2 656  ASP n 
2 657  TYR n 
2 658  ILE n 
2 659  THR n 
2 660  VAL n 
2 661  MET n 
2 662  HIS n 
2 663  ASP n 
2 664  ASN n 
2 665  GLY n 
2 666  THR n 
2 667  ARG n 
2 668  ARG n 
2 669  THR n 
2 670  TYR n 
2 671  ARG n 
2 672  MET n 
2 673  ARG n 
2 674  LYS n 
2 675  PHE n 
2 676  ALA n 
2 677  ARG n 
2 678  SER n 
2 679  ASN n 
2 680  HIS n 
2 681  GLY n 
2 682  THR n 
2 683  CYS n 
2 684  ALA n 
2 685  ASN n 
2 686  GLN n 
2 687  CYS n 
2 688  PRO n 
2 689  ILE n 
2 690  VAL n 
2 691  ASP n 
2 692  ALA n 
2 693  GLY n 
2 694  ASP n 
2 695  ARG n 
2 696  VAL n 
2 697  GLU n 
2 698  ALA n 
2 699  GLY n 
2 700  GLN n 
2 701  VAL n 
2 702  ILE n 
2 703  ALA n 
2 704  ASP n 
2 705  GLY n 
2 706  PRO n 
2 707  CYS n 
2 708  THR n 
2 709  ASP n 
2 710  ASP n 
2 711  GLY n 
2 712  GLU n 
2 713  MET n 
2 714  ALA n 
2 715  LEU n 
2 716  GLY n 
2 717  LYS n 
2 718  ASN n 
2 719  LEU n 
2 720  LEU n 
2 721  VAL n 
2 722  ALA n 
2 723  ILE n 
2 724  MET n 
2 725  PRO n 
2 726  TRP n 
2 727  GLU n 
2 728  GLY n 
2 729  HIS n 
2 730  ASN n 
2 731  TYR n 
2 732  GLU n 
2 733  ASP n 
2 734  ALA n 
2 735  ILE n 
2 736  ILE n 
2 737  LEU n 
2 738  SER n 
2 739  ASN n 
2 740  ARG n 
2 741  LEU n 
2 742  VAL n 
2 743  GLU n 
2 744  GLU n 
2 745  ASP n 
2 746  VAL n 
2 747  LEU n 
2 748  THR n 
2 749  SER n 
2 750  ILE n 
2 751  HIS n 
2 752  ILE n 
2 753  GLU n 
2 754  GLU n 
2 755  HIS n 
2 756  GLU n 
2 757  ILE n 
2 758  ASP n 
2 759  ALA n 
2 760  ARG n 
2 761  ASP n 
2 762  THR n 
2 763  LYS n 
2 764  LEU n 
2 765  GLY n 
2 766  ALA n 
2 767  GLU n 
2 768  GLU n 
2 769  ILE n 
2 770  THR n 
2 771  ARG n 
2 772  ASP n 
2 773  ILE n 
2 774  PRO n 
2 775  ASN n 
2 776  ILE n 
2 777  SER n 
2 778  ASP n 
2 779  GLU n 
2 780  VAL n 
2 781  LEU n 
2 782  ALA n 
2 783  ASP n 
2 784  LEU n 
2 785  ASP n 
2 786  GLU n 
2 787  ARG n 
2 788  GLY n 
2 789  ILE n 
2 790  VAL n 
2 791  ARG n 
2 792  ILE n 
2 793  GLY n 
2 794  ALA n 
2 795  GLU n 
2 796  VAL n 
2 797  ARG n 
2 798  ASP n 
2 799  GLY n 
2 800  ASP n 
2 801  ILE n 
2 802  LEU n 
2 803  VAL n 
2 804  GLY n 
2 805  LYS n 
2 806  VAL n 
2 807  THR n 
2 808  PRO n 
2 809  LYS n 
2 810  GLY n 
2 811  GLU n 
2 812  THR n 
2 813  GLU n 
2 814  LEU n 
2 815  THR n 
2 816  PRO n 
2 817  GLU n 
2 818  GLU n 
2 819  ARG n 
2 820  LEU n 
2 821  LEU n 
2 822  ARG n 
2 823  ALA n 
2 824  ILE n 
2 825  PHE n 
2 826  GLY n 
2 827  GLU n 
2 828  LYS n 
2 829  ALA n 
2 830  ARG n 
2 831  GLU n 
2 832  VAL n 
2 833  ARG n 
2 834  ASP n 
2 835  THR n 
2 836  SER n 
2 837  LEU n 
2 838  LYS n 
2 839  VAL n 
2 840  PRO n 
2 841  HIS n 
2 842  GLY n 
2 843  GLU n 
2 844  SER n 
2 845  GLY n 
2 846  LYS n 
2 847  VAL n 
2 848  ILE n 
2 849  GLY n 
2 850  ILE n 
2 851  ARG n 
2 852  VAL n 
2 853  PHE n 
2 854  SER n 
2 855  ARG n 
2 856  GLU n 
2 857  ASP n 
2 858  GLU n 
2 859  ASP n 
2 860  GLU n 
2 861  LEU n 
2 862  PRO n 
2 863  ALA n 
2 864  GLY n 
2 865  VAL n 
2 866  ASN n 
2 867  GLU n 
2 868  LEU n 
2 869  VAL n 
2 870  ARG n 
2 871  VAL n 
2 872  TYR n 
2 873  VAL n 
2 874  ALA n 
2 875  GLN n 
2 876  LYS n 
2 877  ARG n 
2 878  LYS n 
2 879  ILE n 
2 880  SER n 
2 881  ASP n 
2 882  GLY n 
2 883  ASP n 
2 884  LYS n 
2 885  LEU n 
2 886  ALA n 
2 887  GLY n 
2 888  ARG n 
2 889  HIS n 
2 890  GLY n 
2 891  ASN n 
2 892  LYS n 
2 893  GLY n 
2 894  VAL n 
2 895  ILE n 
2 896  GLY n 
2 897  LYS n 
2 898  ILE n 
2 899  LEU n 
2 900  PRO n 
2 901  VAL n 
2 902  GLU n 
2 903  ASP n 
2 904  MET n 
2 905  PRO n 
2 906  PHE n 
2 907  LEU n 
2 908  ALA n 
2 909  ASP n 
2 910  GLY n 
2 911  THR n 
2 912  PRO n 
2 913  VAL n 
2 914  ASP n 
2 915  ILE n 
2 916  ILE n 
2 917  LEU n 
2 918  ASN n 
2 919  THR n 
2 920  HIS n 
2 921  GLY n 
2 922  VAL n 
2 923  PRO n 
2 924  ARG n 
2 925  ARG n 
2 926  MET n 
2 927  ASN n 
2 928  ILE n 
2 929  GLY n 
2 930  GLN n 
2 931  ILE n 
2 932  LEU n 
2 933  GLU n 
2 934  THR n 
2 935  HIS n 
2 936  LEU n 
2 937  GLY n 
2 938  TRP n 
2 939  CYS n 
2 940  ALA n 
2 941  HIS n 
2 942  SER n 
2 943  GLY n 
2 944  TRP n 
2 945  LYS n 
2 946  VAL n 
2 947  ASP n 
2 948  ALA n 
2 949  ALA n 
2 950  LYS n 
2 951  GLY n 
2 952  VAL n 
2 953  PRO n 
2 954  ASP n 
2 955  TRP n 
2 956  ALA n 
2 957  ALA n 
2 958  ARG n 
2 959  LEU n 
2 960  PRO n 
2 961  ASP n 
2 962  GLU n 
2 963  LEU n 
2 964  LEU n 
2 965  GLU n 
2 966  ALA n 
2 967  GLN n 
2 968  PRO n 
2 969  ASN n 
2 970  ALA n 
2 971  ILE n 
2 972  VAL n 
2 973  SER n 
2 974  THR n 
2 975  PRO n 
2 976  VAL n 
2 977  PHE n 
2 978  ASP n 
2 979  GLY n 
2 980  ALA n 
2 981  GLN n 
2 982  GLU n 
2 983  ALA n 
2 984  GLU n 
2 985  LEU n 
2 986  GLN n 
2 987  GLY n 
2 988  LEU n 
2 989  LEU n 
2 990  SER n 
2 991  CYS n 
2 992  THR n 
2 993  LEU n 
2 994  PRO n 
2 995  ASN n 
2 996  ARG n 
2 997  ASP n 
2 998  GLY n 
2 999  ASP n 
2 1000 VAL n 
2 1001 LEU n 
2 1002 VAL n 
2 1003 ASP n 
2 1004 ALA n 
2 1005 ASP n 
2 1006 GLY n 
2 1007 LYS n 
2 1008 ALA n 
2 1009 MET n 
2 1010 LEU n 
2 1011 PHE n 
2 1012 ASP n 
2 1013 GLY n 
2 1014 ARG n 
2 1015 SER n 
2 1016 GLY n 
2 1017 GLU n 
2 1018 PRO n 
2 1019 PHE n 
2 1020 PRO n 
2 1021 TYR n 
2 1022 PRO n 
2 1023 VAL n 
2 1024 THR n 
2 1025 VAL n 
2 1026 GLY n 
2 1027 TYR n 
2 1028 MET n 
2 1029 TYR n 
2 1030 ILE n 
2 1031 MET n 
2 1032 LYS n 
2 1033 LEU n 
2 1034 HIS n 
2 1035 HIS n 
2 1036 LEU n 
2 1037 VAL n 
2 1038 ASP n 
2 1039 ASP n 
2 1040 LYS n 
2 1041 ILE n 
2 1042 HIS n 
2 1043 ALA n 
2 1044 ARG n 
2 1045 SER n 
2 1046 THR n 
2 1047 GLY n 
2 1048 PRO n 
2 1049 TYR n 
2 1050 SER n 
2 1051 MET n 
2 1052 ILE n 
2 1053 THR n 
2 1054 GLN n 
2 1055 GLN n 
2 1056 PRO n 
2 1057 LEU n 
2 1058 GLY n 
2 1059 GLY n 
2 1060 LYS n 
2 1061 ALA n 
2 1062 GLN n 
2 1063 PHE n 
2 1064 GLY n 
2 1065 GLY n 
2 1066 GLN n 
2 1067 ARG n 
2 1068 PHE n 
2 1069 GLY n 
2 1070 GLU n 
2 1071 MET n 
2 1072 GLU n 
2 1073 CYS n 
2 1074 TRP n 
2 1075 ALA n 
2 1076 MET n 
2 1077 GLN n 
2 1078 ALA n 
2 1079 TYR n 
2 1080 GLY n 
2 1081 ALA n 
2 1082 ALA n 
2 1083 TYR n 
2 1084 THR n 
2 1085 LEU n 
2 1086 GLN n 
2 1087 GLU n 
2 1088 LEU n 
2 1089 LEU n 
2 1090 THR n 
2 1091 ILE n 
2 1092 LYS n 
2 1093 SER n 
2 1094 ASP n 
2 1095 ASP n 
2 1096 THR n 
2 1097 VAL n 
2 1098 GLY n 
2 1099 ARG n 
2 1100 VAL n 
2 1101 LYS n 
2 1102 VAL n 
2 1103 TYR n 
2 1104 GLU n 
2 1105 ALA n 
2 1106 ILE n 
2 1107 VAL n 
2 1108 LYS n 
2 1109 GLY n 
2 1110 GLU n 
2 1111 ASN n 
2 1112 ILE n 
2 1113 PRO n 
2 1114 GLU n 
2 1115 PRO n 
2 1116 GLY n 
2 1117 ILE n 
2 1118 PRO n 
2 1119 GLU n 
2 1120 SER n 
2 1121 PHE n 
2 1122 LYS n 
2 1123 VAL n 
2 1124 LEU n 
2 1125 LEU n 
2 1126 LYS n 
2 1127 GLU n 
2 1128 LEU n 
2 1129 GLN n 
2 1130 SER n 
2 1131 LEU n 
2 1132 CYS n 
2 1133 LEU n 
2 1134 ASN n 
2 1135 VAL n 
2 1136 GLU n 
2 1137 VAL n 
2 1138 LEU n 
2 1139 SER n 
2 1140 SER n 
2 1141 ASP n 
2 1142 GLY n 
2 1143 ALA n 
2 1144 ALA n 
2 1145 ILE n 
2 1146 GLU n 
2 1147 LEU n 
2 1148 ARG n 
2 1149 GLU n 
2 1150 GLY n 
2 1151 GLU n 
2 1152 ASP n 
2 1153 GLU n 
2 1154 ASP n 
2 1155 LEU n 
2 1156 GLU n 
2 1157 ARG n 
2 1158 ALA n 
2 1159 ALA n 
2 1160 ALA n 
2 1161 ASN n 
2 1162 LEU n 
2 1163 GLY n 
2 1164 ILE n 
2 1165 ASN n 
2 1166 LEU n 
2 1167 SER n 
2 1168 ARG n 
2 1169 ASN n 
2 1170 GLU n 
2 1171 SER n 
2 1172 ALA n 
2 1173 SER n 
2 1174 VAL n 
2 1175 GLU n 
2 1176 ASP n 
2 1177 LEU n 
2 1178 ALA n 
3 1    MET n 
3 2    LEU n 
3 3    ASP n 
3 4    VAL n 
3 5    ASN n 
3 6    PHE n 
3 7    PHE n 
3 8    ASP n 
3 9    GLU n 
3 10   LEU n 
3 11   ARG n 
3 12   ILE n 
3 13   GLY n 
3 14   LEU n 
3 15   ALA n 
3 16   THR n 
3 17   ALA n 
3 18   GLU n 
3 19   ASP n 
3 20   ILE n 
3 21   ARG n 
3 22   GLN n 
3 23   TRP n 
3 24   SER n 
3 25   TYR n 
3 26   GLY n 
3 27   GLU n 
3 28   VAL n 
3 29   LYS n 
3 30   LYS n 
3 31   PRO n 
3 32   GLU n 
3 33   THR n 
3 34   ILE n 
3 35   ASN n 
3 36   TYR n 
3 37   ARG n 
3 38   THR n 
3 39   LEU n 
3 40   LYS n 
3 41   PRO n 
3 42   GLU n 
3 43   LYS n 
3 44   ASP n 
3 45   GLY n 
3 46   LEU n 
3 47   PHE n 
3 48   CYS n 
3 49   GLU n 
3 50   LYS n 
3 51   ILE n 
3 52   PHE n 
3 53   GLY n 
3 54   PRO n 
3 55   THR n 
3 56   ARG n 
3 57   ASP n 
3 58   TRP n 
3 59   GLU n 
3 60   CYS n 
3 61   TYR n 
3 62   CYS n 
3 63   GLY n 
3 64   LYS n 
3 65   TYR n 
3 66   LYS n 
3 67   ARG n 
3 68   VAL n 
3 69   ARG n 
3 70   PHE n 
3 71   LYS n 
3 72   GLY n 
3 73   ILE n 
3 74   ILE n 
3 75   CYS n 
3 76   GLU n 
3 77   ARG n 
3 78   CYS n 
3 79   GLY n 
3 80   VAL n 
3 81   GLU n 
3 82   VAL n 
3 83   THR n 
3 84   ARG n 
3 85   ALA n 
3 86   LYS n 
3 87   VAL n 
3 88   ARG n 
3 89   ARG n 
3 90   GLU n 
3 91   ARG n 
3 92   MET n 
3 93   GLY n 
3 94   HIS n 
3 95   ILE n 
3 96   GLU n 
3 97   LEU n 
3 98   ALA n 
3 99   ALA n 
3 100  PRO n 
3 101  VAL n 
3 102  THR n 
3 103  HIS n 
3 104  ILE n 
3 105  TRP n 
3 106  TYR n 
3 107  PHE n 
3 108  LYS n 
3 109  GLY n 
3 110  VAL n 
3 111  PRO n 
3 112  SER n 
3 113  ARG n 
3 114  LEU n 
3 115  GLY n 
3 116  TYR n 
3 117  LEU n 
3 118  LEU n 
3 119  ASP n 
3 120  LEU n 
3 121  ALA n 
3 122  PRO n 
3 123  LYS n 
3 124  ASP n 
3 125  LEU n 
3 126  GLU n 
3 127  LYS n 
3 128  ILE n 
3 129  ILE n 
3 130  TYR n 
3 131  PHE n 
3 132  ALA n 
3 133  ALA n 
3 134  TYR n 
3 135  VAL n 
3 136  ILE n 
3 137  THR n 
3 138  SER n 
3 139  VAL n 
3 140  ASP n 
3 141  GLU n 
3 142  GLU n 
3 143  MET n 
3 144  ARG n 
3 145  HIS n 
3 146  ASN n 
3 147  GLU n 
3 148  LEU n 
3 149  SER n 
3 150  THR n 
3 151  LEU n 
3 152  GLU n 
3 153  ALA n 
3 154  GLU n 
3 155  MET n 
3 156  ALA n 
3 157  VAL n 
3 158  GLU n 
3 159  ARG n 
3 160  LYS n 
3 161  ALA n 
3 162  VAL n 
3 163  GLU n 
3 164  ASP n 
3 165  GLN n 
3 166  ARG n 
3 167  ASP n 
3 168  GLY n 
3 169  GLU n 
3 170  LEU n 
3 171  GLU n 
3 172  ALA n 
3 173  ARG n 
3 174  ALA n 
3 175  GLN n 
3 176  LYS n 
3 177  LEU n 
3 178  GLU n 
3 179  ALA n 
3 180  ASP n 
3 181  LEU n 
3 182  ALA n 
3 183  GLU n 
3 184  LEU n 
3 185  GLU n 
3 186  ALA n 
3 187  GLU n 
3 188  GLY n 
3 189  ALA n 
3 190  LYS n 
3 191  ALA n 
3 192  ASP n 
3 193  ALA n 
3 194  ARG n 
3 195  ARG n 
3 196  LYS n 
3 197  VAL n 
3 198  ARG n 
3 199  ASP n 
3 200  GLY n 
3 201  GLY n 
3 202  GLU n 
3 203  ARG n 
3 204  GLU n 
3 205  MET n 
3 206  ARG n 
3 207  GLN n 
3 208  ILE n 
3 209  ARG n 
3 210  ASP n 
3 211  ARG n 
3 212  ALA n 
3 213  GLN n 
3 214  ARG n 
3 215  GLU n 
3 216  LEU n 
3 217  ASP n 
3 218  ARG n 
3 219  LEU n 
3 220  GLU n 
3 221  ASP n 
3 222  ILE n 
3 223  TRP n 
3 224  SER n 
3 225  THR n 
3 226  PHE n 
3 227  THR n 
3 228  LYS n 
3 229  LEU n 
3 230  ALA n 
3 231  PRO n 
3 232  LYS n 
3 233  GLN n 
3 234  LEU n 
3 235  ILE n 
3 236  VAL n 
3 237  ASP n 
3 238  GLU n 
3 239  ASN n 
3 240  LEU n 
3 241  TYR n 
3 242  ARG n 
3 243  GLU n 
3 244  LEU n 
3 245  VAL n 
3 246  ASP n 
3 247  ARG n 
3 248  TYR n 
3 249  GLY n 
3 250  GLU n 
3 251  TYR n 
3 252  PHE n 
3 253  THR n 
3 254  GLY n 
3 255  ALA n 
3 256  MET n 
3 257  GLY n 
3 258  ALA n 
3 259  GLU n 
3 260  SER n 
3 261  ILE n 
3 262  GLN n 
3 263  LYS n 
3 264  LEU n 
3 265  ILE n 
3 266  GLU n 
3 267  ASN n 
3 268  PHE n 
3 269  ASP n 
3 270  ILE n 
3 271  ASP n 
3 272  ALA n 
3 273  GLU n 
3 274  ALA n 
3 275  GLU n 
3 276  SER n 
3 277  LEU n 
3 278  ARG n 
3 279  ASP n 
3 280  VAL n 
3 281  ILE n 
3 282  ARG n 
3 283  ASN n 
3 284  GLY n 
3 285  LYS n 
3 286  GLY n 
3 287  GLN n 
3 288  LYS n 
3 289  LYS n 
3 290  LEU n 
3 291  ARG n 
3 292  ALA n 
3 293  LEU n 
3 294  LYS n 
3 295  ARG n 
3 296  LEU n 
3 297  LYS n 
3 298  VAL n 
3 299  VAL n 
3 300  ALA n 
3 301  ALA n 
3 302  PHE n 
3 303  GLN n 
3 304  GLN n 
3 305  SER n 
3 306  GLY n 
3 307  ASN n 
3 308  SER n 
3 309  PRO n 
3 310  MET n 
3 311  GLY n 
3 312  MET n 
3 313  VAL n 
3 314  LEU n 
3 315  ASP n 
3 316  ALA n 
3 317  VAL n 
3 318  PRO n 
3 319  VAL n 
3 320  ILE n 
3 321  PRO n 
3 322  PRO n 
3 323  GLU n 
3 324  LEU n 
3 325  ARG n 
3 326  PRO n 
3 327  MET n 
3 328  VAL n 
3 329  GLN n 
3 330  LEU n 
3 331  ASP n 
3 332  GLY n 
3 333  GLY n 
3 334  ARG n 
3 335  PHE n 
3 336  ALA n 
3 337  THR n 
3 338  SER n 
3 339  ASP n 
3 340  LEU n 
3 341  ASN n 
3 342  ASP n 
3 343  LEU n 
3 344  TYR n 
3 345  ARG n 
3 346  ARG n 
3 347  VAL n 
3 348  ILE n 
3 349  ASN n 
3 350  ARG n 
3 351  ASN n 
3 352  ASN n 
3 353  ARG n 
3 354  LEU n 
3 355  LYS n 
3 356  ARG n 
3 357  LEU n 
3 358  ILE n 
3 359  ASP n 
3 360  LEU n 
3 361  GLY n 
3 362  ALA n 
3 363  PRO n 
3 364  GLU n 
3 365  ILE n 
3 366  ILE n 
3 367  VAL n 
3 368  ASN n 
3 369  ASN n 
3 370  GLU n 
3 371  LYS n 
3 372  ARG n 
3 373  MET n 
3 374  LEU n 
3 375  GLN n 
3 376  GLU n 
3 377  SER n 
3 378  VAL n 
3 379  ASP n 
3 380  ALA n 
3 381  LEU n 
3 382  PHE n 
3 383  ASP n 
3 384  ASN n 
3 385  GLY n 
3 386  ARG n 
3 387  ARG n 
3 388  GLY n 
3 389  ARG n 
3 390  PRO n 
3 391  VAL n 
3 392  THR n 
3 393  GLY n 
3 394  PRO n 
3 395  GLY n 
3 396  ASN n 
3 397  ARG n 
3 398  PRO n 
3 399  LEU n 
3 400  LYS n 
3 401  SER n 
3 402  LEU n 
3 403  SER n 
3 404  ASP n 
3 405  LEU n 
3 406  LEU n 
3 407  LYS n 
3 408  GLY n 
3 409  LYS n 
3 410  GLN n 
3 411  GLY n 
3 412  ARG n 
3 413  PHE n 
3 414  ARG n 
3 415  GLN n 
3 416  ASN n 
3 417  LEU n 
3 418  LEU n 
3 419  GLY n 
3 420  LYS n 
3 421  ARG n 
3 422  VAL n 
3 423  ASP n 
3 424  TYR n 
3 425  SER n 
3 426  GLY n 
3 427  ARG n 
3 428  SER n 
3 429  VAL n 
3 430  ILE n 
3 431  VAL n 
3 432  VAL n 
3 433  GLY n 
3 434  PRO n 
3 435  GLN n 
3 436  LEU n 
3 437  LYS n 
3 438  LEU n 
3 439  HIS n 
3 440  GLN n 
3 441  CYS n 
3 442  GLY n 
3 443  LEU n 
3 444  PRO n 
3 445  LYS n 
3 446  LEU n 
3 447  MET n 
3 448  ALA n 
3 449  LEU n 
3 450  GLU n 
3 451  LEU n 
3 452  PHE n 
3 453  LYS n 
3 454  PRO n 
3 455  PHE n 
3 456  VAL n 
3 457  MET n 
3 458  LYS n 
3 459  ARG n 
3 460  LEU n 
3 461  VAL n 
3 462  ASP n 
3 463  LEU n 
3 464  ASN n 
3 465  HIS n 
3 466  ALA n 
3 467  GLN n 
3 468  ASN n 
3 469  ILE n 
3 470  LYS n 
3 471  SER n 
3 472  ALA n 
3 473  LYS n 
3 474  ARG n 
3 475  MET n 
3 476  VAL n 
3 477  GLU n 
3 478  ARG n 
3 479  GLN n 
3 480  ARG n 
3 481  PRO n 
3 482  GLN n 
3 483  VAL n 
3 484  TRP n 
3 485  ASP n 
3 486  VAL n 
3 487  LEU n 
3 488  GLU n 
3 489  GLU n 
3 490  VAL n 
3 491  ILE n 
3 492  ALA n 
3 493  GLU n 
3 494  HIS n 
3 495  PRO n 
3 496  VAL n 
3 497  LEU n 
3 498  LEU n 
3 499  ASN n 
3 500  ARG n 
3 501  ALA n 
3 502  PRO n 
3 503  THR n 
3 504  LEU n 
3 505  HIS n 
3 506  ARG n 
3 507  LEU n 
3 508  GLY n 
3 509  ILE n 
3 510  GLN n 
3 511  ALA n 
3 512  PHE n 
3 513  GLU n 
3 514  PRO n 
3 515  MET n 
3 516  LEU n 
3 517  VAL n 
3 518  GLU n 
3 519  GLY n 
3 520  LYS n 
3 521  ALA n 
3 522  ILE n 
3 523  GLN n 
3 524  LEU n 
3 525  HIS n 
3 526  PRO n 
3 527  LEU n 
3 528  VAL n 
3 529  CYS n 
3 530  GLU n 
3 531  ALA n 
3 532  PHE n 
3 533  ASN n 
3 534  ALA n 
3 535  ASP n 
3 536  PHE n 
3 537  ASP n 
3 538  GLY n 
3 539  ASP n 
3 540  GLN n 
3 541  MET n 
3 542  ALA n 
3 543  VAL n 
3 544  HIS n 
3 545  LEU n 
3 546  PRO n 
3 547  LEU n 
3 548  SER n 
3 549  ALA n 
3 550  GLU n 
3 551  ALA n 
3 552  GLN n 
3 553  ALA n 
3 554  GLU n 
3 555  ALA n 
3 556  ARG n 
3 557  ILE n 
3 558  LEU n 
3 559  MET n 
3 560  LEU n 
3 561  SER n 
3 562  SER n 
3 563  ASN n 
3 564  ASN n 
3 565  ILE n 
3 566  LEU n 
3 567  SER n 
3 568  PRO n 
3 569  ALA n 
3 570  SER n 
3 571  GLY n 
3 572  ARG n 
3 573  PRO n 
3 574  LEU n 
3 575  ALA n 
3 576  MET n 
3 577  PRO n 
3 578  ARG n 
3 579  LEU n 
3 580  ASP n 
3 581  MET n 
3 582  VAL n 
3 583  THR n 
3 584  GLY n 
3 585  LEU n 
3 586  TYR n 
3 587  TYR n 
3 588  LEU n 
3 589  THR n 
3 590  THR n 
3 591  GLU n 
3 592  VAL n 
3 593  PRO n 
3 594  GLY n 
3 595  ASP n 
3 596  THR n 
3 597  GLY n 
3 598  GLU n 
3 599  TYR n 
3 600  GLN n 
3 601  PRO n 
3 602  ALA n 
3 603  SER n 
3 604  GLY n 
3 605  ASP n 
3 606  HIS n 
3 607  PRO n 
3 608  GLU n 
3 609  THR n 
3 610  GLY n 
3 611  VAL n 
3 612  TYR n 
3 613  SER n 
3 614  SER n 
3 615  PRO n 
3 616  ALA n 
3 617  GLU n 
3 618  ALA n 
3 619  ILE n 
3 620  MET n 
3 621  ALA n 
3 622  ALA n 
3 623  ASP n 
3 624  ARG n 
3 625  GLY n 
3 626  VAL n 
3 627  LEU n 
3 628  SER n 
3 629  VAL n 
3 630  ARG n 
3 631  ALA n 
3 632  LYS n 
3 633  ILE n 
3 634  LYS n 
3 635  VAL n 
3 636  ARG n 
3 637  LEU n 
3 638  THR n 
3 639  GLN n 
3 640  LEU n 
3 641  ARG n 
3 642  PRO n 
3 643  PRO n 
3 644  VAL n 
3 645  GLU n 
3 646  ILE n 
3 647  GLU n 
3 648  ALA n 
3 649  GLU n 
3 650  LEU n 
3 651  PHE n 
3 652  GLY n 
3 653  HIS n 
3 654  SER n 
3 655  GLY n 
3 656  TRP n 
3 657  GLN n 
3 658  PRO n 
3 659  GLY n 
3 660  ASP n 
3 661  ALA n 
3 662  TRP n 
3 663  MET n 
3 664  ALA n 
3 665  GLU n 
3 666  THR n 
3 667  THR n 
3 668  LEU n 
3 669  GLY n 
3 670  ARG n 
3 671  VAL n 
3 672  MET n 
3 673  PHE n 
3 674  ASN n 
3 675  GLU n 
3 676  LEU n 
3 677  LEU n 
3 678  PRO n 
3 679  LEU n 
3 680  GLY n 
3 681  TYR n 
3 682  PRO n 
3 683  PHE n 
3 684  VAL n 
3 685  ASN n 
3 686  LYS n 
3 687  GLN n 
3 688  MET n 
3 689  HIS n 
3 690  LYS n 
3 691  LYS n 
3 692  VAL n 
3 693  GLN n 
3 694  ALA n 
3 695  ALA n 
3 696  ILE n 
3 697  ILE n 
3 698  ASN n 
3 699  ASP n 
3 700  LEU n 
3 701  ALA n 
3 702  GLU n 
3 703  ARG n 
3 704  TYR n 
3 705  PRO n 
3 706  MET n 
3 707  ILE n 
3 708  VAL n 
3 709  VAL n 
3 710  ALA n 
3 711  GLN n 
3 712  THR n 
3 713  VAL n 
3 714  ASP n 
3 715  LYS n 
3 716  LEU n 
3 717  LYS n 
3 718  ASP n 
3 719  ALA n 
3 720  GLY n 
3 721  PHE n 
3 722  TYR n 
3 723  TRP n 
3 724  ALA n 
3 725  THR n 
3 726  ARG n 
3 727  SER n 
3 728  GLY n 
3 729  VAL n 
3 730  THR n 
3 731  VAL n 
3 732  SER n 
3 733  MET n 
3 734  ALA n 
3 735  ASP n 
3 736  VAL n 
3 737  LEU n 
3 738  VAL n 
3 739  PRO n 
3 740  PRO n 
3 741  ARG n 
3 742  LYS n 
3 743  LYS n 
3 744  GLU n 
3 745  ILE n 
3 746  LEU n 
3 747  ASP n 
3 748  HIS n 
3 749  TYR n 
3 750  GLU n 
3 751  GLU n 
3 752  ARG n 
3 753  ALA n 
3 754  ASP n 
3 755  LYS n 
3 756  VAL n 
3 757  GLU n 
3 758  LYS n 
3 759  GLN n 
3 760  PHE n 
3 761  GLN n 
3 762  ARG n 
3 763  GLY n 
3 764  ALA n 
3 765  LEU n 
3 766  ASN n 
3 767  HIS n 
3 768  ASP n 
3 769  GLU n 
3 770  ARG n 
3 771  ASN n 
3 772  GLU n 
3 773  ALA n 
3 774  LEU n 
3 775  VAL n 
3 776  GLU n 
3 777  ILE n 
3 778  TRP n 
3 779  LYS n 
3 780  GLU n 
3 781  ALA n 
3 782  THR n 
3 783  ASP n 
3 784  GLU n 
3 785  VAL n 
3 786  GLY n 
3 787  GLN n 
3 788  ALA n 
3 789  LEU n 
3 790  ARG n 
3 791  GLU n 
3 792  HIS n 
3 793  TYR n 
3 794  PRO n 
3 795  ASP n 
3 796  ASP n 
3 797  ASN n 
3 798  PRO n 
3 799  ILE n 
3 800  ILE n 
3 801  THR n 
3 802  ILE n 
3 803  VAL n 
3 804  ASP n 
3 805  SER n 
3 806  GLY n 
3 807  ALA n 
3 808  THR n 
3 809  GLY n 
3 810  ASN n 
3 811  PHE n 
3 812  THR n 
3 813  GLN n 
3 814  THR n 
3 815  ARG n 
3 816  THR n 
3 817  LEU n 
3 818  ALA n 
3 819  GLY n 
3 820  MET n 
3 821  LYS n 
3 822  GLY n 
3 823  LEU n 
3 824  VAL n 
3 825  THR n 
3 826  ASN n 
3 827  PRO n 
3 828  LYS n 
3 829  GLY n 
3 830  GLU n 
3 831  PHE n 
3 832  ILE n 
3 833  PRO n 
3 834  ARG n 
3 835  PRO n 
3 836  VAL n 
3 837  LYS n 
3 838  SER n 
3 839  SER n 
3 840  PHE n 
3 841  ARG n 
3 842  GLU n 
3 843  GLY n 
3 844  LEU n 
3 845  THR n 
3 846  VAL n 
3 847  LEU n 
3 848  GLU n 
3 849  TYR n 
3 850  PHE n 
3 851  ILE n 
3 852  ASN n 
3 853  THR n 
3 854  HIS n 
3 855  GLY n 
3 856  ALA n 
3 857  ARG n 
3 858  LYS n 
3 859  GLY n 
3 860  LEU n 
3 861  ALA n 
3 862  ASP n 
3 863  THR n 
3 864  ALA n 
3 865  LEU n 
3 866  ARG n 
3 867  THR n 
3 868  ALA n 
3 869  ASP n 
3 870  SER n 
3 871  GLY n 
3 872  TYR n 
3 873  LEU n 
3 874  THR n 
3 875  ARG n 
3 876  ARG n 
3 877  LEU n 
3 878  VAL n 
3 879  ASP n 
3 880  VAL n 
3 881  SER n 
3 882  GLN n 
3 883  ASP n 
3 884  VAL n 
3 885  ILE n 
3 886  VAL n 
3 887  ARG n 
3 888  GLU n 
3 889  HIS n 
3 890  ASP n 
3 891  CYS n 
3 892  GLN n 
3 893  THR n 
3 894  GLU n 
3 895  ARG n 
3 896  GLY n 
3 897  ILE n 
3 898  VAL n 
3 899  VAL n 
3 900  GLU n 
3 901  LEU n 
3 902  ALA n 
3 903  GLU n 
3 904  ARG n 
3 905  ALA n 
3 906  PRO n 
3 907  ASP n 
3 908  GLY n 
3 909  THR n 
3 910  LEU n 
3 911  ILE n 
3 912  ARG n 
3 913  ASP n 
3 914  PRO n 
3 915  TYR n 
3 916  ILE n 
3 917  GLU n 
3 918  THR n 
3 919  SER n 
3 920  ALA n 
3 921  TYR n 
3 922  ALA n 
3 923  ARG n 
3 924  THR n 
3 925  LEU n 
3 926  GLY n 
3 927  THR n 
3 928  ASP n 
3 929  ALA n 
3 930  VAL n 
3 931  ASP n 
3 932  GLU n 
3 933  ALA n 
3 934  GLY n 
3 935  ASN n 
3 936  VAL n 
3 937  ILE n 
3 938  VAL n 
3 939  GLU n 
3 940  ARG n 
3 941  GLY n 
3 942  GLN n 
3 943  ASP n 
3 944  LEU n 
3 945  GLY n 
3 946  ASP n 
3 947  PRO n 
3 948  GLU n 
3 949  ILE n 
3 950  ASP n 
3 951  ALA n 
3 952  LEU n 
3 953  LEU n 
3 954  ALA n 
3 955  ALA n 
3 956  GLY n 
3 957  ILE n 
3 958  THR n 
3 959  GLN n 
3 960  VAL n 
3 961  LYS n 
3 962  VAL n 
3 963  ARG n 
3 964  SER n 
3 965  VAL n 
3 966  LEU n 
3 967  THR n 
3 968  CYS n 
3 969  ALA n 
3 970  THR n 
3 971  SER n 
3 972  THR n 
3 973  GLY n 
3 974  VAL n 
3 975  CYS n 
3 976  ALA n 
3 977  THR n 
3 978  CYS n 
3 979  TYR n 
3 980  GLY n 
3 981  ARG n 
3 982  SER n 
3 983  MET n 
3 984  ALA n 
3 985  THR n 
3 986  GLY n 
3 987  LYS n 
3 988  LEU n 
3 989  VAL n 
3 990  ASP n 
3 991  ILE n 
3 992  GLY n 
3 993  GLU n 
3 994  ALA n 
3 995  VAL n 
3 996  GLY n 
3 997  ILE n 
3 998  VAL n 
3 999  ALA n 
3 1000 ALA n 
3 1001 GLN n 
3 1002 SER n 
3 1003 ILE n 
3 1004 GLY n 
3 1005 GLU n 
3 1006 PRO n 
3 1007 GLY n 
3 1008 THR n 
3 1009 GLN n 
3 1010 LEU n 
3 1011 THR n 
3 1012 MET n 
3 1013 ARG n 
3 1014 THR n 
3 1015 PHE n 
3 1016 HIS n 
3 1017 GLN n 
3 1018 GLY n 
3 1019 GLY n 
3 1020 VAL n 
3 1021 GLY n 
3 1022 GLU n 
3 1023 ASP n 
3 1024 ILE n 
3 1025 THR n 
3 1026 GLY n 
3 1027 GLY n 
3 1028 LEU n 
3 1029 PRO n 
3 1030 ARG n 
3 1031 VAL n 
3 1032 GLN n 
3 1033 GLU n 
3 1034 LEU n 
3 1035 PHE n 
3 1036 GLU n 
3 1037 ALA n 
3 1038 ARG n 
3 1039 VAL n 
3 1040 PRO n 
3 1041 ARG n 
3 1042 GLY n 
3 1043 LYS n 
3 1044 ALA n 
3 1045 PRO n 
3 1046 ILE n 
3 1047 ALA n 
3 1048 ASP n 
3 1049 VAL n 
3 1050 THR n 
3 1051 GLY n 
3 1052 ARG n 
3 1053 VAL n 
3 1054 ARG n 
3 1055 LEU n 
3 1056 GLU n 
3 1057 ASP n 
3 1058 GLY n 
3 1059 GLU n 
3 1060 ARG n 
3 1061 PHE n 
3 1062 TYR n 
3 1063 LYS n 
3 1064 ILE n 
3 1065 THR n 
3 1066 ILE n 
3 1067 VAL n 
3 1068 PRO n 
3 1069 ASP n 
3 1070 ASP n 
3 1071 GLY n 
3 1072 GLY n 
3 1073 GLU n 
3 1074 GLU n 
3 1075 VAL n 
3 1076 VAL n 
3 1077 TYR n 
3 1078 ASP n 
3 1079 LYS n 
3 1080 ILE n 
3 1081 SER n 
3 1082 LYS n 
3 1083 ARG n 
3 1084 GLN n 
3 1085 ARG n 
3 1086 LEU n 
3 1087 ARG n 
3 1088 VAL n 
3 1089 PHE n 
3 1090 LYS n 
3 1091 HIS n 
3 1092 GLU n 
3 1093 ASP n 
3 1094 GLY n 
3 1095 SER n 
3 1096 GLU n 
3 1097 ARG n 
3 1098 VAL n 
3 1099 LEU n 
3 1100 SER n 
3 1101 ASP n 
3 1102 GLY n 
3 1103 ASP n 
3 1104 HIS n 
3 1105 VAL n 
3 1106 GLU n 
3 1107 VAL n 
3 1108 GLY n 
3 1109 GLN n 
3 1110 GLN n 
3 1111 LEU n 
3 1112 MET n 
3 1113 GLU n 
3 1114 GLY n 
3 1115 SER n 
3 1116 ALA n 
3 1117 ASP n 
3 1118 PRO n 
3 1119 HIS n 
3 1120 GLU n 
3 1121 VAL n 
3 1122 LEU n 
3 1123 ARG n 
3 1124 VAL n 
3 1125 GLN n 
3 1126 GLY n 
3 1127 PRO n 
3 1128 ARG n 
3 1129 GLU n 
3 1130 VAL n 
3 1131 GLN n 
3 1132 ILE n 
3 1133 HIS n 
3 1134 LEU n 
3 1135 VAL n 
3 1136 ARG n 
3 1137 GLU n 
3 1138 VAL n 
3 1139 GLN n 
3 1140 GLU n 
3 1141 VAL n 
3 1142 TYR n 
3 1143 ARG n 
3 1144 ALA n 
3 1145 GLN n 
3 1146 GLY n 
3 1147 VAL n 
3 1148 SER n 
3 1149 ILE n 
3 1150 HIS n 
3 1151 ASP n 
3 1152 LYS n 
3 1153 HIS n 
3 1154 ILE n 
3 1155 GLU n 
3 1156 VAL n 
3 1157 ILE n 
3 1158 VAL n 
3 1159 ARG n 
3 1160 GLN n 
3 1161 MET n 
3 1162 LEU n 
3 1163 ARG n 
3 1164 ARG n 
3 1165 VAL n 
3 1166 THR n 
3 1167 ILE n 
3 1168 ILE n 
3 1169 ASP n 
3 1170 SER n 
3 1171 GLY n 
3 1172 SER n 
3 1173 THR n 
3 1174 GLU n 
3 1175 PHE n 
3 1176 LEU n 
3 1177 PRO n 
3 1178 GLY n 
3 1179 SER n 
3 1180 LEU n 
3 1181 ILE n 
3 1182 ASP n 
3 1183 ARG n 
3 1184 ALA n 
3 1185 GLU n 
3 1186 PHE n 
3 1187 GLU n 
3 1188 ALA n 
3 1189 GLU n 
3 1190 ASN n 
3 1191 ARG n 
3 1192 ARG n 
3 1193 VAL n 
3 1194 VAL n 
3 1195 ALA n 
3 1196 GLU n 
3 1197 GLY n 
3 1198 GLY n 
3 1199 GLU n 
3 1200 PRO n 
3 1201 ALA n 
3 1202 ALA n 
3 1203 GLY n 
3 1204 ARG n 
3 1205 PRO n 
3 1206 VAL n 
3 1207 LEU n 
3 1208 MET n 
3 1209 GLY n 
3 1210 ILE n 
3 1211 THR n 
3 1212 LYS n 
3 1213 ALA n 
3 1214 SER n 
3 1215 LEU n 
3 1216 ALA n 
3 1217 THR n 
3 1218 ASP n 
3 1219 SER n 
3 1220 TRP n 
3 1221 LEU n 
3 1222 SER n 
3 1223 ALA n 
3 1224 ALA n 
3 1225 SER n 
3 1226 PHE n 
3 1227 GLN n 
3 1228 GLU n 
3 1229 THR n 
3 1230 THR n 
3 1231 ARG n 
3 1232 VAL n 
3 1233 LEU n 
3 1234 THR n 
3 1235 ASP n 
3 1236 ALA n 
3 1237 ALA n 
3 1238 ILE n 
3 1239 ASN n 
3 1240 CYS n 
3 1241 ARG n 
3 1242 SER n 
3 1243 ASP n 
3 1244 LYS n 
3 1245 LEU n 
3 1246 ASN n 
3 1247 GLY n 
3 1248 LEU n 
3 1249 LYS n 
3 1250 GLU n 
3 1251 ASN n 
3 1252 VAL n 
3 1253 ILE n 
3 1254 ILE n 
3 1255 GLY n 
3 1256 LYS n 
3 1257 LEU n 
3 1258 ILE n 
3 1259 PRO n 
3 1260 ALA n 
3 1261 GLY n 
3 1262 THR n 
3 1263 GLY n 
3 1264 ILE n 
3 1265 ASN n 
3 1266 ARG n 
3 1267 TYR n 
3 1268 ARG n 
3 1269 ASN n 
3 1270 ILE n 
3 1271 ALA n 
3 1272 VAL n 
3 1273 GLN n 
3 1274 PRO n 
3 1275 THR n 
3 1276 GLU n 
3 1277 GLU n 
3 1278 ALA n 
3 1279 ARG n 
3 1280 ALA n 
3 1281 ALA n 
3 1282 ALA n 
3 1283 TYR n 
3 1284 THR n 
3 1285 ILE n 
3 1286 PRO n 
3 1287 SER n 
3 1288 TYR n 
3 1289 GLU n 
3 1290 ASP n 
3 1291 GLN n 
3 1292 TYR n 
3 1293 TYR n 
3 1294 SER n 
3 1295 PRO n 
3 1296 ASP n 
3 1297 PHE n 
3 1298 GLY n 
3 1299 ALA n 
3 1300 ALA n 
3 1301 THR n 
3 1302 GLY n 
3 1303 ALA n 
3 1304 ALA n 
3 1305 VAL n 
3 1306 PRO n 
3 1307 LEU n 
3 1308 ASP n 
3 1309 ASP n 
3 1310 TYR n 
3 1311 GLY n 
3 1312 TYR n 
3 1313 SER n 
3 1314 ASP n 
3 1315 TYR n 
3 1316 ARG n 
4 1    MET n 
4 2    SER n 
4 3    ILE n 
4 4    SER n 
4 5    GLN n 
4 6    SER n 
4 7    ASP n 
4 8    ALA n 
4 9    SER n 
4 10   LEU n 
4 11   ALA n 
4 12   ALA n 
4 13   VAL n 
4 14   PRO n 
4 15   ALA n 
4 16   VAL n 
4 17   ASP n 
4 18   GLN n 
4 19   PHE n 
4 20   ASP n 
4 21   PRO n 
4 22   SER n 
4 23   SER n 
4 24   GLY n 
4 25   ALA n 
4 26   SER n 
4 27   GLY n 
4 28   GLY n 
4 29   TYR n 
4 30   ASP n 
4 31   THR n 
4 32   PRO n 
4 33   LEU n 
4 34   GLY n 
4 35   ILE n 
4 36   THR n 
4 37   ASN n 
4 38   PRO n 
4 39   PRO n 
4 40   ILE n 
4 41   ASP n 
4 42   GLU n 
4 43   LEU n 
4 44   LEU n 
4 45   ASP n 
4 46   ARG n 
4 47   VAL n 
4 48   SER n 
4 49   SER n 
4 50   LYS n 
4 51   TYR n 
4 52   ALA n 
4 53   LEU n 
4 54   VAL n 
4 55   ILE n 
4 56   TYR n 
4 57   ALA n 
4 58   ALA n 
4 59   LYS n 
4 60   ARG n 
4 61   ALA n 
4 62   ARG n 
4 63   GLN n 
4 64   ILE n 
4 65   ASN n 
4 66   ASP n 
4 67   TYR n 
4 68   TYR n 
4 69   ASN n 
4 70   GLN n 
4 71   LEU n 
4 72   GLY n 
4 73   GLU n 
4 74   GLY n 
4 75   ILE n 
4 76   LEU n 
4 77   GLU n 
4 78   TYR n 
4 79   VAL n 
4 80   GLY n 
4 81   PRO n 
4 82   LEU n 
4 83   VAL n 
4 84   GLU n 
4 85   PRO n 
4 86   GLY n 
4 87   LEU n 
4 88   GLN n 
4 89   GLU n 
4 90   LYS n 
4 91   PRO n 
4 92   LEU n 
4 93   SER n 
4 94   ILE n 
4 95   ALA n 
4 96   LEU n 
4 97   ARG n 
4 98   GLU n 
4 99   ILE n 
4 100  HIS n 
4 101  ALA n 
4 102  ASP n 
4 103  LEU n 
4 104  LEU n 
4 105  GLU n 
4 106  HIS n 
4 107  THR n 
4 108  GLU n 
4 109  GLY n 
4 110  GLU n 
5 1    MET n 
5 2    ALA n 
5 3    ARG n 
5 4    VAL n 
5 5    SER n 
5 6    GLY n 
5 7    ALA n 
5 8    ALA n 
5 9    ALA n 
5 10   ALA n 
5 11   GLU n 
5 12   ALA n 
5 13   ALA n 
5 14   LEU n 
5 15   MET n 
5 16   ARG n 
5 17   ALA n 
5 18   LEU n 
5 19   TYR n 
5 20   ASP n 
5 21   GLU n 
5 22   HIS n 
5 23   ALA n 
5 24   ALA n 
5 25   VAL n 
5 26   LEU n 
5 27   TRP n 
5 28   ARG n 
5 29   TYR n 
5 30   ALA n 
5 31   LEU n 
5 32   ARG n 
5 33   LEU n 
5 34   THR n 
5 35   GLY n 
5 36   ASP n 
5 37   ALA n 
5 38   ALA n 
5 39   GLN n 
5 40   ALA n 
5 41   GLU n 
5 42   ASP n 
5 43   VAL n 
5 44   VAL n 
5 45   GLN n 
5 46   GLU n 
5 47   THR n 
5 48   LEU n 
5 49   LEU n 
5 50   ARG n 
5 51   ALA n 
5 52   TRP n 
5 53   GLN n 
5 54   HIS n 
5 55   PRO n 
5 56   GLU n 
5 57   VAL n 
5 58   ILE n 
5 59   GLY n 
5 60   ASP n 
5 61   THR n 
5 62   ALA n 
5 63   ARG n 
5 64   PRO n 
5 65   ALA n 
5 66   ARG n 
5 67   ALA n 
5 68   TRP n 
5 69   LEU n 
5 70   PHE n 
5 71   THR n 
5 72   VAL n 
5 73   ALA n 
5 74   ARG n 
5 75   ASN n 
5 76   MET n 
5 77   ILE n 
5 78   ILE n 
5 79   ASP n 
5 80   GLU n 
5 81   ARG n 
5 82   ARG n 
5 83   SER n 
5 84   ALA n 
5 85   ARG n 
5 86   PHE n 
5 87   ARG n 
5 88   ASN n 
5 89   VAL n 
5 90   VAL n 
5 91   GLY n 
5 92   SER n 
5 93   THR n 
5 94   ASP n 
5 95   GLN n 
5 96   SER n 
5 97   GLY n 
5 98   THR n 
5 99   PRO n 
5 100  GLU n 
5 101  GLN n 
5 102  SER n 
5 103  THR n 
5 104  PRO n 
5 105  ASP n 
5 106  GLU n 
5 107  VAL n 
5 108  ASN n 
5 109  ALA n 
5 110  ALA n 
5 111  LEU n 
5 112  ASP n 
5 113  ARG n 
5 114  LEU n 
5 115  LEU n 
5 116  ILE n 
5 117  ALA n 
5 118  ASP n 
5 119  ALA n 
5 120  LEU n 
5 121  ALA n 
5 122  GLN n 
5 123  LEU n 
5 124  SER n 
5 125  ALA n 
5 126  GLU n 
5 127  HIS n 
5 128  ARG n 
5 129  ALA n 
5 130  VAL n 
5 131  ILE n 
5 132  GLN n 
5 133  ARG n 
5 134  SER n 
5 135  TYR n 
5 136  TYR n 
5 137  ARG n 
5 138  GLY n 
5 139  TRP n 
5 140  SER n 
5 141  THR n 
5 142  ALA n 
5 143  GLN n 
5 144  ILE n 
5 145  ALA n 
5 146  THR n 
5 147  ASP n 
5 148  LEU n 
5 149  GLY n 
5 150  ILE n 
5 151  ALA n 
5 152  GLU n 
5 153  GLY n 
5 154  THR n 
5 155  VAL n 
5 156  LYS n 
5 157  SER n 
5 158  ARG n 
5 159  LEU n 
5 160  HIS n 
5 161  TYR n 
5 162  ALA n 
5 163  VAL n 
5 164  ARG n 
5 165  ALA n 
5 166  LEU n 
5 167  ARG n 
5 168  LEU n 
5 169  THR n 
5 170  LEU n 
5 171  GLN n 
5 172  GLU n 
5 173  LEU n 
5 174  GLY n 
5 175  VAL n 
5 176  THR n 
5 177  ARG n 
6 1    C   n 
6 2    U   n 
6 3    C   n 
6 4    G   n 
6 5    A   n 
7 1    DG  n 
7 2    DC  n 
7 3    DA  n 
7 4    DT  n 
7 5    DC  n 
7 6    DC  n 
7 7    DG  n 
7 8    DT  n 
7 9    DG  n 
7 10   DA  n 
7 11   DG  n 
7 12   DT  n 
7 13   DC  n 
7 14   DG  n 
7 15   DA  n 
7 16   DG  n 
7 17   DG  n 
8 1    DC  n 
8 2    DG  n 
8 3    DT  n 
8 4    DG  n 
8 5    DT  n 
8 6    DC  n 
8 7    DA  n 
8 8    DG  n 
8 9    DA  n 
8 10   DG  n 
8 11   DT  n 
8 12   DG  n 
8 13   DT  n 
8 14   DC  n 
8 15   DA  n 
8 16   DC  n 
8 17   DG  n 
8 18   DG  n 
8 19   DA  n 
8 20   DT  n 
8 21   DG  n 
8 22   DC  n 
# 
loop_
_entity_src_gen.entity_id 
_entity_src_gen.pdbx_src_id 
_entity_src_gen.pdbx_alt_source_flag 
_entity_src_gen.pdbx_seq_type 
_entity_src_gen.pdbx_beg_seq_num 
_entity_src_gen.pdbx_end_seq_num 
_entity_src_gen.gene_src_common_name 
_entity_src_gen.gene_src_genus 
_entity_src_gen.pdbx_gene_src_gene 
_entity_src_gen.gene_src_species 
_entity_src_gen.gene_src_strain 
_entity_src_gen.gene_src_tissue 
_entity_src_gen.gene_src_tissue_fraction 
_entity_src_gen.gene_src_details 
_entity_src_gen.pdbx_gene_src_fragment 
_entity_src_gen.pdbx_gene_src_scientific_name 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 
_entity_src_gen.pdbx_gene_src_variant 
_entity_src_gen.pdbx_gene_src_cell_line 
_entity_src_gen.pdbx_gene_src_atcc 
_entity_src_gen.pdbx_gene_src_organ 
_entity_src_gen.pdbx_gene_src_organelle 
_entity_src_gen.pdbx_gene_src_cell 
_entity_src_gen.pdbx_gene_src_cellular_location 
_entity_src_gen.host_org_common_name 
_entity_src_gen.pdbx_host_org_scientific_name 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 
_entity_src_gen.host_org_genus 
_entity_src_gen.pdbx_host_org_gene 
_entity_src_gen.pdbx_host_org_organ 
_entity_src_gen.host_org_species 
_entity_src_gen.pdbx_host_org_tissue 
_entity_src_gen.pdbx_host_org_tissue_fraction 
_entity_src_gen.pdbx_host_org_strain 
_entity_src_gen.pdbx_host_org_variant 
_entity_src_gen.pdbx_host_org_cell_line 
_entity_src_gen.pdbx_host_org_atcc 
_entity_src_gen.pdbx_host_org_culture_collection 
_entity_src_gen.pdbx_host_org_cell 
_entity_src_gen.pdbx_host_org_organelle 
_entity_src_gen.pdbx_host_org_cellular_location 
_entity_src_gen.pdbx_host_org_vector_type 
_entity_src_gen.pdbx_host_org_vector 
_entity_src_gen.host_org_details 
_entity_src_gen.expression_system_id 
_entity_src_gen.plasmid_name 
_entity_src_gen.plasmid_details 
_entity_src_gen.pdbx_description 
1 1 sample 'Biological sequence' 1 359  ? ? 'rpoA, Rv3457c, MTCY13E12.10c' ? 'ATCC 25618 / H37Rv' ? ? ? ? 
'Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)' 83332 ? ? ? ? ? ? ? ? 
;Escherichia coli 'BL21-Gold(DE3)pLysS AG'
;
866768 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
2 1 sample 'Biological sequence' 1 1178 ? ? 'rpoB, Rv0667, MTCI376.08c'    ? 'ATCC 25618 / H37Rv' ? ? ? ? 
'Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)' 83332 ? ? ? ? ? ? ? ? 
;Escherichia coli 'BL21-Gold(DE3)pLysS AG'
;
866768 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
3 1 sample 'Biological sequence' 1 1316 ? ? 'rpoC, Rv0668, MTCI376.07c'    ? 'ATCC 25618 / H37Rv' ? ? ? ? 
'Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)' 83332 ? ? ? ? ? ? ? ? 
;Escherichia coli 'BL21-Gold(DE3)pLysS AG'
;
866768 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
4 1 sample 'Biological sequence' 1 110  ? ? 'rpoZ, Rv1390, MTCY21B4.07'    ? 'ATCC 25618 / H37Rv' ? ? ? ? 
'Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)' 83332 ? ? ? ? ? ? ? ? 
;Escherichia coli 'BL21-Gold(DE3)pLysS AG'
;
866768 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
5 1 sample 'Biological sequence' 1 177  ? ? 'sigL, Rv0735'                 ? 'ATCC 25618 / H37Rv' ? ? ? ? 
'Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)' 83332 ? ? ? ? ? ? ? ? 
;Escherichia coli 'BL21-Gold(DE3)pLysS AG'
;
866768 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
# 
loop_
_pdbx_entity_src_syn.entity_id 
_pdbx_entity_src_syn.pdbx_src_id 
_pdbx_entity_src_syn.pdbx_alt_source_flag 
_pdbx_entity_src_syn.pdbx_beg_seq_num 
_pdbx_entity_src_syn.pdbx_end_seq_num 
_pdbx_entity_src_syn.organism_scientific 
_pdbx_entity_src_syn.organism_common_name 
_pdbx_entity_src_syn.ncbi_taxonomy_id 
_pdbx_entity_src_syn.details 
6 1 sample 1 5  'Mycobacterium tuberculosis H37Rv' ? 83332 ? 
7 1 sample 1 17 'Mycobacterium tuberculosis H37Rv' ? 83332 ? 
8 1 sample 1 22 'Mycobacterium tuberculosis H37Rv' ? 83332 ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_db_isoform 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
1 UNP RPOA_MYCTU P9WGZ1 ? 1 
;MLISQRPTLSEDVLTDNRSQFVIEPLEPGFGYTLGNSLRRTLLSSIPGAAVTSIRIDGVLHEFTTVPGVKEDVTEIILNL
KSLVVSSEEDEPVTMYLRKQGPGEVTAGDIVPPAGVTVHNPGMHIATLNDKGKLEVELVVERGRGYVPAVQNRASGAEIG
RIPVDSIYSPVLKVTYKVDATRVEQRTDFDKLILDVETKNSISPRDALASAGKTLVELFGLARELNVEAEGIEIGPSPAE
ADHIASFALPIDDLDLTVRSYNCLKREGVHTVGELVARTESDLLDIRNFGQKSIDEVKIKLHQLGLSLKDSPPSFDPSEV
AGYDVATGTWSTEGAYDEQDYAETEQL
;
1 
2 UNP RPOB_MYCTU P9WGY9 ? 2 
;MLEGCILADSRQSKTAASPSPSRPQSSSNNSVPGAPNRVSFAKLREPLEVPGLLDVQTDSFEWLIGSPRWRESAAERGDV
NPVGGLEEVLYELSPIEDFSGSMSLSFSDPRFDDVKAPVDECKDKDMTYAAPLFVTAEFINNNTGEIKSQTVFMGDFPMM
TEKGTFIINGTERVVVSQLVRSPGVYFDETIDKSTDKTLHSVKVIPSRGAWLEFDVDKRDTVGVRIDRKRRQPVTVLLKA
LGWTSEQIVERFGFSEIMRSTLEKDNTVGTDEALLDIYRKLRPGEPPTKESAQTLLENLFFKEKRYDLARVGRYKVNKKL
GLHVGEPITSSTLTEEDVVATIEYLVRLHEGQTTMTVPGGVEVPVETDDIDHFGNRRLRTVGELIQNQIRVGMSRMERVV
RERMTTQDVEAITPQTLINIRPVVAAIKEFFGTSQLSQFMDQNNPLSGLTHKRRLSALGPGGLSRERAGLEVRDVHPSHY
GRMCPIETPEGPNIGLIGSLSVYARVNPFGFIETPYRKVVDGVVSDEIVYLTADEEDRHVVAQANSPIDADGRFVEPRVL
VRRKAGEVEYVPSSEVDYMDVSPRQMVSVATAMIPFLEHDDANRALMGANMQRQAVPLVRSEAPLVGTGMELRAAIDAGD
VVVAEESGVIEEVSADYITVMHDNGTRRTYRMRKFARSNHGTCANQCPIVDAGDRVEAGQVIADGPCTDDGEMALGKNLL
VAIMPWEGHNYEDAIILSNRLVEEDVLTSIHIEEHEIDARDTKLGAEEITRDIPNISDEVLADLDERGIVRIGAEVRDGD
ILVGKVTPKGETELTPEERLLRAIFGEKAREVRDTSLKVPHGESGKVIGIRVFSREDEDELPAGVNELVRVYVAQKRKIS
DGDKLAGRHGNKGVIGKILPVEDMPFLADGTPVDIILNTHGVPRRMNIGQILETHLGWCAHSGWKVDAAKGVPDWAARLP
DELLEAQPNAIVSTPVFDGAQEAELQGLLSCTLPNRDGDVLVDADGKAMLFDGRSGEPFPYPVTVGYMYIMKLHHLVDDK
IHARSTGPYSMITQQPLGGKAQFGGQRFGEMECWAMQAYGAAYTLQELLTIKSDDTVGRVKVYEAIVKGENIPEPGIPES
FKVLLKELQSLCLNVEVLSSDGAAIELREGEDEDLERAAANLGINLSRNESASVEDLA
;
1 
3 UNP RPOC_MYCTU P9WGY7 ? 3 
;MLDVNFFDELRIGLATAEDIRQWSYGEVKKPETINYRTLKPEKDGLFCEKIFGPTRDWECYCGKYKRVRFKGIICERCGV
EVTRAKVRRERMGHIELAAPVTHIWYFKGVPSRLGYLLDLAPKDLEKIIYFAAYVITSVDEEMRHNELSTLEAEMAVERK
AVEDQRDGELEARAQKLEADLAELEAEGAKADARRKVRDGGEREMRQIRDRAQRELDRLEDIWSTFTKLAPKQLIVDENL
YRELVDRYGEYFTGAMGAESIQKLIENFDIDAEAESLRDVIRNGKGQKKLRALKRLKVVAAFQQSGNSPMGMVLDAVPVI
PPELRPMVQLDGGRFATSDLNDLYRRVINRNNRLKRLIDLGAPEIIVNNEKRMLQESVDALFDNGRRGRPVTGPGNRPLK
SLSDLLKGKQGRFRQNLLGKRVDYSGRSVIVVGPQLKLHQCGLPKLMALELFKPFVMKRLVDLNHAQNIKSAKRMVERQR
PQVWDVLEEVIAEHPVLLNRAPTLHRLGIQAFEPMLVEGKAIQLHPLVCEAFNADFDGDQMAVHLPLSAEAQAEARILML
SSNNILSPASGRPLAMPRLDMVTGLYYLTTEVPGDTGEYQPASGDHPETGVYSSPAEAIMAADRGVLSVRAKIKVRLTQL
RPPVEIEAELFGHSGWQPGDAWMAETTLGRVMFNELLPLGYPFVNKQMHKKVQAAIINDLAERYPMIVVAQTVDKLKDAG
FYWATRSGVTVSMADVLVPPRKKEILDHYEERADKVEKQFQRGALNHDERNEALVEIWKEATDEVGQALREHYPDDNPII
TIVDSGATGNFTQTRTLAGMKGLVTNPKGEFIPRPVKSSFREGLTVLEYFINTHGARKGLADTALRTADSGYLTRRLVDV
SQDVIVREHDCQTERGIVVELAERAPDGTLIRDPYIETSAYARTLGTDAVDEAGNVIVERGQDLGDPEIDALLAAGITQV
KVRSVLTCATSTGVCATCYGRSMATGKLVDIGEAVGIVAAQSIGEPGTQLTMRTFHQGGVGEDITGGLPRVQELFEARVP
RGKAPIADVTGRVRLEDGERFYKITIVPDDGGEEVVYDKISKRQRLRVFKHEDGSERVLSDGDHVEVGQQLMEGSADPHE
VLRVQGPREVQIHLVREVQEVYRAQGVSIHDKHIEVIVRQMLRRVTIIDSGSTEFLPGSLIDRAEFEAENRRVVAEGGEP
AAGRPVLMGITKASLATDSWLSAASFQETTRVLTDAAINCRSDKLNGLKENVIIGKLIPAGTGINRYRNIAVQPTEEARA
AAYTIPSYEDQYYSPDFGAATGAAVPLDDYGYSDYR
;
1 
4 UNP RPOZ_MYCTU P9WGY5 ? 4 
;MSISQSDASLAAVPAVDQFDPSSGASGGYDTPLGITNPPIDELLDRVSSKYALVIYAAKRARQINDYYNQLGEGILEYVG
PLVEPGLQEKPLSIALREIHADLLEHTEGE
;
1 
5 UNP SIGL_MYCTU P9WGH5 ? 5 
;MARVSGAAAAEAALMRALYDEHAAVLWRYALRLTGDAAQAEDVVQETLLRAWQHPEVIGDTARPARAWLFTVARNMIIDE
RRSARFRNVVGSTDQSGTPEQSTPDEVNAALDRLLIADALAQLSAEHRAVIQRSYYRGWSTAQIATDLGIAEGTVKSRLH
YAVRALRLTLQELGVTR
;
1 
6 PDB 6DV9       6DV9   ? 6 ? 1 
7 PDB 6DV9       6DV9   ? 7 ? 1 
8 PDB 6DV9       6DV9   ? 8 ? 1 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 6DV9 A 13 ? 359  ? P9WGZ1 1 ? 347  ? 1 347  
2 1 6DV9 B 13 ? 359  ? P9WGZ1 1 ? 347  ? 1 347  
3 2 6DV9 C 1  ? 1178 ? P9WGY9 1 ? 1178 ? 1 1178 
4 3 6DV9 D 1  ? 1316 ? P9WGY7 1 ? 1316 ? 1 1316 
5 4 6DV9 E 1  ? 110  ? P9WGY5 1 ? 110  ? 1 110  
6 5 6DV9 F 1  ? 177  ? P9WGH5 1 ? 177  ? 1 177  
7 6 6DV9 I 1  ? 5    ? 6DV9   3 ? 7    ? 3 7    
8 7 6DV9 G 1  ? 17   ? 6DV9   4 ? 20   ? 4 20   
9 8 6DV9 H 1  ? 22   ? 6DV9   4 ? 25   ? 4 25   
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 6DV9 MET A 1  ? UNP P9WGZ1 ? ? 'initiating methionine' -11 1  
1 6DV9 GLY A 2  ? UNP P9WGZ1 ? ? 'expression tag'        -10 2  
1 6DV9 HIS A 3  ? UNP P9WGZ1 ? ? 'expression tag'        -9  3  
1 6DV9 HIS A 4  ? UNP P9WGZ1 ? ? 'expression tag'        -8  4  
1 6DV9 HIS A 5  ? UNP P9WGZ1 ? ? 'expression tag'        -7  5  
1 6DV9 HIS A 6  ? UNP P9WGZ1 ? ? 'expression tag'        -6  6  
1 6DV9 HIS A 7  ? UNP P9WGZ1 ? ? 'expression tag'        -5  7  
1 6DV9 HIS A 8  ? UNP P9WGZ1 ? ? 'expression tag'        -4  8  
1 6DV9 HIS A 9  ? UNP P9WGZ1 ? ? 'expression tag'        -3  9  
1 6DV9 HIS A 10 ? UNP P9WGZ1 ? ? 'expression tag'        -2  10 
1 6DV9 HIS A 11 ? UNP P9WGZ1 ? ? 'expression tag'        -1  11 
1 6DV9 HIS A 12 ? UNP P9WGZ1 ? ? 'expression tag'        0   12 
2 6DV9 MET B 1  ? UNP P9WGZ1 ? ? 'initiating methionine' -11 13 
2 6DV9 GLY B 2  ? UNP P9WGZ1 ? ? 'expression tag'        -10 14 
2 6DV9 HIS B 3  ? UNP P9WGZ1 ? ? 'expression tag'        -9  15 
2 6DV9 HIS B 4  ? UNP P9WGZ1 ? ? 'expression tag'        -8  16 
2 6DV9 HIS B 5  ? UNP P9WGZ1 ? ? 'expression tag'        -7  17 
2 6DV9 HIS B 6  ? UNP P9WGZ1 ? ? 'expression tag'        -6  18 
2 6DV9 HIS B 7  ? UNP P9WGZ1 ? ? 'expression tag'        -5  19 
2 6DV9 HIS B 8  ? UNP P9WGZ1 ? ? 'expression tag'        -4  20 
2 6DV9 HIS B 9  ? UNP P9WGZ1 ? ? 'expression tag'        -3  21 
2 6DV9 HIS B 10 ? UNP P9WGZ1 ? ? 'expression tag'        -2  22 
2 6DV9 HIS B 11 ? UNP P9WGZ1 ? ? 'expression tag'        -1  23 
2 6DV9 HIS B 12 ? UNP P9WGZ1 ? ? 'expression tag'        0   24 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
A   'RNA linking'       y "ADENOSINE-5'-MONOPHOSPHATE"         ? 'C10 H14 N5 O7 P' 347.221 
ALA 'L-peptide linking' y ALANINE                              ? 'C3 H7 N O2'      89.093  
ARG 'L-peptide linking' y ARGININE                             ? 'C6 H15 N4 O2 1'  175.209 
ASN 'L-peptide linking' y ASPARAGINE                           ? 'C4 H8 N2 O3'     132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                      ? 'C4 H7 N O4'      133.103 
C   'RNA linking'       y "CYTIDINE-5'-MONOPHOSPHATE"          ? 'C9 H14 N3 O8 P'  323.197 
CYS 'L-peptide linking' y CYSTEINE                             ? 'C3 H7 N O2 S'    121.158 
DA  'DNA linking'       y "2'-DEOXYADENOSINE-5'-MONOPHOSPHATE" ? 'C10 H14 N5 O6 P' 331.222 
DC  'DNA linking'       y "2'-DEOXYCYTIDINE-5'-MONOPHOSPHATE"  ? 'C9 H14 N3 O7 P'  307.197 
DG  'DNA linking'       y "2'-DEOXYGUANOSINE-5'-MONOPHOSPHATE" ? 'C10 H14 N5 O7 P' 347.221 
DT  'DNA linking'       y "THYMIDINE-5'-MONOPHOSPHATE"         ? 'C10 H15 N2 O8 P' 322.208 
G   'RNA linking'       y "GUANOSINE-5'-MONOPHOSPHATE"         ? 'C10 H14 N5 O8 P' 363.221 
GLN 'L-peptide linking' y GLUTAMINE                            ? 'C5 H10 N2 O3'    146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                      ? 'C5 H9 N O4'      147.129 
GLY 'peptide linking'   y GLYCINE                              ? 'C2 H5 N O2'      75.067  
HIS 'L-peptide linking' y HISTIDINE                            ? 'C6 H10 N3 O2 1'  156.162 
ILE 'L-peptide linking' y ISOLEUCINE                           ? 'C6 H13 N O2'     131.173 
LEU 'L-peptide linking' y LEUCINE                              ? 'C6 H13 N O2'     131.173 
LYS 'L-peptide linking' y LYSINE                               ? 'C6 H15 N2 O2 1'  147.195 
MET 'L-peptide linking' y METHIONINE                           ? 'C5 H11 N O2 S'   149.211 
MG  non-polymer         . 'MAGNESIUM ION'                      ? 'Mg 2'            24.305  
PHE 'L-peptide linking' y PHENYLALANINE                        ? 'C9 H11 N O2'     165.189 
PRO 'L-peptide linking' y PROLINE                              ? 'C5 H9 N O2'      115.130 
SER 'L-peptide linking' y SERINE                               ? 'C3 H7 N O3'      105.093 
THR 'L-peptide linking' y THREONINE                            ? 'C4 H9 N O3'      119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                           ? 'C11 H12 N2 O2'   204.225 
TYR 'L-peptide linking' y TYROSINE                             ? 'C9 H11 N O3'     181.189 
U   'RNA linking'       y "URIDINE-5'-MONOPHOSPHATE"           ? 'C9 H13 N2 O9 P'  324.181 
VAL 'L-peptide linking' y VALINE                               ? 'C5 H11 N O2'     117.146 
ZN  non-polymer         . 'ZINC ION'                           ? 'Zn 2'            65.409  
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.entry_id                   6DV9 
_exptl.crystals_number            1 
_exptl.details                    ? 
_exptl.method                     'X-RAY DIFFRACTION' 
_exptl.method_details             ? 
# 
_exptl_crystal.colour                      ? 
_exptl_crystal.density_diffrn              ? 
_exptl_crystal.density_Matthews            3.43 
_exptl_crystal.density_method              ? 
_exptl_crystal.density_percent_sol         64.14 
_exptl_crystal.description                 ? 
_exptl_crystal.F_000                       ? 
_exptl_crystal.id                          1 
_exptl_crystal.preparation                 ? 
_exptl_crystal.size_max                    ? 
_exptl_crystal.size_mid                    ? 
_exptl_crystal.size_min                    ? 
_exptl_crystal.size_rad                    ? 
_exptl_crystal.colour_lustre               ? 
_exptl_crystal.colour_modifier             ? 
_exptl_crystal.colour_primary              ? 
_exptl_crystal.density_meas                ? 
_exptl_crystal.density_meas_esd            ? 
_exptl_crystal.density_meas_gt             ? 
_exptl_crystal.density_meas_lt             ? 
_exptl_crystal.density_meas_temp           ? 
_exptl_crystal.density_meas_temp_esd       ? 
_exptl_crystal.density_meas_temp_gt        ? 
_exptl_crystal.density_meas_temp_lt        ? 
_exptl_crystal.pdbx_crystal_image_url      ? 
_exptl_crystal.pdbx_crystal_image_format   ? 
_exptl_crystal.pdbx_mosaicity              ? 
_exptl_crystal.pdbx_mosaicity_esd          ? 
# 
_exptl_crystal_grow.apparatus       ? 
_exptl_crystal_grow.atmosphere      ? 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.details         ? 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.method_ref      ? 
_exptl_crystal_grow.pH              5.5 
_exptl_crystal_grow.pressure        ? 
_exptl_crystal_grow.pressure_esd    ? 
_exptl_crystal_grow.seeding         ? 
_exptl_crystal_grow.seeding_ref     ? 
_exptl_crystal_grow.temp            295.0 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.temp_esd        ? 
_exptl_crystal_grow.time            ? 
_exptl_crystal_grow.pdbx_details    '100 mM sodium citrate tribasic dihydrate, pH 5.5, 200 mM sodium acetate, and 10% PEG4000' 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.ambient_environment    ? 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.ambient_temp_esd       ? 
_diffrn.crystal_id             1 
_diffrn.crystal_support        ? 
_diffrn.crystal_treatment      ? 
_diffrn.details                ? 
_diffrn.id                     1 
_diffrn.ambient_pressure       ? 
_diffrn.ambient_pressure_esd   ? 
_diffrn.ambient_pressure_gt    ? 
_diffrn.ambient_pressure_lt    ? 
_diffrn.ambient_temp_gt        ? 
_diffrn.ambient_temp_lt        ? 
# 
_diffrn_detector.details                      ? 
_diffrn_detector.detector                     PIXEL 
_diffrn_detector.diffrn_id                    1 
_diffrn_detector.type                         'DECTRIS PILATUS3 6M' 
_diffrn_detector.area_resol_mean              ? 
_diffrn_detector.dtime                        ? 
_diffrn_detector.pdbx_frames_total            ? 
_diffrn_detector.pdbx_collection_time_total   ? 
_diffrn_detector.pdbx_collection_date         2016-05-12 
# 
_diffrn_radiation.collimation                      ? 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.filter_edge                      ? 
_diffrn_radiation.inhomogeneity                    ? 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.polarisn_norm                    ? 
_diffrn_radiation.polarisn_ratio                   ? 
_diffrn_radiation.probe                            ? 
_diffrn_radiation.type                             ? 
_diffrn_radiation.xray_symbol                      ? 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_wavelength_list             ? 
_diffrn_radiation.pdbx_wavelength                  ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_analyzer                    ? 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.97918 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.current                     ? 
_diffrn_source.details                     ? 
_diffrn_source.diffrn_id                   1 
_diffrn_source.power                       ? 
_diffrn_source.size                        ? 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.target                      ? 
_diffrn_source.type                        'APS BEAMLINE 19-ID' 
_diffrn_source.voltage                     ? 
_diffrn_source.take-off_angle              ? 
_diffrn_source.pdbx_wavelength_list        0.97918 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_synchrotron_beamline   19-ID 
_diffrn_source.pdbx_synchrotron_site       APS 
# 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
_reflns.entry_id                     6DV9 
_reflns.observed_criterion_sigma_I   ? 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             97.690 
_reflns.d_resolution_high            3.800 
_reflns.number_obs                   53020 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         96.6 
_reflns.pdbx_Rmerge_I_obs            0.33000 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        8.6000 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              10.70 
_reflns.pdbx_CC_half                 ? 
_reflns.pdbx_Rpim_I_all              ? 
_reflns.pdbx_Rrim_I_all              ? 
# 
_reflns_shell.pdbx_diffrn_id         1 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.d_res_high             3.80 
_reflns_shell.d_res_low              3.91 
_reflns_shell.percent_possible_all   90.5 
_reflns_shell.Rmerge_I_obs           1.96700 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    ? 
_reflns_shell.pdbx_redundancy        9.90 
_reflns_shell.number_measured_obs    ? 
_reflns_shell.number_unique_all      ? 
_reflns_shell.number_unique_obs      ? 
_reflns_shell.pdbx_CC_half           ? 
_reflns_shell.pdbx_Rpim_I_all        ? 
_reflns_shell.pdbx_Rrim_I_all        ? 
# 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.entry_id                                 6DV9 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.ls_number_reflns_obs                     98206 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          1.90 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             91.471 
_refine.ls_d_res_high                            3.800 
_refine.ls_percent_reflns_obs                    93.60 
_refine.ls_R_factor_obs                          0.1868 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.1844 
_refine.ls_R_factor_R_free                       0.2320 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 5.00 
_refine.ls_number_reflns_R_free                  4908 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.B_iso_mean                               ? 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.solvent_model_details                    'FLAT BULK SOLVENT MODEL' 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             1.11 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             0.90 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  ? 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_method_to_determine_struct          ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       ML 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            0.45 
_refine.pdbx_overall_phase_error                 22.56 
_refine.overall_SU_B                             ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        24051 
_refine_hist.pdbx_number_atoms_nucleic_acid   904 
_refine_hist.pdbx_number_atoms_ligand         3 
_refine_hist.number_atoms_solvent             0 
_refine_hist.number_atoms_total               24958 
_refine_hist.d_res_high                       3.800 
_refine_hist.d_res_low                        91.471 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
f_bond_d           0.002  ? ? 25477 'X-RAY DIFFRACTION' ? 
f_angle_d          0.489  ? ? 34723 'X-RAY DIFFRACTION' ? 
f_dihedral_angle_d 15.242 ? ? 15423 'X-RAY DIFFRACTION' ? 
f_chiral_restr     0.040  ? ? 3960  'X-RAY DIFFRACTION' ? 
f_plane_restr      0.004  ? ? 4425  'X-RAY DIFFRACTION' ? 
# 
loop_
_refine_ls_shell.pdbx_refine_id 
_refine_ls_shell.pdbx_total_number_of_bins_used 
_refine_ls_shell.d_res_high 
_refine_ls_shell.d_res_low 
_refine_ls_shell.number_reflns_R_work 
_refine_ls_shell.R_factor_R_work 
_refine_ls_shell.percent_reflns_obs 
_refine_ls_shell.R_factor_R_free 
_refine_ls_shell.R_factor_R_free_error 
_refine_ls_shell.percent_reflns_R_free 
_refine_ls_shell.number_reflns_R_free 
_refine_ls_shell.number_reflns_all 
_refine_ls_shell.R_factor_all 
_refine_ls_shell.R_factor_obs 
_refine_ls_shell.number_reflns_obs 
'X-RAY DIFFRACTION' . 3.8000  3.8432  2898 0.2946 87.00  0.3266 . . 152 . . . . 
'X-RAY DIFFRACTION' . 3.8432  3.8884  2831 0.2839 86.00  0.3245 . . 151 . . . . 
'X-RAY DIFFRACTION' . 3.8884  3.9358  2850 0.2803 85.00  0.3183 . . 135 . . . . 
'X-RAY DIFFRACTION' . 3.9358  3.9857  2867 0.2666 87.00  0.3389 . . 151 . . . . 
'X-RAY DIFFRACTION' . 3.9857  4.0381  2948 0.2445 88.00  0.2897 . . 134 . . . . 
'X-RAY DIFFRACTION' . 4.0381  4.0934  2961 0.2214 88.00  0.3085 . . 131 . . . . 
'X-RAY DIFFRACTION' . 4.0934  4.1519  2935 0.2199 89.00  0.2322 . . 172 . . . . 
'X-RAY DIFFRACTION' . 4.1519  4.2139  2985 0.2165 89.00  0.2573 . . 177 . . . . 
'X-RAY DIFFRACTION' . 4.2139  4.2797  2999 0.2027 91.00  0.3109 . . 152 . . . . 
'X-RAY DIFFRACTION' . 4.2797  4.3499  3060 0.2039 92.00  0.2186 . . 174 . . . . 
'X-RAY DIFFRACTION' . 4.3499  4.4249  3058 0.1975 93.00  0.2417 . . 145 . . . . 
'X-RAY DIFFRACTION' . 4.4249  4.5053  3124 0.1921 93.00  0.2817 . . 156 . . . . 
'X-RAY DIFFRACTION' . 4.5053  4.5920  3128 0.1833 94.00  0.2241 . . 179 . . . . 
'X-RAY DIFFRACTION' . 4.5920  4.6857  3100 0.1711 95.00  0.2476 . . 177 . . . . 
'X-RAY DIFFRACTION' . 4.6857  4.7876  3155 0.1733 94.00  0.2455 . . 162 . . . . 
'X-RAY DIFFRACTION' . 4.7876  4.8990  3001 0.1725 91.00  0.2020 . . 152 . . . . 
'X-RAY DIFFRACTION' . 4.8990  5.0215  3172 0.1786 95.00  0.2589 . . 172 . . . . 
'X-RAY DIFFRACTION' . 5.0215  5.1572  3166 0.1809 97.00  0.2379 . . 181 . . . . 
'X-RAY DIFFRACTION' . 5.1572  5.3090  3246 0.1816 97.00  0.2645 . . 167 . . . . 
'X-RAY DIFFRACTION' . 5.3090  5.4803  3223 0.1828 98.00  0.2178 . . 196 . . . . 
'X-RAY DIFFRACTION' . 5.4803  5.6762  3255 0.1811 97.00  0.2430 . . 146 . . . . 
'X-RAY DIFFRACTION' . 5.6762  5.9034  3243 0.1832 98.00  0.2278 . . 172 . . . . 
'X-RAY DIFFRACTION' . 5.9034  6.1720  3270 0.1833 98.00  0.2478 . . 204 . . . . 
'X-RAY DIFFRACTION' . 6.1720  6.4973  3141 0.1850 96.00  0.2345 . . 177 . . . . 
'X-RAY DIFFRACTION' . 6.4973  6.9043  3278 0.1729 99.00  0.2310 . . 181 . . . . 
'X-RAY DIFFRACTION' . 6.9043  7.4371  3402 0.1575 100.00 0.2288 . . 116 . . . . 
'X-RAY DIFFRACTION' . 7.4371  8.1851  3324 0.1438 100.00 0.1679 . . 169 . . . . 
'X-RAY DIFFRACTION' . 8.1851  9.3685  3290 0.1309 100.00 0.1555 . . 178 . . . . 
'X-RAY DIFFRACTION' . 9.3685  11.7994 3236 0.1282 97.00  0.1537 . . 177 . . . . 
'X-RAY DIFFRACTION' . 11.7994 91.4971 3152 0.1916 95.00  0.2294 . . 172 . . . . 
# 
_struct.entry_id                     6DV9 
_struct.title                        
;Crystal structure of Mycobacterium tuberculosis transcription initiation complex(ECF sigma factor L) containing 5nt RNA with 4nt spacer
;
_struct.pdbx_descriptor              'DNA-directed RNA polymerase/ECF RNA polymerase sigma factor SigL/RNA Complex' 
_struct.pdbx_model_details           ? 
_struct.pdbx_formula_weight          ? 
_struct.pdbx_formula_weight_method   ? 
_struct.pdbx_model_type_details      ? 
_struct.pdbx_CASP_flag               N 
# 
_struct_keywords.entry_id        6DV9 
_struct_keywords.text            
'Mycobacterium tuberculosis, RNA polymerase, ECF sigma factor, TRANSFERASE, TRANSFERASE-DNA-RNA complex' 
_struct_keywords.pdbx_keywords   TRANSFERASE/DNA/RNA 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1  ? 
B N N 1  ? 
C N N 2  ? 
D N N 3  ? 
E N N 4  ? 
F N N 5  ? 
G N N 6  ? 
H N N 7  ? 
I N N 8  ? 
J N N 9  ? 
K N N 10 ? 
L N N 10 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1   AA1 GLY A 41   ? LEU A 55   ? GLY A 29   LEU A 43   1 ? 15 
HELX_P HELX_P2   AA2 ASP A 84   ? LYS A 93   ? ASP A 72   LYS A 81   1 ? 10 
HELX_P HELX_P3   AA3 GLY A 120  ? ILE A 122  ? GLY A 108  ILE A 110  5 ? 3  
HELX_P HELX_P4   AA4 SER A 215  ? GLU A 236  ? SER A 203  GLU A 224  1 ? 22 
HELX_P HELX_P5   AA5 GLY B 41   ? GLY B 43   ? GLY B 29   GLY B 31   5 ? 3  
HELX_P HELX_P6   AA6 TYR B 44   ? SER B 57   ? TYR B 32   SER B 45   1 ? 14 
HELX_P HELX_P7   AA7 ASP B 84   ? SER B 94   ? ASP B 72   SER B 82   1 ? 11 
HELX_P HELX_P8   AA8 ALA B 161  ? ALA B 166  ? ALA B 149  ALA B 154  5 ? 6  
HELX_P HELX_P9   AA9 SER B 215  ? GLU B 236  ? SER B 203  GLU B 224  1 ? 22 
HELX_P HELX_P10  AB1 LEU C 54   ? ILE C 65   ? LEU C 54   ILE C 65   1 ? 12 
HELX_P HELX_P11  AB2 SER C 67   ? ARG C 77   ? SER C 67   ARG C 77   1 ? 11 
HELX_P HELX_P12  AB3 GLY C 84   ? SER C 94   ? GLY C 84   SER C 94   1 ? 11 
HELX_P HELX_P13  AB4 PRO C 118  ? ASP C 126  ? PRO C 118  ASP C 126  1 ? 9  
HELX_P HELX_P14  AB5 VAL C 234  ? LEU C 241  ? VAL C 234  LEU C 241  1 ? 8  
HELX_P HELX_P15  AB6 THR C 244  ? PHE C 252  ? THR C 244  PHE C 252  1 ? 9  
HELX_P HELX_P16  AB7 SER C 255  ? ASP C 265  ? SER C 255  ASP C 265  1 ? 11 
HELX_P HELX_P17  AB8 GLY C 269  ? ARG C 282  ? GLY C 269  ARG C 282  1 ? 14 
HELX_P HELX_P18  AB9 THR C 288  ? LEU C 299  ? THR C 288  LEU C 299  1 ? 12 
HELX_P HELX_P19  AC1 ALA C 309  ? LEU C 320  ? ALA C 309  LEU C 320  1 ? 12 
HELX_P HELX_P20  AC2 THR C 334  ? GLU C 350  ? THR C 334  GLU C 350  1 ? 17 
HELX_P HELX_P21  AC3 THR C 380  ? GLN C 407  ? THR C 380  GLN C 407  1 ? 28 
HELX_P HELX_P22  AC4 THR C 413  ? ILE C 418  ? THR C 413  ILE C 418  1 ? 6  
HELX_P HELX_P23  AC5 ILE C 420  ? THR C 433  ? ILE C 420  THR C 433  1 ? 14 
HELX_P HELX_P24  AC6 ASN C 444  ? ARG C 453  ? ASN C 444  ARG C 453  1 ? 10 
HELX_P HELX_P25  AC7 SER C 464  ? ALA C 468  ? SER C 464  ALA C 468  5 ? 5  
HELX_P HELX_P26  AC8 HIS C 476  ? TYR C 480  ? HIS C 476  TYR C 480  5 ? 5  
HELX_P HELX_P27  AC9 THR C 532  ? ARG C 538  ? THR C 532  ARG C 538  1 ? 7  
HELX_P HELX_P28  AD1 PRO C 572  ? VAL C 576  ? PRO C 572  VAL C 576  5 ? 5  
HELX_P HELX_P29  AD2 SER C 582  ? VAL C 587  ? SER C 582  VAL C 587  5 ? 6  
HELX_P HELX_P30  AD3 ALA C 590  ? ILE C 594  ? ALA C 590  ILE C 594  5 ? 5  
HELX_P HELX_P31  AD4 PHE C 596  ? ASP C 600  ? PHE C 596  ASP C 600  5 ? 5  
HELX_P HELX_P32  AD5 ASP C 601  ? ARG C 613  ? ASP C 601  ARG C 613  1 ? 13 
HELX_P HELX_P33  AD6 MET C 630  ? GLY C 639  ? MET C 630  GLY C 639  1 ? 10 
HELX_P HELX_P34  AD7 ASN C 739  ? GLU C 744  ? ASN C 739  GLU C 744  1 ? 6  
HELX_P HELX_P35  AD8 GLU C 779  ? LEU C 784  ? GLU C 779  LEU C 784  5 ? 6  
HELX_P HELX_P36  AD9 GLY C 810  ? LEU C 814  ? GLY C 810  LEU C 814  5 ? 5  
HELX_P HELX_P37  AE1 THR C 815  ? ILE C 824  ? THR C 815  ILE C 824  1 ? 10 
HELX_P HELX_P38  AE2 GLU C 856  ? GLU C 858  ? GLU C 856  GLU C 858  5 ? 3  
HELX_P HELX_P39  AE3 ILE C 928  ? GLY C 943  ? ILE C 928  GLY C 943  1 ? 16 
HELX_P HELX_P40  AE4 PRO C 960  ? LEU C 963  ? PRO C 960  LEU C 963  5 ? 4  
HELX_P HELX_P41  AE5 GLN C 981  ? CYS C 991  ? GLN C 981  CYS C 991  1 ? 11 
HELX_P HELX_P42  AE6 LEU C 1036 ? ILE C 1041 ? LEU C 1036 ILE C 1041 1 ? 6  
HELX_P HELX_P43  AE7 GLY C 1069 ? GLY C 1080 ? GLY C 1069 GLY C 1080 1 ? 12 
HELX_P HELX_P44  AE8 ALA C 1081 ? THR C 1090 ? ALA C 1081 THR C 1090 1 ? 10 
HELX_P HELX_P45  AE9 ASP C 1095 ? LYS C 1108 ? ASP C 1095 LYS C 1108 1 ? 14 
HELX_P HELX_P46  AF1 PRO C 1118 ? SER C 1130 ? PRO C 1118 SER C 1130 1 ? 13 
HELX_P HELX_P47  AF2 THR D 16   ? SER D 24   ? THR D 16   SER D 24   1 ? 9  
HELX_P HELX_P48  AF3 ARG D 84   ? GLU D 90   ? ARG D 84   GLU D 90   5 ? 7  
HELX_P HELX_P49  AF4 HIS D 103  ? LYS D 108  ? HIS D 103  LYS D 108  1 ? 6  
HELX_P HELX_P50  AF5 SER D 112  ? ASP D 119  ? SER D 112  ASP D 119  1 ? 8  
HELX_P HELX_P51  AF6 ALA D 121  ? TYR D 130  ? ALA D 121  TYR D 130  1 ? 10 
HELX_P HELX_P52  AF7 ASP D 140  ? GLU D 147  ? ASP D 140  GLU D 147  1 ? 8  
HELX_P HELX_P53  AF8 GLU D 147  ? GLU D 187  ? GLU D 147  GLU D 187  1 ? 41 
HELX_P HELX_P54  AF9 LYS D 190  ? LYS D 228  ? LYS D 190  LYS D 228  1 ? 39 
HELX_P HELX_P55  AG1 ASP D 237  ? GLY D 249  ? ASP D 237  GLY D 249  1 ? 13 
HELX_P HELX_P56  AG2 MET D 256  ? ASN D 267  ? MET D 256  ASN D 267  1 ? 12 
HELX_P HELX_P57  AG3 ASP D 269  ? ASN D 283  ? ASP D 269  ASN D 283  1 ? 15 
HELX_P HELX_P58  AG4 LYS D 285  ? GLY D 306  ? LYS D 285  GLY D 306  1 ? 22 
HELX_P HELX_P59  AG5 SER D 308  ? GLY D 311  ? SER D 308  GLY D 311  5 ? 4  
HELX_P HELX_P60  AG6 PRO D 321  ? ARG D 325  ? PRO D 321  ARG D 325  5 ? 5  
HELX_P HELX_P61  AG7 SER D 338  ? GLY D 361  ? SER D 338  GLY D 361  1 ? 24 
HELX_P HELX_P62  AG8 PRO D 363  ? ASN D 384  ? PRO D 363  ASN D 384  1 ? 22 
HELX_P HELX_P63  AG9 LEU D 402  ? LEU D 406  ? LEU D 402  LEU D 406  5 ? 5  
HELX_P HELX_P64  AH1 GLY D 411  ? LEU D 417  ? GLY D 411  LEU D 417  1 ? 7  
HELX_P HELX_P65  AH2 LYS D 445  ? PHE D 452  ? LYS D 445  PHE D 452  1 ? 8  
HELX_P HELX_P66  AH3 PHE D 452  ? LEU D 463  ? PHE D 452  LEU D 463  1 ? 12 
HELX_P HELX_P67  AH4 ASN D 468  ? GLN D 479  ? ASN D 468  GLN D 479  1 ? 12 
HELX_P HELX_P68  AH5 PRO D 481  ? ILE D 491  ? PRO D 481  ILE D 491  1 ? 11 
HELX_P HELX_P69  AH6 HIS D 505  ? LEU D 507  ? HIS D 505  LEU D 507  5 ? 3  
HELX_P HELX_P70  AH7 VAL D 528  ? ASN D 533  ? VAL D 528  ASN D 533  1 ? 6  
HELX_P HELX_P71  AH8 SER D 548  ? LEU D 558  ? SER D 548  LEU D 558  1 ? 11 
HELX_P HELX_P72  AH9 LEU D 560  ? ASN D 564  ? LEU D 560  ASN D 564  5 ? 5  
HELX_P HELX_P73  AI1 LEU D 579  ? THR D 589  ? LEU D 579  THR D 589  1 ? 11 
HELX_P HELX_P74  AI2 SER D 614  ? GLY D 625  ? SER D 614  GLY D 625  1 ? 12 
HELX_P HELX_P75  AI3 PRO D 643  ? PHE D 651  ? PRO D 643  PHE D 651  1 ? 9  
HELX_P HELX_P76  AI4 THR D 667  ? LEU D 677  ? THR D 667  LEU D 677  1 ? 11 
HELX_P HELX_P77  AI5 HIS D 689  ? TYR D 704  ? HIS D 689  TYR D 704  1 ? 16 
HELX_P HELX_P78  AI6 PRO D 705  ? ARG D 726  ? PRO D 705  ARG D 726  1 ? 22 
HELX_P HELX_P79  AI7 ARG D 741  ? ARG D 762  ? ARG D 741  ARG D 762  1 ? 22 
HELX_P HELX_P80  AI8 ASN D 766  ? TYR D 793  ? ASN D 766  TYR D 793  1 ? 28 
HELX_P HELX_P81  AI9 ASN D 797  ? SER D 805  ? ASN D 797  SER D 805  1 ? 9  
HELX_P HELX_P82  AJ1 ASN D 810  ? GLY D 819  ? ASN D 810  GLY D 819  1 ? 10 
HELX_P HELX_P83  AJ2 THR D 845  ? SER D 881  ? THR D 845  SER D 881  1 ? 37 
HELX_P HELX_P84  AJ3 TYR D 915  ? ALA D 920  ? TYR D 915  ALA D 920  1 ? 6  
HELX_P HELX_P85  AJ4 GLY D 945  ? ALA D 954  ? GLY D 945  ALA D 954  1 ? 10 
HELX_P HELX_P86  AJ5 ALA D 976  ? GLY D 980  ? ALA D 976  GLY D 980  1 ? 5  
HELX_P HELX_P87  AJ6 ALA D 994  ? GLU D 1005 ? ALA D 994  GLU D 1005 1 ? 12 
HELX_P HELX_P88  AJ7 PRO D 1006 ? GLN D 1009 ? PRO D 1006 GLN D 1009 5 ? 4  
HELX_P HELX_P89  AJ8 GLY D 1027 ? GLU D 1036 ? GLY D 1027 GLU D 1036 1 ? 10 
HELX_P HELX_P90  AJ9 ASP D 1117 ? GLY D 1126 ? ASP D 1117 GLY D 1126 1 ? 10 
HELX_P HELX_P91  AK1 GLY D 1126 ? ALA D 1144 ? GLY D 1126 ALA D 1144 1 ? 19 
HELX_P HELX_P92  AK2 HIS D 1150 ? LEU D 1162 ? HIS D 1150 LEU D 1162 1 ? 13 
HELX_P HELX_P93  AK3 ALA D 1184 ? ALA D 1195 ? ALA D 1184 ALA D 1195 1 ? 12 
HELX_P HELX_P94  AK4 GLY D 1209 ? ALA D 1216 ? GLY D 1209 ALA D 1216 1 ? 8  
HELX_P HELX_P95  AK5 SER D 1219 ? SER D 1225 ? SER D 1219 SER D 1225 1 ? 7  
HELX_P HELX_P96  AK6 GLU D 1228 ? CYS D 1240 ? GLU D 1228 CYS D 1240 1 ? 13 
HELX_P HELX_P97  AK7 GLY D 1247 ? GLY D 1255 ? GLY D 1247 GLY D 1255 1 ? 9  
HELX_P HELX_P98  AK8 ALA D 1260 ? GLY D 1263 ? ALA D 1260 GLY D 1263 5 ? 4  
HELX_P HELX_P99  AK9 ILE D 1264 ? ASN D 1269 ? ILE D 1264 ASN D 1269 1 ? 6  
HELX_P HELX_P100 AL1 LEU E 33   ? ASN E 37   ? LEU E 33   ASN E 37   5 ? 5  
HELX_P HELX_P101 AL2 PRO E 39   ? LEU E 44   ? PRO E 39   LEU E 44   1 ? 6  
HELX_P HELX_P102 AL3 SER E 49   ? GLN E 70   ? SER E 49   GLN E 70   1 ? 22 
HELX_P HELX_P103 AL4 LYS E 90   ? ALA E 101  ? LYS E 90   ALA E 101  1 ? 12 
HELX_P HELX_P104 AL5 SER F 5    ? GLY F 35   ? SER F 5    GLY F 35   1 ? 31 
HELX_P HELX_P105 AL6 ASP F 36   ? HIS F 54   ? ASP F 36   HIS F 54   1 ? 19 
HELX_P HELX_P106 AL7 HIS F 54   ? ASP F 60   ? HIS F 54   ASP F 60   1 ? 7  
HELX_P HELX_P107 AL8 PRO F 64   ? ARG F 81   ? PRO F 64   ARG F 81   1 ? 18 
HELX_P HELX_P108 AL9 ARG F 82   ? VAL F 89   ? ARG F 82   VAL F 89   1 ? 8  
HELX_P HELX_P109 AM1 GLU F 106  ? GLN F 122  ? GLU F 106  GLN F 122  1 ? 17 
HELX_P HELX_P110 AM2 SER F 124  ? TYR F 135  ? SER F 124  TYR F 135  1 ? 12 
HELX_P HELX_P111 AM3 SER F 140  ? GLY F 149  ? SER F 140  GLY F 149  1 ? 10 
HELX_P HELX_P112 AM4 ALA F 151  ? GLU F 172  ? ALA F 151  GLU F 172  1 ? 22 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
metalc1  metalc ? ? D CYS 60  SG    ? ? ? 1_555 L ZN .  ZN ? ? D CYS 60  D ZN 1403 1_555 ? ? ? ? ? ? ?                       2.431 
? 
metalc2  metalc ? ? D CYS 62  SG    ? ? ? 1_555 L ZN .  ZN ? ? D CYS 62  D ZN 1403 1_555 ? ? ? ? ? ? ?                       2.417 
? 
metalc3  metalc ? ? D CYS 75  SG    ? ? ? 1_555 L ZN .  ZN ? ? D CYS 75  D ZN 1403 1_555 ? ? ? ? ? ? ?                       2.446 
? 
metalc4  metalc ? ? D CYS 78  SG    ? ? ? 1_555 L ZN .  ZN ? ? D CYS 78  D ZN 1403 1_555 ? ? ? ? ? ? ?                       2.381 
? 
metalc5  metalc ? ? D ASP 535 OD1   ? ? ? 1_555 J MG .  MG ? ? D ASP 535 D MG 1401 1_555 ? ? ? ? ? ? ?                       2.209 
? 
metalc6  metalc ? ? D ASP 535 OD2   ? ? ? 1_555 J MG .  MG ? ? D ASP 535 D MG 1401 1_555 ? ? ? ? ? ? ?                       2.287 
? 
metalc7  metalc ? ? D ASP 537 OD1   ? ? ? 1_555 J MG .  MG ? ? D ASP 537 D MG 1401 1_555 ? ? ? ? ? ? ?                       2.194 
? 
metalc8  metalc ? ? D ASP 539 OD1   ? ? ? 1_555 J MG .  MG ? ? D ASP 539 D MG 1401 1_555 ? ? ? ? ? ? ?                       2.196 
? 
metalc9  metalc ? ? D ASP 539 OD2   ? ? ? 1_555 J MG .  MG ? ? D ASP 539 D MG 1401 1_555 ? ? ? ? ? ? ?                       2.870 
? 
metalc10 metalc ? ? D CYS 891 SG    ? ? ? 1_555 K ZN .  ZN ? ? D CYS 891 D ZN 1402 1_555 ? ? ? ? ? ? ?                       2.441 
? 
metalc11 metalc ? ? D CYS 968 SG    ? ? ? 1_555 K ZN .  ZN ? ? D CYS 968 D ZN 1402 1_555 ? ? ? ? ? ? ?                       2.375 
? 
metalc12 metalc ? ? D CYS 975 SG    ? ? ? 1_555 K ZN .  ZN ? ? D CYS 975 D ZN 1402 1_555 ? ? ? ? ? ? ?                       2.378 
? 
metalc13 metalc ? ? D CYS 978 SG    ? ? ? 1_555 K ZN .  ZN ? ? D CYS 978 D ZN 1402 1_555 ? ? ? ? ? ? ?                       2.445 
? 
metalc14 metalc ? ? G A   5   "O3'" ? ? ? 1_555 J MG .  MG ? ? I A   7   D MG 1401 1_555 ? ? ? ? ? ? ?                       2.008 
? 
hydrog1  hydrog ? ? H DG  1   O6    ? ? ? 1_555 I DC 22 N4 ? ? G DG  4   H DC 25   1_555 ? ? ? ? ? ? 'DG-DC PAIR'            ?     
? 
hydrog2  hydrog ? ? H DC  2   N3    ? ? ? 1_555 I DG 21 N1 ? ? G DC  5   H DG 24   1_555 ? ? ? ? ? ? WATSON-CRICK            ?     
? 
hydrog3  hydrog ? ? H DC  2   N4    ? ? ? 1_555 I DG 21 O6 ? ? G DC  5   H DG 24   1_555 ? ? ? ? ? ? WATSON-CRICK            ?     
? 
hydrog4  hydrog ? ? H DC  2   O2    ? ? ? 1_555 I DG 21 N2 ? ? G DC  5   H DG 24   1_555 ? ? ? ? ? ? WATSON-CRICK            ?     
? 
hydrog5  hydrog ? ? H DA  3   N1    ? ? ? 1_555 I DT 20 N3 ? ? G DA  6   H DT 23   1_555 ? ? ? ? ? ? WATSON-CRICK            ?     
? 
hydrog6  hydrog ? ? H DA  3   N6    ? ? ? 1_555 I DT 20 O4 ? ? G DA  6   H DT 23   1_555 ? ? ? ? ? ? WATSON-CRICK            ?     
? 
hydrog7  hydrog ? ? H DT  4   N3    ? ? ? 1_555 I DA 19 N1 ? ? G DT  7   H DA 22   1_555 ? ? ? ? ? ? WATSON-CRICK            ?     
? 
hydrog8  hydrog ? ? H DT  4   O4    ? ? ? 1_555 I DA 19 N6 ? ? G DT  7   H DA 22   1_555 ? ? ? ? ? ? WATSON-CRICK            ?     
? 
hydrog9  hydrog ? ? H DC  5   N3    ? ? ? 1_555 I DG 18 N1 ? ? G DC  8   H DG 21   1_555 ? ? ? ? ? ? WATSON-CRICK            ?     
? 
hydrog10 hydrog ? ? H DC  5   N4    ? ? ? 1_555 I DG 18 O6 ? ? G DC  8   H DG 21   1_555 ? ? ? ? ? ? WATSON-CRICK            ?     
? 
hydrog11 hydrog ? ? H DC  5   O2    ? ? ? 1_555 I DG 18 N2 ? ? G DC  8   H DG 21   1_555 ? ? ? ? ? ? WATSON-CRICK            ?     
? 
hydrog12 hydrog ? ? H DC  6   N3    ? ? ? 1_555 I DG 17 N2 ? ? G DC  9   H DG 20   1_555 ? ? ? ? ? ? 'REVERSED WATSON-CRICK' ?     
? 
hydrog13 hydrog ? ? H DC  6   O2    ? ? ? 1_555 I DG 17 N1 ? ? G DC  9   H DG 20   1_555 ? ? ? ? ? ? 'REVERSED WATSON-CRICK' ?     
? 
hydrog14 hydrog ? ? H DG  7   N1    ? ? ? 1_555 I DC 16 N3 ? ? G DG  10  H DC 19   1_555 ? ? ? ? ? ? WATSON-CRICK            ?     
? 
hydrog15 hydrog ? ? H DG  7   N2    ? ? ? 1_555 I DC 16 O2 ? ? G DG  10  H DC 19   1_555 ? ? ? ? ? ? WATSON-CRICK            ?     
? 
hydrog16 hydrog ? ? H DG  7   O6    ? ? ? 1_555 I DC 16 N4 ? ? G DG  10  H DC 19   1_555 ? ? ? ? ? ? WATSON-CRICK            ?     
? 
hydrog17 hydrog ? ? H DT  8   N3    ? ? ? 1_555 I DA 15 N1 ? ? G DT  11  H DA 18   1_555 ? ? ? ? ? ? WATSON-CRICK            ?     
? 
hydrog18 hydrog ? ? H DT  8   O4    ? ? ? 1_555 I DA 15 N6 ? ? G DT  11  H DA 18   1_555 ? ? ? ? ? ? WATSON-CRICK            ?     
? 
hydrog19 hydrog ? ? H DG  9   N2    ? ? ? 1_555 I DC 14 O2 ? ? G DG  12  H DC 17   1_555 ? ? ? ? ? ? 'DG-DC PAIR'            ?     
? 
hydrog20 hydrog ? ? H DA  10  N1    ? ? ? 1_555 I DT 13 N3 ? ? G DA  13  H DT 16   1_555 ? ? ? ? ? ? WATSON-CRICK            ?     
? 
hydrog21 hydrog ? ? H DA  10  N6    ? ? ? 1_555 I DT 13 O4 ? ? G DA  13  H DT 16   1_555 ? ? ? ? ? ? WATSON-CRICK            ?     
? 
hydrog22 hydrog ? ? G C   1   N3    ? ? ? 1_555 H DG 16 N1 ? ? I C   3   G DG 19   1_555 ? ? ? ? ? ? WATSON-CRICK            ?     
? 
hydrog23 hydrog ? ? G C   1   N4    ? ? ? 1_555 H DG 16 O6 ? ? I C   3   G DG 19   1_555 ? ? ? ? ? ? WATSON-CRICK            ?     
? 
hydrog24 hydrog ? ? G C   1   O2    ? ? ? 1_555 H DG 16 N2 ? ? I C   3   G DG 19   1_555 ? ? ? ? ? ? WATSON-CRICK            ?     
? 
hydrog25 hydrog ? ? G U   2   N3    ? ? ? 1_555 H DA 15 N1 ? ? I U   4   G DA 18   1_555 ? ? ? ? ? ? 'U-DA PAIR'             ?     
? 
hydrog26 hydrog ? ? G C   3   N3    ? ? ? 1_555 H DG 14 N1 ? ? I C   5   G DG 17   1_555 ? ? ? ? ? ? WATSON-CRICK            ?     
? 
hydrog27 hydrog ? ? G C   3   N4    ? ? ? 1_555 H DG 14 O6 ? ? I C   5   G DG 17   1_555 ? ? ? ? ? ? WATSON-CRICK            ?     
? 
hydrog28 hydrog ? ? G C   3   O2    ? ? ? 1_555 H DG 14 N2 ? ? I C   5   G DG 17   1_555 ? ? ? ? ? ? WATSON-CRICK            ?     
? 
hydrog29 hydrog ? ? G G   4   N1    ? ? ? 1_555 H DC 13 N3 ? ? I G   6   G DC 16   1_555 ? ? ? ? ? ? WATSON-CRICK            ?     
? 
hydrog30 hydrog ? ? G G   4   N2    ? ? ? 1_555 H DC 13 O2 ? ? I G   6   G DC 16   1_555 ? ? ? ? ? ? WATSON-CRICK            ?     
? 
hydrog31 hydrog ? ? G G   4   O6    ? ? ? 1_555 H DC 13 N4 ? ? I G   6   G DC 16   1_555 ? ? ? ? ? ? WATSON-CRICK            ?     
? 
hydrog32 hydrog ? ? G A   5   N1    ? ? ? 1_555 H DT 12 N3 ? ? I A   7   G DT 15   1_555 ? ? ? ? ? ? 'A-DT PAIR'             ?     
? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
metalc ? ? 
hydrog ? ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 GLU 36  A . ? GLU 24  A PRO 37  A ? PRO 25  A 1 0.22   
2 GLU 36  B . ? GLU 24  B PRO 37  B ? PRO 25  B 1 -10.26 
3 PRO 40  B . ? PRO 28  B GLY 41  B ? GLY 29  B 1 -1.29  
4 SER 94  C . ? SER 94  C PRO 95  C ? PRO 95  C 1 -4.50  
5 VAL 110 D . ? VAL 110 D PRO 111 D ? PRO 111 D 1 -3.56  
6 ALA 501 D . ? ALA 501 D PRO 502 D ? PRO 502 D 1 0.07   
7 ASN 37  E . ? ASN 37  E PRO 38  E ? PRO 38  E 1 -2.91  
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA1 ? 4 ? 
AA2 ? 4 ? 
AA3 ? 2 ? 
AA4 ? 2 ? 
AA5 ? 2 ? 
AA6 ? 4 ? 
AA7 ? 4 ? 
AA8 ? 2 ? 
AA9 ? 2 ? 
AB1 ? 2 ? 
AB2 ? 3 ? 
AB3 ? 4 ? 
AB4 ? 3 ? 
AB5 ? 4 ? 
AB6 ? 5 ? 
AB7 ? 2 ? 
AB8 ? 2 ? 
AB9 ? 3 ? 
AC1 ? 6 ? 
AC2 ? 3 ? 
AC3 ? 4 ? 
AC4 ? 2 ? 
AC5 ? 2 ? 
AC6 ? 8 ? 
AC7 ? 5 ? 
AC8 ? 3 ? 
AC9 ? 2 ? 
AD1 ? 2 ? 
AD2 ? 8 ? 
AD3 ? 2 ? 
AD4 ? 2 ? 
AD5 ? 3 ? 
AD6 ? 2 ? 
AD7 ? 3 ? 
AD8 ? 3 ? 
AD9 ? 3 ? 
AE1 ? 2 ? 
AE2 ? 3 ? 
AE3 ? 2 ? 
AE4 ? 2 ? 
AE5 ? 4 ? 
AE6 ? 2 ? 
AE7 ? 3 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA1 1 2 ? anti-parallel 
AA1 2 3 ? anti-parallel 
AA1 3 4 ? anti-parallel 
AA2 1 2 ? anti-parallel 
AA2 2 3 ? anti-parallel 
AA2 3 4 ? anti-parallel 
AA3 1 2 ? anti-parallel 
AA4 1 2 ? anti-parallel 
AA5 1 2 ? anti-parallel 
AA6 1 2 ? anti-parallel 
AA6 2 3 ? anti-parallel 
AA6 3 4 ? anti-parallel 
AA7 1 2 ? anti-parallel 
AA7 2 3 ? anti-parallel 
AA7 3 4 ? anti-parallel 
AA8 1 2 ? anti-parallel 
AA9 1 2 ? anti-parallel 
AB1 1 2 ? anti-parallel 
AB2 1 2 ? parallel      
AB2 2 3 ? parallel      
AB3 1 2 ? anti-parallel 
AB3 2 3 ? anti-parallel 
AB3 3 4 ? anti-parallel 
AB4 1 2 ? anti-parallel 
AB4 2 3 ? anti-parallel 
AB5 1 2 ? anti-parallel 
AB5 2 3 ? parallel      
AB5 3 4 ? anti-parallel 
AB6 1 2 ? anti-parallel 
AB6 2 3 ? anti-parallel 
AB6 3 4 ? anti-parallel 
AB6 4 5 ? anti-parallel 
AB7 1 2 ? anti-parallel 
AB8 1 2 ? anti-parallel 
AB9 1 2 ? anti-parallel 
AB9 2 3 ? anti-parallel 
AC1 1 2 ? anti-parallel 
AC1 2 3 ? anti-parallel 
AC1 3 4 ? parallel      
AC1 4 5 ? anti-parallel 
AC1 5 6 ? anti-parallel 
AC2 1 2 ? anti-parallel 
AC2 2 3 ? anti-parallel 
AC3 1 2 ? anti-parallel 
AC3 2 3 ? anti-parallel 
AC3 3 4 ? anti-parallel 
AC4 1 2 ? anti-parallel 
AC5 1 2 ? anti-parallel 
AC6 1 2 ? anti-parallel 
AC6 2 3 ? anti-parallel 
AC6 3 4 ? anti-parallel 
AC6 4 5 ? parallel      
AC6 5 6 ? anti-parallel 
AC6 6 7 ? parallel      
AC6 7 8 ? anti-parallel 
AC7 1 2 ? anti-parallel 
AC7 2 3 ? anti-parallel 
AC7 3 4 ? anti-parallel 
AC7 4 5 ? anti-parallel 
AC8 1 2 ? anti-parallel 
AC8 2 3 ? anti-parallel 
AC9 1 2 ? anti-parallel 
AD1 1 2 ? anti-parallel 
AD2 1 2 ? anti-parallel 
AD2 2 3 ? anti-parallel 
AD2 3 4 ? anti-parallel 
AD2 4 5 ? anti-parallel 
AD2 5 6 ? parallel      
AD2 6 7 ? anti-parallel 
AD2 7 8 ? parallel      
AD3 1 2 ? anti-parallel 
AD4 1 2 ? anti-parallel 
AD5 1 2 ? anti-parallel 
AD5 2 3 ? anti-parallel 
AD6 1 2 ? anti-parallel 
AD7 1 2 ? anti-parallel 
AD7 2 3 ? anti-parallel 
AD8 1 2 ? anti-parallel 
AD8 2 3 ? parallel      
AD9 1 2 ? parallel      
AD9 2 3 ? anti-parallel 
AE1 1 2 ? parallel      
AE2 1 2 ? anti-parallel 
AE2 2 3 ? anti-parallel 
AE3 1 2 ? anti-parallel 
AE4 1 2 ? anti-parallel 
AE5 1 2 ? anti-parallel 
AE5 2 3 ? anti-parallel 
AE5 3 4 ? anti-parallel 
AE6 1 2 ? anti-parallel 
AE7 1 2 ? anti-parallel 
AE7 2 3 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA1 1 THR A 20   ? THR A 27   ? THR A 8    THR A 15   
AA1 2 ARG A 30   ? LEU A 38   ? ARG A 18   LEU A 26   
AA1 3 ASP A 202  ? THR A 210  ? ASP A 190  THR A 198  
AA1 4 VAL A 183  ? ALA A 192  ? VAL A 171  ALA A 180  
AA2 1 VAL A 105  ? GLN A 112  ? VAL A 93   GLN A 100  
AA2 2 LYS A 145  ? ARG A 156  ? LYS A 133  ARG A 144  
AA2 3 PRO A 59   ? ILE A 68   ? PRO A 47   ILE A 56   
AA2 4 ILE A 174  ? PRO A 175  ? ILE A 162  PRO A 163  
AA3 1 VAL A 97   ? SER A 99   ? VAL A 85   SER A 87   
AA3 2 VAL A 128  ? VAL A 130  ? VAL A 116  VAL A 118  
AA4 1 GLY A 115  ? THR A 118  ? GLY A 103  THR A 106  
AA4 2 HIS A 136  ? LEU A 140  ? HIS A 124  LEU A 128  
AA5 1 TYR A 158  ? VAL A 159  ? TYR A 146  VAL A 147  
AA5 2 SER A 178  ? ILE A 179  ? SER A 166  ILE A 167  
AA6 1 THR B 20   ? THR B 27   ? THR B 8    THR B 15   
AA6 2 ARG B 30   ? LEU B 38   ? ARG B 18   LEU B 26   
AA6 3 PHE B 201  ? THR B 210  ? PHE B 189  THR B 198  
AA6 4 VAL B 183  ? THR B 193  ? VAL B 171  THR B 181  
AA7 1 VAL B 105  ? GLN B 112  ? VAL B 93   GLN B 100  
AA7 2 LYS B 145  ? ARG B 156  ? LYS B 133  ARG B 144  
AA7 3 PRO B 59   ? ILE B 68   ? PRO B 47   ILE B 56   
AA7 4 ARG B 173  ? PRO B 175  ? ARG B 161  PRO B 163  
AA8 1 VAL B 97   ? SER B 99   ? VAL B 85   SER B 87   
AA8 2 VAL B 128  ? VAL B 130  ? VAL B 116  VAL B 118  
AA9 1 GLY B 115  ? THR B 118  ? GLY B 103  THR B 106  
AA9 2 HIS B 136  ? LEU B 140  ? HIS B 124  LEU B 128  
AB1 1 TYR B 158  ? VAL B 159  ? TYR B 146  VAL B 147  
AB1 2 SER B 178  ? ILE B 179  ? SER B 166  ILE B 167  
AB2 1 VAL C 39   ? SER C 40   ? VAL C 39   SER C 40   
AB2 2 VAL C 972  ? SER C 973  ? VAL C 972  SER C 973  
AB2 3 VAL C 626  ? GLY C 627  ? VAL C 626  GLY C 627  
AB3 1 ILE C 96   ? GLU C 97   ? ILE C 96   GLU C 97   
AB3 2 MET C 103  ? PHE C 112  ? MET C 103  PHE C 112  
AB3 3 ALA C 130  ? ASN C 141  ? ALA C 130  ASN C 141  
AB3 4 SER C 149  ? PRO C 158  ? SER C 149  PRO C 158  
AB4 1 PHE C 166  ? ILE C 168  ? PHE C 166  ILE C 168  
AB4 2 THR C 171  ? VAL C 175  ? THR C 171  VAL C 175  
AB4 3 SER C 437  ? PHE C 439  ? SER C 437  PHE C 439  
AB5 1 ARG C 376  ? ARG C 379  ? ARG C 376  ARG C 379  
AB5 2 SER C 177  ? ARG C 181  ? SER C 177  ARG C 181  
AB5 3 ARG C 454  ? SER C 456  ? ARG C 454  SER C 456  
AB5 4 ILE C 497  ? SER C 499  ? ILE C 497  SER C 499  
AB6 1 GLY C 184  ? ILE C 191  ? GLY C 184  ILE C 191  
AB6 2 THR C 198  ? ILE C 205  ? THR C 198  ILE C 205  
AB6 3 LEU C 212  ? VAL C 216  ? LEU C 212  VAL C 216  
AB6 4 VAL C 222  ? ILE C 226  ? VAL C 222  ILE C 226  
AB6 5 ARG C 231  ? PRO C 233  ? ARG C 231  PRO C 233  
AB7 1 ARG C 208  ? GLY C 209  ? ARG C 208  GLY C 209  
AB7 2 TYR C 306  ? ASP C 307  ? TYR C 306  ASP C 307  
AB8 1 THR C 354  ? THR C 356  ? THR C 354  THR C 356  
AB8 2 GLU C 362  ? PRO C 364  ? GLU C 362  PRO C 364  
AB9 1 ARG C 505  ? VAL C 506  ? ARG C 505  VAL C 506  
AB9 2 ILE C 512  ? VAL C 519  ? ILE C 512  VAL C 519  
AB9 3 VAL C 524  ? LEU C 531  ? VAL C 524  LEU C 531  
AC1 1 ARG C 505  ? VAL C 506  ? ARG C 505  VAL C 506  
AC1 2 ILE C 512  ? VAL C 519  ? ILE C 512  VAL C 519  
AC1 3 TYR C 578  ? ASP C 580  ? TYR C 578  ASP C 580  
AC1 4 VAL C 541  ? ALA C 542  ? VAL C 541  ALA C 542  
AC1 5 VAL C 559  ? ARG C 563  ? VAL C 559  ARG C 563  
AC1 6 GLU C 567  ? VAL C 571  ? GLU C 567  VAL C 571  
AC2 1 VAL C 642  ? VAL C 643  ? VAL C 642  VAL C 643  
AC2 2 VAL C 701  ? ASP C 704  ? VAL C 701  ASP C 704  
AC2 3 CYS C 687  ? PRO C 688  ? CYS C 687  PRO C 688  
AC3 1 ARG C 667  ? ARG C 671  ? ARG C 667  ARG C 671  
AC3 2 TYR C 657  ? HIS C 662  ? TYR C 657  HIS C 662  
AC3 3 GLY C 648  ? VAL C 653  ? GLY C 648  VAL C 653  
AC3 4 ARG C 695  ? VAL C 696  ? ARG C 695  VAL C 696  
AC4 1 ALA C 676  ? ARG C 677  ? ALA C 676  ARG C 677  
AC4 2 CYS C 683  ? ALA C 684  ? CYS C 683  ALA C 684  
AC5 1 THR C 708  ? ASP C 709  ? THR C 708  ASP C 709  
AC5 2 GLU C 712  ? MET C 713  ? GLU C 712  MET C 713  
AC6 1 LYS C 1007 ? ALA C 1008 ? LYS C 1007 ALA C 1008 
AC6 2 VAL C 1023 ? LYS C 1032 ? VAL C 1023 LYS C 1032 
AC6 3 LYS C 884  ? ALA C 886  ? LYS C 884  ALA C 886  
AC6 4 LYS C 892  ? LEU C 899  ? LYS C 892  LEU C 899  
AC6 5 ILE C 735  ? SER C 738  ? ILE C 735  SER C 738  
AC6 6 ILE C 915  ? LEU C 917  ? ILE C 915  LEU C 917  
AC6 7 GLY C 716  ? ILE C 723  ? GLY C 716  ILE C 723  
AC6 8 VAL C 1023 ? LYS C 1032 ? VAL C 1023 LYS C 1032 
AC7 1 GLY C 765  ? ALA C 766  ? GLY C 765  ALA C 766  
AC7 2 SER C 749  ? THR C 762  ? SER C 749  THR C 762  
AC7 3 VAL C 865  ? ARG C 877  ? VAL C 865  ARG C 877  
AC7 4 GLY C 845  ? SER C 854  ? GLY C 845  SER C 854  
AC7 5 GLU C 795  ? VAL C 796  ? GLU C 795  VAL C 796  
AC8 1 GLU C 768  ? ILE C 769  ? GLU C 768  ILE C 769  
AC8 2 LYS C 805  ? PRO C 808  ? LYS C 805  PRO C 808  
AC8 3 VAL C 832  ? ASP C 834  ? VAL C 832  ASP C 834  
AC9 1 ILE C 801  ? VAL C 803  ? ILE C 801  VAL C 803  
AC9 2 LEU C 837  ? LYS C 838  ? LEU C 837  LYS C 838  
AD1 1 TRP C 944  ? LYS C 945  ? TRP C 944  LYS C 945  
AD1 2 GLU C 965  ? ALA C 966  ? GLU C 965  ALA C 966  
AD2 1 HIS C 1042 ? ARG C 1044 ? HIS C 1042 ARG C 1044 
AD2 2 SER D 425  ? VAL D 432  ? SER D 425  VAL D 432  
AD2 3 GLN D 540  ? HIS D 544  ? GLN D 540  HIS D 544  
AD2 4 VAL D 496  ? ASN D 499  ? VAL D 496  ASN D 499  
AD2 5 ILE D 509  ? VAL D 517  ? ILE D 509  VAL D 517  
AD2 6 GLN D 440  ? PRO D 444  ? GLN D 440  PRO D 444  
AD2 7 ILE D 522  ? LEU D 524  ? ILE D 522  LEU D 524  
AD2 8 SER D 425  ? VAL D 432  ? SER D 425  VAL D 432  
AD3 1 TYR C 1049 ? SER C 1050 ? TYR C 1049 SER C 1050 
AD3 2 SER F 102  ? THR F 103  ? SER F 102  THR F 103  
AD4 1 ARG C 1067 ? PHE C 1068 ? ARG C 1067 PHE C 1068 
AD4 2 LYS D 420  ? ARG D 421  ? LYS D 420  ARG D 421  
AD5 1 GLU C 1136 ? VAL C 1137 ? GLU C 1136 VAL C 1137 
AD5 2 GLU D 9    ? ARG D 11   ? GLU D 9    ARG D 11   
AD5 3 SER D 1242 ? LYS D 1244 ? SER D 1242 LYS D 1244 
AD6 1 GLY D 93   ? THR D 102  ? GLY D 93   THR D 102  
AD6 2 VAL D 313  ? VAL D 319  ? VAL D 313  VAL D 319  
AD7 1 LEU D 234  ? ILE D 235  ? LEU D 234  ILE D 235  
AD7 2 TYR D 134  ? VAL D 139  ? TYR D 134  VAL D 139  
AD7 3 PHE D 252  ? ALA D 255  ? PHE D 252  ALA D 255  
AD8 1 MET D 327  ? GLN D 329  ? MET D 327  GLN D 329  
AD8 2 PHE D 335  ? THR D 337  ? PHE D 335  THR D 337  
AD8 3 GLY F 91   ? SER F 92   ? GLY F 91   SER F 92   
AD9 1 VAL D 611  ? TYR D 612  ? VAL D 611  TYR D 612  
AD9 2 LYS D 634  ? LEU D 637  ? LYS D 634  LEU D 637  
AD9 3 TRP D 662  ? ALA D 664  ? TRP D 662  ALA D 664  
AE1 1 VAL D 886  ? GLU D 888  ? VAL D 886  GLU D 888  
AE1 2 VAL D 974  ? CYS D 975  ? VAL D 974  CYS D 975  
AE2 1 ILE D 897  ? GLU D 900  ? ILE D 897  GLU D 900  
AE2 2 GLN D 959  ? ARG D 963  ? GLN D 959  ARG D 963  
AE2 3 THR D 924  ? LEU D 925  ? THR D 924  LEU D 925  
AE3 1 ALA D 902  ? GLU D 903  ? ALA D 902  GLU D 903  
AE3 2 ILE D 911  ? ARG D 912  ? ILE D 911  ARG D 912  
AE4 1 ARG D 981  ? SER D 982  ? ARG D 981  SER D 982  
AE4 2 LYS D 987  ? LEU D 988  ? LYS D 987  LEU D 988  
AE5 1 VAL D 1075 ? VAL D 1076 ? VAL D 1075 VAL D 1076 
AE5 2 TYR D 1062 ? PRO D 1068 ? TYR D 1062 PRO D 1068 
AE5 3 GLY D 1051 ? ASP D 1057 ? GLY D 1051 ASP D 1057 
AE5 4 HIS D 1104 ? VAL D 1105 ? HIS D 1104 VAL D 1105 
AE6 1 ARG D 1087 ? VAL D 1088 ? ARG D 1087 VAL D 1088 
AE6 2 ARG D 1097 ? VAL D 1098 ? ARG D 1097 VAL D 1098 
AE7 1 LEU D 1180 ? ASP D 1182 ? LEU D 1180 ASP D 1182 
AE7 2 ARG D 1164 ? THR D 1166 ? ARG D 1164 THR D 1166 
AE7 3 ARG D 1204 ? PRO D 1205 ? ARG D 1204 PRO D 1205 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA1 1 2 N THR A 20   ? N THR A 8    O GLU A 36   ? O GLU A 24   
AA1 2 3 N PHE A 33   ? N PHE A 21   O LEU A 206  ? O LEU A 194  
AA1 3 4 O GLU A 209  ? O GLU A 197  N LEU A 184  ? N LEU A 172  
AA2 1 2 N MET A 107  ? N MET A 95   O LEU A 150  ? O LEU A 138  
AA2 2 3 O VAL A 151  ? O VAL A 139  N SER A 65   ? N SER A 53   
AA2 3 4 N ILE A 66   ? N ILE A 54   O ILE A 174  ? O ILE A 162  
AA3 1 2 N SER A 98   ? N SER A 86   O THR A 129  ? O THR A 117  
AA4 1 2 N GLY A 115  ? N GLY A 103  O LEU A 140  ? O LEU A 128  
AA5 1 2 N VAL A 159  ? N VAL A 147  O SER A 178  ? O SER A 166  
AA6 1 2 N THR B 20   ? N THR B 8    O GLU B 36   ? O GLU B 24   
AA6 2 3 N PHE B 33   ? N PHE B 21   O LEU B 206  ? O LEU B 194  
AA6 3 4 O PHE B 201  ? O PHE B 189  N THR B 193  ? N THR B 181  
AA7 1 2 N MET B 107  ? N MET B 95   O LEU B 150  ? O LEU B 138  
AA7 2 3 O VAL B 151  ? O VAL B 139  N THR B 64   ? N THR B 52   
AA7 3 4 N ILE B 66   ? N ILE B 54   O ILE B 174  ? O ILE B 162  
AA8 1 2 N SER B 98   ? N SER B 86   O THR B 129  ? O THR B 117  
AA9 1 2 N VAL B 117  ? N VAL B 105  O ALA B 138  ? O ALA B 126  
AB1 1 2 N VAL B 159  ? N VAL B 147  O SER B 178  ? O SER B 166  
AB2 1 2 N VAL C 39   ? N VAL C 39   O SER C 973  ? O SER C 973  
AB2 2 3 O VAL C 972  ? O VAL C 972  N GLY C 627  ? N GLY C 627  
AB3 1 2 N ILE C 96   ? N ILE C 96   O LEU C 105  ? O LEU C 105  
AB3 2 3 N ARG C 111  ? N ARG C 111  O PHE C 134  ? O PHE C 134  
AB3 3 4 N VAL C 135  ? N VAL C 135  O VAL C 152  ? O VAL C 152  
AB4 1 2 N PHE C 166  ? N PHE C 166  O ARG C 173  ? O ARG C 173  
AB4 2 3 N VAL C 174  ? N VAL C 174  O GLN C 438  ? O GLN C 438  
AB5 1 2 O ARG C 377  ? O ARG C 377  N VAL C 180  ? N VAL C 180  
AB5 2 3 N SER C 177  ? N SER C 177  O SER C 456  ? O SER C 456  
AB5 3 4 N LEU C 455  ? N LEU C 455  O GLY C 498  ? O GLY C 498  
AB6 1 2 N THR C 190  ? N THR C 190  O LEU C 199  ? O LEU C 199  
AB6 2 3 N VAL C 202  ? N VAL C 202  O PHE C 214  ? O PHE C 214  
AB6 3 4 N GLU C 213  ? N GLU C 213  O ARG C 225  ? O ARG C 225  
AB6 4 5 N VAL C 224  ? N VAL C 224  O GLN C 232  ? O GLN C 232  
AB7 1 2 N ARG C 208  ? N ARG C 208  O ASP C 307  ? O ASP C 307  
AB8 1 2 N MET C 355  ? N MET C 355  O VAL C 363  ? O VAL C 363  
AB9 1 2 N ARG C 505  ? N ARG C 505  O GLU C 513  ? O GLU C 513  
AB9 2 3 N LYS C 518  ? N LYS C 518  O GLU C 527  ? O GLU C 527  
AC1 1 2 N ARG C 505  ? N ARG C 505  O GLU C 513  ? O GLU C 513  
AC1 2 3 N ARG C 517  ? N ARG C 517  O MET C 579  ? O MET C 579  
AC1 3 4 O TYR C 578  ? O TYR C 578  N ALA C 542  ? N ALA C 542  
AC1 4 5 N VAL C 541  ? N VAL C 541  O ARG C 562  ? O ARG C 562  
AC1 5 6 N ARG C 563  ? N ARG C 563  O GLU C 567  ? O GLU C 567  
AC2 1 2 N VAL C 642  ? N VAL C 642  O ALA C 703  ? O ALA C 703  
AC2 2 3 O ASP C 704  ? O ASP C 704  N CYS C 687  ? N CYS C 687  
AC3 1 2 O TYR C 670  ? O TYR C 670  N ILE C 658  ? N ILE C 658  
AC3 2 3 O MET C 661  ? O MET C 661  N VAL C 649  ? N VAL C 649  
AC3 3 4 N GLY C 648  ? N GLY C 648  O VAL C 696  ? O VAL C 696  
AC4 1 2 N ALA C 676  ? N ALA C 676  O ALA C 684  ? O ALA C 684  
AC5 1 2 N ASP C 709  ? N ASP C 709  O GLU C 712  ? O GLU C 712  
AC6 1 2 N ALA C 1008 ? N ALA C 1008 O VAL C 1023 ? O VAL C 1023 
AC6 2 3 O MET C 1031 ? O MET C 1031 N ALA C 886  ? N ALA C 886  
AC6 3 4 N LEU C 885  ? N LEU C 885  O GLY C 893  ? O GLY C 893  
AC6 4 5 O GLY C 896  ? O GLY C 896  N ILE C 735  ? N ILE C 735  
AC6 5 6 N ILE C 736  ? N ILE C 736  O ILE C 916  ? O ILE C 916  
AC6 6 7 N ILE C 915  ? N ILE C 915  O LEU C 720  ? O LEU C 720  
AC6 7 8 N VAL C 721  ? N VAL C 721  O GLY C 1026 ? O GLY C 1026 
AC7 1 2 O GLY C 765  ? O GLY C 765  N THR C 762  ? N THR C 762  
AC7 2 3 N ALA C 759  ? N ALA C 759  O ASN C 866  ? O ASN C 866  
AC7 3 4 O LEU C 868  ? O LEU C 868  N PHE C 853  ? N PHE C 853  
AC7 4 5 O GLY C 845  ? O GLY C 845  N VAL C 796  ? N VAL C 796  
AC8 1 2 N GLU C 768  ? N GLU C 768  O VAL C 806  ? O VAL C 806  
AC8 2 3 N THR C 807  ? N THR C 807  O ARG C 833  ? O ARG C 833  
AC9 1 2 N LEU C 802  ? N LEU C 802  O LEU C 837  ? O LEU C 837  
AD1 1 2 N TRP C 944  ? N TRP C 944  O ALA C 966  ? O ALA C 966  
AD2 1 2 N HIS C 1042 ? N HIS C 1042 O ARG D 427  ? O ARG D 427  
AD2 2 3 N GLY D 426  ? N GLY D 426  O VAL D 543  ? O VAL D 543  
AD2 3 4 O ALA D 542  ? O ALA D 542  N ASN D 499  ? N ASN D 499  
AD2 4 5 N LEU D 498  ? N LEU D 498  O GLN D 510  ? O GLN D 510  
AD2 5 6 O MET D 515  ? O MET D 515  N CYS D 441  ? N CYS D 441  
AD2 6 7 N GLY D 442  ? N GLY D 442  O GLN D 523  ? O GLN D 523  
AD2 7 8 O ILE D 522  ? O ILE D 522  N VAL D 431  ? N VAL D 431  
AD3 1 2 N TYR C 1049 ? N TYR C 1049 O THR F 103  ? O THR F 103  
AD4 1 2 N PHE C 1068 ? N PHE C 1068 O LYS D 420  ? O LYS D 420  
AD5 1 2 N GLU C 1136 ? N GLU C 1136 O ARG D 11   ? O ARG D 11   
AD5 2 3 N LEU D 10   ? N LEU D 10   O ASP D 1243 ? O ASP D 1243 
AD6 1 2 N VAL D 101  ? N VAL D 101  O LEU D 314  ? O LEU D 314  
AD7 1 2 O ILE D 235  ? O ILE D 235  N TYR D 134  ? N TYR D 134  
AD7 2 3 N SER D 138  ? N SER D 138  O THR D 253  ? O THR D 253  
AD8 1 2 N VAL D 328  ? N VAL D 328  O ALA D 336  ? O ALA D 336  
AD8 2 3 N THR D 337  ? N THR D 337  O GLY F 91   ? O GLY F 91   
AD9 1 2 N TYR D 612  ? N TYR D 612  O LYS D 634  ? O LYS D 634  
AD9 2 3 N LEU D 637  ? N LEU D 637  O TRP D 662  ? O TRP D 662  
AE1 1 2 N ARG D 887  ? N ARG D 887  O VAL D 974  ? O VAL D 974  
AE2 1 2 N VAL D 899  ? N VAL D 899  O VAL D 960  ? O VAL D 960  
AE2 2 3 O ARG D 963  ? O ARG D 963  N THR D 924  ? N THR D 924  
AE3 1 2 N GLU D 903  ? N GLU D 903  O ILE D 911  ? O ILE D 911  
AE4 1 2 N SER D 982  ? N SER D 982  O LYS D 987  ? O LYS D 987  
AE5 1 2 O VAL D 1075 ? O VAL D 1075 N ILE D 1066 ? N ILE D 1066 
AE5 2 3 O THR D 1065 ? O THR D 1065 N ARG D 1054 ? N ARG D 1054 
AE5 3 4 N GLY D 1051 ? N GLY D 1051 O VAL D 1105 ? O VAL D 1105 
AE6 1 2 N VAL D 1088 ? N VAL D 1088 O ARG D 1097 ? O ARG D 1097 
AE7 1 2 O ILE D 1181 ? O ILE D 1181 N VAL D 1165 ? N VAL D 1165 
AE7 2 3 N THR D 1166 ? N THR D 1166 O ARG D 1204 ? O ARG D 1204 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software D MG 1401 ? 4 'binding site for residue MG D 1401' 
AC2 Software D ZN 1402 ? 4 'binding site for residue ZN D 1402' 
AC3 Software D ZN 1403 ? 4 'binding site for residue ZN D 1403' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 4 ASP D 535 ? ASP D 535 . ? 1_555 ? 
2  AC1 4 ASP D 537 ? ASP D 537 . ? 1_555 ? 
3  AC1 4 ASP D 539 ? ASP D 539 . ? 1_555 ? 
4  AC1 4 A   G 5   ? A   I 7   . ? 1_555 ? 
5  AC2 4 CYS D 891 ? CYS D 891 . ? 1_555 ? 
6  AC2 4 CYS D 968 ? CYS D 968 . ? 1_555 ? 
7  AC2 4 CYS D 975 ? CYS D 975 . ? 1_555 ? 
8  AC2 4 CYS D 978 ? CYS D 978 . ? 1_555 ? 
9  AC3 4 CYS D 60  ? CYS D 60  . ? 1_555 ? 
10 AC3 4 CYS D 62  ? CYS D 62  . ? 1_555 ? 
11 AC3 4 CYS D 75  ? CYS D 75  . ? 1_555 ? 
12 AC3 4 CYS D 78  ? CYS D 78  . ? 1_555 ? 
# 
_atom_sites.entry_id                    6DV9 
_atom_sites.fract_transf_matrix[1][1]   0.006980 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.006194 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.004207 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
MG 
N  
O  
P  
S  
ZN 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1     N  N     . LEU A 1  14   ? -30.824 -8.887  44.198   1.00 172.01 ? 2    LEU A N     1 
ATOM   2     C  CA    . LEU A 1  14   ? -30.200 -9.240  42.928   1.00 197.23 ? 2    LEU A CA    1 
ATOM   3     C  C     . LEU A 1  14   ? -28.926 -10.052 43.144   1.00 190.47 ? 2    LEU A C     1 
ATOM   4     O  O     . LEU A 1  14   ? -27.838 -9.495  43.287   1.00 171.10 ? 2    LEU A O     1 
ATOM   5     C  CB    . LEU A 1  14   ? -29.898 -7.979  42.110   1.00 178.54 ? 2    LEU A CB    1 
ATOM   6     C  CG    . LEU A 1  14   ? -29.895 -6.627  42.833   1.00 140.55 ? 2    LEU A CG    1 
ATOM   7     C  CD1   . LEU A 1  14   ? -28.656 -6.449  43.702   1.00 132.49 ? 2    LEU A CD1   1 
ATOM   8     C  CD2   . LEU A 1  14   ? -30.017 -5.489  41.831   1.00 98.79  ? 2    LEU A CD2   1 
ATOM   9     N  N     . ILE A 1  15   ? -29.066 -11.379 43.163   1.00 196.82 ? 3    ILE A N     1 
ATOM   10    C  CA    . ILE A 1  15   ? -27.951 -12.281 43.418   1.00 189.71 ? 3    ILE A CA    1 
ATOM   11    C  C     . ILE A 1  15   ? -28.060 -13.480 42.482   1.00 181.70 ? 3    ILE A C     1 
ATOM   12    O  O     . ILE A 1  15   ? -29.064 -13.676 41.794   1.00 158.35 ? 3    ILE A O     1 
ATOM   13    C  CB    . ILE A 1  15   ? -27.896 -12.730 44.896   1.00 186.42 ? 3    ILE A CB    1 
ATOM   14    C  CG1   . ILE A 1  15   ? -26.443 -12.926 45.338   1.00 153.22 ? 3    ILE A CG1   1 
ATOM   15    C  CG2   . ILE A 1  15   ? -28.734 -13.988 45.118   1.00 181.45 ? 3    ILE A CG2   1 
ATOM   16    C  CD1   . ILE A 1  15   ? -25.567 -11.704 45.112   1.00 134.38 ? 3    ILE A CD1   1 
ATOM   17    N  N     . SER A 1  16   ? -27.002 -14.289 42.468   1.00 183.28 ? 4    SER A N     1 
ATOM   18    C  CA    . SER A 1  16   ? -26.847 -15.325 41.456   1.00 175.54 ? 4    SER A CA    1 
ATOM   19    C  C     . SER A 1  16   ? -27.802 -16.492 41.676   1.00 159.35 ? 4    SER A C     1 
ATOM   20    O  O     . SER A 1  16   ? -28.034 -16.930 42.807   1.00 152.93 ? 4    SER A O     1 
ATOM   21    C  CB    . SER A 1  16   ? -25.410 -15.844 41.451   1.00 175.91 ? 4    SER A CB    1 
ATOM   22    O  OG    . SER A 1  16   ? -25.117 -16.550 42.645   1.00 150.69 ? 4    SER A OG    1 
ATOM   23    N  N     . GLN A 1  17   ? -28.355 -16.990 40.574   1.00 150.23 ? 5    GLN A N     1 
ATOM   24    C  CA    . GLN A 1  17   ? -28.957 -18.314 40.502   1.00 152.92 ? 5    GLN A CA    1 
ATOM   25    C  C     . GLN A 1  17   ? -28.316 -19.029 39.324   1.00 147.51 ? 5    GLN A C     1 
ATOM   26    O  O     . GLN A 1  17   ? -28.279 -18.484 38.216   1.00 138.19 ? 5    GLN A O     1 
ATOM   27    C  CB    . GLN A 1  17   ? -30.478 -18.251 40.328   1.00 144.19 ? 5    GLN A CB    1 
ATOM   28    C  CG    . GLN A 1  17   ? -31.119 -19.624 40.168   1.00 126.90 ? 5    GLN A CG    1 
ATOM   29    C  CD    . GLN A 1  17   ? -32.572 -19.557 39.745   1.00 127.08 ? 5    GLN A CD    1 
ATOM   30    O  OE1   . GLN A 1  17   ? -32.932 -18.818 38.828   1.00 140.30 ? 5    GLN A OE1   1 
ATOM   31    N  NE2   . GLN A 1  17   ? -33.418 -20.332 40.413   1.00 123.67 ? 5    GLN A NE2   1 
ATOM   32    N  N     . ARG A 1  18   ? -27.801 -20.230 39.563   1.00 148.65 ? 6    ARG A N     1 
ATOM   33    C  CA    . ARG A 1  18   ? -27.011 -20.904 38.543   1.00 138.79 ? 6    ARG A CA    1 
ATOM   34    C  C     . ARG A 1  18   ? -27.862 -21.196 37.309   1.00 132.22 ? 6    ARG A C     1 
ATOM   35    O  O     . ARG A 1  18   ? -29.006 -21.648 37.435   1.00 124.69 ? 6    ARG A O     1 
ATOM   36    C  CB    . ARG A 1  18   ? -26.411 -22.196 39.096   1.00 118.79 ? 6    ARG A CB    1 
ATOM   37    C  CG    . ARG A 1  18   ? -25.143 -21.966 39.897   1.00 114.27 ? 6    ARG A CG    1 
ATOM   38    C  CD    . ARG A 1  18   ? -24.460 -23.266 40.271   1.00 153.37 ? 6    ARG A CD    1 
ATOM   39    N  NE    . ARG A 1  18   ? -23.027 -23.064 40.454   1.00 193.96 ? 6    ARG A NE    1 
ATOM   40    C  CZ    . ARG A 1  18   ? -22.210 -23.947 41.017   1.00 195.68 ? 6    ARG A CZ    1 
ATOM   41    N  NH1   . ARG A 1  18   ? -20.918 -23.672 41.135   1.00 183.52 ? 6    ARG A NH1   1 
ATOM   42    N  NH2   . ARG A 1  18   ? -22.683 -25.100 41.468   1.00 186.74 ? 6    ARG A NH2   1 
ATOM   43    N  N     . PRO A 1  19   ? -27.344 -20.941 36.108   1.00 110.16 ? 7    PRO A N     1 
ATOM   44    C  CA    . PRO A 1  19   ? -28.140 -21.172 34.899   1.00 91.79  ? 7    PRO A CA    1 
ATOM   45    C  C     . PRO A 1  19   ? -28.339 -22.653 34.622   1.00 83.80  ? 7    PRO A C     1 
ATOM   46    O  O     . PRO A 1  19   ? -27.507 -23.495 34.970   1.00 80.46  ? 7    PRO A O     1 
ATOM   47    C  CB    . PRO A 1  19   ? -27.309 -20.509 33.795   1.00 86.82  ? 7    PRO A CB    1 
ATOM   48    C  CG    . PRO A 1  19   ? -25.912 -20.526 34.319   1.00 87.28  ? 7    PRO A CG    1 
ATOM   49    C  CD    . PRO A 1  19   ? -26.031 -20.347 35.805   1.00 89.50  ? 7    PRO A CD    1 
ATOM   50    N  N     . THR A 1  20   ? -29.468 -22.964 33.986   1.00 85.08  ? 8    THR A N     1 
ATOM   51    C  CA    . THR A 1  20   ? -29.809 -24.332 33.627   1.00 94.71  ? 8    THR A CA    1 
ATOM   52    C  C     . THR A 1  20   ? -30.133 -24.407 32.142   1.00 93.42  ? 8    THR A C     1 
ATOM   53    O  O     . THR A 1  20   ? -30.648 -23.455 31.548   1.00 86.52  ? 8    THR A O     1 
ATOM   54    C  CB    . THR A 1  20   ? -30.995 -24.866 34.456   1.00 90.80  ? 8    THR A CB    1 
ATOM   55    O  OG1   . THR A 1  20   ? -31.199 -26.254 34.162   1.00 107.16 ? 8    THR A OG1   1 
ATOM   56    C  CG2   . THR A 1  20   ? -32.272 -24.094 34.147   1.00 68.56  ? 8    THR A CG2   1 
ATOM   57    N  N     . LEU A 1  21   ? -29.809 -25.552 31.549   1.00 103.03 ? 9    LEU A N     1 
ATOM   58    C  CA    . LEU A 1  21   ? -30.018 -25.811 30.131   1.00 88.18  ? 9    LEU A CA    1 
ATOM   59    C  C     . LEU A 1  21   ? -30.904 -27.039 29.995   1.00 95.45  ? 9    LEU A C     1 
ATOM   60    O  O     . LEU A 1  21   ? -30.575 -28.107 30.524   1.00 110.05 ? 9    LEU A O     1 
ATOM   61    C  CB    . LEU A 1  21   ? -28.681 -26.011 29.411   1.00 84.82  ? 9    LEU A CB    1 
ATOM   62    C  CG    . LEU A 1  21   ? -28.595 -26.940 28.195   1.00 83.31  ? 9    LEU A CG    1 
ATOM   63    C  CD1   . LEU A 1  21   ? -29.413 -26.426 27.020   1.00 88.93  ? 9    LEU A CD1   1 
ATOM   64    C  CD2   . LEU A 1  21   ? -27.142 -27.141 27.787   1.00 74.41  ? 9    LEU A CD2   1 
ATOM   65    N  N     . SER A 1  22   ? -32.026 -26.884 29.296   1.00 84.52  ? 10   SER A N     1 
ATOM   66    C  CA    . SER A 1  22   ? -32.990 -27.959 29.115   1.00 98.90  ? 10   SER A CA    1 
ATOM   67    C  C     . SER A 1  22   ? -33.341 -28.073 27.639   1.00 88.09  ? 10   SER A C     1 
ATOM   68    O  O     . SER A 1  22   ? -33.620 -27.063 26.983   1.00 85.01  ? 10   SER A O     1 
ATOM   69    C  CB    . SER A 1  22   ? -34.248 -27.720 29.958   1.00 124.79 ? 10   SER A CB    1 
ATOM   70    O  OG    . SER A 1  22   ? -34.742 -26.407 29.774   1.00 108.66 ? 10   SER A OG    1 
ATOM   71    N  N     . GLU A 1  23   ? -33.326 -29.303 27.130   1.00 93.19  ? 11   GLU A N     1 
ATOM   72    C  CA    . GLU A 1  23   ? -33.507 -29.575 25.711   1.00 106.73 ? 11   GLU A CA    1 
ATOM   73    C  C     . GLU A 1  23   ? -34.983 -29.675 25.350   1.00 103.38 ? 11   GLU A C     1 
ATOM   74    O  O     . GLU A 1  23   ? -35.781 -30.254 26.092   1.00 114.79 ? 11   GLU A O     1 
ATOM   75    C  CB    . GLU A 1  23   ? -32.796 -30.875 25.327   1.00 115.91 ? 11   GLU A CB    1 
ATOM   76    C  CG    . GLU A 1  23   ? -32.897 -31.238 23.850   1.00 94.10  ? 11   GLU A CG    1 
ATOM   77    C  CD    . GLU A 1  23   ? -32.245 -32.569 23.529   1.00 94.55  ? 11   GLU A CD    1 
ATOM   78    O  OE1   . GLU A 1  23   ? -32.121 -32.898 22.330   1.00 84.54  ? 11   GLU A OE1   1 
ATOM   79    O  OE2   . GLU A 1  23   ? -31.856 -33.285 24.475   1.00 113.63 ? 11   GLU A OE2   1 
ATOM   80    N  N     . ASP A 1  24   ? -35.332 -29.108 24.199   1.00 107.03 ? 12   ASP A N     1 
ATOM   81    C  CA    . ASP A 1  24   ? -36.646 -29.260 23.587   1.00 103.38 ? 12   ASP A CA    1 
ATOM   82    C  C     . ASP A 1  24   ? -36.462 -29.833 22.190   1.00 105.97 ? 12   ASP A C     1 
ATOM   83    O  O     . ASP A 1  24   ? -35.611 -29.357 21.432   1.00 113.58 ? 12   ASP A O     1 
ATOM   84    C  CB    . ASP A 1  24   ? -37.386 -27.922 23.513   1.00 103.75 ? 12   ASP A CB    1 
ATOM   85    C  CG    . ASP A 1  24   ? -37.840 -27.428 24.870   1.00 149.15 ? 12   ASP A CG    1 
ATOM   86    O  OD1   . ASP A 1  24   ? -37.564 -28.109 25.878   1.00 148.95 ? 12   ASP A OD1   1 
ATOM   87    O  OD2   . ASP A 1  24   ? -38.480 -26.357 24.925   1.00 158.40 ? 12   ASP A OD2   1 
ATOM   88    N  N     . VAL A 1  25   ? -37.255 -30.846 21.850   1.00 104.89 ? 13   VAL A N     1 
ATOM   89    C  CA    . VAL A 1  25   ? -37.159 -31.520 20.559   1.00 101.25 ? 13   VAL A CA    1 
ATOM   90    C  C     . VAL A 1  25   ? -38.297 -31.059 19.661   1.00 100.05 ? 13   VAL A C     1 
ATOM   91    O  O     . VAL A 1  25   ? -39.447 -30.931 20.103   1.00 106.30 ? 13   VAL A O     1 
ATOM   92    C  CB    . VAL A 1  25   ? -37.169 -33.053 20.724   1.00 80.34  ? 13   VAL A CB    1 
ATOM   93    C  CG1   . VAL A 1  25   ? -35.876 -33.524 21.369   1.00 77.84  ? 13   VAL A CG1   1 
ATOM   94    C  CG2   . VAL A 1  25   ? -38.371 -33.499 21.548   1.00 96.07  ? 13   VAL A CG2   1 
ATOM   95    N  N     . LEU A 1  26   ? -37.974 -30.795 18.396   1.00 82.52  ? 14   LEU A N     1 
ATOM   96    C  CA    . LEU A 1  26   ? -38.961 -30.464 17.376   1.00 91.27  ? 14   LEU A CA    1 
ATOM   97    C  C     . LEU A 1  26   ? -39.135 -31.586 16.365   1.00 108.28 ? 14   LEU A C     1 
ATOM   98    O  O     . LEU A 1  26   ? -40.261 -32.024 16.109   1.00 116.17 ? 14   LEU A O     1 
ATOM   99    C  CB    . LEU A 1  26   ? -38.569 -29.163 16.655   1.00 107.48 ? 14   LEU A CB    1 
ATOM   100   C  CG    . LEU A 1  26   ? -38.263 -27.923 17.502   1.00 110.80 ? 14   LEU A CG    1 
ATOM   101   C  CD1   . LEU A 1  26   ? -38.297 -26.672 16.635   1.00 111.75 ? 14   LEU A CD1   1 
ATOM   102   C  CD2   . LEU A 1  26   ? -39.216 -27.783 18.684   1.00 142.27 ? 14   LEU A CD2   1 
ATOM   103   N  N     . THR A 1  27   ? -38.037 -32.064 15.782   1.00 103.40 ? 15   THR A N     1 
ATOM   104   C  CA    . THR A 1  27   ? -38.034 -33.248 14.931   1.00 99.39  ? 15   THR A CA    1 
ATOM   105   C  C     . THR A 1  27   ? -36.816 -34.088 15.307   1.00 91.31  ? 15   THR A C     1 
ATOM   106   O  O     . THR A 1  27   ? -36.115 -33.798 16.281   1.00 81.58  ? 15   THR A O     1 
ATOM   107   C  CB    . THR A 1  27   ? -38.039 -32.867 13.444   1.00 114.58 ? 15   THR A CB    1 
ATOM   108   O  OG1   . THR A 1  27   ? -37.068 -31.840 13.205   1.00 125.24 ? 15   THR A OG1   1 
ATOM   109   C  CG2   . THR A 1  27   ? -39.416 -32.377 13.016   1.00 113.53 ? 15   THR A CG2   1 
ATOM   110   N  N     . ASP A 1  28   ? -36.557 -35.139 14.526   1.00 95.14  ? 16   ASP A N     1 
ATOM   111   C  CA    . ASP A 1  28   ? -35.432 -36.022 14.813   1.00 112.04 ? 16   ASP A CA    1 
ATOM   112   C  C     . ASP A 1  28   ? -34.080 -35.398 14.493   1.00 102.25 ? 16   ASP A C     1 
ATOM   113   O  O     . ASP A 1  28   ? -33.053 -35.974 14.868   1.00 100.83 ? 16   ASP A O     1 
ATOM   114   C  CB    . ASP A 1  28   ? -35.579 -37.337 14.045   1.00 121.33 ? 16   ASP A CB    1 
ATOM   115   C  CG    . ASP A 1  28   ? -36.376 -38.373 14.812   1.00 133.41 ? 16   ASP A CG    1 
ATOM   116   O  OD1   . ASP A 1  28   ? -36.852 -38.054 15.922   1.00 139.68 ? 16   ASP A OD1   1 
ATOM   117   O  OD2   . ASP A 1  28   ? -36.521 -39.507 14.309   1.00 147.23 ? 16   ASP A OD2   1 
ATOM   118   N  N     . ASN A 1  29   ? -34.047 -34.248 13.815   1.00 96.89  ? 17   ASN A N     1 
ATOM   119   C  CA    . ASN A 1  29   ? -32.782 -33.592 13.506   1.00 102.07 ? 17   ASN A CA    1 
ATOM   120   C  C     . ASN A 1  29   ? -32.859 -32.087 13.737   1.00 101.76 ? 17   ASN A C     1 
ATOM   121   O  O     . ASN A 1  29   ? -32.181 -31.314 13.051   1.00 105.85 ? 17   ASN A O     1 
ATOM   122   C  CB    . ASN A 1  29   ? -32.347 -33.887 12.067   1.00 112.33 ? 17   ASN A CB    1 
ATOM   123   C  CG    . ASN A 1  29   ? -33.475 -33.718 11.070   1.00 122.59 ? 17   ASN A CG    1 
ATOM   124   O  OD1   . ASN A 1  29   ? -34.410 -32.951 11.296   1.00 112.44 ? 17   ASN A OD1   1 
ATOM   125   N  ND2   . ASN A 1  29   ? -33.396 -34.443 9.960    1.00 134.32 ? 17   ASN A ND2   1 
ATOM   126   N  N     . ARG A 1  30   ? -33.678 -31.657 14.696   1.00 89.21  ? 18   ARG A N     1 
ATOM   127   C  CA    . ARG A 1  30   ? -33.782 -30.249 15.063   1.00 78.09  ? 18   ARG A CA    1 
ATOM   128   C  C     . ARG A 1  30   ? -34.262 -30.158 16.501   1.00 91.06  ? 18   ARG A C     1 
ATOM   129   O  O     . ARG A 1  30   ? -35.285 -30.753 16.854   1.00 93.83  ? 18   ARG A O     1 
ATOM   130   C  CB    . ARG A 1  30   ? -34.735 -29.492 14.129   1.00 92.31  ? 18   ARG A CB    1 
ATOM   131   C  CG    . ARG A 1  30   ? -34.950 -28.029 14.505   1.00 81.57  ? 18   ARG A CG    1 
ATOM   132   C  CD    . ARG A 1  30   ? -34.843 -27.116 13.289   1.00 99.95  ? 18   ARG A CD    1 
ATOM   133   N  NE    . ARG A 1  30   ? -35.266 -25.748 13.579   1.00 94.19  ? 18   ARG A NE    1 
ATOM   134   C  CZ    . ARG A 1  30   ? -36.396 -25.204 13.135   1.00 93.09  ? 18   ARG A CZ    1 
ATOM   135   N  NH1   . ARG A 1  30   ? -37.218 -25.909 12.370   1.00 92.75  ? 18   ARG A NH1   1 
ATOM   136   N  NH2   . ARG A 1  30   ? -36.701 -23.952 13.449   1.00 95.85  ? 18   ARG A NH2   1 
ATOM   137   N  N     . SER A 1  31   ? -33.526 -29.417 17.324   1.00 101.68 ? 19   SER A N     1 
ATOM   138   C  CA    . SER A 1  31   ? -33.854 -29.281 18.734   1.00 94.99  ? 19   SER A CA    1 
ATOM   139   C  C     . SER A 1  31   ? -33.587 -27.855 19.187   1.00 92.13  ? 19   SER A C     1 
ATOM   140   O  O     . SER A 1  31   ? -32.633 -27.217 18.731   1.00 103.06 ? 19   SER A O     1 
ATOM   141   C  CB    . SER A 1  31   ? -33.046 -30.261 19.596   1.00 76.64  ? 19   SER A CB    1 
ATOM   142   O  OG    . SER A 1  31   ? -33.369 -31.604 19.281   1.00 100.35 ? 19   SER A OG    1 
ATOM   143   N  N     . GLN A 1  32   ? -34.437 -27.361 20.080   1.00 87.44  ? 20   GLN A N     1 
ATOM   144   C  CA    . GLN A 1  32   ? -34.239 -26.070 20.719   1.00 75.43  ? 20   GLN A CA    1 
ATOM   145   C  C     . GLN A 1  32   ? -33.688 -26.272 22.124   1.00 85.27  ? 20   GLN A C     1 
ATOM   146   O  O     . GLN A 1  32   ? -34.081 -27.206 22.828   1.00 110.54 ? 20   GLN A O     1 
ATOM   147   C  CB    . GLN A 1  32   ? -35.543 -25.272 20.778   1.00 70.90  ? 20   GLN A CB    1 
ATOM   148   C  CG    . GLN A 1  32   ? -36.084 -24.865 19.417   1.00 89.00  ? 20   GLN A CG    1 
ATOM   149   C  CD    . GLN A 1  32   ? -37.228 -23.872 19.517   1.00 102.16 ? 20   GLN A CD    1 
ATOM   150   O  OE1   . GLN A 1  32   ? -37.571 -23.412 20.606   1.00 95.70  ? 20   GLN A OE1   1 
ATOM   151   N  NE2   . GLN A 1  32   ? -37.822 -23.535 18.377   1.00 107.85 ? 20   GLN A NE2   1 
ATOM   152   N  N     . PHE A 1  33   ? -32.772 -25.391 22.522   1.00 76.79  ? 21   PHE A N     1 
ATOM   153   C  CA    . PHE A 1  33   ? -32.145 -25.435 23.837   1.00 70.27  ? 21   PHE A CA    1 
ATOM   154   C  C     . PHE A 1  33   ? -32.352 -24.089 24.515   1.00 86.90  ? 21   PHE A C     1 
ATOM   155   O  O     . PHE A 1  33   ? -31.977 -23.049 23.962   1.00 102.69 ? 21   PHE A O     1 
ATOM   156   C  CB    . PHE A 1  33   ? -30.650 -25.755 23.731   1.00 64.76  ? 21   PHE A CB    1 
ATOM   157   C  CG    . PHE A 1  33   ? -30.353 -27.081 23.083   1.00 61.54  ? 21   PHE A CG    1 
ATOM   158   C  CD1   . PHE A 1  33   ? -30.289 -27.195 21.704   1.00 75.03  ? 21   PHE A CD1   1 
ATOM   159   C  CD2   . PHE A 1  33   ? -30.125 -28.211 23.853   1.00 70.44  ? 21   PHE A CD2   1 
ATOM   160   C  CE1   . PHE A 1  33   ? -30.015 -28.411 21.103   1.00 86.07  ? 21   PHE A CE1   1 
ATOM   161   C  CE2   . PHE A 1  33   ? -29.847 -29.430 23.257   1.00 81.58  ? 21   PHE A CE2   1 
ATOM   162   C  CZ    . PHE A 1  33   ? -29.793 -29.529 21.881   1.00 83.38  ? 21   PHE A CZ    1 
ATOM   163   N  N     . VAL A 1  34   ? -32.946 -24.108 25.708   1.00 79.67  ? 22   VAL A N     1 
ATOM   164   C  CA    . VAL A 1  34   ? -33.160 -22.907 26.508   1.00 78.64  ? 22   VAL A CA    1 
ATOM   165   C  C     . VAL A 1  34   ? -32.156 -22.899 27.655   1.00 80.94  ? 22   VAL A C     1 
ATOM   166   O  O     . VAL A 1  34   ? -31.999 -23.900 28.367   1.00 93.96  ? 22   VAL A O     1 
ATOM   167   C  CB    . VAL A 1  34   ? -34.605 -22.829 27.031   1.00 85.71  ? 22   VAL A CB    1 
ATOM   168   C  CG1   . VAL A 1  34   ? -35.547 -22.398 25.918   1.00 83.27  ? 22   VAL A CG1   1 
ATOM   169   C  CG2   . VAL A 1  34   ? -35.040 -24.168 27.586   1.00 85.88  ? 22   VAL A CG2   1 
ATOM   170   N  N     . ILE A 1  35   ? -31.464 -21.773 27.820   1.00 68.23  ? 23   ILE A N     1 
ATOM   171   C  CA    . ILE A 1  35   ? -30.460 -21.581 28.861   1.00 85.49  ? 23   ILE A CA    1 
ATOM   172   C  C     . ILE A 1  35   ? -30.852 -20.347 29.656   1.00 101.07 ? 23   ILE A C     1 
ATOM   173   O  O     . ILE A 1  35   ? -31.070 -19.275 29.078   1.00 97.24  ? 23   ILE A O     1 
ATOM   174   C  CB    . ILE A 1  35   ? -29.045 -21.424 28.272   1.00 73.75  ? 23   ILE A CB    1 
ATOM   175   C  CG1   . ILE A 1  35   ? -28.610 -22.708 27.558   1.00 59.01  ? 23   ILE A CG1   1 
ATOM   176   C  CG2   . ILE A 1  35   ? -28.045 -21.031 29.358   1.00 79.17  ? 23   ILE A CG2   1 
ATOM   177   C  CD1   . ILE A 1  35   ? -27.197 -22.647 26.994   1.00 56.02  ? 23   ILE A CD1   1 
ATOM   178   N  N     . GLU A 1  36   ? -30.935 -20.495 30.976   1.00 101.69 ? 24   GLU A N     1 
ATOM   179   C  CA    . GLU A 1  36   ? -31.435 -19.428 31.827   1.00 85.54  ? 24   GLU A CA    1 
ATOM   180   C  C     . GLU A 1  36   ? -31.054 -19.746 33.261   1.00 76.62  ? 24   GLU A C     1 
ATOM   181   O  O     . GLU A 1  36   ? -30.948 -20.926 33.619   1.00 84.99  ? 24   GLU A O     1 
ATOM   182   C  CB    . GLU A 1  36   ? -32.961 -19.291 31.694   1.00 81.38  ? 24   GLU A CB    1 
ATOM   183   C  CG    . GLU A 1  36   ? -33.740 -20.546 32.064   1.00 94.93  ? 24   GLU A CG    1 
ATOM   184   C  CD    . GLU A 1  36   ? -35.235 -20.353 31.916   1.00 119.12 ? 24   GLU A CD    1 
ATOM   185   O  OE1   . GLU A 1  36   ? -35.648 -19.211 31.626   1.00 92.96  ? 24   GLU A OE1   1 
ATOM   186   O  OE2   . GLU A 1  36   ? -35.994 -21.331 32.087   1.00 166.31 ? 24   GLU A OE2   1 
ATOM   187   N  N     . PRO A 1  37   ? -30.862 -18.728 34.114   1.00 80.42  ? 25   PRO A N     1 
ATOM   188   C  CA    . PRO A 1  37   ? -30.997 -17.314 33.768   1.00 71.54  ? 25   PRO A CA    1 
ATOM   189   C  C     . PRO A 1  37   ? -29.664 -16.617 33.521   1.00 92.39  ? 25   PRO A C     1 
ATOM   190   O  O     . PRO A 1  37   ? -28.818 -16.545 34.413   1.00 118.44 ? 25   PRO A O     1 
ATOM   191   C  CB    . PRO A 1  37   ? -31.693 -16.735 34.997   1.00 107.23 ? 25   PRO A CB    1 
ATOM   192   C  CG    . PRO A 1  37   ? -31.177 -17.564 36.125   1.00 135.99 ? 25   PRO A CG    1 
ATOM   193   C  CD    . PRO A 1  37   ? -30.831 -18.929 35.573   1.00 113.12 ? 25   PRO A CD    1 
ATOM   194   N  N     . LEU A 1  38   ? -29.486 -16.109 32.311   1.00 75.57  ? 26   LEU A N     1 
ATOM   195   C  CA    . LEU A 1  38   ? -28.273 -15.394 31.960   1.00 85.98  ? 26   LEU A CA    1 
ATOM   196   C  C     . LEU A 1  38   ? -28.399 -13.917 32.312   1.00 103.23 ? 26   LEU A C     1 
ATOM   197   O  O     . LEU A 1  38   ? -29.497 -13.367 32.427   1.00 102.43 ? 26   LEU A O     1 
ATOM   198   C  CB    . LEU A 1  38   ? -27.965 -15.555 30.473   1.00 95.20  ? 26   LEU A CB    1 
ATOM   199   C  CG    . LEU A 1  38   ? -27.671 -16.994 30.067   1.00 101.19 ? 26   LEU A CG    1 
ATOM   200   C  CD1   . LEU A 1  38   ? -27.524 -17.081 28.567   1.00 111.10 ? 26   LEU A CD1   1 
ATOM   201   C  CD2   . LEU A 1  38   ? -26.418 -17.500 30.766   1.00 87.06  ? 26   LEU A CD2   1 
ATOM   202   N  N     . GLU A 1  39   ? -27.243 -13.278 32.490   1.00 103.23 ? 27   GLU A N     1 
ATOM   203   C  CA    . GLU A 1  39   ? -27.203 -11.858 32.788   1.00 101.21 ? 27   GLU A CA    1 
ATOM   204   C  C     . GLU A 1  39   ? -27.770 -11.058 31.615   1.00 114.75 ? 27   GLU A C     1 
ATOM   205   O  O     . GLU A 1  39   ? -27.839 -11.553 30.486   1.00 141.37 ? 27   GLU A O     1 
ATOM   206   C  CB    . GLU A 1  39   ? -25.767 -11.425 33.090   1.00 97.86  ? 27   GLU A CB    1 
ATOM   207   C  CG    . GLU A 1  39   ? -25.199 -11.951 34.407   1.00 102.08 ? 27   GLU A CG    1 
ATOM   208   C  CD    . GLU A 1  39   ? -25.764 -11.246 35.630   1.00 134.86 ? 27   GLU A CD    1 
ATOM   209   O  OE1   . GLU A 1  39   ? -26.372 -10.167 35.472   1.00 137.58 ? 27   GLU A OE1   1 
ATOM   210   O  OE2   . GLU A 1  39   ? -25.597 -11.773 36.753   1.00 149.36 ? 27   GLU A OE2   1 
ATOM   211   N  N     . PRO A 1  40   ? -28.194 -9.819  31.861   1.00 87.10  ? 28   PRO A N     1 
ATOM   212   C  CA    . PRO A 1  40   ? -28.715 -8.993  30.765   1.00 104.63 ? 28   PRO A CA    1 
ATOM   213   C  C     . PRO A 1  40   ? -27.641 -8.715  29.724   1.00 122.78 ? 28   PRO A C     1 
ATOM   214   O  O     . PRO A 1  40   ? -26.484 -8.448  30.055   1.00 126.35 ? 28   PRO A O     1 
ATOM   215   C  CB    . PRO A 1  40   ? -29.166 -7.708  31.471   1.00 108.21 ? 28   PRO A CB    1 
ATOM   216   C  CG    . PRO A 1  40   ? -28.418 -7.691  32.761   1.00 123.71 ? 28   PRO A CG    1 
ATOM   217   C  CD    . PRO A 1  40   ? -28.260 -9.121  33.156   1.00 97.02  ? 28   PRO A CD    1 
ATOM   218   N  N     . GLY A 1  41   ? -28.037 -8.777  28.451   1.00 129.35 ? 29   GLY A N     1 
ATOM   219   C  CA    . GLY A 1  41   ? -27.109 -8.623  27.348   1.00 126.31 ? 29   GLY A CA    1 
ATOM   220   C  C     . GLY A 1  41   ? -26.184 -9.797  27.112   1.00 105.27 ? 29   GLY A C     1 
ATOM   221   O  O     . GLY A 1  41   ? -25.475 -9.808  26.098   1.00 93.47  ? 29   GLY A O     1 
ATOM   222   N  N     . PHE A 1  42   ? -26.169 -10.786 28.007   1.00 94.14  ? 30   PHE A N     1 
ATOM   223   C  CA    . PHE A 1  42   ? -25.292 -11.943 27.881   1.00 81.92  ? 30   PHE A CA    1 
ATOM   224   C  C     . PHE A 1  42   ? -25.830 -12.987 26.912   1.00 83.18  ? 30   PHE A C     1 
ATOM   225   O  O     . PHE A 1  42   ? -25.053 -13.805 26.410   1.00 77.18  ? 30   PHE A O     1 
ATOM   226   C  CB    . PHE A 1  42   ? -25.091 -12.580 29.259   1.00 101.40 ? 30   PHE A CB    1 
ATOM   227   C  CG    . PHE A 1  42   ? -23.738 -13.198 29.461   1.00 102.06 ? 30   PHE A CG    1 
ATOM   228   C  CD1   . PHE A 1  42   ? -22.759 -12.527 30.173   1.00 99.34  ? 30   PHE A CD1   1 
ATOM   229   C  CD2   . PHE A 1  42   ? -23.450 -14.454 28.958   1.00 100.56 ? 30   PHE A CD2   1 
ATOM   230   C  CE1   . PHE A 1  42   ? -21.517 -13.092 30.369   1.00 92.21  ? 30   PHE A CE1   1 
ATOM   231   C  CE2   . PHE A 1  42   ? -22.208 -15.024 29.149   1.00 97.04  ? 30   PHE A CE2   1 
ATOM   232   C  CZ    . PHE A 1  42   ? -21.241 -14.342 29.856   1.00 93.00  ? 30   PHE A CZ    1 
ATOM   233   N  N     . GLY A 1  43   ? -27.135 -12.967 26.629   1.00 86.02  ? 31   GLY A N     1 
ATOM   234   C  CA    . GLY A 1  43   ? -27.739 -14.058 25.880   1.00 94.56  ? 31   GLY A CA    1 
ATOM   235   C  C     . GLY A 1  43   ? -27.303 -14.116 24.428   1.00 82.44  ? 31   GLY A C     1 
ATOM   236   O  O     . GLY A 1  43   ? -27.100 -15.202 23.877   1.00 73.14  ? 31   GLY A O     1 
ATOM   237   N  N     . TYR A 1  44   ? -27.162 -12.956 23.783   1.00 86.13  ? 32   TYR A N     1 
ATOM   238   C  CA    . TYR A 1  44   ? -26.809 -12.942 22.367   1.00 74.19  ? 32   TYR A CA    1 
ATOM   239   C  C     . TYR A 1  44   ? -25.400 -13.472 22.136   1.00 70.24  ? 32   TYR A C     1 
ATOM   240   O  O     . TYR A 1  44   ? -25.150 -14.180 21.153   1.00 78.75  ? 32   TYR A O     1 
ATOM   241   C  CB    . TYR A 1  44   ? -26.944 -11.527 21.806   1.00 70.18  ? 32   TYR A CB    1 
ATOM   242   C  CG    . TYR A 1  44   ? -28.364 -11.122 21.488   1.00 69.16  ? 32   TYR A CG    1 
ATOM   243   C  CD1   . TYR A 1  44   ? -29.232 -12.000 20.851   1.00 62.34  ? 32   TYR A CD1   1 
ATOM   244   C  CD2   . TYR A 1  44   ? -28.838 -9.863  21.828   1.00 76.20  ? 32   TYR A CD2   1 
ATOM   245   C  CE1   . TYR A 1  44   ? -30.531 -11.631 20.557   1.00 65.47  ? 32   TYR A CE1   1 
ATOM   246   C  CE2   . TYR A 1  44   ? -30.134 -9.486  21.541   1.00 70.32  ? 32   TYR A CE2   1 
ATOM   247   C  CZ    . TYR A 1  44   ? -30.977 -10.373 20.905   1.00 73.61  ? 32   TYR A CZ    1 
ATOM   248   O  OH    . TYR A 1  44   ? -32.269 -9.999  20.619   1.00 80.53  ? 32   TYR A OH    1 
ATOM   249   N  N     . THR A 1  45   ? -24.466 -13.146 23.031   1.00 73.43  ? 33   THR A N     1 
ATOM   250   C  CA    . THR A 1  45   ? -23.077 -13.533 22.814   1.00 69.30  ? 33   THR A CA    1 
ATOM   251   C  C     . THR A 1  45   ? -22.872 -15.026 23.043   1.00 70.91  ? 33   THR A C     1 
ATOM   252   O  O     . THR A 1  45   ? -22.058 -15.658 22.359   1.00 80.55  ? 33   THR A O     1 
ATOM   253   C  CB    . THR A 1  45   ? -22.159 -12.716 23.719   1.00 71.98  ? 33   THR A CB    1 
ATOM   254   O  OG1   . THR A 1  45   ? -22.612 -11.357 23.753   1.00 103.05 ? 33   THR A OG1   1 
ATOM   255   C  CG2   . THR A 1  45   ? -20.750 -12.740 23.177   1.00 58.39  ? 33   THR A CG2   1 
ATOM   256   N  N     . LEU A 1  46   ? -23.602 -15.609 23.998   1.00 70.18  ? 34   LEU A N     1 
ATOM   257   C  CA    . LEU A 1  46   ? -23.500 -17.048 24.220   1.00 78.47  ? 34   LEU A CA    1 
ATOM   258   C  C     . LEU A 1  46   ? -24.066 -17.831 23.044   1.00 95.59  ? 34   LEU A C     1 
ATOM   259   O  O     . LEU A 1  46   ? -23.475 -18.830 22.615   1.00 100.97 ? 34   LEU A O     1 
ATOM   260   C  CB    . LEU A 1  46   ? -24.214 -17.439 25.512   1.00 77.54  ? 34   LEU A CB    1 
ATOM   261   C  CG    . LEU A 1  46   ? -23.400 -17.317 26.797   1.00 92.65  ? 34   LEU A CG    1 
ATOM   262   C  CD1   . LEU A 1  46   ? -24.127 -18.007 27.927   1.00 110.15 ? 34   LEU A CD1   1 
ATOM   263   C  CD2   . LEU A 1  46   ? -22.012 -17.902 26.613   1.00 80.99  ? 34   LEU A CD2   1 
ATOM   264   N  N     . GLY A 1  47   ? -25.211 -17.398 22.512   1.00 95.48  ? 35   GLY A N     1 
ATOM   265   C  CA    . GLY A 1  47   ? -25.779 -18.072 21.356   1.00 87.83  ? 35   GLY A CA    1 
ATOM   266   C  C     . GLY A 1  47   ? -24.856 -18.044 20.153   1.00 66.62  ? 35   GLY A C     1 
ATOM   267   O  O     . GLY A 1  47   ? -24.783 -19.011 19.391   1.00 79.30  ? 35   GLY A O     1 
ATOM   268   N  N     . ASN A 1  48   ? -24.129 -16.939 19.972   1.00 61.75  ? 36   ASN A N     1 
ATOM   269   C  CA    . ASN A 1  48   ? -23.219 -16.827 18.838   1.00 71.22  ? 36   ASN A CA    1 
ATOM   270   C  C     . ASN A 1  48   ? -22.007 -17.733 19.012   1.00 81.31  ? 36   ASN A C     1 
ATOM   271   O  O     . ASN A 1  48   ? -21.622 -18.456 18.085   1.00 99.81  ? 36   ASN A O     1 
ATOM   272   C  CB    . ASN A 1  48   ? -22.776 -15.376 18.658   1.00 69.69  ? 36   ASN A CB    1 
ATOM   273   C  CG    . ASN A 1  48   ? -22.137 -15.129 17.307   1.00 84.08  ? 36   ASN A CG    1 
ATOM   274   O  OD1   . ASN A 1  48   ? -22.599 -15.642 16.288   1.00 78.40  ? 36   ASN A OD1   1 
ATOM   275   N  ND2   . ASN A 1  48   ? -21.064 -14.347 17.292   1.00 86.04  ? 36   ASN A ND2   1 
ATOM   276   N  N     . SER A 1  49   ? -21.390 -17.702 20.199   1.00 60.35  ? 37   SER A N     1 
ATOM   277   C  CA    . SER A 1  49   ? -20.196 -18.507 20.443   1.00 71.41  ? 37   SER A CA    1 
ATOM   278   C  C     . SER A 1  49   ? -20.471 -19.994 20.270   1.00 82.29  ? 37   SER A C     1 
ATOM   279   O  O     . SER A 1  49   ? -19.564 -20.754 19.913   1.00 91.14  ? 37   SER A O     1 
ATOM   280   C  CB    . SER A 1  49   ? -19.651 -18.229 21.843   1.00 63.78  ? 37   SER A CB    1 
ATOM   281   O  OG    . SER A 1  49   ? -19.271 -16.872 21.982   1.00 75.75  ? 37   SER A OG    1 
ATOM   282   N  N     . LEU A 1  50   ? -21.706 -20.429 20.526   1.00 77.13  ? 38   LEU A N     1 
ATOM   283   C  CA    . LEU A 1  50   ? -22.082 -21.806 20.226   1.00 75.24  ? 38   LEU A CA    1 
ATOM   284   C  C     . LEU A 1  50   ? -22.349 -21.994 18.737   1.00 70.23  ? 38   LEU A C     1 
ATOM   285   O  O     . LEU A 1  50   ? -21.944 -23.005 18.155   1.00 65.96  ? 38   LEU A O     1 
ATOM   286   C  CB    . LEU A 1  50   ? -23.311 -22.207 21.042   1.00 58.00  ? 38   LEU A CB    1 
ATOM   287   C  CG    . LEU A 1  50   ? -23.100 -22.334 22.553   1.00 57.70  ? 38   LEU A CG    1 
ATOM   288   C  CD1   . LEU A 1  50   ? -24.422 -22.502 23.293   1.00 50.04  ? 38   LEU A CD1   1 
ATOM   289   C  CD2   . LEU A 1  50   ? -22.163 -23.493 22.852   1.00 51.76  ? 38   LEU A CD2   1 
ATOM   290   N  N     . ARG A 1  51   ? -23.026 -21.027 18.111   1.00 76.65  ? 39   ARG A N     1 
ATOM   291   C  CA    . ARG A 1  51   ? -23.325 -21.129 16.686   1.00 68.18  ? 39   ARG A CA    1 
ATOM   292   C  C     . ARG A 1  51   ? -22.049 -21.195 15.856   1.00 67.64  ? 39   ARG A C     1 
ATOM   293   O  O     . ARG A 1  51   ? -21.943 -22.006 14.929   1.00 82.76  ? 39   ARG A O     1 
ATOM   294   C  CB    . ARG A 1  51   ? -24.188 -19.945 16.248   1.00 67.31  ? 39   ARG A CB    1 
ATOM   295   C  CG    . ARG A 1  51   ? -24.455 -19.881 14.754   1.00 62.29  ? 39   ARG A CG    1 
ATOM   296   C  CD    . ARG A 1  51   ? -25.300 -18.668 14.404   1.00 61.62  ? 39   ARG A CD    1 
ATOM   297   N  NE    . ARG A 1  51   ? -25.558 -18.584 12.970   1.00 72.75  ? 39   ARG A NE    1 
ATOM   298   C  CZ    . ARG A 1  51   ? -24.726 -18.034 12.093   1.00 72.07  ? 39   ARG A CZ    1 
ATOM   299   N  NH1   . ARG A 1  51   ? -23.576 -17.512 12.502   1.00 66.58  ? 39   ARG A NH1   1 
ATOM   300   N  NH2   . ARG A 1  51   ? -25.043 -18.005 10.807   1.00 58.94  ? 39   ARG A NH2   1 
ATOM   301   N  N     . ARG A 1  52   ? -21.066 -20.351 16.178   1.00 54.43  ? 40   ARG A N     1 
ATOM   302   C  CA    . ARG A 1  52   ? -19.824 -20.337 15.413   1.00 76.21  ? 40   ARG A CA    1 
ATOM   303   C  C     . ARG A 1  52   ? -19.073 -21.655 15.557   1.00 72.43  ? 40   ARG A C     1 
ATOM   304   O  O     . ARG A 1  52   ? -18.505 -22.166 14.583   1.00 68.25  ? 40   ARG A O     1 
ATOM   305   C  CB    . ARG A 1  52   ? -18.954 -19.159 15.856   1.00 65.52  ? 40   ARG A CB    1 
ATOM   306   C  CG    . ARG A 1  52   ? -19.586 -17.796 15.584   1.00 65.40  ? 40   ARG A CG    1 
ATOM   307   C  CD    . ARG A 1  52   ? -18.672 -16.651 15.996   1.00 66.20  ? 40   ARG A CD    1 
ATOM   308   N  NE    . ARG A 1  52   ? -17.351 -16.763 15.389   1.00 74.81  ? 40   ARG A NE    1 
ATOM   309   C  CZ    . ARG A 1  52   ? -16.990 -16.179 14.254   1.00 93.13  ? 40   ARG A CZ    1 
ATOM   310   N  NH1   . ARG A 1  52   ? -15.761 -16.345 13.782   1.00 89.90  ? 40   ARG A NH1   1 
ATOM   311   N  NH2   . ARG A 1  52   ? -17.857 -15.429 13.590   1.00 95.33  ? 40   ARG A NH2   1 
ATOM   312   N  N     . THR A 1  53   ? -19.062 -22.226 16.763   1.00 64.74  ? 41   THR A N     1 
ATOM   313   C  CA    . THR A 1  53   ? -18.408 -23.515 16.960   1.00 72.08  ? 41   THR A CA    1 
ATOM   314   C  C     . THR A 1  53   ? -19.215 -24.650 16.341   1.00 79.83  ? 41   THR A C     1 
ATOM   315   O  O     . THR A 1  53   ? -18.636 -25.647 15.894   1.00 88.90  ? 41   THR A O     1 
ATOM   316   C  CB    . THR A 1  53   ? -18.183 -23.771 18.451   1.00 68.71  ? 41   THR A CB    1 
ATOM   317   O  OG1   . THR A 1  53   ? -17.565 -22.624 19.046   1.00 76.40  ? 41   THR A OG1   1 
ATOM   318   C  CG2   . THR A 1  53   ? -17.276 -24.976 18.656   1.00 76.23  ? 41   THR A CG2   1 
ATOM   319   N  N     . LEU A 1  54   ? -20.542 -24.517 16.297   1.00 68.26  ? 42   LEU A N     1 
ATOM   320   C  CA    . LEU A 1  54   ? -21.366 -25.543 15.666   1.00 65.50  ? 42   LEU A CA    1 
ATOM   321   C  C     . LEU A 1  54   ? -21.147 -25.577 14.159   1.00 75.88  ? 42   LEU A C     1 
ATOM   322   O  O     . LEU A 1  54   ? -20.918 -26.644 13.577   1.00 81.54  ? 42   LEU A O     1 
ATOM   323   C  CB    . LEU A 1  54   ? -22.842 -25.302 15.985   1.00 59.94  ? 42   LEU A CB    1 
ATOM   324   C  CG    . LEU A 1  54   ? -23.340 -25.761 17.353   1.00 63.85  ? 42   LEU A CG    1 
ATOM   325   C  CD1   . LEU A 1  54   ? -24.791 -25.362 17.532   1.00 43.00  ? 42   LEU A CD1   1 
ATOM   326   C  CD2   . LEU A 1  54   ? -23.170 -27.264 17.504   1.00 77.74  ? 42   LEU A CD2   1 
ATOM   327   N  N     . LEU A 1  55   ? -21.206 -24.415 13.510   1.00 66.30  ? 43   LEU A N     1 
ATOM   328   C  CA    . LEU A 1  55   ? -21.112 -24.356 12.058   1.00 63.34  ? 43   LEU A CA    1 
ATOM   329   C  C     . LEU A 1  55   ? -19.719 -24.672 11.533   1.00 75.64  ? 43   LEU A C     1 
ATOM   330   O  O     . LEU A 1  55   ? -19.545 -24.756 10.312   1.00 84.46  ? 43   LEU A O     1 
ATOM   331   C  CB    . LEU A 1  55   ? -21.539 -22.973 11.566   1.00 51.50  ? 43   LEU A CB    1 
ATOM   332   C  CG    . LEU A 1  55   ? -22.974 -22.548 11.879   1.00 61.63  ? 43   LEU A CG    1 
ATOM   333   C  CD1   . LEU A 1  55   ? -23.214 -21.114 11.438   1.00 57.98  ? 43   LEU A CD1   1 
ATOM   334   C  CD2   . LEU A 1  55   ? -23.963 -23.486 11.210   1.00 81.72  ? 43   LEU A CD2   1 
ATOM   335   N  N     . SER A 1  56   ? -18.736 -24.856 12.401   1.00 81.30  ? 44   SER A N     1 
ATOM   336   C  CA    . SER A 1  56   ? -17.365 -24.944 11.910   1.00 86.32  ? 44   SER A CA    1 
ATOM   337   C  C     . SER A 1  56   ? -16.584 -26.132 12.449   1.00 82.47  ? 44   SER A C     1 
ATOM   338   O  O     . SER A 1  56   ? -15.871 -26.783 11.681   1.00 95.81  ? 44   SER A O     1 
ATOM   339   C  CB    . SER A 1  56   ? -16.613 -23.643 12.247   1.00 79.46  ? 44   SER A CB    1 
ATOM   340   O  OG    . SER A 1  56   ? -16.586 -23.414 13.646   1.00 69.20  ? 44   SER A OG    1 
ATOM   341   N  N     . SER A 1  57   ? -16.690 -26.432 13.741   1.00 80.35  ? 45   SER A N     1 
ATOM   342   C  CA    . SER A 1  57   ? -15.743 -27.318 14.406   1.00 76.58  ? 45   SER A CA    1 
ATOM   343   C  C     . SER A 1  57   ? -16.426 -28.526 15.039   1.00 80.30  ? 45   SER A C     1 
ATOM   344   O  O     . SER A 1  57   ? -16.044 -28.975 16.123   1.00 77.29  ? 45   SER A O     1 
ATOM   345   C  CB    . SER A 1  57   ? -14.946 -26.552 15.459   1.00 66.99  ? 45   SER A CB    1 
ATOM   346   O  OG    . SER A 1  57   ? -14.381 -25.373 14.915   1.00 58.80  ? 45   SER A OG    1 
ATOM   347   N  N     . ILE A 1  58   ? -17.431 -29.081 14.376   1.00 79.51  ? 46   ILE A N     1 
ATOM   348   C  CA    . ILE A 1  58   ? -18.093 -30.300 14.832   1.00 66.23  ? 46   ILE A CA    1 
ATOM   349   C  C     . ILE A 1  58   ? -17.548 -31.462 14.008   1.00 63.10  ? 46   ILE A C     1 
ATOM   350   O  O     . ILE A 1  58   ? -17.662 -31.434 12.773   1.00 73.59  ? 46   ILE A O     1 
ATOM   351   C  CB    . ILE A 1  58   ? -19.620 -30.203 14.712   1.00 60.38  ? 46   ILE A CB    1 
ATOM   352   C  CG1   . ILE A 1  58   ? -20.137 -29.010 15.519   1.00 64.85  ? 46   ILE A CG1   1 
ATOM   353   C  CG2   . ILE A 1  58   ? -20.275 -31.486 15.200   1.00 67.63  ? 46   ILE A CG2   1 
ATOM   354   C  CD1   . ILE A 1  58   ? -19.699 -29.005 16.970   1.00 69.53  ? 46   ILE A CD1   1 
ATOM   355   N  N     . PRO A 1  59   ? -16.951 -32.477 14.631   1.00 60.22  ? 47   PRO A N     1 
ATOM   356   C  CA    . PRO A 1  59   ? -16.346 -33.566 13.855   1.00 71.97  ? 47   PRO A CA    1 
ATOM   357   C  C     . PRO A 1  59   ? -17.391 -34.344 13.070   1.00 66.59  ? 47   PRO A C     1 
ATOM   358   O  O     . PRO A 1  59   ? -18.507 -34.575 13.539   1.00 64.49  ? 47   PRO A O     1 
ATOM   359   C  CB    . PRO A 1  59   ? -15.680 -34.439 14.926   1.00 73.90  ? 47   PRO A CB    1 
ATOM   360   C  CG    . PRO A 1  59   ? -15.544 -33.548 16.128   1.00 93.41  ? 47   PRO A CG    1 
ATOM   361   C  CD    . PRO A 1  59   ? -16.713 -32.621 16.075   1.00 87.77  ? 47   PRO A CD    1 
ATOM   362   N  N     . GLY A 1  60   ? -17.016 -34.743 11.858   1.00 71.52  ? 48   GLY A N     1 
ATOM   363   C  CA    . GLY A 1  60   ? -17.878 -35.544 11.010   1.00 71.91  ? 48   GLY A CA    1 
ATOM   364   C  C     . GLY A 1  60   ? -17.053 -36.264 9.968    1.00 86.73  ? 48   GLY A C     1 
ATOM   365   O  O     . GLY A 1  60   ? -15.844 -36.059 9.848    1.00 80.12  ? 48   GLY A O     1 
ATOM   366   N  N     . ALA A 1  61   ? -17.730 -37.119 9.207    1.00 86.23  ? 49   ALA A N     1 
ATOM   367   C  CA    . ALA A 1  61   ? -17.099 -37.903 8.157    1.00 66.45  ? 49   ALA A CA    1 
ATOM   368   C  C     . ALA A 1  61   ? -17.672 -37.518 6.801    1.00 63.95  ? 49   ALA A C     1 
ATOM   369   O  O     . ALA A 1  61   ? -18.856 -37.190 6.678    1.00 71.61  ? 49   ALA A O     1 
ATOM   370   C  CB    . ALA A 1  61   ? -17.283 -39.407 8.397    1.00 88.32  ? 49   ALA A CB    1 
ATOM   371   N  N     . ALA A 1  62   ? -16.816 -37.555 5.781    1.00 61.39  ? 50   ALA A N     1 
ATOM   372   C  CA    . ALA A 1  62   ? -17.225 -37.267 4.415    1.00 78.37  ? 50   ALA A CA    1 
ATOM   373   C  C     . ALA A 1  62   ? -16.364 -38.089 3.468    1.00 75.74  ? 50   ALA A C     1 
ATOM   374   O  O     . ALA A 1  62   ? -15.406 -38.749 3.880    1.00 79.15  ? 50   ALA A O     1 
ATOM   375   C  CB    . ALA A 1  62   ? -17.118 -35.771 4.094    1.00 101.44 ? 50   ALA A CB    1 
ATOM   376   N  N     . VAL A 1  63   ? -16.718 -38.046 2.189    1.00 66.19  ? 51   VAL A N     1 
ATOM   377   C  CA    . VAL A 1  63   ? -15.997 -38.780 1.157    1.00 63.73  ? 51   VAL A CA    1 
ATOM   378   C  C     . VAL A 1  63   ? -14.836 -37.918 0.676    1.00 56.36  ? 51   VAL A C     1 
ATOM   379   O  O     . VAL A 1  63   ? -15.041 -36.792 0.209    1.00 60.64  ? 51   VAL A O     1 
ATOM   380   C  CB    . VAL A 1  63   ? -16.925 -39.157 -0.007   1.00 69.14  ? 51   VAL A CB    1 
ATOM   381   C  CG1   . VAL A 1  63   ? -16.215 -40.088 -0.980   1.00 68.23  ? 51   VAL A CG1   1 
ATOM   382   C  CG2   . VAL A 1  63   ? -18.205 -39.791 0.519    1.00 61.58  ? 51   VAL A CG2   1 
ATOM   383   N  N     . THR A 1  64   ? -13.616 -38.441 0.798    1.00 44.51  ? 52   THR A N     1 
ATOM   384   C  CA    . THR A 1  64   ? -12.439 -37.714 0.324    1.00 58.35  ? 52   THR A CA    1 
ATOM   385   C  C     . THR A 1  64   ? -12.346 -37.776 -1.198   1.00 71.39  ? 52   THR A C     1 
ATOM   386   O  O     . THR A 1  64   ? -12.466 -36.756 -1.884   1.00 82.85  ? 52   THR A O     1 
ATOM   387   C  CB    . THR A 1  64   ? -11.171 -38.279 0.973    1.00 74.07  ? 52   THR A CB    1 
ATOM   388   O  OG1   . THR A 1  64   ? -11.213 -38.050 2.387    1.00 86.67  ? 52   THR A OG1   1 
ATOM   389   C  CG2   . THR A 1  64   ? -9.930  -37.613 0.394    1.00 78.72  ? 52   THR A CG2   1 
ATOM   390   N  N     . SER A 1  65   ? -12.143 -38.974 -1.736   1.00 66.49  ? 53   SER A N     1 
ATOM   391   C  CA    . SER A 1  65   ? -11.983 -39.181 -3.166   1.00 63.38  ? 53   SER A CA    1 
ATOM   392   C  C     . SER A 1  65   ? -12.892 -40.314 -3.621   1.00 54.41  ? 53   SER A C     1 
ATOM   393   O  O     . SER A 1  65   ? -13.400 -41.095 -2.813   1.00 63.42  ? 53   SER A O     1 
ATOM   394   C  CB    . SER A 1  65   ? -10.525 -39.500 -3.522   1.00 73.78  ? 53   SER A CB    1 
ATOM   395   O  OG    . SER A 1  65   ? -10.050 -40.606 -2.772   1.00 52.67  ? 53   SER A OG    1 
ATOM   396   N  N     . ILE A 1  66   ? -13.098 -40.388 -4.935   1.00 52.25  ? 54   ILE A N     1 
ATOM   397   C  CA    . ILE A 1  66   ? -13.850 -41.467 -5.557   1.00 59.15  ? 54   ILE A CA    1 
ATOM   398   C  C     . ILE A 1  66   ? -12.997 -42.065 -6.668   1.00 64.96  ? 54   ILE A C     1 
ATOM   399   O  O     . ILE A 1  66   ? -11.928 -41.556 -7.005   1.00 68.11  ? 54   ILE A O     1 
ATOM   400   C  CB    . ILE A 1  66   ? -15.215 -41.006 -6.113   1.00 50.79  ? 54   ILE A CB    1 
ATOM   401   C  CG1   . ILE A 1  66   ? -15.020 -40.111 -7.339   1.00 49.38  ? 54   ILE A CG1   1 
ATOM   402   C  CG2   . ILE A 1  66   ? -16.030 -40.304 -5.029   1.00 54.65  ? 54   ILE A CG2   1 
ATOM   403   C  CD1   . ILE A 1  66   ? -16.291 -39.867 -8.128   1.00 59.38  ? 54   ILE A CD1   1 
ATOM   404   N  N     . ARG A 1  67   ? -13.489 -43.162 -7.239   1.00 65.24  ? 55   ARG A N     1 
ATOM   405   C  CA    . ARG A 1  67   ? -12.779 -43.841 -8.319   1.00 55.54  ? 55   ARG A CA    1 
ATOM   406   C  C     . ARG A 1  67   ? -13.793 -44.619 -9.143   1.00 58.77  ? 55   ARG A C     1 
ATOM   407   O  O     . ARG A 1  67   ? -14.288 -45.660 -8.699   1.00 74.19  ? 55   ARG A O     1 
ATOM   408   C  CB    . ARG A 1  67   ? -11.692 -44.762 -7.772   1.00 70.57  ? 55   ARG A CB    1 
ATOM   409   C  CG    . ARG A 1  67   ? -10.838 -45.406 -8.850   1.00 87.22  ? 55   ARG A CG    1 
ATOM   410   C  CD    . ARG A 1  67   ? -9.453  -45.748 -8.330   1.00 91.43  ? 55   ARG A CD    1 
ATOM   411   N  NE    . ARG A 1  67   ? -8.527  -46.062 -9.415   1.00 127.08 ? 55   ARG A NE    1 
ATOM   412   C  CZ    . ARG A 1  67   ? -7.206  -46.107 -9.278   1.00 133.05 ? 55   ARG A CZ    1 
ATOM   413   N  NH1   . ARG A 1  67   ? -6.654  -45.852 -8.100   1.00 131.42 ? 55   ARG A NH1   1 
ATOM   414   N  NH2   . ARG A 1  67   ? -6.437  -46.399 -10.318  1.00 117.56 ? 55   ARG A NH2   1 
ATOM   415   N  N     . ILE A 1  68   ? -14.104 -44.111 -10.331  1.00 63.66  ? 56   ILE A N     1 
ATOM   416   C  CA    . ILE A 1  68   ? -14.957 -44.799 -11.292  1.00 74.68  ? 56   ILE A CA    1 
ATOM   417   C  C     . ILE A 1  68   ? -14.059 -45.532 -12.277  1.00 84.58  ? 56   ILE A C     1 
ATOM   418   O  O     . ILE A 1  68   ? -13.024 -45.004 -12.705  1.00 94.83  ? 56   ILE A O     1 
ATOM   419   C  CB    . ILE A 1  68   ? -15.900 -43.814 -12.011  1.00 70.94  ? 56   ILE A CB    1 
ATOM   420   C  CG1   . ILE A 1  68   ? -16.741 -43.045 -10.990  1.00 60.30  ? 56   ILE A CG1   1 
ATOM   421   C  CG2   . ILE A 1  68   ? -16.802 -44.546 -12.993  1.00 63.85  ? 56   ILE A CG2   1 
ATOM   422   C  CD1   . ILE A 1  68   ? -17.708 -42.054 -11.610  1.00 58.38  ? 56   ILE A CD1   1 
ATOM   423   N  N     . ASP A 1  69   ? -14.453 -46.756 -12.635  1.00 87.06  ? 57   ASP A N     1 
ATOM   424   C  CA    . ASP A 1  69   ? -13.572 -47.630 -13.404  1.00 90.10  ? 57   ASP A CA    1 
ATOM   425   C  C     . ASP A 1  69   ? -13.328 -47.088 -14.809  1.00 89.66  ? 57   ASP A C     1 
ATOM   426   O  O     . ASP A 1  69   ? -12.179 -46.994 -15.257  1.00 109.10 ? 57   ASP A O     1 
ATOM   427   C  CB    . ASP A 1  69   ? -14.157 -49.043 -13.457  1.00 104.93 ? 57   ASP A CB    1 
ATOM   428   C  CG    . ASP A 1  69   ? -15.545 -49.082 -14.070  1.00 107.99 ? 57   ASP A CG    1 
ATOM   429   O  OD1   . ASP A 1  69   ? -16.213 -48.025 -14.108  1.00 80.92  ? 57   ASP A OD1   1 
ATOM   430   O  OD2   . ASP A 1  69   ? -15.968 -50.170 -14.516  1.00 122.37 ? 57   ASP A OD2   1 
ATOM   431   N  N     . GLY A 1  70   ? -14.393 -46.720 -15.520  1.00 80.09  ? 58   GLY A N     1 
ATOM   432   C  CA    . GLY A 1  70   ? -14.253 -46.329 -16.911  1.00 79.06  ? 58   GLY A CA    1 
ATOM   433   C  C     . GLY A 1  70   ? -13.656 -44.955 -17.132  1.00 82.73  ? 58   GLY A C     1 
ATOM   434   O  O     . GLY A 1  70   ? -13.308 -44.631 -18.272  1.00 78.29  ? 58   GLY A O     1 
ATOM   435   N  N     . VAL A 1  71   ? -13.522 -44.150 -16.082  1.00 81.01  ? 59   VAL A N     1 
ATOM   436   C  CA    . VAL A 1  71   ? -13.088 -42.769 -16.220  1.00 69.09  ? 59   VAL A CA    1 
ATOM   437   C  C     . VAL A 1  71   ? -11.714 -42.596 -15.587  1.00 60.83  ? 59   VAL A C     1 
ATOM   438   O  O     . VAL A 1  71   ? -11.256 -43.408 -14.777  1.00 64.97  ? 59   VAL A O     1 
ATOM   439   C  CB    . VAL A 1  71   ? -14.100 -41.785 -15.599  1.00 57.88  ? 59   VAL A CB    1 
ATOM   440   C  CG1   . VAL A 1  71   ? -15.517 -42.199 -15.953  1.00 73.86  ? 59   VAL A CG1   1 
ATOM   441   C  CG2   . VAL A 1  71   ? -13.914 -41.702 -14.093  1.00 54.49  ? 59   VAL A CG2   1 
ATOM   442   N  N     . LEU A 1  72   ? -11.047 -41.509 -15.981  1.00 61.37  ? 60   LEU A N     1 
ATOM   443   C  CA    . LEU A 1  72   ? -9.762  -41.131 -15.418  1.00 63.27  ? 60   LEU A CA    1 
ATOM   444   C  C     . LEU A 1  72   ? -9.747  -39.703 -14.887  1.00 71.03  ? 60   LEU A C     1 
ATOM   445   O  O     . LEU A 1  72   ? -8.720  -39.274 -14.348  1.00 81.36  ? 60   LEU A O     1 
ATOM   446   C  CB    . LEU A 1  72   ? -8.641  -41.300 -16.459  1.00 68.60  ? 60   LEU A CB    1 
ATOM   447   C  CG    . LEU A 1  72   ? -8.348  -42.713 -16.983  1.00 59.34  ? 60   LEU A CG    1 
ATOM   448   C  CD1   . LEU A 1  72   ? -9.296  -43.122 -18.108  1.00 83.59  ? 60   LEU A CD1   1 
ATOM   449   C  CD2   . LEU A 1  72   ? -6.902  -42.828 -17.437  1.00 58.50  ? 60   LEU A CD2   1 
ATOM   450   N  N     . HIS A 1  73   ? -10.847 -38.962 -15.018  1.00 61.22  ? 61   HIS A N     1 
ATOM   451   C  CA    . HIS A 1  73   ? -10.941 -37.594 -14.521  1.00 75.94  ? 61   HIS A CA    1 
ATOM   452   C  C     . HIS A 1  73   ? -12.408 -37.181 -14.515  1.00 70.23  ? 61   HIS A C     1 
ATOM   453   O  O     . HIS A 1  73   ? -13.273 -37.883 -15.046  1.00 58.67  ? 61   HIS A O     1 
ATOM   454   C  CB    . HIS A 1  73   ? -10.098 -36.623 -15.354  1.00 69.23  ? 61   HIS A CB    1 
ATOM   455   C  CG    . HIS A 1  73   ? -10.395 -36.660 -16.821  1.00 63.05  ? 61   HIS A CG    1 
ATOM   456   N  ND1   . HIS A 1  73   ? -11.474 -36.010 -17.380  1.00 58.25  ? 61   HIS A ND1   1 
ATOM   457   C  CD2   . HIS A 1  73   ? -9.745  -37.260 -17.846  1.00 81.97  ? 61   HIS A CD2   1 
ATOM   458   C  CE1   . HIS A 1  73   ? -11.478 -36.211 -18.686  1.00 76.36  ? 61   HIS A CE1   1 
ATOM   459   N  NE2   . HIS A 1  73   ? -10.440 -36.967 -18.994  1.00 87.16  ? 61   HIS A NE2   1 
ATOM   460   N  N     . GLU A 1  74   ? -12.673 -36.021 -13.907  1.00 70.31  ? 62   GLU A N     1 
ATOM   461   C  CA    . GLU A 1  74   ? -14.049 -35.568 -13.719  1.00 55.98  ? 62   GLU A CA    1 
ATOM   462   C  C     . GLU A 1  74   ? -14.747 -35.312 -15.049  1.00 60.83  ? 62   GLU A C     1 
ATOM   463   O  O     . GLU A 1  74   ? -15.948 -35.569 -15.189  1.00 60.77  ? 62   GLU A O     1 
ATOM   464   C  CB    . GLU A 1  74   ? -14.070 -34.295 -12.871  1.00 59.92  ? 62   GLU A CB    1 
ATOM   465   C  CG    . GLU A 1  74   ? -13.688 -34.483 -11.417  1.00 88.62  ? 62   GLU A CG    1 
ATOM   466   C  CD    . GLU A 1  74   ? -12.925 -33.300 -10.856  1.00 112.51 ? 62   GLU A CD    1 
ATOM   467   O  OE1   . GLU A 1  74   ? -11.779 -33.074 -11.300  1.00 89.84  ? 62   GLU A OE1   1 
ATOM   468   O  OE2   . GLU A 1  74   ? -13.469 -32.592 -9.981   1.00 128.88 ? 62   GLU A OE2   1 
ATOM   469   N  N     . PHE A 1  75   ? -14.012 -34.808 -16.038  1.00 62.44  ? 63   PHE A N     1 
ATOM   470   C  CA    . PHE A 1  75   ? -14.619 -34.193 -17.219  1.00 52.93  ? 63   PHE A CA    1 
ATOM   471   C  C     . PHE A 1  75   ? -14.826 -35.235 -18.320  1.00 53.82  ? 63   PHE A C     1 
ATOM   472   O  O     . PHE A 1  75   ? -14.175 -35.228 -19.367  1.00 69.27  ? 63   PHE A O     1 
ATOM   473   C  CB    . PHE A 1  75   ? -13.759 -33.030 -17.699  1.00 53.24  ? 63   PHE A CB    1 
ATOM   474   C  CG    . PHE A 1  75   ? -13.239 -32.157 -16.587  1.00 55.78  ? 63   PHE A CG    1 
ATOM   475   C  CD1   . PHE A 1  75   ? -13.986 -31.088 -16.118  1.00 59.01  ? 63   PHE A CD1   1 
ATOM   476   C  CD2   . PHE A 1  75   ? -12.002 -32.405 -16.012  1.00 52.24  ? 63   PHE A CD2   1 
ATOM   477   C  CE1   . PHE A 1  75   ? -13.507 -30.285 -15.097  1.00 68.90  ? 63   PHE A CE1   1 
ATOM   478   C  CE2   . PHE A 1  75   ? -11.519 -31.606 -14.993  1.00 59.03  ? 63   PHE A CE2   1 
ATOM   479   C  CZ    . PHE A 1  75   ? -12.273 -30.545 -14.535  1.00 72.66  ? 63   PHE A CZ    1 
ATOM   480   N  N     . THR A 1  76   ? -15.778 -36.132 -18.075  1.00 56.18  ? 64   THR A N     1 
ATOM   481   C  CA    . THR A 1  76   ? -16.113 -37.172 -19.041  1.00 62.23  ? 64   THR A CA    1 
ATOM   482   C  C     . THR A 1  76   ? -17.482 -37.747 -18.691  1.00 64.40  ? 64   THR A C     1 
ATOM   483   O  O     . THR A 1  76   ? -18.121 -37.343 -17.715  1.00 58.88  ? 64   THR A O     1 
ATOM   484   C  CB    . THR A 1  76   ? -15.047 -38.270 -19.074  1.00 77.38  ? 64   THR A CB    1 
ATOM   485   O  OG1   . THR A 1  76   ? -15.420 -39.270 -20.030  1.00 80.15  ? 64   THR A OG1   1 
ATOM   486   C  CG2   . THR A 1  76   ? -14.907 -38.914 -17.708  1.00 65.23  ? 64   THR A CG2   1 
ATOM   487   N  N     . THR A 1  77   ? -17.927 -38.698 -19.510  1.00 59.87  ? 65   THR A N     1 
ATOM   488   C  CA    . THR A 1  77   ? -19.198 -39.380 -19.330  1.00 58.51  ? 65   THR A CA    1 
ATOM   489   C  C     . THR A 1  77   ? -18.968 -40.881 -19.210  1.00 69.60  ? 65   THR A C     1 
ATOM   490   O  O     . THR A 1  77   ? -17.950 -41.415 -19.660  1.00 73.17  ? 65   THR A O     1 
ATOM   491   C  CB    . THR A 1  77   ? -20.158 -39.108 -20.498  1.00 57.52  ? 65   THR A CB    1 
ATOM   492   O  OG1   . THR A 1  77   ? -19.668 -39.753 -21.680  1.00 69.78  ? 65   THR A OG1   1 
ATOM   493   C  CG2   . THR A 1  77   ? -20.279 -37.617 -20.760  1.00 75.60  ? 65   THR A CG2   1 
ATOM   494   N  N     . VAL A 1  78   ? -19.932 -41.555 -18.590  1.00 67.99  ? 66   VAL A N     1 
ATOM   495   C  CA    . VAL A 1  78   ? -19.959 -43.013 -18.517  1.00 63.68  ? 66   VAL A CA    1 
ATOM   496   C  C     . VAL A 1  78   ? -21.043 -43.496 -19.476  1.00 87.98  ? 66   VAL A C     1 
ATOM   497   O  O     . VAL A 1  78   ? -22.124 -42.893 -19.534  1.00 85.40  ? 66   VAL A O     1 
ATOM   498   C  CB    . VAL A 1  78   ? -20.200 -43.497 -17.077  1.00 61.23  ? 66   VAL A CB    1 
ATOM   499   C  CG1   . VAL A 1  78   ? -20.602 -44.966 -17.047  1.00 88.38  ? 66   VAL A CG1   1 
ATOM   500   C  CG2   . VAL A 1  78   ? -18.959 -43.270 -16.225  1.00 72.86  ? 66   VAL A CG2   1 
ATOM   501   N  N     . PRO A 1  79   ? -20.794 -44.541 -20.264  1.00 91.43  ? 67   PRO A N     1 
ATOM   502   C  CA    . PRO A 1  79   ? -21.822 -45.021 -21.198  1.00 97.49  ? 67   PRO A CA    1 
ATOM   503   C  C     . PRO A 1  79   ? -23.056 -45.524 -20.461  1.00 88.98  ? 67   PRO A C     1 
ATOM   504   O  O     . PRO A 1  79   ? -22.959 -46.299 -19.506  1.00 86.20  ? 67   PRO A O     1 
ATOM   505   C  CB    . PRO A 1  79   ? -21.114 -46.152 -21.954  1.00 108.44 ? 67   PRO A CB    1 
ATOM   506   C  CG    . PRO A 1  79   ? -19.654 -45.869 -21.794  1.00 101.46 ? 67   PRO A CG    1 
ATOM   507   C  CD    . PRO A 1  79   ? -19.516 -45.252 -20.435  1.00 69.10  ? 67   PRO A CD    1 
ATOM   508   N  N     . GLY A 1  80   ? -24.225 -45.070 -20.914  1.00 78.45  ? 68   GLY A N     1 
ATOM   509   C  CA    . GLY A 1  80   ? -25.489 -45.520 -20.378  1.00 78.06  ? 68   GLY A CA    1 
ATOM   510   C  C     . GLY A 1  80   ? -26.038 -44.700 -19.231  1.00 91.43  ? 68   GLY A C     1 
ATOM   511   O  O     . GLY A 1  80   ? -27.226 -44.835 -18.909  1.00 100.42 ? 68   GLY A O     1 
ATOM   512   N  N     . VAL A 1  81   ? -25.224 -43.864 -18.602  1.00 83.33  ? 69   VAL A N     1 
ATOM   513   C  CA    . VAL A 1  81   ? -25.690 -43.019 -17.512  1.00 73.32  ? 69   VAL A CA    1 
ATOM   514   C  C     . VAL A 1  81   ? -26.063 -41.658 -18.082  1.00 68.27  ? 69   VAL A C     1 
ATOM   515   O  O     . VAL A 1  81   ? -25.470 -41.179 -19.059  1.00 70.70  ? 69   VAL A O     1 
ATOM   516   C  CB    . VAL A 1  81   ? -24.644 -42.903 -16.383  1.00 68.75  ? 69   VAL A CB    1 
ATOM   517   C  CG1   . VAL A 1  81   ? -24.168 -44.284 -15.960  1.00 69.41  ? 69   VAL A CG1   1 
ATOM   518   C  CG2   . VAL A 1  81   ? -23.473 -42.044 -16.808  1.00 74.69  ? 69   VAL A CG2   1 
ATOM   519   N  N     . LYS A 1  82   ? -27.079 -41.040 -17.481  1.00 63.26  ? 70   LYS A N     1 
ATOM   520   C  CA    . LYS A 1  82   ? -27.581 -39.758 -17.957  1.00 62.02  ? 70   LYS A CA    1 
ATOM   521   C  C     . LYS A 1  82   ? -26.728 -38.583 -17.494  1.00 63.55  ? 70   LYS A C     1 
ATOM   522   O  O     . LYS A 1  82   ? -26.721 -37.539 -18.155  1.00 60.43  ? 70   LYS A O     1 
ATOM   523   C  CB    . LYS A 1  82   ? -29.028 -39.567 -17.497  1.00 65.04  ? 70   LYS A CB    1 
ATOM   524   C  CG    . LYS A 1  82   ? -29.728 -38.347 -18.074  1.00 60.33  ? 70   LYS A CG    1 
ATOM   525   C  CD    . LYS A 1  82   ? -31.092 -38.155 -17.434  1.00 67.63  ? 70   LYS A CD    1 
ATOM   526   C  CE    . LYS A 1  82   ? -31.690 -36.801 -17.778  1.00 85.91  ? 70   LYS A CE    1 
ATOM   527   N  NZ    . LYS A 1  82   ? -32.895 -36.514 -16.947  1.00 105.81 ? 70   LYS A NZ    1 
ATOM   528   N  N     . GLU A 1  83   ? -26.002 -38.731 -16.390  1.00 59.50  ? 71   GLU A N     1 
ATOM   529   C  CA    . GLU A 1  83   ? -25.190 -37.658 -15.835  1.00 53.32  ? 71   GLU A CA    1 
ATOM   530   C  C     . GLU A 1  83   ? -23.724 -37.862 -16.194  1.00 52.50  ? 71   GLU A C     1 
ATOM   531   O  O     . GLU A 1  83   ? -23.223 -38.989 -16.183  1.00 66.48  ? 71   GLU A O     1 
ATOM   532   C  CB    . GLU A 1  83   ? -25.339 -37.589 -14.312  1.00 79.27  ? 71   GLU A CB    1 
ATOM   533   C  CG    . GLU A 1  83   ? -26.759 -37.343 -13.813  1.00 101.55 ? 71   GLU A CG    1 
ATOM   534   C  CD    . GLU A 1  83   ? -27.618 -38.596 -13.809  1.00 87.88  ? 71   GLU A CD    1 
ATOM   535   O  OE1   . GLU A 1  83   ? -27.143 -39.654 -14.275  1.00 65.67  ? 71   GLU A OE1   1 
ATOM   536   O  OE2   . GLU A 1  83   ? -28.772 -38.522 -13.337  1.00 82.05  ? 71   GLU A OE2   1 
ATOM   537   N  N     . ASP A 1  84   ? -23.039 -36.767 -16.512  1.00 63.49  ? 72   ASP A N     1 
ATOM   538   C  CA    . ASP A 1  84   ? -21.592 -36.830 -16.631  1.00 64.94  ? 72   ASP A CA    1 
ATOM   539   C  C     . ASP A 1  84   ? -20.965 -37.016 -15.249  1.00 48.21  ? 72   ASP A C     1 
ATOM   540   O  O     . ASP A 1  84   ? -21.624 -36.882 -14.213  1.00 57.68  ? 72   ASP A O     1 
ATOM   541   C  CB    . ASP A 1  84   ? -21.050 -35.571 -17.309  1.00 77.43  ? 72   ASP A CB    1 
ATOM   542   C  CG    . ASP A 1  84   ? -21.640 -34.299 -16.738  1.00 90.32  ? 72   ASP A CG    1 
ATOM   543   O  OD1   . ASP A 1  84   ? -22.856 -34.073 -16.920  1.00 102.90 ? 72   ASP A OD1   1 
ATOM   544   O  OD2   . ASP A 1  84   ? -20.892 -33.532 -16.094  1.00 81.21  ? 72   ASP A OD2   1 
ATOM   545   N  N     . VAL A 1  85   ? -19.669 -37.338 -15.240  1.00 40.73  ? 73   VAL A N     1 
ATOM   546   C  CA    . VAL A 1  85   ? -18.982 -37.617 -13.980  1.00 53.04  ? 73   VAL A CA    1 
ATOM   547   C  C     . VAL A 1  85   ? -18.946 -36.378 -13.096  1.00 56.62  ? 73   VAL A C     1 
ATOM   548   O  O     . VAL A 1  85   ? -19.011 -36.482 -11.865  1.00 65.16  ? 73   VAL A O     1 
ATOM   549   C  CB    . VAL A 1  85   ? -17.567 -38.164 -14.255  1.00 66.97  ? 73   VAL A CB    1 
ATOM   550   C  CG1   . VAL A 1  85   ? -16.845 -38.481 -12.953  1.00 40.12  ? 73   VAL A CG1   1 
ATOM   551   C  CG2   . VAL A 1  85   ? -17.641 -39.399 -15.132  1.00 71.76  ? 73   VAL A CG2   1 
ATOM   552   N  N     . THR A 1  86   ? -18.854 -35.191 -13.700  1.00 49.40  ? 74   THR A N     1 
ATOM   553   C  CA    . THR A 1  86   ? -18.888 -33.956 -12.922  1.00 59.98  ? 74   THR A CA    1 
ATOM   554   C  C     . THR A 1  86   ? -20.214 -33.810 -12.184  1.00 63.70  ? 74   THR A C     1 
ATOM   555   O  O     . THR A 1  86   ? -20.242 -33.479 -10.992  1.00 66.84  ? 74   THR A O     1 
ATOM   556   C  CB    . THR A 1  86   ? -18.643 -32.753 -13.835  1.00 57.74  ? 74   THR A CB    1 
ATOM   557   O  OG1   . THR A 1  86   ? -17.278 -32.751 -14.274  1.00 67.81  ? 74   THR A OG1   1 
ATOM   558   C  CG2   . THR A 1  86   ? -18.934 -31.455 -13.101  1.00 62.48  ? 74   THR A CG2   1 
ATOM   559   N  N     . GLU A 1  87   ? -21.329 -34.059 -12.878  1.00 55.93  ? 75   GLU A N     1 
ATOM   560   C  CA    . GLU A 1  87   ? -22.637 -33.964 -12.235  1.00 69.96  ? 75   GLU A CA    1 
ATOM   561   C  C     . GLU A 1  87   ? -22.845 -35.079 -11.219  1.00 73.42  ? 75   GLU A C     1 
ATOM   562   O  O     . GLU A 1  87   ? -23.539 -34.880 -10.216  1.00 82.48  ? 75   GLU A O     1 
ATOM   563   C  CB    . GLU A 1  87   ? -23.749 -33.989 -13.285  1.00 83.68  ? 75   GLU A CB    1 
ATOM   564   C  CG    . GLU A 1  87   ? -25.139 -33.689 -12.731  1.00 95.98  ? 75   GLU A CG    1 
ATOM   565   C  CD    . GLU A 1  87   ? -26.210 -33.702 -13.805  1.00 131.67 ? 75   GLU A CD    1 
ATOM   566   O  OE1   . GLU A 1  87   ? -27.407 -33.602 -13.458  1.00 155.64 ? 75   GLU A OE1   1 
ATOM   567   O  OE2   . GLU A 1  87   ? -25.854 -33.814 -14.996  1.00 137.31 ? 75   GLU A OE2   1 
ATOM   568   N  N     . ILE A 1  88   ? -22.261 -36.255 -11.461  1.00 66.96  ? 76   ILE A N     1 
ATOM   569   C  CA    . ILE A 1  88   ? -22.346 -37.337 -10.486  1.00 63.58  ? 76   ILE A CA    1 
ATOM   570   C  C     . ILE A 1  88   ? -21.612 -36.958 -9.207   1.00 61.34  ? 76   ILE A C     1 
ATOM   571   O  O     . ILE A 1  88   ? -22.099 -37.209 -8.098   1.00 66.11  ? 76   ILE A O     1 
ATOM   572   C  CB    . ILE A 1  88   ? -21.797 -38.644 -11.087  1.00 64.95  ? 76   ILE A CB    1 
ATOM   573   C  CG1   . ILE A 1  88   ? -22.728 -39.161 -12.186  1.00 65.68  ? 76   ILE A CG1   1 
ATOM   574   C  CG2   . ILE A 1  88   ? -21.604 -39.693 -10.001  1.00 52.46  ? 76   ILE A CG2   1 
ATOM   575   C  CD1   . ILE A 1  88   ? -22.322 -40.507 -12.748  1.00 53.92  ? 76   ILE A CD1   1 
ATOM   576   N  N     . ILE A 1  89   ? -20.435 -36.343 -9.340   1.00 65.69  ? 77   ILE A N     1 
ATOM   577   C  CA    . ILE A 1  89   ? -19.662 -35.945 -8.167   1.00 53.83  ? 77   ILE A CA    1 
ATOM   578   C  C     . ILE A 1  89   ? -20.403 -34.874 -7.377   1.00 63.02  ? 77   ILE A C     1 
ATOM   579   O  O     . ILE A 1  89   ? -20.389 -34.871 -6.140   1.00 63.30  ? 77   ILE A O     1 
ATOM   580   C  CB    . ILE A 1  89   ? -18.259 -35.474 -8.591   1.00 53.45  ? 77   ILE A CB    1 
ATOM   581   C  CG1   . ILE A 1  89   ? -17.451 -36.655 -9.130   1.00 52.53  ? 77   ILE A CG1   1 
ATOM   582   C  CG2   . ILE A 1  89   ? -17.537 -34.802 -7.434   1.00 64.19  ? 77   ILE A CG2   1 
ATOM   583   C  CD1   . ILE A 1  89   ? -16.021 -36.324 -9.456   1.00 74.10  ? 77   ILE A CD1   1 
ATOM   584   N  N     . LEU A 1  90   ? -21.070 -33.952 -8.077   1.00 61.06  ? 78   LEU A N     1 
ATOM   585   C  CA    . LEU A 1  90   ? -21.848 -32.926 -7.391   1.00 67.33  ? 78   LEU A CA    1 
ATOM   586   C  C     . LEU A 1  90   ? -23.002 -33.539 -6.607   1.00 70.02  ? 78   LEU A C     1 
ATOM   587   O  O     . LEU A 1  90   ? -23.332 -33.071 -5.511   1.00 75.26  ? 78   LEU A O     1 
ATOM   588   C  CB    . LEU A 1  90   ? -22.364 -31.896 -8.395   1.00 68.48  ? 78   LEU A CB    1 
ATOM   589   C  CG    . LEU A 1  90   ? -21.553 -30.601 -8.499   1.00 69.44  ? 78   LEU A CG    1 
ATOM   590   C  CD1   . LEU A 1  90   ? -20.122 -30.880 -8.934   1.00 67.33  ? 78   LEU A CD1   1 
ATOM   591   C  CD2   . LEU A 1  90   ? -22.226 -29.623 -9.448   1.00 75.34  ? 78   LEU A CD2   1 
ATOM   592   N  N     . ASN A 1  91   ? -23.629 -34.585 -7.152   1.00 62.31  ? 79   ASN A N     1 
ATOM   593   C  CA    . ASN A 1  91   ? -24.646 -35.308 -6.397   1.00 61.98  ? 79   ASN A CA    1 
ATOM   594   C  C     . ASN A 1  91   ? -24.035 -36.046 -5.213   1.00 68.98  ? 79   ASN A C     1 
ATOM   595   O  O     . ASN A 1  91   ? -24.684 -36.191 -4.171   1.00 64.95  ? 79   ASN A O     1 
ATOM   596   C  CB    . ASN A 1  91   ? -25.385 -36.286 -7.310   1.00 62.39  ? 79   ASN A CB    1 
ATOM   597   C  CG    . ASN A 1  91   ? -26.135 -35.589 -8.430   1.00 77.17  ? 79   ASN A CG    1 
ATOM   598   O  OD1   . ASN A 1  91   ? -26.082 -34.366 -8.560   1.00 85.76  ? 79   ASN A OD1   1 
ATOM   599   N  ND2   . ASN A 1  91   ? -26.831 -36.367 -9.252   1.00 87.96  ? 79   ASN A ND2   1 
ATOM   600   N  N     . LEU A 1  92   ? -22.791 -36.511 -5.352   1.00 74.98  ? 80   LEU A N     1 
ATOM   601   C  CA    . LEU A 1  92   ? -22.115 -37.185 -4.251   1.00 57.20  ? 80   LEU A CA    1 
ATOM   602   C  C     . LEU A 1  92   ? -21.693 -36.220 -3.152   1.00 62.47  ? 80   LEU A C     1 
ATOM   603   O  O     . LEU A 1  92   ? -21.434 -36.660 -2.027   1.00 72.18  ? 80   LEU A O     1 
ATOM   604   C  CB    . LEU A 1  92   ? -20.898 -37.950 -4.771   1.00 45.74  ? 80   LEU A CB    1 
ATOM   605   C  CG    . LEU A 1  92   ? -21.194 -39.237 -5.539   1.00 47.93  ? 80   LEU A CG    1 
ATOM   606   C  CD1   . LEU A 1  92   ? -19.900 -39.872 -6.016   1.00 34.52  ? 80   LEU A CD1   1 
ATOM   607   C  CD2   . LEU A 1  92   ? -21.983 -40.206 -4.671   1.00 35.14  ? 80   LEU A CD2   1 
ATOM   608   N  N     . LYS A 1  93   ? -21.613 -34.920 -3.448   1.00 68.53  ? 81   LYS A N     1 
ATOM   609   C  CA    . LYS A 1  93   ? -21.332 -33.937 -2.408   1.00 65.17  ? 81   LYS A CA    1 
ATOM   610   C  C     . LYS A 1  93   ? -22.486 -33.802 -1.425   1.00 63.31  ? 81   LYS A C     1 
ATOM   611   O  O     . LYS A 1  93   ? -22.290 -33.277 -0.323   1.00 83.13  ? 81   LYS A O     1 
ATOM   612   C  CB    . LYS A 1  93   ? -21.016 -32.577 -3.035   1.00 84.95  ? 81   LYS A CB    1 
ATOM   613   C  CG    . LYS A 1  93   ? -19.802 -32.581 -3.953   1.00 75.26  ? 81   LYS A CG    1 
ATOM   614   C  CD    . LYS A 1  93   ? -19.607 -31.231 -4.625   1.00 89.02  ? 81   LYS A CD    1 
ATOM   615   C  CE    . LYS A 1  93   ? -19.163 -30.177 -3.628   1.00 81.41  ? 81   LYS A CE    1 
ATOM   616   N  NZ    . LYS A 1  93   ? -17.839 -30.512 -3.045   1.00 71.09  ? 81   LYS A NZ    1 
ATOM   617   N  N     . SER A 1  94   ? -23.680 -34.260 -1.800   1.00 64.62  ? 82   SER A N     1 
ATOM   618   C  CA    . SER A 1  94   ? -24.828 -34.252 -0.905   1.00 70.03  ? 82   SER A CA    1 
ATOM   619   C  C     . SER A 1  94   ? -24.825 -35.420 0.072    1.00 77.04  ? 82   SER A C     1 
ATOM   620   O  O     . SER A 1  94   ? -25.654 -35.438 0.988    1.00 101.65 ? 82   SER A O     1 
ATOM   621   C  CB    . SER A 1  94   ? -26.127 -34.269 -1.717   1.00 67.39  ? 82   SER A CB    1 
ATOM   622   O  OG    . SER A 1  94   ? -26.205 -33.156 -2.590   1.00 83.02  ? 82   SER A OG    1 
ATOM   623   N  N     . LEU A 1  95   ? -23.923 -36.386 -0.100   1.00 69.42  ? 83   LEU A N     1 
ATOM   624   C  CA    . LEU A 1  95   ? -23.914 -37.570 0.750    1.00 65.28  ? 83   LEU A CA    1 
ATOM   625   C  C     . LEU A 1  95   ? -23.598 -37.203 2.193    1.00 75.54  ? 83   LEU A C     1 
ATOM   626   O  O     . LEU A 1  95   ? -22.654 -36.456 2.467    1.00 79.12  ? 83   LEU A O     1 
ATOM   627   C  CB    . LEU A 1  95   ? -22.893 -38.586 0.233    1.00 68.86  ? 83   LEU A CB    1 
ATOM   628   C  CG    . LEU A 1  95   ? -23.435 -39.881 -0.377   1.00 69.47  ? 83   LEU A CG    1 
ATOM   629   C  CD1   . LEU A 1  95   ? -22.338 -40.935 -0.476   1.00 54.03  ? 83   LEU A CD1   1 
ATOM   630   C  CD2   . LEU A 1  95   ? -24.617 -40.405 0.423    1.00 77.78  ? 83   LEU A CD2   1 
ATOM   631   N  N     . VAL A 1  96   ? -24.399 -37.725 3.118    1.00 73.86  ? 84   VAL A N     1 
ATOM   632   C  CA    . VAL A 1  96   ? -24.141 -37.611 4.549    1.00 76.55  ? 84   VAL A CA    1 
ATOM   633   C  C     . VAL A 1  96   ? -23.743 -38.991 5.054    1.00 77.46  ? 84   VAL A C     1 
ATOM   634   O  O     . VAL A 1  96   ? -24.398 -39.991 4.733    1.00 65.14  ? 84   VAL A O     1 
ATOM   635   C  CB    . VAL A 1  96   ? -25.357 -37.052 5.311    1.00 74.01  ? 84   VAL A CB    1 
ATOM   636   C  CG1   . VAL A 1  96   ? -26.603 -37.877 5.044    1.00 70.19  ? 84   VAL A CG1   1 
ATOM   637   C  CG2   . VAL A 1  96   ? -25.065 -36.990 6.801    1.00 101.23 ? 84   VAL A CG2   1 
ATOM   638   N  N     . VAL A 1  97   ? -22.657 -39.050 5.823    1.00 82.70  ? 85   VAL A N     1 
ATOM   639   C  CA    . VAL A 1  97   ? -22.060 -40.324 6.192    1.00 77.76  ? 85   VAL A CA    1 
ATOM   640   C  C     . VAL A 1  97   ? -21.280 -40.132 7.483    1.00 86.33  ? 85   VAL A C     1 
ATOM   641   O  O     . VAL A 1  97   ? -20.772 -39.043 7.763    1.00 90.22  ? 85   VAL A O     1 
ATOM   642   C  CB    . VAL A 1  97   ? -21.170 -40.860 5.040    1.00 69.45  ? 85   VAL A CB    1 
ATOM   643   C  CG1   . VAL A 1  97   ? -19.939 -39.985 4.850    1.00 64.26  ? 85   VAL A CG1   1 
ATOM   644   C  CG2   . VAL A 1  97   ? -20.783 -42.304 5.278    1.00 90.05  ? 85   VAL A CG2   1 
ATOM   645   N  N     . SER A 1  98   ? -21.205 -41.195 8.282    1.00 85.11  ? 86   SER A N     1 
ATOM   646   C  CA    . SER A 1  98   ? -20.440 -41.199 9.519    1.00 83.50  ? 86   SER A CA    1 
ATOM   647   C  C     . SER A 1  98   ? -19.552 -42.434 9.554    1.00 73.18  ? 86   SER A C     1 
ATOM   648   O  O     . SER A 1  98   ? -19.930 -43.502 9.065    1.00 62.25  ? 86   SER A O     1 
ATOM   649   C  CB    . SER A 1  98   ? -21.358 -41.166 10.751   1.00 95.04  ? 86   SER A CB    1 
ATOM   650   O  OG    . SER A 1  98   ? -22.267 -42.254 10.745   1.00 116.24 ? 86   SER A OG    1 
ATOM   651   N  N     . SER A 1  99   ? -18.364 -42.278 10.136   1.00 65.52  ? 87   SER A N     1 
ATOM   652   C  CA    . SER A 1  99   ? -17.362 -43.336 10.169   1.00 80.22  ? 87   SER A CA    1 
ATOM   653   C  C     . SER A 1  99   ? -16.817 -43.490 11.581   1.00 97.02  ? 87   SER A C     1 
ATOM   654   O  O     . SER A 1  99   ? -16.461 -42.498 12.224   1.00 95.83  ? 87   SER A O     1 
ATOM   655   C  CB    . SER A 1  99   ? -16.216 -43.037 9.196    1.00 75.62  ? 87   SER A CB    1 
ATOM   656   O  OG    . SER A 1  99   ? -15.159 -43.968 9.349    1.00 73.08  ? 87   SER A OG    1 
ATOM   657   N  N     . GLU A 1  100  ? -16.745 -44.736 12.055   1.00 101.76 ? 88   GLU A N     1 
ATOM   658   C  CA    . GLU A 1  100  ? -16.160 -45.014 13.361   1.00 90.10  ? 88   GLU A CA    1 
ATOM   659   C  C     . GLU A 1  100  ? -14.644 -45.149 13.308   1.00 88.11  ? 88   GLU A C     1 
ATOM   660   O  O     . GLU A 1  100  ? -13.991 -45.067 14.354   1.00 102.69 ? 88   GLU A O     1 
ATOM   661   C  CB    . GLU A 1  100  ? -16.750 -46.300 13.950   1.00 91.76  ? 88   GLU A CB    1 
ATOM   662   C  CG    . GLU A 1  100  ? -18.266 -46.323 14.075   1.00 103.76 ? 88   GLU A CG    1 
ATOM   663   C  CD    . GLU A 1  100  ? -18.786 -47.686 14.495   1.00 97.84  ? 88   GLU A CD    1 
ATOM   664   O  OE1   . GLU A 1  100  ? -17.957 -48.552 14.843   1.00 76.32  ? 88   GLU A OE1   1 
ATOM   665   O  OE2   . GLU A 1  100  ? -20.018 -47.896 14.471   1.00 102.14 ? 88   GLU A OE2   1 
ATOM   666   N  N     . GLU A 1  101  ? -14.072 -45.337 12.117   1.00 83.10  ? 89   GLU A N     1 
ATOM   667   C  CA    . GLU A 1  101  ? -12.678 -45.753 12.006   1.00 113.31 ? 89   GLU A CA    1 
ATOM   668   C  C     . GLU A 1  101  ? -11.693 -44.613 12.237   1.00 119.23 ? 89   GLU A C     1 
ATOM   669   O  O     . GLU A 1  101  ? -10.583 -44.857 12.726   1.00 123.93 ? 89   GLU A O     1 
ATOM   670   C  CB    . GLU A 1  101  ? -12.434 -46.379 10.631   1.00 119.15 ? 89   GLU A CB    1 
ATOM   671   C  CG    . GLU A 1  101  ? -13.160 -47.699 10.403   1.00 110.68 ? 89   GLU A CG    1 
ATOM   672   C  CD    . GLU A 1  101  ? -12.455 -48.876 11.051   1.00 128.77 ? 89   GLU A CD    1 
ATOM   673   O  OE1   . GLU A 1  101  ? -11.371 -48.673 11.639   1.00 114.17 ? 89   GLU A OE1   1 
ATOM   674   O  OE2   . GLU A 1  101  ? -12.980 -50.006 10.969   1.00 131.57 ? 89   GLU A OE2   1 
ATOM   675   N  N     . ASP A 1  102  ? -12.064 -43.381 11.887   1.00 120.48 ? 90   ASP A N     1 
ATOM   676   C  CA    . ASP A 1  102  ? -11.184 -42.214 11.906   1.00 142.70 ? 90   ASP A CA    1 
ATOM   677   C  C     . ASP A 1  102  ? -9.955  -42.388 11.021   1.00 137.42 ? 90   ASP A C     1 
ATOM   678   O  O     . ASP A 1  102  ? -9.001  -41.609 11.132   1.00 138.82 ? 90   ASP A O     1 
ATOM   679   C  CB    . ASP A 1  102  ? -10.744 -41.849 13.330   1.00 149.01 ? 90   ASP A CB    1 
ATOM   680   C  CG    . ASP A 1  102  ? -11.871 -41.277 14.159   1.00 144.08 ? 90   ASP A CG    1 
ATOM   681   O  OD1   . ASP A 1  102  ? -13.040 -41.396 13.738   1.00 127.89 ? 90   ASP A OD1   1 
ATOM   682   O  OD2   . ASP A 1  102  ? -11.586 -40.703 15.231   1.00 150.44 ? 90   ASP A OD2   1 
ATOM   683   N  N     . GLU A 1  103  ? -9.953  -43.388 10.153   1.00 122.86 ? 91   GLU A N     1 
ATOM   684   C  CA    . GLU A 1  103  ? -8.895  -43.651 9.193    1.00 119.06 ? 91   GLU A CA    1 
ATOM   685   C  C     . GLU A 1  103  ? -9.533  -43.909 7.838    1.00 110.33 ? 91   GLU A C     1 
ATOM   686   O  O     . GLU A 1  103  ? -10.711 -44.274 7.761    1.00 103.30 ? 91   GLU A O     1 
ATOM   687   C  CB    . GLU A 1  103  ? -8.040  -44.854 9.619    1.00 107.49 ? 91   GLU A CB    1 
ATOM   688   C  CG    . GLU A 1  103  ? -8.810  -46.158 9.760    1.00 133.19 ? 91   GLU A CG    1 
ATOM   689   C  CD    . GLU A 1  103  ? -7.941  -47.296 10.264   1.00 158.30 ? 91   GLU A CD    1 
ATOM   690   O  OE1   . GLU A 1  103  ? -6.732  -47.072 10.485   1.00 168.77 ? 91   GLU A OE1   1 
ATOM   691   O  OE2   . GLU A 1  103  ? -8.468  -48.414 10.441   1.00 159.52 ? 91   GLU A OE2   1 
ATOM   692   N  N     . PRO A 1  104  ? -8.793  -43.701 6.749    1.00 92.58  ? 92   PRO A N     1 
ATOM   693   C  CA    . PRO A 1  104  ? -9.362  -43.933 5.415    1.00 64.18  ? 92   PRO A CA    1 
ATOM   694   C  C     . PRO A 1  104  ? -9.926  -45.338 5.268    1.00 68.58  ? 92   PRO A C     1 
ATOM   695   O  O     . PRO A 1  104  ? -9.303  -46.327 5.660    1.00 85.73  ? 92   PRO A O     1 
ATOM   696   C  CB    . PRO A 1  104  ? -8.169  -43.702 4.483    1.00 88.38  ? 92   PRO A CB    1 
ATOM   697   C  CG    . PRO A 1  104  ? -7.319  -42.729 5.219    1.00 94.29  ? 92   PRO A CG    1 
ATOM   698   C  CD    . PRO A 1  104  ? -7.456  -43.086 6.676    1.00 94.42  ? 92   PRO A CD    1 
ATOM   699   N  N     . VAL A 1  105  ? -11.127 -45.416 4.697    1.00 78.01  ? 93   VAL A N     1 
ATOM   700   C  CA    . VAL A 1  105  ? -11.830 -46.678 4.507    1.00 82.10  ? 93   VAL A CA    1 
ATOM   701   C  C     . VAL A 1  105  ? -12.660 -46.556 3.236    1.00 79.79  ? 93   VAL A C     1 
ATOM   702   O  O     . VAL A 1  105  ? -13.067 -45.458 2.845    1.00 93.95  ? 93   VAL A O     1 
ATOM   703   C  CB    . VAL A 1  105  ? -12.693 -47.028 5.743    1.00 66.40  ? 93   VAL A CB    1 
ATOM   704   C  CG1   . VAL A 1  105  ? -13.885 -46.095 5.845    1.00 53.48  ? 93   VAL A CG1   1 
ATOM   705   C  CG2   . VAL A 1  105  ? -13.121 -48.490 5.716    1.00 77.94  ? 93   VAL A CG2   1 
ATOM   706   N  N     . THR A 1  106  ? -12.900 -47.689 2.582    1.00 49.68  ? 94   THR A N     1 
ATOM   707   C  CA    . THR A 1  106  ? -13.376 -47.711 1.205    1.00 65.28  ? 94   THR A CA    1 
ATOM   708   C  C     . THR A 1  106  ? -14.802 -48.242 1.124    1.00 61.32  ? 94   THR A C     1 
ATOM   709   O  O     . THR A 1  106  ? -15.100 -49.323 1.643    1.00 71.15  ? 94   THR A O     1 
ATOM   710   C  CB    . THR A 1  106  ? -12.453 -48.563 0.332    1.00 78.95  ? 94   THR A CB    1 
ATOM   711   O  OG1   . THR A 1  106  ? -11.095 -48.147 0.523    1.00 80.32  ? 94   THR A OG1   1 
ATOM   712   C  CG2   . THR A 1  106  ? -12.817 -48.406 -1.134   1.00 83.53  ? 94   THR A CG2   1 
ATOM   713   N  N     . MET A 1  107  ? -15.669 -47.479 0.462    1.00 58.74  ? 95   MET A N     1 
ATOM   714   C  CA    . MET A 1  107  ? -17.023 -47.891 0.121    1.00 54.52  ? 95   MET A CA    1 
ATOM   715   C  C     . MET A 1  107  ? -17.077 -48.323 -1.340   1.00 76.62  ? 95   MET A C     1 
ATOM   716   O  O     . MET A 1  107  ? -16.267 -47.890 -2.163   1.00 93.79  ? 95   MET A O     1 
ATOM   717   C  CB    . MET A 1  107  ? -18.019 -46.752 0.364    1.00 55.09  ? 95   MET A CB    1 
ATOM   718   C  CG    . MET A 1  107  ? -18.587 -46.698 1.773    1.00 72.35  ? 95   MET A CG    1 
ATOM   719   S  SD    . MET A 1  107  ? -19.132 -45.055 2.286    1.00 70.83  ? 95   MET A SD    1 
ATOM   720   C  CE    . MET A 1  107  ? -20.004 -44.486 0.829    1.00 58.35  ? 95   MET A CE    1 
ATOM   721   N  N     . TYR A 1  108  ? -18.046 -49.178 -1.660   1.00 68.92  ? 96   TYR A N     1 
ATOM   722   C  CA    . TYR A 1  108  ? -18.174 -49.731 -2.999   1.00 68.87  ? 96   TYR A CA    1 
ATOM   723   C  C     . TYR A 1  108  ? -19.603 -49.574 -3.497   1.00 67.70  ? 96   TYR A C     1 
ATOM   724   O  O     . TYR A 1  108  ? -20.553 -49.482 -2.717   1.00 58.65  ? 96   TYR A O     1 
ATOM   725   C  CB    . TYR A 1  108  ? -17.763 -51.207 -3.038   1.00 67.48  ? 96   TYR A CB    1 
ATOM   726   C  CG    . TYR A 1  108  ? -16.288 -51.430 -2.801   1.00 89.21  ? 96   TYR A CG    1 
ATOM   727   C  CD1   . TYR A 1  108  ? -15.784 -51.554 -1.513   1.00 93.48  ? 96   TYR A CD1   1 
ATOM   728   C  CD2   . TYR A 1  108  ? -15.399 -51.513 -3.864   1.00 103.69 ? 96   TYR A CD2   1 
ATOM   729   C  CE1   . TYR A 1  108  ? -14.436 -51.757 -1.290   1.00 104.12 ? 96   TYR A CE1   1 
ATOM   730   C  CE2   . TYR A 1  108  ? -14.049 -51.715 -3.652   1.00 116.83 ? 96   TYR A CE2   1 
ATOM   731   C  CZ    . TYR A 1  108  ? -13.573 -51.836 -2.363   1.00 113.75 ? 96   TYR A CZ    1 
ATOM   732   O  OH    . TYR A 1  108  ? -12.230 -52.038 -2.146   1.00 110.21 ? 96   TYR A OH    1 
ATOM   733   N  N     . LEU A 1  109  ? -19.743 -49.549 -4.821   1.00 83.37  ? 97   LEU A N     1 
ATOM   734   C  CA    . LEU A 1  109  ? -21.054 -49.390 -5.443   1.00 74.81  ? 97   LEU A CA    1 
ATOM   735   C  C     . LEU A 1  109  ? -21.003 -50.013 -6.831   1.00 77.70  ? 97   LEU A C     1 
ATOM   736   O  O     . LEU A 1  109  ? -20.273 -49.527 -7.700   1.00 80.00  ? 97   LEU A O     1 
ATOM   737   C  CB    . LEU A 1  109  ? -21.448 -47.918 -5.511   1.00 63.41  ? 97   LEU A CB    1 
ATOM   738   C  CG    . LEU A 1  109  ? -22.566 -47.549 -6.488   1.00 60.87  ? 97   LEU A CG    1 
ATOM   739   C  CD1   . LEU A 1  109  ? -23.851 -48.292 -6.159   1.00 73.65  ? 97   LEU A CD1   1 
ATOM   740   C  CD2   . LEU A 1  109  ? -22.800 -46.043 -6.514   1.00 71.53  ? 97   LEU A CD2   1 
ATOM   741   N  N     . ARG A 1  110  ? -21.769 -51.083 -7.033   1.00 82.06  ? 98   ARG A N     1 
ATOM   742   C  CA    . ARG A 1  110  ? -21.932 -51.706 -8.341   1.00 78.94  ? 98   ARG A CA    1 
ATOM   743   C  C     . ARG A 1  110  ? -23.414 -51.771 -8.683   1.00 78.94  ? 98   ARG A C     1 
ATOM   744   O  O     . ARG A 1  110  ? -24.221 -52.248 -7.879   1.00 88.44  ? 98   ARG A O     1 
ATOM   745   C  CB    . ARG A 1  110  ? -21.324 -53.112 -8.376   1.00 83.43  ? 98   ARG A CB    1 
ATOM   746   C  CG    . ARG A 1  110  ? -19.817 -53.142 -8.555   1.00 91.91  ? 98   ARG A CG    1 
ATOM   747   C  CD    . ARG A 1  110  ? -19.106 -53.426 -7.247   1.00 103.88 ? 98   ARG A CD    1 
ATOM   748   N  NE    . ARG A 1  110  ? -17.677 -53.643 -7.446   1.00 110.39 ? 98   ARG A NE    1 
ATOM   749   C  CZ    . ARG A 1  110  ? -16.821 -53.920 -6.469   1.00 113.61 ? 98   ARG A CZ    1 
ATOM   750   N  NH1   . ARG A 1  110  ? -17.251 -54.015 -5.218   1.00 122.39 ? 98   ARG A NH1   1 
ATOM   751   N  NH2   . ARG A 1  110  ? -15.536 -54.103 -6.740   1.00 109.41 ? 98   ARG A NH2   1 
ATOM   752   N  N     . LYS A 1  111  ? -23.766 -51.291 -9.874   1.00 82.80  ? 99   LYS A N     1 
ATOM   753   C  CA    . LYS A 1  111  ? -25.137 -51.351 -10.361  1.00 93.30  ? 99   LYS A CA    1 
ATOM   754   C  C     . LYS A 1  111  ? -25.115 -51.444 -11.880  1.00 99.98  ? 99   LYS A C     1 
ATOM   755   O  O     . LYS A 1  111  ? -24.207 -50.922 -12.533  1.00 94.69  ? 99   LYS A O     1 
ATOM   756   C  CB    . LYS A 1  111  ? -25.953 -50.133 -9.911   1.00 94.74  ? 99   LYS A CB    1 
ATOM   757   C  CG    . LYS A 1  111  ? -27.456 -50.294 -10.085  1.00 103.48 ? 99   LYS A CG    1 
ATOM   758   C  CD    . LYS A 1  111  ? -27.991 -51.436 -9.232   1.00 100.34 ? 99   LYS A CD    1 
ATOM   759   C  CE    . LYS A 1  111  ? -29.466 -51.689 -9.503   1.00 123.93 ? 99   LYS A CE    1 
ATOM   760   N  NZ    . LYS A 1  111  ? -30.304 -50.516 -9.131   1.00 109.23 ? 99   LYS A NZ    1 
ATOM   761   N  N     . GLN A 1  112  ? -26.122 -52.117 -12.438  1.00 104.25 ? 100  GLN A N     1 
ATOM   762   C  CA    . GLN A 1  112  ? -26.216 -52.296 -13.882  1.00 91.33  ? 100  GLN A CA    1 
ATOM   763   C  C     . GLN A 1  112  ? -27.669 -52.571 -14.243  1.00 76.08  ? 100  GLN A C     1 
ATOM   764   O  O     . GLN A 1  112  ? -28.501 -52.878 -13.385  1.00 92.34  ? 100  GLN A O     1 
ATOM   765   C  CB    . GLN A 1  112  ? -25.297 -53.427 -14.371  1.00 107.20 ? 100  GLN A CB    1 
ATOM   766   C  CG    . GLN A 1  112  ? -25.096 -53.470 -15.888  1.00 113.87 ? 100  GLN A CG    1 
ATOM   767   C  CD    . GLN A 1  112  ? -24.043 -54.472 -16.322  1.00 137.48 ? 100  GLN A CD    1 
ATOM   768   O  OE1   . GLN A 1  112  ? -23.315 -55.023 -15.497  1.00 163.26 ? 100  GLN A OE1   1 
ATOM   769   N  NE2   . GLN A 1  112  ? -23.955 -54.710 -17.627  1.00 131.65 ? 100  GLN A NE2   1 
ATOM   770   N  N     . GLY A 1  113  ? -27.962 -52.452 -15.534  1.00 60.77  ? 101  GLY A N     1 
ATOM   771   C  CA    . GLY A 1  113  ? -29.299 -52.642 -16.030  1.00 70.04  ? 101  GLY A CA    1 
ATOM   772   C  C     . GLY A 1  113  ? -30.121 -51.383 -15.877  1.00 73.66  ? 101  GLY A C     1 
ATOM   773   O  O     . GLY A 1  113  ? -29.664 -50.376 -15.326  1.00 69.16  ? 101  GLY A O     1 
ATOM   774   N  N     . PRO A 1  114  ? -31.353 -51.413 -16.377  1.00 80.77  ? 102  PRO A N     1 
ATOM   775   C  CA    . PRO A 1  114  ? -32.234 -50.254 -16.217  1.00 81.88  ? 102  PRO A CA    1 
ATOM   776   C  C     . PRO A 1  114  ? -32.537 -50.010 -14.748  1.00 93.82  ? 102  PRO A C     1 
ATOM   777   O  O     . PRO A 1  114  ? -32.754 -50.946 -13.975  1.00 117.88 ? 102  PRO A O     1 
ATOM   778   C  CB    . PRO A 1  114  ? -33.496 -50.652 -16.992  1.00 91.67  ? 102  PRO A CB    1 
ATOM   779   C  CG    . PRO A 1  114  ? -33.081 -51.777 -17.883  1.00 104.63 ? 102  PRO A CG    1 
ATOM   780   C  CD    . PRO A 1  114  ? -31.977 -52.486 -17.163  1.00 95.33  ? 102  PRO A CD    1 
ATOM   781   N  N     . GLY A 1  115  ? -32.548 -48.746 -14.369  1.00 92.91  ? 103  GLY A N     1 
ATOM   782   C  CA    . GLY A 1  115  ? -32.841 -48.382 -12.998  1.00 109.15 ? 103  GLY A CA    1 
ATOM   783   C  C     . GLY A 1  115  ? -32.105 -47.118 -12.604  1.00 88.97  ? 103  GLY A C     1 
ATOM   784   O  O     . GLY A 1  115  ? -31.330 -46.549 -13.370  1.00 86.58  ? 103  GLY A O     1 
ATOM   785   N  N     . GLU A 1  116  ? -32.372 -46.693 -11.374  1.00 81.70  ? 104  GLU A N     1 
ATOM   786   C  CA    . GLU A 1  116  ? -31.779 -45.500 -10.791  1.00 78.50  ? 104  GLU A CA    1 
ATOM   787   C  C     . GLU A 1  116  ? -30.880 -45.904 -9.631   1.00 90.88  ? 104  GLU A C     1 
ATOM   788   O  O     . GLU A 1  116  ? -31.301 -46.660 -8.749   1.00 104.69 ? 104  GLU A O     1 
ATOM   789   C  CB    . GLU A 1  116  ? -32.866 -44.536 -10.311  1.00 86.17  ? 104  GLU A CB    1 
ATOM   790   C  CG    . GLU A 1  116  ? -32.368 -43.430 -9.395   1.00 98.67  ? 104  GLU A CG    1 
ATOM   791   C  CD    . GLU A 1  116  ? -33.478 -42.823 -8.558   1.00 108.54 ? 104  GLU A CD    1 
ATOM   792   O  OE1   . GLU A 1  116  ? -33.354 -41.646 -8.161   1.00 93.24  ? 104  GLU A OE1   1 
ATOM   793   O  OE2   . GLU A 1  116  ? -34.475 -43.529 -8.292   1.00 121.92 ? 104  GLU A OE2   1 
ATOM   794   N  N     . VAL A 1  117  ? -29.649 -45.404 -9.638   1.00 76.94  ? 105  VAL A N     1 
ATOM   795   C  CA    . VAL A 1  117  ? -28.699 -45.660 -8.563   1.00 63.78  ? 105  VAL A CA    1 
ATOM   796   C  C     . VAL A 1  117  ? -28.913 -44.624 -7.470   1.00 91.14  ? 105  VAL A C     1 
ATOM   797   O  O     . VAL A 1  117  ? -28.870 -43.416 -7.729   1.00 94.96  ? 105  VAL A O     1 
ATOM   798   C  CB    . VAL A 1  117  ? -27.252 -45.620 -9.082   1.00 62.49  ? 105  VAL A CB    1 
ATOM   799   C  CG1   . VAL A 1  117  ? -26.276 -45.934 -7.956   1.00 77.73  ? 105  VAL A CG1   1 
ATOM   800   C  CG2   . VAL A 1  117  ? -27.075 -46.587 -10.241  1.00 85.87  ? 105  VAL A CG2   1 
ATOM   801   N  N     . THR A 1  118  ? -29.146 -45.095 -6.251   1.00 94.95  ? 106  THR A N     1 
ATOM   802   C  CA    . THR A 1  118  ? -29.341 -44.232 -5.099   1.00 87.03  ? 106  THR A CA    1 
ATOM   803   C  C     . THR A 1  118  ? -28.230 -44.470 -4.085   1.00 77.28  ? 106  THR A C     1 
ATOM   804   O  O     . THR A 1  118  ? -27.408 -45.380 -4.228   1.00 67.58  ? 106  THR A O     1 
ATOM   805   C  CB    . THR A 1  118  ? -30.713 -44.471 -4.455   1.00 92.77  ? 106  THR A CB    1 
ATOM   806   O  OG1   . THR A 1  118  ? -30.794 -45.825 -3.995   1.00 100.49 ? 106  THR A OG1   1 
ATOM   807   C  CG2   . THR A 1  118  ? -31.824 -44.219 -5.465   1.00 93.70  ? 106  THR A CG2   1 
ATOM   808   N  N     . ALA A 1  119  ? -28.214 -43.630 -3.047   1.00 72.96  ? 107  ALA A N     1 
ATOM   809   C  CA    . ALA A 1  119  ? -27.205 -43.764 -2.001   1.00 64.60  ? 107  ALA A CA    1 
ATOM   810   C  C     . ALA A 1  119  ? -27.329 -45.092 -1.265   1.00 63.15  ? 107  ALA A C     1 
ATOM   811   O  O     . ALA A 1  119  ? -26.339 -45.593 -0.721   1.00 64.40  ? 107  ALA A O     1 
ATOM   812   C  CB    . ALA A 1  119  ? -27.310 -42.599 -1.018   1.00 78.26  ? 107  ALA A CB    1 
ATOM   813   N  N     . GLY A 1  120  ? -28.530 -45.674 -1.235   1.00 76.65  ? 108  GLY A N     1 
ATOM   814   C  CA    . GLY A 1  120  ? -28.710 -46.979 -0.624   1.00 88.76  ? 108  GLY A CA    1 
ATOM   815   C  C     . GLY A 1  120  ? -28.033 -48.106 -1.373   1.00 95.95  ? 108  GLY A C     1 
ATOM   816   O  O     . GLY A 1  120  ? -27.752 -49.151 -0.777   1.00 97.93  ? 108  GLY A O     1 
ATOM   817   N  N     . ASP A 1  121  ? -27.763 -47.917 -2.666   1.00 90.40  ? 109  ASP A N     1 
ATOM   818   C  CA    . ASP A 1  121  ? -27.060 -48.924 -3.449   1.00 79.79  ? 109  ASP A CA    1 
ATOM   819   C  C     . ASP A 1  121  ? -25.595 -49.062 -3.056   1.00 67.20  ? 109  ASP A C     1 
ATOM   820   O  O     . ASP A 1  121  ? -24.928 -49.985 -3.535   1.00 61.21  ? 109  ASP A O     1 
ATOM   821   C  CB    . ASP A 1  121  ? -27.169 -48.596 -4.939   1.00 77.57  ? 109  ASP A CB    1 
ATOM   822   C  CG    . ASP A 1  121  ? -28.547 -48.880 -5.499   1.00 98.63  ? 109  ASP A CG    1 
ATOM   823   O  OD1   . ASP A 1  121  ? -29.008 -50.035 -5.386   1.00 110.14 ? 109  ASP A OD1   1 
ATOM   824   O  OD2   . ASP A 1  121  ? -29.172 -47.946 -6.044   1.00 94.90  ? 109  ASP A OD2   1 
ATOM   825   N  N     . ILE A 1  122  ? -25.080 -48.177 -2.207   1.00 64.24  ? 110  ILE A N     1 
ATOM   826   C  CA    . ILE A 1  122  ? -23.702 -48.270 -1.743   1.00 55.06  ? 110  ILE A CA    1 
ATOM   827   C  C     . ILE A 1  122  ? -23.626 -49.274 -0.603   1.00 59.84  ? 110  ILE A C     1 
ATOM   828   O  O     . ILE A 1  122  ? -24.474 -49.280 0.299    1.00 59.25  ? 110  ILE A O     1 
ATOM   829   C  CB    . ILE A 1  122  ? -23.183 -46.890 -1.300   1.00 63.85  ? 110  ILE A CB    1 
ATOM   830   C  CG1   . ILE A 1  122  ? -23.522 -45.824 -2.342   1.00 72.22  ? 110  ILE A CG1   1 
ATOM   831   C  CG2   . ILE A 1  122  ? -21.684 -46.939 -1.074   1.00 71.16  ? 110  ILE A CG2   1 
ATOM   832   C  CD1   . ILE A 1  122  ? -23.182 -44.413 -1.899   1.00 61.25  ? 110  ILE A CD1   1 
ATOM   833   N  N     . VAL A 1  123  ? -22.611 -50.132 -0.640   1.00 67.92  ? 111  VAL A N     1 
ATOM   834   C  CA    . VAL A 1  123  ? -22.350 -51.089 0.431    1.00 65.84  ? 111  VAL A CA    1 
ATOM   835   C  C     . VAL A 1  123  ? -21.220 -50.525 1.290    1.00 69.46  ? 111  VAL A C     1 
ATOM   836   O  O     . VAL A 1  123  ? -20.057 -50.534 0.850    1.00 70.10  ? 111  VAL A O     1 
ATOM   837   C  CB    . VAL A 1  123  ? -22.002 -52.479 -0.120   1.00 61.72  ? 111  VAL A CB    1 
ATOM   838   C  CG1   . VAL A 1  123  ? -23.272 -53.238 -0.464   1.00 64.52  ? 111  VAL A CG1   1 
ATOM   839   C  CG2   . VAL A 1  123  ? -21.116 -52.371 -1.354   1.00 98.16  ? 111  VAL A CG2   1 
ATOM   840   N  N     . PRO A 1  124  ? -21.503 -50.011 2.483    1.00 70.22  ? 112  PRO A N     1 
ATOM   841   C  CA    . PRO A 1  124  ? -20.439 -49.468 3.326    1.00 65.88  ? 112  PRO A CA    1 
ATOM   842   C  C     . PRO A 1  124  ? -19.751 -50.573 4.105    1.00 67.40  ? 112  PRO A C     1 
ATOM   843   O  O     . PRO A 1  124  ? -20.384 -51.575 4.467    1.00 87.07  ? 112  PRO A O     1 
ATOM   844   C  CB    . PRO A 1  124  ? -21.191 -48.509 4.258    1.00 83.86  ? 112  PRO A CB    1 
ATOM   845   C  CG    . PRO A 1  124  ? -22.532 -49.142 4.405    1.00 102.80 ? 112  PRO A CG    1 
ATOM   846   C  CD    . PRO A 1  124  ? -22.837 -49.801 3.075    1.00 90.66  ? 112  PRO A CD    1 
ATOM   847   N  N     . PRO A 1  125  ? -18.452 -50.436 4.373    1.00 71.12  ? 113  PRO A N     1 
ATOM   848   C  CA    . PRO A 1  125  ? -17.767 -51.426 5.217    1.00 84.68  ? 113  PRO A CA    1 
ATOM   849   C  C     . PRO A 1  125  ? -18.180 -51.291 6.676    1.00 95.33  ? 113  PRO A C     1 
ATOM   850   O  O     . PRO A 1  125  ? -18.955 -50.394 7.018    1.00 101.53 ? 113  PRO A O     1 
ATOM   851   C  CB    . PRO A 1  125  ? -16.287 -51.091 5.010    1.00 80.64  ? 113  PRO A CB    1 
ATOM   852   C  CG    . PRO A 1  125  ? -16.290 -49.634 4.680    1.00 77.96  ? 113  PRO A CG    1 
ATOM   853   C  CD    . PRO A 1  125  ? -17.531 -49.399 3.874    1.00 77.25  ? 113  PRO A CD    1 
ATOM   854   N  N     . ALA A 1  126  ? -17.682 -52.176 7.542    1.00 85.24  ? 114  ALA A N     1 
ATOM   855   C  CA    . ALA A 1  126  ? -18.003 -52.091 8.963    1.00 95.42  ? 114  ALA A CA    1 
ATOM   856   C  C     . ALA A 1  126  ? -17.485 -50.785 9.554    1.00 97.17  ? 114  ALA A C     1 
ATOM   857   O  O     . ALA A 1  126  ? -16.326 -50.412 9.350    1.00 91.80  ? 114  ALA A O     1 
ATOM   858   C  CB    . ALA A 1  126  ? -17.403 -53.280 9.715    1.00 130.03 ? 114  ALA A CB    1 
ATOM   859   N  N     . GLY A 1  127  ? -18.351 -50.090 10.298   1.00 100.54 ? 115  GLY A N     1 
ATOM   860   C  CA    . GLY A 1  127  ? -18.022 -48.835 10.942   1.00 102.00 ? 115  GLY A CA    1 
ATOM   861   C  C     . GLY A 1  127  ? -18.590 -47.614 10.242   1.00 85.78  ? 115  GLY A C     1 
ATOM   862   O  O     . GLY A 1  127  ? -18.793 -46.578 10.888   1.00 86.47  ? 115  GLY A O     1 
ATOM   863   N  N     . VAL A 1  128  ? -18.855 -47.714 8.943    1.00 91.43  ? 116  VAL A N     1 
ATOM   864   C  CA    . VAL A 1  128  ? -19.370 -46.607 8.145    1.00 77.53  ? 116  VAL A CA    1 
ATOM   865   C  C     . VAL A 1  128  ? -20.809 -46.918 7.754    1.00 73.18  ? 116  VAL A C     1 
ATOM   866   O  O     . VAL A 1  128  ? -21.150 -48.073 7.475    1.00 86.21  ? 116  VAL A O     1 
ATOM   867   C  CB    . VAL A 1  128  ? -18.484 -46.371 6.905    1.00 81.05  ? 116  VAL A CB    1 
ATOM   868   C  CG1   . VAL A 1  128  ? -19.021 -45.240 6.055    1.00 81.68  ? 116  VAL A CG1   1 
ATOM   869   C  CG2   . VAL A 1  128  ? -17.063 -46.070 7.338    1.00 99.46  ? 116  VAL A CG2   1 
ATOM   870   N  N     . THR A 1  129  ? -21.656 -45.887 7.746    1.00 71.16  ? 117  THR A N     1 
ATOM   871   C  CA    . THR A 1  129  ? -23.073 -46.063 7.455    1.00 69.79  ? 117  THR A CA    1 
ATOM   872   C  C     . THR A 1  129  ? -23.603 -44.856 6.689    1.00 86.85  ? 117  THR A C     1 
ATOM   873   O  O     . THR A 1  129  ? -23.194 -43.719 6.942    1.00 97.70  ? 117  THR A O     1 
ATOM   874   C  CB    . THR A 1  129  ? -23.879 -46.279 8.745    1.00 95.13  ? 117  THR A CB    1 
ATOM   875   O  OG1   . THR A 1  129  ? -25.275 -46.356 8.435    1.00 126.32 ? 117  THR A OG1   1 
ATOM   876   C  CG2   . THR A 1  129  ? -23.641 -45.146 9.737    1.00 78.28  ? 117  THR A CG2   1 
ATOM   877   N  N     . VAL A 1  130  ? -24.514 -45.117 5.750    1.00 72.68  ? 118  VAL A N     1 
ATOM   878   C  CA    . VAL A 1  130  ? -25.110 -44.093 4.895    1.00 68.98  ? 118  VAL A CA    1 
ATOM   879   C  C     . VAL A 1  130  ? -26.432 -43.657 5.514    1.00 83.60  ? 118  VAL A C     1 
ATOM   880   O  O     . VAL A 1  130  ? -27.249 -44.500 5.907    1.00 101.14 ? 118  VAL A O     1 
ATOM   881   C  CB    . VAL A 1  130  ? -25.310 -44.616 3.461    1.00 76.71  ? 118  VAL A CB    1 
ATOM   882   C  CG1   . VAL A 1  130  ? -25.953 -43.555 2.579    1.00 84.82  ? 118  VAL A CG1   1 
ATOM   883   C  CG2   . VAL A 1  130  ? -23.979 -45.067 2.872    1.00 81.12  ? 118  VAL A CG2   1 
ATOM   884   N  N     . HIS A 1  131  ? -26.648 -42.343 5.598    1.00 73.11  ? 119  HIS A N     1 
ATOM   885   C  CA    . HIS A 1  131  ? -27.742 -41.781 6.380    1.00 92.80  ? 119  HIS A CA    1 
ATOM   886   C  C     . HIS A 1  131  ? -28.894 -41.241 5.541    1.00 86.83  ? 119  HIS A C     1 
ATOM   887   O  O     . HIS A 1  131  ? -29.846 -40.692 6.108    1.00 101.21 ? 119  HIS A O     1 
ATOM   888   C  CB    . HIS A 1  131  ? -27.210 -40.671 7.297    1.00 89.78  ? 119  HIS A CB    1 
ATOM   889   C  CG    . HIS A 1  131  ? -26.348 -41.171 8.413    1.00 70.45  ? 119  HIS A CG    1 
ATOM   890   N  ND1   . HIS A 1  131  ? -26.834 -41.965 9.429    1.00 79.65  ? 119  HIS A ND1   1 
ATOM   891   C  CD2   . HIS A 1  131  ? -25.033 -40.984 8.679    1.00 78.20  ? 119  HIS A CD2   1 
ATOM   892   C  CE1   . HIS A 1  131  ? -25.856 -42.249 10.269   1.00 112.51 ? 119  HIS A CE1   1 
ATOM   893   N  NE2   . HIS A 1  131  ? -24.753 -41.666 9.838    1.00 110.25 ? 119  HIS A NE2   1 
ATOM   894   N  N     . ASN A 1  132  ? -28.835 -41.368 4.218    1.00 56.54  ? 120  ASN A N     1 
ATOM   895   C  CA    . ASN A 1  132  ? -29.965 -41.029 3.350    1.00 75.33  ? 120  ASN A CA    1 
ATOM   896   C  C     . ASN A 1  132  ? -29.949 -41.949 2.142    1.00 74.21  ? 120  ASN A C     1 
ATOM   897   O  O     . ASN A 1  132  ? -29.577 -41.549 1.031    1.00 87.07  ? 120  ASN A O     1 
ATOM   898   C  CB    . ASN A 1  132  ? -29.928 -39.558 2.929    1.00 87.98  ? 120  ASN A CB    1 
ATOM   899   C  CG    . ASN A 1  132  ? -28.546 -39.095 2.523    1.00 80.51  ? 120  ASN A CG    1 
ATOM   900   O  OD1   . ASN A 1  132  ? -27.628 -39.898 2.358    1.00 80.06  ? 120  ASN A OD1   1 
ATOM   901   N  ND2   . ASN A 1  132  ? -28.391 -37.785 2.360    1.00 72.11  ? 120  ASN A ND2   1 
ATOM   902   N  N     . PRO A 1  133  ? -30.370 -43.205 2.319    1.00 64.66  ? 121  PRO A N     1 
ATOM   903   C  CA    . PRO A 1  133  ? -30.291 -44.185 1.223    1.00 78.60  ? 121  PRO A CA    1 
ATOM   904   C  C     . PRO A 1  133  ? -31.156 -43.862 0.007    1.00 82.05  ? 121  PRO A C     1 
ATOM   905   O  O     . PRO A 1  133  ? -31.097 -44.607 -0.974   1.00 94.04  ? 121  PRO A O     1 
ATOM   906   C  CB    . PRO A 1  133  ? -30.764 -45.490 1.890    1.00 105.44 ? 121  PRO A CB    1 
ATOM   907   C  CG    . PRO A 1  133  ? -30.617 -45.259 3.359    1.00 115.82 ? 121  PRO A CG    1 
ATOM   908   C  CD    . PRO A 1  133  ? -30.899 -43.806 3.554    1.00 103.03 ? 121  PRO A CD    1 
ATOM   909   N  N     . GLY A 1  134  ? -31.960 -42.800 0.030    1.00 76.50  ? 122  GLY A N     1 
ATOM   910   C  CA    . GLY A 1  134  ? -32.805 -42.452 -1.095   1.00 82.84  ? 122  GLY A CA    1 
ATOM   911   C  C     . GLY A 1  134  ? -32.290 -41.358 -2.005   1.00 88.67  ? 122  GLY A C     1 
ATOM   912   O  O     . GLY A 1  134  ? -33.014 -40.933 -2.911   1.00 111.35 ? 122  GLY A O     1 
ATOM   913   N  N     . MET A 1  135  ? -31.062 -40.890 -1.800   1.00 79.59  ? 123  MET A N     1 
ATOM   914   C  CA    . MET A 1  135  ? -30.537 -39.793 -2.602   1.00 84.68  ? 123  MET A CA    1 
ATOM   915   C  C     . MET A 1  135  ? -30.228 -40.253 -4.020   1.00 84.14  ? 123  MET A C     1 
ATOM   916   O  O     . MET A 1  135  ? -29.557 -41.269 -4.222   1.00 76.20  ? 123  MET A O     1 
ATOM   917   C  CB    . MET A 1  135  ? -29.275 -39.226 -1.964   1.00 72.98  ? 123  MET A CB    1 
ATOM   918   C  CG    . MET A 1  135  ? -28.512 -38.296 -2.891   1.00 83.92  ? 123  MET A CG    1 
ATOM   919   S  SD    . MET A 1  135  ? -26.840 -38.005 -2.315   1.00 99.48  ? 123  MET A SD    1 
ATOM   920   C  CE    . MET A 1  135  ? -27.192 -37.757 -0.585   1.00 76.16  ? 123  MET A CE    1 
ATOM   921   N  N     . HIS A 1  136  ? -30.707 -39.491 -5.000   1.00 82.87  ? 124  HIS A N     1 
ATOM   922   C  CA    . HIS A 1  136  ? -30.393 -39.762 -6.396   1.00 89.53  ? 124  HIS A CA    1 
ATOM   923   C  C     . HIS A 1  136  ? -28.907 -39.546 -6.658   1.00 81.59  ? 124  HIS A C     1 
ATOM   924   O  O     . HIS A 1  136  ? -28.317 -38.558 -6.213   1.00 87.89  ? 124  HIS A O     1 
ATOM   925   C  CB    . HIS A 1  136  ? -31.224 -38.856 -7.308   1.00 101.48 ? 124  HIS A CB    1 
ATOM   926   C  CG    . HIS A 1  136  ? -31.051 -39.130 -8.771   1.00 83.48  ? 124  HIS A CG    1 
ATOM   927   N  ND1   . HIS A 1  136  ? -29.873 -38.888 -9.444   1.00 83.01  ? 124  HIS A ND1   1 
ATOM   928   C  CD2   . HIS A 1  136  ? -31.920 -39.603 -9.696   1.00 70.42  ? 124  HIS A CD2   1 
ATOM   929   C  CE1   . HIS A 1  136  ? -30.019 -39.215 -10.716  1.00 83.08  ? 124  HIS A CE1   1 
ATOM   930   N  NE2   . HIS A 1  136  ? -31.252 -39.651 -10.895  1.00 83.02  ? 124  HIS A NE2   1 
ATOM   931   N  N     . ILE A 1  137  ? -28.303 -40.481 -7.392   1.00 76.24  ? 125  ILE A N     1 
ATOM   932   C  CA    . ILE A 1  137  ? -26.905 -40.396 -7.794   1.00 75.15  ? 125  ILE A CA    1 
ATOM   933   C  C     . ILE A 1  137  ? -26.763 -40.379 -9.312   1.00 76.65  ? 125  ILE A C     1 
ATOM   934   O  O     . ILE A 1  137  ? -26.077 -39.518 -9.873   1.00 89.25  ? 125  ILE A O     1 
ATOM   935   C  CB    . ILE A 1  137  ? -26.071 -41.544 -7.179   1.00 72.77  ? 125  ILE A CB    1 
ATOM   936   C  CG1   . ILE A 1  137  ? -25.921 -41.347 -5.668   1.00 75.00  ? 125  ILE A CG1   1 
ATOM   937   C  CG2   . ILE A 1  137  ? -24.707 -41.634 -7.847   1.00 53.25  ? 125  ILE A CG2   1 
ATOM   938   C  CD1   . ILE A 1  137  ? -25.027 -42.371 -4.996   1.00 81.50  ? 125  ILE A CD1   1 
ATOM   939   N  N     . ALA A 1  138  ? -27.414 -41.319 -9.995   1.00 63.77  ? 126  ALA A N     1 
ATOM   940   C  CA    . ALA A 1  138  ? -27.335 -41.401 -11.447  1.00 79.73  ? 126  ALA A CA    1 
ATOM   941   C  C     . ALA A 1  138  ? -28.509 -42.212 -11.972  1.00 83.59  ? 126  ALA A C     1 
ATOM   942   O  O     . ALA A 1  138  ? -29.064 -43.059 -11.266  1.00 80.93  ? 126  ALA A O     1 
ATOM   943   C  CB    . ALA A 1  138  ? -26.015 -42.029 -11.907  1.00 78.21  ? 126  ALA A CB    1 
ATOM   944   N  N     . THR A 1  139  ? -28.874 -41.943 -13.222  1.00 71.74  ? 127  THR A N     1 
ATOM   945   C  CA    . THR A 1  139  ? -29.893 -42.699 -13.935  1.00 64.44  ? 127  THR A CA    1 
ATOM   946   C  C     . THR A 1  139  ? -29.215 -43.560 -14.991  1.00 74.50  ? 127  THR A C     1 
ATOM   947   O  O     . THR A 1  139  ? -28.434 -43.053 -15.803  1.00 83.53  ? 127  THR A O     1 
ATOM   948   C  CB    . THR A 1  139  ? -30.919 -41.772 -14.589  1.00 65.47  ? 127  THR A CB    1 
ATOM   949   O  OG1   . THR A 1  139  ? -31.538 -40.957 -13.585  1.00 53.81  ? 127  THR A OG1   1 
ATOM   950   C  CG2   . THR A 1  139  ? -31.987 -42.584 -15.305  1.00 95.38  ? 127  THR A CG2   1 
ATOM   951   N  N     . LEU A 1  140  ? -29.511 -44.856 -14.975  1.00 73.28  ? 128  LEU A N     1 
ATOM   952   C  CA    . LEU A 1  140  ? -28.898 -45.817 -15.878  1.00 61.95  ? 128  LEU A CA    1 
ATOM   953   C  C     . LEU A 1  140  ? -29.962 -46.423 -16.780  1.00 74.42  ? 128  LEU A C     1 
ATOM   954   O  O     . LEU A 1  140  ? -31.066 -46.741 -16.326  1.00 72.62  ? 128  LEU A O     1 
ATOM   955   C  CB    . LEU A 1  140  ? -28.180 -46.930 -15.101  1.00 57.59  ? 128  LEU A CB    1 
ATOM   956   C  CG    . LEU A 1  140  ? -26.755 -46.695 -14.590  1.00 60.55  ? 128  LEU A CG    1 
ATOM   957   C  CD1   . LEU A 1  140  ? -26.670 -45.504 -13.646  1.00 62.48  ? 128  LEU A CD1   1 
ATOM   958   C  CD2   . LEU A 1  140  ? -26.231 -47.952 -13.909  1.00 67.99  ? 128  LEU A CD2   1 
ATOM   959   N  N     . ASN A 1  141  ? -29.631 -46.580 -18.057  1.00 82.93  ? 129  ASN A N     1 
ATOM   960   C  CA    . ASN A 1  141  ? -30.518 -47.253 -18.988  1.00 95.45  ? 129  ASN A CA    1 
ATOM   961   C  C     . ASN A 1  141  ? -30.063 -48.707 -19.155  1.00 86.25  ? 129  ASN A C     1 
ATOM   962   O  O     . ASN A 1  141  ? -29.352 -49.251 -18.302  1.00 85.60  ? 129  ASN A O     1 
ATOM   963   C  CB    . ASN A 1  141  ? -30.576 -46.474 -20.314  1.00 92.72  ? 129  ASN A CB    1 
ATOM   964   C  CG    . ASN A 1  141  ? -29.221 -46.346 -20.997  1.00 93.10  ? 129  ASN A CG    1 
ATOM   965   O  OD1   . ASN A 1  141  ? -28.291 -47.107 -20.728  1.00 88.65  ? 129  ASN A OD1   1 
ATOM   966   N  ND2   . ASN A 1  141  ? -29.112 -45.379 -21.901  1.00 98.58  ? 129  ASN A ND2   1 
ATOM   967   N  N     . ASP A 1  142  ? -30.464 -49.339 -20.260  1.00 87.14  ? 130  ASP A N     1 
ATOM   968   C  CA    . ASP A 1  142  ? -30.146 -50.747 -20.478  1.00 81.95  ? 130  ASP A CA    1 
ATOM   969   C  C     . ASP A 1  142  ? -28.641 -50.970 -20.591  1.00 72.48  ? 130  ASP A C     1 
ATOM   970   O  O     . ASP A 1  142  ? -28.099 -51.916 -20.008  1.00 75.90  ? 130  ASP A O     1 
ATOM   971   C  CB    . ASP A 1  142  ? -30.852 -51.246 -21.739  1.00 110.51 ? 130  ASP A CB    1 
ATOM   972   C  CG    . ASP A 1  142  ? -32.292 -50.775 -21.829  1.00 115.99 ? 130  ASP A CG    1 
ATOM   973   O  OD1   . ASP A 1  142  ? -33.117 -51.206 -20.996  1.00 100.52 ? 130  ASP A OD1   1 
ATOM   974   O  OD2   . ASP A 1  142  ? -32.595 -49.963 -22.730  1.00 115.15 ? 130  ASP A OD2   1 
ATOM   975   N  N     . LYS A 1  143  ? -27.952 -50.110 -21.339  1.00 73.44  ? 131  LYS A N     1 
ATOM   976   C  CA    . LYS A 1  143  ? -26.526 -50.265 -21.599  1.00 71.52  ? 131  LYS A CA    1 
ATOM   977   C  C     . LYS A 1  143  ? -25.647 -49.701 -20.490  1.00 75.39  ? 131  LYS A C     1 
ATOM   978   O  O     . LYS A 1  143  ? -24.418 -49.749 -20.614  1.00 82.17  ? 131  LYS A O     1 
ATOM   979   C  CB    . LYS A 1  143  ? -26.168 -49.588 -22.926  1.00 78.03  ? 131  LYS A CB    1 
ATOM   980   C  CG    . LYS A 1  143  ? -27.153 -49.875 -24.049  1.00 77.58  ? 131  LYS A CG    1 
ATOM   981   C  CD    . LYS A 1  143  ? -26.797 -49.106 -25.311  1.00 77.39  ? 131  LYS A CD    1 
ATOM   982   C  CE    . LYS A 1  143  ? -27.812 -49.355 -26.415  1.00 85.15  ? 131  LYS A CE    1 
ATOM   983   N  NZ    . LYS A 1  143  ? -27.433 -48.664 -27.678  1.00 113.96 ? 131  LYS A NZ    1 
ATOM   984   N  N     . GLY A 1  144  ? -26.233 -49.181 -19.413  1.00 79.31  ? 132  GLY A N     1 
ATOM   985   C  CA    . GLY A 1  144  ? -25.474 -48.468 -18.402  1.00 77.29  ? 132  GLY A CA    1 
ATOM   986   C  C     . GLY A 1  144  ? -25.043 -49.351 -17.247  1.00 79.87  ? 132  GLY A C     1 
ATOM   987   O  O     . GLY A 1  144  ? -25.858 -50.065 -16.658  1.00 90.62  ? 132  GLY A O     1 
ATOM   988   N  N     . LYS A 1  145  ? -23.751 -49.289 -16.924  1.00 67.71  ? 133  LYS A N     1 
ATOM   989   C  CA    . LYS A 1  145  ? -23.172 -49.969 -15.772  1.00 69.46  ? 133  LYS A CA    1 
ATOM   990   C  C     . LYS A 1  145  ? -22.276 -48.988 -15.033  1.00 70.45  ? 133  LYS A C     1 
ATOM   991   O  O     . LYS A 1  145  ? -21.405 -48.360 -15.645  1.00 84.25  ? 133  LYS A O     1 
ATOM   992   C  CB    . LYS A 1  145  ? -22.370 -51.206 -16.194  1.00 87.78  ? 133  LYS A CB    1 
ATOM   993   C  CG    . LYS A 1  145  ? -21.287 -51.621 -15.203  1.00 107.30 ? 133  LYS A CG    1 
ATOM   994   C  CD    . LYS A 1  145  ? -20.471 -52.794 -15.730  1.00 106.40 ? 133  LYS A CD    1 
ATOM   995   C  CE    . LYS A 1  145  ? -19.196 -52.990 -14.922  1.00 114.04 ? 133  LYS A CE    1 
ATOM   996   N  NZ    . LYS A 1  145  ? -19.486 -53.221 -13.480  1.00 107.69 ? 133  LYS A NZ    1 
ATOM   997   N  N     . LEU A 1  146  ? -22.486 -48.860 -13.724  1.00 59.54  ? 134  LEU A N     1 
ATOM   998   C  CA    . LEU A 1  146  ? -21.758 -47.905 -12.897  1.00 59.75  ? 134  LEU A CA    1 
ATOM   999   C  C     . LEU A 1  146  ? -21.072 -48.649 -11.760  1.00 69.18  ? 134  LEU A C     1 
ATOM   1000  O  O     . LEU A 1  146  ? -21.735 -49.323 -10.963  1.00 82.18  ? 134  LEU A O     1 
ATOM   1001  C  CB    . LEU A 1  146  ? -22.697 -46.827 -12.353  1.00 67.32  ? 134  LEU A CB    1 
ATOM   1002  C  CG    . LEU A 1  146  ? -22.035 -45.587 -11.752  1.00 60.01  ? 134  LEU A CG    1 
ATOM   1003  C  CD1   . LEU A 1  146  ? -21.173 -44.879 -12.791  1.00 56.48  ? 134  LEU A CD1   1 
ATOM   1004  C  CD2   . LEU A 1  146  ? -23.086 -44.645 -11.185  1.00 55.93  ? 134  LEU A CD2   1 
ATOM   1005  N  N     . GLU A 1  147  ? -19.746 -48.524 -11.689  1.00 61.38  ? 135  GLU A N     1 
ATOM   1006  C  CA    . GLU A 1  147  ? -18.926 -49.161 -10.663  1.00 75.31  ? 135  GLU A CA    1 
ATOM   1007  C  C     . GLU A 1  147  ? -18.028 -48.097 -10.051  1.00 77.70  ? 135  GLU A C     1 
ATOM   1008  O  O     . GLU A 1  147  ? -17.162 -47.546 -10.738  1.00 78.11  ? 135  GLU A O     1 
ATOM   1009  C  CB    . GLU A 1  147  ? -18.093 -50.302 -11.255  1.00 90.90  ? 135  GLU A CB    1 
ATOM   1010  C  CG    . GLU A 1  147  ? -17.313 -51.110 -10.231  1.00 111.79 ? 135  GLU A CG    1 
ATOM   1011  C  CD    . GLU A 1  147  ? -16.667 -52.340 -10.840  1.00 122.18 ? 135  GLU A CD    1 
ATOM   1012  O  OE1   . GLU A 1  147  ? -15.643 -52.809 -10.299  1.00 131.92 ? 135  GLU A OE1   1 
ATOM   1013  O  OE2   . GLU A 1  147  ? -17.185 -52.835 -11.863  1.00 101.80 ? 135  GLU A OE2   1 
ATOM   1014  N  N     . VAL A 1  148  ? -18.236 -47.804 -8.768   1.00 72.13  ? 136  VAL A N     1 
ATOM   1015  C  CA    . VAL A 1  148  ? -17.616 -46.653 -8.119   1.00 62.64  ? 136  VAL A CA    1 
ATOM   1016  C  C     . VAL A 1  148  ? -17.051 -47.075 -6.769   1.00 69.28  ? 136  VAL A C     1 
ATOM   1017  O  O     . VAL A 1  148  ? -17.726 -47.760 -5.993   1.00 68.14  ? 136  VAL A O     1 
ATOM   1018  C  CB    . VAL A 1  148  ? -18.617 -45.494 -7.935   1.00 60.39  ? 136  VAL A CB    1 
ATOM   1019  C  CG1   . VAL A 1  148  ? -17.926 -44.277 -7.336   1.00 74.76  ? 136  VAL A CG1   1 
ATOM   1020  C  CG2   . VAL A 1  148  ? -19.285 -45.133 -9.255   1.00 71.76  ? 136  VAL A CG2   1 
ATOM   1021  N  N     . GLU A 1  149  ? -15.815 -46.668 -6.493   1.00 71.12  ? 137  GLU A N     1 
ATOM   1022  C  CA    . GLU A 1  149  ? -15.229 -46.736 -5.163   1.00 57.88  ? 137  GLU A CA    1 
ATOM   1023  C  C     . GLU A 1  149  ? -15.278 -45.357 -4.521   1.00 62.51  ? 137  GLU A C     1 
ATOM   1024  O  O     . GLU A 1  149  ? -15.170 -44.336 -5.202   1.00 72.18  ? 137  GLU A O     1 
ATOM   1025  C  CB    . GLU A 1  149  ? -13.778 -47.221 -5.218   1.00 55.30  ? 137  GLU A CB    1 
ATOM   1026  C  CG    . GLU A 1  149  ? -13.593 -48.596 -5.822   1.00 97.01  ? 137  GLU A CG    1 
ATOM   1027  C  CD    . GLU A 1  149  ? -12.135 -48.997 -5.900   1.00 128.63 ? 137  GLU A CD    1 
ATOM   1028  O  OE1   . GLU A 1  149  ? -11.317 -48.422 -5.149   1.00 104.62 ? 137  GLU A OE1   1 
ATOM   1029  O  OE2   . GLU A 1  149  ? -11.805 -49.882 -6.717   1.00 156.14 ? 137  GLU A OE2   1 
ATOM   1030  N  N     . LEU A 1  150  ? -15.441 -45.333 -3.198   1.00 63.50  ? 138  LEU A N     1 
ATOM   1031  C  CA    . LEU A 1  150  ? -15.541 -44.077 -2.457   1.00 49.69  ? 138  LEU A CA    1 
ATOM   1032  C  C     . LEU A 1  150  ? -14.717 -44.186 -1.184   1.00 50.13  ? 138  LEU A C     1 
ATOM   1033  O  O     . LEU A 1  150  ? -15.040 -44.988 -0.302   1.00 62.53  ? 138  LEU A O     1 
ATOM   1034  C  CB    . LEU A 1  150  ? -16.999 -43.738 -2.120   1.00 49.85  ? 138  LEU A CB    1 
ATOM   1035  C  CG    . LEU A 1  150  ? -18.035 -43.710 -3.246   1.00 70.41  ? 138  LEU A CG    1 
ATOM   1036  C  CD1   . LEU A 1  150  ? -18.634 -45.092 -3.478   1.00 79.36  ? 138  LEU A CD1   1 
ATOM   1037  C  CD2   . LEU A 1  150  ? -19.128 -42.692 -2.953   1.00 67.83  ? 138  LEU A CD2   1 
ATOM   1038  N  N     . VAL A 1  151  ? -13.666 -43.381 -1.086   1.00 56.28  ? 139  VAL A N     1 
ATOM   1039  C  CA    . VAL A 1  151  ? -12.838 -43.322 0.112    1.00 55.14  ? 139  VAL A CA    1 
ATOM   1040  C  C     . VAL A 1  151  ? -13.446 -42.314 1.077    1.00 66.42  ? 139  VAL A C     1 
ATOM   1041  O  O     . VAL A 1  151  ? -13.667 -41.151 0.719    1.00 69.36  ? 139  VAL A O     1 
ATOM   1042  C  CB    . VAL A 1  151  ? -11.387 -42.946 -0.234   1.00 70.21  ? 139  VAL A CB    1 
ATOM   1043  C  CG1   . VAL A 1  151  ? -10.649 -42.487 1.011    1.00 63.75  ? 139  VAL A CG1   1 
ATOM   1044  C  CG2   . VAL A 1  151  ? -10.671 -44.127 -0.871   1.00 82.48  ? 139  VAL A CG2   1 
ATOM   1045  N  N     . VAL A 1  152  ? -13.714 -42.754 2.303    1.00 70.55  ? 140  VAL A N     1 
ATOM   1046  C  CA    . VAL A 1  152  ? -14.337 -41.922 3.325    1.00 66.89  ? 140  VAL A CA    1 
ATOM   1047  C  C     . VAL A 1  152  ? -13.360 -41.773 4.481    1.00 72.22  ? 140  VAL A C     1 
ATOM   1048  O  O     . VAL A 1  152  ? -12.940 -42.771 5.081    1.00 81.04  ? 140  VAL A O     1 
ATOM   1049  C  CB    . VAL A 1  152  ? -15.670 -42.513 3.808    1.00 54.16  ? 140  VAL A CB    1 
ATOM   1050  C  CG1   . VAL A 1  152  ? -16.186 -41.746 5.018    1.00 65.89  ? 140  VAL A CG1   1 
ATOM   1051  C  CG2   . VAL A 1  152  ? -16.691 -42.489 2.685    1.00 61.74  ? 140  VAL A CG2   1 
ATOM   1052  N  N     . GLU A 1  153  ? -12.997 -40.534 4.785    1.00 68.33  ? 141  GLU A N     1 
ATOM   1053  C  CA    . GLU A 1  153  ? -12.168 -40.197 5.930    1.00 77.56  ? 141  GLU A CA    1 
ATOM   1054  C  C     . GLU A 1  153  ? -13.002 -39.432 6.953    1.00 81.12  ? 141  GLU A C     1 
ATOM   1055  O  O     . GLU A 1  153  ? -14.213 -39.251 6.796    1.00 68.67  ? 141  GLU A O     1 
ATOM   1056  C  CB    . GLU A 1  153  ? -10.948 -39.386 5.492    1.00 83.55  ? 141  GLU A CB    1 
ATOM   1057  C  CG    . GLU A 1  153  ? -9.988  -40.147 4.599    1.00 89.40  ? 141  GLU A CG    1 
ATOM   1058  C  CD    . GLU A 1  153  ? -8.854  -39.278 4.096    1.00 112.98 ? 141  GLU A CD    1 
ATOM   1059  O  OE1   . GLU A 1  153  ? -8.798  -38.092 4.484    1.00 118.79 ? 141  GLU A OE1   1 
ATOM   1060  O  OE2   . GLU A 1  153  ? -8.022  -39.779 3.312    1.00 130.94 ? 141  GLU A OE2   1 
ATOM   1061  N  N     . ARG A 1  154  ? -12.338 -38.976 8.013    1.00 84.26  ? 142  ARG A N     1 
ATOM   1062  C  CA    . ARG A 1  154  ? -13.009 -38.252 9.086    1.00 71.56  ? 142  ARG A CA    1 
ATOM   1063  C  C     . ARG A 1  154  ? -12.170 -37.050 9.492    1.00 92.99  ? 142  ARG A C     1 
ATOM   1064  O  O     . ARG A 1  154  ? -10.991 -37.194 9.829    1.00 121.44 ? 142  ARG A O     1 
ATOM   1065  C  CB    . ARG A 1  154  ? -13.260 -39.162 10.292   1.00 99.12  ? 142  ARG A CB    1 
ATOM   1066  C  CG    . ARG A 1  154  ? -14.232 -38.582 11.300   1.00 120.37 ? 142  ARG A CG    1 
ATOM   1067  C  CD    . ARG A 1  154  ? -15.011 -39.685 11.987   1.00 102.28 ? 142  ARG A CD    1 
ATOM   1068  N  NE    . ARG A 1  154  ? -16.085 -39.153 12.815   1.00 102.76 ? 142  ARG A NE    1 
ATOM   1069  C  CZ    . ARG A 1  154  ? -15.924 -38.733 14.064   1.00 112.70 ? 142  ARG A CZ    1 
ATOM   1070  N  NH1   . ARG A 1  154  ? -14.727 -38.782 14.634   1.00 111.37 ? 142  ARG A NH1   1 
ATOM   1071  N  NH2   . ARG A 1  154  ? -16.959 -38.261 14.744   1.00 121.39 ? 142  ARG A NH2   1 
ATOM   1072  N  N     . GLY A 1  155  ? -12.782 -35.875 9.461    1.00 87.20  ? 143  GLY A N     1 
ATOM   1073  C  CA    . GLY A 1  155  ? -12.147 -34.642 9.894    1.00 108.15 ? 143  GLY A CA    1 
ATOM   1074  C  C     . GLY A 1  155  ? -13.190 -33.688 10.443   1.00 88.44  ? 143  GLY A C     1 
ATOM   1075  O  O     . GLY A 1  155  ? -14.194 -34.111 11.026   1.00 92.31  ? 143  GLY A O     1 
ATOM   1076  N  N     . ARG A 1  156  ? -12.953 -32.389 10.263   1.00 71.80  ? 144  ARG A N     1 
ATOM   1077  C  CA    . ARG A 1  156  ? -13.913 -31.374 10.675   1.00 79.95  ? 144  ARG A CA    1 
ATOM   1078  C  C     . ARG A 1  156  ? -13.836 -30.192 9.721    1.00 80.18  ? 144  ARG A C     1 
ATOM   1079  O  O     . ARG A 1  156  ? -12.796 -29.940 9.106    1.00 87.14  ? 144  ARG A O     1 
ATOM   1080  C  CB    . ARG A 1  156  ? -13.670 -30.909 12.111   1.00 98.83  ? 144  ARG A CB    1 
ATOM   1081  C  CG    . ARG A 1  156  ? -12.360 -30.189 12.305   1.00 103.74 ? 144  ARG A CG    1 
ATOM   1082  C  CD    . ARG A 1  156  ? -12.271 -29.634 13.702   1.00 95.03  ? 144  ARG A CD    1 
ATOM   1083  N  NE    . ARG A 1  156  ? -11.103 -28.780 13.855   1.00 107.41 ? 144  ARG A NE    1 
ATOM   1084  C  CZ    . ARG A 1  156  ? -9.894  -29.228 14.169   1.00 129.17 ? 144  ARG A CZ    1 
ATOM   1085  N  NH1   . ARG A 1  156  ? -9.697  -30.524 14.363   1.00 144.39 ? 144  ARG A NH1   1 
ATOM   1086  N  NH2   . ARG A 1  156  ? -8.885  -28.380 14.289   1.00 125.64 ? 144  ARG A NH2   1 
ATOM   1087  N  N     . GLY A 1  157  ? -14.950 -29.470 9.605    1.00 76.73  ? 145  GLY A N     1 
ATOM   1088  C  CA    . GLY A 1  157  ? -15.016 -28.286 8.766    1.00 78.15  ? 145  GLY A CA    1 
ATOM   1089  C  C     . GLY A 1  157  ? -15.161 -28.587 7.288    1.00 77.12  ? 145  GLY A C     1 
ATOM   1090  O  O     . GLY A 1  157  ? -15.926 -29.475 6.895    1.00 81.06  ? 145  GLY A O     1 
ATOM   1091  N  N     . TYR A 1  158  ? -14.431 -27.845 6.456    1.00 81.96  ? 146  TYR A N     1 
ATOM   1092  C  CA    . TYR A 1  158  ? -14.435 -28.037 5.009    1.00 80.02  ? 146  TYR A CA    1 
ATOM   1093  C  C     . TYR A 1  158  ? -12.996 -28.048 4.520    1.00 75.00  ? 146  TYR A C     1 
ATOM   1094  O  O     . TYR A 1  158  ? -12.252 -27.091 4.757    1.00 80.01  ? 146  TYR A O     1 
ATOM   1095  C  CB    . TYR A 1  158  ? -15.241 -26.940 4.303    1.00 82.12  ? 146  TYR A CB    1 
ATOM   1096  C  CG    . TYR A 1  158  ? -14.897 -26.773 2.836    1.00 74.29  ? 146  TYR A CG    1 
ATOM   1097  C  CD1   . TYR A 1  158  ? -14.028 -25.774 2.417    1.00 75.21  ? 146  TYR A CD1   1 
ATOM   1098  C  CD2   . TYR A 1  158  ? -15.436 -27.618 1.874    1.00 80.93  ? 146  TYR A CD2   1 
ATOM   1099  C  CE1   . TYR A 1  158  ? -13.705 -25.620 1.085    1.00 83.46  ? 146  TYR A CE1   1 
ATOM   1100  C  CE2   . TYR A 1  158  ? -15.119 -27.470 0.536    1.00 90.24  ? 146  TYR A CE2   1 
ATOM   1101  C  CZ    . TYR A 1  158  ? -14.252 -26.470 0.150    1.00 80.89  ? 146  TYR A CZ    1 
ATOM   1102  O  OH    . TYR A 1  158  ? -13.929 -26.314 -1.175   1.00 59.90  ? 146  TYR A OH    1 
ATOM   1103  N  N     . VAL A 1  159  ? -12.606 -29.122 3.842    1.00 65.61  ? 147  VAL A N     1 
ATOM   1104  C  CA    . VAL A 1  159  ? -11.289 -29.244 3.229    1.00 90.02  ? 147  VAL A CA    1 
ATOM   1105  C  C     . VAL A 1  159  ? -11.484 -29.402 1.729    1.00 80.65  ? 147  VAL A C     1 
ATOM   1106  O  O     . VAL A 1  159  ? -12.297 -30.224 1.302    1.00 69.17  ? 147  VAL A O     1 
ATOM   1107  C  CB    . VAL A 1  159  ? -10.473 -30.421 3.798    1.00 77.40  ? 147  VAL A CB    1 
ATOM   1108  C  CG1   . VAL A 1  159  ? -11.237 -31.729 3.690    1.00 62.34  ? 147  VAL A CG1   1 
ATOM   1109  C  CG2   . VAL A 1  159  ? -9.123  -30.525 3.099    1.00 109.90 ? 147  VAL A CG2   1 
ATOM   1110  N  N     . PRO A 1  160  ? -10.799 -28.621 0.898    1.00 69.96  ? 148  PRO A N     1 
ATOM   1111  C  CA    . PRO A 1  160  ? -10.922 -28.795 -0.553   1.00 74.12  ? 148  PRO A CA    1 
ATOM   1112  C  C     . PRO A 1  160  ? -10.263 -30.091 -1.001   1.00 78.82  ? 148  PRO A C     1 
ATOM   1113  O  O     . PRO A 1  160  ? -9.563  -30.765 -0.242   1.00 75.54  ? 148  PRO A O     1 
ATOM   1114  C  CB    . PRO A 1  160  ? -10.203 -27.569 -1.127   1.00 85.14  ? 148  PRO A CB    1 
ATOM   1115  C  CG    . PRO A 1  160  ? -10.105 -26.597 0.019    1.00 90.28  ? 148  PRO A CG    1 
ATOM   1116  C  CD    . PRO A 1  160  ? -9.987  -27.445 1.245    1.00 84.51  ? 148  PRO A CD    1 
ATOM   1117  N  N     . ALA A 1  161  ? -10.502 -30.434 -2.266   1.00 78.45  ? 149  ALA A N     1 
ATOM   1118  C  CA    . ALA A 1  161  ? -9.958  -31.663 -2.827   1.00 72.40  ? 149  ALA A CA    1 
ATOM   1119  C  C     . ALA A 1  161  ? -8.438  -31.664 -2.744   1.00 74.98  ? 149  ALA A C     1 
ATOM   1120  O  O     . ALA A 1  161  ? -7.777  -30.715 -3.177   1.00 66.20  ? 149  ALA A O     1 
ATOM   1121  C  CB    . ALA A 1  161  ? -10.409 -31.826 -4.279   1.00 72.89  ? 149  ALA A CB    1 
ATOM   1122  N  N     . VAL A 1  162  ? -7.883  -32.735 -2.176   1.00 82.88  ? 150  VAL A N     1 
ATOM   1123  C  CA    . VAL A 1  162  ? -6.436  -32.841 -2.039   1.00 94.47  ? 150  VAL A CA    1 
ATOM   1124  C  C     . VAL A 1  162  ? -5.823  -33.096 -3.409   1.00 117.01 ? 150  VAL A C     1 
ATOM   1125  O  O     . VAL A 1  162  ? -6.289  -33.959 -4.165   1.00 124.19 ? 150  VAL A O     1 
ATOM   1126  C  CB    . VAL A 1  162  ? -6.067  -33.947 -1.039   1.00 75.83  ? 150  VAL A CB    1 
ATOM   1127  C  CG1   . VAL A 1  162  ? -4.594  -33.854 -0.674   1.00 95.41  ? 150  VAL A CG1   1 
ATOM   1128  C  CG2   . VAL A 1  162  ? -6.938  -33.854 0.209    1.00 64.99  ? 150  VAL A CG2   1 
ATOM   1129  N  N     . GLN A 1  163  ? -4.780  -32.336 -3.738   1.00 133.55 ? 151  GLN A N     1 
ATOM   1130  C  CA    . GLN A 1  163  ? -4.148  -32.442 -5.046   1.00 148.36 ? 151  GLN A CA    1 
ATOM   1131  C  C     . GLN A 1  163  ? -3.530  -33.822 -5.245   1.00 142.40 ? 151  GLN A C     1 
ATOM   1132  O  O     . GLN A 1  163  ? -3.146  -34.502 -4.290   1.00 127.01 ? 151  GLN A O     1 
ATOM   1133  C  CB    . GLN A 1  163  ? -3.068  -31.371 -5.203   1.00 151.79 ? 151  GLN A CB    1 
ATOM   1134  C  CG    . GLN A 1  163  ? -3.562  -29.947 -5.027   1.00 150.64 ? 151  GLN A CG    1 
ATOM   1135  C  CD    . GLN A 1  163  ? -2.432  -28.937 -5.050   1.00 148.66 ? 151  GLN A CD    1 
ATOM   1136  O  OE1   . GLN A 1  163  ? -1.270  -29.282 -4.834   1.00 150.28 ? 151  GLN A OE1   1 
ATOM   1137  N  NE2   . GLN A 1  163  ? -2.767  -27.680 -5.317   1.00 123.90 ? 151  GLN A NE2   1 
ATOM   1138  N  N     . ASN A 1  164  ? -3.436  -34.234 -6.513   1.00 142.06 ? 152  ASN A N     1 
ATOM   1139  C  CA    . ASN A 1  164  ? -2.733  -35.468 -6.841   1.00 142.40 ? 152  ASN A CA    1 
ATOM   1140  C  C     . ASN A 1  164  ? -1.224  -35.317 -6.714   1.00 160.86 ? 152  ASN A C     1 
ATOM   1141  O  O     . ASN A 1  164  ? -0.531  -36.317 -6.504   1.00 169.61 ? 152  ASN A O     1 
ATOM   1142  C  CB    . ASN A 1  164  ? -3.093  -35.927 -8.256   1.00 149.25 ? 152  ASN A CB    1 
ATOM   1143  C  CG    . ASN A 1  164  ? -4.496  -36.490 -8.347   1.00 138.87 ? 152  ASN A CG    1 
ATOM   1144  O  OD1   . ASN A 1  164  ? -5.343  -36.210 -7.502   1.00 158.38 ? 152  ASN A OD1   1 
ATOM   1145  N  ND2   . ASN A 1  164  ? -4.747  -37.292 -9.375   1.00 106.52 ? 152  ASN A ND2   1 
ATOM   1146  N  N     . ARG A 1  165  ? -0.702  -34.095 -6.841   1.00 163.47 ? 153  ARG A N     1 
ATOM   1147  C  CA    . ARG A 1  165  ? 0.724   -33.878 -6.624   1.00 163.24 ? 153  ARG A CA    1 
ATOM   1148  C  C     . ARG A 1  165  ? 1.074   -33.910 -5.142   1.00 151.12 ? 153  ARG A C     1 
ATOM   1149  O  O     . ARG A 1  165  ? 2.181   -34.324 -4.777   1.00 137.33 ? 153  ARG A O     1 
ATOM   1150  C  CB    . ARG A 1  165  ? 1.156   -32.550 -7.247   1.00 162.00 ? 153  ARG A CB    1 
ATOM   1151  C  CG    . ARG A 1  165  ? 1.015   -32.493 -8.759   1.00 160.65 ? 153  ARG A CG    1 
ATOM   1152  C  CD    . ARG A 1  165  ? 1.998   -33.426 -9.442   1.00 169.52 ? 153  ARG A CD    1 
ATOM   1153  N  NE    . ARG A 1  165  ? 3.384   -33.035 -9.202   1.00 175.29 ? 153  ARG A NE    1 
ATOM   1154  C  CZ    . ARG A 1  165  ? 4.432   -33.650 -9.738   1.00 156.74 ? 153  ARG A CZ    1 
ATOM   1155  N  NH1   . ARG A 1  165  ? 4.249   -34.685 -10.546  1.00 112.88 ? 153  ARG A NH1   1 
ATOM   1156  N  NH2   . ARG A 1  165  ? 5.661   -33.231 -9.468   1.00 152.21 ? 153  ARG A NH2   1 
ATOM   1157  N  N     . ALA A 1  166  ? 0.153   -33.479 -4.276   1.00 155.27 ? 154  ALA A N     1 
ATOM   1158  C  CA    . ALA A 1  166  ? 0.408   -33.512 -2.840   1.00 146.10 ? 154  ALA A CA    1 
ATOM   1159  C  C     . ALA A 1  166  ? 0.157   -34.898 -2.257   1.00 146.66 ? 154  ALA A C     1 
ATOM   1160  O  O     . ALA A 1  166  ? 0.899   -35.348 -1.377   1.00 147.77 ? 154  ALA A O     1 
ATOM   1161  C  CB    . ALA A 1  166  ? -0.454  -32.471 -2.125   1.00 140.44 ? 154  ALA A CB    1 
ATOM   1162  N  N     . SER A 1  167  ? -0.885  -35.580 -2.724   1.00 150.65 ? 155  SER A N     1 
ATOM   1163  C  CA    . SER A 1  167  ? -1.150  -36.941 -2.290   1.00 144.37 ? 155  SER A CA    1 
ATOM   1164  C  C     . SER A 1  167  ? -0.336  -37.934 -3.115   1.00 153.09 ? 155  SER A C     1 
ATOM   1165  O  O     . SER A 1  167  ? 0.230   -37.605 -4.160   1.00 175.59 ? 155  SER A O     1 
ATOM   1166  C  CB    . SER A 1  167  ? -2.640  -37.266 -2.405   1.00 135.34 ? 155  SER A CB    1 
ATOM   1167  O  OG    . SER A 1  167  ? -3.379  -36.698 -1.340   1.00 115.75 ? 155  SER A OG    1 
ATOM   1168  N  N     . GLY A 1  168  ? -0.277  -39.168 -2.624   1.00 146.78 ? 156  GLY A N     1 
ATOM   1169  C  CA    . GLY A 1  168  ? 0.281   -40.257 -3.391   1.00 142.41 ? 156  GLY A CA    1 
ATOM   1170  C  C     . GLY A 1  168  ? -0.686  -40.894 -4.358   1.00 145.92 ? 156  GLY A C     1 
ATOM   1171  O  O     . GLY A 1  168  ? -0.373  -41.929 -4.951   1.00 144.22 ? 156  GLY A O     1 
ATOM   1172  N  N     . ALA A 1  169  ? -1.861  -40.294 -4.535   1.00 159.50 ? 157  ALA A N     1 
ATOM   1173  C  CA    . ALA A 1  169  ? -2.890  -40.877 -5.383   1.00 157.44 ? 157  ALA A CA    1 
ATOM   1174  C  C     . ALA A 1  169  ? -2.454  -40.878 -6.841   1.00 135.43 ? 157  ALA A C     1 
ATOM   1175  O  O     . ALA A 1  169  ? -1.904  -39.895 -7.347   1.00 115.69 ? 157  ALA A O     1 
ATOM   1176  C  CB    . ALA A 1  169  ? -4.203  -40.111 -5.229   1.00 140.45 ? 157  ALA A CB    1 
ATOM   1177  N  N     . GLU A 1  170  ? -2.707  -41.992 -7.517   1.00 125.01 ? 158  GLU A N     1 
ATOM   1178  C  CA    . GLU A 1  170  ? -2.335  -42.148 -8.912   1.00 107.53 ? 158  GLU A CA    1 
ATOM   1179  C  C     . GLU A 1  170  ? -3.441  -41.575 -9.800   1.00 106.56 ? 158  GLU A C     1 
ATOM   1180  O  O     . GLU A 1  170  ? -4.367  -40.911 -9.327   1.00 114.12 ? 158  GLU A O     1 
ATOM   1181  C  CB    . GLU A 1  170  ? -2.017  -43.615 -9.196   1.00 120.81 ? 158  GLU A CB    1 
ATOM   1182  C  CG    . GLU A 1  170  ? -0.641  -44.037 -8.684   1.00 149.27 ? 158  GLU A CG    1 
ATOM   1183  C  CD    . GLU A 1  170  ? -0.481  -45.542 -8.573   1.00 167.66 ? 158  GLU A CD    1 
ATOM   1184  O  OE1   . GLU A 1  170  ? -1.467  -46.220 -8.218   1.00 175.18 ? 158  GLU A OE1   1 
ATOM   1185  O  OE2   . GLU A 1  170  ? 0.631   -46.046 -8.841   1.00 166.69 ? 158  GLU A OE2   1 
ATOM   1186  N  N     . ILE A 1  171  ? -3.354  -41.837 -11.106  1.00 96.23  ? 159  ILE A N     1 
ATOM   1187  C  CA    . ILE A 1  171  ? -4.128  -41.069 -12.079  1.00 88.16  ? 159  ILE A CA    1 
ATOM   1188  C  C     . ILE A 1  171  ? -5.619  -41.367 -11.957  1.00 90.30  ? 159  ILE A C     1 
ATOM   1189  O  O     . ILE A 1  171  ? -6.458  -40.466 -12.095  1.00 103.72 ? 159  ILE A O     1 
ATOM   1190  C  CB    . ILE A 1  171  ? -3.599  -41.339 -13.502  1.00 63.81  ? 159  ILE A CB    1 
ATOM   1191  C  CG1   . ILE A 1  171  ? -2.387  -40.449 -13.807  1.00 64.56  ? 159  ILE A CG1   1 
ATOM   1192  C  CG2   . ILE A 1  171  ? -4.689  -41.134 -14.546  1.00 91.31  ? 159  ILE A CG2   1 
ATOM   1193  C  CD1   . ILE A 1  171  ? -1.106  -40.848 -13.093  1.00 54.96  ? 159  ILE A CD1   1 
ATOM   1194  N  N     . GLY A 1  172  ? -5.977  -42.622 -11.677  1.00 80.64  ? 160  GLY A N     1 
ATOM   1195  C  CA    . GLY A 1  172  ? -7.380  -43.001 -11.677  1.00 92.30  ? 160  GLY A CA    1 
ATOM   1196  C  C     . GLY A 1  172  ? -8.201  -42.334 -10.591  1.00 95.93  ? 160  GLY A C     1 
ATOM   1197  O  O     . GLY A 1  172  ? -9.414  -42.162 -10.745  1.00 73.55  ? 160  GLY A O     1 
ATOM   1198  N  N     . ARG A 1  173  ? -7.563  -41.941 -9.492   1.00 96.87  ? 161  ARG A N     1 
ATOM   1199  C  CA    . ARG A 1  173  ? -8.294  -41.401 -8.354   1.00 80.38  ? 161  ARG A CA    1 
ATOM   1200  C  C     . ARG A 1  173  ? -8.780  -39.983 -8.637   1.00 63.68  ? 161  ARG A C     1 
ATOM   1201  O  O     . ARG A 1  173  ? -8.042  -39.149 -9.169   1.00 76.71  ? 161  ARG A O     1 
ATOM   1202  C  CB    . ARG A 1  173  ? -7.410  -41.423 -7.109   1.00 97.04  ? 161  ARG A CB    1 
ATOM   1203  C  CG    . ARG A 1  173  ? -8.097  -40.948 -5.843   1.00 86.00  ? 161  ARG A CG    1 
ATOM   1204  C  CD    . ARG A 1  173  ? -7.547  -41.661 -4.616   1.00 75.67  ? 161  ARG A CD    1 
ATOM   1205  N  NE    . ARG A 1  173  ? -8.142  -42.984 -4.437   1.00 83.21  ? 161  ARG A NE    1 
ATOM   1206  C  CZ    . ARG A 1  173  ? -7.598  -44.119 -4.862   1.00 103.27 ? 161  ARG A CZ    1 
ATOM   1207  N  NH1   . ARG A 1  173  ? -6.434  -44.106 -5.497   1.00 90.30  ? 161  ARG A NH1   1 
ATOM   1208  N  NH2   . ARG A 1  173  ? -8.219  -45.272 -4.650   1.00 116.13 ? 161  ARG A NH2   1 
ATOM   1209  N  N     . ILE A 1  174  ? -10.032 -39.718 -8.275   1.00 54.96  ? 162  ILE A N     1 
ATOM   1210  C  CA    . ILE A 1  174  ? -10.651 -38.411 -8.483   1.00 58.05  ? 162  ILE A CA    1 
ATOM   1211  C  C     . ILE A 1  174  ? -10.941 -37.767 -7.132   1.00 61.25  ? 162  ILE A C     1 
ATOM   1212  O  O     . ILE A 1  174  ? -11.940 -38.111 -6.484   1.00 68.12  ? 162  ILE A O     1 
ATOM   1213  C  CB    . ILE A 1  174  ? -11.937 -38.527 -9.313   1.00 50.47  ? 162  ILE A CB    1 
ATOM   1214  C  CG1   . ILE A 1  174  ? -11.652 -39.190 -10.661  1.00 54.60  ? 162  ILE A CG1   1 
ATOM   1215  C  CG2   . ILE A 1  174  ? -12.549 -37.161 -9.515   1.00 63.32  ? 162  ILE A CG2   1 
ATOM   1216  C  CD1   . ILE A 1  174  ? -12.866 -39.283 -11.562  1.00 59.24  ? 162  ILE A CD1   1 
ATOM   1217  N  N     . PRO A 1  175  ? -10.105 -36.842 -6.667   1.00 55.55  ? 163  PRO A N     1 
ATOM   1218  C  CA    . PRO A 1  175  ? -10.366 -36.194 -5.377   1.00 50.64  ? 163  PRO A CA    1 
ATOM   1219  C  C     . PRO A 1  175  ? -11.595 -35.301 -5.423   1.00 55.94  ? 163  PRO A C     1 
ATOM   1220  O  O     . PRO A 1  175  ? -11.921 -34.695 -6.447   1.00 62.19  ? 163  PRO A O     1 
ATOM   1221  C  CB    . PRO A 1  175  ? -9.096  -35.372 -5.129   1.00 59.56  ? 163  PRO A CB    1 
ATOM   1222  C  CG    . PRO A 1  175  ? -8.055  -36.020 -5.973   1.00 64.02  ? 163  PRO A CG    1 
ATOM   1223  C  CD    . PRO A 1  175  ? -8.772  -36.506 -7.193   1.00 65.25  ? 163  PRO A CD    1 
ATOM   1224  N  N     . VAL A 1  176  ? -12.277 -35.224 -4.280   1.00 50.73  ? 164  VAL A N     1 
ATOM   1225  C  CA    . VAL A 1  176  ? -13.483 -34.425 -4.118   1.00 64.38  ? 164  VAL A CA    1 
ATOM   1226  C  C     . VAL A 1  176  ? -13.291 -33.505 -2.919   1.00 69.17  ? 164  VAL A C     1 
ATOM   1227  O  O     . VAL A 1  176  ? -12.502 -33.784 -2.014   1.00 88.98  ? 164  VAL A O     1 
ATOM   1228  C  CB    . VAL A 1  176  ? -14.741 -35.305 -3.923   1.00 59.87  ? 164  VAL A CB    1 
ATOM   1229  C  CG1   . VAL A 1  176  ? -16.007 -34.507 -4.190   1.00 56.48  ? 164  VAL A CG1   1 
ATOM   1230  C  CG2   . VAL A 1  176  ? -14.686 -36.543 -4.810   1.00 66.04  ? 164  VAL A CG2   1 
ATOM   1231  N  N     . ASP A 1  177  ? -14.016 -32.389 -2.926   1.00 62.49  ? 165  ASP A N     1 
ATOM   1232  C  CA    . ASP A 1  177  ? -14.113 -31.568 -1.727   1.00 76.55  ? 165  ASP A CA    1 
ATOM   1233  C  C     . ASP A 1  177  ? -14.880 -32.326 -0.649   1.00 66.94  ? 165  ASP A C     1 
ATOM   1234  O  O     . ASP A 1  177  ? -15.842 -33.044 -0.938   1.00 80.96  ? 165  ASP A O     1 
ATOM   1235  C  CB    . ASP A 1  177  ? -14.809 -30.240 -2.031   1.00 94.96  ? 165  ASP A CB    1 
ATOM   1236  C  CG    . ASP A 1  177  ? -14.120 -29.453 -3.127   1.00 86.37  ? 165  ASP A CG    1 
ATOM   1237  O  OD1   . ASP A 1  177  ? -12.872 -29.462 -3.174   1.00 85.24  ? 165  ASP A OD1   1 
ATOM   1238  O  OD2   . ASP A 1  177  ? -14.831 -28.825 -3.941   1.00 90.91  ? 165  ASP A OD2   1 
ATOM   1239  N  N     . SER A 1  178  ? -14.449 -32.169 0.599    1.00 53.16  ? 166  SER A N     1 
ATOM   1240  C  CA    . SER A 1  178  ? -15.049 -32.860 1.735    1.00 62.11  ? 166  SER A CA    1 
ATOM   1241  C  C     . SER A 1  178  ? -15.682 -31.837 2.672    1.00 70.19  ? 166  SER A C     1 
ATOM   1242  O  O     . SER A 1  178  ? -14.992 -30.947 3.182    1.00 71.31  ? 166  SER A O     1 
ATOM   1243  C  CB    . SER A 1  178  ? -14.004 -33.695 2.478    1.00 84.40  ? 166  SER A CB    1 
ATOM   1244  O  OG    . SER A 1  178  ? -13.364 -34.616 1.610    1.00 70.18  ? 166  SER A OG    1 
ATOM   1245  N  N     . ILE A 1  179  ? -16.987 -31.963 2.892    1.00 63.65  ? 167  ILE A N     1 
ATOM   1246  C  CA    . ILE A 1  179  ? -17.728 -31.103 3.810    1.00 64.80  ? 167  ILE A CA    1 
ATOM   1247  C  C     . ILE A 1  179  ? -17.961 -31.925 5.070    1.00 79.81  ? 167  ILE A C     1 
ATOM   1248  O  O     . ILE A 1  179  ? -18.821 -32.806 5.102    1.00 77.15  ? 167  ILE A O     1 
ATOM   1249  C  CB    . ILE A 1  179  ? -19.046 -30.615 3.202    1.00 58.28  ? 167  ILE A CB    1 
ATOM   1250  C  CG1   . ILE A 1  179  ? -18.804 -29.986 1.826    1.00 58.89  ? 167  ILE A CG1   1 
ATOM   1251  C  CG2   . ILE A 1  179  ? -19.731 -29.625 4.140    1.00 80.75  ? 167  ILE A CG2   1 
ATOM   1252  C  CD1   . ILE A 1  179  ? -20.067 -29.493 1.140    1.00 58.90  ? 167  ILE A CD1   1 
ATOM   1253  N  N     . TYR A 1  180  ? -17.186 -31.642 6.113    1.00 77.86  ? 168  TYR A N     1 
ATOM   1254  C  CA    . TYR A 1  180  ? -17.151 -32.537 7.260    1.00 62.01  ? 168  TYR A CA    1 
ATOM   1255  C  C     . TYR A 1  180  ? -18.225 -32.201 8.277    1.00 73.98  ? 168  TYR A C     1 
ATOM   1256  O  O     . TYR A 1  180  ? -18.698 -33.093 8.993    1.00 84.03  ? 168  TYR A O     1 
ATOM   1257  C  CB    . TYR A 1  180  ? -15.777 -32.482 7.920    1.00 70.01  ? 168  TYR A CB    1 
ATOM   1258  C  CG    . TYR A 1  180  ? -14.681 -33.215 7.186    1.00 81.08  ? 168  TYR A CG    1 
ATOM   1259  C  CD1   . TYR A 1  180  ? -14.926 -34.419 6.538    1.00 70.81  ? 168  TYR A CD1   1 
ATOM   1260  C  CD2   . TYR A 1  180  ? -13.390 -32.706 7.157    1.00 94.15  ? 168  TYR A CD2   1 
ATOM   1261  C  CE1   . TYR A 1  180  ? -13.909 -35.098 5.876    1.00 82.42  ? 168  TYR A CE1   1 
ATOM   1262  C  CE2   . TYR A 1  180  ? -12.371 -33.374 6.504    1.00 104.19 ? 168  TYR A CE2   1 
ATOM   1263  C  CZ    . TYR A 1  180  ? -12.636 -34.568 5.862    1.00 96.75  ? 168  TYR A CZ    1 
ATOM   1264  O  OH    . TYR A 1  180  ? -11.630 -35.240 5.207    1.00 82.22  ? 168  TYR A OH    1 
ATOM   1265  N  N     . SER A 1  181  ? -18.608 -30.936 8.364    1.00 82.69  ? 169  SER A N     1 
ATOM   1266  C  CA    . SER A 1  181  ? -19.549 -30.515 9.387    1.00 79.15  ? 169  SER A CA    1 
ATOM   1267  C  C     . SER A 1  181  ? -20.887 -31.217 9.196    1.00 71.59  ? 169  SER A C     1 
ATOM   1268  O  O     . SER A 1  181  ? -21.422 -31.235 8.079    1.00 73.85  ? 169  SER A O     1 
ATOM   1269  C  CB    . SER A 1  181  ? -19.741 -29.002 9.342    1.00 75.08  ? 169  SER A CB    1 
ATOM   1270  O  OG    . SER A 1  181  ? -20.801 -28.612 10.196   1.00 65.57  ? 169  SER A OG    1 
ATOM   1271  N  N     . PRO A 1  182  ? -21.451 -31.814 10.249   1.00 66.76  ? 170  PRO A N     1 
ATOM   1272  C  CA    . PRO A 1  182  ? -22.792 -32.400 10.159   1.00 71.64  ? 170  PRO A CA    1 
ATOM   1273  C  C     . PRO A 1  182  ? -23.915 -31.445 10.523   1.00 77.79  ? 170  PRO A C     1 
ATOM   1274  O  O     . PRO A 1  182  ? -25.084 -31.809 10.363   1.00 82.28  ? 170  PRO A O     1 
ATOM   1275  C  CB    . PRO A 1  182  ? -22.710 -33.541 11.176   1.00 59.96  ? 170  PRO A CB    1 
ATOM   1276  C  CG    . PRO A 1  182  ? -21.835 -32.977 12.257   1.00 50.09  ? 170  PRO A CG    1 
ATOM   1277  C  CD    . PRO A 1  182  ? -20.834 -32.058 11.567   1.00 60.44  ? 170  PRO A CD    1 
ATOM   1278  N  N     . VAL A 1  183  ? -23.600 -30.247 11.020   1.00 66.45  ? 171  VAL A N     1 
ATOM   1279  C  CA    . VAL A 1  183  ? -24.624 -29.284 11.407   1.00 55.76  ? 171  VAL A CA    1 
ATOM   1280  C  C     . VAL A 1  183  ? -25.136 -28.574 10.160   1.00 68.89  ? 171  VAL A C     1 
ATOM   1281  O  O     . VAL A 1  183  ? -24.361 -28.229 9.260    1.00 81.16  ? 171  VAL A O     1 
ATOM   1282  C  CB    . VAL A 1  183  ? -24.066 -28.288 12.438   1.00 58.40  ? 171  VAL A CB    1 
ATOM   1283  C  CG1   . VAL A 1  183  ? -25.196 -27.580 13.156   1.00 73.24  ? 171  VAL A CG1   1 
ATOM   1284  C  CG2   . VAL A 1  183  ? -23.172 -29.003 13.437   1.00 84.81  ? 171  VAL A CG2   1 
ATOM   1285  N  N     . LEU A 1  184  ? -26.449 -28.353 10.100   1.00 70.32  ? 172  LEU A N     1 
ATOM   1286  C  CA    . LEU A 1  184  ? -27.093 -27.812 8.910    1.00 70.89  ? 172  LEU A CA    1 
ATOM   1287  C  C     . LEU A 1  184  ? -27.461 -26.340 9.048    1.00 73.32  ? 172  LEU A C     1 
ATOM   1288  O  O     . LEU A 1  184  ? -27.193 -25.546 8.141    1.00 89.87  ? 172  LEU A O     1 
ATOM   1289  C  CB    . LEU A 1  184  ? -28.347 -28.631 8.574    1.00 60.27  ? 172  LEU A CB    1 
ATOM   1290  C  CG    . LEU A 1  184  ? -29.042 -28.318 7.247    1.00 74.43  ? 172  LEU A CG    1 
ATOM   1291  C  CD1   . LEU A 1  184  ? -28.123 -28.636 6.077    1.00 93.61  ? 172  LEU A CD1   1 
ATOM   1292  C  CD2   . LEU A 1  184  ? -30.349 -29.087 7.136    1.00 86.87  ? 172  LEU A CD2   1 
ATOM   1293  N  N     . LYS A 1  185  ? -28.067 -25.956 10.169   1.00 71.03  ? 173  LYS A N     1 
ATOM   1294  C  CA    . LYS A 1  185  ? -28.547 -24.589 10.342   1.00 79.86  ? 173  LYS A CA    1 
ATOM   1295  C  C     . LYS A 1  185  ? -28.683 -24.296 11.828   1.00 76.01  ? 173  LYS A C     1 
ATOM   1296  O  O     . LYS A 1  185  ? -29.375 -25.028 12.543   1.00 63.99  ? 173  LYS A O     1 
ATOM   1297  C  CB    . LYS A 1  185  ? -29.887 -24.395 9.625    1.00 93.96  ? 173  LYS A CB    1 
ATOM   1298  C  CG    . LYS A 1  185  ? -30.392 -22.965 9.614    1.00 88.81  ? 173  LYS A CG    1 
ATOM   1299  C  CD    . LYS A 1  185  ? -31.458 -22.785 8.547    1.00 93.73  ? 173  LYS A CD    1 
ATOM   1300  C  CE    . LYS A 1  185  ? -30.912 -23.151 7.174    1.00 95.68  ? 173  LYS A CE    1 
ATOM   1301  N  NZ    . LYS A 1  185  ? -31.927 -22.984 6.100    1.00 98.99  ? 173  LYS A NZ    1 
ATOM   1302  N  N     . VAL A 1  186  ? -28.030 -23.229 12.282   1.00 80.91  ? 174  VAL A N     1 
ATOM   1303  C  CA    . VAL A 1  186  ? -28.026 -22.840 13.686   1.00 70.04  ? 174  VAL A CA    1 
ATOM   1304  C  C     . VAL A 1  186  ? -28.479 -21.393 13.804   1.00 71.17  ? 174  VAL A C     1 
ATOM   1305  O  O     . VAL A 1  186  ? -28.042 -20.529 13.035   1.00 73.68  ? 174  VAL A O     1 
ATOM   1306  C  CB    . VAL A 1  186  ? -26.634 -23.018 14.327   1.00 65.17  ? 174  VAL A CB    1 
ATOM   1307  C  CG1   . VAL A 1  186  ? -26.661 -22.588 15.782   1.00 51.75  ? 174  VAL A CG1   1 
ATOM   1308  C  CG2   . VAL A 1  186  ? -26.187 -24.452 14.217   1.00 80.65  ? 174  VAL A CG2   1 
ATOM   1309  N  N     . THR A 1  187  ? -29.355 -21.132 14.772   1.00 63.80  ? 175  THR A N     1 
ATOM   1310  C  CA    . THR A 1  187  ? -29.785 -19.781 15.093   1.00 64.58  ? 175  THR A CA    1 
ATOM   1311  C  C     . THR A 1  187  ? -30.060 -19.704 16.588   1.00 69.15  ? 175  THR A C     1 
ATOM   1312  O  O     . THR A 1  187  ? -29.909 -20.686 17.321   1.00 70.73  ? 175  THR A O     1 
ATOM   1313  C  CB    . THR A 1  187  ? -31.022 -19.376 14.285   1.00 63.32  ? 175  THR A CB    1 
ATOM   1314  O  OG1   . THR A 1  187  ? -31.495 -18.101 14.739   1.00 64.67  ? 175  THR A OG1   1 
ATOM   1315  C  CG2   . THR A 1  187  ? -32.127 -20.408 14.435   1.00 76.55  ? 175  THR A CG2   1 
ATOM   1316  N  N     . TYR A 1  188  ? -30.471 -18.521 17.037   1.00 79.75  ? 176  TYR A N     1 
ATOM   1317  C  CA    . TYR A 1  188  ? -30.802 -18.311 18.437   1.00 62.49  ? 176  TYR A CA    1 
ATOM   1318  C  C     . TYR A 1  188  ? -31.669 -17.068 18.565   1.00 74.50  ? 176  TYR A C     1 
ATOM   1319  O  O     . TYR A 1  188  ? -31.707 -16.217 17.673   1.00 71.12  ? 176  TYR A O     1 
ATOM   1320  C  CB    . TYR A 1  188  ? -29.544 -18.174 19.304   1.00 46.96  ? 176  TYR A CB    1 
ATOM   1321  C  CG    . TYR A 1  188  ? -28.571 -17.122 18.821   1.00 53.79  ? 176  TYR A CG    1 
ATOM   1322  C  CD1   . TYR A 1  188  ? -28.770 -15.776 19.104   1.00 74.01  ? 176  TYR A CD1   1 
ATOM   1323  C  CD2   . TYR A 1  188  ? -27.448 -17.478 18.090   1.00 63.90  ? 176  TYR A CD2   1 
ATOM   1324  C  CE1   . TYR A 1  188  ? -27.882 -14.816 18.664   1.00 69.15  ? 176  TYR A CE1   1 
ATOM   1325  C  CE2   . TYR A 1  188  ? -26.555 -16.525 17.649   1.00 73.18  ? 176  TYR A CE2   1 
ATOM   1326  C  CZ    . TYR A 1  188  ? -26.775 -15.197 17.938   1.00 61.10  ? 176  TYR A CZ    1 
ATOM   1327  O  OH    . TYR A 1  188  ? -25.886 -14.246 17.499   1.00 49.26  ? 176  TYR A OH    1 
ATOM   1328  N  N     . LYS A 1  189  ? -32.364 -16.983 19.696   1.00 65.71  ? 177  LYS A N     1 
ATOM   1329  C  CA    . LYS A 1  189  ? -33.112 -15.796 20.079   1.00 77.63  ? 177  LYS A CA    1 
ATOM   1330  C  C     . LYS A 1  189  ? -33.061 -15.667 21.593   1.00 85.99  ? 177  LYS A C     1 
ATOM   1331  O  O     . LYS A 1  189  ? -32.927 -16.662 22.309   1.00 88.77  ? 177  LYS A O     1 
ATOM   1332  C  CB    . LYS A 1  189  ? -34.571 -15.849 19.601   1.00 80.14  ? 177  LYS A CB    1 
ATOM   1333  C  CG    . LYS A 1  189  ? -35.386 -16.990 20.196   1.00 87.32  ? 177  LYS A CG    1 
ATOM   1334  C  CD    . LYS A 1  189  ? -36.872 -16.825 19.901   1.00 108.61 ? 177  LYS A CD    1 
ATOM   1335  C  CE    . LYS A 1  189  ? -37.163 -16.911 18.410   1.00 134.82 ? 177  LYS A CE    1 
ATOM   1336  N  NZ    . LYS A 1  189  ? -36.970 -18.291 17.885   1.00 110.46 ? 177  LYS A NZ    1 
ATOM   1337  N  N     . VAL A 1  190  ? -33.149 -14.431 22.077   1.00 93.15  ? 178  VAL A N     1 
ATOM   1338  C  CA    . VAL A 1  190  ? -33.169 -14.176 23.510   1.00 97.53  ? 178  VAL A CA    1 
ATOM   1339  C  C     . VAL A 1  190  ? -34.399 -13.344 23.840   1.00 109.07 ? 178  VAL A C     1 
ATOM   1340  O  O     . VAL A 1  190  ? -34.884 -12.557 23.020   1.00 105.19 ? 178  VAL A O     1 
ATOM   1341  C  CB    . VAL A 1  190  ? -31.879 -13.479 24.010   1.00 79.60  ? 178  VAL A CB    1 
ATOM   1342  C  CG1   . VAL A 1  190  ? -30.644 -14.106 23.373   1.00 80.40  ? 178  VAL A CG1   1 
ATOM   1343  C  CG2   . VAL A 1  190  ? -31.928 -11.980 23.759   1.00 84.07  ? 178  VAL A CG2   1 
ATOM   1344  N  N     . ASP A 1  191  ? -34.920 -13.547 25.045   1.00 109.65 ? 179  ASP A N     1 
ATOM   1345  C  CA    . ASP A 1  191  ? -36.051 -12.787 25.563   1.00 117.68 ? 179  ASP A CA    1 
ATOM   1346  C  C     . ASP A 1  191  ? -35.567 -12.013 26.780   1.00 128.09 ? 179  ASP A C     1 
ATOM   1347  O  O     . ASP A 1  191  ? -35.319 -12.602 27.838   1.00 119.48 ? 179  ASP A O     1 
ATOM   1348  C  CB    . ASP A 1  191  ? -37.219 -13.705 25.917   1.00 110.52 ? 179  ASP A CB    1 
ATOM   1349  C  CG    . ASP A 1  191  ? -37.884 -14.297 24.693   1.00 144.91 ? 179  ASP A CG    1 
ATOM   1350  O  OD1   . ASP A 1  191  ? -37.216 -15.050 23.954   1.00 159.75 ? 179  ASP A OD1   1 
ATOM   1351  O  OD2   . ASP A 1  191  ? -39.077 -14.007 24.469   1.00 159.98 ? 179  ASP A OD2   1 
ATOM   1352  N  N     . ALA A 1  192  ? -35.422 -10.701 26.629   1.00 138.69 ? 180  ALA A N     1 
ATOM   1353  C  CA    . ALA A 1  192  ? -34.935 -9.850  27.705   1.00 134.71 ? 180  ALA A CA    1 
ATOM   1354  C  C     . ALA A 1  192  ? -36.094 -9.432  28.600   1.00 149.14 ? 180  ALA A C     1 
ATOM   1355  O  O     . ALA A 1  192  ? -37.134 -8.981  28.112   1.00 170.46 ? 180  ALA A O     1 
ATOM   1356  C  CB    . ALA A 1  192  ? -34.228 -8.617  27.142   1.00 130.80 ? 180  ALA A CB    1 
ATOM   1357  N  N     . THR A 1  193  ? -35.911 -9.591  29.908   1.00 130.54 ? 181  THR A N     1 
ATOM   1358  C  CA    . THR A 1  193  ? -36.881 -9.127  30.898   1.00 111.33 ? 181  THR A CA    1 
ATOM   1359  C  C     . THR A 1  193  ? -36.465 -7.723  31.319   1.00 121.57 ? 181  THR A C     1 
ATOM   1360  O  O     . THR A 1  193  ? -35.636 -7.548  32.213   1.00 136.59 ? 181  THR A O     1 
ATOM   1361  C  CB    . THR A 1  193  ? -36.942 -10.074 32.088   1.00 115.96 ? 181  THR A CB    1 
ATOM   1362  O  OG1   . THR A 1  193  ? -37.136 -11.417 31.629   1.00 102.85 ? 181  THR A OG1   1 
ATOM   1363  C  CG2   . THR A 1  193  ? -38.089 -9.690  33.012   1.00 146.04 ? 181  THR A CG2   1 
ATOM   1364  N  N     . ARG A 1  194  ? -37.041 -6.713  30.667   1.00 130.42 ? 182  ARG A N     1 
ATOM   1365  C  CA    . ARG A 1  194  ? -36.650 -5.321  30.859   1.00 153.87 ? 182  ARG A CA    1 
ATOM   1366  C  C     . ARG A 1  194  ? -37.616 -4.552  31.752   1.00 177.19 ? 182  ARG A C     1 
ATOM   1367  O  O     . ARG A 1  194  ? -37.614 -3.317  31.731   1.00 186.35 ? 182  ARG A O     1 
ATOM   1368  C  CB    . ARG A 1  194  ? -36.513 -4.622  29.505   1.00 152.74 ? 182  ARG A CB    1 
ATOM   1369  C  CG    . ARG A 1  194  ? -35.095 -4.190  29.189   1.00 153.89 ? 182  ARG A CG    1 
ATOM   1370  C  CD    . ARG A 1  194  ? -34.125 -5.339  29.401   1.00 141.60 ? 182  ARG A CD    1 
ATOM   1371  N  NE    . ARG A 1  194  ? -32.733 -4.913  29.299   1.00 127.98 ? 182  ARG A NE    1 
ATOM   1372  C  CZ    . ARG A 1  194  ? -31.695 -5.731  29.433   1.00 112.50 ? 182  ARG A CZ    1 
ATOM   1373  N  NH1   . ARG A 1  194  ? -30.460 -5.259  29.325   1.00 103.71 ? 182  ARG A NH1   1 
ATOM   1374  N  NH2   . ARG A 1  194  ? -31.891 -7.020  29.672   1.00 96.92  ? 182  ARG A NH2   1 
ATOM   1375  N  N     . VAL A 1  195  ? -38.441 -5.253  32.529   1.00 179.57 ? 183  VAL A N     1 
ATOM   1376  C  CA    . VAL A 1  195  ? -39.318 -4.586  33.485   1.00 182.46 ? 183  VAL A CA    1 
ATOM   1377  C  C     . VAL A 1  195  ? -38.458 -3.926  34.554   1.00 170.23 ? 183  VAL A C     1 
ATOM   1378  O  O     . VAL A 1  195  ? -37.681 -4.595  35.247   1.00 152.56 ? 183  VAL A O     1 
ATOM   1379  C  CB    . VAL A 1  195  ? -40.313 -5.575  34.103   1.00 186.94 ? 183  VAL A CB    1 
ATOM   1380  C  CG1   . VAL A 1  195  ? -41.084 -4.911  35.230   1.00 184.82 ? 183  VAL A CG1   1 
ATOM   1381  C  CG2   . VAL A 1  195  ? -41.268 -6.100  33.044   1.00 156.97 ? 183  VAL A CG2   1 
ATOM   1382  N  N     . GLU A 1  196  ? -38.585 -2.606  34.682   1.00 176.77 ? 184  GLU A N     1 
ATOM   1383  C  CA    . GLU A 1  196  ? -37.808 -1.851  35.657   1.00 167.39 ? 184  GLU A CA    1 
ATOM   1384  C  C     . GLU A 1  196  ? -38.082 -2.350  37.069   1.00 164.57 ? 184  GLU A C     1 
ATOM   1385  O  O     . GLU A 1  196  ? -39.107 -2.009  37.668   1.00 151.77 ? 184  GLU A O     1 
ATOM   1386  C  CB    . GLU A 1  196  ? -38.121 -0.358  35.550   1.00 170.15 ? 184  GLU A CB    1 
ATOM   1387  C  CG    . GLU A 1  196  ? -37.783 0.254   34.201   1.00 177.22 ? 184  GLU A CG    1 
ATOM   1388  C  CD    . GLU A 1  196  ? -38.127 1.728   34.133   1.00 158.53 ? 184  GLU A CD    1 
ATOM   1389  O  OE1   . GLU A 1  196  ? -38.523 2.292   35.175   1.00 153.74 ? 184  GLU A OE1   1 
ATOM   1390  O  OE2   . GLU A 1  196  ? -38.006 2.320   33.040   1.00 133.70 ? 184  GLU A OE2   1 
ATOM   1391  N  N     . GLN A 1  197  ? -37.174 -3.157  37.600   1.00 166.19 ? 185  GLN A N     1 
ATOM   1392  C  CA    . GLN A 1  197  ? -37.312 -3.751  38.927   1.00 155.23 ? 185  GLN A CA    1 
ATOM   1393  C  C     . GLN A 1  197  ? -35.940 -4.285  39.327   1.00 151.35 ? 185  GLN A C     1 
ATOM   1394  O  O     . GLN A 1  197  ? -34.947 -4.081  38.619   1.00 138.04 ? 185  GLN A O     1 
ATOM   1395  C  CB    . GLN A 1  197  ? -38.394 -4.834  38.931   1.00 134.44 ? 185  GLN A CB    1 
ATOM   1396  C  CG    . GLN A 1  197  ? -39.026 -5.099  40.291   1.00 125.17 ? 185  GLN A CG    1 
ATOM   1397  C  CD    . GLN A 1  197  ? -40.196 -6.058  40.210   1.00 141.02 ? 185  GLN A CD    1 
ATOM   1398  O  OE1   . GLN A 1  197  ? -40.942 -6.064  39.231   1.00 126.31 ? 185  GLN A OE1   1 
ATOM   1399  N  NE2   . GLN A 1  197  ? -40.361 -6.880  41.241   1.00 130.19 ? 185  GLN A NE2   1 
ATOM   1400  N  N     . ARG A 1  198  ? -35.883 -4.975  40.467   1.00 161.42 ? 186  ARG A N     1 
ATOM   1401  C  CA    . ARG A 1  198  ? -34.622 -5.525  40.947   1.00 174.51 ? 186  ARG A CA    1 
ATOM   1402  C  C     . ARG A 1  198  ? -34.125 -6.688  40.098   1.00 155.56 ? 186  ARG A C     1 
ATOM   1403  O  O     . ARG A 1  198  ? -32.926 -6.985  40.124   1.00 142.56 ? 186  ARG A O     1 
ATOM   1404  C  CB    . ARG A 1  198  ? -34.774 -5.979  42.399   1.00 196.21 ? 186  ARG A CB    1 
ATOM   1405  C  CG    . ARG A 1  198  ? -35.964 -6.899  42.630   1.00 183.94 ? 186  ARG A CG    1 
ATOM   1406  C  CD    . ARG A 1  198  ? -35.976 -7.440  44.048   1.00 168.61 ? 186  ARG A CD    1 
ATOM   1407  N  NE    . ARG A 1  198  ? -34.780 -8.225  44.336   1.00 157.73 ? 186  ARG A NE    1 
ATOM   1408  C  CZ    . ARG A 1  198  ? -34.518 -8.783  45.512   1.00 158.98 ? 186  ARG A CZ    1 
ATOM   1409  N  NH1   . ARG A 1  198  ? -35.370 -8.644  46.518   1.00 181.83 ? 186  ARG A NH1   1 
ATOM   1410  N  NH2   . ARG A 1  198  ? -33.403 -9.481  45.684   1.00 139.74 ? 186  ARG A NH2   1 
ATOM   1411  N  N     . THR A 1  199  ? -35.005 -7.348  39.348   1.00 147.04 ? 187  THR A N     1 
ATOM   1412  C  CA    . THR A 1  199  ? -34.675 -8.593  38.661   1.00 150.88 ? 187  THR A CA    1 
ATOM   1413  C  C     . THR A 1  199  ? -34.763 -8.399  37.154   1.00 156.63 ? 187  THR A C     1 
ATOM   1414  O  O     . THR A 1  199  ? -35.849 -8.151  36.619   1.00 125.32 ? 187  THR A O     1 
ATOM   1415  C  CB    . THR A 1  199  ? -35.606 -9.724  39.108   1.00 148.88 ? 187  THR A CB    1 
ATOM   1416  O  OG1   . THR A 1  199  ? -36.966 -9.367  38.832   1.00 144.18 ? 187  THR A OG1   1 
ATOM   1417  C  CG2   . THR A 1  199  ? -35.451 -9.986  40.599   1.00 152.69 ? 187  THR A CG2   1 
ATOM   1418  N  N     . ASP A 1  200  ? -33.622 -8.520  36.475   1.00 160.61 ? 188  ASP A N     1 
ATOM   1419  C  CA    . ASP A 1  200  ? -33.544 -8.551  35.021   1.00 117.79 ? 188  ASP A CA    1 
ATOM   1420  C  C     . ASP A 1  200  ? -32.676 -9.731  34.607   1.00 105.99 ? 188  ASP A C     1 
ATOM   1421  O  O     . ASP A 1  200  ? -31.649 -9.999  35.237   1.00 96.63  ? 188  ASP A O     1 
ATOM   1422  C  CB    . ASP A 1  200  ? -32.957 -7.250  34.446   1.00 114.20 ? 188  ASP A CB    1 
ATOM   1423  C  CG    . ASP A 1  200  ? -33.956 -6.104  34.430   1.00 146.32 ? 188  ASP A CG    1 
ATOM   1424  O  OD1   . ASP A 1  200  ? -35.141 -6.329  34.747   1.00 158.47 ? 188  ASP A OD1   1 
ATOM   1425  O  OD2   . ASP A 1  200  ? -33.550 -4.972  34.093   1.00 146.18 ? 188  ASP A OD2   1 
ATOM   1426  N  N     . PHE A 1  201  ? -33.085 -10.435 33.553   1.00 116.08 ? 189  PHE A N     1 
ATOM   1427  C  CA    . PHE A 1  201  ? -32.326 -11.595 33.103   1.00 105.80 ? 189  PHE A CA    1 
ATOM   1428  C  C     . PHE A 1  201  ? -32.663 -11.894 31.650   1.00 112.49 ? 189  PHE A C     1 
ATOM   1429  O  O     . PHE A 1  201  ? -33.733 -11.535 31.152   1.00 113.75 ? 189  PHE A O     1 
ATOM   1430  C  CB    . PHE A 1  201  ? -32.601 -12.821 33.982   1.00 106.11 ? 189  PHE A CB    1 
ATOM   1431  C  CG    . PHE A 1  201  ? -33.852 -13.567 33.612   1.00 104.71 ? 189  PHE A CG    1 
ATOM   1432  C  CD1   . PHE A 1  201  ? -35.101 -13.025 33.868   1.00 125.01 ? 189  PHE A CD1   1 
ATOM   1433  C  CD2   . PHE A 1  201  ? -33.778 -14.815 33.015   1.00 95.58  ? 189  PHE A CD2   1 
ATOM   1434  C  CE1   . PHE A 1  201  ? -36.252 -13.713 33.529   1.00 132.20 ? 189  PHE A CE1   1 
ATOM   1435  C  CE2   . PHE A 1  201  ? -34.924 -15.507 32.676   1.00 115.68 ? 189  PHE A CE2   1 
ATOM   1436  C  CZ    . PHE A 1  201  ? -36.163 -14.955 32.932   1.00 126.10 ? 189  PHE A CZ    1 
ATOM   1437  N  N     . ASP A 1  202  ? -31.729 -12.565 30.979   1.00 110.87 ? 190  ASP A N     1 
ATOM   1438  C  CA    . ASP A 1  202  ? -31.888 -12.988 29.595   1.00 97.23  ? 190  ASP A CA    1 
ATOM   1439  C  C     . ASP A 1  202  ? -32.037 -14.502 29.528   1.00 94.87  ? 190  ASP A C     1 
ATOM   1440  O  O     . ASP A 1  202  ? -31.325 -15.237 30.221   1.00 101.65 ? 190  ASP A O     1 
ATOM   1441  C  CB    . ASP A 1  202  ? -30.691 -12.555 28.741   1.00 94.97  ? 190  ASP A CB    1 
ATOM   1442  C  CG    . ASP A 1  202  ? -30.711 -11.077 28.413   1.00 109.58 ? 190  ASP A CG    1 
ATOM   1443  O  OD1   . ASP A 1  202  ? -31.666 -10.387 28.827   1.00 111.75 ? 190  ASP A OD1   1 
ATOM   1444  O  OD2   . ASP A 1  202  ? -29.772 -10.606 27.736   1.00 100.21 ? 190  ASP A OD2   1 
ATOM   1445  N  N     . LYS A 1  203  ? -32.963 -14.965 28.693   1.00 86.95  ? 191  LYS A N     1 
ATOM   1446  C  CA    . LYS A 1  203  ? -33.144 -16.386 28.420   1.00 86.13  ? 191  LYS A CA    1 
ATOM   1447  C  C     . LYS A 1  203  ? -32.763 -16.656 26.971   1.00 96.58  ? 191  LYS A C     1 
ATOM   1448  O  O     . LYS A 1  203  ? -33.386 -16.114 26.052   1.00 97.25  ? 191  LYS A O     1 
ATOM   1449  C  CB    . LYS A 1  203  ? -34.582 -16.831 28.688   1.00 106.18 ? 191  LYS A CB    1 
ATOM   1450  C  CG    . LYS A 1  203  ? -34.892 -18.229 28.162   1.00 102.15 ? 191  LYS A CG    1 
ATOM   1451  C  CD    . LYS A 1  203  ? -36.275 -18.699 28.585   1.00 92.64  ? 191  LYS A CD    1 
ATOM   1452  C  CE    . LYS A 1  203  ? -37.357 -17.734 28.132   1.00 121.44 ? 191  LYS A CE    1 
ATOM   1453  N  NZ    . LYS A 1  203  ? -37.423 -17.636 26.649   1.00 134.07 ? 191  LYS A NZ    1 
ATOM   1454  N  N     . LEU A 1  204  ? -31.747 -17.490 26.774   1.00 98.23  ? 192  LEU A N     1 
ATOM   1455  C  CA    . LEU A 1  204  ? -31.265 -17.829 25.443   1.00 83.97  ? 192  LEU A CA    1 
ATOM   1456  C  C     . LEU A 1  204  ? -31.975 -19.073 24.924   1.00 83.90  ? 192  LEU A C     1 
ATOM   1457  O  O     . LEU A 1  204  ? -32.126 -20.062 25.645   1.00 84.01  ? 192  LEU A O     1 
ATOM   1458  C  CB    . LEU A 1  204  ? -29.753 -18.058 25.468   1.00 76.54  ? 192  LEU A CB    1 
ATOM   1459  C  CG    . LEU A 1  204  ? -29.097 -18.697 24.242   1.00 82.94  ? 192  LEU A CG    1 
ATOM   1460  C  CD1   . LEU A 1  204  ? -29.285 -17.833 23.005   1.00 97.42  ? 192  LEU A CD1   1 
ATOM   1461  C  CD2   . LEU A 1  204  ? -27.621 -18.948 24.507   1.00 70.49  ? 192  LEU A CD2   1 
ATOM   1462  N  N     . ILE A 1  205  ? -32.409 -19.016 23.667   1.00 79.89  ? 193  ILE A N     1 
ATOM   1463  C  CA    . ILE A 1  205  ? -33.069 -20.137 23.003   1.00 74.59  ? 193  ILE A CA    1 
ATOM   1464  C  C     . ILE A 1  205  ? -32.216 -20.507 21.796   1.00 87.85  ? 193  ILE A C     1 
ATOM   1465  O  O     . ILE A 1  205  ? -32.314 -19.873 20.739   1.00 89.57  ? 193  ILE A O     1 
ATOM   1466  C  CB    . ILE A 1  205  ? -34.504 -19.806 22.583   1.00 76.94  ? 193  ILE A CB    1 
ATOM   1467  C  CG1   . ILE A 1  205  ? -35.310 -19.307 23.782   1.00 95.17  ? 193  ILE A CG1   1 
ATOM   1468  C  CG2   . ILE A 1  205  ? -35.167 -21.028 21.956   1.00 66.07  ? 193  ILE A CG2   1 
ATOM   1469  C  CD1   . ILE A 1  205  ? -36.723 -18.894 23.438   1.00 103.15 ? 193  ILE A CD1   1 
ATOM   1470  N  N     . LEU A 1  206  ? -31.386 -21.536 21.943   1.00 83.98  ? 194  LEU A N     1 
ATOM   1471  C  CA    . LEU A 1  206  ? -30.536 -22.006 20.855   1.00 80.03  ? 194  LEU A CA    1 
ATOM   1472  C  C     . LEU A 1  206  ? -31.290 -23.011 19.994   1.00 83.06  ? 194  LEU A C     1 
ATOM   1473  O  O     . LEU A 1  206  ? -31.955 -23.913 20.511   1.00 87.59  ? 194  LEU A O     1 
ATOM   1474  C  CB    . LEU A 1  206  ? -29.258 -22.640 21.406   1.00 54.86  ? 194  LEU A CB    1 
ATOM   1475  C  CG    . LEU A 1  206  ? -28.175 -23.019 20.393   1.00 50.91  ? 194  LEU A CG    1 
ATOM   1476  C  CD1   . LEU A 1  206  ? -27.643 -21.783 19.675   1.00 59.95  ? 194  LEU A CD1   1 
ATOM   1477  C  CD2   . LEU A 1  206  ? -27.048 -23.782 21.075   1.00 48.92  ? 194  LEU A CD2   1 
ATOM   1478  N  N     . ASP A 1  207  ? -31.182 -22.850 18.676   1.00 68.89  ? 195  ASP A N     1 
ATOM   1479  C  CA    . ASP A 1  207  ? -31.850 -23.715 17.711   1.00 60.35  ? 195  ASP A CA    1 
ATOM   1480  C  C     . ASP A 1  207  ? -30.790 -24.375 16.842   1.00 71.64  ? 195  ASP A C     1 
ATOM   1481  O  O     . ASP A 1  207  ? -30.009 -23.685 16.177   1.00 75.11  ? 195  ASP A O     1 
ATOM   1482  C  CB    . ASP A 1  207  ? -32.843 -22.919 16.860   1.00 65.53  ? 195  ASP A CB    1 
ATOM   1483  C  CG    . ASP A 1  207  ? -33.770 -23.809 16.045   1.00 90.11  ? 195  ASP A CG    1 
ATOM   1484  O  OD1   . ASP A 1  207  ? -33.286 -24.762 15.399   1.00 86.23  ? 195  ASP A OD1   1 
ATOM   1485  O  OD2   . ASP A 1  207  ? -34.992 -23.550 16.047   1.00 109.02 ? 195  ASP A OD2   1 
ATOM   1486  N  N     . VAL A 1  208  ? -30.768 -25.707 16.843   1.00 74.10  ? 196  VAL A N     1 
ATOM   1487  C  CA    . VAL A 1  208  ? -29.736 -26.488 16.171   1.00 62.71  ? 196  VAL A CA    1 
ATOM   1488  C  C     . VAL A 1  208  ? -30.405 -27.513 15.267   1.00 75.71  ? 196  VAL A C     1 
ATOM   1489  O  O     . VAL A 1  208  ? -31.314 -28.230 15.702   1.00 63.82  ? 196  VAL A O     1 
ATOM   1490  C  CB    . VAL A 1  208  ? -28.807 -27.191 17.179   1.00 51.30  ? 196  VAL A CB    1 
ATOM   1491  C  CG1   . VAL A 1  208  ? -27.692 -27.928 16.453   1.00 54.92  ? 196  VAL A CG1   1 
ATOM   1492  C  CG2   . VAL A 1  208  ? -28.247 -26.187 18.178   1.00 59.56  ? 196  VAL A CG2   1 
ATOM   1493  N  N     . GLU A 1  209  ? -29.950 -27.588 14.018   1.00 83.40  ? 197  GLU A N     1 
ATOM   1494  C  CA    . GLU A 1  209  ? -30.431 -28.570 13.055   1.00 75.73  ? 197  GLU A CA    1 
ATOM   1495  C  C     . GLU A 1  209  ? -29.237 -29.294 12.453   1.00 73.35  ? 197  GLU A C     1 
ATOM   1496  O  O     . GLU A 1  209  ? -28.294 -28.653 11.978   1.00 78.31  ? 197  GLU A O     1 
ATOM   1497  C  CB    . GLU A 1  209  ? -31.263 -27.908 11.949   1.00 77.63  ? 197  GLU A CB    1 
ATOM   1498  C  CG    . GLU A 1  209  ? -31.825 -28.888 10.928   1.00 88.83  ? 197  GLU A CG    1 
ATOM   1499  C  CD    . GLU A 1  209  ? -32.534 -28.198 9.779    1.00 106.67 ? 197  GLU A CD    1 
ATOM   1500  O  OE1   . GLU A 1  209  ? -32.187 -27.037 9.475    1.00 114.32 ? 197  GLU A OE1   1 
ATOM   1501  O  OE2   . GLU A 1  209  ? -33.439 -28.816 9.179    1.00 106.24 ? 197  GLU A OE2   1 
ATOM   1502  N  N     . THR A 1  210  ? -29.278 -30.623 12.473   1.00 67.55  ? 198  THR A N     1 
ATOM   1503  C  CA    . THR A 1  210  ? -28.206 -31.461 11.955   1.00 70.74  ? 198  THR A CA    1 
ATOM   1504  C  C     . THR A 1  210  ? -28.673 -32.186 10.694   1.00 73.69  ? 198  THR A C     1 
ATOM   1505  O  O     . THR A 1  210  ? -29.797 -32.001 10.219   1.00 77.75  ? 198  THR A O     1 
ATOM   1506  C  CB    . THR A 1  210  ? -27.730 -32.452 13.021   1.00 70.30  ? 198  THR A CB    1 
ATOM   1507  O  OG1   . THR A 1  210  ? -28.824 -33.282 13.430   1.00 85.03  ? 198  THR A OG1   1 
ATOM   1508  C  CG2   . THR A 1  210  ? -27.179 -31.710 14.234   1.00 72.17  ? 198  THR A CG2   1 
ATOM   1509  N  N     . LYS A 1  211  ? -27.788 -33.025 10.151   1.00 62.71  ? 199  LYS A N     1 
ATOM   1510  C  CA    . LYS A 1  211  ? -28.023 -33.713 8.887    1.00 82.18  ? 199  LYS A CA    1 
ATOM   1511  C  C     . LYS A 1  211  ? -28.157 -35.224 9.063    1.00 89.00  ? 199  LYS A C     1 
ATOM   1512  O  O     . LYS A 1  211  ? -27.728 -35.993 8.199    1.00 110.56 ? 199  LYS A O     1 
ATOM   1513  C  CB    . LYS A 1  211  ? -26.906 -33.397 7.891    1.00 97.05  ? 199  LYS A CB    1 
ATOM   1514  C  CG    . LYS A 1  211  ? -26.733 -31.916 7.596    1.00 93.84  ? 199  LYS A CG    1 
ATOM   1515  C  CD    . LYS A 1  211  ? -25.811 -31.681 6.406    1.00 95.57  ? 199  LYS A CD    1 
ATOM   1516  C  CE    . LYS A 1  211  ? -24.405 -32.207 6.656    1.00 72.99  ? 199  LYS A CE    1 
ATOM   1517  N  NZ    . LYS A 1  211  ? -23.487 -31.845 5.538    1.00 60.45  ? 199  LYS A NZ    1 
ATOM   1518  N  N     . ASN A 1  212  ? -28.748 -35.661 10.176   1.00 71.32  ? 200  ASN A N     1 
ATOM   1519  C  CA    . ASN A 1  212  ? -28.978 -37.059 10.539   1.00 84.12  ? 200  ASN A CA    1 
ATOM   1520  C  C     . ASN A 1  212  ? -27.692 -37.842 10.782   1.00 85.81  ? 200  ASN A C     1 
ATOM   1521  O  O     . ASN A 1  212  ? -27.767 -39.031 11.117   1.00 84.72  ? 200  ASN A O     1 
ATOM   1522  C  CB    . ASN A 1  212  ? -29.819 -37.811 9.496    1.00 95.08  ? 200  ASN A CB    1 
ATOM   1523  C  CG    . ASN A 1  212  ? -31.269 -37.367 9.486    1.00 97.28  ? 200  ASN A CG    1 
ATOM   1524  O  OD1   . ASN A 1  212  ? -31.789 -36.887 10.493   1.00 95.23  ? 200  ASN A OD1   1 
ATOM   1525  N  ND2   . ASN A 1  212  ? -31.932 -37.531 8.347    1.00 96.99  ? 200  ASN A ND2   1 
ATOM   1526  N  N     . SER A 1  213  ? -26.517 -37.228 10.625   1.00 88.49  ? 201  SER A N     1 
ATOM   1527  C  CA    . SER A 1  213  ? -25.280 -37.916 10.979   1.00 87.26  ? 201  SER A CA    1 
ATOM   1528  C  C     . SER A 1  213  ? -25.125 -38.005 12.491   1.00 88.17  ? 201  SER A C     1 
ATOM   1529  O  O     . SER A 1  213  ? -24.706 -39.042 13.020   1.00 95.32  ? 201  SER A O     1 
ATOM   1530  C  CB    . SER A 1  213  ? -24.083 -37.202 10.353   1.00 94.23  ? 201  SER A CB    1 
ATOM   1531  O  OG    . SER A 1  213  ? -22.876 -37.891 10.629   1.00 83.76  ? 201  SER A OG    1 
ATOM   1532  N  N     . ILE A 1  214  ? -25.450 -36.923 13.198   1.00 75.43  ? 202  ILE A N     1 
ATOM   1533  C  CA    . ILE A 1  214  ? -25.523 -36.910 14.651   1.00 75.74  ? 202  ILE A CA    1 
ATOM   1534  C  C     . ILE A 1  214  ? -26.795 -36.175 15.047   1.00 76.79  ? 202  ILE A C     1 
ATOM   1535  O  O     . ILE A 1  214  ? -27.373 -35.417 14.266   1.00 74.99  ? 202  ILE A O     1 
ATOM   1536  C  CB    . ILE A 1  214  ? -24.290 -36.251 15.308   1.00 76.04  ? 202  ILE A CB    1 
ATOM   1537  C  CG1   . ILE A 1  214  ? -24.174 -34.783 14.889   1.00 63.74  ? 202  ILE A CG1   1 
ATOM   1538  C  CG2   . ILE A 1  214  ? -23.020 -37.015 14.963   1.00 85.54  ? 202  ILE A CG2   1 
ATOM   1539  C  CD1   . ILE A 1  214  ? -23.014 -34.055 15.538   1.00 78.98  ? 202  ILE A CD1   1 
ATOM   1540  N  N     . SER A 1  215  ? -27.235 -36.421 16.274   1.00 86.69  ? 203  SER A N     1 
ATOM   1541  C  CA    . SER A 1  215  ? -28.399 -35.735 16.804   1.00 88.58  ? 203  SER A CA    1 
ATOM   1542  C  C     . SER A 1  215  ? -28.010 -34.336 17.275   1.00 82.24  ? 203  SER A C     1 
ATOM   1543  O  O     . SER A 1  215  ? -26.836 -34.067 17.545   1.00 75.56  ? 203  SER A O     1 
ATOM   1544  C  CB    . SER A 1  215  ? -29.008 -36.543 17.946   1.00 97.44  ? 203  SER A CB    1 
ATOM   1545  O  OG    . SER A 1  215  ? -28.141 -36.588 19.063   1.00 120.07 ? 203  SER A OG    1 
ATOM   1546  N  N     . PRO A 1  216  ? -28.979 -33.416 17.365   1.00 78.64  ? 204  PRO A N     1 
ATOM   1547  C  CA    . PRO A 1  216  ? -28.633 -32.031 17.735   1.00 65.04  ? 204  PRO A CA    1 
ATOM   1548  C  C     . PRO A 1  216  ? -27.918 -31.905 19.071   1.00 69.81  ? 204  PRO A C     1 
ATOM   1549  O  O     . PRO A 1  216  ? -27.008 -31.076 19.198   1.00 83.76  ? 204  PRO A O     1 
ATOM   1550  C  CB    . PRO A 1  216  ? -29.999 -31.329 17.756   1.00 76.01  ? 204  PRO A CB    1 
ATOM   1551  C  CG    . PRO A 1  216  ? -30.847 -32.131 16.832   1.00 96.24  ? 204  PRO A CG    1 
ATOM   1552  C  CD    . PRO A 1  216  ? -30.402 -33.552 17.005   1.00 93.97  ? 204  PRO A CD    1 
ATOM   1553  N  N     . ARG A 1  217  ? -28.301 -32.698 20.075   1.00 69.73  ? 205  ARG A N     1 
ATOM   1554  C  CA    . ARG A 1  217  ? -27.657 -32.578 21.380   1.00 75.19  ? 205  ARG A CA    1 
ATOM   1555  C  C     . ARG A 1  217  ? -26.212 -33.062 21.345   1.00 76.88  ? 205  ARG A C     1 
ATOM   1556  O  O     . ARG A 1  217  ? -25.377 -32.565 22.110   1.00 72.71  ? 205  ARG A O     1 
ATOM   1557  C  CB    . ARG A 1  217  ? -28.457 -33.340 22.438   1.00 84.68  ? 205  ARG A CB    1 
ATOM   1558  C  CG    . ARG A 1  217  ? -28.710 -34.804 22.118   1.00 84.31  ? 205  ARG A CG    1 
ATOM   1559  C  CD    . ARG A 1  217  ? -29.542 -35.453 23.212   1.00 94.81  ? 205  ARG A CD    1 
ATOM   1560  N  NE    . ARG A 1  217  ? -28.923 -35.291 24.525   1.00 132.50 ? 205  ARG A NE    1 
ATOM   1561  C  CZ    . ARG A 1  217  ? -29.498 -35.638 25.671   1.00 145.22 ? 205  ARG A CZ    1 
ATOM   1562  N  NH1   . ARG A 1  217  ? -30.714 -36.166 25.670   1.00 178.94 ? 205  ARG A NH1   1 
ATOM   1563  N  NH2   . ARG A 1  217  ? -28.861 -35.454 26.819   1.00 104.26 ? 205  ARG A NH2   1 
ATOM   1564  N  N     . ASP A 1  218  ? -25.895 -34.018 20.468   1.00 80.06  ? 206  ASP A N     1 
ATOM   1565  C  CA    . ASP A 1  218  ? -24.511 -34.459 20.327   1.00 86.08  ? 206  ASP A CA    1 
ATOM   1566  C  C     . ASP A 1  218  ? -23.637 -33.355 19.745   1.00 90.76  ? 206  ASP A C     1 
ATOM   1567  O  O     . ASP A 1  218  ? -22.481 -33.191 20.151   1.00 89.86  ? 206  ASP A O     1 
ATOM   1568  C  CB    . ASP A 1  218  ? -24.444 -35.712 19.453   1.00 96.75  ? 206  ASP A CB    1 
ATOM   1569  C  CG    . ASP A 1  218  ? -25.309 -36.837 19.980   1.00 108.16 ? 206  ASP A CG    1 
ATOM   1570  O  OD1   . ASP A 1  218  ? -25.379 -37.008 21.215   1.00 108.93 ? 206  ASP A OD1   1 
ATOM   1571  O  OD2   . ASP A 1  218  ? -25.928 -37.547 19.158   1.00 125.92 ? 206  ASP A OD2   1 
ATOM   1572  N  N     . ALA A 1  219  ? -24.174 -32.590 18.791   1.00 81.71  ? 207  ALA A N     1 
ATOM   1573  C  CA    . ALA A 1  219  ? -23.415 -31.491 18.202   1.00 70.35  ? 207  ALA A CA    1 
ATOM   1574  C  C     . ALA A 1  219  ? -23.142 -30.404 19.233   1.00 81.79  ? 207  ALA A C     1 
ATOM   1575  O  O     . ALA A 1  219  ? -22.004 -29.941 19.379   1.00 75.83  ? 207  ALA A O     1 
ATOM   1576  C  CB    . ALA A 1  219  ? -24.167 -30.919 17.000   1.00 58.53  ? 207  ALA A CB    1 
ATOM   1577  N  N     . LEU A 1  220  ? -24.181 -29.981 19.958   1.00 86.51  ? 208  LEU A N     1 
ATOM   1578  C  CA    . LEU A 1  220  ? -23.995 -28.985 21.008   1.00 79.19  ? 208  LEU A CA    1 
ATOM   1579  C  C     . LEU A 1  220  ? -23.036 -29.480 22.083   1.00 72.91  ? 208  LEU A C     1 
ATOM   1580  O  O     . LEU A 1  220  ? -22.295 -28.682 22.669   1.00 81.61  ? 208  LEU A O     1 
ATOM   1581  C  CB    . LEU A 1  220  ? -25.347 -28.611 21.619   1.00 70.25  ? 208  LEU A CB    1 
ATOM   1582  C  CG    . LEU A 1  220  ? -25.337 -27.634 22.795   1.00 60.82  ? 208  LEU A CG    1 
ATOM   1583  C  CD1   . LEU A 1  220  ? -24.643 -26.339 22.410   1.00 50.09  ? 208  LEU A CD1   1 
ATOM   1584  C  CD2   . LEU A 1  220  ? -26.750 -27.359 23.283   1.00 61.31  ? 208  LEU A CD2   1 
ATOM   1585  N  N     . ALA A 1  221  ? -23.024 -30.789 22.347   1.00 65.38  ? 209  ALA A N     1 
ATOM   1586  C  CA    . ALA A 1  221  ? -22.064 -31.337 23.298   1.00 82.06  ? 209  ALA A CA    1 
ATOM   1587  C  C     . ALA A 1  221  ? -20.636 -31.200 22.782   1.00 92.99  ? 209  ALA A C     1 
ATOM   1588  O  O     . ALA A 1  221  ? -19.717 -30.904 23.555   1.00 90.71  ? 209  ALA A O     1 
ATOM   1589  C  CB    . ALA A 1  221  ? -22.392 -32.799 23.593   1.00 95.62  ? 209  ALA A CB    1 
ATOM   1590  N  N     . SER A 1  222  ? -20.432 -31.408 21.479   1.00 96.72  ? 210  SER A N     1 
ATOM   1591  C  CA    . SER A 1  222  ? -19.102 -31.241 20.899   1.00 97.66  ? 210  SER A CA    1 
ATOM   1592  C  C     . SER A 1  222  ? -18.664 -29.782 20.952   1.00 88.69  ? 210  SER A C     1 
ATOM   1593  O  O     . SER A 1  222  ? -17.525 -29.478 21.329   1.00 92.69  ? 210  SER A O     1 
ATOM   1594  C  CB    . SER A 1  222  ? -19.088 -31.760 19.461   1.00 80.06  ? 210  SER A CB    1 
ATOM   1595  O  OG    . SER A 1  222  ? -17.784 -31.706 18.912   1.00 69.04  ? 210  SER A OG    1 
ATOM   1596  N  N     . ALA A 1  223  ? -19.557 -28.863 20.576   1.00 72.01  ? 211  ALA A N     1 
ATOM   1597  C  CA    . ALA A 1  223  ? -19.251 -27.443 20.703   1.00 85.20  ? 211  ALA A CA    1 
ATOM   1598  C  C     . ALA A 1  223  ? -19.052 -27.047 22.160   1.00 76.25  ? 211  ALA A C     1 
ATOM   1599  O  O     . ALA A 1  223  ? -18.274 -26.132 22.454   1.00 71.24  ? 211  ALA A O     1 
ATOM   1600  C  CB    . ALA A 1  223  ? -20.361 -26.606 20.066   1.00 79.54  ? 211  ALA A CB    1 
ATOM   1601  N  N     . GLY A 1  224  ? -19.736 -27.724 23.083   1.00 76.42  ? 212  GLY A N     1 
ATOM   1602  C  CA    . GLY A 1  224  ? -19.525 -27.445 24.494   1.00 79.43  ? 212  GLY A CA    1 
ATOM   1603  C  C     . GLY A 1  224  ? -18.140 -27.852 24.962   1.00 74.27  ? 212  GLY A C     1 
ATOM   1604  O  O     . GLY A 1  224  ? -17.437 -27.073 25.613   1.00 76.78  ? 212  GLY A O     1 
ATOM   1605  N  N     . LYS A 1  225  ? -17.727 -29.080 24.633   1.00 70.07  ? 213  LYS A N     1 
ATOM   1606  C  CA    . LYS A 1  225  ? -16.401 -29.547 25.026   1.00 78.21  ? 213  LYS A CA    1 
ATOM   1607  C  C     . LYS A 1  225  ? -15.299 -28.785 24.298   1.00 78.36  ? 213  LYS A C     1 
ATOM   1608  O  O     . LYS A 1  225  ? -14.183 -28.666 24.818   1.00 75.66  ? 213  LYS A O     1 
ATOM   1609  C  CB    . LYS A 1  225  ? -16.279 -31.051 24.772   1.00 83.50  ? 213  LYS A CB    1 
ATOM   1610  C  CG    . LYS A 1  225  ? -15.088 -31.702 25.458   1.00 79.27  ? 213  LYS A CG    1 
ATOM   1611  C  CD    . LYS A 1  225  ? -15.127 -33.216 25.344   1.00 114.53 ? 213  LYS A CD    1 
ATOM   1612  C  CE    . LYS A 1  225  ? -13.906 -33.842 25.996   1.00 135.44 ? 213  LYS A CE    1 
ATOM   1613  N  NZ    . LYS A 1  225  ? -13.959 -35.328 25.947   1.00 140.64 ? 213  LYS A NZ    1 
ATOM   1614  N  N     . THR A 1  226  ? -15.590 -28.257 23.105   1.00 83.02  ? 214  THR A N     1 
ATOM   1615  C  CA    . THR A 1  226  ? -14.615 -27.418 22.413   1.00 90.87  ? 214  THR A CA    1 
ATOM   1616  C  C     . THR A 1  226  ? -14.402 -26.100 23.149   1.00 81.03  ? 214  THR A C     1 
ATOM   1617  O  O     . THR A 1  226  ? -13.261 -25.654 23.317   1.00 79.45  ? 214  THR A O     1 
ATOM   1618  C  CB    . THR A 1  226  ? -15.066 -27.147 20.977   1.00 78.64  ? 214  THR A CB    1 
ATOM   1619  O  OG1   . THR A 1  226  ? -15.592 -28.345 20.396   1.00 79.07  ? 214  THR A OG1   1 
ATOM   1620  C  CG2   . THR A 1  226  ? -13.893 -26.652 20.136   1.00 82.00  ? 214  THR A CG2   1 
ATOM   1621  N  N     . LEU A 1  227  ? -15.488 -25.464 23.594   1.00 72.47  ? 215  LEU A N     1 
ATOM   1622  C  CA    . LEU A 1  227  ? -15.389 -24.155 24.232   1.00 70.63  ? 215  LEU A CA    1 
ATOM   1623  C  C     . LEU A 1  227  ? -14.947 -24.264 25.687   1.00 84.36  ? 215  LEU A C     1 
ATOM   1624  O  O     . LEU A 1  227  ? -14.208 -23.402 26.175   1.00 90.64  ? 215  LEU A O     1 
ATOM   1625  C  CB    . LEU A 1  227  ? -16.728 -23.422 24.126   1.00 61.50  ? 215  LEU A CB    1 
ATOM   1626  C  CG    . LEU A 1  227  ? -17.163 -23.120 22.689   1.00 66.68  ? 215  LEU A CG    1 
ATOM   1627  C  CD1   . LEU A 1  227  ? -18.574 -22.557 22.634   1.00 78.57  ? 215  LEU A CD1   1 
ATOM   1628  C  CD2   . LEU A 1  227  ? -16.181 -22.170 22.024   1.00 78.39  ? 215  LEU A CD2   1 
ATOM   1629  N  N     . VAL A 1  228  ? -15.395 -25.304 26.396   1.00 84.45  ? 216  VAL A N     1 
ATOM   1630  C  CA    . VAL A 1  228  ? -14.914 -25.543 27.756   1.00 84.23  ? 216  VAL A CA    1 
ATOM   1631  C  C     . VAL A 1  228  ? -13.397 -25.685 27.764   1.00 85.73  ? 216  VAL A C     1 
ATOM   1632  O  O     . VAL A 1  228  ? -12.710 -25.150 28.644   1.00 101.76 ? 216  VAL A O     1 
ATOM   1633  C  CB    . VAL A 1  228  ? -15.606 -26.782 28.357   1.00 76.35  ? 216  VAL A CB    1 
ATOM   1634  C  CG1   . VAL A 1  228  ? -14.761 -27.385 29.466   1.00 95.14  ? 216  VAL A CG1   1 
ATOM   1635  C  CG2   . VAL A 1  228  ? -16.979 -26.415 28.884   1.00 69.78  ? 216  VAL A CG2   1 
ATOM   1636  N  N     . GLU A 1  229  ? -12.851 -26.399 26.776   1.00 80.87  ? 217  GLU A N     1 
ATOM   1637  C  CA    . GLU A 1  229  ? -11.402 -26.521 26.654   1.00 98.09  ? 217  GLU A CA    1 
ATOM   1638  C  C     . GLU A 1  229  ? -10.754 -25.176 26.349   1.00 98.91  ? 217  GLU A C     1 
ATOM   1639  O  O     . GLU A 1  229  ? -9.696  -24.850 26.900   1.00 90.81  ? 217  GLU A O     1 
ATOM   1640  C  CB    . GLU A 1  229  ? -11.053 -27.533 25.563   1.00 100.48 ? 217  GLU A CB    1 
ATOM   1641  C  CG    . GLU A 1  229  ? -9.559  -27.775 25.388   1.00 119.87 ? 217  GLU A CG    1 
ATOM   1642  C  CD    . GLU A 1  229  ? -8.994  -28.720 26.431   1.00 130.21 ? 217  GLU A CD    1 
ATOM   1643  O  OE1   . GLU A 1  229  ? -9.732  -29.625 26.874   1.00 111.79 ? 217  GLU A OE1   1 
ATOM   1644  O  OE2   . GLU A 1  229  ? -7.813  -28.560 26.806   1.00 165.78 ? 217  GLU A OE2   1 
ATOM   1645  N  N     . LEU A 1  230  ? -11.375 -24.381 25.474   1.00 90.29  ? 218  LEU A N     1 
ATOM   1646  C  CA    . LEU A 1  230  ? -10.759 -23.132 25.032   1.00 84.82  ? 218  LEU A CA    1 
ATOM   1647  C  C     . LEU A 1  230  ? -10.743 -22.092 26.145   1.00 83.51  ? 218  LEU A C     1 
ATOM   1648  O  O     . LEU A 1  230  ? -9.687  -21.538 26.473   1.00 89.27  ? 218  LEU A O     1 
ATOM   1649  C  CB    . LEU A 1  230  ? -11.490 -22.593 23.802   1.00 92.30  ? 218  LEU A CB    1 
ATOM   1650  C  CG    . LEU A 1  230  ? -10.963 -23.090 22.455   1.00 90.53  ? 218  LEU A CG    1 
ATOM   1651  C  CD1   . LEU A 1  230  ? -11.781 -22.521 21.306   1.00 99.75  ? 218  LEU A CD1   1 
ATOM   1652  C  CD2   . LEU A 1  230  ? -9.495  -22.726 22.302   1.00 83.28  ? 218  LEU A CD2   1 
ATOM   1653  N  N     . PHE A 1  231  ? -11.906 -21.807 26.738   1.00 81.74  ? 219  PHE A N     1 
ATOM   1654  C  CA    . PHE A 1  231  ? -11.977 -20.781 27.773   1.00 76.03  ? 219  PHE A CA    1 
ATOM   1655  C  C     . PHE A 1  231  ? -11.158 -21.139 29.005   1.00 94.10  ? 219  PHE A C     1 
ATOM   1656  O  O     . PHE A 1  231  ? -10.851 -20.252 29.809   1.00 109.13 ? 219  PHE A O     1 
ATOM   1657  C  CB    . PHE A 1  231  ? -13.432 -20.524 28.162   1.00 77.56  ? 219  PHE A CB    1 
ATOM   1658  C  CG    . PHE A 1  231  ? -14.195 -19.728 27.144   1.00 80.26  ? 219  PHE A CG    1 
ATOM   1659  C  CD1   . PHE A 1  231  ? -14.088 -18.349 27.106   1.00 74.52  ? 219  PHE A CD1   1 
ATOM   1660  C  CD2   . PHE A 1  231  ? -15.010 -20.358 26.219   1.00 71.94  ? 219  PHE A CD2   1 
ATOM   1661  C  CE1   . PHE A 1  231  ? -14.784 -17.611 26.170   1.00 71.18  ? 219  PHE A CE1   1 
ATOM   1662  C  CE2   . PHE A 1  231  ? -15.706 -19.626 25.278   1.00 70.85  ? 219  PHE A CE2   1 
ATOM   1663  C  CZ    . PHE A 1  231  ? -15.598 -18.252 25.258   1.00 84.17  ? 219  PHE A CZ    1 
ATOM   1664  N  N     . GLY A 1  232  ? -10.789 -22.410 29.169   1.00 97.50  ? 220  GLY A N     1 
ATOM   1665  C  CA    . GLY A 1  232  ? -9.896  -22.801 30.246   1.00 105.67 ? 220  GLY A CA    1 
ATOM   1666  C  C     . GLY A 1  232  ? -8.499  -22.224 30.134   1.00 126.73 ? 220  GLY A C     1 
ATOM   1667  O  O     . GLY A 1  232  ? -7.713  -22.363 31.080   1.00 135.73 ? 220  GLY A O     1 
ATOM   1668  N  N     . LEU A 1  233  ? -8.170  -21.590 29.003   1.00 124.39 ? 221  LEU A N     1 
ATOM   1669  C  CA    . LEU A 1  233  ? -6.895  -20.900 28.850   1.00 111.81 ? 221  LEU A CA    1 
ATOM   1670  C  C     . LEU A 1  233  ? -6.826  -19.598 29.639   1.00 111.88 ? 221  LEU A C     1 
ATOM   1671  O  O     . LEU A 1  233  ? -5.722  -19.153 29.970   1.00 125.87 ? 221  LEU A O     1 
ATOM   1672  C  CB    . LEU A 1  233  ? -6.628  -20.606 27.373   1.00 103.43 ? 221  LEU A CB    1 
ATOM   1673  C  CG    . LEU A 1  233  ? -6.437  -21.822 26.469   1.00 110.68 ? 221  LEU A CG    1 
ATOM   1674  C  CD1   . LEU A 1  233  ? -6.220  -21.391 25.030   1.00 109.10 ? 221  LEU A CD1   1 
ATOM   1675  C  CD2   . LEU A 1  233  ? -5.279  -22.682 26.959   1.00 126.06 ? 221  LEU A CD2   1 
ATOM   1676  N  N     . ALA A 1  234  ? -7.968  -18.969 29.933   1.00 96.14  ? 222  ALA A N     1 
ATOM   1677  C  CA    . ALA A 1  234  ? -7.962  -17.751 30.737   1.00 110.85 ? 222  ALA A CA    1 
ATOM   1678  C  C     . ALA A 1  234  ? -7.872  -18.053 32.224   1.00 127.50 ? 222  ALA A C     1 
ATOM   1679  O  O     . ALA A 1  234  ? -7.419  -17.203 32.999   1.00 129.62 ? 222  ALA A O     1 
ATOM   1680  C  CB    . ALA A 1  234  ? -9.216  -16.923 30.455   1.00 100.92 ? 222  ALA A CB    1 
ATOM   1681  N  N     . ARG A 1  235  ? -8.299  -19.246 32.636   1.00 124.89 ? 223  ARG A N     1 
ATOM   1682  C  CA    . ARG A 1  235  ? -8.318  -19.580 34.054   1.00 135.94 ? 223  ARG A CA    1 
ATOM   1683  C  C     . ARG A 1  235  ? -6.919  -19.876 34.584   1.00 142.05 ? 223  ARG A C     1 
ATOM   1684  O  O     . ARG A 1  235  ? -6.661  -19.693 35.779   1.00 126.68 ? 223  ARG A O     1 
ATOM   1685  C  CB    . ARG A 1  235  ? -9.255  -20.765 34.285   1.00 127.46 ? 223  ARG A CB    1 
ATOM   1686  C  CG    . ARG A 1  235  ? -9.425  -21.180 35.735   1.00 121.85 ? 223  ARG A CG    1 
ATOM   1687  C  CD    . ARG A 1  235  ? -10.547 -22.195 35.872   1.00 113.50 ? 223  ARG A CD    1 
ATOM   1688  N  NE    . ARG A 1  235  ? -10.691 -23.004 34.664   1.00 141.79 ? 223  ARG A NE    1 
ATOM   1689  C  CZ    . ARG A 1  235  ? -10.006 -24.117 34.419   1.00 150.11 ? 223  ARG A CZ    1 
ATOM   1690  N  NH1   . ARG A 1  235  ? -9.122  -24.561 35.302   1.00 172.36 ? 223  ARG A NH1   1 
ATOM   1691  N  NH2   . ARG A 1  235  ? -10.203 -24.786 33.290   1.00 106.75 ? 223  ARG A NH2   1 
ATOM   1692  N  N     . GLU A 1  236  ? -6.006  -20.319 33.723   1.00 146.06 ? 224  GLU A N     1 
ATOM   1693  C  CA    . GLU A 1  236  ? -4.642  -20.584 34.161   1.00 155.20 ? 224  GLU A CA    1 
ATOM   1694  C  C     . GLU A 1  236  ? -3.901  -19.270 34.381   1.00 159.63 ? 224  GLU A C     1 
ATOM   1695  O  O     . GLU A 1  236  ? -3.979  -18.352 33.558   1.00 130.32 ? 224  GLU A O     1 
ATOM   1696  C  CB    . GLU A 1  236  ? -3.913  -21.460 33.138   1.00 153.28 ? 224  GLU A CB    1 
ATOM   1697  C  CG    . GLU A 1  236  ? -3.723  -20.826 31.767   1.00 155.59 ? 224  GLU A CG    1 
ATOM   1698  C  CD    . GLU A 1  236  ? -3.341  -21.835 30.701   1.00 146.75 ? 224  GLU A CD    1 
ATOM   1699  O  OE1   . GLU A 1  236  ? -3.756  -23.007 30.816   1.00 133.91 ? 224  GLU A OE1   1 
ATOM   1700  O  OE2   . GLU A 1  236  ? -2.626  -21.459 29.748   1.00 143.34 ? 224  GLU A OE2   1 
ATOM   1701  N  N     . LEU A 1  237  ? -3.197  -19.169 35.505   1.00 184.48 ? 225  LEU A N     1 
ATOM   1702  C  CA    . LEU A 1  237  ? -2.494  -17.938 35.827   1.00 186.49 ? 225  LEU A CA    1 
ATOM   1703  C  C     . LEU A 1  237  ? -1.188  -17.847 35.042   1.00 185.65 ? 225  LEU A C     1 
ATOM   1704  O  O     . LEU A 1  237  ? -0.777  -18.781 34.348   1.00 159.76 ? 225  LEU A O     1 
ATOM   1705  C  CB    . LEU A 1  237  ? -2.221  -17.845 37.328   1.00 171.30 ? 225  LEU A CB    1 
ATOM   1706  C  CG    . LEU A 1  237  ? -3.408  -17.984 38.286   1.00 139.10 ? 225  LEU A CG    1 
ATOM   1707  C  CD1   . LEU A 1  237  ? -3.054  -17.394 39.644   1.00 130.35 ? 225  LEU A CD1   1 
ATOM   1708  C  CD2   . LEU A 1  237  ? -4.673  -17.342 37.727   1.00 128.79 ? 225  LEU A CD2   1 
ATOM   1709  N  N     . ASN A 1  238  ? -0.530  -16.699 35.159   1.00 194.92 ? 226  ASN A N     1 
ATOM   1710  C  CA    . ASN A 1  238  ? 0.695   -16.449 34.410   1.00 185.88 ? 226  ASN A CA    1 
ATOM   1711  C  C     . ASN A 1  238  ? 1.927   -16.804 35.236   1.00 163.43 ? 226  ASN A C     1 
ATOM   1712  O  O     . ASN A 1  238  ? 2.768   -17.593 34.805   1.00 155.02 ? 226  ASN A O     1 
ATOM   1713  C  CB    . ASN A 1  238  ? 0.758   -14.986 33.965   1.00 182.40 ? 226  ASN A CB    1 
ATOM   1714  C  CG    . ASN A 1  238  ? 1.615   -14.789 32.728   1.00 173.08 ? 226  ASN A CG    1 
ATOM   1715  O  OD1   . ASN A 1  238  ? 1.783   -15.704 31.922   1.00 174.90 ? 226  ASN A OD1   1 
ATOM   1716  N  ND2   . ASN A 1  238  ? 2.158   -13.587 32.570   1.00 158.81 ? 226  ASN A ND2   1 
ATOM   1717  N  N     . MET B 1  13   ? -12.267 -35.324 16.431   1.00 124.74 ? 1    MET B N     1 
ATOM   1718  C  CA    . MET B 1  13   ? -11.744 -34.363 15.466   1.00 134.26 ? 1    MET B CA    1 
ATOM   1719  C  C     . MET B 1  13   ? -10.242 -34.533 15.283   1.00 156.96 ? 1    MET B C     1 
ATOM   1720  O  O     . MET B 1  13   ? -9.754  -35.638 15.048   1.00 155.34 ? 1    MET B O     1 
ATOM   1721  C  CB    . MET B 1  13   ? -12.058 -32.931 15.906   1.00 100.41 ? 1    MET B CB    1 
ATOM   1722  N  N     . LEU B 1  14   ? -9.514  -33.422 15.389   1.00 165.12 ? 2    LEU B N     1 
ATOM   1723  C  CA    . LEU B 1  14   ? -8.068  -33.413 15.227   1.00 164.14 ? 2    LEU B CA    1 
ATOM   1724  C  C     . LEU B 1  14   ? -7.460  -32.467 16.254   1.00 161.96 ? 2    LEU B C     1 
ATOM   1725  O  O     . LEU B 1  14   ? -8.148  -31.626 16.839   1.00 139.58 ? 2    LEU B O     1 
ATOM   1726  C  CB    . LEU B 1  14   ? -7.662  -32.998 13.805   1.00 150.28 ? 2    LEU B CB    1 
ATOM   1727  C  CG    . LEU B 1  14   ? -8.221  -33.835 12.651   1.00 133.46 ? 2    LEU B CG    1 
ATOM   1728  C  CD1   . LEU B 1  14   ? -8.005  -33.136 11.318   1.00 121.96 ? 2    LEU B CD1   1 
ATOM   1729  C  CD2   . LEU B 1  14   ? -7.597  -35.223 12.637   1.00 120.95 ? 2    LEU B CD2   1 
ATOM   1730  N  N     . ILE B 1  15   ? -6.154  -32.611 16.462   1.00 174.60 ? 3    ILE B N     1 
ATOM   1731  C  CA    . ILE B 1  15   ? -5.439  -31.836 17.470   1.00 160.14 ? 3    ILE B CA    1 
ATOM   1732  C  C     . ILE B 1  15   ? -5.153  -30.436 16.940   1.00 168.95 ? 3    ILE B C     1 
ATOM   1733  O  O     . ILE B 1  15   ? -4.804  -30.255 15.766   1.00 171.42 ? 3    ILE B O     1 
ATOM   1734  C  CB    . ILE B 1  15   ? -4.142  -32.561 17.878   1.00 154.69 ? 3    ILE B CB    1 
ATOM   1735  C  CG1   . ILE B 1  15   ? -4.460  -33.947 18.445   1.00 132.48 ? 3    ILE B CG1   1 
ATOM   1736  C  CG2   . ILE B 1  15   ? -3.356  -31.744 18.894   1.00 148.54 ? 3    ILE B CG2   1 
ATOM   1737  C  CD1   . ILE B 1  15   ? -3.237  -34.726 18.878   1.00 92.02  ? 3    ILE B CD1   1 
ATOM   1738  N  N     . SER B 1  16   ? -5.309  -29.437 17.810   1.00 155.47 ? 4    SER B N     1 
ATOM   1739  C  CA    . SER B 1  16   ? -5.009  -28.037 17.504   1.00 152.26 ? 4    SER B CA    1 
ATOM   1740  C  C     . SER B 1  16   ? -4.144  -27.497 18.641   1.00 174.53 ? 4    SER B C     1 
ATOM   1741  O  O     . SER B 1  16   ? -4.653  -27.199 19.725   1.00 188.21 ? 4    SER B O     1 
ATOM   1742  C  CB    . SER B 1  16   ? -6.287  -27.222 17.337   1.00 145.00 ? 4    SER B CB    1 
ATOM   1743  O  OG    . SER B 1  16   ? -7.104  -27.307 18.493   1.00 144.77 ? 4    SER B OG    1 
ATOM   1744  N  N     . GLN B 1  17   ? -2.846  -27.353 18.390   1.00 175.18 ? 5    GLN B N     1 
ATOM   1745  C  CA    . GLN B 1  17   ? -1.863  -27.133 19.441   1.00 183.00 ? 5    GLN B CA    1 
ATOM   1746  C  C     . GLN B 1  17   ? -1.396  -25.682 19.492   1.00 168.75 ? 5    GLN B C     1 
ATOM   1747  O  O     . GLN B 1  17   ? -1.660  -24.874 18.595   1.00 148.68 ? 5    GLN B O     1 
ATOM   1748  C  CB    . GLN B 1  17   ? -0.653  -28.055 19.248   1.00 177.00 ? 5    GLN B CB    1 
ATOM   1749  C  CG    . GLN B 1  17   ? 0.179   -27.733 18.017   1.00 157.93 ? 5    GLN B CG    1 
ATOM   1750  C  CD    . GLN B 1  17   ? 1.518   -28.442 18.019   1.00 156.83 ? 5    GLN B CD    1 
ATOM   1751  O  OE1   . GLN B 1  17   ? 1.827   -29.201 18.937   1.00 177.01 ? 5    GLN B OE1   1 
ATOM   1752  N  NE2   . GLN B 1  17   ? 2.323   -28.194 16.993   1.00 138.16 ? 5    GLN B NE2   1 
ATOM   1753  N  N     . ARG B 1  18   ? -0.699  -25.375 20.596   1.00 154.59 ? 6    ARG B N     1 
ATOM   1754  C  CA    . ARG B 1  18   ? 0.062   -24.168 20.914   1.00 141.70 ? 6    ARG B CA    1 
ATOM   1755  C  C     . ARG B 1  18   ? -0.722  -22.930 21.362   1.00 141.74 ? 6    ARG B C     1 
ATOM   1756  O  O     . ARG B 1  18   ? -0.160  -21.831 21.297   1.00 151.84 ? 6    ARG B O     1 
ATOM   1757  C  CB    . ARG B 1  18   ? 0.928   -23.778 19.712   1.00 147.78 ? 6    ARG B CB    1 
ATOM   1758  N  N     . PRO B 1  19   ? -1.963  -23.016 21.856   1.00 128.16 ? 7    PRO B N     1 
ATOM   1759  C  CA    . PRO B 1  19   ? -2.625  -21.768 22.269   1.00 104.56 ? 7    PRO B CA    1 
ATOM   1760  C  C     . PRO B 1  19   ? -2.162  -21.354 23.660   1.00 107.23 ? 7    PRO B C     1 
ATOM   1761  O  O     . PRO B 1  19   ? -2.323  -22.097 24.630   1.00 123.23 ? 7    PRO B O     1 
ATOM   1762  C  CB    . PRO B 1  19   ? -4.112  -22.135 22.251   1.00 77.41  ? 7    PRO B CB    1 
ATOM   1763  C  CG    . PRO B 1  19   ? -4.130  -23.569 22.618   1.00 103.60 ? 7    PRO B CG    1 
ATOM   1764  C  CD    . PRO B 1  19   ? -2.830  -24.180 22.135   1.00 128.45 ? 7    PRO B CD    1 
ATOM   1765  N  N     . THR B 1  20   ? -1.573  -20.163 23.754   1.00 113.58 ? 8    THR B N     1 
ATOM   1766  C  CA    . THR B 1  20   ? -0.999  -19.677 25.000   1.00 117.85 ? 8    THR B CA    1 
ATOM   1767  C  C     . THR B 1  20   ? -1.580  -18.315 25.350   1.00 117.93 ? 8    THR B C     1 
ATOM   1768  O  O     . THR B 1  20   ? -2.086  -17.589 24.491   1.00 114.39 ? 8    THR B O     1 
ATOM   1769  C  CB    . THR B 1  20   ? 0.531   -19.575 24.916   1.00 123.24 ? 8    THR B CB    1 
ATOM   1770  O  OG1   . THR B 1  20   ? 0.892   -18.587 23.943   1.00 116.92 ? 8    THR B OG1   1 
ATOM   1771  C  CG2   . THR B 1  20   ? 1.134   -20.913 24.519   1.00 104.64 ? 8    THR B CG2   1 
ATOM   1772  N  N     . LEU B 1  21   ? -1.491  -17.972 26.634   1.00 115.86 ? 9    LEU B N     1 
ATOM   1773  C  CA    . LEU B 1  21   ? -1.974  -16.699 27.155   1.00 106.23 ? 9    LEU B CA    1 
ATOM   1774  C  C     . LEU B 1  21   ? -0.797  -15.923 27.729   1.00 101.36 ? 9    LEU B C     1 
ATOM   1775  O  O     . LEU B 1  21   ? -0.089  -16.423 28.610   1.00 108.16 ? 9    LEU B O     1 
ATOM   1776  C  CB    . LEU B 1  21   ? -3.053  -16.912 28.220   1.00 84.18  ? 9    LEU B CB    1 
ATOM   1777  C  CG    . LEU B 1  21   ? -3.460  -15.691 29.052   1.00 76.51  ? 9    LEU B CG    1 
ATOM   1778  C  CD1   . LEU B 1  21   ? -3.905  -14.539 28.160   1.00 66.11  ? 9    LEU B CD1   1 
ATOM   1779  C  CD2   . LEU B 1  21   ? -4.553  -16.049 30.054   1.00 101.00 ? 9    LEU B CD2   1 
ATOM   1780  N  N     . SER B 1  22   ? -0.590  -14.708 27.227   1.00 84.78  ? 10   SER B N     1 
ATOM   1781  C  CA    . SER B 1  22   ? 0.451   -13.816 27.713   1.00 93.69  ? 10   SER B CA    1 
ATOM   1782  C  C     . SER B 1  22   ? -0.183  -12.515 28.185   1.00 86.54  ? 10   SER B C     1 
ATOM   1783  O  O     . SER B 1  22   ? -1.273  -12.142 27.744   1.00 71.46  ? 10   SER B O     1 
ATOM   1784  C  CB    . SER B 1  22   ? 1.495   -13.532 26.627   1.00 106.89 ? 10   SER B CB    1 
ATOM   1785  O  OG    . SER B 1  22   ? 1.961   -14.737 26.045   1.00 116.34 ? 10   SER B OG    1 
ATOM   1786  N  N     . GLU B 1  23   ? 0.508   -11.823 29.088   1.00 105.57 ? 11   GLU B N     1 
ATOM   1787  C  CA    . GLU B 1  23   ? -0.024  -10.618 29.709   1.00 96.88  ? 11   GLU B CA    1 
ATOM   1788  C  C     . GLU B 1  23   ? 1.020   -9.513  29.699   1.00 115.10 ? 11   GLU B C     1 
ATOM   1789  O  O     . GLU B 1  23   ? 2.152   -9.717  30.149   1.00 104.45 ? 11   GLU B O     1 
ATOM   1790  C  CB    . GLU B 1  23   ? -0.472  -10.891 31.146   1.00 103.38 ? 11   GLU B CB    1 
ATOM   1791  C  CG    . GLU B 1  23   ? -0.973  -9.660  31.876   1.00 113.12 ? 11   GLU B CG    1 
ATOM   1792  C  CD    . GLU B 1  23   ? -1.208  -9.924  33.344   1.00 119.20 ? 11   GLU B CD    1 
ATOM   1793  O  OE1   . GLU B 1  23   ? -0.860  -11.031 33.805   1.00 115.09 ? 11   GLU B OE1   1 
ATOM   1794  O  OE2   . GLU B 1  23   ? -1.738  -9.027  34.035   1.00 107.00 ? 11   GLU B OE2   1 
ATOM   1795  N  N     . ASP B 1  24   ? 0.634   -8.345  29.192   1.00 116.00 ? 12   ASP B N     1 
ATOM   1796  C  CA    . ASP B 1  24   ? 1.430   -7.131  29.289   1.00 109.46 ? 12   ASP B CA    1 
ATOM   1797  C  C     . ASP B 1  24   ? 0.738   -6.173  30.250   1.00 103.25 ? 12   ASP B C     1 
ATOM   1798  O  O     . ASP B 1  24   ? -0.450  -5.881  30.090   1.00 117.06 ? 12   ASP B O     1 
ATOM   1799  C  CB    . ASP B 1  24   ? 1.615   -6.478  27.917   1.00 101.03 ? 12   ASP B CB    1 
ATOM   1800  C  CG    . ASP B 1  24   ? 2.512   -7.289  27.000   1.00 140.82 ? 12   ASP B CG    1 
ATOM   1801  O  OD1   . ASP B 1  24   ? 3.120   -8.272  27.477   1.00 156.70 ? 12   ASP B OD1   1 
ATOM   1802  O  OD2   . ASP B 1  24   ? 2.609   -6.945  25.804   1.00 160.35 ? 12   ASP B OD2   1 
ATOM   1803  N  N     . VAL B 1  25   ? 1.479   -5.691  31.242   1.00 92.44  ? 13   VAL B N     1 
ATOM   1804  C  CA    . VAL B 1  25   ? 0.928   -4.894  32.332   1.00 87.02  ? 13   VAL B CA    1 
ATOM   1805  C  C     . VAL B 1  25   ? 1.201   -3.424  32.040   1.00 90.99  ? 13   VAL B C     1 
ATOM   1806  O  O     . VAL B 1  25   ? 2.331   -2.947  32.189   1.00 95.35  ? 13   VAL B O     1 
ATOM   1807  C  CB    . VAL B 1  25   ? 1.515   -5.314  33.685   1.00 81.24  ? 13   VAL B CB    1 
ATOM   1808  C  CG1   . VAL B 1  25   ? 0.950   -4.458  34.805   1.00 86.16  ? 13   VAL B CG1   1 
ATOM   1809  C  CG2   . VAL B 1  25   ? 1.237   -6.787  33.944   1.00 99.91  ? 13   VAL B CG2   1 
ATOM   1810  N  N     . LEU B 1  26   ? 0.159   -2.698  31.626   1.00 93.60  ? 14   LEU B N     1 
ATOM   1811  C  CA    . LEU B 1  26   ? 0.283   -1.258  31.412   1.00 100.41 ? 14   LEU B CA    1 
ATOM   1812  C  C     . LEU B 1  26   ? 0.388   -0.523  32.742   1.00 106.44 ? 14   LEU B C     1 
ATOM   1813  O  O     . LEU B 1  26   ? 1.402   0.125   33.032   1.00 115.30 ? 14   LEU B O     1 
ATOM   1814  C  CB    . LEU B 1  26   ? -0.908  -0.742  30.597   1.00 110.67 ? 14   LEU B CB    1 
ATOM   1815  C  CG    . LEU B 1  26   ? -0.945  -0.974  29.080   1.00 89.84  ? 14   LEU B CG    1 
ATOM   1816  C  CD1   . LEU B 1  26   ? 0.311   -0.425  28.417   1.00 118.46 ? 14   LEU B CD1   1 
ATOM   1817  C  CD2   . LEU B 1  26   ? -1.153  -2.442  28.721   1.00 93.49  ? 14   LEU B CD2   1 
ATOM   1818  N  N     . THR B 1  27   ? -0.655  -0.608  33.562   1.00 116.34 ? 15   THR B N     1 
ATOM   1819  C  CA    . THR B 1  27   ? -0.668  -0.074  34.916   1.00 106.39 ? 15   THR B CA    1 
ATOM   1820  C  C     . THR B 1  27   ? -0.990  -1.200  35.896   1.00 117.39 ? 15   THR B C     1 
ATOM   1821  O  O     . THR B 1  27   ? -1.245  -2.341  35.504   1.00 129.39 ? 15   THR B O     1 
ATOM   1822  C  CB    . THR B 1  27   ? -1.680  1.070   35.052   1.00 93.69  ? 15   THR B CB    1 
ATOM   1823  O  OG1   . THR B 1  27   ? -3.003  0.529   35.158   1.00 117.43 ? 15   THR B OG1   1 
ATOM   1824  C  CG2   . THR B 1  27   ? -1.611  1.993   33.843   1.00 102.47 ? 15   THR B CG2   1 
ATOM   1825  N  N     . ASP B 1  28   ? -0.985  -0.861  37.188   1.00 109.35 ? 16   ASP B N     1 
ATOM   1826  C  CA    . ASP B 1  28   ? -1.235  -1.861  38.221   1.00 119.98 ? 16   ASP B CA    1 
ATOM   1827  C  C     . ASP B 1  28   ? -2.643  -2.438  38.128   1.00 118.00 ? 16   ASP B C     1 
ATOM   1828  O  O     . ASP B 1  28   ? -2.873  -3.577  38.551   1.00 115.17 ? 16   ASP B O     1 
ATOM   1829  C  CB    . ASP B 1  28   ? -1.004  -1.252  39.605   1.00 135.05 ? 16   ASP B CB    1 
ATOM   1830  C  CG    . ASP B 1  28   ? 0.326   -0.530  39.707   1.00 139.20 ? 16   ASP B CG    1 
ATOM   1831  O  OD1   . ASP B 1  28   ? 1.040   -0.459  38.684   1.00 137.22 ? 16   ASP B OD1   1 
ATOM   1832  O  OD2   . ASP B 1  28   ? 0.659   -0.035  40.805   1.00 151.82 ? 16   ASP B OD2   1 
ATOM   1833  N  N     . ASN B 1  29   ? -3.591  -1.678  37.585   1.00 116.50 ? 17   ASN B N     1 
ATOM   1834  C  CA    . ASN B 1  29   ? -4.977  -2.112  37.453   1.00 135.35 ? 17   ASN B CA    1 
ATOM   1835  C  C     . ASN B 1  29   ? -5.442  -2.000  36.008   1.00 131.66 ? 17   ASN B C     1 
ATOM   1836  O  O     . ASN B 1  29   ? -6.585  -1.626  35.729   1.00 132.46 ? 17   ASN B O     1 
ATOM   1837  C  CB    . ASN B 1  29   ? -5.889  -1.319  38.384   1.00 123.76 ? 17   ASN B CB    1 
ATOM   1838  C  CG    . ASN B 1  29   ? -5.506  0.145   38.469   1.00 118.13 ? 17   ASN B CG    1 
ATOM   1839  O  OD1   . ASN B 1  29   ? -4.390  0.529   38.120   1.00 107.60 ? 17   ASN B OD1   1 
ATOM   1840  N  ND2   . ASN B 1  29   ? -6.429  0.971   38.949   1.00 122.39 ? 17   ASN B ND2   1 
ATOM   1841  N  N     . ARG B 1  30   ? -4.556  -2.325  35.069   1.00 121.38 ? 18   ARG B N     1 
ATOM   1842  C  CA    . ARG B 1  30   ? -4.911  -2.379  33.652   1.00 111.84 ? 18   ARG B CA    1 
ATOM   1843  C  C     . ARG B 1  30   ? -3.829  -3.158  32.925   1.00 112.52 ? 18   ARG B C     1 
ATOM   1844  O  O     . ARG B 1  30   ? -2.664  -2.746  32.928   1.00 114.03 ? 18   ARG B O     1 
ATOM   1845  C  CB    . ARG B 1  30   ? -5.062  -0.979  33.054   1.00 109.02 ? 18   ARG B CB    1 
ATOM   1846  C  CG    . ARG B 1  30   ? -5.102  -0.982  31.533   1.00 113.72 ? 18   ARG B CG    1 
ATOM   1847  C  CD    . ARG B 1  30   ? -5.496  0.369   30.961   1.00 125.66 ? 18   ARG B CD    1 
ATOM   1848  N  NE    . ARG B 1  30   ? -5.365  0.392   29.506   1.00 102.61 ? 18   ARG B NE    1 
ATOM   1849  C  CZ    . ARG B 1  30   ? -5.839  1.358   28.726   1.00 112.60 ? 18   ARG B CZ    1 
ATOM   1850  N  NH1   . ARG B 1  30   ? -6.487  2.386   29.257   1.00 127.76 ? 18   ARG B NH1   1 
ATOM   1851  N  NH2   . ARG B 1  30   ? -5.670  1.295   27.413   1.00 124.40 ? 18   ARG B NH2   1 
ATOM   1852  N  N     . SER B 1  31   ? -4.206  -4.273  32.305   1.00 111.07 ? 19   SER B N     1 
ATOM   1853  C  CA    . SER B 1  31   ? -3.267  -5.121  31.590   1.00 97.74  ? 19   SER B CA    1 
ATOM   1854  C  C     . SER B 1  31   ? -3.837  -5.500  30.231   1.00 101.71 ? 19   SER B C     1 
ATOM   1855  O  O     . SER B 1  31   ? -5.043  -5.408  29.989   1.00 101.54 ? 19   SER B O     1 
ATOM   1856  C  CB    . SER B 1  31   ? -2.935  -6.389  32.388   1.00 96.10  ? 19   SER B CB    1 
ATOM   1857  O  OG    . SER B 1  31   ? -2.336  -6.070  33.631   1.00 80.22  ? 19   SER B OG    1 
ATOM   1858  N  N     . GLN B 1  32   ? -2.946  -5.934  29.344   1.00 103.09 ? 20   GLN B N     1 
ATOM   1859  C  CA    . GLN B 1  32   ? -3.312  -6.419  28.020   1.00 76.09  ? 20   GLN B CA    1 
ATOM   1860  C  C     . GLN B 1  32   ? -2.997  -7.904  27.920   1.00 80.75  ? 20   GLN B C     1 
ATOM   1861  O  O     . GLN B 1  32   ? -1.888  -8.331  28.257   1.00 86.89  ? 20   GLN B O     1 
ATOM   1862  C  CB    . GLN B 1  32   ? -2.575  -5.652  26.920   1.00 86.51  ? 20   GLN B CB    1 
ATOM   1863  C  CG    . GLN B 1  32   ? -3.341  -4.463  26.362   1.00 103.61 ? 20   GLN B CG    1 
ATOM   1864  C  CD    . GLN B 1  32   ? -2.789  -3.990  25.029   1.00 113.25 ? 20   GLN B CD    1 
ATOM   1865  O  OE1   . GLN B 1  32   ? -1.874  -4.597  24.474   1.00 94.05  ? 20   GLN B OE1   1 
ATOM   1866  N  NE2   . GLN B 1  32   ? -3.347  -2.902  24.508   1.00 119.06 ? 20   GLN B NE2   1 
ATOM   1867  N  N     . PHE B 1  33   ? -3.969  -8.682  27.455   1.00 83.77  ? 21   PHE B N     1 
ATOM   1868  C  CA    . PHE B 1  33   ? -3.826  -10.122 27.298   1.00 88.83  ? 21   PHE B CA    1 
ATOM   1869  C  C     . PHE B 1  33   ? -3.876  -10.492 25.822   1.00 92.70  ? 21   PHE B C     1 
ATOM   1870  O  O     . PHE B 1  33   ? -4.641  -9.905  25.050   1.00 88.91  ? 21   PHE B O     1 
ATOM   1871  C  CB    . PHE B 1  33   ? -4.925  -10.871 28.055   1.00 75.84  ? 21   PHE B CB    1 
ATOM   1872  C  CG    . PHE B 1  33   ? -4.940  -10.599 29.531   1.00 84.34  ? 21   PHE B CG    1 
ATOM   1873  C  CD1   . PHE B 1  33   ? -5.662  -9.535  30.047   1.00 92.39  ? 21   PHE B CD1   1 
ATOM   1874  C  CD2   . PHE B 1  33   ? -4.234  -11.409 30.403   1.00 85.40  ? 21   PHE B CD2   1 
ATOM   1875  C  CE1   . PHE B 1  33   ? -5.677  -9.284  31.407   1.00 89.56  ? 21   PHE B CE1   1 
ATOM   1876  C  CE2   . PHE B 1  33   ? -4.246  -11.164 31.762   1.00 98.05  ? 21   PHE B CE2   1 
ATOM   1877  C  CZ    . PHE B 1  33   ? -4.968  -10.101 32.265   1.00 91.06  ? 21   PHE B CZ    1 
ATOM   1878  N  N     . VAL B 1  34   ? -3.059  -11.469 25.436   1.00 97.69  ? 22   VAL B N     1 
ATOM   1879  C  CA    . VAL B 1  34   ? -3.050  -11.996 24.078   1.00 74.79  ? 22   VAL B CA    1 
ATOM   1880  C  C     . VAL B 1  34   ? -3.223  -13.508 24.145   1.00 71.62  ? 22   VAL B C     1 
ATOM   1881  O  O     . VAL B 1  34   ? -2.480  -14.194 24.855   1.00 73.12  ? 22   VAL B O     1 
ATOM   1882  C  CB    . VAL B 1  34   ? -1.762  -11.621 23.317   1.00 67.51  ? 22   VAL B CB    1 
ATOM   1883  C  CG1   . VAL B 1  34   ? -1.791  -10.152 22.919   1.00 66.16  ? 22   VAL B CG1   1 
ATOM   1884  C  CG2   . VAL B 1  34   ? -0.529  -11.911 24.156   1.00 79.01  ? 22   VAL B CG2   1 
ATOM   1885  N  N     . ILE B 1  35   ? -4.216  -14.021 23.427   1.00 62.43  ? 23   ILE B N     1 
ATOM   1886  C  CA    . ILE B 1  35   ? -4.441  -15.455 23.291   1.00 70.52  ? 23   ILE B CA    1 
ATOM   1887  C  C     . ILE B 1  35   ? -4.007  -15.843 21.887   1.00 95.25  ? 23   ILE B C     1 
ATOM   1888  O  O     . ILE B 1  35   ? -4.606  -15.400 20.901   1.00 95.92  ? 23   ILE B O     1 
ATOM   1889  C  CB    . ILE B 1  35   ? -5.907  -15.834 23.555   1.00 67.17  ? 23   ILE B CB    1 
ATOM   1890  C  CG1   . ILE B 1  35   ? -6.334  -15.388 24.954   1.00 60.27  ? 23   ILE B CG1   1 
ATOM   1891  C  CG2   . ILE B 1  35   ? -6.106  -17.331 23.416   1.00 88.98  ? 23   ILE B CG2   1 
ATOM   1892  C  CD1   . ILE B 1  35   ? -7.749  -15.800 25.325   1.00 72.33  ? 23   ILE B CD1   1 
ATOM   1893  N  N     . GLU B 1  36   ? -2.956  -16.659 21.797   1.00 108.96 ? 24   GLU B N     1 
ATOM   1894  C  CA    . GLU B 1  36   ? -2.314  -16.939 20.529   1.00 99.58  ? 24   GLU B CA    1 
ATOM   1895  C  C     . GLU B 1  36   ? -1.786  -18.365 20.516   1.00 107.81 ? 24   GLU B C     1 
ATOM   1896  O  O     . GLU B 1  36   ? -1.268  -18.833 21.541   1.00 115.68 ? 24   GLU B O     1 
ATOM   1897  C  CB    . GLU B 1  36   ? -1.168  -15.954 20.276   1.00 105.34 ? 24   GLU B CB    1 
ATOM   1898  C  CG    . GLU B 1  36   ? -0.245  -16.354 19.151   1.00 120.55 ? 24   GLU B CG    1 
ATOM   1899  C  CD    . GLU B 1  36   ? 1.021   -15.537 19.122   1.00 127.74 ? 24   GLU B CD    1 
ATOM   1900  O  OE1   . GLU B 1  36   ? 1.184   -14.657 19.991   1.00 123.27 ? 24   GLU B OE1   1 
ATOM   1901  O  OE2   . GLU B 1  36   ? 1.857   -15.778 18.228   1.00 141.75 ? 24   GLU B OE2   1 
ATOM   1902  N  N     . PRO B 1  37   ? -1.931  -19.091 19.394   1.00 111.30 ? 25   PRO B N     1 
ATOM   1903  C  CA    . PRO B 1  37   ? -2.759  -18.658 18.265   1.00 113.62 ? 25   PRO B CA    1 
ATOM   1904  C  C     . PRO B 1  37   ? -4.058  -19.447 18.102   1.00 107.78 ? 25   PRO B C     1 
ATOM   1905  O  O     . PRO B 1  37   ? -4.027  -20.666 17.931   1.00 83.38  ? 25   PRO B O     1 
ATOM   1906  C  CB    . PRO B 1  37   ? -1.843  -18.891 17.066   1.00 106.19 ? 25   PRO B CB    1 
ATOM   1907  C  CG    . PRO B 1  37   ? -1.002  -20.067 17.478   1.00 118.78 ? 25   PRO B CG    1 
ATOM   1908  C  CD    . PRO B 1  37   ? -0.948  -20.107 18.982   1.00 120.03 ? 25   PRO B CD    1 
ATOM   1909  N  N     . LEU B 1  38   ? -5.188  -18.750 18.147   1.00 114.76 ? 26   LEU B N     1 
ATOM   1910  C  CA    . LEU B 1  38   ? -6.463  -19.390 17.861   1.00 102.93 ? 26   LEU B CA    1 
ATOM   1911  C  C     . LEU B 1  38   ? -6.574  -19.690 16.372   1.00 94.59  ? 26   LEU B C     1 
ATOM   1912  O  O     . LEU B 1  38   ? -6.315  -18.823 15.529   1.00 104.12 ? 26   LEU B O     1 
ATOM   1913  C  CB    . LEU B 1  38   ? -7.620  -18.498 18.313   1.00 113.73 ? 26   LEU B CB    1 
ATOM   1914  C  CG    . LEU B 1  38   ? -7.541  -18.058 19.778   1.00 101.04 ? 26   LEU B CG    1 
ATOM   1915  C  CD1   . LEU B 1  38   ? -8.749  -17.220 20.184   1.00 82.35  ? 26   LEU B CD1   1 
ATOM   1916  C  CD2   . LEU B 1  38   ? -7.386  -19.270 20.686   1.00 96.66  ? 26   LEU B CD2   1 
ATOM   1917  N  N     . GLU B 1  39   ? -6.937  -20.928 16.052   1.00 79.20  ? 27   GLU B N     1 
ATOM   1918  C  CA    . GLU B 1  39   ? -7.149  -21.307 14.666   1.00 112.99 ? 27   GLU B CA    1 
ATOM   1919  C  C     . GLU B 1  39   ? -8.294  -20.495 14.062   1.00 109.02 ? 27   GLU B C     1 
ATOM   1920  O  O     . GLU B 1  39   ? -9.247  -20.130 14.759   1.00 101.30 ? 27   GLU B O     1 
ATOM   1921  C  CB    . GLU B 1  39   ? -7.440  -22.805 14.552   1.00 105.82 ? 27   GLU B CB    1 
ATOM   1922  C  CG    . GLU B 1  39   ? -8.479  -23.330 15.524   1.00 85.87  ? 27   GLU B CG    1 
ATOM   1923  C  CD    . GLU B 1  39   ? -8.681  -24.834 15.419   1.00 96.88  ? 27   GLU B CD    1 
ATOM   1924  O  OE1   . GLU B 1  39   ? -8.341  -25.419 14.368   1.00 93.19  ? 27   GLU B OE1   1 
ATOM   1925  O  OE2   . GLU B 1  39   ? -9.181  -25.432 16.394   1.00 117.43 ? 27   GLU B OE2   1 
ATOM   1926  N  N     . PRO B 1  40   ? -8.217  -20.206 12.764   1.00 109.01 ? 28   PRO B N     1 
ATOM   1927  C  CA    . PRO B 1  40   ? -9.244  -19.383 12.113   1.00 107.08 ? 28   PRO B CA    1 
ATOM   1928  C  C     . PRO B 1  40   ? -10.595 -20.084 12.104   1.00 99.76  ? 28   PRO B C     1 
ATOM   1929  O  O     . PRO B 1  40   ? -10.704 -21.251 11.719   1.00 116.63 ? 28   PRO B O     1 
ATOM   1930  C  CB    . PRO B 1  40   ? -8.695  -19.193 10.693   1.00 129.71 ? 28   PRO B CB    1 
ATOM   1931  C  CG    . PRO B 1  40   ? -7.799  -20.370 10.468   1.00 138.00 ? 28   PRO B CG    1 
ATOM   1932  C  CD    . PRO B 1  40   ? -7.257  -20.779 11.807   1.00 107.86 ? 28   PRO B CD    1 
ATOM   1933  N  N     . GLY B 1  41   ? -11.626 -19.364 12.539   1.00 95.17  ? 29   GLY B N     1 
ATOM   1934  C  CA    . GLY B 1  41   ? -11.472 -18.005 13.020   1.00 97.73  ? 29   GLY B CA    1 
ATOM   1935  C  C     . GLY B 1  41   ? -12.077 -17.856 14.400   1.00 97.55  ? 29   GLY B C     1 
ATOM   1936  O  O     . GLY B 1  41   ? -13.083 -17.174 14.575   1.00 87.47  ? 29   GLY B O     1 
ATOM   1937  N  N     . PHE B 1  42   ? -11.458 -18.501 15.390   1.00 110.03 ? 30   PHE B N     1 
ATOM   1938  C  CA    . PHE B 1  42   ? -12.080 -18.585 16.708   1.00 103.70 ? 30   PHE B CA    1 
ATOM   1939  C  C     . PHE B 1  42   ? -12.014 -17.258 17.451   1.00 93.82  ? 30   PHE B C     1 
ATOM   1940  O  O     . PHE B 1  42   ? -12.903 -16.951 18.253   1.00 94.72  ? 30   PHE B O     1 
ATOM   1941  C  CB    . PHE B 1  42   ? -11.422 -19.685 17.535   1.00 92.71  ? 30   PHE B CB    1 
ATOM   1942  C  CG    . PHE B 1  42   ? -12.163 -20.987 17.508   1.00 83.56  ? 30   PHE B CG    1 
ATOM   1943  C  CD1   . PHE B 1  42   ? -13.483 -21.059 17.921   1.00 79.01  ? 30   PHE B CD1   1 
ATOM   1944  C  CD2   . PHE B 1  42   ? -11.534 -22.144 17.089   1.00 80.48  ? 30   PHE B CD2   1 
ATOM   1945  C  CE1   . PHE B 1  42   ? -14.164 -22.259 17.902   1.00 85.51  ? 30   PHE B CE1   1 
ATOM   1946  C  CE2   . PHE B 1  42   ? -12.207 -23.346 17.070   1.00 81.95  ? 30   PHE B CE2   1 
ATOM   1947  C  CZ    . PHE B 1  42   ? -13.523 -23.405 17.477   1.00 81.48  ? 30   PHE B CZ    1 
ATOM   1948  N  N     . GLY B 1  43   ? -10.969 -16.467 17.201   1.00 91.75  ? 31   GLY B N     1 
ATOM   1949  C  CA    . GLY B 1  43   ? -10.723 -15.214 17.895   1.00 78.89  ? 31   GLY B CA    1 
ATOM   1950  C  C     . GLY B 1  43   ? -11.948 -14.361 18.152   1.00 77.19  ? 31   GLY B C     1 
ATOM   1951  O  O     . GLY B 1  43   ? -12.035 -13.680 19.179   1.00 82.73  ? 31   GLY B O     1 
ATOM   1952  N  N     . TYR B 1  44   ? -12.905 -14.403 17.221   1.00 79.86  ? 32   TYR B N     1 
ATOM   1953  C  CA    . TYR B 1  44   ? -14.178 -13.709 17.388   1.00 74.55  ? 32   TYR B CA    1 
ATOM   1954  C  C     . TYR B 1  44   ? -15.169 -14.497 18.240   1.00 85.13  ? 32   TYR B C     1 
ATOM   1955  O  O     . TYR B 1  44   ? -15.970 -13.890 18.957   1.00 93.13  ? 32   TYR B O     1 
ATOM   1956  C  CB    . TYR B 1  44   ? -14.792 -13.404 16.017   1.00 80.72  ? 32   TYR B CB    1 
ATOM   1957  C  CG    . TYR B 1  44   ? -14.179 -12.200 15.333   1.00 73.97  ? 32   TYR B CG    1 
ATOM   1958  C  CD1   . TYR B 1  44   ? -14.750 -10.939 15.459   1.00 87.21  ? 32   TYR B CD1   1 
ATOM   1959  C  CD2   . TYR B 1  44   ? -13.025 -12.322 14.572   1.00 81.94  ? 32   TYR B CD2   1 
ATOM   1960  C  CE1   . TYR B 1  44   ? -14.190 -9.835  14.842   1.00 104.92 ? 32   TYR B CE1   1 
ATOM   1961  C  CE2   . TYR B 1  44   ? -12.459 -11.226 13.952   1.00 86.74  ? 32   TYR B CE2   1 
ATOM   1962  C  CZ    . TYR B 1  44   ? -13.045 -9.984  14.089   1.00 95.76  ? 32   TYR B CZ    1 
ATOM   1963  O  OH    . TYR B 1  44   ? -12.487 -8.885  13.474   1.00 106.71 ? 32   TYR B OH    1 
ATOM   1964  N  N     . THR B 1  45   ? -15.141 -15.834 18.184   1.00 93.29  ? 33   THR B N     1 
ATOM   1965  C  CA    . THR B 1  45   ? -16.078 -16.626 18.981   1.00 101.28 ? 33   THR B CA    1 
ATOM   1966  C  C     . THR B 1  45   ? -15.900 -16.347 20.467   1.00 73.02  ? 33   THR B C     1 
ATOM   1967  O  O     . THR B 1  45   ? -16.841 -15.935 21.155   1.00 67.69  ? 33   THR B O     1 
ATOM   1968  C  CB    . THR B 1  45   ? -15.901 -18.123 18.715   1.00 108.09 ? 33   THR B CB    1 
ATOM   1969  O  OG1   . THR B 1  45   ? -14.838 -18.627 19.533   1.00 113.53 ? 33   THR B OG1   1 
ATOM   1970  C  CG2   . THR B 1  45   ? -15.571 -18.381 17.269   1.00 82.21  ? 33   THR B CG2   1 
ATOM   1971  N  N     . LEU B 1  46   ? -14.697 -16.584 20.982   1.00 61.16  ? 34   LEU B N     1 
ATOM   1972  C  CA    . LEU B 1  46   ? -14.395 -16.339 22.384   1.00 73.35  ? 34   LEU B CA    1 
ATOM   1973  C  C     . LEU B 1  46   ? -13.905 -14.918 22.637   1.00 79.59  ? 34   LEU B C     1 
ATOM   1974  O  O     . LEU B 1  46   ? -13.372 -14.641 23.716   1.00 68.67  ? 34   LEU B O     1 
ATOM   1975  C  CB    . LEU B 1  46   ? -13.367 -17.359 22.891   1.00 59.54  ? 34   LEU B CB    1 
ATOM   1976  C  CG    . LEU B 1  46   ? -11.954 -17.432 22.308   1.00 64.87  ? 34   LEU B CG    1 
ATOM   1977  C  CD1   . LEU B 1  46   ? -10.959 -16.705 23.199   1.00 66.35  ? 34   LEU B CD1   1 
ATOM   1978  C  CD2   . LEU B 1  46   ? -11.532 -18.882 22.112   1.00 57.00  ? 34   LEU B CD2   1 
ATOM   1979  N  N     . GLY B 1  47   ? -14.083 -14.015 21.674   1.00 82.77  ? 35   GLY B N     1 
ATOM   1980  C  CA    . GLY B 1  47   ? -13.690 -12.631 21.843   1.00 78.10  ? 35   GLY B CA    1 
ATOM   1981  C  C     . GLY B 1  47   ? -14.745 -11.798 22.540   1.00 72.68  ? 35   GLY B C     1 
ATOM   1982  O  O     . GLY B 1  47   ? -14.532 -11.323 23.660   1.00 65.45  ? 35   GLY B O     1 
ATOM   1983  N  N     . ASN B 1  48   ? -15.894 -11.612 21.884   1.00 73.01  ? 36   ASN B N     1 
ATOM   1984  C  CA    . ASN B 1  48   ? -16.980 -10.852 22.489   1.00 83.25  ? 36   ASN B CA    1 
ATOM   1985  C  C     . ASN B 1  48   ? -17.544 -11.540 23.725   1.00 76.84  ? 36   ASN B C     1 
ATOM   1986  O  O     . ASN B 1  48   ? -18.139 -10.871 24.577   1.00 79.90  ? 36   ASN B O     1 
ATOM   1987  C  CB    . ASN B 1  48   ? -18.092 -10.625 21.465   1.00 95.60  ? 36   ASN B CB    1 
ATOM   1988  C  CG    . ASN B 1  48   ? -19.114 -9.615  21.936   1.00 94.23  ? 36   ASN B CG    1 
ATOM   1989  O  OD1   . ASN B 1  48   ? -18.809 -8.740  22.745   1.00 77.29  ? 36   ASN B OD1   1 
ATOM   1990  N  ND2   . ASN B 1  48   ? -20.336 -9.733  21.434   1.00 84.03  ? 36   ASN B ND2   1 
ATOM   1991  N  N     . SER B 1  49   ? -17.370 -12.858 23.841   1.00 73.43  ? 37   SER B N     1 
ATOM   1992  C  CA    . SER B 1  49   ? -17.857 -13.571 25.017   1.00 72.14  ? 37   SER B CA    1 
ATOM   1993  C  C     . SER B 1  49   ? -16.995 -13.278 26.238   1.00 69.47  ? 37   SER B C     1 
ATOM   1994  O  O     . SER B 1  49   ? -17.519 -13.067 27.338   1.00 79.93  ? 37   SER B O     1 
ATOM   1995  C  CB    . SER B 1  49   ? -17.899 -15.073 24.738   1.00 77.15  ? 37   SER B CB    1 
ATOM   1996  O  OG    . SER B 1  49   ? -18.845 -15.377 23.728   1.00 70.70  ? 37   SER B OG    1 
ATOM   1997  N  N     . LEU B 1  50   ? -15.672 -13.269 26.064   1.00 56.72  ? 38   LEU B N     1 
ATOM   1998  C  CA    . LEU B 1  50   ? -14.783 -12.966 27.181   1.00 56.61  ? 38   LEU B CA    1 
ATOM   1999  C  C     . LEU B 1  50   ? -15.004 -11.549 27.692   1.00 61.55  ? 38   LEU B C     1 
ATOM   2000  O  O     . LEU B 1  50   ? -14.947 -11.304 28.903   1.00 69.92  ? 38   LEU B O     1 
ATOM   2001  C  CB    . LEU B 1  50   ? -13.326 -13.165 26.766   1.00 55.28  ? 38   LEU B CB    1 
ATOM   2002  C  CG    . LEU B 1  50   ? -12.718 -14.524 27.120   1.00 59.66  ? 38   LEU B CG    1 
ATOM   2003  C  CD1   . LEU B 1  50   ? -11.258 -14.601 26.688   1.00 81.63  ? 38   LEU B CD1   1 
ATOM   2004  C  CD2   . LEU B 1  50   ? -12.860 -14.801 28.612   1.00 53.73  ? 38   LEU B CD2   1 
ATOM   2005  N  N     . ARG B 1  51   ? -15.265 -10.603 26.788   1.00 63.58  ? 39   ARG B N     1 
ATOM   2006  C  CA    . ARG B 1  51   ? -15.497 -9.227  27.211   1.00 69.02  ? 39   ARG B CA    1 
ATOM   2007  C  C     . ARG B 1  51   ? -16.780 -9.108  28.024   1.00 75.09  ? 39   ARG B C     1 
ATOM   2008  O  O     . ARG B 1  51   ? -16.783 -8.526  29.115   1.00 82.27  ? 39   ARG B O     1 
ATOM   2009  C  CB    . ARG B 1  51   ? -15.547 -8.294  26.002   1.00 67.57  ? 39   ARG B CB    1 
ATOM   2010  C  CG    . ARG B 1  51   ? -16.146 -6.940  26.340   1.00 63.13  ? 39   ARG B CG    1 
ATOM   2011  C  CD    . ARG B 1  51   ? -15.881 -5.896  25.277   1.00 63.79  ? 39   ARG B CD    1 
ATOM   2012  N  NE    . ARG B 1  51   ? -16.304 -4.573  25.729   1.00 75.56  ? 39   ARG B NE    1 
ATOM   2013  C  CZ    . ARG B 1  51   ? -17.535 -4.093  25.586   1.00 84.21  ? 39   ARG B CZ    1 
ATOM   2014  N  NH1   . ARG B 1  51   ? -18.470 -4.825  24.996   1.00 76.20  ? 39   ARG B NH1   1 
ATOM   2015  N  NH2   . ARG B 1  51   ? -17.831 -2.879  26.032   1.00 98.38  ? 39   ARG B NH2   1 
ATOM   2016  N  N     . ARG B 1  52   ? -17.884 -9.651  27.505   1.00 72.89  ? 40   ARG B N     1 
ATOM   2017  C  CA    . ARG B 1  52   ? -19.159 -9.529  28.204   1.00 72.93  ? 40   ARG B CA    1 
ATOM   2018  C  C     . ARG B 1  52   ? -19.148 -10.276 29.533   1.00 77.47  ? 40   ARG B C     1 
ATOM   2019  O  O     . ARG B 1  52   ? -19.841 -9.871  30.473   1.00 90.98  ? 40   ARG B O     1 
ATOM   2020  C  CB    . ARG B 1  52   ? -20.299 -10.033 27.318   1.00 80.66  ? 40   ARG B CB    1 
ATOM   2021  C  CG    . ARG B 1  52   ? -21.664 -9.501  27.725   1.00 79.70  ? 40   ARG B CG    1 
ATOM   2022  C  CD    . ARG B 1  52   ? -21.700 -7.982  27.639   1.00 91.52  ? 40   ARG B CD    1 
ATOM   2023  N  NE    . ARG B 1  52   ? -21.772 -7.514  26.257   1.00 126.19 ? 40   ARG B NE    1 
ATOM   2024  C  CZ    . ARG B 1  52   ? -22.867 -7.011  25.696   1.00 132.27 ? 40   ARG B CZ    1 
ATOM   2025  N  NH1   . ARG B 1  52   ? -23.983 -6.897  26.401   1.00 125.94 ? 40   ARG B NH1   1 
ATOM   2026  N  NH2   . ARG B 1  52   ? -22.844 -6.614  24.430   1.00 128.96 ? 40   ARG B NH2   1 
ATOM   2027  N  N     . THR B 1  53   ? -18.372 -11.359 29.634   1.00 68.06  ? 41   THR B N     1 
ATOM   2028  C  CA    . THR B 1  53   ? -18.261 -12.070 30.905   1.00 69.34  ? 41   THR B CA    1 
ATOM   2029  C  C     . THR B 1  53   ? -17.515 -11.236 31.936   1.00 72.53  ? 41   THR B C     1 
ATOM   2030  O  O     . THR B 1  53   ? -17.875 -11.230 33.119   1.00 87.20  ? 41   THR B O     1 
ATOM   2031  C  CB    . THR B 1  53   ? -17.562 -13.414 30.698   1.00 64.36  ? 41   THR B CB    1 
ATOM   2032  O  OG1   . THR B 1  53   ? -18.177 -14.109 29.607   1.00 62.22  ? 41   THR B OG1   1 
ATOM   2033  C  CG2   . THR B 1  53   ? -17.663 -14.270 31.954   1.00 65.34  ? 41   THR B CG2   1 
ATOM   2034  N  N     . LEU B 1  54   ? -16.469 -10.528 31.505   1.00 68.94  ? 42   LEU B N     1 
ATOM   2035  C  CA    . LEU B 1  54   ? -15.750 -9.636  32.408   1.00 70.25  ? 42   LEU B CA    1 
ATOM   2036  C  C     . LEU B 1  54   ? -16.643 -8.493  32.872   1.00 79.62  ? 42   LEU B C     1 
ATOM   2037  O  O     . LEU B 1  54   ? -16.748 -8.220  34.074   1.00 100.33 ? 42   LEU B O     1 
ATOM   2038  C  CB    . LEU B 1  54   ? -14.497 -9.095  31.715   1.00 62.68  ? 42   LEU B CB    1 
ATOM   2039  C  CG    . LEU B 1  54   ? -13.368 -10.087 31.421   1.00 50.29  ? 42   LEU B CG    1 
ATOM   2040  C  CD1   . LEU B 1  54   ? -12.502 -9.607  30.261   1.00 65.63  ? 42   LEU B CD1   1 
ATOM   2041  C  CD2   . LEU B 1  54   ? -12.520 -10.312 32.662   1.00 59.48  ? 42   LEU B CD2   1 
ATOM   2042  N  N     . LEU B 1  55   ? -17.317 -7.829  31.931   1.00 70.18  ? 43   LEU B N     1 
ATOM   2043  C  CA    . LEU B 1  55   ? -18.070 -6.621  32.246   1.00 83.19  ? 43   LEU B CA    1 
ATOM   2044  C  C     . LEU B 1  55   ? -19.353 -6.898  33.019   1.00 104.37 ? 43   LEU B C     1 
ATOM   2045  O  O     . LEU B 1  55   ? -19.894 -5.975  33.637   1.00 116.61 ? 43   LEU B O     1 
ATOM   2046  C  CB    . LEU B 1  55   ? -18.406 -5.868  30.958   1.00 89.96  ? 43   LEU B CB    1 
ATOM   2047  C  CG    . LEU B 1  55   ? -17.703 -4.529  30.730   1.00 95.09  ? 43   LEU B CG    1 
ATOM   2048  C  CD1   . LEU B 1  55   ? -16.204 -4.680  30.885   1.00 82.97  ? 43   LEU B CD1   1 
ATOM   2049  C  CD2   . LEU B 1  55   ? -18.045 -3.973  29.356   1.00 91.45  ? 43   LEU B CD2   1 
ATOM   2050  N  N     . SER B 1  56   ? -19.854 -8.134  33.009   1.00 103.44 ? 44   SER B N     1 
ATOM   2051  C  CA    . SER B 1  56   ? -21.192 -8.393  33.517   1.00 95.02  ? 44   SER B CA    1 
ATOM   2052  C  C     . SER B 1  56   ? -21.308 -9.579  34.465   1.00 84.48  ? 44   SER B C     1 
ATOM   2053  O  O     . SER B 1  56   ? -22.408 -9.829  34.968   1.00 93.66  ? 44   SER B O     1 
ATOM   2054  C  CB    . SER B 1  56   ? -22.167 -8.603  32.348   1.00 97.43  ? 44   SER B CB    1 
ATOM   2055  O  OG    . SER B 1  56   ? -22.096 -7.529  31.427   1.00 100.72 ? 44   SER B OG    1 
ATOM   2056  N  N     . SER B 1  57   ? -20.232 -10.314 34.729   1.00 83.49  ? 45   SER B N     1 
ATOM   2057  C  CA    . SER B 1  57   ? -20.340 -11.537 35.523   1.00 93.41  ? 45   SER B CA    1 
ATOM   2058  C  C     . SER B 1  57   ? -19.157 -11.682 36.477   1.00 83.54  ? 45   SER B C     1 
ATOM   2059  O  O     . SER B 1  57   ? -18.560 -12.751 36.609   1.00 60.86  ? 45   SER B O     1 
ATOM   2060  C  CB    . SER B 1  57   ? -20.464 -12.763 34.623   1.00 104.55 ? 45   SER B CB    1 
ATOM   2061  O  OG    . SER B 1  57   ? -20.901 -13.885 35.370   1.00 116.47 ? 45   SER B OG    1 
ATOM   2062  N  N     . ILE B 1  58   ? -18.813 -10.600 37.166   1.00 80.96  ? 46   ILE B N     1 
ATOM   2063  C  CA    . ILE B 1  58   ? -17.874 -10.665 38.283   1.00 87.53  ? 46   ILE B CA    1 
ATOM   2064  C  C     . ILE B 1  58   ? -18.539 -10.007 39.486   1.00 99.23  ? 46   ILE B C     1 
ATOM   2065  O  O     . ILE B 1  58   ? -18.997 -8.860  39.386   1.00 106.21 ? 46   ILE B O     1 
ATOM   2066  C  CB    . ILE B 1  58   ? -16.532 -9.994  37.952   1.00 86.63  ? 46   ILE B CB    1 
ATOM   2067  C  CG1   . ILE B 1  58   ? -15.894 -10.634 36.717   1.00 96.50  ? 46   ILE B CG1   1 
ATOM   2068  C  CG2   . ILE B 1  58   ? -15.588 -10.088 39.144   1.00 67.74  ? 46   ILE B CG2   1 
ATOM   2069  C  CD1   . ILE B 1  58   ? -14.526 -10.081 36.394   1.00 79.84  ? 46   ILE B CD1   1 
ATOM   2070  N  N     . PRO B 1  59   ? -18.627 -10.685 40.630   1.00 89.89  ? 47   PRO B N     1 
ATOM   2071  C  CA    . PRO B 1  59   ? -19.347 -10.108 41.775   1.00 69.28  ? 47   PRO B CA    1 
ATOM   2072  C  C     . PRO B 1  59   ? -18.581 -8.941  42.382   1.00 69.71  ? 47   PRO B C     1 
ATOM   2073  O  O     . PRO B 1  59   ? -17.400 -9.057  42.712   1.00 74.22  ? 47   PRO B O     1 
ATOM   2074  C  CB    . PRO B 1  59   ? -19.457 -11.283 42.753   1.00 104.31 ? 47   PRO B CB    1 
ATOM   2075  C  CG    . PRO B 1  59   ? -18.311 -12.172 42.399   1.00 122.20 ? 47   PRO B CG    1 
ATOM   2076  C  CD    . PRO B 1  59   ? -18.127 -12.042 40.913   1.00 97.24  ? 47   PRO B CD    1 
ATOM   2077  N  N     . GLY B 1  60   ? -19.267 -7.809  42.525   1.00 68.78  ? 48   GLY B N     1 
ATOM   2078  C  CA    . GLY B 1  60   ? -18.683 -6.645  43.157   1.00 87.45  ? 48   GLY B CA    1 
ATOM   2079  C  C     . GLY B 1  60   ? -19.730 -5.883  43.939   1.00 98.21  ? 48   GLY B C     1 
ATOM   2080  O  O     . GLY B 1  60   ? -20.918 -6.214  43.921   1.00 101.09 ? 48   GLY B O     1 
ATOM   2081  N  N     . ALA B 1  61   ? -19.272 -4.841  44.628   1.00 95.01  ? 49   ALA B N     1 
ATOM   2082  C  CA    . ALA B 1  61   ? -20.134 -4.028  45.470   1.00 78.66  ? 49   ALA B CA    1 
ATOM   2083  C  C     . ALA B 1  61   ? -19.954 -2.555  45.131   1.00 85.62  ? 49   ALA B C     1 
ATOM   2084  O  O     . ALA B 1  61   ? -18.854 -2.108  44.793   1.00 94.55  ? 49   ALA B O     1 
ATOM   2085  C  CB    . ALA B 1  61   ? -19.844 -4.261  46.958   1.00 89.59  ? 49   ALA B CB    1 
ATOM   2086  N  N     . ALA B 1  62   ? -21.050 -1.806  45.225   1.00 69.66  ? 50   ALA B N     1 
ATOM   2087  C  CA    . ALA B 1  62   ? -21.033 -0.379  44.934   1.00 83.65  ? 50   ALA B CA    1 
ATOM   2088  C  C     . ALA B 1  62   ? -22.254 0.265   45.574   1.00 82.18  ? 50   ALA B C     1 
ATOM   2089  O  O     . ALA B 1  62   ? -23.185 -0.416  46.011   1.00 65.40  ? 50   ALA B O     1 
ATOM   2090  C  CB    . ALA B 1  62   ? -20.998 -0.113  43.426   1.00 125.44 ? 50   ALA B CB    1 
ATOM   2091  N  N     . VAL B 1  63   ? -22.239 1.598   45.613   1.00 94.56  ? 51   VAL B N     1 
ATOM   2092  C  CA    . VAL B 1  63   ? -23.303 2.347   46.269   1.00 86.48  ? 51   VAL B CA    1 
ATOM   2093  C  C     . VAL B 1  63   ? -24.598 2.192   45.483   1.00 90.41  ? 51   VAL B C     1 
ATOM   2094  O  O     . VAL B 1  63   ? -24.633 2.391   44.262   1.00 106.10 ? 51   VAL B O     1 
ATOM   2095  C  CB    . VAL B 1  63   ? -22.912 3.824   46.414   1.00 75.03  ? 51   VAL B CB    1 
ATOM   2096  C  CG1   . VAL B 1  63   ? -23.934 4.557   47.264   1.00 66.46  ? 51   VAL B CG1   1 
ATOM   2097  C  CG2   . VAL B 1  63   ? -21.523 3.948   47.020   1.00 72.64  ? 51   VAL B CG2   1 
ATOM   2098  N  N     . THR B 1  64   ? -25.672 1.833   46.185   1.00 75.11  ? 52   THR B N     1 
ATOM   2099  C  CA    . THR B 1  64   ? -26.982 1.647   45.572   1.00 92.09  ? 52   THR B CA    1 
ATOM   2100  C  C     . THR B 1  64   ? -27.824 2.918   45.632   1.00 90.25  ? 52   THR B C     1 
ATOM   2101  O  O     . THR B 1  64   ? -28.444 3.304   44.636   1.00 95.73  ? 52   THR B O     1 
ATOM   2102  C  CB    . THR B 1  64   ? -27.718 0.487   46.251   1.00 98.80  ? 52   THR B CB    1 
ATOM   2103  O  OG1   . THR B 1  64   ? -27.052 -0.744  45.944   1.00 122.18 ? 52   THR B OG1   1 
ATOM   2104  C  CG2   . THR B 1  64   ? -29.158 0.409   45.772   1.00 95.51  ? 52   THR B CG2   1 
ATOM   2105  N  N     . SER B 1  65   ? -27.854 3.575   46.789   1.00 92.58  ? 53   SER B N     1 
ATOM   2106  C  CA    . SER B 1  65   ? -28.575 4.828   46.950   1.00 106.38 ? 53   SER B CA    1 
ATOM   2107  C  C     . SER B 1  65   ? -27.914 5.629   48.060   1.00 95.11  ? 53   SER B C     1 
ATOM   2108  O  O     . SER B 1  65   ? -27.243 5.075   48.934   1.00 87.26  ? 53   SER B O     1 
ATOM   2109  C  CB    . SER B 1  65   ? -30.058 4.592   47.263   1.00 94.30  ? 53   SER B CB    1 
ATOM   2110  O  OG    . SER B 1  65   ? -30.209 3.720   48.369   1.00 88.01  ? 53   SER B OG    1 
ATOM   2111  N  N     . ILE B 1  66   ? -28.101 6.949   48.012   1.00 92.76  ? 54   ILE B N     1 
ATOM   2112  C  CA    . ILE B 1  66   ? -27.561 7.840   49.028   1.00 92.88  ? 54   ILE B CA    1 
ATOM   2113  C  C     . ILE B 1  66   ? -28.678 8.740   49.540   1.00 108.03 ? 54   ILE B C     1 
ATOM   2114  O  O     . ILE B 1  66   ? -29.745 8.858   48.934   1.00 120.74 ? 54   ILE B O     1 
ATOM   2115  C  CB    . ILE B 1  66   ? -26.380 8.693   48.510   1.00 78.89  ? 54   ILE B CB    1 
ATOM   2116  C  CG1   . ILE B 1  66   ? -26.882 9.842   47.637   1.00 79.79  ? 54   ILE B CG1   1 
ATOM   2117  C  CG2   . ILE B 1  66   ? -25.395 7.835   47.733   1.00 71.62  ? 54   ILE B CG2   1 
ATOM   2118  C  CD1   . ILE B 1  66   ? -25.815 10.859  47.285   1.00 85.20  ? 54   ILE B CD1   1 
ATOM   2119  N  N     . ARG B 1  67   ? -28.417 9.374   50.681   1.00 98.59  ? 55   ARG B N     1 
ATOM   2120  C  CA    . ARG B 1  67   ? -29.367 10.296  51.293   1.00 81.51  ? 55   ARG B CA    1 
ATOM   2121  C  C     . ARG B 1  67   ? -28.575 11.391  51.989   1.00 86.86  ? 55   ARG B C     1 
ATOM   2122  O  O     . ARG B 1  67   ? -27.725 11.095  52.834   1.00 86.28  ? 55   ARG B O     1 
ATOM   2123  C  CB    . ARG B 1  67   ? -30.282 9.568   52.279   1.00 103.27 ? 55   ARG B CB    1 
ATOM   2124  C  CG    . ARG B 1  67   ? -31.390 10.425  52.859   1.00 130.30 ? 55   ARG B CG    1 
ATOM   2125  C  CD    . ARG B 1  67   ? -32.392 9.577   53.626   1.00 128.46 ? 55   ARG B CD    1 
ATOM   2126  N  NE    . ARG B 1  67   ? -31.781 8.879   54.753   1.00 113.66 ? 55   ARG B NE    1 
ATOM   2127  C  CZ    . ARG B 1  67   ? -32.453 8.117   55.610   1.00 135.77 ? 55   ARG B CZ    1 
ATOM   2128  N  NH1   . ARG B 1  67   ? -33.760 7.953   55.470   1.00 150.82 ? 55   ARG B NH1   1 
ATOM   2129  N  NH2   . ARG B 1  67   ? -31.818 7.518   56.607   1.00 144.82 ? 55   ARG B NH2   1 
ATOM   2130  N  N     . ILE B 1  68   ? -28.843 12.646  51.633   1.00 74.69  ? 56   ILE B N     1 
ATOM   2131  C  CA    . ILE B 1  68   ? -28.079 13.789  52.124   1.00 96.54  ? 56   ILE B CA    1 
ATOM   2132  C  C     . ILE B 1  68   ? -28.956 14.581  53.083   1.00 112.25 ? 56   ILE B C     1 
ATOM   2133  O  O     . ILE B 1  68   ? -30.068 14.989  52.726   1.00 115.65 ? 56   ILE B O     1 
ATOM   2134  C  CB    . ILE B 1  68   ? -27.584 14.673  50.969   1.00 95.02  ? 56   ILE B CB    1 
ATOM   2135  C  CG1   . ILE B 1  68   ? -26.704 13.860  50.015   1.00 108.49 ? 56   ILE B CG1   1 
ATOM   2136  C  CG2   . ILE B 1  68   ? -26.826 15.883  51.502   1.00 108.96 ? 56   ILE B CG2   1 
ATOM   2137  C  CD1   . ILE B 1  68   ? -26.203 14.644  48.815   1.00 105.32 ? 56   ILE B CD1   1 
ATOM   2138  N  N     . ASP B 1  69   ? -28.455 14.800  54.298   1.00 101.07 ? 57   ASP B N     1 
ATOM   2139  C  CA    . ASP B 1  69   ? -29.183 15.601  55.272   1.00 96.92  ? 57   ASP B CA    1 
ATOM   2140  C  C     . ASP B 1  69   ? -29.262 17.049  54.805   1.00 105.83 ? 57   ASP B C     1 
ATOM   2141  O  O     . ASP B 1  69   ? -28.279 17.619  54.325   1.00 98.14  ? 57   ASP B O     1 
ATOM   2142  C  CB    . ASP B 1  69   ? -28.507 15.525  56.640   1.00 114.88 ? 57   ASP B CB    1 
ATOM   2143  C  CG    . ASP B 1  69   ? -29.383 16.067  57.752   1.00 128.54 ? 57   ASP B CG    1 
ATOM   2144  O  OD1   . ASP B 1  69   ? -30.610 16.179  57.541   1.00 123.05 ? 57   ASP B OD1   1 
ATOM   2145  O  OD2   . ASP B 1  69   ? -28.846 16.386  58.833   1.00 123.59 ? 57   ASP B OD2   1 
ATOM   2146  N  N     . GLY B 1  70   ? -30.444 17.644  54.949   1.00 115.85 ? 58   GLY B N     1 
ATOM   2147  C  CA    . GLY B 1  70   ? -30.697 18.975  54.442   1.00 115.19 ? 58   GLY B CA    1 
ATOM   2148  C  C     . GLY B 1  70   ? -31.182 19.028  53.010   1.00 99.99  ? 58   GLY B C     1 
ATOM   2149  O  O     . GLY B 1  70   ? -31.410 20.128  52.490   1.00 106.25 ? 58   GLY B O     1 
ATOM   2150  N  N     . VAL B 1  71   ? -31.345 17.880  52.357   1.00 103.88 ? 59   VAL B N     1 
ATOM   2151  C  CA    . VAL B 1  71   ? -31.813 17.798  50.978   1.00 108.99 ? 59   VAL B CA    1 
ATOM   2152  C  C     . VAL B 1  71   ? -33.075 16.948  50.978   1.00 111.41 ? 59   VAL B C     1 
ATOM   2153  O  O     . VAL B 1  71   ? -33.017 15.737  51.229   1.00 100.26 ? 59   VAL B O     1 
ATOM   2154  C  CB    . VAL B 1  71   ? -30.749 17.208  50.042   1.00 98.65  ? 59   VAL B CB    1 
ATOM   2155  C  CG1   . VAL B 1  71   ? -31.275 17.136  48.616   1.00 142.99 ? 59   VAL B CG1   1 
ATOM   2156  C  CG2   . VAL B 1  71   ? -29.473 18.033  50.106   1.00 92.02  ? 59   VAL B CG2   1 
ATOM   2157  N  N     . LEU B 1  72   ? -34.217 17.577  50.694   1.00 121.22 ? 60   LEU B N     1 
ATOM   2158  C  CA    . LEU B 1  72   ? -35.506 16.892  50.741   1.00 127.52 ? 60   LEU B CA    1 
ATOM   2159  C  C     . LEU B 1  72   ? -36.220 16.966  49.397   1.00 131.63 ? 60   LEU B C     1 
ATOM   2160  O  O     . LEU B 1  72   ? -36.377 15.936  48.739   1.00 129.03 ? 60   LEU B O     1 
ATOM   2161  C  CB    . LEU B 1  72   ? -36.369 17.476  51.862   1.00 133.83 ? 60   LEU B CB    1 
ATOM   2162  C  CG    . LEU B 1  72   ? -36.037 17.051  53.293   1.00 128.33 ? 60   LEU B CG    1 
ATOM   2163  C  CD1   . LEU B 1  72   ? -36.946 17.763  54.278   1.00 125.50 ? 60   LEU B CD1   1 
ATOM   2164  C  CD2   . LEU B 1  72   ? -36.168 15.546  53.439   1.00 124.59 ? 60   LEU B CD2   1 
ATOM   2165  N  N     . HIS B 1  73   ? -36.664 18.147  48.970   1.00 140.11 ? 61   HIS B N     1 
ATOM   2166  C  CA    . HIS B 1  73   ? -37.435 18.296  47.744   1.00 133.70 ? 61   HIS B CA    1 
ATOM   2167  C  C     . HIS B 1  73   ? -36.709 19.117  46.685   1.00 127.75 ? 61   HIS B C     1 
ATOM   2168  O  O     . HIS B 1  73   ? -37.304 19.435  45.650   1.00 123.89 ? 61   HIS B O     1 
ATOM   2169  C  CB    . HIS B 1  73   ? -38.793 18.935  48.050   1.00 137.71 ? 61   HIS B CB    1 
ATOM   2170  C  CG    . HIS B 1  73   ? -39.678 18.099  48.923   1.00 140.33 ? 61   HIS B CG    1 
ATOM   2171  N  ND1   . HIS B 1  73   ? -39.402 17.856  50.251   1.00 154.09 ? 61   HIS B ND1   1 
ATOM   2172  C  CD2   . HIS B 1  73   ? -40.842 17.460  48.658   1.00 126.61 ? 61   HIS B CD2   1 
ATOM   2173  C  CE1   . HIS B 1  73   ? -40.354 17.098  50.766   1.00 150.85 ? 61   HIS B CE1   1 
ATOM   2174  N  NE2   . HIS B 1  73   ? -41.240 16.844  49.820   1.00 147.80 ? 61   HIS B NE2   1 
ATOM   2175  N  N     . GLU B 1  74   ? -35.444 19.465  46.911   1.00 123.37 ? 62   GLU B N     1 
ATOM   2176  C  CA    . GLU B 1  74   ? -34.733 20.352  45.998   1.00 124.43 ? 62   GLU B CA    1 
ATOM   2177  C  C     . GLU B 1  74   ? -33.846 19.576  45.032   1.00 147.95 ? 62   GLU B C     1 
ATOM   2178  O  O     . GLU B 1  74   ? -34.093 19.572  43.821   1.00 149.91 ? 62   GLU B O     1 
ATOM   2179  C  CB    . GLU B 1  74   ? -33.893 21.361  46.784   1.00 108.30 ? 62   GLU B CB    1 
ATOM   2180  N  N     . PHE B 1  75   ? -32.806 18.932  45.564   1.00 151.12 ? 63   PHE B N     1 
ATOM   2181  C  CA    . PHE B 1  75   ? -31.806 18.194  44.792   1.00 154.91 ? 63   PHE B CA    1 
ATOM   2182  C  C     . PHE B 1  75   ? -31.019 19.093  43.845   1.00 147.35 ? 63   PHE B C     1 
ATOM   2183  O  O     . PHE B 1  75   ? -30.356 18.600  42.926   1.00 118.48 ? 63   PHE B O     1 
ATOM   2184  C  CB    . PHE B 1  75   ? -32.436 17.039  44.004   1.00 125.41 ? 63   PHE B CB    1 
ATOM   2185  C  CG    . PHE B 1  75   ? -33.417 16.229  44.794   1.00 114.97 ? 63   PHE B CG    1 
ATOM   2186  C  CD1   . PHE B 1  75   ? -32.982 15.314  45.736   1.00 116.62 ? 63   PHE B CD1   1 
ATOM   2187  C  CD2   . PHE B 1  75   ? -34.776 16.374  44.587   1.00 128.61 ? 63   PHE B CD2   1 
ATOM   2188  C  CE1   . PHE B 1  75   ? -33.887 14.567  46.464   1.00 125.23 ? 63   PHE B CE1   1 
ATOM   2189  C  CE2   . PHE B 1  75   ? -35.684 15.630  45.309   1.00 142.78 ? 63   PHE B CE2   1 
ATOM   2190  C  CZ    . PHE B 1  75   ? -35.238 14.721  46.245   1.00 134.78 ? 63   PHE B CZ    1 
ATOM   2191  N  N     . THR B 1  76   ? -31.073 20.409  44.049   1.00 150.52 ? 64   THR B N     1 
ATOM   2192  C  CA    . THR B 1  76   ? -30.339 21.339  43.201   1.00 133.74 ? 64   THR B CA    1 
ATOM   2193  C  C     . THR B 1  76   ? -28.994 21.719  43.808   1.00 131.90 ? 64   THR B C     1 
ATOM   2194  O  O     . THR B 1  76   ? -27.966 21.672  43.125   1.00 120.70 ? 64   THR B O     1 
ATOM   2195  C  CB    . THR B 1  76   ? -31.177 22.597  42.942   1.00 136.79 ? 64   THR B CB    1 
ATOM   2196  O  OG1   . THR B 1  76   ? -32.401 22.235  42.290   1.00 125.51 ? 64   THR B OG1   1 
ATOM   2197  C  CG2   . THR B 1  76   ? -30.409 23.577  42.063   1.00 139.31 ? 64   THR B CG2   1 
ATOM   2198  N  N     . THR B 1  77   ? -28.981 22.087  45.086   1.00 134.58 ? 65   THR B N     1 
ATOM   2199  C  CA    . THR B 1  77   ? -27.761 22.521  45.750   1.00 129.79 ? 65   THR B CA    1 
ATOM   2200  C  C     . THR B 1  77   ? -27.781 22.059  47.199   1.00 120.67 ? 65   THR B C     1 
ATOM   2201  O  O     . THR B 1  77   ? -28.843 21.965  47.821   1.00 113.84 ? 65   THR B O     1 
ATOM   2202  C  CB    . THR B 1  77   ? -27.599 24.049  45.693   1.00 124.39 ? 65   THR B CB    1 
ATOM   2203  O  OG1   . THR B 1  77   ? -27.824 24.508  44.355   1.00 138.91 ? 65   THR B OG1   1 
ATOM   2204  C  CG2   . THR B 1  77   ? -26.199 24.463  46.126   1.00 101.11 ? 65   THR B CG2   1 
ATOM   2205  N  N     . VAL B 1  78   ? -26.600 21.765  47.726   1.00 113.73 ? 66   VAL B N     1 
ATOM   2206  C  CA    . VAL B 1  78   ? -26.415 21.467  49.143   1.00 120.59 ? 66   VAL B CA    1 
ATOM   2207  C  C     . VAL B 1  78   ? -25.773 22.688  49.793   1.00 140.29 ? 66   VAL B C     1 
ATOM   2208  O  O     . VAL B 1  78   ? -24.703 23.124  49.340   1.00 131.16 ? 66   VAL B O     1 
ATOM   2209  C  CB    . VAL B 1  78   ? -25.554 20.215  49.354   1.00 106.15 ? 66   VAL B CB    1 
ATOM   2210  C  CG1   . VAL B 1  78   ? -25.370 19.955  50.842   1.00 122.96 ? 66   VAL B CG1   1 
ATOM   2211  C  CG2   . VAL B 1  78   ? -26.186 19.016  48.664   1.00 119.51 ? 66   VAL B CG2   1 
ATOM   2212  N  N     . PRO B 1  79   ? -26.376 23.268  50.829   1.00 150.95 ? 67   PRO B N     1 
ATOM   2213  C  CA    . PRO B 1  79   ? -25.772 24.442  51.471   1.00 141.41 ? 67   PRO B CA    1 
ATOM   2214  C  C     . PRO B 1  79   ? -24.583 24.054  52.334   1.00 127.05 ? 67   PRO B C     1 
ATOM   2215  O  O     . PRO B 1  79   ? -24.591 23.026  53.017   1.00 100.25 ? 67   PRO B O     1 
ATOM   2216  C  CB    . PRO B 1  79   ? -26.914 25.010  52.326   1.00 132.82 ? 67   PRO B CB    1 
ATOM   2217  C  CG    . PRO B 1  79   ? -28.162 24.297  51.867   1.00 130.25 ? 67   PRO B CG    1 
ATOM   2218  C  CD    . PRO B 1  79   ? -27.701 22.962  51.385   1.00 129.39 ? 67   PRO B CD    1 
ATOM   2219  N  N     . GLY B 1  80   ? -23.555 24.898  52.304   1.00 137.33 ? 68   GLY B N     1 
ATOM   2220  C  CA    . GLY B 1  80   ? -22.353 24.661  53.073   1.00 159.88 ? 68   GLY B CA    1 
ATOM   2221  C  C     . GLY B 1  80   ? -21.258 23.916  52.344   1.00 145.19 ? 68   GLY B C     1 
ATOM   2222  O  O     . GLY B 1  80   ? -20.207 23.656  52.943   1.00 140.74 ? 68   GLY B O     1 
ATOM   2223  N  N     . VAL B 1  81   ? -21.471 23.552  51.080   1.00 141.12 ? 69   VAL B N     1 
ATOM   2224  C  CA    . VAL B 1  81   ? -20.452 22.906  50.263   1.00 138.82 ? 69   VAL B CA    1 
ATOM   2225  C  C     . VAL B 1  81   ? -20.485 23.520  48.872   1.00 137.28 ? 69   VAL B C     1 
ATOM   2226  O  O     . VAL B 1  81   ? -21.535 23.950  48.385   1.00 124.82 ? 69   VAL B O     1 
ATOM   2227  C  CB    . VAL B 1  81   ? -20.644 21.375  50.178   1.00 121.78 ? 69   VAL B CB    1 
ATOM   2228  C  CG1   . VAL B 1  81   ? -20.383 20.728  51.525   1.00 107.14 ? 69   VAL B CG1   1 
ATOM   2229  C  CG2   . VAL B 1  81   ? -22.040 21.043  49.684   1.00 110.31 ? 69   VAL B CG2   1 
ATOM   2230  N  N     . LYS B 1  82   ? -19.316 23.558  48.230   1.00 133.20 ? 70   LYS B N     1 
ATOM   2231  C  CA    . LYS B 1  82   ? -19.229 24.123  46.888   1.00 134.04 ? 70   LYS B CA    1 
ATOM   2232  C  C     . LYS B 1  82   ? -19.930 23.232  45.871   1.00 134.32 ? 70   LYS B C     1 
ATOM   2233  O  O     . LYS B 1  82   ? -20.678 23.720  45.015   1.00 151.04 ? 70   LYS B O     1 
ATOM   2234  C  CB    . LYS B 1  82   ? -17.764 24.332  46.503   1.00 128.79 ? 70   LYS B CB    1 
ATOM   2235  C  CG    . LYS B 1  82   ? -16.998 25.221  47.465   1.00 143.17 ? 70   LYS B CG    1 
ATOM   2236  C  CD    . LYS B 1  82   ? -17.508 26.652  47.425   1.00 167.61 ? 70   LYS B CD    1 
ATOM   2237  C  CE    . LYS B 1  82   ? -16.996 27.451  48.612   1.00 150.15 ? 70   LYS B CE    1 
ATOM   2238  N  NZ    . LYS B 1  82   ? -15.511 27.412  48.724   1.00 148.71 ? 70   LYS B NZ    1 
ATOM   2239  N  N     . GLU B 1  83   ? -19.703 21.922  45.951   1.00 130.01 ? 71   GLU B N     1 
ATOM   2240  C  CA    . GLU B 1  83   ? -20.325 20.997  45.015   1.00 123.02 ? 71   GLU B CA    1 
ATOM   2241  C  C     . GLU B 1  83   ? -21.839 20.997  45.181   1.00 121.87 ? 71   GLU B C     1 
ATOM   2242  O  O     . GLU B 1  83   ? -22.361 21.094  46.296   1.00 123.36 ? 71   GLU B O     1 
ATOM   2243  C  CB    . GLU B 1  83   ? -19.783 19.579  45.219   1.00 101.36 ? 71   GLU B CB    1 
ATOM   2244  C  CG    . GLU B 1  83   ? -18.329 19.381  44.811   1.00 108.59 ? 71   GLU B CG    1 
ATOM   2245  C  CD    . GLU B 1  83   ? -17.350 19.783  45.897   1.00 116.56 ? 71   GLU B CD    1 
ATOM   2246  O  OE1   . GLU B 1  83   ? -17.800 20.240  46.969   1.00 119.80 ? 71   GLU B OE1   1 
ATOM   2247  O  OE2   . GLU B 1  83   ? -16.128 19.637  45.681   1.00 120.95 ? 71   GLU B OE2   1 
ATOM   2248  N  N     . ASP B 1  84   ? -22.546 20.892  44.060   1.00 127.65 ? 72   ASP B N     1 
ATOM   2249  C  CA    . ASP B 1  84   ? -23.993 20.727  44.082   1.00 115.55 ? 72   ASP B CA    1 
ATOM   2250  C  C     . ASP B 1  84   ? -24.317 19.253  44.331   1.00 112.43 ? 72   ASP B C     1 
ATOM   2251  O  O     . ASP B 1  84   ? -23.446 18.453  44.683   1.00 112.27 ? 72   ASP B O     1 
ATOM   2252  C  CB    . ASP B 1  84   ? -24.610 21.263  42.792   1.00 117.34 ? 72   ASP B CB    1 
ATOM   2253  C  CG    . ASP B 1  84   ? -23.983 20.666  41.547   1.00 135.14 ? 72   ASP B CG    1 
ATOM   2254  O  OD1   . ASP B 1  84   ? -22.948 19.978  41.668   1.00 129.21 ? 72   ASP B OD1   1 
ATOM   2255  O  OD2   . ASP B 1  84   ? -24.528 20.885  40.445   1.00 154.03 ? 72   ASP B OD2   1 
ATOM   2256  N  N     . VAL B 1  85   ? -25.582 18.874  44.142   1.00 109.94 ? 73   VAL B N     1 
ATOM   2257  C  CA    . VAL B 1  85   ? -26.021 17.530  44.512   1.00 109.51 ? 73   VAL B CA    1 
ATOM   2258  C  C     . VAL B 1  85   ? -25.445 16.489  43.557   1.00 107.92 ? 73   VAL B C     1 
ATOM   2259  O  O     . VAL B 1  85   ? -24.880 15.477  43.987   1.00 98.75  ? 73   VAL B O     1 
ATOM   2260  C  CB    . VAL B 1  85   ? -27.559 17.464  44.557   1.00 112.59 ? 73   VAL B CB    1 
ATOM   2261  C  CG1   . VAL B 1  85   ? -28.023 16.056  44.904   1.00 95.90  ? 73   VAL B CG1   1 
ATOM   2262  C  CG2   . VAL B 1  85   ? -28.104 18.475  45.555   1.00 134.25 ? 73   VAL B CG2   1 
ATOM   2263  N  N     . THR B 1  86   ? -25.579 16.720  42.249   1.00 117.46 ? 74   THR B N     1 
ATOM   2264  C  CA    . THR B 1  86   ? -25.186 15.705  41.275   1.00 107.24 ? 74   THR B CA    1 
ATOM   2265  C  C     . THR B 1  86   ? -23.678 15.482  41.248   1.00 101.40 ? 74   THR B C     1 
ATOM   2266  O  O     . THR B 1  86   ? -23.228 14.369  40.951   1.00 102.25 ? 74   THR B O     1 
ATOM   2267  C  CB    . THR B 1  86   ? -25.692 16.086  39.882   1.00 96.88  ? 74   THR B CB    1 
ATOM   2268  O  OG1   . THR B 1  86   ? -25.319 17.437  39.585   1.00 108.28 ? 74   THR B OG1   1 
ATOM   2269  C  CG2   . THR B 1  86   ? -27.206 15.952  39.816   1.00 94.89  ? 74   THR B CG2   1 
ATOM   2270  N  N     . GLU B 1  87   ? -22.883 16.511  41.552   1.00 102.96 ? 75   GLU B N     1 
ATOM   2271  C  CA    . GLU B 1  87   ? -21.436 16.323  41.597   1.00 92.32  ? 75   GLU B CA    1 
ATOM   2272  C  C     . GLU B 1  87   ? -21.022 15.466  42.787   1.00 78.35  ? 75   GLU B C     1 
ATOM   2273  O  O     . GLU B 1  87   ? -20.010 14.759  42.719   1.00 67.99  ? 75   GLU B O     1 
ATOM   2274  C  CB    . GLU B 1  87   ? -20.728 17.678  41.637   1.00 92.62  ? 75   GLU B CB    1 
ATOM   2275  C  CG    . GLU B 1  87   ? -19.409 17.708  40.881   1.00 99.39  ? 75   GLU B CG    1 
ATOM   2276  C  CD    . GLU B 1  87   ? -18.834 19.106  40.765   1.00 144.85 ? 75   GLU B CD    1 
ATOM   2277  O  OE1   . GLU B 1  87   ? -19.558 20.077  41.071   1.00 165.03 ? 75   GLU B OE1   1 
ATOM   2278  O  OE2   . GLU B 1  87   ? -17.656 19.233  40.369   1.00 162.93 ? 75   GLU B OE2   1 
ATOM   2279  N  N     . ILE B 1  88   ? -21.787 15.517  43.880   1.00 90.56  ? 76   ILE B N     1 
ATOM   2280  C  CA    . ILE B 1  88   ? -21.557 14.607  44.999   1.00 108.32 ? 76   ILE B CA    1 
ATOM   2281  C  C     . ILE B 1  88   ? -21.811 13.168  44.570   1.00 89.50  ? 76   ILE B C     1 
ATOM   2282  O  O     . ILE B 1  88   ? -21.050 12.255  44.914   1.00 92.37  ? 76   ILE B O     1 
ATOM   2283  C  CB    . ILE B 1  88   ? -22.444 14.997  46.197   1.00 99.09  ? 76   ILE B CB    1 
ATOM   2284  C  CG1   . ILE B 1  88   ? -22.088 16.396  46.700   1.00 83.51  ? 76   ILE B CG1   1 
ATOM   2285  C  CG2   . ILE B 1  88   ? -22.316 13.976  47.318   1.00 71.67  ? 76   ILE B CG2   1 
ATOM   2286  C  CD1   . ILE B 1  88   ? -20.674 16.514  47.201   1.00 92.94  ? 76   ILE B CD1   1 
ATOM   2287  N  N     . ILE B 1  89   ? -22.886 12.946  43.809   1.00 84.31  ? 77   ILE B N     1 
ATOM   2288  C  CA    . ILE B 1  89   ? -23.249 11.600  43.375   1.00 93.26  ? 77   ILE B CA    1 
ATOM   2289  C  C     . ILE B 1  89   ? -22.171 11.004  42.480   1.00 95.58  ? 77   ILE B C     1 
ATOM   2290  O  O     . ILE B 1  89   ? -21.913 9.794   42.527   1.00 87.87  ? 77   ILE B O     1 
ATOM   2291  C  CB    . ILE B 1  89   ? -24.619 11.634  42.668   1.00 91.42  ? 77   ILE B CB    1 
ATOM   2292  C  CG1   . ILE B 1  89   ? -25.694 12.182  43.611   1.00 82.51  ? 77   ILE B CG1   1 
ATOM   2293  C  CG2   . ILE B 1  89   ? -24.997 10.253  42.151   1.00 88.55  ? 77   ILE B CG2   1 
ATOM   2294  C  CD1   . ILE B 1  89   ? -27.042 12.377  42.954   1.00 72.01  ? 77   ILE B CD1   1 
ATOM   2295  N  N     . LEU B 1  90   ? -21.519 11.832  41.661   1.00 99.43  ? 78   LEU B N     1 
ATOM   2296  C  CA    . LEU B 1  90   ? -20.497 11.326  40.748   1.00 103.56 ? 78   LEU B CA    1 
ATOM   2297  C  C     . LEU B 1  90   ? -19.300 10.775  41.514   1.00 103.01 ? 78   LEU B C     1 
ATOM   2298  O  O     . LEU B 1  90   ? -18.939 9.601   41.365   1.00 99.80  ? 78   LEU B O     1 
ATOM   2299  C  CB    . LEU B 1  90   ? -20.063 12.430  39.780   1.00 95.03  ? 78   LEU B CB    1 
ATOM   2300  C  CG    . LEU B 1  90   ? -21.129 12.938  38.808   1.00 83.67  ? 78   LEU B CG    1 
ATOM   2301  C  CD1   . LEU B 1  90   ? -20.502 13.795  37.718   1.00 79.27  ? 78   LEU B CD1   1 
ATOM   2302  C  CD2   . LEU B 1  90   ? -21.908 11.780  38.204   1.00 76.55  ? 78   LEU B CD2   1 
ATOM   2303  N  N     . ASN B 1  91   ? -18.667 11.613  42.342   1.00 101.97 ? 79   ASN B N     1 
ATOM   2304  C  CA    . ASN B 1  91   ? -17.539 11.154  43.145   1.00 104.38 ? 79   ASN B CA    1 
ATOM   2305  C  C     . ASN B 1  91   ? -17.928 10.030  44.096   1.00 98.93  ? 79   ASN B C     1 
ATOM   2306  O  O     . ASN B 1  91   ? -17.069 9.222   44.466   1.00 99.95  ? 79   ASN B O     1 
ATOM   2307  C  CB    . ASN B 1  91   ? -16.935 12.322  43.927   1.00 93.88  ? 79   ASN B CB    1 
ATOM   2308  C  CG    . ASN B 1  91   ? -16.229 13.322  43.031   1.00 102.36 ? 79   ASN B CG    1 
ATOM   2309  O  OD1   . ASN B 1  91   ? -16.767 14.384  42.720   1.00 93.65  ? 79   ASN B OD1   1 
ATOM   2310  N  ND2   . ASN B 1  91   ? -15.017 12.982  42.606   1.00 111.71 ? 79   ASN B ND2   1 
ATOM   2311  N  N     . LEU B 1  92   ? -19.200 9.956   44.497   1.00 99.08  ? 80   LEU B N     1 
ATOM   2312  C  CA    . LEU B 1  92   ? -19.672 8.809   45.268   1.00 103.87 ? 80   LEU B CA    1 
ATOM   2313  C  C     . LEU B 1  92   ? -19.848 7.569   44.402   1.00 87.17  ? 80   LEU B C     1 
ATOM   2314  O  O     . LEU B 1  92   ? -19.617 6.452   44.878   1.00 92.51  ? 80   LEU B O     1 
ATOM   2315  C  CB    . LEU B 1  92   ? -20.992 9.142   45.964   1.00 108.89 ? 80   LEU B CB    1 
ATOM   2316  C  CG    . LEU B 1  92   ? -20.883 9.925   47.271   1.00 86.78  ? 80   LEU B CG    1 
ATOM   2317  C  CD1   . LEU B 1  92   ? -22.259 10.173  47.857   1.00 61.11  ? 80   LEU B CD1   1 
ATOM   2318  C  CD2   . LEU B 1  92   ? -20.001 9.181   48.262   1.00 71.06  ? 80   LEU B CD2   1 
ATOM   2319  N  N     . LYS B 1  93   ? -20.264 7.740   43.144   1.00 81.42  ? 81   LYS B N     1 
ATOM   2320  C  CA    . LYS B 1  93   ? -20.406 6.596   42.249   1.00 97.95  ? 81   LYS B CA    1 
ATOM   2321  C  C     . LYS B 1  93   ? -19.055 5.952   41.960   1.00 90.13  ? 81   LYS B C     1 
ATOM   2322  O  O     . LYS B 1  93   ? -18.956 4.724   41.856   1.00 79.79  ? 81   LYS B O     1 
ATOM   2323  C  CB    . LYS B 1  93   ? -21.083 7.028   40.947   1.00 82.18  ? 81   LYS B CB    1 
ATOM   2324  C  CG    . LYS B 1  93   ? -22.241 6.138   40.519   1.00 62.00  ? 81   LYS B CG    1 
ATOM   2325  C  CD    . LYS B 1  93   ? -22.875 6.628   39.227   1.00 97.47  ? 81   LYS B CD    1 
ATOM   2326  C  CE    . LYS B 1  93   ? -23.466 8.017   39.394   1.00 97.41  ? 81   LYS B CE    1 
ATOM   2327  N  NZ    . LYS B 1  93   ? -24.071 8.508   38.125   1.00 66.36  ? 81   LYS B NZ    1 
ATOM   2328  N  N     . SER B 1  94   ? -18.006 6.764   41.829   1.00 86.61  ? 82   SER B N     1 
ATOM   2329  C  CA    . SER B 1  94   ? -16.662 6.262   41.575   1.00 99.24  ? 82   SER B CA    1 
ATOM   2330  C  C     . SER B 1  94   ? -15.976 5.733   42.827   1.00 86.78  ? 82   SER B C     1 
ATOM   2331  O  O     . SER B 1  94   ? -14.829 5.282   42.739   1.00 96.68  ? 82   SER B O     1 
ATOM   2332  C  CB    . SER B 1  94   ? -15.803 7.361   40.943   1.00 116.79 ? 82   SER B CB    1 
ATOM   2333  O  OG    . SER B 1  94   ? -15.844 8.547   41.718   1.00 115.41 ? 82   SER B OG    1 
ATOM   2334  N  N     . LEU B 1  95   ? -16.636 5.785   43.980   1.00 84.98  ? 83   LEU B N     1 
ATOM   2335  C  CA    . LEU B 1  95   ? -16.069 5.216   45.196   1.00 88.78  ? 83   LEU B CA    1 
ATOM   2336  C  C     . LEU B 1  95   ? -15.953 3.705   45.052   1.00 84.27  ? 83   LEU B C     1 
ATOM   2337  O  O     . LEU B 1  95   ? -16.956 3.013   44.850   1.00 93.45  ? 83   LEU B O     1 
ATOM   2338  C  CB    . LEU B 1  95   ? -16.936 5.580   46.401   1.00 99.92  ? 83   LEU B CB    1 
ATOM   2339  C  CG    . LEU B 1  95   ? -16.555 5.013   47.771   1.00 78.65  ? 83   LEU B CG    1 
ATOM   2340  C  CD1   . LEU B 1  95   ? -16.712 6.075   48.848   1.00 82.24  ? 83   LEU B CD1   1 
ATOM   2341  C  CD2   . LEU B 1  95   ? -17.402 3.796   48.110   1.00 85.45  ? 83   LEU B CD2   1 
ATOM   2342  N  N     . VAL B 1  96   ? -14.731 3.195   45.145   1.00 65.70  ? 84   VAL B N     1 
ATOM   2343  C  CA    . VAL B 1  96   ? -14.480 1.766   45.023   1.00 81.46  ? 84   VAL B CA    1 
ATOM   2344  C  C     . VAL B 1  96   ? -14.634 1.131   46.400   1.00 89.11  ? 84   VAL B C     1 
ATOM   2345  O  O     . VAL B 1  96   ? -14.126 1.653   47.400   1.00 87.49  ? 84   VAL B O     1 
ATOM   2346  C  CB    . VAL B 1  96   ? -13.090 1.497   44.417   1.00 87.47  ? 84   VAL B CB    1 
ATOM   2347  C  CG1   . VAL B 1  96   ? -12.983 2.164   43.059   1.00 102.35 ? 84   VAL B CG1   1 
ATOM   2348  C  CG2   . VAL B 1  96   ? -11.990 2.013   45.312   1.00 101.52 ? 84   VAL B CG2   1 
ATOM   2349  N  N     . VAL B 1  97   ? -15.369 0.022   46.462   1.00 95.16  ? 85   VAL B N     1 
ATOM   2350  C  CA    . VAL B 1  97   ? -15.731 -0.578  47.739   1.00 92.66  ? 85   VAL B CA    1 
ATOM   2351  C  C     . VAL B 1  97   ? -15.922 -2.076  47.543   1.00 102.54 ? 85   VAL B C     1 
ATOM   2352  O  O     . VAL B 1  97   ? -16.266 -2.542  46.453   1.00 119.98 ? 85   VAL B O     1 
ATOM   2353  C  CB    . VAL B 1  97   ? -16.997 0.092   48.328   1.00 88.20  ? 85   VAL B CB    1 
ATOM   2354  C  CG1   . VAL B 1  97   ? -18.265 -0.493  47.719   1.00 96.60  ? 85   VAL B CG1   1 
ATOM   2355  C  CG2   . VAL B 1  97   ? -17.010 -0.012  49.841   1.00 109.37 ? 85   VAL B CG2   1 
ATOM   2356  N  N     . SER B 1  98   ? -15.677 -2.833  48.611   1.00 84.00  ? 86   SER B N     1 
ATOM   2357  C  CA    . SER B 1  98   ? -15.817 -4.281  48.605   1.00 92.91  ? 86   SER B CA    1 
ATOM   2358  C  C     . SER B 1  98   ? -16.491 -4.724  49.894   1.00 112.53 ? 86   SER B C     1 
ATOM   2359  O  O     . SER B 1  98   ? -16.274 -4.137  50.957   1.00 113.73 ? 86   SER B O     1 
ATOM   2360  C  CB    . SER B 1  98   ? -14.459 -4.981  48.458   1.00 100.76 ? 86   SER B CB    1 
ATOM   2361  O  OG    . SER B 1  98   ? -14.506 -6.304  48.964   1.00 135.93 ? 86   SER B OG    1 
ATOM   2362  N  N     . SER B 1  99   ? -17.305 -5.774  49.794   1.00 121.23 ? 87   SER B N     1 
ATOM   2363  C  CA    . SER B 1  99   ? -18.056 -6.276  50.934   1.00 114.22 ? 87   SER B CA    1 
ATOM   2364  C  C     . SER B 1  99   ? -18.001 -7.796  50.964   1.00 123.30 ? 87   SER B C     1 
ATOM   2365  O  O     . SER B 1  99   ? -18.014 -8.447  49.915   1.00 128.30 ? 87   SER B O     1 
ATOM   2366  C  CB    . SER B 1  99   ? -19.518 -5.810  50.889   1.00 98.68  ? 87   SER B CB    1 
ATOM   2367  O  OG    . SER B 1  99   ? -19.609 -4.398  50.966   1.00 123.98 ? 87   SER B OG    1 
ATOM   2368  N  N     . GLU B 1  100  ? -17.932 -8.353  52.172   1.00 129.66 ? 88   GLU B N     1 
ATOM   2369  C  CA    . GLU B 1  100  ? -18.027 -9.791  52.379   1.00 127.68 ? 88   GLU B CA    1 
ATOM   2370  C  C     . GLU B 1  100  ? -19.422 -10.230 52.799   1.00 119.79 ? 88   GLU B C     1 
ATOM   2371  O  O     . GLU B 1  100  ? -19.652 -11.429 52.981   1.00 132.14 ? 88   GLU B O     1 
ATOM   2372  C  CB    . GLU B 1  100  ? -17.008 -10.252 53.427   1.00 122.40 ? 88   GLU B CB    1 
ATOM   2373  C  CG    . GLU B 1  100  ? -15.556 -10.081 53.013   1.00 136.66 ? 88   GLU B CG    1 
ATOM   2374  C  CD    . GLU B 1  100  ? -14.606 -10.872 53.891   1.00 161.38 ? 88   GLU B CD    1 
ATOM   2375  O  OE1   . GLU B 1  100  ? -13.597 -11.387 53.365   1.00 173.04 ? 88   GLU B OE1   1 
ATOM   2376  O  OE2   . GLU B 1  100  ? -14.874 -10.989 55.106   1.00 164.01 ? 88   GLU B OE2   1 
ATOM   2377  N  N     . GLU B 1  101  ? -20.352 -9.293  52.957   1.00 115.51 ? 89   GLU B N     1 
ATOM   2378  C  CA    . GLU B 1  101  ? -21.721 -9.592  53.354   1.00 125.05 ? 89   GLU B CA    1 
ATOM   2379  C  C     . GLU B 1  101  ? -22.642 -9.415  52.156   1.00 123.70 ? 89   GLU B C     1 
ATOM   2380  O  O     . GLU B 1  101  ? -22.604 -8.377  51.486   1.00 105.59 ? 89   GLU B O     1 
ATOM   2381  C  CB    . GLU B 1  101  ? -22.167 -8.688  54.506   1.00 121.71 ? 89   GLU B CB    1 
ATOM   2382  N  N     . ASP B 1  102  ? -23.468 -10.430 51.893   1.00 140.14 ? 90   ASP B N     1 
ATOM   2383  C  CA    . ASP B 1  102  ? -24.363 -10.384 50.741   1.00 150.20 ? 90   ASP B CA    1 
ATOM   2384  C  C     . ASP B 1  102  ? -25.468 -9.350  50.929   1.00 144.42 ? 90   ASP B C     1 
ATOM   2385  O  O     . ASP B 1  102  ? -25.872 -8.686  49.967   1.00 148.16 ? 90   ASP B O     1 
ATOM   2386  C  CB    . ASP B 1  102  ? -24.961 -11.768 50.496   1.00 158.84 ? 90   ASP B CB    1 
ATOM   2387  C  CG    . ASP B 1  102  ? -23.944 -12.754 49.964   1.00 167.40 ? 90   ASP B CG    1 
ATOM   2388  O  OD1   . ASP B 1  102  ? -23.612 -12.674 48.762   1.00 142.88 ? 90   ASP B OD1   1 
ATOM   2389  O  OD2   . ASP B 1  102  ? -23.460 -13.594 50.753   1.00 185.40 ? 90   ASP B OD2   1 
ATOM   2390  N  N     . GLU B 1  103  ? -25.967 -9.202  52.154   1.00 140.80 ? 91   GLU B N     1 
ATOM   2391  C  CA    . GLU B 1  103  ? -27.080 -8.306  52.416   1.00 152.06 ? 91   GLU B CA    1 
ATOM   2392  C  C     . GLU B 1  103  ? -26.655 -6.849  52.243   1.00 140.36 ? 91   GLU B C     1 
ATOM   2393  O  O     . GLU B 1  103  ? -25.473 -6.519  52.367   1.00 128.52 ? 91   GLU B O     1 
ATOM   2394  C  CB    . GLU B 1  103  ? -27.617 -8.532  53.827   1.00 154.89 ? 91   GLU B CB    1 
ATOM   2395  N  N     . PRO B 1  104  ? -27.603 -5.957  51.948   1.00 122.36 ? 92   PRO B N     1 
ATOM   2396  C  CA    . PRO B 1  104  ? -27.255 -4.537  51.824   1.00 99.10  ? 92   PRO B CA    1 
ATOM   2397  C  C     . PRO B 1  104  ? -26.813 -3.955  53.157   1.00 109.02 ? 92   PRO B C     1 
ATOM   2398  O  O     . PRO B 1  104  ? -27.358 -4.285  54.213   1.00 148.33 ? 92   PRO B O     1 
ATOM   2399  C  CB    . PRO B 1  104  ? -28.559 -3.891  51.339   1.00 88.59  ? 92   PRO B CB    1 
ATOM   2400  C  CG    . PRO B 1  104  ? -29.627 -4.825  51.775   1.00 93.94  ? 92   PRO B CG    1 
ATOM   2401  C  CD    . PRO B 1  104  ? -29.025 -6.195  51.645   1.00 113.77 ? 92   PRO B CD    1 
ATOM   2402  N  N     . VAL B 1  105  ? -25.812 -3.080  53.095   1.00 99.23  ? 93   VAL B N     1 
ATOM   2403  C  CA    . VAL B 1  105  ? -25.271 -2.408  54.270   1.00 88.30  ? 93   VAL B CA    1 
ATOM   2404  C  C     . VAL B 1  105  ? -25.369 -0.903  54.059   1.00 101.49 ? 93   VAL B C     1 
ATOM   2405  O  O     . VAL B 1  105  ? -25.249 -0.413  52.930   1.00 107.63 ? 93   VAL B O     1 
ATOM   2406  C  CB    . VAL B 1  105  ? -23.815 -2.838  54.561   1.00 76.75  ? 93   VAL B CB    1 
ATOM   2407  C  CG1   . VAL B 1  105  ? -23.731 -4.353  54.716   1.00 122.21 ? 93   VAL B CG1   1 
ATOM   2408  C  CG2   . VAL B 1  105  ? -22.856 -2.343  53.477   1.00 97.65  ? 93   VAL B CG2   1 
ATOM   2409  N  N     . THR B 1  106  ? -25.615 -0.178  55.147   1.00 92.71  ? 94   THR B N     1 
ATOM   2410  C  CA    . THR B 1  106  ? -25.719 1.275   55.130   1.00 83.08  ? 94   THR B CA    1 
ATOM   2411  C  C     . THR B 1  106  ? -24.512 1.872   55.838   1.00 90.48  ? 94   THR B C     1 
ATOM   2412  O  O     . THR B 1  106  ? -24.199 1.491   56.972   1.00 113.36 ? 94   THR B O     1 
ATOM   2413  C  CB    . THR B 1  106  ? -27.015 1.751   55.797   1.00 68.86  ? 94   THR B CB    1 
ATOM   2414  O  OG1   . THR B 1  106  ? -27.037 1.339   57.170   1.00 108.58 ? 94   THR B OG1   1 
ATOM   2415  C  CG2   . THR B 1  106  ? -28.229 1.180   55.079   1.00 79.70  ? 94   THR B CG2   1 
ATOM   2416  N  N     . MET B 1  107  ? -23.833 2.797   55.165   1.00 102.45 ? 95   MET B N     1 
ATOM   2417  C  CA    . MET B 1  107  ? -22.674 3.485   55.713   1.00 99.76  ? 95   MET B CA    1 
ATOM   2418  C  C     . MET B 1  107  ? -22.978 4.971   55.830   1.00 99.70  ? 95   MET B C     1 
ATOM   2419  O  O     . MET B 1  107  ? -23.616 5.556   54.948   1.00 111.94 ? 95   MET B O     1 
ATOM   2420  C  CB    . MET B 1  107  ? -21.435 3.274   54.838   1.00 97.38  ? 95   MET B CB    1 
ATOM   2421  C  CG    . MET B 1  107  ? -21.199 1.831   54.428   1.00 101.27 ? 95   MET B CG    1 
ATOM   2422  S  SD    . MET B 1  107  ? -19.621 1.616   53.584   1.00 134.82 ? 95   MET B SD    1 
ATOM   2423  C  CE    . MET B 1  107  ? -19.732 2.896   52.338   1.00 120.40 ? 95   MET B CE    1 
ATOM   2424  N  N     . TYR B 1  108  ? -22.519 5.577   56.920   1.00 95.93  ? 96   TYR B N     1 
ATOM   2425  C  CA    . TYR B 1  108  ? -22.712 6.997   57.175   1.00 108.81 ? 96   TYR B CA    1 
ATOM   2426  C  C     . TYR B 1  108  ? -21.393 7.737   57.001   1.00 103.17 ? 96   TYR B C     1 
ATOM   2427  O  O     . TYR B 1  108  ? -20.329 7.224   57.360   1.00 90.09  ? 96   TYR B O     1 
ATOM   2428  C  CB    . TYR B 1  108  ? -23.271 7.234   58.581   1.00 122.59 ? 96   TYR B CB    1 
ATOM   2429  C  CG    . TYR B 1  108  ? -24.686 6.732   58.761   1.00 115.85 ? 96   TYR B CG    1 
ATOM   2430  C  CD1   . TYR B 1  108  ? -25.765 7.456   58.272   1.00 105.64 ? 96   TYR B CD1   1 
ATOM   2431  C  CD2   . TYR B 1  108  ? -24.942 5.535   59.417   1.00 113.21 ? 96   TYR B CD2   1 
ATOM   2432  C  CE1   . TYR B 1  108  ? -27.061 7.003   58.430   1.00 105.73 ? 96   TYR B CE1   1 
ATOM   2433  C  CE2   . TYR B 1  108  ? -26.235 5.074   59.580   1.00 113.19 ? 96   TYR B CE2   1 
ATOM   2434  C  CZ    . TYR B 1  108  ? -27.290 5.812   59.085   1.00 121.55 ? 96   TYR B CZ    1 
ATOM   2435  O  OH    . TYR B 1  108  ? -28.578 5.356   59.246   1.00 116.89 ? 96   TYR B OH    1 
ATOM   2436  N  N     . LEU B 1  109  ? -21.471 8.941   56.439   1.00 97.94  ? 97   LEU B N     1 
ATOM   2437  C  CA    . LEU B 1  109  ? -20.309 9.794   56.217   1.00 103.89 ? 97   LEU B CA    1 
ATOM   2438  C  C     . LEU B 1  109  ? -20.625 11.179  56.759   1.00 111.90 ? 97   LEU B C     1 
ATOM   2439  O  O     . LEU B 1  109  ? -21.580 11.819  56.308   1.00 87.44  ? 97   LEU B O     1 
ATOM   2440  C  CB    . LEU B 1  109  ? -19.950 9.864   54.730   1.00 100.49 ? 97   LEU B CB    1 
ATOM   2441  C  CG    . LEU B 1  109  ? -18.986 10.972  54.300   1.00 103.29 ? 97   LEU B CG    1 
ATOM   2442  C  CD1   . LEU B 1  109  ? -17.620 10.771  54.929   1.00 98.25  ? 97   LEU B CD1   1 
ATOM   2443  C  CD2   . LEU B 1  109  ? -18.877 11.038  52.784   1.00 113.64 ? 97   LEU B CD2   1 
ATOM   2444  N  N     . ARG B 1  110  ? -19.829 11.638  57.723   1.00 110.24 ? 98   ARG B N     1 
ATOM   2445  C  CA    . ARG B 1  110  ? -20.072 12.913  58.380   1.00 81.75  ? 98   ARG B CA    1 
ATOM   2446  C  C     . ARG B 1  110  ? -18.752 13.609  58.675   1.00 91.54  ? 98   ARG B C     1 
ATOM   2447  O  O     . ARG B 1  110  ? -17.792 12.974  59.122   1.00 81.40  ? 98   ARG B O     1 
ATOM   2448  C  CB    . ARG B 1  110  ? -20.863 12.727  59.683   1.00 86.06  ? 98   ARG B CB    1 
ATOM   2449  C  CG    . ARG B 1  110  ? -22.325 12.356  59.488   1.00 99.00  ? 98   ARG B CG    1 
ATOM   2450  C  CD    . ARG B 1  110  ? -23.039 12.220  60.824   1.00 78.30  ? 98   ARG B CD    1 
ATOM   2451  N  NE    . ARG B 1  110  ? -22.834 10.904  61.420   1.00 96.83  ? 98   ARG B NE    1 
ATOM   2452  C  CZ    . ARG B 1  110  ? -23.749 9.940   61.430   1.00 100.47 ? 98   ARG B CZ    1 
ATOM   2453  N  NH1   . ARG B 1  110  ? -24.939 10.148  60.884   1.00 91.49  ? 98   ARG B NH1   1 
ATOM   2454  N  NH2   . ARG B 1  110  ? -23.477 8.770   61.991   1.00 89.94  ? 98   ARG B NH2   1 
ATOM   2455  N  N     . LYS B 1  111  ? -18.714 14.916  58.419   1.00 97.71  ? 99   LYS B N     1 
ATOM   2456  C  CA    . LYS B 1  111  ? -17.579 15.759  58.771   1.00 112.11 ? 99   LYS B CA    1 
ATOM   2457  C  C     . LYS B 1  111  ? -18.029 17.212  58.720   1.00 123.31 ? 99   LYS B C     1 
ATOM   2458  O  O     . LYS B 1  111  ? -18.742 17.613  57.797   1.00 102.64 ? 99   LYS B O     1 
ATOM   2459  C  CB    . LYS B 1  111  ? -16.384 15.540  57.834   1.00 96.93  ? 99   LYS B CB    1 
ATOM   2460  C  CG    . LYS B 1  111  ? -15.161 16.363  58.217   1.00 103.60 ? 99   LYS B CG    1 
ATOM   2461  C  CD    . LYS B 1  111  ? -14.055 16.252  57.184   1.00 127.72 ? 99   LYS B CD    1 
ATOM   2462  C  CE    . LYS B 1  111  ? -12.923 17.217  57.496   1.00 140.66 ? 99   LYS B CE    1 
ATOM   2463  N  NZ    . LYS B 1  111  ? -11.861 17.182  56.454   1.00 155.37 ? 99   LYS B NZ    1 
ATOM   2464  N  N     . GLN B 1  112  ? -17.606 17.992  59.711   1.00 132.06 ? 100  GLN B N     1 
ATOM   2465  C  CA    . GLN B 1  112  ? -18.017 19.380  59.868   1.00 125.01 ? 100  GLN B CA    1 
ATOM   2466  C  C     . GLN B 1  112  ? -16.800 20.295  59.785   1.00 129.69 ? 100  GLN B C     1 
ATOM   2467  O  O     . GLN B 1  112  ? -15.650 19.846  59.782   1.00 128.77 ? 100  GLN B O     1 
ATOM   2468  C  CB    . GLN B 1  112  ? -18.757 19.577  61.201   1.00 131.50 ? 100  GLN B CB    1 
ATOM   2469  C  CG    . GLN B 1  112  ? -19.570 20.862  61.309   1.00 130.62 ? 100  GLN B CG    1 
ATOM   2470  C  CD    . GLN B 1  112  ? -20.361 20.948  62.597   1.00 135.30 ? 100  GLN B CD    1 
ATOM   2471  O  OE1   . GLN B 1  112  ? -20.501 19.961  63.319   1.00 119.58 ? 100  GLN B OE1   1 
ATOM   2472  N  NE2   . GLN B 1  112  ? -20.883 22.132  62.894   1.00 156.59 ? 100  GLN B NE2   1 
ATOM   2473  N  N     . GLY B 1  113  ? -17.066 21.597  59.703   1.00 124.20 ? 101  GLY B N     1 
ATOM   2474  C  CA    . GLY B 1  113  ? -16.023 22.594  59.697   1.00 127.54 ? 101  GLY B CA    1 
ATOM   2475  C  C     . GLY B 1  113  ? -15.386 22.755  58.334   1.00 128.84 ? 101  GLY B C     1 
ATOM   2476  O  O     . GLY B 1  113  ? -15.421 21.849  57.496   1.00 147.19 ? 101  GLY B O     1 
ATOM   2477  N  N     . PRO B 1  114  ? -14.798 23.924  58.086   1.00 139.49 ? 102  PRO B N     1 
ATOM   2478  C  CA    . PRO B 1  114  ? -14.099 24.138  56.814   1.00 150.42 ? 102  PRO B CA    1 
ATOM   2479  C  C     . PRO B 1  114  ? -12.977 23.128  56.629   1.00 150.20 ? 102  PRO B C     1 
ATOM   2480  O  O     . PRO B 1  114  ? -12.280 22.759  57.577   1.00 136.48 ? 102  PRO B O     1 
ATOM   2481  C  CB    . PRO B 1  114  ? -13.561 25.570  56.937   1.00 139.38 ? 102  PRO B CB    1 
ATOM   2482  C  CG    . PRO B 1  114  ? -13.591 25.877  58.406   1.00 149.65 ? 102  PRO B CG    1 
ATOM   2483  C  CD    . PRO B 1  114  ? -14.752 25.111  58.954   1.00 144.91 ? 102  PRO B CD    1 
ATOM   2484  N  N     . GLY B 1  115  ? -12.821 22.675  55.402   1.00 145.28 ? 103  GLY B N     1 
ATOM   2485  C  CA    . GLY B 1  115  ? -11.852 21.653  55.074   1.00 151.40 ? 103  GLY B CA    1 
ATOM   2486  C  C     . GLY B 1  115  ? -12.306 20.885  53.844   1.00 140.77 ? 103  GLY B C     1 
ATOM   2487  O  O     . GLY B 1  115  ? -13.047 21.409  53.014   1.00 137.96 ? 103  GLY B O     1 
ATOM   2488  N  N     . GLU B 1  116  ? -11.855 19.637  53.757   1.00 128.98 ? 104  GLU B N     1 
ATOM   2489  C  CA    . GLU B 1  116  ? -12.125 18.792  52.603   1.00 133.96 ? 104  GLU B CA    1 
ATOM   2490  C  C     . GLU B 1  116  ? -12.581 17.414  53.060   1.00 129.27 ? 104  GLU B C     1 
ATOM   2491  O  O     . GLU B 1  116  ? -12.020 16.845  54.002   1.00 123.74 ? 104  GLU B O     1 
ATOM   2492  C  CB    . GLU B 1  116  ? -10.883 18.659  51.715   1.00 138.77 ? 104  GLU B CB    1 
ATOM   2493  C  CG    . GLU B 1  116  ? -11.151 18.031  50.359   1.00 142.44 ? 104  GLU B CG    1 
ATOM   2494  C  CD    . GLU B 1  116  ? -9.922  17.362  49.779   1.00 136.67 ? 104  GLU B CD    1 
ATOM   2495  O  OE1   . GLU B 1  116  ? -9.252  16.610  50.518   1.00 130.80 ? 104  GLU B OE1   1 
ATOM   2496  O  OE2   . GLU B 1  116  ? -9.623  17.591  48.589   1.00 134.34 ? 104  GLU B OE2   1 
ATOM   2497  N  N     . VAL B 1  117  ? -13.597 16.882  52.385   1.00 125.42 ? 105  VAL B N     1 
ATOM   2498  C  CA    . VAL B 1  117  ? -14.089 15.534  52.644   1.00 105.25 ? 105  VAL B CA    1 
ATOM   2499  C  C     . VAL B 1  117  ? -13.334 14.562  51.750   1.00 100.37 ? 105  VAL B C     1 
ATOM   2500  O  O     . VAL B 1  117  ? -12.970 14.883  50.614   1.00 114.90 ? 105  VAL B O     1 
ATOM   2501  C  CB    . VAL B 1  117  ? -15.612 15.435  52.414   1.00 86.47  ? 105  VAL B CB    1 
ATOM   2502  C  CG1   . VAL B 1  117  ? -16.172 14.177  53.065   1.00 84.86  ? 105  VAL B CG1   1 
ATOM   2503  C  CG2   . VAL B 1  117  ? -16.314 16.671  52.936   1.00 98.81  ? 105  VAL B CG2   1 
ATOM   2504  N  N     . THR B 1  118  ? -13.087 13.362  52.271   1.00 97.32  ? 106  THR B N     1 
ATOM   2505  C  CA    . THR B 1  118  ? -12.448 12.296  51.514   1.00 87.75  ? 106  THR B CA    1 
ATOM   2506  C  C     . THR B 1  118  ? -13.211 11.000  51.747   1.00 89.61  ? 106  THR B C     1 
ATOM   2507  O  O     . THR B 1  118  ? -14.053 10.900  52.644   1.00 111.46 ? 106  THR B O     1 
ATOM   2508  C  CB    . THR B 1  118  ? -10.974 12.114  51.905   1.00 93.42  ? 106  THR B CB    1 
ATOM   2509  O  OG1   . THR B 1  118  ? -10.880 11.795  53.299   1.00 122.59 ? 106  THR B OG1   1 
ATOM   2510  C  CG2   . THR B 1  118  ? -10.174 13.378  51.621   1.00 96.06  ? 106  THR B CG2   1 
ATOM   2511  N  N     . ALA B 1  119  ? -12.907 9.996   50.923   1.00 93.42  ? 107  ALA B N     1 
ATOM   2512  C  CA    . ALA B 1  119  ? -13.440 8.659   51.145   1.00 99.85  ? 107  ALA B CA    1 
ATOM   2513  C  C     . ALA B 1  119  ? -12.769 7.950   52.311   1.00 110.37 ? 107  ALA B C     1 
ATOM   2514  O  O     . ALA B 1  119  ? -13.147 6.816   52.624   1.00 119.81 ? 107  ALA B O     1 
ATOM   2515  C  CB    . ALA B 1  119  ? -13.304 7.815   49.876   1.00 112.82 ? 107  ALA B CB    1 
ATOM   2516  N  N     . GLY B 1  120  ? -11.780 8.578   52.942   1.00 112.72 ? 108  GLY B N     1 
ATOM   2517  C  CA    . GLY B 1  120  ? -11.191 8.058   54.158   1.00 112.13 ? 108  GLY B CA    1 
ATOM   2518  C  C     . GLY B 1  120  ? -11.931 8.563   55.378   1.00 129.89 ? 108  GLY B C     1 
ATOM   2519  O  O     . GLY B 1  120  ? -11.980 7.890   56.411   1.00 132.93 ? 108  GLY B O     1 
ATOM   2520  N  N     . ASP B 1  121  ? -12.524 9.753   55.261   1.00 140.87 ? 109  ASP B N     1 
ATOM   2521  C  CA    . ASP B 1  121  ? -13.371 10.299  56.315   1.00 140.68 ? 109  ASP B CA    1 
ATOM   2522  C  C     . ASP B 1  121  ? -14.673 9.530   56.481   1.00 126.37 ? 109  ASP B C     1 
ATOM   2523  O  O     . ASP B 1  121  ? -15.506 9.924   57.305   1.00 130.02 ? 109  ASP B O     1 
ATOM   2524  C  CB    . ASP B 1  121  ? -13.674 11.772  56.038   1.00 121.18 ? 109  ASP B CB    1 
ATOM   2525  C  CG    . ASP B 1  121  ? -12.454 12.655  56.200   1.00 132.20 ? 109  ASP B CG    1 
ATOM   2526  O  OD1   . ASP B 1  121  ? -11.556 12.288  56.986   1.00 149.92 ? 109  ASP B OD1   1 
ATOM   2527  O  OD2   . ASP B 1  121  ? -12.394 13.715  55.543   1.00 115.33 ? 109  ASP B OD2   1 
ATOM   2528  N  N     . ILE B 1  122  ? -14.869 8.465   55.724   1.00 114.37 ? 110  ILE B N     1 
ATOM   2529  C  CA    . ILE B 1  122  ? -16.024 7.592   55.866   1.00 112.09 ? 110  ILE B CA    1 
ATOM   2530  C  C     . ILE B 1  122  ? -15.703 6.542   56.919   1.00 111.06 ? 110  ILE B C     1 
ATOM   2531  O  O     . ILE B 1  122  ? -14.546 6.143   57.097   1.00 115.62 ? 110  ILE B O     1 
ATOM   2532  C  CB    . ILE B 1  122  ? -16.395 6.957   54.508   1.00 121.21 ? 110  ILE B CB    1 
ATOM   2533  C  CG1   . ILE B 1  122  ? -17.888 6.659   54.440   1.00 123.72 ? 110  ILE B CG1   1 
ATOM   2534  C  CG2   . ILE B 1  122  ? -15.611 5.676   54.264   1.00 122.11 ? 110  ILE B CG2   1 
ATOM   2535  C  CD1   . ILE B 1  122  ? -18.310 6.136   53.095   1.00 90.89  ? 110  ILE B CD1   1 
ATOM   2536  N  N     . VAL B 1  123  ? -16.722 6.110   57.650   1.00 98.78  ? 111  VAL B N     1 
ATOM   2537  C  CA    . VAL B 1  123  ? -16.578 5.062   58.656   1.00 106.82 ? 111  VAL B CA    1 
ATOM   2538  C  C     . VAL B 1  123  ? -17.165 3.778   58.082   1.00 107.90 ? 111  VAL B C     1 
ATOM   2539  O  O     . VAL B 1  123  ? -18.374 3.733   57.804   1.00 100.78 ? 111  VAL B O     1 
ATOM   2540  C  CB    . VAL B 1  123  ? -17.247 5.444   59.987   1.00 115.95 ? 111  VAL B CB    1 
ATOM   2541  C  CG1   . VAL B 1  123  ? -18.628 6.046   59.764   1.00 133.23 ? 111  VAL B CG1   1 
ATOM   2542  C  CG2   . VAL B 1  123  ? -17.320 4.234   60.909   1.00 111.37 ? 111  VAL B CG2   1 
ATOM   2543  N  N     . PRO B 1  124  ? -16.365 2.740   57.864   1.00 110.08 ? 112  PRO B N     1 
ATOM   2544  C  CA    . PRO B 1  124  ? -16.875 1.532   57.226   1.00 110.53 ? 112  PRO B CA    1 
ATOM   2545  C  C     . PRO B 1  124  ? -17.255 0.487   58.257   1.00 101.62 ? 112  PRO B C     1 
ATOM   2546  O  O     . PRO B 1  124  ? -16.427 0.095   59.093   1.00 116.06 ? 112  PRO B O     1 
ATOM   2547  C  CB    . PRO B 1  124  ? -15.687 1.061   56.369   1.00 111.85 ? 112  PRO B CB    1 
ATOM   2548  C  CG    . PRO B 1  124  ? -14.481 1.909   56.820   1.00 102.25 ? 112  PRO B CG    1 
ATOM   2549  C  CD    . PRO B 1  124  ? -14.907 2.683   58.031   1.00 97.75  ? 112  PRO B CD    1 
ATOM   2550  N  N     . PRO B 1  125  ? -18.501 0.015   58.235   1.00 87.55  ? 113  PRO B N     1 
ATOM   2551  C  CA    . PRO B 1  125  ? -18.875 -1.122  59.082   1.00 102.06 ? 113  PRO B CA    1 
ATOM   2552  C  C     . PRO B 1  125  ? -18.032 -2.348  58.761   1.00 101.68 ? 113  PRO B C     1 
ATOM   2553  O  O     . PRO B 1  125  ? -17.447 -2.470  57.683   1.00 115.28 ? 113  PRO B O     1 
ATOM   2554  C  CB    . PRO B 1  125  ? -20.356 -1.351  58.745   1.00 79.94  ? 113  PRO B CB    1 
ATOM   2555  C  CG    . PRO B 1  125  ? -20.593 -0.597  57.461   1.00 79.73  ? 113  PRO B CG    1 
ATOM   2556  C  CD    . PRO B 1  125  ? -19.650 0.559   57.495   1.00 93.12  ? 113  PRO B CD    1 
ATOM   2557  N  N     . ALA B 1  126  ? -17.968 -3.262  59.730   1.00 106.33 ? 114  ALA B N     1 
ATOM   2558  C  CA    . ALA B 1  126  ? -17.115 -4.437  59.603   1.00 121.96 ? 114  ALA B CA    1 
ATOM   2559  C  C     . ALA B 1  126  ? -17.561 -5.304  58.433   1.00 123.10 ? 114  ALA B C     1 
ATOM   2560  O  O     . ALA B 1  126  ? -18.754 -5.574  58.261   1.00 126.03 ? 114  ALA B O     1 
ATOM   2561  C  CB    . ALA B 1  126  ? -17.135 -5.247  60.899   1.00 153.25 ? 114  ALA B CB    1 
ATOM   2562  N  N     . GLY B 1  127  ? -16.594 -5.743  57.629   1.00 125.49 ? 115  GLY B N     1 
ATOM   2563  C  CA    . GLY B 1  127  ? -16.853 -6.509  56.431   1.00 138.11 ? 115  GLY B CA    1 
ATOM   2564  C  C     . GLY B 1  127  ? -16.724 -5.714  55.148   1.00 127.69 ? 115  GLY B C     1 
ATOM   2565  O  O     . GLY B 1  127  ? -16.482 -6.306  54.090   1.00 115.97 ? 115  GLY B O     1 
ATOM   2566  N  N     . VAL B 1  128  ? -16.870 -4.394  55.211   1.00 134.55 ? 116  VAL B N     1 
ATOM   2567  C  CA    . VAL B 1  128  ? -16.785 -3.527  54.041   1.00 116.97 ? 116  VAL B CA    1 
ATOM   2568  C  C     . VAL B 1  128  ? -15.442 -2.809  54.058   1.00 116.62 ? 116  VAL B C     1 
ATOM   2569  O  O     . VAL B 1  128  ? -14.930 -2.453  55.127   1.00 122.31 ? 116  VAL B O     1 
ATOM   2570  C  CB    . VAL B 1  128  ? -17.956 -2.523  54.019   1.00 102.83 ? 116  VAL B CB    1 
ATOM   2571  C  CG1   . VAL B 1  128  ? -18.069 -1.858  52.662   1.00 114.55 ? 116  VAL B CG1   1 
ATOM   2572  C  CG2   . VAL B 1  128  ? -19.253 -3.224  54.382   1.00 93.25  ? 116  VAL B CG2   1 
ATOM   2573  N  N     . THR B 1  129  ? -14.866 -2.594  52.876   1.00 105.80 ? 117  THR B N     1 
ATOM   2574  C  CA    . THR B 1  129  ? -13.549 -1.980  52.746   1.00 109.75 ? 117  THR B CA    1 
ATOM   2575  C  C     . THR B 1  129  ? -13.586 -0.896  51.677   1.00 102.03 ? 117  THR B C     1 
ATOM   2576  O  O     . THR B 1  129  ? -14.071 -1.133  50.566   1.00 105.14 ? 117  THR B O     1 
ATOM   2577  C  CB    . THR B 1  129  ? -12.482 -3.028  52.393   1.00 107.43 ? 117  THR B CB    1 
ATOM   2578  O  OG1   . THR B 1  129  ? -12.455 -4.046  53.401   1.00 117.67 ? 117  THR B OG1   1 
ATOM   2579  C  CG2   . THR B 1  129  ? -11.102 -2.386  52.293   1.00 91.91  ? 117  THR B CG2   1 
ATOM   2580  N  N     . VAL B 1  130  ? -13.071 0.284   52.013   1.00 87.33  ? 118  VAL B N     1 
ATOM   2581  C  CA    . VAL B 1  130  ? -12.934 1.393   51.072   1.00 96.61  ? 118  VAL B CA    1 
ATOM   2582  C  C     . VAL B 1  130  ? -11.507 1.379   50.541   1.00 113.06 ? 118  VAL B C     1 
ATOM   2583  O  O     . VAL B 1  130  ? -10.550 1.528   51.311   1.00 115.43 ? 118  VAL B O     1 
ATOM   2584  C  CB    . VAL B 1  130  ? -13.272 2.738   51.736   1.00 90.74  ? 118  VAL B CB    1 
ATOM   2585  C  CG1   . VAL B 1  130  ? -13.060 3.888   50.759   1.00 95.72  ? 118  VAL B CG1   1 
ATOM   2586  C  CG2   . VAL B 1  130  ? -14.703 2.728   52.249   1.00 91.56  ? 118  VAL B CG2   1 
ATOM   2587  N  N     . HIS B 1  131  ? -11.359 1.198   49.228   1.00 104.05 ? 119  HIS B N     1 
ATOM   2588  C  CA    . HIS B 1  131  ? -10.048 0.982   48.629   1.00 93.35  ? 119  HIS B CA    1 
ATOM   2589  C  C     . HIS B 1  131  ? -9.377  2.260   48.136   1.00 75.99  ? 119  HIS B C     1 
ATOM   2590  O  O     . HIS B 1  131  ? -8.203  2.209   47.754   1.00 73.51  ? 119  HIS B O     1 
ATOM   2591  C  CB    . HIS B 1  131  ? -10.154 -0.009  47.464   1.00 88.84  ? 119  HIS B CB    1 
ATOM   2592  C  CG    . HIS B 1  131  ? -10.650 -1.364  47.864   1.00 85.62  ? 119  HIS B CG    1 
ATOM   2593  N  ND1   . HIS B 1  131  ? -9.802  -2.396  48.203   1.00 101.49 ? 119  HIS B ND1   1 
ATOM   2594  C  CD2   . HIS B 1  131  ? -11.906 -1.857  47.974   1.00 80.03  ? 119  HIS B CD2   1 
ATOM   2595  C  CE1   . HIS B 1  131  ? -10.514 -3.466  48.507   1.00 106.39 ? 119  HIS B CE1   1 
ATOM   2596  N  NE2   . HIS B 1  131  ? -11.794 -3.166  48.376   1.00 87.95  ? 119  HIS B NE2   1 
ATOM   2597  N  N     . ASN B 1  132  ? -10.074 3.395   48.127   1.00 73.90  ? 120  ASN B N     1 
ATOM   2598  C  CA    . ASN B 1  132  ? -9.496  4.674   47.712   1.00 98.37  ? 120  ASN B CA    1 
ATOM   2599  C  C     . ASN B 1  132  ? -9.795  5.737   48.764   1.00 107.89 ? 120  ASN B C     1 
ATOM   2600  O  O     . ASN B 1  132  ? -10.619 6.635   48.549   1.00 106.17 ? 120  ASN B O     1 
ATOM   2601  C  CB    . ASN B 1  132  ? -10.012 5.092   46.333   1.00 99.38  ? 120  ASN B CB    1 
ATOM   2602  C  CG    . ASN B 1  132  ? -11.527 5.171   46.269   1.00 94.14  ? 120  ASN B CG    1 
ATOM   2603  O  OD1   . ASN B 1  132  ? -12.225 4.676   47.154   1.00 93.52  ? 120  ASN B OD1   1 
ATOM   2604  N  ND2   . ASN B 1  132  ? -12.042 5.789   45.212   1.00 75.31  ? 120  ASN B ND2   1 
ATOM   2605  N  N     . PRO B 1  133  ? -9.124  5.673   49.917   1.00 110.46 ? 121  PRO B N     1 
ATOM   2606  C  CA    . PRO B 1  133  ? -9.380  6.672   50.969   1.00 121.78 ? 121  PRO B CA    1 
ATOM   2607  C  C     . PRO B 1  133  ? -9.026  8.093   50.564   1.00 119.22 ? 121  PRO B C     1 
ATOM   2608  O  O     . PRO B 1  133  ? -9.559  9.039   51.158   1.00 128.94 ? 121  PRO B O     1 
ATOM   2609  C  CB    . PRO B 1  133  ? -8.504  6.189   52.135   1.00 126.40 ? 121  PRO B CB    1 
ATOM   2610  C  CG    . PRO B 1  133  ? -8.227  4.748   51.843   1.00 108.52 ? 121  PRO B CG    1 
ATOM   2611  C  CD    . PRO B 1  133  ? -8.155  4.654   50.352   1.00 98.98  ? 121  PRO B CD    1 
ATOM   2612  N  N     . GLY B 1  134  ? -8.151  8.276   49.579   1.00 102.22 ? 122  GLY B N     1 
ATOM   2613  C  CA    . GLY B 1  134  ? -7.753  9.593   49.132   1.00 107.05 ? 122  GLY B CA    1 
ATOM   2614  C  C     . GLY B 1  134  ? -8.645  10.231  48.093   1.00 105.55 ? 122  GLY B C     1 
ATOM   2615  O  O     . GLY B 1  134  ? -8.340  11.331  47.621   1.00 97.06  ? 122  GLY B O     1 
ATOM   2616  N  N     . MET B 1  135  ? -9.745  9.582   47.721   1.00 101.29 ? 123  MET B N     1 
ATOM   2617  C  CA    . MET B 1  135  ? -10.632 10.125  46.700   1.00 107.13 ? 123  MET B CA    1 
ATOM   2618  C  C     . MET B 1  135  ? -11.398 11.323  47.250   1.00 97.36  ? 123  MET B C     1 
ATOM   2619  O  O     . MET B 1  135  ? -12.072 11.220  48.281   1.00 104.20 ? 123  MET B O     1 
ATOM   2620  C  CB    . MET B 1  135  ? -11.601 9.051   46.214   1.00 109.41 ? 123  MET B CB    1 
ATOM   2621  C  CG    . MET B 1  135  ? -12.558 9.535   45.138   1.00 98.87  ? 123  MET B CG    1 
ATOM   2622  S  SD    . MET B 1  135  ? -13.970 8.439   44.919   1.00 122.37 ? 123  MET B SD    1 
ATOM   2623  C  CE    . MET B 1  135  ? -14.711 8.530   46.547   1.00 122.31 ? 123  MET B CE    1 
ATOM   2624  N  N     . HIS B 1  136  ? -11.293 12.456  46.559   1.00 96.41  ? 124  HIS B N     1 
ATOM   2625  C  CA    . HIS B 1  136  ? -12.034 13.650  46.940   1.00 96.85  ? 124  HIS B CA    1 
ATOM   2626  C  C     . HIS B 1  136  ? -13.532 13.430  46.768   1.00 97.10  ? 124  HIS B C     1 
ATOM   2627  O  O     . HIS B 1  136  ? -13.977 12.795  45.808   1.00 105.75 ? 124  HIS B O     1 
ATOM   2628  C  CB    . HIS B 1  136  ? -11.580 14.842  46.096   1.00 116.74 ? 124  HIS B CB    1 
ATOM   2629  C  CG    . HIS B 1  136  ? -12.491 16.027  46.182   1.00 115.47 ? 124  HIS B CG    1 
ATOM   2630  N  ND1   . HIS B 1  136  ? -12.411 16.955  47.197   1.00 109.49 ? 124  HIS B ND1   1 
ATOM   2631  C  CD2   . HIS B 1  136  ? -13.504 16.432  45.380   1.00 119.94 ? 124  HIS B CD2   1 
ATOM   2632  C  CE1   . HIS B 1  136  ? -13.334 17.882  47.016   1.00 123.35 ? 124  HIS B CE1   1 
ATOM   2633  N  NE2   . HIS B 1  136  ? -14.011 17.588  45.920   1.00 123.26 ? 124  HIS B NE2   1 
ATOM   2634  N  N     . ILE B 1  137  ? -14.315 13.964  47.708   1.00 95.21  ? 125  ILE B N     1 
ATOM   2635  C  CA    . ILE B 1  137  ? -15.768 13.851  47.690   1.00 96.69  ? 125  ILE B CA    1 
ATOM   2636  C  C     . ILE B 1  137  ? -16.435 15.223  47.692   1.00 106.81 ? 125  ILE B C     1 
ATOM   2637  O  O     . ILE B 1  137  ? -17.342 15.486  46.896   1.00 117.15 ? 125  ILE B O     1 
ATOM   2638  C  CB    . ILE B 1  137  ? -16.282 12.991  48.869   1.00 80.48  ? 125  ILE B CB    1 
ATOM   2639  C  CG1   . ILE B 1  137  ? -15.689 11.580  48.804   1.00 76.74  ? 125  ILE B CG1   1 
ATOM   2640  C  CG2   . ILE B 1  137  ? -17.803 12.925  48.861   1.00 67.89  ? 125  ILE B CG2   1 
ATOM   2641  C  CD1   . ILE B 1  137  ? -16.265 10.620  49.828   1.00 62.77  ? 125  ILE B CD1   1 
ATOM   2642  N  N     . ALA B 1  138  ? -15.992 16.116  48.576   1.00 113.90 ? 126  ALA B N     1 
ATOM   2643  C  CA    . ALA B 1  138  ? -16.603 17.433  48.681   1.00 118.53 ? 126  ALA B CA    1 
ATOM   2644  C  C     . ALA B 1  138  ? -15.660 18.384  49.404   1.00 125.74 ? 126  ALA B C     1 
ATOM   2645  O  O     . ALA B 1  138  ? -14.874 17.969  50.260   1.00 126.95 ? 126  ALA B O     1 
ATOM   2646  C  CB    . ALA B 1  138  ? -17.946 17.370  49.417   1.00 120.24 ? 126  ALA B CB    1 
ATOM   2647  N  N     . THR B 1  139  ? -15.752 19.662  49.046   1.00 127.70 ? 127  THR B N     1 
ATOM   2648  C  CA    . THR B 1  139  ? -15.067 20.735  49.754   1.00 119.25 ? 127  THR B CA    1 
ATOM   2649  C  C     . THR B 1  139  ? -16.054 21.411  50.696   1.00 130.97 ? 127  THR B C     1 
ATOM   2650  O  O     . THR B 1  139  ? -17.143 21.815  50.275   1.00 139.20 ? 127  THR B O     1 
ATOM   2651  C  CB    . THR B 1  139  ? -14.483 21.763  48.782   1.00 118.69 ? 127  THR B CB    1 
ATOM   2652  O  OG1   . THR B 1  139  ? -15.528 22.292  47.957   1.00 135.91 ? 127  THR B OG1   1 
ATOM   2653  C  CG2   . THR B 1  139  ? -13.421 21.128  47.903   1.00 99.00  ? 127  THR B CG2   1 
ATOM   2654  N  N     . LEU B 1  140  ? -15.674 21.531  51.965   1.00 123.37 ? 128  LEU B N     1 
ATOM   2655  C  CA    . LEU B 1  140  ? -16.554 22.082  52.987   1.00 114.53 ? 128  LEU B CA    1 
ATOM   2656  C  C     . LEU B 1  140  ? -16.357 23.591  53.076   1.00 143.03 ? 128  LEU B C     1 
ATOM   2657  O  O     . LEU B 1  140  ? -15.232 24.067  53.270   1.00 147.83 ? 128  LEU B O     1 
ATOM   2658  C  CB    . LEU B 1  140  ? -16.289 21.421  54.339   1.00 111.36 ? 128  LEU B CB    1 
ATOM   2659  C  CG    . LEU B 1  140  ? -16.598 19.923  54.393   1.00 106.84 ? 128  LEU B CG    1 
ATOM   2660  C  CD1   . LEU B 1  140  ? -16.212 19.313  55.732   1.00 136.40 ? 128  LEU B CD1   1 
ATOM   2661  C  CD2   . LEU B 1  140  ? -18.067 19.667  54.095   1.00 101.26 ? 128  LEU B CD2   1 
ATOM   2662  N  N     . ASN B 1  141  ? -17.449 24.337  52.931   1.00 149.24 ? 129  ASN B N     1 
ATOM   2663  C  CA    . ASN B 1  141  ? -17.407 25.779  53.098   1.00 161.64 ? 129  ASN B CA    1 
ATOM   2664  C  C     . ASN B 1  141  ? -17.155 26.126  54.566   1.00 173.26 ? 129  ASN B C     1 
ATOM   2665  O  O     . ASN B 1  141  ? -17.196 25.270  55.455   1.00 171.91 ? 129  ASN B O     1 
ATOM   2666  C  CB    . ASN B 1  141  ? -18.713 26.406  52.603   1.00 149.25 ? 129  ASN B CB    1 
ATOM   2667  C  CG    . ASN B 1  141  ? -18.575 27.884  52.288   1.00 179.09 ? 129  ASN B CG    1 
ATOM   2668  O  OD1   . ASN B 1  141  ? -17.792 28.597  52.914   1.00 193.41 ? 129  ASN B OD1   1 
ATOM   2669  N  ND2   . ASN B 1  141  ? -19.343 28.352  51.310   1.00 179.34 ? 129  ASN B ND2   1 
ATOM   2670  N  N     . ASP B 1  142  ? -16.876 27.405  54.813   1.00 177.72 ? 130  ASP B N     1 
ATOM   2671  C  CA    . ASP B 1  142  ? -16.625 27.870  56.171   1.00 160.36 ? 130  ASP B CA    1 
ATOM   2672  C  C     . ASP B 1  142  ? -17.845 27.626  57.052   1.00 156.72 ? 130  ASP B C     1 
ATOM   2673  O  O     . ASP B 1  142  ? -18.977 27.922  56.658   1.00 157.22 ? 130  ASP B O     1 
ATOM   2674  C  CB    . ASP B 1  142  ? -16.264 29.356  56.157   1.00 169.71 ? 130  ASP B CB    1 
ATOM   2675  N  N     . LYS B 1  143  ? -17.606 27.084  58.249   1.00 143.77 ? 131  LYS B N     1 
ATOM   2676  C  CA    . LYS B 1  143  ? -18.678 26.673  59.158   1.00 148.70 ? 131  LYS B CA    1 
ATOM   2677  C  C     . LYS B 1  143  ? -19.630 25.699  58.468   1.00 156.22 ? 131  LYS B C     1 
ATOM   2678  O  O     . LYS B 1  143  ? -20.847 25.735  58.664   1.00 171.01 ? 131  LYS B O     1 
ATOM   2679  C  CB    . LYS B 1  143  ? -19.434 27.883  59.711   1.00 132.48 ? 131  LYS B CB    1 
ATOM   2680  N  N     . GLY B 1  144  ? -19.066 24.818  57.649   1.00 142.42 ? 132  GLY B N     1 
ATOM   2681  C  CA    . GLY B 1  144  ? -19.844 23.891  56.845   1.00 140.06 ? 132  GLY B CA    1 
ATOM   2682  C  C     . GLY B 1  144  ? -19.939 22.523  57.497   1.00 130.30 ? 132  GLY B C     1 
ATOM   2683  O  O     . GLY B 1  144  ? -18.999 22.063  58.145   1.00 121.63 ? 132  GLY B O     1 
ATOM   2684  N  N     . LYS B 1  145  ? -21.089 21.881  57.311   1.00 123.36 ? 133  LYS B N     1 
ATOM   2685  C  CA    . LYS B 1  145  ? -21.358 20.554  57.843   1.00 122.20 ? 133  LYS B CA    1 
ATOM   2686  C  C     . LYS B 1  145  ? -21.999 19.709  56.753   1.00 113.59 ? 133  LYS B C     1 
ATOM   2687  O  O     . LYS B 1  145  ? -22.808 20.210  55.966   1.00 91.44  ? 133  LYS B O     1 
ATOM   2688  C  CB    . LYS B 1  145  ? -22.274 20.628  59.074   1.00 118.15 ? 133  LYS B CB    1 
ATOM   2689  C  CG    . LYS B 1  145  ? -22.588 19.289  59.725   1.00 124.75 ? 133  LYS B CG    1 
ATOM   2690  C  CD    . LYS B 1  145  ? -23.326 19.494  61.040   1.00 144.27 ? 133  LYS B CD    1 
ATOM   2691  C  CE    . LYS B 1  145  ? -24.122 18.261  61.440   1.00 150.20 ? 133  LYS B CE    1 
ATOM   2692  N  NZ    . LYS B 1  145  ? -23.260 17.064  61.640   1.00 144.92 ? 133  LYS B NZ    1 
ATOM   2693  N  N     . LEU B 1  146  ? -21.633 18.430  56.704   1.00 107.44 ? 134  LEU B N     1 
ATOM   2694  C  CA    . LEU B 1  146  ? -22.145 17.527  55.680   1.00 95.99  ? 134  LEU B CA    1 
ATOM   2695  C  C     . LEU B 1  146  ? -22.424 16.167  56.300   1.00 108.76 ? 134  LEU B C     1 
ATOM   2696  O  O     . LEU B 1  146  ? -21.508 15.516  56.810   1.00 87.30  ? 134  LEU B O     1 
ATOM   2697  C  CB    . LEU B 1  146  ? -21.155 17.396  54.517   1.00 106.08 ? 134  LEU B CB    1 
ATOM   2698  C  CG    . LEU B 1  146  ? -21.598 16.520  53.344   1.00 103.38 ? 134  LEU B CG    1 
ATOM   2699  C  CD1   . LEU B 1  146  ? -21.416 17.257  52.028   1.00 94.75  ? 134  LEU B CD1   1 
ATOM   2700  C  CD2   . LEU B 1  146  ? -20.831 15.208  53.331   1.00 85.21  ? 134  LEU B CD2   1 
ATOM   2701  N  N     . GLU B 1  147  ? -23.686 15.747  56.257   1.00 114.60 ? 135  GLU B N     1 
ATOM   2702  C  CA    . GLU B 1  147  ? -24.095 14.406  56.651   1.00 107.83 ? 135  GLU B CA    1 
ATOM   2703  C  C     . GLU B 1  147  ? -24.693 13.706  55.440   1.00 108.70 ? 135  GLU B C     1 
ATOM   2704  O  O     . GLU B 1  147  ? -25.525 14.286  54.734   1.00 106.69 ? 135  GLU B O     1 
ATOM   2705  C  CB    . GLU B 1  147  ? -25.115 14.441  57.794   1.00 135.80 ? 135  GLU B CB    1 
ATOM   2706  C  CG    . GLU B 1  147  ? -24.607 15.066  59.080   1.00 141.46 ? 135  GLU B CG    1 
ATOM   2707  C  CD    . GLU B 1  147  ? -25.518 14.780  60.258   1.00 136.08 ? 135  GLU B CD    1 
ATOM   2708  O  OE1   . GLU B 1  147  ? -26.677 14.374  60.030   1.00 133.53 ? 135  GLU B OE1   1 
ATOM   2709  O  OE2   . GLU B 1  147  ? -25.073 14.954  61.412   1.00 140.78 ? 135  GLU B OE2   1 
ATOM   2710  N  N     . VAL B 1  148  ? -24.271 12.467  55.199   1.00 106.43 ? 136  VAL B N     1 
ATOM   2711  C  CA    . VAL B 1  148  ? -24.766 11.696  54.061   1.00 95.41  ? 136  VAL B CA    1 
ATOM   2712  C  C     . VAL B 1  148  ? -24.709 10.216  54.415   1.00 78.88  ? 136  VAL B C     1 
ATOM   2713  O  O     . VAL B 1  148  ? -23.789 9.759   55.102   1.00 69.17  ? 136  VAL B O     1 
ATOM   2714  C  CB    . VAL B 1  148  ? -23.970 12.017  52.774   1.00 79.92  ? 136  VAL B CB    1 
ATOM   2715  C  CG1   . VAL B 1  148  ? -22.506 11.655  52.937   1.00 79.49  ? 136  VAL B CG1   1 
ATOM   2716  C  CG2   . VAL B 1  148  ? -24.575 11.311  51.566   1.00 71.30  ? 136  VAL B CG2   1 
ATOM   2717  N  N     . GLU B 1  149  ? -25.710 9.472   53.953   1.00 73.48  ? 137  GLU B N     1 
ATOM   2718  C  CA    . GLU B 1  149  ? -25.842 8.046   54.217   1.00 93.10  ? 137  GLU B CA    1 
ATOM   2719  C  C     . GLU B 1  149  ? -25.719 7.285   52.906   1.00 99.90  ? 137  GLU B C     1 
ATOM   2720  O  O     . GLU B 1  149  ? -26.382 7.628   51.924   1.00 104.62 ? 137  GLU B O     1 
ATOM   2721  C  CB    . GLU B 1  149  ? -27.185 7.745   54.887   1.00 106.88 ? 137  GLU B CB    1 
ATOM   2722  C  CG    . GLU B 1  149  ? -27.569 6.280   54.898   1.00 126.94 ? 137  GLU B CG    1 
ATOM   2723  C  CD    . GLU B 1  149  ? -28.994 6.065   55.361   1.00 131.75 ? 137  GLU B CD    1 
ATOM   2724  O  OE1   . GLU B 1  149  ? -29.644 7.055   55.756   1.00 117.46 ? 137  GLU B OE1   1 
ATOM   2725  O  OE2   . GLU B 1  149  ? -29.465 4.909   55.326   1.00 140.70 ? 137  GLU B OE2   1 
ATOM   2726  N  N     . LEU B 1  150  ? -24.875 6.256   52.893   1.00 101.00 ? 138  LEU B N     1 
ATOM   2727  C  CA    . LEU B 1  150  ? -24.608 5.473   51.694   1.00 88.14  ? 138  LEU B CA    1 
ATOM   2728  C  C     . LEU B 1  150  ? -25.099 4.044   51.878   1.00 86.53  ? 138  LEU B C     1 
ATOM   2729  O  O     . LEU B 1  150  ? -24.957 3.463   52.958   1.00 102.95 ? 138  LEU B O     1 
ATOM   2730  C  CB    . LEU B 1  150  ? -23.113 5.468   51.362   1.00 85.81  ? 138  LEU B CB    1 
ATOM   2731  C  CG    . LEU B 1  150  ? -22.395 6.820   51.363   1.00 87.61  ? 138  LEU B CG    1 
ATOM   2732  C  CD1   . LEU B 1  150  ? -20.982 6.673   50.827   1.00 113.01 ? 138  LEU B CD1   1 
ATOM   2733  C  CD2   . LEU B 1  150  ? -23.166 7.855   50.561   1.00 86.24  ? 138  LEU B CD2   1 
ATOM   2734  N  N     . VAL B 1  151  ? -25.670 3.480   50.816   1.00 86.52  ? 139  VAL B N     1 
ATOM   2735  C  CA    . VAL B 1  151  ? -26.180 2.113   50.811   1.00 79.15  ? 139  VAL B CA    1 
ATOM   2736  C  C     . VAL B 1  151  ? -25.345 1.304   49.828   1.00 88.84  ? 139  VAL B C     1 
ATOM   2737  O  O     . VAL B 1  151  ? -25.286 1.632   48.637   1.00 109.91 ? 139  VAL B O     1 
ATOM   2738  C  CB    . VAL B 1  151  ? -27.670 2.063   50.440   1.00 95.26  ? 139  VAL B CB    1 
ATOM   2739  C  CG1   . VAL B 1  151  ? -28.154 0.623   50.387   1.00 90.11  ? 139  VAL B CG1   1 
ATOM   2740  C  CG2   . VAL B 1  151  ? -28.493 2.871   51.432   1.00 104.78 ? 139  VAL B CG2   1 
ATOM   2741  N  N     . VAL B 1  152  ? -24.706 0.246   50.323   1.00 74.14  ? 140  VAL B N     1 
ATOM   2742  C  CA    . VAL B 1  152  ? -23.818 -0.598  49.530   1.00 77.51  ? 140  VAL B CA    1 
ATOM   2743  C  C     . VAL B 1  152  ? -24.430 -1.988  49.426   1.00 84.57  ? 140  VAL B C     1 
ATOM   2744  O  O     . VAL B 1  152  ? -24.881 -2.553  50.430   1.00 108.43 ? 140  VAL B O     1 
ATOM   2745  C  CB    . VAL B 1  152  ? -22.408 -0.663  50.144   1.00 77.07  ? 140  VAL B CB    1 
ATOM   2746  C  CG1   . VAL B 1  152  ? -21.502 -1.566  49.319   1.00 89.28  ? 140  VAL B CG1   1 
ATOM   2747  C  CG2   . VAL B 1  152  ? -21.815 0.733   50.259   1.00 80.15  ? 140  VAL B CG2   1 
ATOM   2748  N  N     . GLU B 1  153  ? -24.442 -2.538  48.213   1.00 81.61  ? 141  GLU B N     1 
ATOM   2749  C  CA    . GLU B 1  153  ? -24.994 -3.859  47.952   1.00 84.18  ? 141  GLU B CA    1 
ATOM   2750  C  C     . GLU B 1  153  ? -24.062 -4.618  47.020   1.00 96.94  ? 141  GLU B C     1 
ATOM   2751  O  O     . GLU B 1  153  ? -23.246 -4.027  46.308   1.00 91.70  ? 141  GLU B O     1 
ATOM   2752  C  CB    . GLU B 1  153  ? -26.392 -3.779  47.323   1.00 73.92  ? 141  GLU B CB    1 
ATOM   2753  C  CG    . GLU B 1  153  ? -27.410 -3.010  48.140   1.00 81.68  ? 141  GLU B CG    1 
ATOM   2754  C  CD    . GLU B 1  153  ? -28.710 -2.794  47.391   1.00 101.80 ? 141  GLU B CD    1 
ATOM   2755  O  OE1   . GLU B 1  153  ? -28.796 -3.207  46.216   1.00 142.23 ? 141  GLU B OE1   1 
ATOM   2756  O  OE2   . GLU B 1  153  ? -29.644 -2.205  47.975   1.00 120.02 ? 141  GLU B OE2   1 
ATOM   2757  N  N     . ARG B 1  154  ? -24.198 -5.942  47.027   1.00 95.62  ? 142  ARG B N     1 
ATOM   2758  C  CA    . ARG B 1  154  ? -23.466 -6.795  46.104   1.00 85.29  ? 142  ARG B CA    1 
ATOM   2759  C  C     . ARG B 1  154  ? -24.273 -6.998  44.829   1.00 104.62 ? 142  ARG B C     1 
ATOM   2760  O  O     . ARG B 1  154  ? -25.504 -7.087  44.865   1.00 103.00 ? 142  ARG B O     1 
ATOM   2761  C  CB    . ARG B 1  154  ? -23.153 -8.153  46.737   1.00 83.37  ? 142  ARG B CB    1 
ATOM   2762  C  CG    . ARG B 1  154  ? -22.275 -8.091  47.975   1.00 122.45 ? 142  ARG B CG    1 
ATOM   2763  C  CD    . ARG B 1  154  ? -21.367 -9.312  48.063   1.00 119.93 ? 142  ARG B CD    1 
ATOM   2764  N  NE    . ARG B 1  154  ? -20.144 -9.142  47.282   1.00 91.92  ? 142  ARG B NE    1 
ATOM   2765  C  CZ    . ARG B 1  154  ? -19.272 -10.114 47.028   1.00 115.08 ? 142  ARG B CZ    1 
ATOM   2766  N  NH1   . ARG B 1  154  ? -19.488 -11.341 47.484   1.00 133.71 ? 142  ARG B NH1   1 
ATOM   2767  N  NH2   . ARG B 1  154  ? -18.185 -9.861  46.312   1.00 108.33 ? 142  ARG B NH2   1 
ATOM   2768  N  N     . GLY B 1  155  ? -23.572 -7.070  43.705   1.00 112.13 ? 143  GLY B N     1 
ATOM   2769  C  CA    . GLY B 1  155  ? -24.225 -7.309  42.432   1.00 103.78 ? 143  GLY B CA    1 
ATOM   2770  C  C     . GLY B 1  155  ? -23.191 -7.516  41.350   1.00 91.43  ? 143  GLY B C     1 
ATOM   2771  O  O     . GLY B 1  155  ? -21.985 -7.548  41.609   1.00 71.77  ? 143  GLY B O     1 
ATOM   2772  N  N     . ARG B 1  156  ? -23.681 -7.652  40.119   1.00 88.55  ? 144  ARG B N     1 
ATOM   2773  C  CA    . ARG B 1  156  ? -22.823 -7.874  38.963   1.00 98.01  ? 144  ARG B CA    1 
ATOM   2774  C  C     . ARG B 1  156  ? -23.228 -6.946  37.828   1.00 90.18  ? 144  ARG B C     1 
ATOM   2775  O  O     . ARG B 1  156  ? -24.417 -6.821  37.517   1.00 78.82  ? 144  ARG B O     1 
ATOM   2776  C  CB    . ARG B 1  156  ? -22.883 -9.332  38.497   1.00 104.28 ? 144  ARG B CB    1 
ATOM   2777  C  CG    . ARG B 1  156  ? -22.239 -10.308 39.463   1.00 98.93  ? 144  ARG B CG    1 
ATOM   2778  C  CD    . ARG B 1  156  ? -22.027 -11.665 38.818   1.00 103.05 ? 144  ARG B CD    1 
ATOM   2779  N  NE    . ARG B 1  156  ? -23.286 -12.319 38.479   1.00 110.66 ? 144  ARG B NE    1 
ATOM   2780  C  CZ    . ARG B 1  156  ? -23.935 -13.148 39.290   1.00 127.69 ? 144  ARG B CZ    1 
ATOM   2781  N  NH1   . ARG B 1  156  ? -23.441 -13.421 40.489   1.00 129.60 ? 144  ARG B NH1   1 
ATOM   2782  N  NH2   . ARG B 1  156  ? -25.075 -13.704 38.903   1.00 142.37 ? 144  ARG B NH2   1 
ATOM   2783  N  N     . GLY B 1  157  ? -22.237 -6.304  37.214   1.00 89.65  ? 145  GLY B N     1 
ATOM   2784  C  CA    . GLY B 1  157  ? -22.470 -5.463  36.057   1.00 100.53 ? 145  GLY B CA    1 
ATOM   2785  C  C     . GLY B 1  157  ? -22.828 -4.028  36.389   1.00 94.10  ? 145  GLY B C     1 
ATOM   2786  O  O     . GLY B 1  157  ? -22.263 -3.435  37.313   1.00 96.22  ? 145  GLY B O     1 
ATOM   2787  N  N     . TYR B 1  158  ? -23.770 -3.464  35.635   1.00 87.65  ? 146  TYR B N     1 
ATOM   2788  C  CA    . TYR B 1  158  ? -24.188 -2.075  35.792   1.00 77.07  ? 146  TYR B CA    1 
ATOM   2789  C  C     . TYR B 1  158  ? -25.708 -2.026  35.746   1.00 90.10  ? 146  TYR B C     1 
ATOM   2790  O  O     . TYR B 1  158  ? -26.313 -2.465  34.763   1.00 97.93  ? 146  TYR B O     1 
ATOM   2791  C  CB    . TYR B 1  158  ? -23.577 -1.192  34.695   1.00 65.73  ? 146  TYR B CB    1 
ATOM   2792  C  CG    . TYR B 1  158  ? -24.064 0.244   34.683   1.00 70.49  ? 146  TYR B CG    1 
ATOM   2793  C  CD1   . TYR B 1  158  ? -25.165 0.617   33.922   1.00 73.02  ? 146  TYR B CD1   1 
ATOM   2794  C  CD2   . TYR B 1  158  ? -23.413 1.227   35.417   1.00 73.16  ? 146  TYR B CD2   1 
ATOM   2795  C  CE1   . TYR B 1  158  ? -25.612 1.925   33.902   1.00 73.75  ? 146  TYR B CE1   1 
ATOM   2796  C  CE2   . TYR B 1  158  ? -23.854 2.540   35.403   1.00 73.67  ? 146  TYR B CE2   1 
ATOM   2797  C  CZ    . TYR B 1  158  ? -24.953 2.882   34.643   1.00 77.45  ? 146  TYR B CZ    1 
ATOM   2798  O  OH    . TYR B 1  158  ? -25.396 4.186   34.623   1.00 70.53  ? 146  TYR B OH    1 
ATOM   2799  N  N     . VAL B 1  159  ? -26.319 -1.504  36.804   1.00 87.51  ? 147  VAL B N     1 
ATOM   2800  C  CA    . VAL B 1  159  ? -27.768 -1.397  36.919   1.00 92.32  ? 147  VAL B CA    1 
ATOM   2801  C  C     . VAL B 1  159  ? -28.117 0.078   37.065   1.00 88.26  ? 147  VAL B C     1 
ATOM   2802  O  O     . VAL B 1  159  ? -27.516 0.764   37.894   1.00 91.35  ? 147  VAL B O     1 
ATOM   2803  C  CB    . VAL B 1  159  ? -28.326 -2.204  38.106   1.00 85.34  ? 147  VAL B CB    1 
ATOM   2804  C  CG1   . VAL B 1  159  ? -27.410 -2.082  39.301   1.00 97.53  ? 147  VAL B CG1   1 
ATOM   2805  C  CG2   . VAL B 1  159  ? -29.730 -1.744  38.467   1.00 83.05  ? 147  VAL B CG2   1 
ATOM   2806  N  N     . PRO B 1  160  ? -29.058 0.607   36.285   1.00 99.48  ? 148  PRO B N     1 
ATOM   2807  C  CA    . PRO B 1  160  ? -29.383 2.034   36.378   1.00 116.22 ? 148  PRO B CA    1 
ATOM   2808  C  C     . PRO B 1  160  ? -30.095 2.361   37.683   1.00 118.35 ? 148  PRO B C     1 
ATOM   2809  O  O     . PRO B 1  160  ? -30.579 1.490   38.409   1.00 111.22 ? 148  PRO B O     1 
ATOM   2810  C  CB    . PRO B 1  160  ? -30.292 2.271   35.170   1.00 115.51 ? 148  PRO B CB    1 
ATOM   2811  C  CG    . PRO B 1  160  ? -30.919 0.943   34.916   1.00 111.08 ? 148  PRO B CG    1 
ATOM   2812  C  CD    . PRO B 1  160  ? -29.868 -0.079  35.264   1.00 112.91 ? 148  PRO B CD    1 
ATOM   2813  N  N     . ALA B 1  161  ? -30.156 3.665   37.970   1.00 116.11 ? 149  ALA B N     1 
ATOM   2814  C  CA    . ALA B 1  161  ? -30.819 4.130   39.183   1.00 115.01 ? 149  ALA B CA    1 
ATOM   2815  C  C     . ALA B 1  161  ? -32.329 3.949   39.111   1.00 121.56 ? 149  ALA B C     1 
ATOM   2816  O  O     . ALA B 1  161  ? -32.978 3.765   40.148   1.00 122.66 ? 149  ALA B O     1 
ATOM   2817  C  CB    . ALA B 1  161  ? -30.479 5.598   39.434   1.00 137.04 ? 149  ALA B CB    1 
ATOM   2818  N  N     . VAL B 1  162  ? -32.900 3.994   37.904   1.00 146.23 ? 150  VAL B N     1 
ATOM   2819  C  CA    . VAL B 1  162  ? -34.354 3.969   37.752   1.00 167.04 ? 150  VAL B CA    1 
ATOM   2820  C  C     . VAL B 1  162  ? -34.939 2.697   38.352   1.00 158.91 ? 150  VAL B C     1 
ATOM   2821  O  O     . VAL B 1  162  ? -36.026 2.715   38.941   1.00 151.46 ? 150  VAL B O     1 
ATOM   2822  C  CB    . VAL B 1  162  ? -34.737 4.125   36.269   1.00 169.38 ? 150  VAL B CB    1 
ATOM   2823  C  CG1   . VAL B 1  162  ? -36.233 4.358   36.128   1.00 151.68 ? 150  VAL B CG1   1 
ATOM   2824  C  CG2   . VAL B 1  162  ? -33.952 5.260   35.634   1.00 144.36 ? 150  VAL B CG2   1 
ATOM   2825  N  N     . GLN B 1  163  ? -34.231 1.573   38.217   1.00 160.08 ? 151  GLN B N     1 
ATOM   2826  C  CA    . GLN B 1  163  ? -34.700 0.331   38.821   1.00 173.71 ? 151  GLN B CA    1 
ATOM   2827  C  C     . GLN B 1  163  ? -34.639 0.366   40.343   1.00 163.81 ? 151  GLN B C     1 
ATOM   2828  O  O     . GLN B 1  163  ? -35.374 -0.383  40.995   1.00 175.59 ? 151  GLN B O     1 
ATOM   2829  C  CB    . GLN B 1  163  ? -33.891 -0.852  38.289   1.00 167.45 ? 151  GLN B CB    1 
ATOM   2830  C  CG    . GLN B 1  163  ? -34.148 -1.162  36.824   1.00 150.26 ? 151  GLN B CG    1 
ATOM   2831  C  CD    . GLN B 1  163  ? -33.342 -2.344  36.325   1.00 162.64 ? 151  GLN B CD    1 
ATOM   2832  O  OE1   . GLN B 1  163  ? -32.355 -2.742  36.941   1.00 152.17 ? 151  GLN B OE1   1 
ATOM   2833  N  NE2   . GLN B 1  163  ? -33.764 -2.915  35.204   1.00 164.19 ? 151  GLN B NE2   1 
ATOM   2834  N  N     . ASN B 1  164  ? -33.785 1.212   40.921   1.00 131.58 ? 152  ASN B N     1 
ATOM   2835  C  CA    . ASN B 1  164  ? -33.688 1.372   42.366   1.00 137.92 ? 152  ASN B CA    1 
ATOM   2836  C  C     . ASN B 1  164  ? -34.692 2.385   42.914   1.00 152.55 ? 152  ASN B C     1 
ATOM   2837  O  O     . ASN B 1  164  ? -34.527 2.860   44.044   1.00 157.03 ? 152  ASN B O     1 
ATOM   2838  C  CB    . ASN B 1  164  ? -32.263 1.780   42.759   1.00 128.41 ? 152  ASN B CB    1 
ATOM   2839  C  CG    . ASN B 1  164  ? -31.269 0.634   42.641   1.00 112.00 ? 152  ASN B CG    1 
ATOM   2840  O  OD1   . ASN B 1  164  ? -31.616 -0.528  42.846   1.00 100.85 ? 152  ASN B OD1   1 
ATOM   2841  N  ND2   . ASN B 1  164  ? -30.021 0.963   42.317   1.00 102.48 ? 152  ASN B ND2   1 
ATOM   2842  N  N     . ARG B 1  165  ? -35.726 2.725   42.138   1.00 149.45 ? 153  ARG B N     1 
ATOM   2843  C  CA    . ARG B 1  165  ? -36.712 3.700   42.596   1.00 158.00 ? 153  ARG B CA    1 
ATOM   2844  C  C     . ARG B 1  165  ? -37.488 3.177   43.800   1.00 190.84 ? 153  ARG B C     1 
ATOM   2845  O  O     . ARG B 1  165  ? -37.828 3.943   44.710   1.00 180.31 ? 153  ARG B O     1 
ATOM   2846  C  CB    . ARG B 1  165  ? -37.666 4.056   41.453   1.00 140.45 ? 153  ARG B CB    1 
ATOM   2847  C  CG    . ARG B 1  165  ? -38.459 2.868   40.935   1.00 137.25 ? 153  ARG B CG    1 
ATOM   2848  C  CD    . ARG B 1  165  ? -39.391 3.235   39.801   1.00 163.16 ? 153  ARG B CD    1 
ATOM   2849  N  NE    . ARG B 1  165  ? -40.146 2.068   39.355   1.00 157.48 ? 153  ARG B NE    1 
ATOM   2850  C  CZ    . ARG B 1  165  ? -41.048 2.088   38.382   1.00 147.51 ? 153  ARG B CZ    1 
ATOM   2851  N  NH1   . ARG B 1  165  ? -41.686 0.976   38.046   1.00 118.22 ? 153  ARG B NH1   1 
ATOM   2852  N  NH2   . ARG B 1  165  ? -41.313 3.220   37.746   1.00 135.99 ? 153  ARG B NH2   1 
ATOM   2853  N  N     . ALA B 1  166  ? -37.767 1.871   43.828   1.00 209.87 ? 154  ALA B N     1 
ATOM   2854  C  CA    . ALA B 1  166  ? -38.501 1.283   44.942   1.00 207.87 ? 154  ALA B CA    1 
ATOM   2855  C  C     . ALA B 1  166  ? -37.616 1.077   46.165   1.00 194.33 ? 154  ALA B C     1 
ATOM   2856  O  O     . ALA B 1  166  ? -38.123 1.041   47.291   1.00 172.86 ? 154  ALA B O     1 
ATOM   2857  C  CB    . ALA B 1  166  ? -39.125 -0.046  44.514   1.00 194.44 ? 154  ALA B CB    1 
ATOM   2858  N  N     . SER B 1  167  ? -36.301 0.949   45.965   1.00 196.97 ? 155  SER B N     1 
ATOM   2859  C  CA    . SER B 1  167  ? -35.378 0.723   47.073   1.00 183.73 ? 155  SER B CA    1 
ATOM   2860  C  C     . SER B 1  167  ? -35.256 1.927   47.998   1.00 192.80 ? 155  SER B C     1 
ATOM   2861  O  O     . SER B 1  167  ? -34.827 1.767   49.145   1.00 193.30 ? 155  SER B O     1 
ATOM   2862  C  CB    . SER B 1  167  ? -33.995 0.350   46.532   1.00 168.62 ? 155  SER B CB    1 
ATOM   2863  O  OG    . SER B 1  167  ? -32.984 0.600   47.493   1.00 146.08 ? 155  SER B OG    1 
ATOM   2864  N  N     . GLY B 1  168  ? -35.618 3.121   47.534   1.00 202.53 ? 156  GLY B N     1 
ATOM   2865  C  CA    . GLY B 1  168  ? -35.456 4.326   48.329   1.00 193.10 ? 156  GLY B CA    1 
ATOM   2866  C  C     . GLY B 1  168  ? -36.682 4.630   49.176   1.00 211.42 ? 156  GLY B C     1 
ATOM   2867  O  O     . GLY B 1  168  ? -37.816 4.548   48.707   1.00 217.20 ? 156  GLY B O     1 
ATOM   2868  N  N     . ALA B 1  169  ? -36.434 4.988   50.433   1.00 217.62 ? 157  ALA B N     1 
ATOM   2869  C  CA    . ALA B 1  169  ? -37.506 5.363   51.341   1.00 200.70 ? 157  ALA B CA    1 
ATOM   2870  C  C     . ALA B 1  169  ? -37.993 6.774   51.034   1.00 190.06 ? 157  ALA B C     1 
ATOM   2871  O  O     . ALA B 1  169  ? -37.230 7.634   50.584   1.00 191.08 ? 157  ALA B O     1 
ATOM   2872  C  CB    . ALA B 1  169  ? -37.039 5.273   52.794   1.00 154.80 ? 157  ALA B CB    1 
ATOM   2873  N  N     . GLU B 1  170  ? -39.281 7.009   51.287   1.00 175.03 ? 158  GLU B N     1 
ATOM   2874  C  CA    . GLU B 1  170  ? -39.905 8.302   51.000   1.00 186.03 ? 158  GLU B CA    1 
ATOM   2875  C  C     . GLU B 1  170  ? -39.483 9.320   52.062   1.00 184.58 ? 158  GLU B C     1 
ATOM   2876  O  O     . GLU B 1  170  ? -40.278 9.801   52.873   1.00 195.29 ? 158  GLU B O     1 
ATOM   2877  C  CB    . GLU B 1  170  ? -41.419 8.157   50.928   1.00 181.60 ? 158  GLU B CB    1 
ATOM   2878  C  CG    . GLU B 1  170  ? -42.138 9.388   50.395   1.00 165.74 ? 158  GLU B CG    1 
ATOM   2879  C  CD    . GLU B 1  170  ? -43.642 9.308   50.558   1.00 141.98 ? 158  GLU B CD    1 
ATOM   2880  O  OE1   . GLU B 1  170  ? -44.157 8.203   50.829   1.00 148.41 ? 158  GLU B OE1   1 
ATOM   2881  O  OE2   . GLU B 1  170  ? -44.309 10.354  50.418   1.00 109.55 ? 158  GLU B OE2   1 
ATOM   2882  N  N     . ILE B 1  171  ? -38.191 9.650   52.042   1.00 166.36 ? 159  ILE B N     1 
ATOM   2883  C  CA    . ILE B 1  171  ? -37.629 10.625  52.971   1.00 142.29 ? 159  ILE B CA    1 
ATOM   2884  C  C     . ILE B 1  171  ? -36.281 11.107  52.433   1.00 134.31 ? 159  ILE B C     1 
ATOM   2885  O  O     . ILE B 1  171  ? -35.224 10.872  53.029   1.00 132.90 ? 159  ILE B O     1 
ATOM   2886  C  CB    . ILE B 1  171  ? -37.532 10.034  54.398   1.00 153.68 ? 159  ILE B CB    1 
ATOM   2887  C  CG1   . ILE B 1  171  ? -36.970 11.058  55.393   1.00 151.16 ? 159  ILE B CG1   1 
ATOM   2888  C  CG2   . ILE B 1  171  ? -36.779 8.697   54.407   1.00 140.91 ? 159  ILE B CG2   1 
ATOM   2889  C  CD1   . ILE B 1  171  ? -37.616 12.419  55.287   1.00 131.89 ? 159  ILE B CD1   1 
ATOM   2890  N  N     . GLY B 1  172  ? -36.315 11.781  51.287   1.00 143.23 ? 160  GLY B N     1 
ATOM   2891  C  CA    . GLY B 1  172  ? -35.115 12.374  50.727   1.00 130.67 ? 160  GLY B CA    1 
ATOM   2892  C  C     . GLY B 1  172  ? -34.035 11.399  50.316   1.00 129.33 ? 160  GLY B C     1 
ATOM   2893  O  O     . GLY B 1  172  ? -32.857 11.770  50.290   1.00 109.16 ? 160  GLY B O     1 
ATOM   2894  N  N     . ARG B 1  173  ? -34.395 10.160  49.994   1.00 133.24 ? 161  ARG B N     1 
ATOM   2895  C  CA    . ARG B 1  173  ? -33.435 9.170   49.523   1.00 107.85 ? 161  ARG B CA    1 
ATOM   2896  C  C     . ARG B 1  173  ? -33.444 9.151   48.001   1.00 94.74  ? 161  ARG B C     1 
ATOM   2897  O  O     . ARG B 1  173  ? -34.513 9.099   47.383   1.00 109.54 ? 161  ARG B O     1 
ATOM   2898  C  CB    . ARG B 1  173  ? -33.761 7.781   50.077   1.00 104.60 ? 161  ARG B CB    1 
ATOM   2899  N  N     . ILE B 1  174  ? -32.260 9.198   47.401   1.00 98.39  ? 162  ILE B N     1 
ATOM   2900  C  CA    . ILE B 1  174  ? -32.103 9.240   45.953   1.00 88.09  ? 162  ILE B CA    1 
ATOM   2901  C  C     . ILE B 1  174  ? -31.381 7.975   45.513   1.00 97.16  ? 162  ILE B C     1 
ATOM   2902  O  O     . ILE B 1  174  ? -30.380 7.600   46.128   1.00 84.35  ? 162  ILE B O     1 
ATOM   2903  C  CB    . ILE B 1  174  ? -31.340 10.490  45.474   1.00 72.76  ? 162  ILE B CB    1 
ATOM   2904  C  CG1   . ILE B 1  174  ? -30.015 10.650  46.218   1.00 68.07  ? 162  ILE B CG1   1 
ATOM   2905  C  CG2   . ILE B 1  174  ? -32.186 11.728  45.667   1.00 82.87  ? 162  ILE B CG2   1 
ATOM   2906  C  CD1   . ILE B 1  174  ? -29.240 11.886  45.817   1.00 89.81  ? 162  ILE B CD1   1 
ATOM   2907  N  N     . PRO B 1  175  ? -31.856 7.282   44.484   1.00 99.95  ? 163  PRO B N     1 
ATOM   2908  C  CA    . PRO B 1  175  ? -31.120 6.132   43.957   1.00 97.76  ? 163  PRO B CA    1 
ATOM   2909  C  C     . PRO B 1  175  ? -30.060 6.573   42.959   1.00 98.57  ? 163  PRO B C     1 
ATOM   2910  O  O     . PRO B 1  175  ? -30.147 7.637   42.342   1.00 93.23  ? 163  PRO B O     1 
ATOM   2911  C  CB    . PRO B 1  175  ? -32.206 5.292   43.271   1.00 117.40 ? 163  PRO B CB    1 
ATOM   2912  C  CG    . PRO B 1  175  ? -33.497 6.102   43.369   1.00 116.61 ? 163  PRO B CG    1 
ATOM   2913  C  CD    . PRO B 1  175  ? -33.119 7.493   43.763   1.00 90.66  ? 163  PRO B CD    1 
ATOM   2914  N  N     . VAL B 1  176  ? -29.037 5.730   42.814   1.00 88.59  ? 164  VAL B N     1 
ATOM   2915  C  CA    . VAL B 1  176  ? -27.902 6.034   41.954   1.00 93.90  ? 164  VAL B CA    1 
ATOM   2916  C  C     . VAL B 1  176  ? -27.583 4.823   41.088   1.00 109.01 ? 164  VAL B C     1 
ATOM   2917  O  O     . VAL B 1  176  ? -27.955 3.688   41.396   1.00 107.45 ? 164  VAL B O     1 
ATOM   2918  C  CB    . VAL B 1  176  ? -26.649 6.454   42.755   1.00 81.23  ? 164  VAL B CB    1 
ATOM   2919  C  CG1   . VAL B 1  176  ? -26.954 7.645   43.651   1.00 81.40  ? 164  VAL B CG1   1 
ATOM   2920  C  CG2   . VAL B 1  176  ? -26.121 5.286   43.571   1.00 84.27  ? 164  VAL B CG2   1 
ATOM   2921  N  N     . ASP B 1  177  ? -26.891 5.088   39.983   1.00 101.97 ? 165  ASP B N     1 
ATOM   2922  C  CA    . ASP B 1  177  ? -26.345 4.014   39.167   1.00 90.20  ? 165  ASP B CA    1 
ATOM   2923  C  C     . ASP B 1  177  ? -25.324 3.229   39.979   1.00 85.70  ? 165  ASP B C     1 
ATOM   2924  O  O     . ASP B 1  177  ? -24.475 3.810   40.660   1.00 79.86  ? 165  ASP B O     1 
ATOM   2925  C  CB    . ASP B 1  177  ? -25.696 4.586   37.907   1.00 113.15 ? 165  ASP B CB    1 
ATOM   2926  C  CG    . ASP B 1  177  ? -26.600 5.557   37.174   1.00 105.45 ? 165  ASP B CG    1 
ATOM   2927  O  OD1   . ASP B 1  177  ? -27.694 5.142   36.736   1.00 103.16 ? 165  ASP B OD1   1 
ATOM   2928  O  OD2   . ASP B 1  177  ? -26.217 6.740   37.044   1.00 81.55  ? 165  ASP B OD2   1 
ATOM   2929  N  N     . SER B 1  178  ? -25.412 1.906   39.913   1.00 73.16  ? 166  SER B N     1 
ATOM   2930  C  CA    . SER B 1  178  ? -24.548 1.023   40.688   1.00 88.31  ? 166  SER B CA    1 
ATOM   2931  C  C     . SER B 1  178  ? -23.540 0.375   39.747   1.00 82.46  ? 166  SER B C     1 
ATOM   2932  O  O     . SER B 1  178  ? -23.905 -0.470  38.922   1.00 73.34  ? 166  SER B O     1 
ATOM   2933  C  CB    . SER B 1  178  ? -25.373 -0.032  41.422   1.00 111.18 ? 166  SER B CB    1 
ATOM   2934  O  OG    . SER B 1  178  ? -26.396 0.570   42.198   1.00 109.33 ? 166  SER B OG    1 
ATOM   2935  N  N     . ILE B 1  179  ? -22.274 0.774   39.870   1.00 78.10  ? 167  ILE B N     1 
ATOM   2936  C  CA    . ILE B 1  179  ? -21.196 0.148   39.112   1.00 75.72  ? 167  ILE B CA    1 
ATOM   2937  C  C     . ILE B 1  179  ? -20.676 -1.030  39.926   1.00 68.07  ? 167  ILE B C     1 
ATOM   2938  O  O     . ILE B 1  179  ? -19.611 -0.955  40.550   1.00 59.97  ? 167  ILE B O     1 
ATOM   2939  C  CB    . ILE B 1  179  ? -20.078 1.154   38.777   1.00 57.74  ? 167  ILE B CB    1 
ATOM   2940  C  CG1   . ILE B 1  179  ? -20.667 2.382   38.079   1.00 61.20  ? 167  ILE B CG1   1 
ATOM   2941  C  CG2   . ILE B 1  179  ? -19.011 0.510   37.894   1.00 58.08  ? 167  ILE B CG2   1 
ATOM   2942  C  CD1   . ILE B 1  179  ? -19.631 3.384   37.621   1.00 72.03  ? 167  ILE B CD1   1 
ATOM   2943  N  N     . TYR B 1  180  ? -21.447 -2.120  39.939   1.00 71.12  ? 168  TYR B N     1 
ATOM   2944  C  CA    . TYR B 1  180  ? -21.055 -3.305  40.694   1.00 81.45  ? 168  TYR B CA    1 
ATOM   2945  C  C     . TYR B 1  180  ? -19.779 -3.921  40.138   1.00 92.50  ? 168  TYR B C     1 
ATOM   2946  O  O     . TYR B 1  180  ? -18.911 -4.365  40.899   1.00 87.97  ? 168  TYR B O     1 
ATOM   2947  C  CB    . TYR B 1  180  ? -22.181 -4.338  40.665   1.00 85.16  ? 168  TYR B CB    1 
ATOM   2948  C  CG    . TYR B 1  180  ? -23.438 -3.969  41.425   1.00 90.56  ? 168  TYR B CG    1 
ATOM   2949  C  CD1   . TYR B 1  180  ? -23.374 -3.320  42.651   1.00 106.64 ? 168  TYR B CD1   1 
ATOM   2950  C  CD2   . TYR B 1  180  ? -24.691 -4.288  40.918   1.00 96.85  ? 168  TYR B CD2   1 
ATOM   2951  C  CE1   . TYR B 1  180  ? -24.525 -2.996  43.348   1.00 111.83 ? 168  TYR B CE1   1 
ATOM   2952  C  CE2   . TYR B 1  180  ? -25.844 -3.973  41.610   1.00 99.80  ? 168  TYR B CE2   1 
ATOM   2953  C  CZ    . TYR B 1  180  ? -25.756 -3.322  42.821   1.00 108.49 ? 168  TYR B CZ    1 
ATOM   2954  O  OH    . TYR B 1  180  ? -26.900 -2.998  43.514   1.00 109.71 ? 168  TYR B OH    1 
ATOM   2955  N  N     . SER B 1  181  ? -19.652 -3.958  38.815   1.00 98.13  ? 169  SER B N     1 
ATOM   2956  C  CA    . SER B 1  181  ? -18.584 -4.715  38.181   1.00 94.29  ? 169  SER B CA    1 
ATOM   2957  C  C     . SER B 1  181  ? -17.220 -4.144  38.560   1.00 89.84  ? 169  SER B C     1 
ATOM   2958  O  O     . SER B 1  181  ? -17.032 -2.921  38.556   1.00 89.66  ? 169  SER B O     1 
ATOM   2959  C  CB    . SER B 1  181  ? -18.754 -4.703  36.662   1.00 99.29  ? 169  SER B CB    1 
ATOM   2960  O  OG    . SER B 1  181  ? -17.677 -5.369  36.028   1.00 100.69 ? 169  SER B OG    1 
ATOM   2961  N  N     . PRO B 1  182  ? -16.249 -4.997  38.899   1.00 80.75  ? 170  PRO B N     1 
ATOM   2962  C  CA    . PRO B 1  182  ? -14.913 -4.489  39.243   1.00 78.51  ? 170  PRO B CA    1 
ATOM   2963  C  C     . PRO B 1  182  ? -14.126 -3.984  38.046   1.00 90.84  ? 170  PRO B C     1 
ATOM   2964  O  O     . PRO B 1  182  ? -13.195 -3.193  38.233   1.00 103.00 ? 170  PRO B O     1 
ATOM   2965  C  CB    . PRO B 1  182  ? -14.227 -5.704  39.888   1.00 76.43  ? 170  PRO B CB    1 
ATOM   2966  C  CG    . PRO B 1  182  ? -15.340 -6.673  40.199   1.00 78.81  ? 170  PRO B CG    1 
ATOM   2967  C  CD    . PRO B 1  182  ? -16.369 -6.441  39.143   1.00 87.35  ? 170  PRO B CD    1 
ATOM   2968  N  N     . VAL B 1  183  ? -14.463 -4.405  36.833   1.00 88.11  ? 171  VAL B N     1 
ATOM   2969  C  CA    . VAL B 1  183  ? -13.772 -3.936  35.637   1.00 76.06  ? 171  VAL B CA    1 
ATOM   2970  C  C     . VAL B 1  183  ? -14.523 -2.741  35.068   1.00 78.02  ? 171  VAL B C     1 
ATOM   2971  O  O     . VAL B 1  183  ? -15.760 -2.696  35.080   1.00 72.09  ? 171  VAL B O     1 
ATOM   2972  C  CB    . VAL B 1  183  ? -13.630 -5.065  34.599   1.00 77.84  ? 171  VAL B CB    1 
ATOM   2973  C  CG1   . VAL B 1  183  ? -12.726 -6.163  35.141   1.00 58.70  ? 171  VAL B CG1   1 
ATOM   2974  C  CG2   . VAL B 1  183  ? -14.991 -5.625  34.233   1.00 81.17  ? 171  VAL B CG2   1 
ATOM   2975  N  N     . LEU B 1  184  ? -13.770 -1.759  34.574   1.00 74.12  ? 172  LEU B N     1 
ATOM   2976  C  CA    . LEU B 1  184  ? -14.329 -0.496  34.109   1.00 72.43  ? 172  LEU B CA    1 
ATOM   2977  C  C     . LEU B 1  184  ? -14.501 -0.444  32.597   1.00 85.14  ? 172  LEU B C     1 
ATOM   2978  O  O     . LEU B 1  184  ? -15.562 -0.045  32.109   1.00 90.46  ? 172  LEU B O     1 
ATOM   2979  C  CB    . LEU B 1  184  ? -13.440 0.665   34.572   1.00 86.48  ? 172  LEU B CB    1 
ATOM   2980  C  CG    . LEU B 1  184  ? -13.244 0.784   36.084   1.00 75.63  ? 172  LEU B CG    1 
ATOM   2981  C  CD1   . LEU B 1  184  ? -12.172 1.811   36.411   1.00 79.20  ? 172  LEU B CD1   1 
ATOM   2982  C  CD2   . LEU B 1  184  ? -14.559 1.136   36.765   1.00 107.65 ? 172  LEU B CD2   1 
ATOM   2983  N  N     . LYS B 1  185  ? -13.480 -0.843  31.843   1.00 82.16  ? 173  LYS B N     1 
ATOM   2984  C  CA    . LYS B 1  185  ? -13.509 -0.709  30.391   1.00 81.56  ? 173  LYS B CA    1 
ATOM   2985  C  C     . LYS B 1  185  ? -12.722 -1.854  29.776   1.00 88.81  ? 173  LYS B C     1 
ATOM   2986  O  O     . LYS B 1  185  ? -11.550 -2.051  30.109   1.00 85.04  ? 173  LYS B O     1 
ATOM   2987  C  CB    . LYS B 1  185  ? -12.931 0.641   29.962   1.00 77.26  ? 173  LYS B CB    1 
ATOM   2988  C  CG    . LYS B 1  185  ? -12.973 0.895   28.469   1.00 88.34  ? 173  LYS B CG    1 
ATOM   2989  C  CD    . LYS B 1  185  ? -12.523 2.310   28.145   1.00 110.81 ? 173  LYS B CD    1 
ATOM   2990  C  CE    . LYS B 1  185  ? -12.724 2.628   26.673   1.00 134.94 ? 173  LYS B CE    1 
ATOM   2991  N  NZ    . LYS B 1  185  ? -12.406 4.051   26.374   1.00 151.51 ? 173  LYS B NZ    1 
ATOM   2992  N  N     . VAL B 1  186  ? -13.367 -2.606  28.887   1.00 94.10  ? 174  VAL B N     1 
ATOM   2993  C  CA    . VAL B 1  186  ? -12.741 -3.726  28.197   1.00 85.41  ? 174  VAL B CA    1 
ATOM   2994  C  C     . VAL B 1  186  ? -12.991 -3.574  26.704   1.00 82.29  ? 174  VAL B C     1 
ATOM   2995  O  O     . VAL B 1  186  ? -14.134 -3.377  26.277   1.00 74.19  ? 174  VAL B O     1 
ATOM   2996  C  CB    . VAL B 1  186  ? -13.271 -5.082  28.701   1.00 83.80  ? 174  VAL B CB    1 
ATOM   2997  C  CG1   . VAL B 1  186  ? -12.865 -6.199  27.752   1.00 76.18  ? 174  VAL B CG1   1 
ATOM   2998  C  CG2   . VAL B 1  186  ? -12.750 -5.365  30.100   1.00 85.22  ? 174  VAL B CG2   1 
ATOM   2999  N  N     . THR B 1  187  ? -11.921 -3.648  25.917   1.00 93.23  ? 175  THR B N     1 
ATOM   3000  C  CA    . THR B 1  187  ? -12.005 -3.656  24.465   1.00 90.22  ? 175  THR B CA    1 
ATOM   3001  C  C     . THR B 1  187  ? -11.169 -4.810  23.931   1.00 82.92  ? 175  THR B C     1 
ATOM   3002  O  O     . THR B 1  187  ? -10.229 -5.275  24.582   1.00 78.97  ? 175  THR B O     1 
ATOM   3003  C  CB    . THR B 1  187  ? -11.520 -2.333  23.853   1.00 95.29  ? 175  THR B CB    1 
ATOM   3004  O  OG1   . THR B 1  187  ? -10.140 -2.131  24.182   1.00 76.70  ? 175  THR B OG1   1 
ATOM   3005  C  CG2   . THR B 1  187  ? -12.340 -1.163  24.378   1.00 102.11 ? 175  THR B CG2   1 
ATOM   3006  N  N     . TYR B 1  188  ? -11.518 -5.271  22.731   1.00 79.46  ? 176  TYR B N     1 
ATOM   3007  C  CA    . TYR B 1  188  ? -10.818 -6.394  22.128   1.00 77.08  ? 176  TYR B CA    1 
ATOM   3008  C  C     . TYR B 1  188  ? -10.754 -6.217  20.619   1.00 83.83  ? 176  TYR B C     1 
ATOM   3009  O  O     . TYR B 1  188  ? -11.666 -5.661  20.002   1.00 90.80  ? 176  TYR B O     1 
ATOM   3010  C  CB    . TYR B 1  188  ? -11.492 -7.730  22.467   1.00 70.66  ? 176  TYR B CB    1 
ATOM   3011  C  CG    . TYR B 1  188  ? -12.740 -8.015  21.665   1.00 69.87  ? 176  TYR B CG    1 
ATOM   3012  C  CD1   . TYR B 1  188  ? -13.927 -7.347  21.931   1.00 84.29  ? 176  TYR B CD1   1 
ATOM   3013  C  CD2   . TYR B 1  188  ? -12.733 -8.960  20.648   1.00 75.67  ? 176  TYR B CD2   1 
ATOM   3014  C  CE1   . TYR B 1  188  ? -15.069 -7.607  21.203   1.00 87.20  ? 176  TYR B CE1   1 
ATOM   3015  C  CE2   . TYR B 1  188  ? -13.870 -9.227  19.915   1.00 90.51  ? 176  TYR B CE2   1 
ATOM   3016  C  CZ    . TYR B 1  188  ? -15.035 -8.548  20.197   1.00 83.84  ? 176  TYR B CZ    1 
ATOM   3017  O  OH    . TYR B 1  188  ? -16.172 -8.810  19.469   1.00 71.06  ? 176  TYR B OH    1 
ATOM   3018  N  N     . LYS B 1  189  ? -9.659  -6.700  20.036   1.00 72.82  ? 177  LYS B N     1 
ATOM   3019  C  CA    . LYS B 1  189  ? -9.500  -6.760  18.592   1.00 82.21  ? 177  LYS B CA    1 
ATOM   3020  C  C     . LYS B 1  189  ? -8.813  -8.071  18.242   1.00 75.62  ? 177  LYS B C     1 
ATOM   3021  O  O     . LYS B 1  189  ? -8.108  -8.664  19.063   1.00 71.69  ? 177  LYS B O     1 
ATOM   3022  C  CB    . LYS B 1  189  ? -8.698  -5.565  18.056   1.00 105.55 ? 177  LYS B CB    1 
ATOM   3023  C  CG    . LYS B 1  189  ? -7.191  -5.745  18.129   1.00 106.54 ? 177  LYS B CG    1 
ATOM   3024  C  CD    . LYS B 1  189  ? -6.468  -4.419  17.989   1.00 137.13 ? 177  LYS B CD    1 
ATOM   3025  C  CE    . LYS B 1  189  ? -6.766  -3.514  19.173   1.00 181.21 ? 177  LYS B CE    1 
ATOM   3026  N  NZ    . LYS B 1  189  ? -6.012  -2.235  19.096   1.00 178.80 ? 177  LYS B NZ    1 
ATOM   3027  N  N     . VAL B 1  190  ? -9.036  -8.530  17.013   1.00 76.63  ? 178  VAL B N     1 
ATOM   3028  C  CA    . VAL B 1  190  ? -8.504  -9.801  16.539   1.00 72.23  ? 178  VAL B CA    1 
ATOM   3029  C  C     . VAL B 1  190  ? -7.606  -9.530  15.341   1.00 78.11  ? 178  VAL B C     1 
ATOM   3030  O  O     . VAL B 1  190  ? -8.016  -8.852  14.391   1.00 84.12  ? 178  VAL B O     1 
ATOM   3031  C  CB    . VAL B 1  190  ? -9.628  -10.787 16.169   1.00 66.02  ? 178  VAL B CB    1 
ATOM   3032  C  CG1   . VAL B 1  190  ? -9.062  -12.184 15.958   1.00 75.59  ? 178  VAL B CG1   1 
ATOM   3033  C  CG2   . VAL B 1  190  ? -10.708 -10.797 17.244   1.00 77.14  ? 178  VAL B CG2   1 
ATOM   3034  N  N     . ASP B 1  191  ? -6.384  -10.052 15.391   1.00 83.16  ? 179  ASP B N     1 
ATOM   3035  C  CA    . ASP B 1  191  ? -5.424  -9.948  14.305   1.00 100.02 ? 179  ASP B CA    1 
ATOM   3036  C  C     . ASP B 1  191  ? -5.172  -11.332 13.710   1.00 93.03  ? 179  ASP B C     1 
ATOM   3037  O  O     . ASP B 1  191  ? -5.877  -12.302 14.010   1.00 89.44  ? 179  ASP B O     1 
ATOM   3038  C  CB    . ASP B 1  191  ? -4.132  -9.295  14.802   1.00 119.64 ? 179  ASP B CB    1 
ATOM   3039  C  CG    . ASP B 1  191  ? -4.277  -7.801  15.016   1.00 123.93 ? 179  ASP B CG    1 
ATOM   3040  O  OD1   . ASP B 1  191  ? -5.373  -7.263  14.747   1.00 133.06 ? 179  ASP B OD1   1 
ATOM   3041  O  OD2   . ASP B 1  191  ? -3.294  -7.164  15.449   1.00 112.48 ? 179  ASP B OD2   1 
ATOM   3042  N  N     . ALA B 1  192  ? -4.153  -11.424 12.860   1.00 81.95  ? 180  ALA B N     1 
ATOM   3043  C  CA    . ALA B 1  192  ? -3.813  -12.656 12.166   1.00 82.47  ? 180  ALA B CA    1 
ATOM   3044  C  C     . ALA B 1  192  ? -2.363  -13.026 12.441   1.00 93.54  ? 180  ALA B C     1 
ATOM   3045  O  O     . ALA B 1  192  ? -1.478  -12.165 12.431   1.00 105.36 ? 180  ALA B O     1 
ATOM   3046  C  CB    . ALA B 1  192  ? -4.042  -12.522 10.657   1.00 112.00 ? 180  ALA B CB    1 
ATOM   3047  N  N     . THR B 1  193  ? -2.131  -14.311 12.695   1.00 101.60 ? 181  THR B N     1 
ATOM   3048  C  CA    . THR B 1  193  ? -0.796  -14.859 12.882   1.00 123.23 ? 181  THR B CA    1 
ATOM   3049  C  C     . THR B 1  193  ? -0.682  -16.125 12.045   1.00 133.74 ? 181  THR B C     1 
ATOM   3050  O  O     . THR B 1  193  ? -1.682  -16.787 11.764   1.00 147.52 ? 181  THR B O     1 
ATOM   3051  C  CB    . THR B 1  193  ? -0.511  -15.159 14.368   1.00 122.09 ? 181  THR B CB    1 
ATOM   3052  O  OG1   . THR B 1  193  ? -0.898  -14.033 15.165   1.00 124.33 ? 181  THR B OG1   1 
ATOM   3053  C  CG2   . THR B 1  193  ? 0.971   -15.433 14.597   1.00 125.13 ? 181  THR B CG2   1 
ATOM   3054  N  N     . ARG B 1  194  ? 0.539   -16.447 11.628   1.00 134.13 ? 182  ARG B N     1 
ATOM   3055  C  CA    . ARG B 1  194  ? 0.797   -17.606 10.779   1.00 155.50 ? 182  ARG B CA    1 
ATOM   3056  C  C     . ARG B 1  194  ? 1.479   -18.689 11.607   1.00 151.42 ? 182  ARG B C     1 
ATOM   3057  O  O     . ARG B 1  194  ? 2.632   -18.531 12.024   1.00 161.94 ? 182  ARG B O     1 
ATOM   3058  C  CB    . ARG B 1  194  ? 1.642   -17.212 9.571    1.00 148.96 ? 182  ARG B CB    1 
ATOM   3059  C  CG    . ARG B 1  194  ? 2.773   -16.276 9.926    1.00 148.15 ? 182  ARG B CG    1 
ATOM   3060  C  CD    . ARG B 1  194  ? 3.529   -15.784 8.713    1.00 121.76 ? 182  ARG B CD    1 
ATOM   3061  N  NE    . ARG B 1  194  ? 4.631   -14.924 9.126    1.00 132.04 ? 182  ARG B NE    1 
ATOM   3062  C  CZ    . ARG B 1  194  ? 5.833   -15.370 9.475    1.00 128.81 ? 182  ARG B CZ    1 
ATOM   3063  N  NH1   . ARG B 1  194  ? 6.776   -14.515 9.848    1.00 105.11 ? 182  ARG B NH1   1 
ATOM   3064  N  NH2   . ARG B 1  194  ? 6.095   -16.669 9.445    1.00 131.59 ? 182  ARG B NH2   1 
ATOM   3065  N  N     . VAL B 1  195  ? 0.761   -19.785 11.846   1.00 140.70 ? 183  VAL B N     1 
ATOM   3066  C  CA    . VAL B 1  195  ? 1.344   -20.926 12.544   1.00 157.67 ? 183  VAL B CA    1 
ATOM   3067  C  C     . VAL B 1  195  ? 2.174   -21.767 11.589   1.00 170.23 ? 183  VAL B C     1 
ATOM   3068  O  O     . VAL B 1  195  ? 3.358   -22.028 11.828   1.00 181.39 ? 183  VAL B O     1 
ATOM   3069  C  CB    . VAL B 1  195  ? 0.239   -21.772 13.199   1.00 137.14 ? 183  VAL B CB    1 
ATOM   3070  C  CG1   . VAL B 1  195  ? 0.820   -23.061 13.759   1.00 125.46 ? 183  VAL B CG1   1 
ATOM   3071  C  CG2   . VAL B 1  195  ? -0.446  -20.983 14.274   1.00 149.98 ? 183  VAL B CG2   1 
ATOM   3072  N  N     . GLU B 1  196  ? 1.554   -22.208 10.484   1.00 149.35 ? 184  GLU B N     1 
ATOM   3073  C  CA    . GLU B 1  196  ? 2.158   -23.127 9.532    1.00 144.25 ? 184  GLU B CA    1 
ATOM   3074  C  C     . GLU B 1  196  ? 1.809   -22.669 8.113    1.00 147.47 ? 184  GLU B C     1 
ATOM   3075  O  O     . GLU B 1  196  ? 0.975   -23.261 7.429    1.00 176.98 ? 184  GLU B O     1 
ATOM   3076  C  CB    . GLU B 1  196  ? 1.694   -24.560 9.789    1.00 149.97 ? 184  GLU B CB    1 
ATOM   3077  C  CG    . GLU B 1  196  ? 2.482   -25.277 10.866   1.00 147.82 ? 184  GLU B CG    1 
ATOM   3078  C  CD    . GLU B 1  196  ? 3.531   -26.199 10.284   1.00 155.11 ? 184  GLU B CD    1 
ATOM   3079  O  OE1   . GLU B 1  196  ? 3.837   -27.228 10.921   1.00 141.96 ? 184  GLU B OE1   1 
ATOM   3080  O  OE2   . GLU B 1  196  ? 4.035   -25.901 9.181    1.00 160.70 ? 184  GLU B OE2   1 
ATOM   3081  N  N     . GLN B 1  197  ? 2.453   -21.591 7.670    1.00 131.59 ? 185  GLN B N     1 
ATOM   3082  C  CA    . GLN B 1  197  ? 2.309   -21.039 6.326    1.00 151.24 ? 185  GLN B CA    1 
ATOM   3083  C  C     . GLN B 1  197  ? 0.865   -20.664 5.991    1.00 160.51 ? 185  GLN B C     1 
ATOM   3084  O  O     . GLN B 1  197  ? 0.537   -20.463 4.815    1.00 139.18 ? 185  GLN B O     1 
ATOM   3085  C  CB    . GLN B 1  197  ? 2.873   -22.004 5.273    1.00 132.16 ? 185  GLN B CB    1 
ATOM   3086  C  CG    . GLN B 1  197  ? 4.361   -22.293 5.464    1.00 125.91 ? 185  GLN B CG    1 
ATOM   3087  C  CD    . GLN B 1  197  ? 4.769   -23.678 4.995    1.00 130.63 ? 185  GLN B CD    1 
ATOM   3088  O  OE1   . GLN B 1  197  ? 3.937   -24.474 4.560    1.00 142.11 ? 185  GLN B OE1   1 
ATOM   3089  N  NE2   . GLN B 1  197  ? 6.061   -23.975 5.089    1.00 121.58 ? 185  GLN B NE2   1 
ATOM   3090  N  N     . ARG B 1  198  ? -0.001  -20.573 6.997    1.00 160.45 ? 186  ARG B N     1 
ATOM   3091  C  CA    . ARG B 1  198  ? -1.380  -20.129 6.849    1.00 150.35 ? 186  ARG B CA    1 
ATOM   3092  C  C     . ARG B 1  198  ? -1.524  -18.807 7.589    1.00 130.27 ? 186  ARG B C     1 
ATOM   3093  O  O     . ARG B 1  198  ? -1.273  -18.742 8.797    1.00 142.80 ? 186  ARG B O     1 
ATOM   3094  C  CB    . ARG B 1  198  ? -2.357  -21.166 7.410    1.00 154.12 ? 186  ARG B CB    1 
ATOM   3095  C  CG    . ARG B 1  198  ? -2.348  -22.504 6.693    1.00 175.67 ? 186  ARG B CG    1 
ATOM   3096  C  CD    . ARG B 1  198  ? -3.320  -22.515 5.521    1.00 192.76 ? 186  ARG B CD    1 
ATOM   3097  N  NE    . ARG B 1  198  ? -4.716  -22.635 5.942    1.00 189.74 ? 186  ARG B NE    1 
ATOM   3098  C  CZ    . ARG B 1  198  ? -5.550  -21.610 6.093    1.00 159.55 ? 186  ARG B CZ    1 
ATOM   3099  N  NH1   . ARG B 1  198  ? -5.136  -20.372 5.861    1.00 144.28 ? 186  ARG B NH1   1 
ATOM   3100  N  NH2   . ARG B 1  198  ? -6.803  -21.824 6.474    1.00 139.26 ? 186  ARG B NH2   1 
ATOM   3101  N  N     . THR B 1  199  ? -1.925  -17.759 6.874    1.00 126.73 ? 187  THR B N     1 
ATOM   3102  C  CA    . THR B 1  199  ? -2.006  -16.421 7.447    1.00 149.42 ? 187  THR B CA    1 
ATOM   3103  C  C     . THR B 1  199  ? -3.349  -16.131 8.102    1.00 146.05 ? 187  THR B C     1 
ATOM   3104  O  O     . THR B 1  199  ? -3.578  -15.000 8.540    1.00 138.71 ? 187  THR B O     1 
ATOM   3105  C  CB    . THR B 1  199  ? -1.729  -15.366 6.375    1.00 140.92 ? 187  THR B CB    1 
ATOM   3106  O  OG1   . THR B 1  199  ? -1.822  -14.055 6.951    1.00 144.37 ? 187  THR B OG1   1 
ATOM   3107  C  CG2   . THR B 1  199  ? -2.739  -15.485 5.255    1.00 136.16 ? 187  THR B CG2   1 
ATOM   3108  N  N     . ASP B 1  200  ? -4.239  -17.117 8.186    1.00 137.20 ? 188  ASP B N     1 
ATOM   3109  C  CA    . ASP B 1  200  ? -5.583  -16.874 8.686    1.00 138.68 ? 188  ASP B CA    1 
ATOM   3110  C  C     . ASP B 1  200  ? -5.746  -17.148 10.177   1.00 138.20 ? 188  ASP B C     1 
ATOM   3111  O  O     . ASP B 1  200  ? -6.760  -16.739 10.750   1.00 140.32 ? 188  ASP B O     1 
ATOM   3112  C  CB    . ASP B 1  200  ? -6.595  -17.710 7.891    1.00 151.44 ? 188  ASP B CB    1 
ATOM   3113  C  CG    . ASP B 1  200  ? -6.870  -17.134 6.512    1.00 190.34 ? 188  ASP B CG    1 
ATOM   3114  O  OD1   . ASP B 1  200  ? -6.713  -15.906 6.342    1.00 211.06 ? 188  ASP B OD1   1 
ATOM   3115  O  OD2   . ASP B 1  200  ? -7.247  -17.902 5.601    1.00 184.32 ? 188  ASP B OD2   1 
ATOM   3116  N  N     . PHE B 1  201  ? -4.782  -17.808 10.820   1.00 138.38 ? 189  PHE B N     1 
ATOM   3117  C  CA    . PHE B 1  201  ? -4.907  -18.107 12.244   1.00 125.42 ? 189  PHE B CA    1 
ATOM   3118  C  C     . PHE B 1  201  ? -5.070  -16.821 13.049   1.00 120.76 ? 189  PHE B C     1 
ATOM   3119  O  O     . PHE B 1  201  ? -4.301  -15.869 12.887   1.00 115.25 ? 189  PHE B O     1 
ATOM   3120  C  CB    . PHE B 1  201  ? -3.689  -18.898 12.729   1.00 114.16 ? 189  PHE B CB    1 
ATOM   3121  C  CG    . PHE B 1  201  ? -3.741  -20.364 12.393   1.00 115.33 ? 189  PHE B CG    1 
ATOM   3122  C  CD1   . PHE B 1  201  ? -3.766  -20.790 11.075   1.00 140.18 ? 189  PHE B CD1   1 
ATOM   3123  C  CD2   . PHE B 1  201  ? -3.758  -21.317 13.399   1.00 103.42 ? 189  PHE B CD2   1 
ATOM   3124  C  CE1   . PHE B 1  201  ? -3.815  -22.138 10.767   1.00 145.35 ? 189  PHE B CE1   1 
ATOM   3125  C  CE2   . PHE B 1  201  ? -3.802  -22.666 13.098   1.00 91.82  ? 189  PHE B CE2   1 
ATOM   3126  C  CZ    . PHE B 1  201  ? -3.831  -23.076 11.781   1.00 135.16 ? 189  PHE B CZ    1 
ATOM   3127  N  N     . ASP B 1  202  ? -6.085  -16.791 13.912   1.00 119.78 ? 190  ASP B N     1 
ATOM   3128  C  CA    . ASP B 1  202  ? -6.452  -15.579 14.636   1.00 110.97 ? 190  ASP B CA    1 
ATOM   3129  C  C     . ASP B 1  202  ? -5.643  -15.418 15.917   1.00 95.57  ? 190  ASP B C     1 
ATOM   3130  O  O     . ASP B 1  202  ? -5.326  -16.397 16.598   1.00 76.54  ? 190  ASP B O     1 
ATOM   3131  C  CB    . ASP B 1  202  ? -7.944  -15.584 14.975   1.00 99.13  ? 190  ASP B CB    1 
ATOM   3132  C  CG    . ASP B 1  202  ? -8.813  -15.311 13.769   1.00 102.00 ? 190  ASP B CG    1 
ATOM   3133  O  OD1   . ASP B 1  202  ? -8.248  -15.108 12.675   1.00 113.16 ? 190  ASP B OD1   1 
ATOM   3134  O  OD2   . ASP B 1  202  ? -10.055 -15.295 13.913   1.00 86.35  ? 190  ASP B OD2   1 
ATOM   3135  N  N     . LYS B 1  203  ? -5.322  -14.166 16.244   1.00 98.26  ? 191  LYS B N     1 
ATOM   3136  C  CA    . LYS B 1  203  ? -4.696  -13.801 17.510   1.00 90.82  ? 191  LYS B CA    1 
ATOM   3137  C  C     . LYS B 1  203  ? -5.592  -12.790 18.209   1.00 89.96  ? 191  LYS B C     1 
ATOM   3138  O  O     . LYS B 1  203  ? -5.866  -11.717 17.661   1.00 67.75  ? 191  LYS B O     1 
ATOM   3139  C  CB    . LYS B 1  203  ? -3.296  -13.218 17.298   1.00 90.60  ? 191  LYS B CB    1 
ATOM   3140  C  CG    . LYS B 1  203  ? -2.556  -12.918 18.595   1.00 82.97  ? 191  LYS B CG    1 
ATOM   3141  C  CD    . LYS B 1  203  ? -1.207  -12.263 18.340   1.00 82.63  ? 191  LYS B CD    1 
ATOM   3142  C  CE    . LYS B 1  203  ? -1.366  -10.820 17.888   1.00 61.69  ? 191  LYS B CE    1 
ATOM   3143  N  NZ    . LYS B 1  203  ? -0.051  -10.133 17.747   1.00 74.98  ? 191  LYS B NZ    1 
ATOM   3144  N  N     . LEU B 1  204  ? -6.042  -13.126 19.414   1.00 99.84  ? 192  LEU B N     1 
ATOM   3145  C  CA    . LEU B 1  204  ? -6.980  -12.293 20.155   1.00 81.86  ? 192  LEU B CA    1 
ATOM   3146  C  C     . LEU B 1  204  ? -6.229  -11.438 21.168   1.00 80.18  ? 192  LEU B C     1 
ATOM   3147  O  O     . LEU B 1  204  ? -5.348  -11.936 21.876   1.00 64.90  ? 192  LEU B O     1 
ATOM   3148  C  CB    . LEU B 1  204  ? -8.032  -13.152 20.858   1.00 57.36  ? 192  LEU B CB    1 
ATOM   3149  C  CG    . LEU B 1  204  ? -9.025  -12.405 21.748   1.00 67.50  ? 192  LEU B CG    1 
ATOM   3150  C  CD1   . LEU B 1  204  ? -9.742  -11.322 20.959   1.00 70.09  ? 192  LEU B CD1   1 
ATOM   3151  C  CD2   . LEU B 1  204  ? -10.020 -13.370 22.362   1.00 56.99  ? 192  LEU B CD2   1 
ATOM   3152  N  N     . ILE B 1  205  ? -6.582  -10.157 21.232   1.00 87.30  ? 193  ILE B N     1 
ATOM   3153  C  CA    . ILE B 1  205  ? -5.947  -9.196  22.127   1.00 76.16  ? 193  ILE B CA    1 
ATOM   3154  C  C     . ILE B 1  205  ? -7.027  -8.599  23.020   1.00 83.90  ? 193  ILE B C     1 
ATOM   3155  O  O     . ILE B 1  205  ? -8.002  -8.022  22.522   1.00 79.37  ? 193  ILE B O     1 
ATOM   3156  C  CB    . ILE B 1  205  ? -5.208  -8.096  21.350   1.00 66.96  ? 193  ILE B CB    1 
ATOM   3157  C  CG1   . ILE B 1  205  ? -4.249  -8.714  20.328   1.00 86.04  ? 193  ILE B CG1   1 
ATOM   3158  C  CG2   . ILE B 1  205  ? -4.463  -7.177  22.307   1.00 74.44  ? 193  ILE B CG2   1 
ATOM   3159  C  CD1   . ILE B 1  205  ? -3.588  -7.701  19.419   1.00 98.83  ? 193  ILE B CD1   1 
ATOM   3160  N  N     . LEU B 1  206  ? -6.855  -8.735  24.332   1.00 86.09  ? 194  LEU B N     1 
ATOM   3161  C  CA    . LEU B 1  206  ? -7.799  -8.219  25.314   1.00 66.70  ? 194  LEU B CA    1 
ATOM   3162  C  C     . LEU B 1  206  ? -7.148  -7.105  26.122   1.00 81.08  ? 194  LEU B C     1 
ATOM   3163  O  O     . LEU B 1  206  ? -6.019  -7.257  26.599   1.00 78.98  ? 194  LEU B O     1 
ATOM   3164  C  CB    . LEU B 1  206  ? -8.284  -9.328  26.250   1.00 61.18  ? 194  LEU B CB    1 
ATOM   3165  C  CG    . LEU B 1  206  ? -9.561  -10.062 25.843   1.00 59.93  ? 194  LEU B CG    1 
ATOM   3166  C  CD1   . LEU B 1  206  ? -9.896  -11.145 26.854   1.00 45.77  ? 194  LEU B CD1   1 
ATOM   3167  C  CD2   . LEU B 1  206  ? -10.712 -9.081  25.710   1.00 64.27  ? 194  LEU B CD2   1 
ATOM   3168  N  N     . ASP B 1  207  ? -7.864  -5.993  26.277   1.00 92.23  ? 195  ASP B N     1 
ATOM   3169  C  CA    . ASP B 1  207  ? -7.418  -4.854  27.073   1.00 96.69  ? 195  ASP B CA    1 
ATOM   3170  C  C     . ASP B 1  207  ? -8.445  -4.630  28.176   1.00 94.90  ? 195  ASP B C     1 
ATOM   3171  O  O     . ASP B 1  207  ? -9.579  -4.225  27.899   1.00 91.12  ? 195  ASP B O     1 
ATOM   3172  C  CB    . ASP B 1  207  ? -7.252  -3.607  26.201   1.00 114.07 ? 195  ASP B CB    1 
ATOM   3173  C  CG    . ASP B 1  207  ? -6.666  -2.426  26.961   1.00 106.06 ? 195  ASP B CG    1 
ATOM   3174  O  OD1   . ASP B 1  207  ? -7.242  -2.018  27.992   1.00 100.02 ? 195  ASP B OD1   1 
ATOM   3175  O  OD2   . ASP B 1  207  ? -5.621  -1.902  26.522   1.00 117.34 ? 195  ASP B OD2   1 
ATOM   3176  N  N     . VAL B 1  208  ? -8.051  -4.887  29.421   1.00 94.45  ? 196  VAL B N     1 
ATOM   3177  C  CA    . VAL B 1  208  ? -8.950  -4.813  30.567   1.00 75.49  ? 196  VAL B CA    1 
ATOM   3178  C  C     . VAL B 1  208  ? -8.432  -3.746  31.520   1.00 85.78  ? 196  VAL B C     1 
ATOM   3179  O  O     . VAL B 1  208  ? -7.312  -3.857  32.036   1.00 93.52  ? 196  VAL B O     1 
ATOM   3180  C  CB    . VAL B 1  208  ? -9.074  -6.168  31.283   1.00 63.01  ? 196  VAL B CB    1 
ATOM   3181  C  CG1   . VAL B 1  208  ? -10.024 -6.063  32.472   1.00 88.06  ? 196  VAL B CG1   1 
ATOM   3182  C  CG2   . VAL B 1  208  ? -9.535  -7.246  30.312   1.00 79.99  ? 196  VAL B CG2   1 
ATOM   3183  N  N     . GLU B 1  209  ? -9.240  -2.716  31.752   1.00 103.17 ? 197  GLU B N     1 
ATOM   3184  C  CA    . GLU B 1  209  ? -8.982  -1.724  32.787   1.00 111.40 ? 197  GLU B CA    1 
ATOM   3185  C  C     . GLU B 1  209  ? -9.951  -1.963  33.936   1.00 102.93 ? 197  GLU B C     1 
ATOM   3186  O  O     . GLU B 1  209  ? -11.169 -1.992  33.731   1.00 100.25 ? 197  GLU B O     1 
ATOM   3187  C  CB    . GLU B 1  209  ? -9.130  -0.299  32.250   1.00 125.55 ? 197  GLU B CB    1 
ATOM   3188  C  CG    . GLU B 1  209  ? -8.959  0.770   33.317   1.00 128.29 ? 197  GLU B CG    1 
ATOM   3189  C  CD    . GLU B 1  209  ? -9.033  2.177   32.760   1.00 168.20 ? 197  GLU B CD    1 
ATOM   3190  O  OE1   . GLU B 1  209  ? -8.910  2.340   31.527   1.00 183.20 ? 197  GLU B OE1   1 
ATOM   3191  O  OE2   . GLU B 1  209  ? -9.215  3.121   33.558   1.00 151.52 ? 197  GLU B OE2   1 
ATOM   3192  N  N     . THR B 1  210  ? -9.410  -2.137  35.138   1.00 96.41  ? 198  THR B N     1 
ATOM   3193  C  CA    . THR B 1  210  ? -10.195 -2.528  36.297   1.00 87.55  ? 198  THR B CA    1 
ATOM   3194  C  C     . THR B 1  210  ? -9.966  -1.547  37.437   1.00 99.75  ? 198  THR B C     1 
ATOM   3195  O  O     . THR B 1  210  ? -9.031  -0.742  37.423   1.00 104.49 ? 198  THR B O     1 
ATOM   3196  C  CB    . THR B 1  210  ? -9.839  -3.948  36.760   1.00 91.49  ? 198  THR B CB    1 
ATOM   3197  O  OG1   . THR B 1  210  ? -10.589 -4.273  37.936   1.00 114.83 ? 198  THR B OG1   1 
ATOM   3198  C  CG2   . THR B 1  210  ? -8.353  -4.043  37.071   1.00 99.91  ? 198  THR B CG2   1 
ATOM   3199  N  N     . LYS B 1  211  ? -10.844 -1.624  38.433   1.00 112.89 ? 199  LYS B N     1 
ATOM   3200  C  CA    . LYS B 1  211  ? -10.628 -0.905  39.675   1.00 113.44 ? 199  LYS B CA    1 
ATOM   3201  C  C     . LYS B 1  211  ? -9.553  -1.612  40.500   1.00 117.65 ? 199  LYS B C     1 
ATOM   3202  O  O     . LYS B 1  211  ? -9.073  -2.695  40.150   1.00 124.37 ? 199  LYS B O     1 
ATOM   3203  C  CB    . LYS B 1  211  ? -11.938 -0.788  40.458   1.00 96.80  ? 199  LYS B CB    1 
ATOM   3204  C  CG    . LYS B 1  211  ? -12.982 0.083   39.772   1.00 98.75  ? 199  LYS B CG    1 
ATOM   3205  C  CD    . LYS B 1  211  ? -14.293 0.152   40.546   1.00 88.05  ? 199  LYS B CD    1 
ATOM   3206  C  CE    . LYS B 1  211  ? -15.093 -1.132  40.436   1.00 73.24  ? 199  LYS B CE    1 
ATOM   3207  N  NZ    . LYS B 1  211  ? -16.462 -0.984  41.009   1.00 72.89  ? 199  LYS B NZ    1 
ATOM   3208  N  N     . ASN B 1  212  ? -9.165  -0.983  41.606   1.00 106.81 ? 200  ASN B N     1 
ATOM   3209  C  CA    . ASN B 1  212  ? -8.150  -1.556  42.482   1.00 106.96 ? 200  ASN B CA    1 
ATOM   3210  C  C     . ASN B 1  212  ? -8.706  -2.627  43.413   1.00 97.14  ? 200  ASN B C     1 
ATOM   3211  O  O     . ASN B 1  212  ? -8.001  -3.051  44.336   1.00 88.77  ? 200  ASN B O     1 
ATOM   3212  C  CB    . ASN B 1  212  ? -7.468  -0.453  43.297   1.00 91.64  ? 200  ASN B CB    1 
ATOM   3213  C  CG    . ASN B 1  212  ? -8.442  0.593   43.797   1.00 113.71 ? 200  ASN B CG    1 
ATOM   3214  O  OD1   . ASN B 1  212  ? -9.649  0.361   43.851   1.00 118.12 ? 200  ASN B OD1   1 
ATOM   3215  N  ND2   . ASN B 1  212  ? -7.919  1.758   44.164   1.00 131.33 ? 200  ASN B ND2   1 
ATOM   3216  N  N     . SER B 1  213  ? -9.946  -3.071  43.195   1.00 93.26  ? 201  SER B N     1 
ATOM   3217  C  CA    . SER B 1  213  ? -10.482 -4.175  43.983   1.00 90.44  ? 201  SER B CA    1 
ATOM   3218  C  C     . SER B 1  213  ? -9.778  -5.482  43.641   1.00 105.78 ? 201  SER B C     1 
ATOM   3219  O  O     . SER B 1  213  ? -9.463  -6.278  44.535   1.00 116.28 ? 201  SER B O     1 
ATOM   3220  C  CB    . SER B 1  213  ? -11.989 -4.298  43.754   1.00 82.36  ? 201  SER B CB    1 
ATOM   3221  O  OG    . SER B 1  213  ? -12.643 -3.058  43.959   1.00 85.55  ? 201  SER B OG    1 
ATOM   3222  N  N     . ILE B 1  214  ? -9.519  -5.714  42.350   1.00 116.79 ? 202  ILE B N     1 
ATOM   3223  C  CA    . ILE B 1  214  ? -8.800  -6.891  41.876   1.00 122.02 ? 202  ILE B CA    1 
ATOM   3224  C  C     . ILE B 1  214  ? -7.954  -6.502  40.672   1.00 107.46 ? 202  ILE B C     1 
ATOM   3225  O  O     . ILE B 1  214  ? -8.251  -5.543  39.957   1.00 85.50  ? 202  ILE B O     1 
ATOM   3226  C  CB    . ILE B 1  214  ? -9.744  -8.059  41.507   1.00 106.78 ? 202  ILE B CB    1 
ATOM   3227  C  CG1   . ILE B 1  214  ? -11.056 -7.547  40.899   1.00 88.76  ? 202  ILE B CG1   1 
ATOM   3228  C  CG2   . ILE B 1  214  ? -10.024 -8.919  42.722   1.00 123.69 ? 202  ILE B CG2   1 
ATOM   3229  C  CD1   . ILE B 1  214  ? -10.995 -7.226  39.417   1.00 78.46  ? 202  ILE B CD1   1 
ATOM   3230  N  N     . SER B 1  215  ? -6.898  -7.273  40.448   1.00 119.95 ? 203  SER B N     1 
ATOM   3231  C  CA    . SER B 1  215  ? -6.028  -7.062  39.306   1.00 120.80 ? 203  SER B CA    1 
ATOM   3232  C  C     . SER B 1  215  ? -6.660  -7.644  38.044   1.00 108.85 ? 203  SER B C     1 
ATOM   3233  O  O     . SER B 1  215  ? -7.607  -8.431  38.121   1.00 105.43 ? 203  SER B O     1 
ATOM   3234  C  CB    . SER B 1  215  ? -4.668  -7.702  39.567   1.00 124.91 ? 203  SER B CB    1 
ATOM   3235  O  OG    . SER B 1  215  ? -4.790  -9.104  39.724   1.00 115.51 ? 203  SER B OG    1 
ATOM   3236  N  N     . PRO B 1  216  ? -6.171  -7.254  36.863   1.00 93.55  ? 204  PRO B N     1 
ATOM   3237  C  CA    . PRO B 1  216  ? -6.714  -7.845  35.628   1.00 79.71  ? 204  PRO B CA    1 
ATOM   3238  C  C     . PRO B 1  216  ? -6.545  -9.352  35.545   1.00 88.45  ? 204  PRO B C     1 
ATOM   3239  O  O     . PRO B 1  216  ? -7.373  -10.021 34.913   1.00 93.59  ? 204  PRO B O     1 
ATOM   3240  C  CB    . PRO B 1  216  ? -5.926  -7.128  34.523   1.00 105.90 ? 204  PRO B CB    1 
ATOM   3241  C  CG    . PRO B 1  216  ? -5.528  -5.829  35.132   1.00 109.99 ? 204  PRO B CG    1 
ATOM   3242  C  CD    . PRO B 1  216  ? -5.267  -6.124  36.580   1.00 104.35 ? 204  PRO B CD    1 
ATOM   3243  N  N     . ARG B 1  217  ? -5.500  -9.909  36.164   1.00 95.09  ? 205  ARG B N     1 
ATOM   3244  C  CA    . ARG B 1  217  ? -5.284  -11.353 36.115   1.00 88.64  ? 205  ARG B CA    1 
ATOM   3245  C  C     . ARG B 1  217  ? -6.459  -12.108 36.723   1.00 93.33  ? 205  ARG B C     1 
ATOM   3246  O  O     . ARG B 1  217  ? -7.024  -13.013 36.098   1.00 82.37  ? 205  ARG B O     1 
ATOM   3247  C  CB    . ARG B 1  217  ? -3.990  -11.717 36.843   1.00 94.29  ? 205  ARG B CB    1 
ATOM   3248  C  CG    . ARG B 1  217  ? -2.750  -11.049 36.294   1.00 93.28  ? 205  ARG B CG    1 
ATOM   3249  C  CD    . ARG B 1  217  ? -1.520  -11.419 37.108   1.00 120.27 ? 205  ARG B CD    1 
ATOM   3250  N  NE    . ARG B 1  217  ? -0.292  -10.895 36.518   1.00 135.83 ? 205  ARG B NE    1 
ATOM   3251  C  CZ    . ARG B 1  217  ? 0.144   -9.650  36.681   1.00 130.34 ? 205  ARG B CZ    1 
ATOM   3252  N  NH1   . ARG B 1  217  ? 1.275   -9.263  36.108   1.00 139.09 ? 205  ARG B NH1   1 
ATOM   3253  N  NH2   . ARG B 1  217  ? -0.552  -8.791  37.413   1.00 109.24 ? 205  ARG B NH2   1 
ATOM   3254  N  N     . ASP B 1  218  ? -6.838  -11.749 37.952   1.00 113.45 ? 206  ASP B N     1 
ATOM   3255  C  CA    . ASP B 1  218  ? -7.910  -12.465 38.633   1.00 103.11 ? 206  ASP B CA    1 
ATOM   3256  C  C     . ASP B 1  218  ? -9.268  -12.179 38.005   1.00 97.73  ? 206  ASP B C     1 
ATOM   3257  O  O     . ASP B 1  218  ? -10.148 -13.047 38.018   1.00 92.59  ? 206  ASP B O     1 
ATOM   3258  C  CB    . ASP B 1  218  ? -7.919  -12.105 40.118   1.00 109.93 ? 206  ASP B CB    1 
ATOM   3259  C  CG    . ASP B 1  218  ? -6.677  -12.592 40.843   1.00 131.67 ? 206  ASP B CG    1 
ATOM   3260  O  OD1   . ASP B 1  218  ? -5.601  -11.982 40.663   1.00 127.86 ? 206  ASP B OD1   1 
ATOM   3261  O  OD2   . ASP B 1  218  ? -6.776  -13.585 41.594   1.00 162.99 ? 206  ASP B OD2   1 
ATOM   3262  N  N     . ALA B 1  219  ? -9.460  -10.976 37.457   1.00 99.59  ? 207  ALA B N     1 
ATOM   3263  C  CA    . ALA B 1  219  ? -10.703 -10.679 36.752   1.00 87.72  ? 207  ALA B CA    1 
ATOM   3264  C  C     . ALA B 1  219  ? -10.887 -11.606 35.558   1.00 87.16  ? 207  ALA B C     1 
ATOM   3265  O  O     . ALA B 1  219  ? -11.989 -12.114 35.319   1.00 81.42  ? 207  ALA B O     1 
ATOM   3266  C  CB    . ALA B 1  219  ? -10.719 -9.216  36.306   1.00 78.37  ? 207  ALA B CB    1 
ATOM   3267  N  N     . LEU B 1  220  ? -9.811  -11.850 34.805   1.00 102.35 ? 208  LEU B N     1 
ATOM   3268  C  CA    . LEU B 1  220  ? -9.888  -12.755 33.663   1.00 96.52  ? 208  LEU B CA    1 
ATOM   3269  C  C     . LEU B 1  220  ? -10.065 -14.201 34.112   1.00 92.08  ? 208  LEU B C     1 
ATOM   3270  O  O     . LEU B 1  220  ? -10.879 -14.937 33.541   1.00 91.20  ? 208  LEU B O     1 
ATOM   3271  C  CB    . LEU B 1  220  ? -8.639  -12.603 32.795   1.00 75.22  ? 208  LEU B CB    1 
ATOM   3272  C  CG    . LEU B 1  220  ? -8.551  -13.477 31.545   1.00 64.45  ? 208  LEU B CG    1 
ATOM   3273  C  CD1   . LEU B 1  220  ? -9.730  -13.215 30.620   1.00 85.46  ? 208  LEU B CD1   1 
ATOM   3274  C  CD2   . LEU B 1  220  ? -7.235  -13.244 30.821   1.00 69.16  ? 208  LEU B CD2   1 
ATOM   3275  N  N     . ALA B 1  221  ? -9.313  -14.627 35.132   1.00 83.61  ? 209  ALA B N     1 
ATOM   3276  C  CA    . ALA B 1  221  ? -9.467  -15.982 35.658   1.00 86.53  ? 209  ALA B CA    1 
ATOM   3277  C  C     . ALA B 1  221  ? -10.872 -16.220 36.196   1.00 93.90  ? 209  ALA B C     1 
ATOM   3278  O  O     . ALA B 1  221  ? -11.398 -17.334 36.086   1.00 99.20  ? 209  ALA B O     1 
ATOM   3279  C  CB    . ALA B 1  221  ? -8.431  -16.242 36.751   1.00 116.14 ? 209  ALA B CB    1 
ATOM   3280  N  N     . SER B 1  222  ? -11.489 -15.193 36.787   1.00 99.44  ? 210  SER B N     1 
ATOM   3281  C  CA    . SER B 1  222  ? -12.878 -15.309 37.223   1.00 107.78 ? 210  SER B CA    1 
ATOM   3282  C  C     . SER B 1  222  ? -13.814 -15.502 36.038   1.00 104.74 ? 210  SER B C     1 
ATOM   3283  O  O     . SER B 1  222  ? -14.729 -16.331 36.093   1.00 103.83 ? 210  SER B O     1 
ATOM   3284  C  CB    . SER B 1  222  ? -13.282 -14.074 38.027   1.00 99.04  ? 210  SER B CB    1 
ATOM   3285  O  OG    . SER B 1  222  ? -14.671 -13.819 37.911   1.00 93.56  ? 210  SER B OG    1 
ATOM   3286  N  N     . ALA B 1  223  ? -13.607 -14.737 34.962   1.00 108.08 ? 211  ALA B N     1 
ATOM   3287  C  CA    . ALA B 1  223  ? -14.442 -14.884 33.774   1.00 108.34 ? 211  ALA B CA    1 
ATOM   3288  C  C     . ALA B 1  223  ? -14.270 -16.254 33.134   1.00 97.40  ? 211  ALA B C     1 
ATOM   3289  O  O     . ALA B 1  223  ? -15.231 -16.809 32.587   1.00 92.62  ? 211  ALA B O     1 
ATOM   3290  C  CB    . ALA B 1  223  ? -14.119 -13.785 32.762   1.00 74.90  ? 211  ALA B CB    1 
ATOM   3291  N  N     . GLY B 1  224  ? -13.060 -16.812 33.187   1.00 95.30  ? 212  GLY B N     1 
ATOM   3292  C  CA    . GLY B 1  224  ? -12.844 -18.137 32.629   1.00 101.69 ? 212  GLY B CA    1 
ATOM   3293  C  C     . GLY B 1  224  ? -13.593 -19.215 33.387   1.00 89.26  ? 212  GLY B C     1 
ATOM   3294  O  O     . GLY B 1  224  ? -14.194 -20.107 32.782   1.00 86.18  ? 212  GLY B O     1 
ATOM   3295  N  N     . LYS B 1  225  ? -13.575 -19.143 34.720   1.00 91.02  ? 213  LYS B N     1 
ATOM   3296  C  CA    . LYS B 1  225  ? -14.289 -20.123 35.534   1.00 105.50 ? 213  LYS B CA    1 
ATOM   3297  C  C     . LYS B 1  225  ? -15.785 -20.089 35.250   1.00 103.75 ? 213  LYS B C     1 
ATOM   3298  O  O     . LYS B 1  225  ? -16.410 -21.131 35.017   1.00 108.38 ? 213  LYS B O     1 
ATOM   3299  C  CB    . LYS B 1  225  ? -14.021 -19.865 37.017   1.00 124.15 ? 213  LYS B CB    1 
ATOM   3300  C  CG    . LYS B 1  225  ? -14.649 -20.893 37.943   1.00 121.74 ? 213  LYS B CG    1 
ATOM   3301  C  CD    . LYS B 1  225  ? -14.675 -20.406 39.382   1.00 117.88 ? 213  LYS B CD    1 
ATOM   3302  C  CE    . LYS B 1  225  ? -13.290 -20.003 39.860   1.00 124.38 ? 213  LYS B CE    1 
ATOM   3303  N  NZ    . LYS B 1  225  ? -13.314 -19.507 41.264   1.00 104.91 ? 213  LYS B NZ    1 
ATOM   3304  N  N     . THR B 1  226  ? -16.379 -18.892 35.264   1.00 101.77 ? 214  THR B N     1 
ATOM   3305  C  CA    . THR B 1  226  ? -17.813 -18.758 35.035   1.00 107.08 ? 214  THR B CA    1 
ATOM   3306  C  C     . THR B 1  226  ? -18.223 -19.151 33.621   1.00 78.44  ? 214  THR B C     1 
ATOM   3307  O  O     . THR B 1  226  ? -19.385 -19.517 33.409   1.00 74.06  ? 214  THR B O     1 
ATOM   3308  C  CB    . THR B 1  226  ? -18.261 -17.323 35.319   1.00 99.12  ? 214  THR B CB    1 
ATOM   3309  O  OG1   . THR B 1  226  ? -17.617 -16.431 34.401   1.00 91.57  ? 214  THR B OG1   1 
ATOM   3310  C  CG2   . THR B 1  226  ? -17.900 -16.924 36.741   1.00 102.86 ? 214  THR B CG2   1 
ATOM   3311  N  N     . LEU B 1  227  ? -17.307 -19.081 32.651   1.00 73.72  ? 215  LEU B N     1 
ATOM   3312  C  CA    . LEU B 1  227  ? -17.603 -19.509 31.286   1.00 75.60  ? 215  LEU B CA    1 
ATOM   3313  C  C     . LEU B 1  227  ? -17.449 -21.014 31.099   1.00 73.40  ? 215  LEU B C     1 
ATOM   3314  O  O     . LEU B 1  227  ? -18.270 -21.635 30.416   1.00 73.60  ? 215  LEU B O     1 
ATOM   3315  C  CB    . LEU B 1  227  ? -16.708 -18.767 30.293   1.00 87.58  ? 215  LEU B CB    1 
ATOM   3316  C  CG    . LEU B 1  227  ? -17.233 -17.386 29.904   1.00 67.59  ? 215  LEU B CG    1 
ATOM   3317  C  CD1   . LEU B 1  227  ? -16.147 -16.559 29.244   1.00 69.32  ? 215  LEU B CD1   1 
ATOM   3318  C  CD2   . LEU B 1  227  ? -18.451 -17.507 28.993   1.00 55.90  ? 215  LEU B CD2   1 
ATOM   3319  N  N     . VAL B 1  228  ? -16.405 -21.611 31.683   1.00 67.93  ? 216  VAL B N     1 
ATOM   3320  C  CA    . VAL B 1  228  ? -16.270 -23.066 31.657   1.00 61.81  ? 216  VAL B CA    1 
ATOM   3321  C  C     . VAL B 1  228  ? -17.474 -23.717 32.327   1.00 75.81  ? 216  VAL B C     1 
ATOM   3322  O  O     . VAL B 1  228  ? -17.986 -24.742 31.860   1.00 76.82  ? 216  VAL B O     1 
ATOM   3323  C  CB    . VAL B 1  228  ? -14.948 -23.495 32.321   1.00 70.06  ? 216  VAL B CB    1 
ATOM   3324  C  CG1   . VAL B 1  228  ? -14.882 -25.010 32.460   1.00 82.36  ? 216  VAL B CG1   1 
ATOM   3325  C  CG2   . VAL B 1  228  ? -13.758 -22.988 31.520   1.00 82.64  ? 216  VAL B CG2   1 
ATOM   3326  N  N     . GLU B 1  229  ? -17.946 -23.130 33.430   1.00 78.30  ? 217  GLU B N     1 
ATOM   3327  C  CA    . GLU B 1  229  ? -19.177 -23.606 34.053   1.00 91.37  ? 217  GLU B CA    1 
ATOM   3328  C  C     . GLU B 1  229  ? -20.366 -23.438 33.118   1.00 87.46  ? 217  GLU B C     1 
ATOM   3329  O  O     . GLU B 1  229  ? -21.250 -24.301 33.063   1.00 95.32  ? 217  GLU B O     1 
ATOM   3330  C  CB    . GLU B 1  229  ? -19.426 -22.861 35.365   1.00 106.20 ? 217  GLU B CB    1 
ATOM   3331  C  CG    . GLU B 1  229  ? -18.456 -23.207 36.477   1.00 146.03 ? 217  GLU B CG    1 
ATOM   3332  C  CD    . GLU B 1  229  ? -18.791 -22.504 37.777   1.00 174.75 ? 217  GLU B CD    1 
ATOM   3333  O  OE1   . GLU B 1  229  ? -18.994 -21.271 37.755   1.00 150.32 ? 217  GLU B OE1   1 
ATOM   3334  O  OE2   . GLU B 1  229  ? -18.863 -23.187 38.820   1.00 200.09 ? 217  GLU B OE2   1 
ATOM   3335  N  N     . LEU B 1  230  ? -20.404 -22.330 32.376   1.00 83.72  ? 218  LEU B N     1 
ATOM   3336  C  CA    . LEU B 1  230  ? -21.519 -22.071 31.472   1.00 77.85  ? 218  LEU B CA    1 
ATOM   3337  C  C     . LEU B 1  230  ? -21.558 -23.093 30.342   1.00 84.73  ? 218  LEU B C     1 
ATOM   3338  O  O     . LEU B 1  230  ? -22.569 -23.776 30.138   1.00 86.60  ? 218  LEU B O     1 
ATOM   3339  C  CB    . LEU B 1  230  ? -21.420 -20.648 30.921   1.00 59.38  ? 218  LEU B CB    1 
ATOM   3340  C  CG    . LEU B 1  230  ? -22.551 -19.708 31.339   1.00 68.00  ? 218  LEU B CG    1 
ATOM   3341  C  CD1   . LEU B 1  230  ? -22.257 -18.278 30.905   1.00 97.62  ? 218  LEU B CD1   1 
ATOM   3342  C  CD2   . LEU B 1  230  ? -23.872 -20.198 30.764   1.00 60.34  ? 218  LEU B CD2   1 
ATOM   3343  N  N     . PHE B 1  231  ? -20.459 -23.218 29.594   1.00 81.86  ? 219  PHE B N     1 
ATOM   3344  C  CA    . PHE B 1  231  ? -20.403 -24.207 28.525   1.00 63.42  ? 219  PHE B CA    1 
ATOM   3345  C  C     . PHE B 1  231  ? -20.299 -25.632 29.049   1.00 77.79  ? 219  PHE B C     1 
ATOM   3346  O  O     . PHE B 1  231  ? -20.468 -26.574 28.267   1.00 83.88  ? 219  PHE B O     1 
ATOM   3347  C  CB    . PHE B 1  231  ? -19.234 -23.906 27.590   1.00 66.49  ? 219  PHE B CB    1 
ATOM   3348  C  CG    . PHE B 1  231  ? -19.361 -22.594 26.880   1.00 66.81  ? 219  PHE B CG    1 
ATOM   3349  C  CD1   . PHE B 1  231  ? -20.314 -22.420 25.892   1.00 75.20  ? 219  PHE B CD1   1 
ATOM   3350  C  CD2   . PHE B 1  231  ? -18.536 -21.533 27.204   1.00 71.15  ? 219  PHE B CD2   1 
ATOM   3351  C  CE1   . PHE B 1  231  ? -20.442 -21.211 25.239   1.00 73.85  ? 219  PHE B CE1   1 
ATOM   3352  C  CE2   . PHE B 1  231  ? -18.660 -20.322 26.555   1.00 66.25  ? 219  PHE B CE2   1 
ATOM   3353  C  CZ    . PHE B 1  231  ? -19.610 -20.163 25.568   1.00 65.36  ? 219  PHE B CZ    1 
ATOM   3354  N  N     . GLY B 1  232  ? -20.021 -25.812 30.342   1.00 70.75  ? 220  GLY B N     1 
ATOM   3355  C  CA    . GLY B 1  232  ? -20.091 -27.140 30.922   1.00 85.81  ? 220  GLY B CA    1 
ATOM   3356  C  C     . GLY B 1  232  ? -21.483 -27.734 30.853   1.00 102.56 ? 220  GLY B C     1 
ATOM   3357  O  O     . GLY B 1  232  ? -21.637 -28.957 30.799   1.00 114.84 ? 220  GLY B O     1 
ATOM   3358  N  N     . LEU B 1  233  ? -22.512 -26.881 30.847   1.00 93.36  ? 221  LEU B N     1 
ATOM   3359  C  CA    . LEU B 1  233  ? -23.881 -27.367 30.706   1.00 95.64  ? 221  LEU B CA    1 
ATOM   3360  C  C     . LEU B 1  233  ? -24.072 -28.099 29.384   1.00 98.52  ? 221  LEU B C     1 
ATOM   3361  O  O     . LEU B 1  233  ? -24.722 -29.150 29.334   1.00 117.20 ? 221  LEU B O     1 
ATOM   3362  C  CB    . LEU B 1  233  ? -24.866 -26.202 30.821   1.00 84.67  ? 221  LEU B CB    1 
ATOM   3363  C  CG    . LEU B 1  233  ? -24.739 -25.305 32.055   1.00 101.59 ? 221  LEU B CG    1 
ATOM   3364  C  CD1   . LEU B 1  233  ? -25.818 -24.230 32.065   1.00 102.00 ? 221  LEU B CD1   1 
ATOM   3365  C  CD2   . LEU B 1  233  ? -24.795 -26.135 33.325   1.00 131.89 ? 221  LEU B CD2   1 
ATOM   3366  N  N     . ALA B 1  234  ? -23.512 -27.559 28.299   1.00 84.02  ? 222  ALA B N     1 
ATOM   3367  C  CA    . ALA B 1  234  ? -23.570 -28.254 27.018   1.00 81.17  ? 222  ALA B CA    1 
ATOM   3368  C  C     . ALA B 1  234  ? -22.675 -29.486 27.021   1.00 81.08  ? 222  ALA B C     1 
ATOM   3369  O  O     . ALA B 1  234  ? -23.043 -30.530 26.471   1.00 74.97  ? 222  ALA B O     1 
ATOM   3370  C  CB    . ALA B 1  234  ? -23.171 -27.308 25.887   1.00 77.50  ? 222  ALA B CB    1 
ATOM   3371  N  N     . ARG B 1  235  ? -21.495 -29.381 27.639   1.00 79.32  ? 223  ARG B N     1 
ATOM   3372  C  CA    . ARG B 1  235  ? -20.556 -30.497 27.649   1.00 87.76  ? 223  ARG B CA    1 
ATOM   3373  C  C     . ARG B 1  235  ? -21.148 -31.713 28.352   1.00 95.59  ? 223  ARG B C     1 
ATOM   3374  O  O     . ARG B 1  235  ? -20.893 -32.857 27.953   1.00 93.07  ? 223  ARG B O     1 
ATOM   3375  C  CB    . ARG B 1  235  ? -19.248 -30.060 28.315   1.00 92.36  ? 223  ARG B CB    1 
ATOM   3376  C  CG    . ARG B 1  235  ? -18.235 -31.169 28.544   1.00 96.64  ? 223  ARG B CG    1 
ATOM   3377  C  CD    . ARG B 1  235  ? -16.970 -30.610 29.182   1.00 90.64  ? 223  ARG B CD    1 
ATOM   3378  N  NE    . ARG B 1  235  ? -15.953 -31.635 29.398   1.00 100.20 ? 223  ARG B NE    1 
ATOM   3379  C  CZ    . ARG B 1  235  ? -15.748 -32.256 30.556   1.00 102.33 ? 223  ARG B CZ    1 
ATOM   3380  N  NH1   . ARG B 1  235  ? -16.487 -31.958 31.616   1.00 110.10 ? 223  ARG B NH1   1 
ATOM   3381  N  NH2   . ARG B 1  235  ? -14.797 -33.175 30.653   1.00 109.98 ? 223  ARG B NH2   1 
ATOM   3382  N  N     . GLU B 1  236  ? -21.960 -31.485 29.387   1.00 100.32 ? 224  GLU B N     1 
ATOM   3383  C  CA    . GLU B 1  236  ? -22.558 -32.577 30.147   1.00 117.82 ? 224  GLU B CA    1 
ATOM   3384  C  C     . GLU B 1  236  ? -23.533 -33.419 29.332   1.00 98.95  ? 224  GLU B C     1 
ATOM   3385  O  O     . GLU B 1  236  ? -23.936 -34.490 29.800   1.00 117.17 ? 224  GLU B O     1 
ATOM   3386  C  CB    . GLU B 1  236  ? -23.288 -32.026 31.374   1.00 124.42 ? 224  GLU B CB    1 
ATOM   3387  C  CG    . GLU B 1  236  ? -22.387 -31.485 32.464   1.00 111.37 ? 224  GLU B CG    1 
ATOM   3388  C  CD    . GLU B 1  236  ? -23.173 -30.823 33.575   1.00 144.18 ? 224  GLU B CD    1 
ATOM   3389  O  OE1   . GLU B 1  236  ? -24.420 -30.903 33.548   1.00 148.08 ? 224  GLU B OE1   1 
ATOM   3390  O  OE2   . GLU B 1  236  ? -22.549 -30.218 34.472   1.00 162.00 ? 224  GLU B OE2   1 
ATOM   3391  N  N     . LEU B 1  237  ? -23.910 -32.979 28.129   1.00 68.15  ? 225  LEU B N     1 
ATOM   3392  C  CA    . LEU B 1  237  ? -25.001 -33.630 27.410   1.00 75.54  ? 225  LEU B CA    1 
ATOM   3393  C  C     . LEU B 1  237  ? -24.611 -34.996 26.850   1.00 80.79  ? 225  LEU B C     1 
ATOM   3394  O  O     . LEU B 1  237  ? -25.451 -35.902 26.817   1.00 91.32  ? 225  LEU B O     1 
ATOM   3395  C  CB    . LEU B 1  237  ? -25.496 -32.722 26.287   1.00 72.86  ? 225  LEU B CB    1 
ATOM   3396  C  CG    . LEU B 1  237  ? -26.489 -31.650 26.734   1.00 52.23  ? 225  LEU B CG    1 
ATOM   3397  C  CD1   . LEU B 1  237  ? -26.733 -30.650 25.620   1.00 73.55  ? 225  LEU B CD1   1 
ATOM   3398  C  CD2   . LEU B 1  237  ? -27.799 -32.289 27.186   1.00 66.14  ? 225  LEU B CD2   1 
ATOM   3399  N  N     . ASN B 1  238  ? -23.365 -35.171 26.400   1.00 71.85  ? 226  ASN B N     1 
ATOM   3400  C  CA    . ASN B 1  238  ? -23.008 -36.400 25.696   1.00 96.09  ? 226  ASN B CA    1 
ATOM   3401  C  C     . ASN B 1  238  ? -21.572 -36.854 25.946   1.00 102.32 ? 226  ASN B C     1 
ATOM   3402  O  O     . ASN B 1  238  ? -21.307 -38.061 25.983   1.00 94.71  ? 226  ASN B O     1 
ATOM   3403  C  CB    . ASN B 1  238  ? -23.239 -36.220 24.193   1.00 125.39 ? 226  ASN B CB    1 
ATOM   3404  C  CG    . ASN B 1  238  ? -23.103 -37.519 23.418   1.00 119.06 ? 226  ASN B CG    1 
ATOM   3405  O  OD1   . ASN B 1  238  ? -23.177 -38.608 23.987   1.00 126.86 ? 226  ASN B OD1   1 
ATOM   3406  N  ND2   . ASN B 1  238  ? -22.909 -37.408 22.109   1.00 101.09 ? 226  ASN B ND2   1 
ATOM   3407  N  N     . VAL B 1  239  ? -20.646 -35.908 26.123   1.00 110.83 ? 227  VAL B N     1 
ATOM   3408  C  CA    . VAL B 1  239  ? -19.219 -36.191 26.268   1.00 117.56 ? 227  VAL B CA    1 
ATOM   3409  C  C     . VAL B 1  239  ? -18.732 -36.910 25.016   1.00 113.49 ? 227  VAL B C     1 
ATOM   3410  O  O     . VAL B 1  239  ? -18.357 -38.087 25.064   1.00 73.66  ? 227  VAL B O     1 
ATOM   3411  C  CB    . VAL B 1  239  ? -18.915 -37.012 27.539   1.00 79.09  ? 227  VAL B CB    1 
ATOM   3412  C  CG1   . VAL B 1  239  ? -17.418 -36.998 27.848   1.00 88.24  ? 227  VAL B CG1   1 
ATOM   3413  C  CG2   . VAL B 1  239  ? -19.711 -36.490 28.723   1.00 48.27  ? 227  VAL B CG2   1 
ATOM   3414  N  N     . GLU B 1  240  ? -18.761 -36.212 23.885   1.00 114.14 ? 228  GLU B N     1 
ATOM   3415  C  CA    . GLU B 1  240  ? -18.233 -36.714 22.629   1.00 109.75 ? 228  GLU B CA    1 
ATOM   3416  C  C     . GLU B 1  240  ? -16.886 -36.050 22.352   1.00 114.27 ? 228  GLU B C     1 
ATOM   3417  O  O     . GLU B 1  240  ? -16.392 -35.232 23.132   1.00 125.06 ? 228  GLU B O     1 
ATOM   3418  C  CB    . GLU B 1  240  ? -19.227 -36.462 21.490   1.00 128.55 ? 228  GLU B CB    1 
ATOM   3419  C  CG    . GLU B 1  240  ? -19.080 -37.391 20.289   1.00 140.63 ? 228  GLU B CG    1 
ATOM   3420  C  CD    . GLU B 1  240  ? -19.602 -36.776 19.003   1.00 103.11 ? 228  GLU B CD    1 
ATOM   3421  O  OE1   . GLU B 1  240  ? -19.959 -35.578 19.012   1.00 104.28 ? 228  GLU B OE1   1 
ATOM   3422  O  OE2   . GLU B 1  240  ? -19.651 -37.492 17.982   1.00 55.41  ? 228  GLU B OE2   1 
ATOM   3423  N  N     . ALA B 1  241  ? -16.287 -36.404 21.219   1.00 119.90 ? 229  ALA B N     1 
ATOM   3424  C  CA    . ALA B 1  241  ? -15.003 -35.845 20.833   1.00 121.55 ? 229  ALA B CA    1 
ATOM   3425  C  C     . ALA B 1  241  ? -15.170 -34.429 20.292   1.00 101.50 ? 229  ALA B C     1 
ATOM   3426  O  O     . ALA B 1  241  ? -16.235 -34.037 19.809   1.00 75.43  ? 229  ALA B O     1 
ATOM   3427  C  CB    . ALA B 1  241  ? -14.324 -36.728 19.787   1.00 99.51  ? 229  ALA B CB    1 
ATOM   3428  N  N     . GLU B 1  242  ? -14.084 -33.665 20.374   1.00 110.04 ? 230  GLU B N     1 
ATOM   3429  C  CA    . GLU B 1  242  ? -14.061 -32.291 19.895   1.00 89.91  ? 230  GLU B CA    1 
ATOM   3430  C  C     . GLU B 1  242  ? -12.612 -31.838 19.818   1.00 106.35 ? 230  GLU B C     1 
ATOM   3431  O  O     . GLU B 1  242  ? -11.766 -32.304 20.586   1.00 114.33 ? 230  GLU B O     1 
ATOM   3432  C  CB    . GLU B 1  242  ? -14.871 -31.363 20.809   1.00 76.92  ? 230  GLU B CB    1 
ATOM   3433  N  N     . GLY B 1  243  ? -12.337 -30.934 18.877   1.00 106.66 ? 231  GLY B N     1 
ATOM   3434  C  CA    . GLY B 1  243  ? -11.001 -30.396 18.688   1.00 103.29 ? 231  GLY B CA    1 
ATOM   3435  C  C     . GLY B 1  243  ? -10.393 -29.834 19.957   1.00 105.67 ? 231  GLY B C     1 
ATOM   3436  O  O     . GLY B 1  243  ? -10.775 -28.751 20.411   1.00 110.90 ? 231  GLY B O     1 
ATOM   3437  N  N     . ILE B 1  244  ? -9.435  -30.556 20.531   1.00 114.48 ? 232  ILE B N     1 
ATOM   3438  C  CA    . ILE B 1  244  ? -8.935  -30.262 21.870   1.00 114.49 ? 232  ILE B CA    1 
ATOM   3439  C  C     . ILE B 1  244  ? -7.446  -30.572 21.928   1.00 119.63 ? 232  ILE B C     1 
ATOM   3440  O  O     . ILE B 1  244  ? -6.981  -31.557 21.348   1.00 131.63 ? 232  ILE B O     1 
ATOM   3441  C  CB    . ILE B 1  244  ? -9.721  -31.064 22.932   1.00 143.33 ? 232  ILE B CB    1 
ATOM   3442  C  CG1   . ILE B 1  244  ? -11.025 -30.348 23.288   1.00 147.05 ? 232  ILE B CG1   1 
ATOM   3443  C  CG2   . ILE B 1  244  ? -8.874  -31.334 24.170   1.00 144.73 ? 232  ILE B CG2   1 
ATOM   3444  C  CD1   . ILE B 1  244  ? -11.748 -30.960 24.460   1.00 121.20 ? 232  ILE B CD1   1 
ATOM   3445  N  N     . GLU B 1  245  ? -6.700  -29.719 22.627   1.00 112.83 ? 233  GLU B N     1 
ATOM   3446  C  CA    . GLU B 1  245  ? -5.297  -29.981 22.930   1.00 127.52 ? 233  GLU B CA    1 
ATOM   3447  C  C     . GLU B 1  245  ? -4.879  -29.273 24.217   1.00 110.04 ? 233  GLU B C     1 
ATOM   3448  O  O     . GLU B 1  245  ? -5.102  -28.073 24.379   1.00 97.33  ? 233  GLU B O     1 
ATOM   3449  C  CB    . GLU B 1  245  ? -4.400  -29.543 21.773   1.00 134.16 ? 233  GLU B CB    1 
ATOM   3450  N  N     . SER C 2  28   ? -49.188 -16.395 -18.563  1.00 141.63 ? 28   SER C N     1 
ATOM   3451  C  CA    . SER C 2  28   ? -47.937 -17.107 -18.799  1.00 156.65 ? 28   SER C CA    1 
ATOM   3452  C  C     . SER C 2  28   ? -47.085 -16.379 -19.832  1.00 187.64 ? 28   SER C C     1 
ATOM   3453  O  O     . SER C 2  28   ? -47.587 -15.552 -20.594  1.00 185.32 ? 28   SER C O     1 
ATOM   3454  C  CB    . SER C 2  28   ? -48.211 -18.540 -19.258  1.00 129.24 ? 28   SER C CB    1 
ATOM   3455  N  N     . ASN C 2  29   ? -45.793 -16.693 -19.858  1.00 185.88 ? 29   ASN C N     1 
ATOM   3456  C  CA    . ASN C 2  29   ? -44.842 -16.041 -20.748  1.00 174.00 ? 29   ASN C CA    1 
ATOM   3457  C  C     . ASN C 2  29   ? -44.308 -17.059 -21.746  1.00 181.33 ? 29   ASN C C     1 
ATOM   3458  O  O     . ASN C 2  29   ? -43.784 -18.106 -21.350  1.00 177.67 ? 29   ASN C O     1 
ATOM   3459  C  CB    . ASN C 2  29   ? -43.695 -15.412 -19.957  1.00 130.64 ? 29   ASN C CB    1 
ATOM   3460  N  N     . ASN C 2  30   ? -44.451 -16.748 -23.035  1.00 181.51 ? 30   ASN C N     1 
ATOM   3461  C  CA    . ASN C 2  30   ? -43.883 -17.541 -24.126  1.00 163.89 ? 30   ASN C CA    1 
ATOM   3462  C  C     . ASN C 2  30   ? -44.411 -18.977 -24.105  1.00 161.62 ? 30   ASN C C     1 
ATOM   3463  O  O     . ASN C 2  30   ? -43.659 -19.946 -23.980  1.00 150.75 ? 30   ASN C O     1 
ATOM   3464  C  CB    . ASN C 2  30   ? -42.352 -17.515 -24.074  1.00 141.83 ? 30   ASN C CB    1 
ATOM   3465  C  CG    . ASN C 2  30   ? -41.796 -16.112 -23.952  1.00 154.43 ? 30   ASN C CG    1 
ATOM   3466  O  OD1   . ASN C 2  30   ? -42.429 -15.143 -24.372  1.00 170.65 ? 30   ASN C OD1   1 
ATOM   3467  N  ND2   . ASN C 2  30   ? -40.607 -15.995 -23.375  1.00 145.92 ? 30   ASN C ND2   1 
ATOM   3468  N  N     . SER C 2  31   ? -45.730 -19.099 -24.237  1.00 158.93 ? 31   SER C N     1 
ATOM   3469  C  CA    . SER C 2  31   ? -46.383 -20.408 -24.292  1.00 151.48 ? 31   SER C CA    1 
ATOM   3470  C  C     . SER C 2  31   ? -46.435 -20.920 -25.733  1.00 153.03 ? 31   SER C C     1 
ATOM   3471  O  O     . SER C 2  31   ? -47.498 -21.135 -26.314  1.00 175.04 ? 31   SER C O     1 
ATOM   3472  C  CB    . SER C 2  31   ? -47.777 -20.328 -23.681  1.00 142.57 ? 31   SER C CB    1 
ATOM   3473  O  OG    . SER C 2  31   ? -47.710 -20.050 -22.294  1.00 150.57 ? 31   SER C OG    1 
ATOM   3474  N  N     . VAL C 2  32   ? -45.253 -21.119 -26.307  1.00 140.88 ? 32   VAL C N     1 
ATOM   3475  C  CA    . VAL C 2  32   ? -45.149 -21.566 -27.695  1.00 129.22 ? 32   VAL C CA    1 
ATOM   3476  C  C     . VAL C 2  32   ? -44.240 -22.789 -27.850  1.00 138.20 ? 32   VAL C C     1 
ATOM   3477  O  O     . VAL C 2  32   ? -44.526 -23.632 -28.713  1.00 163.11 ? 32   VAL C O     1 
ATOM   3478  C  CB    . VAL C 2  32   ? -44.718 -20.403 -28.616  1.00 101.29 ? 32   VAL C CB    1 
ATOM   3479  C  CG1   . VAL C 2  32   ? -43.511 -19.647 -28.072  1.00 94.30  ? 32   VAL C CG1   1 
ATOM   3480  C  CG2   . VAL C 2  32   ? -44.467 -20.885 -30.043  1.00 107.52 ? 32   VAL C CG2   1 
ATOM   3481  N  N     . PRO C 2  33   ? -43.155 -22.981 -27.051  1.00 118.55 ? 33   PRO C N     1 
ATOM   3482  C  CA    . PRO C 2  33   ? -42.313 -24.158 -27.298  1.00 109.99 ? 33   PRO C CA    1 
ATOM   3483  C  C     . PRO C 2  33   ? -42.513 -25.298 -26.307  1.00 71.68  ? 33   PRO C C     1 
ATOM   3484  O  O     . PRO C 2  33   ? -42.013 -26.404 -26.532  1.00 60.10  ? 33   PRO C O     1 
ATOM   3485  C  CB    . PRO C 2  33   ? -40.891 -23.586 -27.197  1.00 92.50  ? 33   PRO C CB    1 
ATOM   3486  C  CG    . PRO C 2  33   ? -41.045 -22.228 -26.483  1.00 67.34  ? 33   PRO C CG    1 
ATOM   3487  C  CD    . PRO C 2  33   ? -42.484 -22.110 -26.072  1.00 86.39  ? 33   PRO C CD    1 
ATOM   3488  N  N     . GLY C 2  34   ? -43.237 -25.056 -25.218  1.00 82.10  ? 34   GLY C N     1 
ATOM   3489  C  CA    . GLY C 2  34   ? -43.290 -26.010 -24.129  1.00 81.64  ? 34   GLY C CA    1 
ATOM   3490  C  C     . GLY C 2  34   ? -42.266 -25.753 -23.050  1.00 99.22  ? 34   GLY C C     1 
ATOM   3491  O  O     . GLY C 2  34   ? -41.729 -26.707 -22.474  1.00 70.95  ? 34   GLY C O     1 
ATOM   3492  N  N     . ALA C 2  35   ? -41.978 -24.492 -22.763  1.00 117.39 ? 35   ALA C N     1 
ATOM   3493  C  CA    . ALA C 2  35   ? -40.934 -24.089 -21.834  1.00 96.26  ? 35   ALA C CA    1 
ATOM   3494  C  C     . ALA C 2  35   ? -41.492 -24.004 -20.422  1.00 92.70  ? 35   ALA C C     1 
ATOM   3495  O  O     . ALA C 2  35   ? -42.700 -24.130 -20.209  1.00 100.94 ? 35   ALA C O     1 
ATOM   3496  C  CB    . ALA C 2  35   ? -40.355 -22.752 -22.287  1.00 113.71 ? 35   ALA C CB    1 
ATOM   3497  N  N     . PRO C 2  36   ? -40.633 -23.813 -19.415  1.00 106.22 ? 36   PRO C N     1 
ATOM   3498  C  CA    . PRO C 2  36   ? -41.145 -23.599 -18.056  1.00 109.09 ? 36   PRO C CA    1 
ATOM   3499  C  C     . PRO C 2  36   ? -42.027 -22.362 -17.979  1.00 89.54  ? 36   PRO C C     1 
ATOM   3500  O  O     . PRO C 2  36   ? -41.848 -21.392 -18.720  1.00 66.86  ? 36   PRO C O     1 
ATOM   3501  C  CB    . PRO C 2  36   ? -39.873 -23.437 -17.214  1.00 92.47  ? 36   PRO C CB    1 
ATOM   3502  C  CG    . PRO C 2  36   ? -38.778 -23.167 -18.200  1.00 89.00  ? 36   PRO C CG    1 
ATOM   3503  C  CD    . PRO C 2  36   ? -39.166 -23.940 -19.414  1.00 98.47  ? 36   PRO C CD    1 
ATOM   3504  N  N     . ASN C 2  37   ? -42.991 -22.409 -17.064  1.00 93.05  ? 37   ASN C N     1 
ATOM   3505  C  CA    . ASN C 2  37   ? -44.004 -21.363 -16.940  1.00 102.02 ? 37   ASN C CA    1 
ATOM   3506  C  C     . ASN C 2  37   ? -43.465 -20.234 -16.072  1.00 97.91  ? 37   ASN C C     1 
ATOM   3507  O  O     . ASN C 2  37   ? -43.511 -20.298 -14.842  1.00 98.02  ? 37   ASN C O     1 
ATOM   3508  C  CB    . ASN C 2  37   ? -45.291 -21.936 -16.358  1.00 96.41  ? 37   ASN C CB    1 
ATOM   3509  C  CG    . ASN C 2  37   ? -46.352 -20.876 -16.135  1.00 100.03 ? 37   ASN C CG    1 
ATOM   3510  O  OD1   . ASN C 2  37   ? -46.429 -19.892 -16.873  1.00 106.24 ? 37   ASN C OD1   1 
ATOM   3511  N  ND2   . ASN C 2  37   ? -47.170 -21.066 -15.108  1.00 96.44  ? 37   ASN C ND2   1 
ATOM   3512  N  N     . ARG C 2  38   ? -42.952 -19.189 -16.716  1.00 96.32  ? 38   ARG C N     1 
ATOM   3513  C  CA    . ARG C 2  38   ? -42.575 -17.963 -16.027  1.00 77.35  ? 38   ARG C CA    1 
ATOM   3514  C  C     . ARG C 2  38   ? -43.746 -16.990 -16.090  1.00 95.87  ? 38   ARG C C     1 
ATOM   3515  O  O     . ARG C 2  38   ? -44.328 -16.781 -17.159  1.00 117.40 ? 38   ARG C O     1 
ATOM   3516  C  CB    . ARG C 2  38   ? -41.321 -17.352 -16.655  1.00 72.83  ? 38   ARG C CB    1 
ATOM   3517  C  CG    . ARG C 2  38   ? -40.611 -16.338 -15.770  1.00 61.30  ? 38   ARG C CG    1 
ATOM   3518  C  CD    . ARG C 2  38   ? -39.255 -15.943 -16.343  1.00 65.01  ? 38   ARG C CD    1 
ATOM   3519  N  NE    . ARG C 2  38   ? -38.257 -17.000 -16.205  1.00 66.16  ? 38   ARG C NE    1 
ATOM   3520  C  CZ    . ARG C 2  38   ? -37.375 -17.066 -15.213  1.00 66.85  ? 38   ARG C CZ    1 
ATOM   3521  N  NH1   . ARG C 2  38   ? -36.500 -18.062 -15.165  1.00 64.43  ? 38   ARG C NH1   1 
ATOM   3522  N  NH2   . ARG C 2  38   ? -37.365 -16.135 -14.269  1.00 69.78  ? 38   ARG C NH2   1 
ATOM   3523  N  N     . VAL C 2  39   ? -44.099 -16.411 -14.947  1.00 87.13  ? 39   VAL C N     1 
ATOM   3524  C  CA    . VAL C 2  39   ? -45.306 -15.602 -14.816  1.00 85.80  ? 39   VAL C CA    1 
ATOM   3525  C  C     . VAL C 2  39   ? -44.919 -14.133 -14.942  1.00 81.20  ? 39   VAL C C     1 
ATOM   3526  O  O     . VAL C 2  39   ? -44.093 -13.632 -14.172  1.00 72.79  ? 39   VAL C O     1 
ATOM   3527  C  CB    . VAL C 2  39   ? -46.021 -15.880 -13.484  1.00 60.29  ? 39   VAL C CB    1 
ATOM   3528  C  CG1   . VAL C 2  39   ? -47.512 -15.646 -13.632  1.00 78.05  ? 39   VAL C CG1   1 
ATOM   3529  C  CG2   . VAL C 2  39   ? -45.744 -17.304 -13.018  1.00 75.93  ? 39   VAL C CG2   1 
ATOM   3530  N  N     . SER C 2  40   ? -45.524 -13.436 -15.899  1.00 82.75  ? 40   SER C N     1 
ATOM   3531  C  CA    . SER C 2  40   ? -45.090 -12.098 -16.277  1.00 75.72  ? 40   SER C CA    1 
ATOM   3532  C  C     . SER C 2  40   ? -46.012 -11.025 -15.710  1.00 85.92  ? 40   SER C C     1 
ATOM   3533  O  O     . SER C 2  40   ? -47.230 -11.213 -15.624  1.00 100.03 ? 40   SER C O     1 
ATOM   3534  C  CB    . SER C 2  40   ? -45.024 -11.965 -17.800  1.00 85.99  ? 40   SER C CB    1 
ATOM   3535  O  OG    . SER C 2  40   ? -44.762 -10.626 -18.181  1.00 104.29 ? 40   SER C OG    1 
ATOM   3536  N  N     . PHE C 2  41   ? -45.416 -9.891  -15.335  1.00 79.45  ? 41   PHE C N     1 
ATOM   3537  C  CA    . PHE C 2  41   ? -46.153 -8.710  -14.878  1.00 91.77  ? 41   PHE C CA    1 
ATOM   3538  C  C     . PHE C 2  41   ? -46.529 -7.836  -16.078  1.00 107.83 ? 41   PHE C C     1 
ATOM   3539  O  O     . PHE C 2  41   ? -46.190 -6.657  -16.161  1.00 133.03 ? 41   PHE C O     1 
ATOM   3540  C  CB    . PHE C 2  41   ? -45.321 -7.918  -13.871  1.00 89.94  ? 41   PHE C CB    1 
ATOM   3541  C  CG    . PHE C 2  41   ? -45.141 -8.593  -12.531  1.00 78.35  ? 41   PHE C CG    1 
ATOM   3542  C  CD1   . PHE C 2  41   ? -44.605 -9.868  -12.434  1.00 106.05 ? 41   PHE C CD1   1 
ATOM   3543  C  CD2   . PHE C 2  41   ? -45.465 -7.922  -11.361  1.00 65.35  ? 41   PHE C CD2   1 
ATOM   3544  C  CE1   . PHE C 2  41   ? -44.429 -10.473 -11.201  1.00 98.36  ? 41   PHE C CE1   1 
ATOM   3545  C  CE2   . PHE C 2  41   ? -45.287 -8.522  -10.125  1.00 80.97  ? 41   PHE C CE2   1 
ATOM   3546  C  CZ    . PHE C 2  41   ? -44.769 -9.799  -10.047  1.00 73.72  ? 41   PHE C CZ    1 
ATOM   3547  N  N     . ALA C 2  42   ? -47.242 -8.441  -17.024  1.00 99.83  ? 42   ALA C N     1 
ATOM   3548  C  CA    . ALA C 2  42   ? -47.505 -7.822  -18.318  1.00 102.74 ? 42   ALA C CA    1 
ATOM   3549  C  C     . ALA C 2  42   ? -48.927 -7.275  -18.364  1.00 112.89 ? 42   ALA C C     1 
ATOM   3550  O  O     . ALA C 2  42   ? -49.895 -8.035  -18.250  1.00 139.80 ? 42   ALA C O     1 
ATOM   3551  C  CB    . ALA C 2  42   ? -47.281 -8.823  -19.452  1.00 111.73 ? 42   ALA C CB    1 
ATOM   3552  N  N     . LYS C 2  43   ? -49.046 -5.957  -18.535  1.00 90.48  ? 43   LYS C N     1 
ATOM   3553  C  CA    . LYS C 2  43   ? -50.337 -5.319  -18.746  1.00 111.04 ? 43   LYS C CA    1 
ATOM   3554  C  C     . LYS C 2  43   ? -50.669 -5.146  -20.222  1.00 111.57 ? 43   LYS C C     1 
ATOM   3555  O  O     . LYS C 2  43   ? -51.843 -4.963  -20.565  1.00 111.27 ? 43   LYS C O     1 
ATOM   3556  C  CB    . LYS C 2  43   ? -50.374 -3.953  -18.047  1.00 128.35 ? 43   LYS C CB    1 
ATOM   3557  C  CG    . LYS C 2  43   ? -51.771 -3.366  -17.880  1.00 147.63 ? 43   LYS C CG    1 
ATOM   3558  C  CD    . LYS C 2  43   ? -51.730 -2.001  -17.214  1.00 156.97 ? 43   LYS C CD    1 
ATOM   3559  C  CE    . LYS C 2  43   ? -53.133 -1.475  -16.952  1.00 151.90 ? 43   LYS C CE    1 
ATOM   3560  N  NZ    . LYS C 2  43   ? -53.903 -2.365  -16.037  1.00 129.25 ? 43   LYS C NZ    1 
ATOM   3561  N  N     . LEU C 2  44   ? -49.671 -5.220  -21.100  1.00 106.60 ? 44   LEU C N     1 
ATOM   3562  C  CA    . LEU C 2  44   ? -49.855 -5.017  -22.530  1.00 112.76 ? 44   LEU C CA    1 
ATOM   3563  C  C     . LEU C 2  44   ? -49.663 -6.334  -23.268  1.00 116.93 ? 44   LEU C C     1 
ATOM   3564  O  O     . LEU C 2  44   ? -48.683 -7.048  -23.028  1.00 125.48 ? 44   LEU C O     1 
ATOM   3565  C  CB    . LEU C 2  44   ? -48.874 -3.972  -23.063  1.00 109.69 ? 44   LEU C CB    1 
ATOM   3566  C  CG    . LEU C 2  44   ? -48.749 -2.687  -22.244  1.00 113.32 ? 44   LEU C CG    1 
ATOM   3567  C  CD1   . LEU C 2  44   ? -47.751 -1.737  -22.888  1.00 108.67 ? 44   LEU C CD1   1 
ATOM   3568  C  CD2   . LEU C 2  44   ? -50.104 -2.017  -22.072  1.00 131.31 ? 44   LEU C CD2   1 
ATOM   3569  N  N     . ARG C 2  45   ? -50.593 -6.647  -24.165  1.00 111.44 ? 45   ARG C N     1 
ATOM   3570  C  CA    . ARG C 2  45   ? -50.467 -7.835  -24.993  1.00 108.54 ? 45   ARG C CA    1 
ATOM   3571  C  C     . ARG C 2  45   ? -49.385 -7.635  -26.049  1.00 110.07 ? 45   ARG C C     1 
ATOM   3572  O  O     . ARG C 2  45   ? -49.108 -6.515  -26.486  1.00 104.88 ? 45   ARG C O     1 
ATOM   3573  C  CB    . ARG C 2  45   ? -51.802 -8.162  -25.662  1.00 119.86 ? 45   ARG C CB    1 
ATOM   3574  C  CG    . ARG C 2  45   ? -52.362 -7.029  -26.509  1.00 136.98 ? 45   ARG C CG    1 
ATOM   3575  C  CD    . ARG C 2  45   ? -53.723 -7.382  -27.084  1.00 133.59 ? 45   ARG C CD    1 
ATOM   3576  N  NE    . ARG C 2  45   ? -53.664 -8.553  -27.954  1.00 146.71 ? 45   ARG C NE    1 
ATOM   3577  C  CZ    . ARG C 2  45   ? -53.421 -8.501  -29.260  1.00 133.93 ? 45   ARG C CZ    1 
ATOM   3578  N  NH1   . ARG C 2  45   ? -53.212 -7.333  -29.852  1.00 134.21 ? 45   ARG C NH1   1 
ATOM   3579  N  NH2   . ARG C 2  45   ? -53.387 -9.618  -29.974  1.00 119.35 ? 45   ARG C NH2   1 
ATOM   3580  N  N     . GLU C 2  46   ? -48.762 -8.742  -26.451  1.00 101.91 ? 46   GLU C N     1 
ATOM   3581  C  CA    . GLU C 2  46   ? -47.736 -8.710  -27.482  1.00 117.23 ? 46   GLU C CA    1 
ATOM   3582  C  C     . GLU C 2  46   ? -48.372 -9.041  -28.823  1.00 115.05 ? 46   GLU C C     1 
ATOM   3583  O  O     . GLU C 2  46   ? -48.783 -10.192 -29.034  1.00 112.36 ? 46   GLU C O     1 
ATOM   3584  C  CB    . GLU C 2  46   ? -46.616 -9.698  -27.161  1.00 126.25 ? 46   GLU C CB    1 
ATOM   3585  C  CG    . GLU C 2  46   ? -45.697 -9.263  -26.023  1.00 122.02 ? 46   GLU C CG    1 
ATOM   3586  C  CD    . GLU C 2  46   ? -44.325 -8.834  -26.513  1.00 144.63 ? 46   GLU C CD    1 
ATOM   3587  O  OE1   . GLU C 2  46   ? -44.132 -8.755  -27.745  1.00 139.03 ? 46   GLU C OE1   1 
ATOM   3588  O  OE2   . GLU C 2  46   ? -43.439 -8.581  -25.668  1.00 153.05 ? 46   GLU C OE2   1 
ATOM   3589  N  N     . PRO C 2  47   ? -48.488 -8.084  -29.748  1.00 99.77  ? 47   PRO C N     1 
ATOM   3590  C  CA    . PRO C 2  47   ? -49.140 -8.400  -31.030  1.00 85.65  ? 47   PRO C CA    1 
ATOM   3591  C  C     . PRO C 2  47   ? -48.302 -9.294  -31.925  1.00 92.07  ? 47   PRO C C     1 
ATOM   3592  O  O     . PRO C 2  47   ? -48.850 -10.179 -32.593  1.00 102.51 ? 47   PRO C O     1 
ATOM   3593  C  CB    . PRO C 2  47   ? -49.365 -7.015  -31.652  1.00 101.29 ? 47   PRO C CB    1 
ATOM   3594  C  CG    . PRO C 2  47   ? -48.294 -6.162  -31.058  1.00 95.99  ? 47   PRO C CG    1 
ATOM   3595  C  CD    . PRO C 2  47   ? -48.089 -6.669  -29.657  1.00 93.07  ? 47   PRO C CD    1 
ATOM   3596  N  N     . LEU C 2  48   ? -46.987 -9.091  -31.956  1.00 93.20  ? 48   LEU C N     1 
ATOM   3597  C  CA    . LEU C 2  48   ? -46.092 -9.831  -32.836  1.00 80.19  ? 48   LEU C CA    1 
ATOM   3598  C  C     . LEU C 2  48   ? -44.999 -10.484 -32.005  1.00 86.81  ? 48   LEU C C     1 
ATOM   3599  O  O     . LEU C 2  48   ? -44.355 -9.817  -31.188  1.00 84.62  ? 48   LEU C O     1 
ATOM   3600  C  CB    . LEU C 2  48   ? -45.487 -8.903  -33.898  1.00 75.25  ? 48   LEU C CB    1 
ATOM   3601  C  CG    . LEU C 2  48   ? -44.320 -9.365  -34.774  1.00 88.34  ? 48   LEU C CG    1 
ATOM   3602  C  CD1   . LEU C 2  48   ? -44.465 -8.799  -36.176  1.00 119.29 ? 48   LEU C CD1   1 
ATOM   3603  C  CD2   . LEU C 2  48   ? -42.994 -8.925  -34.179  1.00 99.35  ? 48   LEU C CD2   1 
ATOM   3604  N  N     . GLU C 2  49   ? -44.791 -11.780 -32.217  1.00 93.87  ? 49   GLU C N     1 
ATOM   3605  C  CA    . GLU C 2  49   ? -43.761 -12.505 -31.492  1.00 107.24 ? 49   GLU C CA    1 
ATOM   3606  C  C     . GLU C 2  49   ? -42.385 -12.202 -32.072  1.00 90.80  ? 49   GLU C C     1 
ATOM   3607  O  O     . GLU C 2  49   ? -42.241 -11.896 -33.260  1.00 79.63  ? 49   GLU C O     1 
ATOM   3608  C  CB    . GLU C 2  49   ? -44.030 -14.011 -31.529  1.00 131.67 ? 49   GLU C CB    1 
ATOM   3609  C  CG    . GLU C 2  49   ? -44.113 -14.607 -32.926  1.00 150.05 ? 49   GLU C CG    1 
ATOM   3610  C  CD    . GLU C 2  49   ? -44.400 -16.098 -32.908  1.00 204.59 ? 49   GLU C CD    1 
ATOM   3611  O  OE1   . GLU C 2  49   ? -44.709 -16.634 -31.823  1.00 216.80 ? 49   GLU C OE1   1 
ATOM   3612  O  OE2   . GLU C 2  49   ? -44.315 -16.734 -33.980  1.00 217.89 ? 49   GLU C OE2   1 
ATOM   3613  N  N     . VAL C 2  50   ? -41.375 -12.283 -31.211  1.00 104.43 ? 50   VAL C N     1 
ATOM   3614  C  CA    . VAL C 2  50   ? -39.984 -12.003 -31.562  1.00 93.36  ? 50   VAL C CA    1 
ATOM   3615  C  C     . VAL C 2  50   ? -39.593 -12.811 -32.794  1.00 82.21  ? 50   VAL C C     1 
ATOM   3616  O  O     . VAL C 2  50   ? -39.864 -14.019 -32.851  1.00 84.71  ? 50   VAL C O     1 
ATOM   3617  C  CB    . VAL C 2  50   ? -39.049 -12.311 -30.381  1.00 97.39  ? 50   VAL C CB    1 
ATOM   3618  C  CG1   . VAL C 2  50   ? -37.595 -12.100 -30.772  1.00 68.16  ? 50   VAL C CG1   1 
ATOM   3619  C  CG2   . VAL C 2  50   ? -39.413 -11.450 -29.183  1.00 108.43 ? 50   VAL C CG2   1 
ATOM   3620  N  N     . PRO C 2  51   ? -38.972 -12.193 -33.806  1.00 75.71  ? 51   PRO C N     1 
ATOM   3621  C  CA    . PRO C 2  51   ? -38.556 -12.958 -34.989  1.00 78.89  ? 51   PRO C CA    1 
ATOM   3622  C  C     . PRO C 2  51   ? -37.392 -13.888 -34.694  1.00 73.58  ? 51   PRO C C     1 
ATOM   3623  O  O     . PRO C 2  51   ? -36.997 -14.059 -33.536  1.00 78.31  ? 51   PRO C O     1 
ATOM   3624  C  CB    . PRO C 2  51   ? -38.159 -11.865 -35.988  1.00 88.46  ? 51   PRO C CB    1 
ATOM   3625  C  CG    . PRO C 2  51   ? -37.725 -10.726 -35.128  1.00 86.34  ? 51   PRO C CG    1 
ATOM   3626  C  CD    . PRO C 2  51   ? -38.633 -10.764 -33.926  1.00 80.80  ? 51   PRO C CD    1 
ATOM   3627  N  N     . GLY C 2  52   ? -36.837 -14.498 -35.736  1.00 78.06  ? 52   GLY C N     1 
ATOM   3628  C  CA    . GLY C 2  52   ? -35.633 -15.284 -35.577  1.00 79.00  ? 52   GLY C CA    1 
ATOM   3629  C  C     . GLY C 2  52   ? -34.437 -14.390 -35.328  1.00 88.78  ? 52   GLY C C     1 
ATOM   3630  O  O     . GLY C 2  52   ? -34.045 -13.615 -36.206  1.00 100.00 ? 52   GLY C O     1 
ATOM   3631  N  N     . LEU C 2  53   ? -33.853 -14.480 -34.130  1.00 81.21  ? 53   LEU C N     1 
ATOM   3632  C  CA    . LEU C 2  53   ? -32.745 -13.599 -33.777  1.00 77.69  ? 53   LEU C CA    1 
ATOM   3633  C  C     . LEU C 2  53   ? -31.515 -13.836 -34.643  1.00 77.23  ? 53   LEU C C     1 
ATOM   3634  O  O     . LEU C 2  53   ? -30.631 -12.974 -34.691  1.00 75.59  ? 53   LEU C O     1 
ATOM   3635  C  CB    . LEU C 2  53   ? -32.388 -13.770 -32.298  1.00 69.33  ? 53   LEU C CB    1 
ATOM   3636  C  CG    . LEU C 2  53   ? -33.479 -13.357 -31.305  1.00 68.29  ? 53   LEU C CG    1 
ATOM   3637  C  CD1   . LEU C 2  53   ? -33.046 -13.608 -29.867  1.00 87.14  ? 53   LEU C CD1   1 
ATOM   3638  C  CD2   . LEU C 2  53   ? -33.865 -11.899 -31.508  1.00 67.30  ? 53   LEU C CD2   1 
ATOM   3639  N  N     . LEU C 2  54   ? -31.439 -14.975 -35.328  1.00 77.43  ? 54   LEU C N     1 
ATOM   3640  C  CA    . LEU C 2  54   ? -30.327 -15.288 -36.214  1.00 84.18  ? 54   LEU C CA    1 
ATOM   3641  C  C     . LEU C 2  54   ? -30.630 -14.980 -37.675  1.00 83.35  ? 54   LEU C C     1 
ATOM   3642  O  O     . LEU C 2  54   ? -29.832 -15.338 -38.547  1.00 86.72  ? 54   LEU C O     1 
ATOM   3643  C  CB    . LEU C 2  54   ? -29.932 -16.760 -36.072  1.00 81.41  ? 54   LEU C CB    1 
ATOM   3644  C  CG    . LEU C 2  54   ? -29.185 -17.175 -34.805  1.00 72.46  ? 54   LEU C CG    1 
ATOM   3645  C  CD1   . LEU C 2  54   ? -28.690 -18.611 -34.918  1.00 69.95  ? 54   LEU C CD1   1 
ATOM   3646  C  CD2   . LEU C 2  54   ? -28.033 -16.227 -34.548  1.00 42.25  ? 54   LEU C CD2   1 
ATOM   3647  N  N     . ASP C 2  55   ? -31.759 -14.324 -37.961  1.00 80.07  ? 55   ASP C N     1 
ATOM   3648  C  CA    . ASP C 2  55   ? -32.157 -14.098 -39.348  1.00 72.11  ? 55   ASP C CA    1 
ATOM   3649  C  C     . ASP C 2  55   ? -31.142 -13.239 -40.094  1.00 66.45  ? 55   ASP C C     1 
ATOM   3650  O  O     . ASP C 2  55   ? -30.919 -13.437 -41.294  1.00 71.87  ? 55   ASP C O     1 
ATOM   3651  C  CB    . ASP C 2  55   ? -33.542 -13.450 -39.403  1.00 89.71  ? 55   ASP C CB    1 
ATOM   3652  C  CG    . ASP C 2  55   ? -34.666 -14.447 -39.189  1.00 104.44 ? 55   ASP C CG    1 
ATOM   3653  O  OD1   . ASP C 2  55   ? -34.375 -15.616 -38.860  1.00 105.40 ? 55   ASP C OD1   1 
ATOM   3654  O  OD2   . ASP C 2  55   ? -35.843 -14.061 -39.360  1.00 108.98 ? 55   ASP C OD2   1 
ATOM   3655  N  N     . VAL C 2  56   ? -30.520 -12.281 -39.402  1.00 65.04  ? 56   VAL C N     1 
ATOM   3656  C  CA    . VAL C 2  56   ? -29.580 -11.370 -40.053  1.00 68.57  ? 56   VAL C CA    1 
ATOM   3657  C  C     . VAL C 2  56   ? -28.448 -12.150 -40.711  1.00 65.51  ? 56   VAL C C     1 
ATOM   3658  O  O     . VAL C 2  56   ? -28.108 -11.923 -41.879  1.00 77.22  ? 56   VAL C O     1 
ATOM   3659  C  CB    . VAL C 2  56   ? -29.043 -10.342 -39.041  1.00 79.81  ? 56   VAL C CB    1 
ATOM   3660  C  CG1   . VAL C 2  56   ? -28.001 -9.446  -39.691  1.00 78.58  ? 56   VAL C CG1   1 
ATOM   3661  C  CG2   . VAL C 2  56   ? -30.182 -9.514  -38.484  1.00 92.70  ? 56   VAL C CG2   1 
ATOM   3662  N  N     . GLN C 2  57   ? -27.849 -13.083 -39.969  1.00 57.51  ? 57   GLN C N     1 
ATOM   3663  C  CA    . GLN C 2  57   ? -26.820 -13.945 -40.537  1.00 54.18  ? 57   GLN C CA    1 
ATOM   3664  C  C     . GLN C 2  57   ? -27.415 -15.023 -41.437  1.00 60.15  ? 57   GLN C C     1 
ATOM   3665  O  O     . GLN C 2  57   ? -26.804 -15.386 -42.447  1.00 73.68  ? 57   GLN C O     1 
ATOM   3666  C  CB    . GLN C 2  57   ? -25.996 -14.584 -39.416  1.00 54.10  ? 57   GLN C CB    1 
ATOM   3667  C  CG    . GLN C 2  57   ? -25.258 -13.584 -38.530  1.00 64.18  ? 57   GLN C CG    1 
ATOM   3668  C  CD    . GLN C 2  57   ? -23.971 -13.078 -39.156  1.00 65.25  ? 57   GLN C CD    1 
ATOM   3669  O  OE1   . GLN C 2  57   ? -23.130 -13.864 -39.594  1.00 49.92  ? 57   GLN C OE1   1 
ATOM   3670  N  NE2   . GLN C 2  57   ? -23.812 -11.760 -39.203  1.00 75.14  ? 57   GLN C NE2   1 
ATOM   3671  N  N     . THR C 2  58   ? -28.606 -15.525 -41.102  1.00 52.93  ? 58   THR C N     1 
ATOM   3672  C  CA    . THR C 2  58   ? -29.203 -16.617 -41.866  1.00 53.59  ? 58   THR C CA    1 
ATOM   3673  C  C     . THR C 2  58   ? -29.723 -16.131 -43.216  1.00 74.25  ? 58   THR C C     1 
ATOM   3674  O  O     . THR C 2  58   ? -29.303 -16.623 -44.269  1.00 81.16  ? 58   THR C O     1 
ATOM   3675  C  CB    . THR C 2  58   ? -30.326 -17.271 -41.054  1.00 68.13  ? 58   THR C CB    1 
ATOM   3676  O  OG1   . THR C 2  58   ? -29.765 -17.969 -39.936  1.00 71.88  ? 58   THR C OG1   1 
ATOM   3677  C  CG2   . THR C 2  58   ? -31.116 -18.248 -41.910  1.00 82.00  ? 58   THR C CG2   1 
ATOM   3678  N  N     . ASP C 2  59   ? -30.636 -15.154 -43.202  1.00 86.97  ? 59   ASP C N     1 
ATOM   3679  C  CA    . ASP C 2  59   ? -31.290 -14.725 -44.437  1.00 88.58  ? 59   ASP C CA    1 
ATOM   3680  C  C     . ASP C 2  59   ? -30.287 -14.183 -45.449  1.00 80.49  ? 59   ASP C C     1 
ATOM   3681  O  O     . ASP C 2  59   ? -30.446 -14.384 -46.659  1.00 76.92  ? 59   ASP C O     1 
ATOM   3682  C  CB    . ASP C 2  59   ? -32.354 -13.670 -44.132  1.00 93.45  ? 59   ASP C CB    1 
ATOM   3683  C  CG    . ASP C 2  59   ? -33.472 -14.201 -43.255  1.00 112.29 ? 59   ASP C CG    1 
ATOM   3684  O  OD1   . ASP C 2  59   ? -33.482 -15.417 -42.968  1.00 112.03 ? 59   ASP C OD1   1 
ATOM   3685  O  OD2   . ASP C 2  59   ? -34.342 -13.400 -42.853  1.00 104.15 ? 59   ASP C OD2   1 
ATOM   3686  N  N     . SER C 2  60   ? -29.248 -13.492 -44.974  1.00 82.25  ? 60   SER C N     1 
ATOM   3687  C  CA    . SER C 2  60   ? -28.277 -12.902 -45.890  1.00 75.31  ? 60   SER C CA    1 
ATOM   3688  C  C     . SER C 2  60   ? -27.512 -13.975 -46.654  1.00 68.25  ? 60   SER C C     1 
ATOM   3689  O  O     . SER C 2  60   ? -27.173 -13.788 -47.829  1.00 58.37  ? 60   SER C O     1 
ATOM   3690  C  CB    . SER C 2  60   ? -27.311 -12.002 -45.123  1.00 77.51  ? 60   SER C CB    1 
ATOM   3691  O  OG    . SER C 2  60   ? -26.378 -11.401 -46.004  1.00 76.10  ? 60   SER C OG    1 
ATOM   3692  N  N     . PHE C 2  61   ? -27.233 -15.108 -46.007  1.00 65.79  ? 61   PHE C N     1 
ATOM   3693  C  CA    . PHE C 2  61   ? -26.477 -16.168 -46.664  1.00 71.90  ? 61   PHE C CA    1 
ATOM   3694  C  C     . PHE C 2  61   ? -27.360 -17.047 -47.540  1.00 68.71  ? 61   PHE C C     1 
ATOM   3695  O  O     . PHE C 2  61   ? -26.891 -17.556 -48.565  1.00 69.91  ? 61   PHE C O     1 
ATOM   3696  C  CB    . PHE C 2  61   ? -25.750 -17.025 -45.626  1.00 75.96  ? 61   PHE C CB    1 
ATOM   3697  C  CG    . PHE C 2  61   ? -24.699 -17.923 -46.215  1.00 67.68  ? 61   PHE C CG    1 
ATOM   3698  C  CD1   . PHE C 2  61   ? -24.933 -19.279 -46.381  1.00 60.19  ? 61   PHE C CD1   1 
ATOM   3699  C  CD2   . PHE C 2  61   ? -23.479 -17.406 -46.616  1.00 67.87  ? 61   PHE C CD2   1 
ATOM   3700  C  CE1   . PHE C 2  61   ? -23.965 -20.102 -46.929  1.00 63.73  ? 61   PHE C CE1   1 
ATOM   3701  C  CE2   . PHE C 2  61   ? -22.509 -18.223 -47.165  1.00 66.93  ? 61   PHE C CE2   1 
ATOM   3702  C  CZ    . PHE C 2  61   ? -22.752 -19.572 -47.321  1.00 68.51  ? 61   PHE C CZ    1 
ATOM   3703  N  N     . GLU C 2  62   ? -28.626 -17.241 -47.161  1.00 63.24  ? 62   GLU C N     1 
ATOM   3704  C  CA    . GLU C 2  62   ? -29.533 -18.033 -47.987  1.00 76.68  ? 62   GLU C CA    1 
ATOM   3705  C  C     . GLU C 2  62   ? -29.782 -17.362 -49.333  1.00 84.05  ? 62   GLU C C     1 
ATOM   3706  O  O     . GLU C 2  62   ? -29.913 -18.042 -50.357  1.00 95.63  ? 62   GLU C O     1 
ATOM   3707  C  CB    . GLU C 2  62   ? -30.851 -18.264 -47.250  1.00 91.81  ? 62   GLU C CB    1 
ATOM   3708  C  CG    . GLU C 2  62   ? -30.688 -18.892 -45.878  1.00 99.52  ? 62   GLU C CG    1 
ATOM   3709  C  CD    . GLU C 2  62   ? -32.010 -19.118 -45.178  1.00 118.01 ? 62   GLU C CD    1 
ATOM   3710  O  OE1   . GLU C 2  62   ? -32.405 -20.292 -45.026  1.00 132.30 ? 62   GLU C OE1   1 
ATOM   3711  O  OE2   . GLU C 2  62   ? -32.656 -18.123 -44.784  1.00 104.35 ? 62   GLU C OE2   1 
ATOM   3712  N  N     . TRP C 2  63   ? -29.857 -16.029 -49.349  1.00 70.91  ? 63   TRP C N     1 
ATOM   3713  C  CA    . TRP C 2  63   ? -29.984 -15.311 -50.614  1.00 67.26  ? 63   TRP C CA    1 
ATOM   3714  C  C     . TRP C 2  63   ? -28.726 -15.457 -51.460  1.00 71.57  ? 63   TRP C C     1 
ATOM   3715  O  O     . TRP C 2  63   ? -28.807 -15.553 -52.690  1.00 83.81  ? 63   TRP C O     1 
ATOM   3716  C  CB    . TRP C 2  63   ? -30.281 -13.834 -50.354  1.00 63.38  ? 63   TRP C CB    1 
ATOM   3717  C  CG    . TRP C 2  63   ? -29.923 -12.944 -51.507  1.00 66.07  ? 63   TRP C CG    1 
ATOM   3718  C  CD1   . TRP C 2  63   ? -30.683 -12.685 -52.610  1.00 90.11  ? 63   TRP C CD1   1 
ATOM   3719  C  CD2   . TRP C 2  63   ? -28.710 -12.198 -51.672  1.00 64.16  ? 63   TRP C CD2   1 
ATOM   3720  N  NE1   . TRP C 2  63   ? -30.020 -11.825 -53.451  1.00 92.77  ? 63   TRP C NE1   1 
ATOM   3721  C  CE2   . TRP C 2  63   ? -28.806 -11.511 -52.898  1.00 80.69  ? 63   TRP C CE2   1 
ATOM   3722  C  CE3   . TRP C 2  63   ? -27.553 -12.046 -50.903  1.00 76.34  ? 63   TRP C CE3   1 
ATOM   3723  C  CZ2   . TRP C 2  63   ? -27.790 -10.684 -53.372  1.00 104.18 ? 63   TRP C CZ2   1 
ATOM   3724  C  CZ3   . TRP C 2  63   ? -26.546 -11.225 -51.374  1.00 87.68  ? 63   TRP C CZ3   1 
ATOM   3725  C  CH2   . TRP C 2  63   ? -26.671 -10.554 -52.597  1.00 101.06 ? 63   TRP C CH2   1 
ATOM   3726  N  N     . LEU C 2  64   ? -27.555 -15.477 -50.818  1.00 64.83  ? 64   LEU C N     1 
ATOM   3727  C  CA    . LEU C 2  64   ? -26.299 -15.540 -51.560  1.00 68.65  ? 64   LEU C CA    1 
ATOM   3728  C  C     . LEU C 2  64   ? -26.181 -16.836 -52.351  1.00 79.04  ? 64   LEU C C     1 
ATOM   3729  O  O     . LEU C 2  64   ? -25.734 -16.829 -53.504  1.00 97.21  ? 64   LEU C O     1 
ATOM   3730  C  CB    . LEU C 2  64   ? -25.119 -15.391 -50.600  1.00 59.98  ? 64   LEU C CB    1 
ATOM   3731  C  CG    . LEU C 2  64   ? -23.734 -15.617 -51.207  1.00 61.36  ? 64   LEU C CG    1 
ATOM   3732  C  CD1   . LEU C 2  64   ? -23.432 -14.569 -52.271  1.00 80.93  ? 64   LEU C CD1   1 
ATOM   3733  C  CD2   . LEU C 2  64   ? -22.664 -15.626 -50.125  1.00 69.40  ? 64   LEU C CD2   1 
ATOM   3734  N  N     . ILE C 2  65   ? -26.578 -17.959 -51.752  1.00 88.06  ? 65   ILE C N     1 
ATOM   3735  C  CA    . ILE C 2  65   ? -26.442 -19.265 -52.386  1.00 98.54  ? 65   ILE C CA    1 
ATOM   3736  C  C     . ILE C 2  65   ? -27.755 -19.748 -52.996  1.00 82.33  ? 65   ILE C C     1 
ATOM   3737  O  O     . ILE C 2  65   ? -27.829 -20.886 -53.469  1.00 81.36  ? 65   ILE C O     1 
ATOM   3738  C  CB    . ILE C 2  65   ? -25.877 -20.298 -51.397  1.00 105.34 ? 65   ILE C CB    1 
ATOM   3739  C  CG1   . ILE C 2  65   ? -26.738 -20.367 -50.134  1.00 89.05  ? 65   ILE C CG1   1 
ATOM   3740  C  CG2   . ILE C 2  65   ? -24.441 -19.952 -51.038  1.00 99.13  ? 65   ILE C CG2   1 
ATOM   3741  C  CD1   . ILE C 2  65   ? -27.633 -21.581 -50.068  1.00 74.76  ? 65   ILE C CD1   1 
ATOM   3742  N  N     . GLY C 2  66   ? -28.790 -18.910 -52.999  1.00 71.68  ? 66   GLY C N     1 
ATOM   3743  C  CA    . GLY C 2  66   ? -30.046 -19.241 -53.647  1.00 85.42  ? 66   GLY C CA    1 
ATOM   3744  C  C     . GLY C 2  66   ? -30.710 -20.505 -53.139  1.00 98.70  ? 66   GLY C C     1 
ATOM   3745  O  O     . GLY C 2  66   ? -31.133 -21.352 -53.932  1.00 109.21 ? 66   GLY C O     1 
ATOM   3746  N  N     . SER C 2  67   ? -30.809 -20.641 -51.818  1.00 99.04  ? 67   SER C N     1 
ATOM   3747  C  CA    . SER C 2  67   ? -31.415 -21.821 -51.226  1.00 94.17  ? 67   SER C CA    1 
ATOM   3748  C  C     . SER C 2  67   ? -32.914 -21.853 -51.517  1.00 89.55  ? 67   SER C C     1 
ATOM   3749  O  O     . SER C 2  67   ? -33.520 -20.823 -51.823  1.00 98.32  ? 67   SER C O     1 
ATOM   3750  C  CB    . SER C 2  67   ? -31.170 -21.844 -49.718  1.00 101.57 ? 67   SER C CB    1 
ATOM   3751  O  OG    . SER C 2  67   ? -31.961 -20.876 -49.050  1.00 102.02 ? 67   SER C OG    1 
ATOM   3752  N  N     . PRO C 2  68   ? -33.535 -23.035 -51.443  1.00 82.40  ? 68   PRO C N     1 
ATOM   3753  C  CA    . PRO C 2  68   ? -34.989 -23.107 -51.665  1.00 92.26  ? 68   PRO C CA    1 
ATOM   3754  C  C     . PRO C 2  68   ? -35.798 -22.293 -50.670  1.00 103.49 ? 68   PRO C C     1 
ATOM   3755  O  O     . PRO C 2  68   ? -36.847 -21.751 -51.039  1.00 109.12 ? 68   PRO C O     1 
ATOM   3756  C  CB    . PRO C 2  68   ? -35.286 -24.608 -51.541  1.00 89.55  ? 68   PRO C CB    1 
ATOM   3757  C  CG    . PRO C 2  68   ? -33.994 -25.276 -51.869  1.00 107.86 ? 68   PRO C CG    1 
ATOM   3758  C  CD    . PRO C 2  68   ? -32.930 -24.373 -51.320  1.00 96.52  ? 68   PRO C CD    1 
ATOM   3759  N  N     . ARG C 2  69   ? -35.346 -22.192 -49.416  1.00 107.74 ? 69   ARG C N     1 
ATOM   3760  C  CA    . ARG C 2  69   ? -36.076 -21.399 -48.431  1.00 115.32 ? 69   ARG C CA    1 
ATOM   3761  C  C     . ARG C 2  69   ? -36.104 -19.927 -48.818  1.00 103.22 ? 69   ARG C C     1 
ATOM   3762  O  O     . ARG C 2  69   ? -37.152 -19.275 -48.733  1.00 111.92 ? 69   ARG C O     1 
ATOM   3763  C  CB    . ARG C 2  69   ? -35.456 -21.571 -47.044  1.00 133.93 ? 69   ARG C CB    1 
ATOM   3764  C  CG    . ARG C 2  69   ? -36.368 -22.248 -46.034  1.00 124.52 ? 69   ARG C CG    1 
ATOM   3765  C  CD    . ARG C 2  69   ? -35.977 -21.881 -44.613  1.00 120.13 ? 69   ARG C CD    1 
ATOM   3766  N  NE    . ARG C 2  69   ? -34.528 -21.802 -44.457  1.00 150.15 ? 69   ARG C NE    1 
ATOM   3767  C  CZ    . ARG C 2  69   ? -33.744 -22.845 -44.205  1.00 161.49 ? 69   ARG C CZ    1 
ATOM   3768  N  NH1   . ARG C 2  69   ? -34.266 -24.057 -44.080  1.00 157.85 ? 69   ARG C NH1   1 
ATOM   3769  N  NH2   . ARG C 2  69   ? -32.434 -22.675 -44.081  1.00 154.51 ? 69   ARG C NH2   1 
ATOM   3770  N  N     . TRP C 2  70   ? -34.960 -19.381 -49.238  1.00 92.41  ? 70   TRP C N     1 
ATOM   3771  C  CA    . TRP C 2  70   ? -34.928 -17.995 -49.691  1.00 99.86  ? 70   TRP C CA    1 
ATOM   3772  C  C     . TRP C 2  70   ? -35.791 -17.800 -50.930  1.00 107.60 ? 70   TRP C C     1 
ATOM   3773  O  O     . TRP C 2  70   ? -36.522 -16.807 -51.038  1.00 98.74  ? 70   TRP C O     1 
ATOM   3774  C  CB    . TRP C 2  70   ? -33.492 -17.559 -49.976  1.00 85.96  ? 70   TRP C CB    1 
ATOM   3775  C  CG    . TRP C 2  70   ? -33.427 -16.377 -50.894  1.00 102.00 ? 70   TRP C CG    1 
ATOM   3776  C  CD1   . TRP C 2  70   ? -33.545 -15.062 -50.548  1.00 105.19 ? 70   TRP C CD1   1 
ATOM   3777  C  CD2   . TRP C 2  70   ? -33.249 -16.404 -52.315  1.00 100.40 ? 70   TRP C CD2   1 
ATOM   3778  N  NE1   . TRP C 2  70   ? -33.445 -14.269 -51.666  1.00 107.81 ? 70   TRP C NE1   1 
ATOM   3779  C  CE2   . TRP C 2  70   ? -33.264 -15.069 -52.764  1.00 109.12 ? 70   TRP C CE2   1 
ATOM   3780  C  CE3   . TRP C 2  70   ? -33.078 -17.428 -53.251  1.00 98.55  ? 70   TRP C CE3   1 
ATOM   3781  C  CZ2   . TRP C 2  70   ? -33.111 -14.731 -54.108  1.00 117.65 ? 70   TRP C CZ2   1 
ATOM   3782  C  CZ3   . TRP C 2  70   ? -32.927 -17.092 -54.583  1.00 108.90 ? 70   TRP C CZ3   1 
ATOM   3783  C  CH2   . TRP C 2  70   ? -32.945 -15.756 -54.999  1.00 106.83 ? 70   TRP C CH2   1 
ATOM   3784  N  N     . ARG C 2  71   ? -35.711 -18.733 -51.883  1.00 112.50 ? 71   ARG C N     1 
ATOM   3785  C  CA    . ARG C 2  71   ? -36.498 -18.617 -53.107  1.00 118.68 ? 71   ARG C CA    1 
ATOM   3786  C  C     . ARG C 2  71   ? -37.990 -18.662 -52.811  1.00 123.00 ? 71   ARG C C     1 
ATOM   3787  O  O     . ARG C 2  71   ? -38.769 -17.893 -53.388  1.00 132.61 ? 71   ARG C O     1 
ATOM   3788  C  CB    . ARG C 2  71   ? -36.112 -19.727 -54.085  1.00 122.00 ? 71   ARG C CB    1 
ATOM   3789  C  CG    . ARG C 2  71   ? -36.935 -19.740 -55.363  1.00 114.27 ? 71   ARG C CG    1 
ATOM   3790  C  CD    . ARG C 2  71   ? -36.394 -20.754 -56.355  1.00 101.99 ? 71   ARG C CD    1 
ATOM   3791  N  NE    . ARG C 2  71   ? -34.988 -20.512 -56.663  1.00 105.40 ? 71   ARG C NE    1 
ATOM   3792  C  CZ    . ARG C 2  71   ? -34.562 -19.631 -57.562  1.00 122.71 ? 71   ARG C CZ    1 
ATOM   3793  N  NH1   . ARG C 2  71   ? -35.435 -18.902 -58.243  1.00 106.01 ? 71   ARG C NH1   1 
ATOM   3794  N  NH2   . ARG C 2  71   ? -33.263 -19.477 -57.778  1.00 114.82 ? 71   ARG C NH2   1 
ATOM   3795  N  N     . GLU C 2  72   ? -38.408 -19.560 -51.917  1.00 111.49 ? 72   GLU C N     1 
ATOM   3796  C  CA    . GLU C 2  72   ? -39.815 -19.624 -51.534  1.00 118.30 ? 72   GLU C CA    1 
ATOM   3797  C  C     . GLU C 2  72   ? -40.235 -18.374 -50.769  1.00 109.75 ? 72   GLU C C     1 
ATOM   3798  O  O     . GLU C 2  72   ? -41.369 -17.902 -50.918  1.00 107.43 ? 72   GLU C O     1 
ATOM   3799  C  CB    . GLU C 2  72   ? -40.075 -20.880 -50.704  1.00 131.18 ? 72   GLU C CB    1 
ATOM   3800  C  CG    . GLU C 2  72   ? -40.012 -22.174 -51.502  1.00 144.10 ? 72   GLU C CG    1 
ATOM   3801  C  CD    . GLU C 2  72   ? -40.311 -23.396 -50.656  1.00 163.81 ? 72   GLU C CD    1 
ATOM   3802  O  OE1   . GLU C 2  72   ? -40.346 -23.267 -49.414  1.00 160.99 ? 72   GLU C OE1   1 
ATOM   3803  O  OE2   . GLU C 2  72   ? -40.514 -24.485 -51.234  1.00 159.07 ? 72   GLU C OE2   1 
ATOM   3804  N  N     . SER C 2  73   ? -39.338 -17.826 -49.946  1.00 103.85 ? 73   SER C N     1 
ATOM   3805  C  CA    . SER C 2  73   ? -39.636 -16.575 -49.256  1.00 115.12 ? 73   SER C CA    1 
ATOM   3806  C  C     . SER C 2  73   ? -39.812 -15.431 -50.246  1.00 120.30 ? 73   SER C C     1 
ATOM   3807  O  O     . SER C 2  73   ? -40.710 -14.595 -50.089  1.00 121.48 ? 73   SER C O     1 
ATOM   3808  C  CB    . SER C 2  73   ? -38.530 -16.250 -48.252  1.00 122.96 ? 73   SER C CB    1 
ATOM   3809  O  OG    . SER C 2  73   ? -38.578 -14.887 -47.862  1.00 127.68 ? 73   SER C OG    1 
ATOM   3810  N  N     . ALA C 2  74   ? -38.963 -15.379 -51.275  1.00 116.85 ? 74   ALA C N     1 
ATOM   3811  C  CA    . ALA C 2  74   ? -39.087 -14.333 -52.284  1.00 114.09 ? 74   ALA C CA    1 
ATOM   3812  C  C     . ALA C 2  74   ? -40.325 -14.530 -53.151  1.00 102.54 ? 74   ALA C C     1 
ATOM   3813  O  O     . ALA C 2  74   ? -40.880 -13.552 -53.665  1.00 109.73 ? 74   ALA C O     1 
ATOM   3814  C  CB    . ALA C 2  74   ? -37.831 -14.291 -53.154  1.00 104.41 ? 74   ALA C CB    1 
ATOM   3815  N  N     . ALA C 2  75   ? -40.771 -15.776 -53.323  1.00 97.14  ? 75   ALA C N     1 
ATOM   3816  C  CA    . ALA C 2  75   ? -41.946 -16.041 -54.148  1.00 110.31 ? 75   ALA C CA    1 
ATOM   3817  C  C     . ALA C 2  75   ? -43.195 -15.405 -53.549  1.00 100.18 ? 75   ALA C C     1 
ATOM   3818  O  O     . ALA C 2  75   ? -43.967 -14.742 -54.252  1.00 104.77 ? 75   ALA C O     1 
ATOM   3819  C  CB    . ALA C 2  75   ? -42.136 -17.548 -54.323  1.00 113.95 ? 75   ALA C CB    1 
ATOM   3820  N  N     . GLU C 2  76   ? -43.413 -15.600 -52.246  1.00 97.70  ? 76   GLU C N     1 
ATOM   3821  C  CA    . GLU C 2  76   ? -44.549 -14.967 -51.585  1.00 114.73 ? 76   GLU C CA    1 
ATOM   3822  C  C     . GLU C 2  76   ? -44.327 -13.477 -51.368  1.00 107.77 ? 76   GLU C C     1 
ATOM   3823  O  O     . GLU C 2  76   ? -45.293 -12.749 -51.115  1.00 113.55 ? 76   GLU C O     1 
ATOM   3824  C  CB    . GLU C 2  76   ? -44.835 -15.649 -50.246  1.00 127.45 ? 76   GLU C CB    1 
ATOM   3825  C  CG    . GLU C 2  76   ? -43.749 -15.459 -49.200  1.00 149.41 ? 76   GLU C CG    1 
ATOM   3826  C  CD    . GLU C 2  76   ? -44.179 -15.932 -47.826  1.00 154.48 ? 76   GLU C CD    1 
ATOM   3827  O  OE1   . GLU C 2  76   ? -45.274 -16.524 -47.716  1.00 150.47 ? 76   GLU C OE1   1 
ATOM   3828  O  OE2   . GLU C 2  76   ? -43.425 -15.708 -46.855  1.00 155.82 ? 76   GLU C OE2   1 
ATOM   3829  N  N     . ARG C 2  77   ? -43.080 -13.010 -51.461  1.00 97.30  ? 77   ARG C N     1 
ATOM   3830  C  CA    . ARG C 2  77   ? -42.780 -11.589 -51.350  1.00 95.99  ? 77   ARG C CA    1 
ATOM   3831  C  C     . ARG C 2  77   ? -43.251 -10.801 -52.566  1.00 111.57 ? 77   ARG C C     1 
ATOM   3832  O  O     . ARG C 2  77   ? -43.181 -9.567  -52.554  1.00 106.57 ? 77   ARG C O     1 
ATOM   3833  C  CB    . ARG C 2  77   ? -41.273 -11.402 -51.140  1.00 103.56 ? 77   ARG C CB    1 
ATOM   3834  C  CG    . ARG C 2  77   ? -40.867 -10.056 -50.553  1.00 95.40  ? 77   ARG C CG    1 
ATOM   3835  C  CD    . ARG C 2  77   ? -39.512 -10.135 -49.862  1.00 111.07 ? 77   ARG C CD    1 
ATOM   3836  N  NE    . ARG C 2  77   ? -38.450 -10.573 -50.763  1.00 134.09 ? 77   ARG C NE    1 
ATOM   3837  C  CZ    . ARG C 2  77   ? -37.224 -10.901 -50.367  1.00 129.54 ? 77   ARG C CZ    1 
ATOM   3838  N  NH1   . ARG C 2  77   ? -36.902 -10.847 -49.082  1.00 118.27 ? 77   ARG C NH1   1 
ATOM   3839  N  NH2   . ARG C 2  77   ? -36.319 -11.288 -51.256  1.00 115.28 ? 77   ARG C NH2   1 
ATOM   3840  N  N     . GLY C 2  78   ? -43.742 -11.480 -53.601  1.00 125.34 ? 78   GLY C N     1 
ATOM   3841  C  CA    . GLY C 2  78   ? -44.177 -10.840 -54.821  1.00 126.99 ? 78   GLY C CA    1 
ATOM   3842  C  C     . GLY C 2  78   ? -43.147 -10.836 -55.928  1.00 117.77 ? 78   GLY C C     1 
ATOM   3843  O  O     . GLY C 2  78   ? -43.469 -10.424 -57.049  1.00 108.42 ? 78   GLY C O     1 
ATOM   3844  N  N     . ASP C 2  79   ? -41.926 -11.288 -55.646  1.00 115.72 ? 79   ASP C N     1 
ATOM   3845  C  CA    . ASP C 2  79   ? -40.856 -11.266 -56.634  1.00 118.82 ? 79   ASP C CA    1 
ATOM   3846  C  C     . ASP C 2  79   ? -41.223 -12.090 -57.861  1.00 112.30 ? 79   ASP C C     1 
ATOM   3847  O  O     . ASP C 2  79   ? -41.983 -13.059 -57.787  1.00 99.10  ? 79   ASP C O     1 
ATOM   3848  C  CB    . ASP C 2  79   ? -39.561 -11.800 -56.023  1.00 114.09 ? 79   ASP C CB    1 
ATOM   3849  C  CG    . ASP C 2  79   ? -38.871 -10.784 -55.140  1.00 124.13 ? 79   ASP C CG    1 
ATOM   3850  O  OD1   . ASP C 2  79   ? -37.761 -10.339 -55.501  1.00 139.35 ? 79   ASP C OD1   1 
ATOM   3851  O  OD2   . ASP C 2  79   ? -39.451 -10.414 -54.098  1.00 125.34 ? 79   ASP C OD2   1 
ATOM   3852  N  N     . VAL C 2  80   ? -40.669 -11.689 -59.001  1.00 116.21 ? 80   VAL C N     1 
ATOM   3853  C  CA    . VAL C 2  80   ? -40.835 -12.401 -60.261  1.00 111.90 ? 80   VAL C CA    1 
ATOM   3854  C  C     . VAL C 2  80   ? -39.446 -12.675 -60.819  1.00 114.52 ? 80   VAL C C     1 
ATOM   3855  O  O     . VAL C 2  80   ? -38.679 -11.738 -61.072  1.00 109.89 ? 80   VAL C O     1 
ATOM   3856  C  CB    . VAL C 2  80   ? -41.691 -11.610 -61.264  1.00 104.76 ? 80   VAL C CB    1 
ATOM   3857  C  CG1   . VAL C 2  80   ? -41.450 -10.119 -61.108  1.00 108.35 ? 80   VAL C CG1   1 
ATOM   3858  C  CG2   . VAL C 2  80   ? -41.401 -12.061 -62.690  1.00 120.37 ? 80   VAL C CG2   1 
ATOM   3859  N  N     . ASN C 2  81   ? -39.123 -13.956 -60.997  1.00 111.69 ? 81   ASN C N     1 
ATOM   3860  C  CA    . ASN C 2  81   ? -37.798 -14.410 -61.400  1.00 111.74 ? 81   ASN C CA    1 
ATOM   3861  C  C     . ASN C 2  81   ? -36.725 -13.844 -60.476  1.00 112.55 ? 81   ASN C C     1 
ATOM   3862  O  O     . ASN C 2  81   ? -35.897 -13.034 -60.913  1.00 96.11  ? 81   ASN C O     1 
ATOM   3863  C  CB    . ASN C 2  81   ? -37.508 -14.017 -62.851  1.00 113.90 ? 81   ASN C CB    1 
ATOM   3864  C  CG    . ASN C 2  81   ? -38.472 -14.654 -63.831  1.00 115.30 ? 81   ASN C CG    1 
ATOM   3865  O  OD1   . ASN C 2  81   ? -39.067 -15.694 -63.549  1.00 111.79 ? 81   ASN C OD1   1 
ATOM   3866  N  ND2   . ASN C 2  81   ? -38.627 -14.034 -64.996  1.00 123.82 ? 81   ASN C ND2   1 
ATOM   3867  N  N     . PRO C 2  82   ? -36.701 -14.235 -59.203  1.00 112.55 ? 82   PRO C N     1 
ATOM   3868  C  CA    . PRO C 2  82   ? -35.648 -13.749 -58.307  1.00 94.66  ? 82   PRO C CA    1 
ATOM   3869  C  C     . PRO C 2  82   ? -34.317 -14.416 -58.615  1.00 89.42  ? 82   PRO C C     1 
ATOM   3870  O  O     . PRO C 2  82   ? -34.248 -15.505 -59.190  1.00 81.81  ? 82   PRO C O     1 
ATOM   3871  C  CB    . PRO C 2  82   ? -36.159 -14.136 -56.917  1.00 105.01 ? 82   PRO C CB    1 
ATOM   3872  C  CG    . PRO C 2  82   ? -36.985 -15.348 -57.164  1.00 110.41 ? 82   PRO C CG    1 
ATOM   3873  C  CD    . PRO C 2  82   ? -37.621 -15.161 -58.518  1.00 105.91 ? 82   PRO C CD    1 
ATOM   3874  N  N     . VAL C 2  83   ? -33.243 -13.740 -58.217  1.00 90.58  ? 83   VAL C N     1 
ATOM   3875  C  CA    . VAL C 2  83   ? -31.885 -14.149 -58.557  1.00 96.59  ? 83   VAL C CA    1 
ATOM   3876  C  C     . VAL C 2  83   ? -31.035 -14.114 -57.295  1.00 92.30  ? 83   VAL C C     1 
ATOM   3877  O  O     . VAL C 2  83   ? -30.964 -13.082 -56.617  1.00 92.28  ? 83   VAL C O     1 
ATOM   3878  C  CB    . VAL C 2  83   ? -31.278 -13.251 -59.648  1.00 102.67 ? 83   VAL C CB    1 
ATOM   3879  C  CG1   . VAL C 2  83   ? -29.780 -13.422 -59.703  1.00 93.14  ? 83   VAL C CG1   1 
ATOM   3880  C  CG2   . VAL C 2  83   ? -31.885 -13.583 -60.995  1.00 132.58 ? 83   VAL C CG2   1 
ATOM   3881  N  N     . GLY C 2  84   ? -30.390 -15.236 -56.984  1.00 87.20  ? 84   GLY C N     1 
ATOM   3882  C  CA    . GLY C 2  84   ? -29.516 -15.304 -55.832  1.00 86.80  ? 84   GLY C CA    1 
ATOM   3883  C  C     . GLY C 2  84   ? -28.235 -14.517 -56.030  1.00 86.76  ? 84   GLY C C     1 
ATOM   3884  O  O     . GLY C 2  84   ? -27.893 -14.076 -57.128  1.00 89.06  ? 84   GLY C O     1 
ATOM   3885  N  N     . GLY C 2  85   ? -27.506 -14.344 -54.923  1.00 92.79  ? 85   GLY C N     1 
ATOM   3886  C  CA    . GLY C 2  85   ? -26.286 -13.554 -54.962  1.00 84.52  ? 85   GLY C CA    1 
ATOM   3887  C  C     . GLY C 2  85   ? -25.209 -14.152 -55.844  1.00 88.07  ? 85   GLY C C     1 
ATOM   3888  O  O     . GLY C 2  85   ? -24.439 -13.420 -56.472  1.00 92.69  ? 85   GLY C O     1 
ATOM   3889  N  N     . LEU C 2  86   ? -25.134 -15.483 -55.902  1.00 86.21  ? 86   LEU C N     1 
ATOM   3890  C  CA    . LEU C 2  86   ? -24.186 -16.134 -56.799  1.00 69.91  ? 86   LEU C CA    1 
ATOM   3891  C  C     . LEU C 2  86   ? -24.629 -16.003 -58.249  1.00 78.94  ? 86   LEU C C     1 
ATOM   3892  O  O     . LEU C 2  86   ? -23.826 -15.667 -59.127  1.00 97.36  ? 86   LEU C O     1 
ATOM   3893  C  CB    . LEU C 2  86   ? -24.019 -17.604 -56.419  1.00 71.61  ? 86   LEU C CB    1 
ATOM   3894  C  CG    . LEU C 2  86   ? -22.875 -17.901 -55.452  1.00 73.80  ? 86   LEU C CG    1 
ATOM   3895  C  CD1   . LEU C 2  86   ? -22.655 -19.397 -55.333  1.00 70.27  ? 86   LEU C CD1   1 
ATOM   3896  C  CD2   . LEU C 2  86   ? -21.609 -17.203 -55.917  1.00 61.19  ? 86   LEU C CD2   1 
ATOM   3897  N  N     . GLU C 2  87   ? -25.907 -16.277 -58.520  1.00 72.26  ? 87   GLU C N     1 
ATOM   3898  C  CA    . GLU C 2  87   ? -26.435 -16.059 -59.861  1.00 88.03  ? 87   GLU C CA    1 
ATOM   3899  C  C     . GLU C 2  87   ? -26.259 -14.604 -60.282  1.00 88.98  ? 87   GLU C C     1 
ATOM   3900  O  O     . GLU C 2  87   ? -25.868 -14.323 -61.419  1.00 99.75  ? 87   GLU C O     1 
ATOM   3901  C  CB    . GLU C 2  87   ? -27.907 -16.473 -59.915  1.00 91.59  ? 87   GLU C CB    1 
ATOM   3902  C  CG    . GLU C 2  87   ? -28.183 -17.854 -59.324  1.00 112.04 ? 87   GLU C CG    1 
ATOM   3903  C  CD    . GLU C 2  87   ? -29.660 -18.109 -59.079  1.00 130.58 ? 87   GLU C CD    1 
ATOM   3904  O  OE1   . GLU C 2  87   ? -30.490 -17.322 -59.579  1.00 128.70 ? 87   GLU C OE1   1 
ATOM   3905  O  OE2   . GLU C 2  87   ? -29.990 -19.094 -58.383  1.00 129.04 ? 87   GLU C OE2   1 
ATOM   3906  N  N     . GLU C 2  88   ? -26.500 -13.665 -59.362  1.00 89.87  ? 88   GLU C N     1 
ATOM   3907  C  CA    . GLU C 2  88   ? -26.373 -12.249 -59.695  1.00 89.69  ? 88   GLU C CA    1 
ATOM   3908  C  C     . GLU C 2  88   ? -24.960 -11.893 -60.142  1.00 83.07  ? 88   GLU C C     1 
ATOM   3909  O  O     . GLU C 2  88   ? -24.783 -11.007 -60.985  1.00 97.26  ? 88   GLU C O     1 
ATOM   3910  C  CB    . GLU C 2  88   ? -26.788 -11.393 -58.498  1.00 91.34  ? 88   GLU C CB    1 
ATOM   3911  C  CG    . GLU C 2  88   ? -26.736 -9.897  -58.745  1.00 101.60 ? 88   GLU C CG    1 
ATOM   3912  C  CD    . GLU C 2  88   ? -27.148 -9.101  -57.526  1.00 120.47 ? 88   GLU C CD    1 
ATOM   3913  O  OE1   . GLU C 2  88   ? -27.678 -9.712  -56.575  1.00 117.60 ? 88   GLU C OE1   1 
ATOM   3914  O  OE2   . GLU C 2  88   ? -26.940 -7.870  -57.516  1.00 129.93 ? 88   GLU C OE2   1 
ATOM   3915  N  N     . VAL C 2  89   ? -23.946 -12.574 -59.605  1.00 84.43  ? 89   VAL C N     1 
ATOM   3916  C  CA    . VAL C 2  89   ? -22.571 -12.315 -60.025  1.00 95.47  ? 89   VAL C CA    1 
ATOM   3917  C  C     . VAL C 2  89   ? -22.303 -12.918 -61.400  1.00 103.73 ? 89   VAL C C     1 
ATOM   3918  O  O     . VAL C 2  89   ? -21.610 -12.317 -62.230  1.00 121.98 ? 89   VAL C O     1 
ATOM   3919  C  CB    . VAL C 2  89   ? -21.587 -12.844 -58.963  1.00 94.48  ? 89   VAL C CB    1 
ATOM   3920  C  CG1   . VAL C 2  89   ? -20.166 -12.893 -59.510  1.00 80.97  ? 89   VAL C CG1   1 
ATOM   3921  C  CG2   . VAL C 2  89   ? -21.641 -11.976 -57.717  1.00 95.54  ? 89   VAL C CG2   1 
ATOM   3922  N  N     . LEU C 2  90   ? -22.859 -14.101 -61.673  1.00 91.47  ? 90   LEU C N     1 
ATOM   3923  C  CA    . LEU C 2  90   ? -22.601 -14.766 -62.947  1.00 93.97  ? 90   LEU C CA    1 
ATOM   3924  C  C     . LEU C 2  90   ? -23.301 -14.057 -64.102  1.00 110.63 ? 90   LEU C C     1 
ATOM   3925  O  O     . LEU C 2  90   ? -22.756 -13.983 -65.210  1.00 118.40 ? 90   LEU C O     1 
ATOM   3926  C  CB    . LEU C 2  90   ? -23.036 -16.228 -62.870  1.00 87.07  ? 90   LEU C CB    1 
ATOM   3927  C  CG    . LEU C 2  90   ? -22.351 -17.062 -61.785  1.00 87.63  ? 90   LEU C CG    1 
ATOM   3928  C  CD1   . LEU C 2  90   ? -22.755 -18.523 -61.886  1.00 90.64  ? 90   LEU C CD1   1 
ATOM   3929  C  CD2   . LEU C 2  90   ? -20.841 -16.917 -61.873  1.00 62.13  ? 90   LEU C CD2   1 
ATOM   3930  N  N     . TYR C 2  91   ? -24.511 -13.540 -63.866  1.00 100.70 ? 91   TYR C N     1 
ATOM   3931  C  CA    . TYR C 2  91   ? -25.229 -12.825 -64.918  1.00 91.89  ? 91   TYR C CA    1 
ATOM   3932  C  C     . TYR C 2  91   ? -24.540 -11.508 -65.258  1.00 106.16 ? 91   TYR C C     1 
ATOM   3933  O  O     . TYR C 2  91   ? -24.444 -11.139 -66.435  1.00 138.11 ? 91   TYR C O     1 
ATOM   3934  C  CB    . TYR C 2  91   ? -26.682 -12.580 -64.500  1.00 84.73  ? 91   TYR C CB    1 
ATOM   3935  C  CG    . TYR C 2  91   ? -27.582 -13.800 -64.584  1.00 114.46 ? 91   TYR C CG    1 
ATOM   3936  C  CD1   . TYR C 2  91   ? -27.287 -14.954 -63.873  1.00 129.76 ? 91   TYR C CD1   1 
ATOM   3937  C  CD2   . TYR C 2  91   ? -28.738 -13.791 -65.359  1.00 124.01 ? 91   TYR C CD2   1 
ATOM   3938  C  CE1   . TYR C 2  91   ? -28.099 -16.066 -63.933  1.00 135.96 ? 91   TYR C CE1   1 
ATOM   3939  C  CE2   . TYR C 2  91   ? -29.563 -14.905 -65.428  1.00 141.79 ? 91   TYR C CE2   1 
ATOM   3940  C  CZ    . TYR C 2  91   ? -29.235 -16.040 -64.710  1.00 139.04 ? 91   TYR C CZ    1 
ATOM   3941  O  OH    . TYR C 2  91   ? -30.039 -17.156 -64.763  1.00 120.63 ? 91   TYR C OH    1 
ATOM   3942  N  N     . GLU C 2  92   ? -24.056 -10.786 -64.244  1.00 101.37 ? 92   GLU C N     1 
ATOM   3943  C  CA    . GLU C 2  92   ? -23.274 -9.582  -64.509  1.00 118.72 ? 92   GLU C CA    1 
ATOM   3944  C  C     . GLU C 2  92   ? -21.992 -9.917  -65.258  1.00 129.78 ? 92   GLU C C     1 
ATOM   3945  O  O     . GLU C 2  92   ? -21.586 -9.184  -66.168  1.00 154.14 ? 92   GLU C O     1 
ATOM   3946  C  CB    . GLU C 2  92   ? -22.947 -8.859  -63.203  1.00 123.57 ? 92   GLU C CB    1 
ATOM   3947  C  CG    . GLU C 2  92   ? -24.139 -8.238  -62.504  1.00 158.12 ? 92   GLU C CG    1 
ATOM   3948  C  CD    . GLU C 2  92   ? -23.731 -7.368  -61.331  1.00 153.91 ? 92   GLU C CD    1 
ATOM   3949  O  OE1   . GLU C 2  92   ? -22.542 -6.992  -61.251  1.00 148.63 ? 92   GLU C OE1   1 
ATOM   3950  O  OE2   . GLU C 2  92   ? -24.601 -7.062  -60.489  1.00 124.89 ? 92   GLU C OE2   1 
ATOM   3951  N  N     . LEU C 2  93   ? -21.336 -11.017 -64.880  1.00 110.69 ? 93   LEU C N     1 
ATOM   3952  C  CA    . LEU C 2  93   ? -20.113 -11.428 -65.560  1.00 104.90 ? 93   LEU C CA    1 
ATOM   3953  C  C     . LEU C 2  93   ? -20.387 -11.770 -67.017  1.00 130.04 ? 93   LEU C C     1 
ATOM   3954  O  O     . LEU C 2  93   ? -19.633 -11.375 -67.915  1.00 152.20 ? 93   LEU C O     1 
ATOM   3955  C  CB    . LEU C 2  93   ? -19.488 -12.625 -64.839  1.00 107.51 ? 93   LEU C CB    1 
ATOM   3956  C  CG    . LEU C 2  93   ? -18.330 -13.342 -65.541  1.00 117.74 ? 93   LEU C CG    1 
ATOM   3957  C  CD1   . LEU C 2  93   ? -17.195 -12.376 -65.834  1.00 138.55 ? 93   LEU C CD1   1 
ATOM   3958  C  CD2   . LEU C 2  93   ? -17.836 -14.508 -64.695  1.00 103.93 ? 93   LEU C CD2   1 
ATOM   3959  N  N     . SER C 2  94   ? -21.459 -12.509 -67.267  1.00 131.55 ? 94   SER C N     1 
ATOM   3960  C  CA    . SER C 2  94   ? -21.765 -12.925 -68.622  1.00 148.84 ? 94   SER C CA    1 
ATOM   3961  C  C     . SER C 2  94   ? -22.151 -11.714 -69.468  1.00 152.29 ? 94   SER C C     1 
ATOM   3962  O  O     . SER C 2  94   ? -22.893 -10.842 -69.005  1.00 122.64 ? 94   SER C O     1 
ATOM   3963  C  CB    . SER C 2  94   ? -22.900 -13.949 -68.616  1.00 129.95 ? 94   SER C CB    1 
ATOM   3964  O  OG    . SER C 2  94   ? -23.281 -14.301 -69.934  1.00 134.12 ? 94   SER C OG    1 
ATOM   3965  N  N     . PRO C 2  95   ? -21.664 -11.628 -70.709  1.00 158.35 ? 95   PRO C N     1 
ATOM   3966  C  CA    . PRO C 2  95   ? -20.706 -12.571 -71.286  1.00 134.85 ? 95   PRO C CA    1 
ATOM   3967  C  C     . PRO C 2  95   ? -19.321 -11.957 -71.477  1.00 133.71 ? 95   PRO C C     1 
ATOM   3968  O  O     . PRO C 2  95   ? -19.190 -10.734 -71.497  1.00 141.42 ? 95   PRO C O     1 
ATOM   3969  C  CB    . PRO C 2  95   ? -21.346 -12.909 -72.627  1.00 141.53 ? 95   PRO C CB    1 
ATOM   3970  C  CG    . PRO C 2  95   ? -21.993 -11.621 -73.029  1.00 155.97 ? 95   PRO C CG    1 
ATOM   3971  C  CD    . PRO C 2  95   ? -22.390 -10.894 -71.758  1.00 166.09 ? 95   PRO C CD    1 
ATOM   3972  N  N     . ILE C 2  96   ? -18.306 -12.805 -71.608  1.00 122.11 ? 96   ILE C N     1 
ATOM   3973  C  CA    . ILE C 2  96   ? -16.926 -12.374 -71.791  1.00 148.69 ? 96   ILE C CA    1 
ATOM   3974  C  C     . ILE C 2  96   ? -16.594 -12.490 -73.271  1.00 167.83 ? 96   ILE C C     1 
ATOM   3975  O  O     . ILE C 2  96   ? -16.724 -13.570 -73.859  1.00 164.61 ? 96   ILE C O     1 
ATOM   3976  C  CB    . ILE C 2  96   ? -15.960 -13.216 -70.943  1.00 144.65 ? 96   ILE C CB    1 
ATOM   3977  C  CG1   . ILE C 2  96   ? -16.240 -13.032 -69.451  1.00 154.08 ? 96   ILE C CG1   1 
ATOM   3978  C  CG2   . ILE C 2  96   ? -14.517 -12.861 -71.248  1.00 157.67 ? 96   ILE C CG2   1 
ATOM   3979  C  CD1   . ILE C 2  96   ? -15.429 -13.974 -68.594  1.00 151.33 ? 96   ILE C CD1   1 
ATOM   3980  N  N     . GLU C 2  97   ? -16.170 -11.384 -73.878  1.00 170.66 ? 97   GLU C N     1 
ATOM   3981  C  CA    . GLU C 2  97   ? -15.846 -11.356 -75.298  1.00 168.15 ? 97   GLU C CA    1 
ATOM   3982  C  C     . GLU C 2  97   ? -14.622 -10.481 -75.521  1.00 187.38 ? 97   GLU C C     1 
ATOM   3983  O  O     . GLU C 2  97   ? -14.373 -9.533  -74.771  1.00 188.37 ? 97   GLU C O     1 
ATOM   3984  C  CB    . GLU C 2  97   ? -17.019 -10.828 -76.136  1.00 161.35 ? 97   GLU C CB    1 
ATOM   3985  C  CG    . GLU C 2  97   ? -18.297 -11.641 -76.016  1.00 154.28 ? 97   GLU C CG    1 
ATOM   3986  C  CD    . GLU C 2  97   ? -19.528 -10.847 -76.402  1.00 154.78 ? 97   GLU C CD    1 
ATOM   3987  O  OE1   . GLU C 2  97   ? -19.409 -9.617  -76.584  1.00 146.90 ? 97   GLU C OE1   1 
ATOM   3988  O  OE2   . GLU C 2  97   ? -20.614 -11.452 -76.521  1.00 143.27 ? 97   GLU C OE2   1 
ATOM   3989  N  N     . ASP C 2  98   ? -13.864 -10.805 -76.564  1.00 199.04 ? 98   ASP C N     1 
ATOM   3990  C  CA    . ASP C 2  98   ? -12.700 -10.014 -76.927  1.00 201.09 ? 98   ASP C CA    1 
ATOM   3991  C  C     . ASP C 2  98   ? -13.128 -8.797  -77.746  1.00 199.09 ? 98   ASP C C     1 
ATOM   3992  O  O     . ASP C 2  98   ? -14.317 -8.533  -77.946  1.00 190.01 ? 98   ASP C O     1 
ATOM   3993  C  CB    . ASP C 2  98   ? -11.687 -10.871 -77.685  1.00 181.42 ? 98   ASP C CB    1 
ATOM   3994  C  CG    . ASP C 2  98   ? -12.286 -11.547 -78.903  1.00 178.19 ? 98   ASP C CG    1 
ATOM   3995  O  OD1   . ASP C 2  98   ? -13.489 -11.881 -78.873  1.00 177.06 ? 98   ASP C OD1   1 
ATOM   3996  O  OD2   . ASP C 2  98   ? -11.551 -11.748 -79.892  1.00 163.10 ? 98   ASP C OD2   1 
ATOM   3997  N  N     . PHE C 2  99   ? -12.138 -8.040  -78.228  1.00 210.47 ? 99   PHE C N     1 
ATOM   3998  C  CA    . PHE C 2  99   ? -12.432 -6.815  -78.965  1.00 218.92 ? 99   PHE C CA    1 
ATOM   3999  C  C     . PHE C 2  99   ? -13.150 -7.101  -80.277  1.00 212.21 ? 99   PHE C C     1 
ATOM   4000  O  O     . PHE C 2  99   ? -13.917 -6.260  -80.760  1.00 187.85 ? 99   PHE C O     1 
ATOM   4001  C  CB    . PHE C 2  99   ? -11.141 -6.035  -79.228  1.00 220.82 ? 99   PHE C CB    1 
ATOM   4002  C  CG    . PHE C 2  99   ? -10.164 -6.753  -80.118  1.00 226.35 ? 99   PHE C CG    1 
ATOM   4003  C  CD1   . PHE C 2  99   ? -10.029 -6.401  -81.452  1.00 217.46 ? 99   PHE C CD1   1 
ATOM   4004  C  CD2   . PHE C 2  99   ? -9.376  -7.778  -79.620  1.00 218.06 ? 99   PHE C CD2   1 
ATOM   4005  C  CE1   . PHE C 2  99   ? -9.127  -7.059  -82.270  1.00 198.14 ? 99   PHE C CE1   1 
ATOM   4006  C  CE2   . PHE C 2  99   ? -8.475  -8.438  -80.431  1.00 216.56 ? 99   PHE C CE2   1 
ATOM   4007  C  CZ    . PHE C 2  99   ? -8.350  -8.079  -81.758  1.00 205.17 ? 99   PHE C CZ    1 
ATOM   4008  N  N     . SER C 2  100  ? -12.919 -8.275  -80.866  1.00 209.68 ? 100  SER C N     1 
ATOM   4009  C  CA    . SER C 2  100  ? -13.576 -8.620  -82.121  1.00 193.99 ? 100  SER C CA    1 
ATOM   4010  C  C     . SER C 2  100  ? -14.997 -9.118  -81.885  1.00 164.89 ? 100  SER C C     1 
ATOM   4011  O  O     . SER C 2  100  ? -15.940 -8.663  -82.541  1.00 152.44 ? 100  SER C O     1 
ATOM   4012  C  CB    . SER C 2  100  ? -12.760 -9.677  -82.867  1.00 191.68 ? 100  SER C CB    1 
ATOM   4013  O  OG    . SER C 2  100  ? -12.716 -10.892 -82.137  1.00 175.73 ? 100  SER C OG    1 
ATOM   4014  N  N     . GLY C 2  101  ? -15.166 -10.044 -80.948  1.00 155.43 ? 101  GLY C N     1 
ATOM   4015  C  CA    . GLY C 2  101  ? -16.432 -10.710 -80.743  1.00 148.75 ? 101  GLY C CA    1 
ATOM   4016  C  C     . GLY C 2  101  ? -16.505 -12.114 -81.295  1.00 149.14 ? 101  GLY C C     1 
ATOM   4017  O  O     . GLY C 2  101  ? -17.605 -12.673 -81.374  1.00 142.66 ? 101  GLY C O     1 
ATOM   4018  N  N     . SER C 2  102  ? -15.371 -12.700 -81.683  1.00 159.21 ? 102  SER C N     1 
ATOM   4019  C  CA    . SER C 2  102  ? -15.351 -14.049 -82.232  1.00 179.38 ? 102  SER C CA    1 
ATOM   4020  C  C     . SER C 2  102  ? -15.409 -15.126 -81.158  1.00 171.16 ? 102  SER C C     1 
ATOM   4021  O  O     . SER C 2  102  ? -15.788 -16.263 -81.460  1.00 156.20 ? 102  SER C O     1 
ATOM   4022  C  CB    . SER C 2  102  ? -14.097 -14.246 -83.086  1.00 186.58 ? 102  SER C CB    1 
ATOM   4023  O  OG    . SER C 2  102  ? -13.970 -15.593 -83.506  1.00 181.73 ? 102  SER C OG    1 
ATOM   4024  N  N     . MET C 2  103  ? -15.045 -14.797 -79.921  1.00 171.24 ? 103  MET C N     1 
ATOM   4025  C  CA    . MET C 2  103  ? -15.002 -15.754 -78.825  1.00 178.54 ? 103  MET C CA    1 
ATOM   4026  C  C     . MET C 2  103  ? -15.838 -15.234 -77.665  1.00 189.88 ? 103  MET C C     1 
ATOM   4027  O  O     . MET C 2  103  ? -15.817 -14.038 -77.362  1.00 185.20 ? 103  MET C O     1 
ATOM   4028  C  CB    . MET C 2  103  ? -13.558 -16.001 -78.374  1.00 189.43 ? 103  MET C CB    1 
ATOM   4029  C  CG    . MET C 2  103  ? -12.661 -16.557 -79.470  1.00 184.92 ? 103  MET C CG    1 
ATOM   4030  S  SD    . MET C 2  103  ? -10.918 -16.572 -79.017  1.00 212.79 ? 103  MET C SD    1 
ATOM   4031  C  CE    . MET C 2  103  ? -10.603 -14.816 -78.859  1.00 172.13 ? 103  MET C CE    1 
ATOM   4032  N  N     . SER C 2  104  ? -16.574 -16.137 -77.018  1.00 191.72 ? 104  SER C N     1 
ATOM   4033  C  CA    . SER C 2  104  ? -17.463 -15.756 -75.930  1.00 181.63 ? 104  SER C CA    1 
ATOM   4034  C  C     . SER C 2  104  ? -17.540 -16.879 -74.907  1.00 174.41 ? 104  SER C C     1 
ATOM   4035  O  O     . SER C 2  104  ? -17.532 -18.060 -75.266  1.00 162.50 ? 104  SER C O     1 
ATOM   4036  C  CB    . SER C 2  104  ? -18.867 -15.418 -76.443  1.00 171.57 ? 104  SER C CB    1 
ATOM   4037  O  OG    . SER C 2  104  ? -19.734 -15.089 -75.371  1.00 169.26 ? 104  SER C OG    1 
ATOM   4038  N  N     . LEU C 2  105  ? -17.619 -16.498 -73.632  1.00 172.91 ? 105  LEU C N     1 
ATOM   4039  C  CA    . LEU C 2  105  ? -17.747 -17.433 -72.524  1.00 150.43 ? 105  LEU C CA    1 
ATOM   4040  C  C     . LEU C 2  105  ? -18.863 -16.960 -71.604  1.00 133.01 ? 105  LEU C C     1 
ATOM   4041  O  O     . LEU C 2  105  ? -19.028 -15.755 -71.386  1.00 117.39 ? 105  LEU C O     1 
ATOM   4042  C  CB    . LEU C 2  105  ? -16.427 -17.558 -71.746  1.00 136.63 ? 105  LEU C CB    1 
ATOM   4043  C  CG    . LEU C 2  105  ? -16.374 -18.595 -70.622  1.00 116.65 ? 105  LEU C CG    1 
ATOM   4044  C  CD1   . LEU C 2  105  ? -16.664 -19.981 -71.165  1.00 125.45 ? 105  LEU C CD1   1 
ATOM   4045  C  CD2   . LEU C 2  105  ? -15.025 -18.569 -69.919  1.00 108.46 ? 105  LEU C CD2   1 
ATOM   4046  N  N     . SER C 2  106  ? -19.629 -17.910 -71.068  1.00 133.70 ? 106  SER C N     1 
ATOM   4047  C  CA    . SER C 2  106  ? -20.785 -17.594 -70.240  1.00 138.81 ? 106  SER C CA    1 
ATOM   4048  C  C     . SER C 2  106  ? -20.930 -18.632 -69.136  1.00 137.26 ? 106  SER C C     1 
ATOM   4049  O  O     . SER C 2  106  ? -20.464 -19.768 -69.254  1.00 127.88 ? 106  SER C O     1 
ATOM   4050  C  CB    . SER C 2  106  ? -22.071 -17.526 -71.076  1.00 121.65 ? 106  SER C CB    1 
ATOM   4051  O  OG    . SER C 2  106  ? -22.200 -18.669 -71.903  1.00 133.36 ? 106  SER C OG    1 
ATOM   4052  N  N     . PHE C 2  107  ? -21.597 -18.224 -68.057  1.00 114.76 ? 107  PHE C N     1 
ATOM   4053  C  CA    . PHE C 2  107  ? -21.811 -19.072 -66.894  1.00 92.66  ? 107  PHE C CA    1 
ATOM   4054  C  C     . PHE C 2  107  ? -23.278 -19.033 -66.492  1.00 96.79  ? 107  PHE C C     1 
ATOM   4055  O  O     . PHE C 2  107  ? -23.962 -18.023 -66.681  1.00 107.80 ? 107  PHE C O     1 
ATOM   4056  C  CB    . PHE C 2  107  ? -20.943 -18.636 -65.708  1.00 99.49  ? 107  PHE C CB    1 
ATOM   4057  C  CG    . PHE C 2  107  ? -19.470 -18.676 -65.985  1.00 115.02 ? 107  PHE C CG    1 
ATOM   4058  C  CD1   . PHE C 2  107  ? -18.769 -19.867 -65.901  1.00 123.79 ? 107  PHE C CD1   1 
ATOM   4059  C  CD2   . PHE C 2  107  ? -18.783 -17.522 -66.321  1.00 100.53 ? 107  PHE C CD2   1 
ATOM   4060  C  CE1   . PHE C 2  107  ? -17.414 -19.906 -66.153  1.00 119.26 ? 107  PHE C CE1   1 
ATOM   4061  C  CE2   . PHE C 2  107  ? -17.425 -17.555 -66.574  1.00 102.12 ? 107  PHE C CE2   1 
ATOM   4062  C  CZ    . PHE C 2  107  ? -16.740 -18.749 -66.489  1.00 108.29 ? 107  PHE C CZ    1 
ATOM   4063  N  N     . SER C 2  108  ? -23.750 -20.141 -65.927  1.00 90.22  ? 108  SER C N     1 
ATOM   4064  C  CA    . SER C 2  108  ? -25.135 -20.256 -65.488  1.00 86.13  ? 108  SER C CA    1 
ATOM   4065  C  C     . SER C 2  108  ? -25.262 -21.480 -64.590  1.00 99.97  ? 108  SER C C     1 
ATOM   4066  O  O     . SER C 2  108  ? -24.376 -22.338 -64.545  1.00 97.99  ? 108  SER C O     1 
ATOM   4067  C  CB    . SER C 2  108  ? -26.097 -20.353 -66.677  1.00 102.01 ? 108  SER C CB    1 
ATOM   4068  O  OG    . SER C 2  108  ? -25.803 -21.480 -67.484  1.00 115.42 ? 108  SER C OG    1 
ATOM   4069  N  N     . ASP C 2  109  ? -26.385 -21.540 -63.871  1.00 108.63 ? 109  ASP C N     1 
ATOM   4070  C  CA    . ASP C 2  109  ? -26.774 -22.657 -63.015  1.00 114.37 ? 109  ASP C CA    1 
ATOM   4071  C  C     . ASP C 2  109  ? -25.705 -22.983 -61.978  1.00 115.47 ? 109  ASP C C     1 
ATOM   4072  O  O     . ASP C 2  109  ? -25.016 -24.004 -62.102  1.00 115.87 ? 109  ASP C O     1 
ATOM   4073  C  CB    . ASP C 2  109  ? -27.066 -23.902 -63.857  1.00 128.48 ? 109  ASP C CB    1 
ATOM   4074  C  CG    . ASP C 2  109  ? -27.943 -24.908 -63.132  1.00 143.10 ? 109  ASP C CG    1 
ATOM   4075  O  OD1   . ASP C 2  109  ? -28.711 -25.622 -63.811  1.00 151.33 ? 109  ASP C OD1   1 
ATOM   4076  O  OD2   . ASP C 2  109  ? -27.883 -24.972 -61.885  1.00 131.88 ? 109  ASP C OD2   1 
ATOM   4077  N  N     . PRO C 2  110  ? -25.536 -22.161 -60.944  1.00 110.01 ? 110  PRO C N     1 
ATOM   4078  C  CA    . PRO C 2  110  ? -24.614 -22.525 -59.864  1.00 95.92  ? 110  PRO C CA    1 
ATOM   4079  C  C     . PRO C 2  110  ? -25.272 -23.486 -58.886  1.00 93.89  ? 110  PRO C C     1 
ATOM   4080  O  O     . PRO C 2  110  ? -26.422 -23.301 -58.480  1.00 96.80  ? 110  PRO C O     1 
ATOM   4081  C  CB    . PRO C 2  110  ? -24.300 -21.179 -59.203  1.00 84.72  ? 110  PRO C CB    1 
ATOM   4082  C  CG    . PRO C 2  110  ? -25.532 -20.372 -59.430  1.00 92.89  ? 110  PRO C CG    1 
ATOM   4083  C  CD    . PRO C 2  110  ? -26.103 -20.813 -60.757  1.00 111.06 ? 110  PRO C CD    1 
ATOM   4084  N  N     . ARG C 2  111  ? -24.530 -24.526 -58.514  1.00 92.31  ? 111  ARG C N     1 
ATOM   4085  C  CA    . ARG C 2  111  ? -25.057 -25.548 -57.622  1.00 102.43 ? 111  ARG C CA    1 
ATOM   4086  C  C     . ARG C 2  111  ? -23.941 -26.054 -56.721  1.00 101.68 ? 111  ARG C C     1 
ATOM   4087  O  O     . ARG C 2  111  ? -22.754 -25.919 -57.031  1.00 93.85  ? 111  ARG C O     1 
ATOM   4088  C  CB    . ARG C 2  111  ? -25.685 -26.704 -58.407  1.00 107.06 ? 111  ARG C CB    1 
ATOM   4089  C  CG    . ARG C 2  111  ? -24.754 -27.329 -59.429  1.00 121.70 ? 111  ARG C CG    1 
ATOM   4090  C  CD    . ARG C 2  111  ? -25.521 -28.221 -60.387  1.00 126.17 ? 111  ARG C CD    1 
ATOM   4091  N  NE    . ARG C 2  111  ? -24.696 -28.654 -61.511  1.00 124.61 ? 111  ARG C NE    1 
ATOM   4092  C  CZ    . ARG C 2  111  ? -24.458 -27.914 -62.589  1.00 118.38 ? 111  ARG C CZ    1 
ATOM   4093  N  NH1   . ARG C 2  111  ? -24.977 -26.698 -62.689  1.00 108.92 ? 111  ARG C NH1   1 
ATOM   4094  N  NH2   . ARG C 2  111  ? -23.698 -28.388 -63.566  1.00 128.07 ? 111  ARG C NH2   1 
ATOM   4095  N  N     . PHE C 2  112  ? -24.340 -26.644 -55.597  1.00 102.59 ? 112  PHE C N     1 
ATOM   4096  C  CA    . PHE C 2  112  ? -23.414 -27.148 -54.595  1.00 93.93  ? 112  PHE C CA    1 
ATOM   4097  C  C     . PHE C 2  112  ? -23.604 -28.644 -54.404  1.00 99.39  ? 112  PHE C C     1 
ATOM   4098  O  O     . PHE C 2  112  ? -24.735 -29.142 -54.392  1.00 90.91  ? 112  PHE C O     1 
ATOM   4099  C  CB    . PHE C 2  112  ? -23.610 -26.446 -53.245  1.00 90.68  ? 112  PHE C CB    1 
ATOM   4100  C  CG    . PHE C 2  112  ? -23.336 -24.973 -53.277  1.00 81.07  ? 112  PHE C CG    1 
ATOM   4101  C  CD1   . PHE C 2  112  ? -22.037 -24.497 -53.245  1.00 80.81  ? 112  PHE C CD1   1 
ATOM   4102  C  CD2   . PHE C 2  112  ? -24.379 -24.063 -53.323  1.00 75.33  ? 112  PHE C CD2   1 
ATOM   4103  C  CE1   . PHE C 2  112  ? -21.781 -23.141 -53.269  1.00 86.80  ? 112  PHE C CE1   1 
ATOM   4104  C  CE2   . PHE C 2  112  ? -24.129 -22.706 -53.347  1.00 78.29  ? 112  PHE C CE2   1 
ATOM   4105  C  CZ    . PHE C 2  112  ? -22.829 -22.245 -53.319  1.00 88.69  ? 112  PHE C CZ    1 
ATOM   4106  N  N     . ASP C 2  113  ? -22.491 -29.355 -54.255  1.00 94.98  ? 113  ASP C N     1 
ATOM   4107  C  CA    . ASP C 2  113  ? -22.530 -30.725 -53.778  1.00 107.14 ? 113  ASP C CA    1 
ATOM   4108  C  C     . ASP C 2  113  ? -22.572 -30.727 -52.250  1.00 114.85 ? 113  ASP C C     1 
ATOM   4109  O  O     . ASP C 2  113  ? -22.480 -29.681 -51.602  1.00 110.42 ? 113  ASP C O     1 
ATOM   4110  C  CB    . ASP C 2  113  ? -21.323 -31.504 -54.301  1.00 115.44 ? 113  ASP C CB    1 
ATOM   4111  C  CG    . ASP C 2  113  ? -21.518 -33.004 -54.232  1.00 139.02 ? 113  ASP C CG    1 
ATOM   4112  O  OD1   . ASP C 2  113  ? -22.568 -33.446 -53.721  1.00 143.85 ? 113  ASP C OD1   1 
ATOM   4113  O  OD2   . ASP C 2  113  ? -20.621 -33.742 -54.690  1.00 141.61 ? 113  ASP C OD2   1 
ATOM   4114  N  N     . ASP C 2  114  ? -22.720 -31.916 -51.671  1.00 138.21 ? 114  ASP C N     1 
ATOM   4115  C  CA    . ASP C 2  114  ? -22.795 -32.032 -50.221  1.00 114.12 ? 114  ASP C CA    1 
ATOM   4116  C  C     . ASP C 2  114  ? -21.521 -31.502 -49.566  1.00 107.04 ? 114  ASP C C     1 
ATOM   4117  O  O     . ASP C 2  114  ? -20.475 -31.345 -50.204  1.00 119.45 ? 114  ASP C O     1 
ATOM   4118  C  CB    . ASP C 2  114  ? -23.035 -33.484 -49.809  1.00 122.21 ? 114  ASP C CB    1 
ATOM   4119  C  CG    . ASP C 2  114  ? -24.450 -33.947 -50.101  1.00 120.84 ? 114  ASP C CG    1 
ATOM   4120  O  OD1   . ASP C 2  114  ? -25.385 -33.128 -49.977  1.00 125.75 ? 114  ASP C OD1   1 
ATOM   4121  O  OD2   . ASP C 2  114  ? -24.626 -35.132 -50.454  1.00 111.96 ? 114  ASP C OD2   1 
ATOM   4122  N  N     . VAL C 2  115  ? -21.624 -31.218 -48.265  1.00 90.64  ? 115  VAL C N     1 
ATOM   4123  C  CA    . VAL C 2  115  ? -20.505 -30.634 -47.537  1.00 87.30  ? 115  VAL C CA    1 
ATOM   4124  C  C     . VAL C 2  115  ? -19.365 -31.642 -47.449  1.00 96.29  ? 115  VAL C C     1 
ATOM   4125  O  O     . VAL C 2  115  ? -19.579 -32.861 -47.390  1.00 109.84 ? 115  VAL C O     1 
ATOM   4126  C  CB    . VAL C 2  115  ? -20.949 -30.168 -46.138  1.00 100.91 ? 115  VAL C CB    1 
ATOM   4127  C  CG1   . VAL C 2  115  ? -20.060 -29.035 -45.651  1.00 108.77 ? 115  VAL C CG1   1 
ATOM   4128  C  CG2   . VAL C 2  115  ? -22.407 -29.734 -46.156  1.00 105.50 ? 115  VAL C CG2   1 
ATOM   4129  N  N     . LYS C 2  116  ? -18.133 -31.127 -47.446  1.00 89.11  ? 116  LYS C N     1 
ATOM   4130  C  CA    . LYS C 2  116  ? -16.965 -32.001 -47.493  1.00 97.55  ? 116  LYS C CA    1 
ATOM   4131  C  C     . LYS C 2  116  ? -16.785 -32.768 -46.188  1.00 109.95 ? 116  LYS C C     1 
ATOM   4132  O  O     . LYS C 2  116  ? -16.477 -33.966 -46.205  1.00 124.97 ? 116  LYS C O     1 
ATOM   4133  C  CB    . LYS C 2  116  ? -15.713 -31.184 -47.813  1.00 100.77 ? 116  LYS C CB    1 
ATOM   4134  C  CG    . LYS C 2  116  ? -15.786 -30.433 -49.132  1.00 111.05 ? 116  LYS C CG    1 
ATOM   4135  C  CD    . LYS C 2  116  ? -14.456 -29.782 -49.471  1.00 117.86 ? 116  LYS C CD    1 
ATOM   4136  C  CE    . LYS C 2  116  ? -13.369 -30.827 -49.661  1.00 116.48 ? 116  LYS C CE    1 
ATOM   4137  N  NZ    . LYS C 2  116  ? -12.058 -30.216 -50.015  1.00 107.90 ? 116  LYS C NZ    1 
ATOM   4138  N  N     . ALA C 2  117  ? -16.970 -32.102 -45.051  1.00 106.95 ? 117  ALA C N     1 
ATOM   4139  C  CA    . ALA C 2  117  ? -16.779 -32.727 -43.751  1.00 107.90 ? 117  ALA C CA    1 
ATOM   4140  C  C     . ALA C 2  117  ? -17.749 -32.107 -42.759  1.00 108.06 ? 117  ALA C C     1 
ATOM   4141  O  O     . ALA C 2  117  ? -18.104 -30.930 -42.897  1.00 112.55 ? 117  ALA C O     1 
ATOM   4142  C  CB    . ALA C 2  117  ? -15.335 -32.562 -43.253  1.00 108.46 ? 117  ALA C CB    1 
ATOM   4143  N  N     . PRO C 2  118  ? -18.196 -32.865 -41.758  1.00 104.66 ? 118  PRO C N     1 
ATOM   4144  C  CA    . PRO C 2  118  ? -19.127 -32.315 -40.764  1.00 94.35  ? 118  PRO C CA    1 
ATOM   4145  C  C     . PRO C 2  118  ? -18.502 -31.176 -39.970  1.00 105.25 ? 118  PRO C C     1 
ATOM   4146  O  O     . PRO C 2  118  ? -17.299 -30.911 -40.027  1.00 100.23 ? 118  PRO C O     1 
ATOM   4147  C  CB    . PRO C 2  118  ? -19.444 -33.519 -39.869  1.00 100.14 ? 118  PRO C CB    1 
ATOM   4148  C  CG    . PRO C 2  118  ? -19.174 -34.710 -40.733  1.00 125.72 ? 118  PRO C CG    1 
ATOM   4149  C  CD    . PRO C 2  118  ? -18.013 -34.318 -41.598  1.00 129.44 ? 118  PRO C CD    1 
ATOM   4150  N  N     . VAL C 2  119  ? -19.361 -30.497 -39.204  1.00 106.51 ? 119  VAL C N     1 
ATOM   4151  C  CA    . VAL C 2  119  ? -18.953 -29.288 -38.490  1.00 77.83  ? 119  VAL C CA    1 
ATOM   4152  C  C     . VAL C 2  119  ? -17.861 -29.603 -37.473  1.00 97.16  ? 119  VAL C C     1 
ATOM   4153  O  O     . VAL C 2  119  ? -16.820 -28.937 -37.429  1.00 88.44  ? 119  VAL C O     1 
ATOM   4154  C  CB    . VAL C 2  119  ? -20.174 -28.628 -37.822  1.00 83.25  ? 119  VAL C CB    1 
ATOM   4155  C  CG1   . VAL C 2  119  ? -19.738 -27.695 -36.703  1.00 97.02  ? 119  VAL C CG1   1 
ATOM   4156  C  CG2   . VAL C 2  119  ? -21.000 -27.874 -38.854  1.00 89.76  ? 119  VAL C CG2   1 
ATOM   4157  N  N     . ASP C 2  120  ? -18.080 -30.624 -36.642  1.00 120.21 ? 120  ASP C N     1 
ATOM   4158  C  CA    . ASP C 2  120  ? -17.129 -30.909 -35.573  1.00 118.24 ? 120  ASP C CA    1 
ATOM   4159  C  C     . ASP C 2  120  ? -15.836 -31.519 -36.104  1.00 104.91 ? 120  ASP C C     1 
ATOM   4160  O  O     . ASP C 2  120  ? -14.786 -31.381 -35.467  1.00 84.52  ? 120  ASP C O     1 
ATOM   4161  C  CB    . ASP C 2  120  ? -17.766 -31.830 -34.533  1.00 123.42 ? 120  ASP C CB    1 
ATOM   4162  C  CG    . ASP C 2  120  ? -18.429 -33.040 -35.155  1.00 131.53 ? 120  ASP C CG    1 
ATOM   4163  O  OD1   . ASP C 2  120  ? -18.816 -32.964 -36.340  1.00 125.47 ? 120  ASP C OD1   1 
ATOM   4164  O  OD2   . ASP C 2  120  ? -18.570 -34.064 -34.455  1.00 145.04 ? 120  ASP C OD2   1 
ATOM   4165  N  N     . GLU C 2  121  ? -15.885 -32.194 -37.255  1.00 103.03 ? 121  GLU C N     1 
ATOM   4166  C  CA    . GLU C 2  121  ? -14.659 -32.743 -37.824  1.00 100.55 ? 121  GLU C CA    1 
ATOM   4167  C  C     . GLU C 2  121  ? -13.719 -31.630 -38.274  1.00 100.43 ? 121  GLU C C     1 
ATOM   4168  O  O     . GLU C 2  121  ? -12.494 -31.763 -38.170  1.00 107.44 ? 121  GLU C O     1 
ATOM   4169  C  CB    . GLU C 2  121  ? -14.986 -33.681 -38.989  1.00 110.79 ? 121  GLU C CB    1 
ATOM   4170  C  CG    . GLU C 2  121  ? -13.754 -34.280 -39.657  1.00 129.80 ? 121  GLU C CG    1 
ATOM   4171  C  CD    . GLU C 2  121  ? -14.094 -35.246 -40.778  1.00 151.03 ? 121  GLU C CD    1 
ATOM   4172  O  OE1   . GLU C 2  121  ? -15.214 -35.798 -40.778  1.00 157.28 ? 121  GLU C OE1   1 
ATOM   4173  O  OE2   . GLU C 2  121  ? -13.235 -35.453 -41.662  1.00 148.70 ? 121  GLU C OE2   1 
ATOM   4174  N  N     . CYS C 2  122  ? -14.278 -30.523 -38.768  1.00 92.81  ? 122  CYS C N     1 
ATOM   4175  C  CA    . CYS C 2  122  ? -13.451 -29.385 -39.157  1.00 95.16  ? 122  CYS C CA    1 
ATOM   4176  C  C     . CYS C 2  122  ? -12.824 -28.716 -37.938  1.00 105.88 ? 122  CYS C C     1 
ATOM   4177  O  O     . CYS C 2  122  ? -11.675 -28.264 -37.995  1.00 116.23 ? 122  CYS C O     1 
ATOM   4178  C  CB    . CYS C 2  122  ? -14.282 -28.383 -39.961  1.00 90.87  ? 122  CYS C CB    1 
ATOM   4179  S  SG    . CYS C 2  122  ? -14.770 -28.958 -41.610  1.00 116.20 ? 122  CYS C SG    1 
ATOM   4180  N  N     . LYS C 2  123  ? -13.562 -28.648 -36.826  1.00 97.16  ? 123  LYS C N     1 
ATOM   4181  C  CA    . LYS C 2  123  ? -12.999 -28.110 -35.591  1.00 101.80 ? 123  LYS C CA    1 
ATOM   4182  C  C     . LYS C 2  123  ? -11.864 -28.979 -35.066  1.00 108.94 ? 123  LYS C C     1 
ATOM   4183  O  O     . LYS C 2  123  ? -10.914 -28.463 -34.465  1.00 106.49 ? 123  LYS C O     1 
ATOM   4184  C  CB    . LYS C 2  123  ? -14.088 -27.977 -34.526  1.00 112.70 ? 123  LYS C CB    1 
ATOM   4185  C  CG    . LYS C 2  123  ? -15.136 -26.914 -34.811  1.00 76.65  ? 123  LYS C CG    1 
ATOM   4186  C  CD    . LYS C 2  123  ? -16.144 -26.839 -33.674  1.00 73.39  ? 123  LYS C CD    1 
ATOM   4187  C  CE    . LYS C 2  123  ? -17.176 -25.750 -33.909  1.00 67.76  ? 123  LYS C CE    1 
ATOM   4188  N  NZ    . LYS C 2  123  ? -18.162 -25.684 -32.795  1.00 93.75  ? 123  LYS C NZ    1 
ATOM   4189  N  N     . ASP C 2  124  ? -11.943 -30.293 -35.282  1.00 99.54  ? 124  ASP C N     1 
ATOM   4190  C  CA    . ASP C 2  124  ? -10.930 -31.204 -34.761  1.00 110.93 ? 124  ASP C CA    1 
ATOM   4191  C  C     . ASP C 2  124  ? -9.673  -31.201 -35.625  1.00 102.85 ? 124  ASP C C     1 
ATOM   4192  O  O     . ASP C 2  124  ? -8.557  -31.074 -35.108  1.00 104.88 ? 124  ASP C O     1 
ATOM   4193  C  CB    . ASP C 2  124  ? -11.504 -32.617 -34.656  1.00 117.61 ? 124  ASP C CB    1 
ATOM   4194  C  CG    . ASP C 2  124  ? -10.489 -33.621 -34.148  1.00 114.33 ? 124  ASP C CG    1 
ATOM   4195  O  OD1   . ASP C 2  124  ? -10.046 -33.483 -32.988  1.00 110.48 ? 124  ASP C OD1   1 
ATOM   4196  O  OD2   . ASP C 2  124  ? -10.135 -34.547 -34.908  1.00 115.13 ? 124  ASP C OD2   1 
ATOM   4197  N  N     . LYS C 2  125  ? -9.832  -31.343 -36.939  1.00 94.04  ? 125  LYS C N     1 
ATOM   4198  C  CA    . LYS C 2  125  ? -8.700  -31.425 -37.853  1.00 100.98 ? 125  LYS C CA    1 
ATOM   4199  C  C     . LYS C 2  125  ? -8.246  -30.065 -38.371  1.00 110.93 ? 125  LYS C C     1 
ATOM   4200  O  O     . LYS C 2  125  ? -7.347  -30.013 -39.217  1.00 118.95 ? 125  LYS C O     1 
ATOM   4201  C  CB    . LYS C 2  125  ? -9.041  -32.342 -39.033  1.00 93.57  ? 125  LYS C CB    1 
ATOM   4202  C  CG    . LYS C 2  125  ? -9.385  -33.764 -38.616  1.00 101.92 ? 125  LYS C CG    1 
ATOM   4203  C  CD    . LYS C 2  125  ? -9.500  -34.696 -39.810  1.00 104.82 ? 125  LYS C CD    1 
ATOM   4204  C  CE    . LYS C 2  125  ? -9.732  -36.129 -39.358  1.00 121.40 ? 125  LYS C CE    1 
ATOM   4205  N  NZ    . LYS C 2  125  ? -9.728  -37.082 -40.500  1.00 125.56 ? 125  LYS C NZ    1 
ATOM   4206  N  N     . ASP C 2  126  ? -8.844  -28.975 -37.886  1.00 116.95 ? 126  ASP C N     1 
ATOM   4207  C  CA    . ASP C 2  126  ? -8.433  -27.613 -38.235  1.00 113.19 ? 126  ASP C CA    1 
ATOM   4208  C  C     . ASP C 2  126  ? -8.508  -27.367 -39.742  1.00 104.95 ? 126  ASP C C     1 
ATOM   4209  O  O     . ASP C 2  126  ? -7.587  -26.824 -40.355  1.00 99.55  ? 126  ASP C O     1 
ATOM   4210  C  CB    . ASP C 2  126  ? -7.031  -27.307 -37.699  1.00 96.83  ? 126  ASP C CB    1 
ATOM   4211  C  CG    . ASP C 2  126  ? -7.047  -26.841 -36.257  1.00 113.34 ? 126  ASP C CG    1 
ATOM   4212  O  OD1   . ASP C 2  126  ? -7.642  -27.540 -35.410  1.00 120.22 ? 126  ASP C OD1   1 
ATOM   4213  O  OD2   . ASP C 2  126  ? -6.458  -25.777 -35.969  1.00 111.44 ? 126  ASP C OD2   1 
ATOM   4214  N  N     . MET C 2  127  ? -9.624  -27.773 -40.340  1.00 98.99  ? 127  MET C N     1 
ATOM   4215  C  CA    . MET C 2  127  ? -9.927  -27.474 -41.729  1.00 105.85 ? 127  MET C CA    1 
ATOM   4216  C  C     . MET C 2  127  ? -11.109 -26.506 -41.793  1.00 94.42  ? 127  MET C C     1 
ATOM   4217  O  O     . MET C 2  127  ? -11.561 -25.975 -40.772  1.00 90.11  ? 127  MET C O     1 
ATOM   4218  C  CB    . MET C 2  127  ? -10.188 -28.766 -42.508  1.00 124.26 ? 127  MET C CB    1 
ATOM   4219  C  CG    . MET C 2  127  ? -10.833 -29.876 -41.699  1.00 118.67 ? 127  MET C CG    1 
ATOM   4220  S  SD    . MET C 2  127  ? -11.150 -31.338 -42.707  1.00 119.90 ? 127  MET C SD    1 
ATOM   4221  C  CE    . MET C 2  127  ? -9.562  -31.548 -43.509  1.00 78.28  ? 127  MET C CE    1 
ATOM   4222  N  N     . THR C 2  128  ? -11.613 -26.275 -43.003  1.00 94.23  ? 128  THR C N     1 
ATOM   4223  C  CA    . THR C 2  128  ? -12.632 -25.264 -43.255  1.00 77.80  ? 128  THR C CA    1 
ATOM   4224  C  C     . THR C 2  128  ? -13.918 -25.928 -43.730  1.00 80.08  ? 128  THR C C     1 
ATOM   4225  O  O     . THR C 2  128  ? -13.892 -26.769 -44.637  1.00 80.96  ? 128  THR C O     1 
ATOM   4226  C  CB    . THR C 2  128  ? -12.143 -24.240 -44.287  1.00 76.80  ? 128  THR C CB    1 
ATOM   4227  O  OG1   . THR C 2  128  ? -11.035 -23.506 -43.747  1.00 70.53  ? 128  THR C OG1   1 
ATOM   4228  C  CG2   . THR C 2  128  ? -13.253 -23.268 -44.659  1.00 81.76  ? 128  THR C CG2   1 
ATOM   4229  N  N     . TYR C 2  129  ? -15.035 -25.550 -43.107  1.00 82.18  ? 129  TYR C N     1 
ATOM   4230  C  CA    . TYR C 2  129  ? -16.356 -26.047 -43.478  1.00 71.26  ? 129  TYR C CA    1 
ATOM   4231  C  C     . TYR C 2  129  ? -16.752 -25.451 -44.825  1.00 79.10  ? 129  TYR C C     1 
ATOM   4232  O  O     . TYR C 2  129  ? -16.944 -24.236 -44.940  1.00 68.90  ? 129  TYR C O     1 
ATOM   4233  C  CB    . TYR C 2  129  ? -17.362 -25.681 -42.386  1.00 76.01  ? 129  TYR C CB    1 
ATOM   4234  C  CG    . TYR C 2  129  ? -18.689 -26.402 -42.471  1.00 70.77  ? 129  TYR C CG    1 
ATOM   4235  C  CD1   . TYR C 2  129  ? -18.789 -27.753 -42.167  1.00 84.93  ? 129  TYR C CD1   1 
ATOM   4236  C  CD2   . TYR C 2  129  ? -19.847 -25.728 -42.838  1.00 69.51  ? 129  TYR C CD2   1 
ATOM   4237  C  CE1   . TYR C 2  129  ? -20.001 -28.417 -42.240  1.00 88.51  ? 129  TYR C CE1   1 
ATOM   4238  C  CE2   . TYR C 2  129  ? -21.064 -26.384 -42.914  1.00 79.55  ? 129  TYR C CE2   1 
ATOM   4239  C  CZ    . TYR C 2  129  ? -21.135 -27.728 -42.614  1.00 77.50  ? 129  TYR C CZ    1 
ATOM   4240  O  OH    . TYR C 2  129  ? -22.342 -28.385 -42.689  1.00 73.17  ? 129  TYR C OH    1 
ATOM   4241  N  N     . ALA C 2  130  ? -16.860 -26.294 -45.850  1.00 101.45 ? 130  ALA C N     1 
ATOM   4242  C  CA    . ALA C 2  130  ? -17.134 -25.803 -47.193  1.00 101.54 ? 130  ALA C CA    1 
ATOM   4243  C  C     . ALA C 2  130  ? -17.798 -26.897 -48.015  1.00 98.81  ? 130  ALA C C     1 
ATOM   4244  O  O     . ALA C 2  130  ? -17.721 -28.084 -47.685  1.00 95.93  ? 130  ALA C O     1 
ATOM   4245  C  CB    . ALA C 2  130  ? -15.854 -25.318 -47.885  1.00 99.05  ? 130  ALA C CB    1 
ATOM   4246  N  N     . ALA C 2  131  ? -18.452 -26.474 -49.095  1.00 95.25  ? 131  ALA C N     1 
ATOM   4247  C  CA    . ALA C 2  131  ? -19.074 -27.364 -50.059  1.00 108.58 ? 131  ALA C CA    1 
ATOM   4248  C  C     . ALA C 2  131  ? -18.597 -27.005 -51.460  1.00 115.16 ? 131  ALA C C     1 
ATOM   4249  O  O     . ALA C 2  131  ? -18.472 -25.819 -51.789  1.00 103.94 ? 131  ALA C O     1 
ATOM   4250  C  CB    . ALA C 2  131  ? -20.606 -27.276 -49.993  1.00 101.80 ? 131  ALA C CB    1 
ATOM   4251  N  N     . PRO C 2  132  ? -18.315 -27.999 -52.301  1.00 108.52 ? 132  PRO C N     1 
ATOM   4252  C  CA    . PRO C 2  132  ? -17.833 -27.700 -53.655  1.00 97.07  ? 132  PRO C CA    1 
ATOM   4253  C  C     . PRO C 2  132  ? -18.913 -27.036 -54.497  1.00 90.12  ? 132  PRO C C     1 
ATOM   4254  O  O     . PRO C 2  132  ? -20.072 -27.455 -54.500  1.00 82.80  ? 132  PRO C O     1 
ATOM   4255  C  CB    . PRO C 2  132  ? -17.451 -29.077 -54.211  1.00 115.37 ? 132  PRO C CB    1 
ATOM   4256  C  CG    . PRO C 2  132  ? -18.240 -30.047 -53.402  1.00 94.05  ? 132  PRO C CG    1 
ATOM   4257  C  CD    . PRO C 2  132  ? -18.384 -29.447 -52.038  1.00 89.76  ? 132  PRO C CD    1 
ATOM   4258  N  N     . LEU C 2  133  ? -18.516 -25.987 -55.213  1.00 85.53  ? 133  LEU C N     1 
ATOM   4259  C  CA    . LEU C 2  133  ? -19.430 -25.190 -56.020  1.00 87.09  ? 133  LEU C CA    1 
ATOM   4260  C  C     . LEU C 2  133  ? -19.278 -25.573 -57.487  1.00 107.81 ? 133  LEU C C     1 
ATOM   4261  O  O     . LEU C 2  133  ? -18.178 -25.493 -58.044  1.00 115.03 ? 133  LEU C O     1 
ATOM   4262  C  CB    . LEU C 2  133  ? -19.167 -23.697 -55.822  1.00 74.37  ? 133  LEU C CB    1 
ATOM   4263  C  CG    . LEU C 2  133  ? -19.865 -22.731 -56.782  1.00 89.46  ? 133  LEU C CG    1 
ATOM   4264  C  CD1   . LEU C 2  133  ? -21.375 -22.922 -56.759  1.00 97.71  ? 133  LEU C CD1   1 
ATOM   4265  C  CD2   . LEU C 2  133  ? -19.501 -21.293 -56.445  1.00 73.27  ? 133  LEU C CD2   1 
ATOM   4266  N  N     . PHE C 2  134  ? -20.382 -25.983 -58.105  1.00 107.40 ? 134  PHE C N     1 
ATOM   4267  C  CA    . PHE C 2  134  ? -20.420 -26.346 -59.514  1.00 112.31 ? 134  PHE C CA    1 
ATOM   4268  C  C     . PHE C 2  134  ? -21.212 -25.308 -60.296  1.00 103.29 ? 134  PHE C C     1 
ATOM   4269  O  O     . PHE C 2  134  ? -22.225 -24.794 -59.812  1.00 97.57  ? 134  PHE C O     1 
ATOM   4270  C  CB    . PHE C 2  134  ? -21.053 -27.726 -59.714  1.00 119.24 ? 134  PHE C CB    1 
ATOM   4271  C  CG    . PHE C 2  134  ? -20.235 -28.857 -59.166  1.00 104.89 ? 134  PHE C CG    1 
ATOM   4272  C  CD1   . PHE C 2  134  ? -18.854 -28.771 -59.112  1.00 85.56  ? 134  PHE C CD1   1 
ATOM   4273  C  CD2   . PHE C 2  134  ? -20.849 -30.011 -58.707  1.00 99.38  ? 134  PHE C CD2   1 
ATOM   4274  C  CE1   . PHE C 2  134  ? -18.101 -29.815 -58.610  1.00 88.80  ? 134  PHE C CE1   1 
ATOM   4275  C  CE2   . PHE C 2  134  ? -20.103 -31.057 -58.203  1.00 104.73 ? 134  PHE C CE2   1 
ATOM   4276  C  CZ    . PHE C 2  134  ? -18.727 -30.960 -58.154  1.00 111.41 ? 134  PHE C CZ    1 
ATOM   4277  N  N     . VAL C 2  135  ? -20.744 -25.003 -61.506  1.00 98.37  ? 135  VAL C N     1 
ATOM   4278  C  CA    . VAL C 2  135  ? -21.449 -24.120 -62.423  1.00 107.69 ? 135  VAL C CA    1 
ATOM   4279  C  C     . VAL C 2  135  ? -21.467 -24.770 -63.800  1.00 127.22 ? 135  VAL C C     1 
ATOM   4280  O  O     . VAL C 2  135  ? -20.699 -25.688 -64.093  1.00 124.22 ? 135  VAL C O     1 
ATOM   4281  C  CB    . VAL C 2  135  ? -20.817 -22.713 -62.509  1.00 84.39  ? 135  VAL C CB    1 
ATOM   4282  C  CG1   . VAL C 2  135  ? -20.814 -22.030 -61.145  1.00 89.64  ? 135  VAL C CG1   1 
ATOM   4283  C  CG2   . VAL C 2  135  ? -19.411 -22.795 -63.088  1.00 93.48  ? 135  VAL C CG2   1 
ATOM   4284  N  N     . THR C 2  136  ? -22.361 -24.274 -64.650  1.00 133.19 ? 136  THR C N     1 
ATOM   4285  C  CA    . THR C 2  136  ? -22.478 -24.727 -66.030  1.00 114.93 ? 136  THR C CA    1 
ATOM   4286  C  C     . THR C 2  136  ? -21.918 -23.645 -66.943  1.00 117.41 ? 136  THR C C     1 
ATOM   4287  O  O     . THR C 2  136  ? -22.454 -22.532 -66.993  1.00 115.68 ? 136  THR C O     1 
ATOM   4288  C  CB    . THR C 2  136  ? -23.931 -25.037 -66.388  1.00 87.46  ? 136  THR C CB    1 
ATOM   4289  O  OG1   . THR C 2  136  ? -24.481 -25.933 -65.414  1.00 93.52  ? 136  THR C OG1   1 
ATOM   4290  C  CG2   . THR C 2  136  ? -24.013 -25.682 -67.764  1.00 110.53 ? 136  THR C CG2   1 
ATOM   4291  N  N     . ALA C 2  137  ? -20.845 -23.971 -67.658  1.00 125.48 ? 137  ALA C N     1 
ATOM   4292  C  CA    . ALA C 2  137  ? -20.162 -23.027 -68.528  1.00 128.30 ? 137  ALA C CA    1 
ATOM   4293  C  C     . ALA C 2  137  ? -20.129 -23.553 -69.956  1.00 150.40 ? 137  ALA C C     1 
ATOM   4294  O  O     . ALA C 2  137  ? -20.116 -24.765 -70.190  1.00 149.75 ? 137  ALA C O     1 
ATOM   4295  C  CB    . ALA C 2  137  ? -18.734 -22.757 -68.042  1.00 106.44 ? 137  ALA C CB    1 
ATOM   4296  N  N     . GLU C 2  138  ? -20.108 -22.624 -70.910  1.00 154.02 ? 138  GLU C N     1 
ATOM   4297  C  CA    . GLU C 2  138  ? -20.090 -22.973 -72.322  1.00 149.94 ? 138  GLU C CA    1 
ATOM   4298  C  C     . GLU C 2  138  ? -19.364 -21.883 -73.097  1.00 156.37 ? 138  GLU C C     1 
ATOM   4299  O  O     . GLU C 2  138  ? -19.394 -20.708 -72.723  1.00 140.15 ? 138  GLU C O     1 
ATOM   4300  C  CB    . GLU C 2  138  ? -21.510 -23.167 -72.870  1.00 129.82 ? 138  GLU C CB    1 
ATOM   4301  C  CG    . GLU C 2  138  ? -22.374 -21.915 -72.846  1.00 133.24 ? 138  GLU C CG    1 
ATOM   4302  C  CD    . GLU C 2  138  ? -23.775 -22.164 -73.369  1.00 135.19 ? 138  GLU C CD    1 
ATOM   4303  O  OE1   . GLU C 2  138  ? -24.179 -23.343 -73.452  1.00 119.20 ? 138  GLU C OE1   1 
ATOM   4304  O  OE2   . GLU C 2  138  ? -24.472 -21.181 -73.700  1.00 141.70 ? 138  GLU C OE2   1 
ATOM   4305  N  N     . PHE C 2  139  ? -18.709 -22.290 -74.181  1.00 156.99 ? 139  PHE C N     1 
ATOM   4306  C  CA    . PHE C 2  139  ? -17.943 -21.385 -75.029  1.00 167.06 ? 139  PHE C CA    1 
ATOM   4307  C  C     . PHE C 2  139  ? -18.742 -21.086 -76.291  1.00 181.87 ? 139  PHE C C     1 
ATOM   4308  O  O     . PHE C 2  139  ? -19.074 -22.002 -77.050  1.00 162.59 ? 139  PHE C O     1 
ATOM   4309  C  CB    . PHE C 2  139  ? -16.587 -21.992 -75.384  1.00 146.06 ? 139  PHE C CB    1 
ATOM   4310  C  CG    . PHE C 2  139  ? -15.692 -21.067 -76.154  1.00 165.25 ? 139  PHE C CG    1 
ATOM   4311  C  CD1   . PHE C 2  139  ? -15.669 -21.089 -77.539  1.00 175.40 ? 139  PHE C CD1   1 
ATOM   4312  C  CD2   . PHE C 2  139  ? -14.872 -20.173 -75.491  1.00 169.11 ? 139  PHE C CD2   1 
ATOM   4313  C  CE1   . PHE C 2  139  ? -14.843 -20.235 -78.244  1.00 168.32 ? 139  PHE C CE1   1 
ATOM   4314  C  CE2   . PHE C 2  139  ? -14.044 -19.320 -76.188  1.00 171.25 ? 139  PHE C CE2   1 
ATOM   4315  C  CZ    . PHE C 2  139  ? -14.029 -19.351 -77.567  1.00 160.34 ? 139  PHE C CZ    1 
ATOM   4316  N  N     . ILE C 2  140  ? -19.036 -19.811 -76.518  1.00 193.70 ? 140  ILE C N     1 
ATOM   4317  C  CA    . ILE C 2  140  ? -19.809 -19.376 -77.674  1.00 185.10 ? 140  ILE C CA    1 
ATOM   4318  C  C     . ILE C 2  140  ? -18.832 -18.859 -78.722  1.00 181.20 ? 140  ILE C C     1 
ATOM   4319  O  O     . ILE C 2  140  ? -18.151 -17.851 -78.508  1.00 178.92 ? 140  ILE C O     1 
ATOM   4320  C  CB    . ILE C 2  140  ? -20.836 -18.302 -77.296  1.00 195.96 ? 140  ILE C CB    1 
ATOM   4321  C  CG1   . ILE C 2  140  ? -21.743 -18.804 -76.171  1.00 183.29 ? 140  ILE C CG1   1 
ATOM   4322  C  CG2   . ILE C 2  140  ? -21.655 -17.900 -78.512  1.00 184.65 ? 140  ILE C CG2   1 
ATOM   4323  C  CD1   . ILE C 2  140  ? -22.759 -17.785 -75.704  1.00 160.00 ? 140  ILE C CD1   1 
ATOM   4324  N  N     . ASN C 2  141  ? -18.761 -19.544 -79.861  1.00 188.44 ? 141  ASN C N     1 
ATOM   4325  C  CA    . ASN C 2  141  ? -17.935 -19.122 -80.988  1.00 192.49 ? 141  ASN C CA    1 
ATOM   4326  C  C     . ASN C 2  141  ? -18.861 -18.818 -82.158  1.00 183.27 ? 141  ASN C C     1 
ATOM   4327  O  O     . ASN C 2  141  ? -19.534 -19.717 -82.672  1.00 170.50 ? 141  ASN C O     1 
ATOM   4328  C  CB    . ASN C 2  141  ? -16.910 -20.194 -81.356  1.00 183.25 ? 141  ASN C CB    1 
ATOM   4329  C  CG    . ASN C 2  141  ? -15.820 -19.671 -82.275  1.00 172.70 ? 141  ASN C CG    1 
ATOM   4330  O  OD1   . ASN C 2  141  ? -16.025 -18.717 -83.027  1.00 174.96 ? 141  ASN C OD1   1 
ATOM   4331  N  ND2   . ASN C 2  141  ? -14.651 -20.297 -82.218  1.00 155.18 ? 141  ASN C ND2   1 
ATOM   4332  N  N     . ASN C 2  142  ? -18.897 -17.550 -82.578  1.00 179.00 ? 142  ASN C N     1 
ATOM   4333  C  CA    . ASN C 2  142  ? -19.752 -17.171 -83.698  1.00 195.57 ? 142  ASN C CA    1 
ATOM   4334  C  C     . ASN C 2  142  ? -19.285 -17.805 -84.998  1.00 189.25 ? 142  ASN C C     1 
ATOM   4335  O  O     . ASN C 2  142  ? -20.089 -18.015 -85.913  1.00 183.63 ? 142  ASN C O     1 
ATOM   4336  C  CB    . ASN C 2  142  ? -19.790 -15.650 -83.847  1.00 190.75 ? 142  ASN C CB    1 
ATOM   4337  C  CG    . ASN C 2  142  ? -20.377 -14.962 -82.637  1.00 169.55 ? 142  ASN C CG    1 
ATOM   4338  O  OD1   . ASN C 2  142  ? -19.668 -14.655 -81.680  1.00 139.86 ? 142  ASN C OD1   1 
ATOM   4339  N  ND2   . ASN C 2  142  ? -21.681 -14.714 -82.671  1.00 175.90 ? 142  ASN C ND2   1 
ATOM   4340  N  N     . ASN C 2  143  ? -17.998 -18.122 -85.096  1.00 185.21 ? 143  ASN C N     1 
ATOM   4341  C  CA    . ASN C 2  143  ? -17.396 -18.585 -86.336  1.00 161.17 ? 143  ASN C CA    1 
ATOM   4342  C  C     . ASN C 2  143  ? -17.447 -20.097 -86.517  1.00 147.95 ? 143  ASN C C     1 
ATOM   4343  O  O     . ASN C 2  143  ? -16.989 -20.592 -87.550  1.00 163.62 ? 143  ASN C O     1 
ATOM   4344  C  CB    . ASN C 2  143  ? -15.942 -18.113 -86.415  1.00 150.33 ? 143  ASN C CB    1 
ATOM   4345  C  CG    . ASN C 2  143  ? -15.829 -16.626 -86.676  1.00 160.52 ? 143  ASN C CG    1 
ATOM   4346  O  OD1   . ASN C 2  143  ? -16.815 -15.894 -86.596  1.00 167.13 ? 143  ASN C OD1   1 
ATOM   4347  N  ND2   . ASN C 2  143  ? -14.623 -16.171 -86.994  1.00 160.85 ? 143  ASN C ND2   1 
ATOM   4348  N  N     . THR C 2  144  ? -17.982 -20.850 -85.555  1.00 158.24 ? 144  THR C N     1 
ATOM   4349  C  CA    . THR C 2  144  ? -18.001 -22.301 -85.670  1.00 172.38 ? 144  THR C CA    1 
ATOM   4350  C  C     . THR C 2  144  ? -19.383 -22.920 -85.577  1.00 182.90 ? 144  THR C C     1 
ATOM   4351  O  O     . THR C 2  144  ? -19.536 -24.089 -85.947  1.00 175.50 ? 144  THR C O     1 
ATOM   4352  C  CB    . THR C 2  144  ? -17.118 -22.944 -84.593  1.00 179.44 ? 144  THR C CB    1 
ATOM   4353  O  OG1   . THR C 2  144  ? -17.719 -22.744 -83.308  1.00 170.41 ? 144  THR C OG1   1 
ATOM   4354  C  CG2   . THR C 2  144  ? -15.738 -22.319 -84.606  1.00 164.23 ? 144  THR C CG2   1 
ATOM   4355  N  N     . GLY C 2  145  ? -20.378 -22.192 -85.079  1.00 181.94 ? 145  GLY C N     1 
ATOM   4356  C  CA    . GLY C 2  145  ? -21.739 -22.699 -85.053  1.00 189.16 ? 145  GLY C CA    1 
ATOM   4357  C  C     . GLY C 2  145  ? -21.937 -23.927 -84.193  1.00 195.60 ? 145  GLY C C     1 
ATOM   4358  O  O     . GLY C 2  145  ? -22.837 -24.727 -84.469  1.00 195.47 ? 145  GLY C O     1 
ATOM   4359  N  N     . GLU C 2  146  ? -21.118 -24.101 -83.159  1.00 188.46 ? 146  GLU C N     1 
ATOM   4360  C  CA    . GLU C 2  146  ? -21.262 -25.219 -82.238  1.00 174.83 ? 146  GLU C CA    1 
ATOM   4361  C  C     . GLU C 2  146  ? -20.662 -24.821 -80.898  1.00 180.84 ? 146  GLU C C     1 
ATOM   4362  O  O     . GLU C 2  146  ? -19.705 -24.045 -80.837  1.00 182.15 ? 146  GLU C O     1 
ATOM   4363  C  CB    . GLU C 2  146  ? -20.602 -26.493 -82.787  1.00 178.79 ? 146  GLU C CB    1 
ATOM   4364  C  CG    . GLU C 2  146  ? -19.204 -26.292 -83.358  1.00 191.96 ? 146  GLU C CG    1 
ATOM   4365  C  CD    . GLU C 2  146  ? -18.134 -26.240 -82.286  1.00 189.95 ? 146  GLU C CD    1 
ATOM   4366  O  OE1   . GLU C 2  146  ? -18.250 -26.988 -81.292  1.00 179.00 ? 146  GLU C OE1   1 
ATOM   4367  O  OE2   . GLU C 2  146  ? -17.182 -25.445 -82.431  1.00 174.15 ? 146  GLU C OE2   1 
ATOM   4368  N  N     . ILE C 2  147  ? -21.240 -25.350 -79.822  1.00 172.46 ? 147  ILE C N     1 
ATOM   4369  C  CA    . ILE C 2  147  ? -20.889 -24.945 -78.466  1.00 163.64 ? 147  ILE C CA    1 
ATOM   4370  C  C     . ILE C 2  147  ? -20.748 -26.187 -77.596  1.00 166.15 ? 147  ILE C C     1 
ATOM   4371  O  O     . ILE C 2  147  ? -21.579 -27.099 -77.657  1.00 155.70 ? 147  ILE C O     1 
ATOM   4372  C  CB    . ILE C 2  147  ? -21.941 -23.977 -77.882  1.00 156.49 ? 147  ILE C CB    1 
ATOM   4373  C  CG1   . ILE C 2  147  ? -21.932 -22.650 -78.646  1.00 133.82 ? 147  ILE C CG1   1 
ATOM   4374  C  CG2   . ILE C 2  147  ? -21.702 -23.746 -76.400  1.00 169.55 ? 147  ILE C CG2   1 
ATOM   4375  C  CD1   . ILE C 2  147  ? -23.005 -21.683 -78.207  1.00 123.13 ? 147  ILE C CD1   1 
ATOM   4376  N  N     . LYS C 2  148  ? -19.689 -26.223 -76.788  1.00 178.20 ? 148  LYS C N     1 
ATOM   4377  C  CA    . LYS C 2  148  ? -19.448 -27.307 -75.841  1.00 173.58 ? 148  LYS C CA    1 
ATOM   4378  C  C     . LYS C 2  148  ? -19.764 -26.799 -74.440  1.00 169.07 ? 148  LYS C C     1 
ATOM   4379  O  O     . LYS C 2  148  ? -19.041 -25.953 -73.902  1.00 152.38 ? 148  LYS C O     1 
ATOM   4380  C  CB    . LYS C 2  148  ? -18.007 -27.806 -75.927  1.00 153.86 ? 148  LYS C CB    1 
ATOM   4381  C  CG    . LYS C 2  148  ? -17.595 -28.317 -77.296  1.00 156.40 ? 148  LYS C CG    1 
ATOM   4382  C  CD    . LYS C 2  148  ? -16.116 -28.671 -77.313  1.00 159.58 ? 148  LYS C CD    1 
ATOM   4383  C  CE    . LYS C 2  148  ? -15.645 -29.030 -78.713  1.00 156.97 ? 148  LYS C CE    1 
ATOM   4384  N  NZ    . LYS C 2  148  ? -14.169 -29.232 -78.780  1.00 124.25 ? 148  LYS C NZ    1 
ATOM   4385  N  N     . SER C 2  149  ? -20.839 -27.315 -73.854  1.00 168.08 ? 149  SER C N     1 
ATOM   4386  C  CA    . SER C 2  149  ? -21.258 -26.954 -72.508  1.00 140.67 ? 149  SER C CA    1 
ATOM   4387  C  C     . SER C 2  149  ? -21.060 -28.139 -71.574  1.00 144.55 ? 149  SER C C     1 
ATOM   4388  O  O     . SER C 2  149  ? -21.363 -29.281 -71.932  1.00 154.92 ? 149  SER C O     1 
ATOM   4389  C  CB    . SER C 2  149  ? -22.722 -26.512 -72.485  1.00 127.55 ? 149  SER C CB    1 
ATOM   4390  O  OG    . SER C 2  149  ? -23.126 -26.167 -71.172  1.00 135.47 ? 149  SER C OG    1 
ATOM   4391  N  N     . GLN C 2  150  ? -20.557 -27.860 -70.377  1.00 138.27 ? 150  GLN C N     1 
ATOM   4392  C  CA    . GLN C 2  150  ? -20.298 -28.900 -69.391  1.00 126.67 ? 150  GLN C CA    1 
ATOM   4393  C  C     . GLN C 2  150  ? -20.299 -28.266 -68.006  1.00 129.25 ? 150  GLN C C     1 
ATOM   4394  O  O     . GLN C 2  150  ? -20.485 -27.055 -67.854  1.00 127.07 ? 150  GLN C O     1 
ATOM   4395  C  CB    . GLN C 2  150  ? -18.979 -29.618 -69.686  1.00 116.86 ? 150  GLN C CB    1 
ATOM   4396  C  CG    . GLN C 2  150  ? -17.807 -28.687 -69.938  1.00 126.49 ? 150  GLN C CG    1 
ATOM   4397  C  CD    . GLN C 2  150  ? -16.492 -29.431 -70.003  1.00 136.51 ? 150  GLN C CD    1 
ATOM   4398  O  OE1   . GLN C 2  150  ? -15.817 -29.606 -68.990  1.00 138.56 ? 150  GLN C OE1   1 
ATOM   4399  N  NE2   . GLN C 2  150  ? -16.125 -29.884 -71.196  1.00 142.26 ? 150  GLN C NE2   1 
ATOM   4400  N  N     . THR C 2  151  ? -20.096 -29.104 -66.991  1.00 124.88 ? 151  THR C N     1 
ATOM   4401  C  CA    . THR C 2  151  ? -20.062 -28.664 -65.603  1.00 123.53 ? 151  THR C CA    1 
ATOM   4402  C  C     . THR C 2  151  ? -18.628 -28.349 -65.199  1.00 114.90 ? 151  THR C C     1 
ATOM   4403  O  O     . THR C 2  151  ? -17.735 -29.189 -65.351  1.00 105.79 ? 151  THR C O     1 
ATOM   4404  C  CB    . THR C 2  151  ? -20.640 -29.740 -64.681  1.00 127.12 ? 151  THR C CB    1 
ATOM   4405  O  OG1   . THR C 2  151  ? -22.015 -29.973 -65.014  1.00 111.78 ? 151  THR C OG1   1 
ATOM   4406  C  CG2   . THR C 2  151  ? -20.532 -29.313 -63.222  1.00 136.35 ? 151  THR C CG2   1 
ATOM   4407  N  N     . VAL C 2  152  ? -18.413 -27.144 -64.678  1.00 112.04 ? 152  VAL C N     1 
ATOM   4408  C  CA    . VAL C 2  152  ? -17.087 -26.680 -64.286  1.00 112.01 ? 152  VAL C CA    1 
ATOM   4409  C  C     . VAL C 2  152  ? -17.091 -26.426 -62.786  1.00 129.82 ? 152  VAL C C     1 
ATOM   4410  O  O     . VAL C 2  152  ? -17.856 -25.587 -62.292  1.00 121.67 ? 152  VAL C O     1 
ATOM   4411  C  CB    . VAL C 2  152  ? -16.673 -25.416 -65.053  1.00 113.64 ? 152  VAL C CB    1 
ATOM   4412  C  CG1   . VAL C 2  152  ? -15.298 -24.961 -64.601  1.00 110.07 ? 152  VAL C CG1   1 
ATOM   4413  C  CG2   . VAL C 2  152  ? -16.691 -25.673 -66.554  1.00 144.19 ? 152  VAL C CG2   1 
ATOM   4414  N  N     . PHE C 2  153  ? -16.241 -27.152 -62.066  1.00 138.85 ? 153  PHE C N     1 
ATOM   4415  C  CA    . PHE C 2  153  ? -16.060 -26.923 -60.639  1.00 128.25 ? 153  PHE C CA    1 
ATOM   4416  C  C     . PHE C 2  153  ? -15.310 -25.616 -60.411  1.00 126.12 ? 153  PHE C C     1 
ATOM   4417  O  O     . PHE C 2  153  ? -14.238 -25.396 -60.983  1.00 110.24 ? 153  PHE C O     1 
ATOM   4418  C  CB    . PHE C 2  153  ? -15.302 -28.099 -60.023  1.00 118.90 ? 153  PHE C CB    1 
ATOM   4419  C  CG    . PHE C 2  153  ? -14.708 -27.811 -58.674  1.00 116.42 ? 153  PHE C CG    1 
ATOM   4420  C  CD1   . PHE C 2  153  ? -15.486 -27.874 -57.531  1.00 125.64 ? 153  PHE C CD1   1 
ATOM   4421  C  CD2   . PHE C 2  153  ? -13.362 -27.507 -58.547  1.00 134.05 ? 153  PHE C CD2   1 
ATOM   4422  C  CE1   . PHE C 2  153  ? -14.938 -27.622 -56.289  1.00 136.61 ? 153  PHE C CE1   1 
ATOM   4423  C  CE2   . PHE C 2  153  ? -12.809 -27.253 -57.308  1.00 146.87 ? 153  PHE C CE2   1 
ATOM   4424  C  CZ    . PHE C 2  153  ? -13.597 -27.314 -56.177  1.00 145.99 ? 153  PHE C CZ    1 
ATOM   4425  N  N     . MET C 2  154  ? -15.876 -24.746 -59.574  1.00 129.56 ? 154  MET C N     1 
ATOM   4426  C  CA    . MET C 2  154  ? -15.302 -23.431 -59.308  1.00 125.96 ? 154  MET C CA    1 
ATOM   4427  C  C     . MET C 2  154  ? -14.413 -23.410 -58.070  1.00 126.12 ? 154  MET C C     1 
ATOM   4428  O  O     . MET C 2  154  ? -13.302 -22.876 -58.116  1.00 130.62 ? 154  MET C O     1 
ATOM   4429  C  CB    . MET C 2  154  ? -16.415 -22.387 -59.164  1.00 124.09 ? 154  MET C CB    1 
ATOM   4430  C  CG    . MET C 2  154  ? -17.021 -21.951 -60.485  1.00 122.21 ? 154  MET C CG    1 
ATOM   4431  S  SD    . MET C 2  154  ? -15.773 -21.348 -61.639  1.00 134.89 ? 154  MET C SD    1 
ATOM   4432  C  CE    . MET C 2  154  ? -15.063 -19.998 -60.699  1.00 99.43  ? 154  MET C CE    1 
ATOM   4433  N  N     . GLY C 2  155  ? -14.877 -23.970 -56.959  1.00 113.10 ? 155  GLY C N     1 
ATOM   4434  C  CA    . GLY C 2  155  ? -14.071 -23.977 -55.757  1.00 113.94 ? 155  GLY C CA    1 
ATOM   4435  C  C     . GLY C 2  155  ? -14.818 -24.460 -54.533  1.00 112.72 ? 155  GLY C C     1 
ATOM   4436  O  O     . GLY C 2  155  ? -16.052 -24.490 -54.522  1.00 108.49 ? 155  GLY C O     1 
ATOM   4437  N  N     . ASP C 2  156  ? -14.080 -24.852 -53.499  1.00 112.78 ? 156  ASP C N     1 
ATOM   4438  C  CA    . ASP C 2  156  ? -14.700 -25.200 -52.229  1.00 101.44 ? 156  ASP C CA    1 
ATOM   4439  C  C     . ASP C 2  156  ? -15.204 -23.930 -51.556  1.00 92.82  ? 156  ASP C C     1 
ATOM   4440  O  O     . ASP C 2  156  ? -14.413 -23.058 -51.182  1.00 67.79  ? 156  ASP C O     1 
ATOM   4441  C  CB    . ASP C 2  156  ? -13.709 -25.942 -51.336  1.00 105.14 ? 156  ASP C CB    1 
ATOM   4442  C  CG    . ASP C 2  156  ? -13.394 -27.335 -51.849  1.00 119.48 ? 156  ASP C CG    1 
ATOM   4443  O  OD1   . ASP C 2  156  ? -14.262 -27.935 -52.519  1.00 108.17 ? 156  ASP C OD1   1 
ATOM   4444  O  OD2   . ASP C 2  156  ? -12.280 -27.832 -51.580  1.00 136.54 ? 156  ASP C OD2   1 
ATOM   4445  N  N     . PHE C 2  157  ? -16.525 -23.826 -51.410  1.00 90.24  ? 157  PHE C N     1 
ATOM   4446  C  CA    . PHE C 2  157  ? -17.163 -22.585 -51.003  1.00 82.71  ? 157  PHE C CA    1 
ATOM   4447  C  C     . PHE C 2  157  ? -17.496 -22.635 -49.522  1.00 81.89  ? 157  PHE C C     1 
ATOM   4448  O  O     . PHE C 2  157  ? -18.254 -23.523 -49.103  1.00 83.46  ? 157  PHE C O     1 
ATOM   4449  C  CB    . PHE C 2  157  ? -18.427 -22.356 -51.822  1.00 86.92  ? 157  PHE C CB    1 
ATOM   4450  C  CG    . PHE C 2  157  ? -18.977 -20.970 -51.708  1.00 80.29  ? 157  PHE C CG    1 
ATOM   4451  C  CD1   . PHE C 2  157  ? -20.121 -20.721 -50.971  1.00 84.38  ? 157  PHE C CD1   1 
ATOM   4452  C  CD2   . PHE C 2  157  ? -18.345 -19.912 -52.336  1.00 68.83  ? 157  PHE C CD2   1 
ATOM   4453  C  CE1   . PHE C 2  157  ? -20.628 -19.442 -50.866  1.00 83.35  ? 157  PHE C CE1   1 
ATOM   4454  C  CE2   . PHE C 2  157  ? -18.846 -18.633 -52.233  1.00 75.51  ? 157  PHE C CE2   1 
ATOM   4455  C  CZ    . PHE C 2  157  ? -19.990 -18.397 -51.498  1.00 80.33  ? 157  PHE C CZ    1 
ATOM   4456  N  N     . PRO C 2  158  ? -16.974 -21.719 -48.705  1.00 78.27  ? 158  PRO C N     1 
ATOM   4457  C  CA    . PRO C 2  158  ? -17.253 -21.767 -47.262  1.00 69.79  ? 158  PRO C CA    1 
ATOM   4458  C  C     . PRO C 2  158  ? -18.745 -21.670 -46.975  1.00 64.50  ? 158  PRO C C     1 
ATOM   4459  O  O     . PRO C 2  158  ? -19.429 -20.760 -47.448  1.00 58.75  ? 158  PRO C O     1 
ATOM   4460  C  CB    . PRO C 2  158  ? -16.493 -20.552 -46.715  1.00 78.52  ? 158  PRO C CB    1 
ATOM   4461  C  CG    . PRO C 2  158  ? -15.433 -20.275 -47.733  1.00 76.52  ? 158  PRO C CG    1 
ATOM   4462  C  CD    . PRO C 2  158  ? -16.042 -20.634 -49.055  1.00 82.09  ? 158  PRO C CD    1 
ATOM   4463  N  N     . MET C 2  159  ? -19.244 -22.618 -46.189  1.00 63.31  ? 159  MET C N     1 
ATOM   4464  C  CA    . MET C 2  159  ? -20.658 -22.713 -45.863  1.00 56.14  ? 159  MET C CA    1 
ATOM   4465  C  C     . MET C 2  159  ? -20.921 -22.213 -44.448  1.00 63.65  ? 159  MET C C     1 
ATOM   4466  O  O     . MET C 2  159  ? -20.075 -22.333 -43.558  1.00 76.32  ? 159  MET C O     1 
ATOM   4467  C  CB    . MET C 2  159  ? -21.152 -24.154 -46.008  1.00 71.16  ? 159  MET C CB    1 
ATOM   4468  C  CG    . MET C 2  159  ? -21.307 -24.608 -47.451  1.00 86.97  ? 159  MET C CG    1 
ATOM   4469  S  SD    . MET C 2  159  ? -22.597 -23.692 -48.317  1.00 102.07 ? 159  MET C SD    1 
ATOM   4470  C  CE    . MET C 2  159  ? -24.011 -24.040 -47.275  1.00 76.29  ? 159  MET C CE    1 
ATOM   4471  N  N     . MET C 2  160  ? -22.107 -21.643 -44.252  1.00 65.09  ? 160  MET C N     1 
ATOM   4472  C  CA    . MET C 2  160  ? -22.511 -21.126 -42.952  1.00 70.35  ? 160  MET C CA    1 
ATOM   4473  C  C     . MET C 2  160  ? -23.227 -22.211 -42.159  1.00 71.33  ? 160  MET C C     1 
ATOM   4474  O  O     . MET C 2  160  ? -24.143 -22.863 -42.671  1.00 52.88  ? 160  MET C O     1 
ATOM   4475  C  CB    . MET C 2  160  ? -23.417 -19.905 -43.109  1.00 77.04  ? 160  MET C CB    1 
ATOM   4476  C  CG    . MET C 2  160  ? -24.060 -19.455 -41.808  1.00 82.06  ? 160  MET C CG    1 
ATOM   4477  S  SD    . MET C 2  160  ? -25.096 -17.995 -41.988  1.00 83.15  ? 160  MET C SD    1 
ATOM   4478  C  CE    . MET C 2  160  ? -23.857 -16.735 -42.269  1.00 78.32  ? 160  MET C CE    1 
ATOM   4479  N  N     . THR C 2  161  ? -22.807 -22.397 -40.910  1.00 82.42  ? 161  THR C N     1 
ATOM   4480  C  CA    . THR C 2  161  ? -23.439 -23.373 -40.039  1.00 82.93  ? 161  THR C CA    1 
ATOM   4481  C  C     . THR C 2  161  ? -24.862 -22.935 -39.690  1.00 68.26  ? 161  THR C C     1 
ATOM   4482  O  O     . THR C 2  161  ? -25.274 -21.797 -39.931  1.00 78.36  ? 161  THR C O     1 
ATOM   4483  C  CB    . THR C 2  161  ? -22.619 -23.563 -38.763  1.00 88.27  ? 161  THR C CB    1 
ATOM   4484  O  OG1   . THR C 2  161  ? -22.648 -22.356 -37.991  1.00 81.58  ? 161  THR C OG1   1 
ATOM   4485  C  CG2   . THR C 2  161  ? -21.177 -23.899 -39.107  1.00 82.45  ? 161  THR C CG2   1 
ATOM   4486  N  N     . GLU C 2  162  ? -25.618 -23.870 -39.111  1.00 53.87  ? 162  GLU C N     1 
ATOM   4487  C  CA    . GLU C 2  162  ? -26.981 -23.567 -38.688  1.00 76.01  ? 162  GLU C CA    1 
ATOM   4488  C  C     . GLU C 2  162  ? -27.005 -22.534 -37.569  1.00 84.72  ? 162  GLU C C     1 
ATOM   4489  O  O     . GLU C 2  162  ? -27.993 -21.806 -37.418  1.00 83.11  ? 162  GLU C O     1 
ATOM   4490  C  CB    . GLU C 2  162  ? -27.684 -24.850 -38.248  1.00 99.48  ? 162  GLU C CB    1 
ATOM   4491  C  CG    . GLU C 2  162  ? -27.862 -25.866 -39.362  1.00 78.32  ? 162  GLU C CG    1 
ATOM   4492  C  CD    . GLU C 2  162  ? -28.022 -27.278 -38.839  1.00 121.42 ? 162  GLU C CD    1 
ATOM   4493  O  OE1   . GLU C 2  162  ? -27.025 -27.845 -38.343  1.00 134.75 ? 162  GLU C OE1   1 
ATOM   4494  O  OE2   . GLU C 2  162  ? -29.145 -27.819 -38.913  1.00 125.47 ? 162  GLU C OE2   1 
ATOM   4495  N  N     . LYS C 2  163  ? -25.935 -22.453 -36.783  1.00 89.77  ? 163  LYS C N     1 
ATOM   4496  C  CA    . LYS C 2  163  ? -25.820 -21.446 -35.737  1.00 98.07  ? 163  LYS C CA    1 
ATOM   4497  C  C     . LYS C 2  163  ? -25.465 -20.066 -36.277  1.00 73.74  ? 163  LYS C C     1 
ATOM   4498  O  O     . LYS C 2  163  ? -25.287 -19.137 -35.482  1.00 86.86  ? 163  LYS C O     1 
ATOM   4499  C  CB    . LYS C 2  163  ? -24.776 -21.882 -34.704  1.00 129.22 ? 163  LYS C CB    1 
ATOM   4500  C  CG    . LYS C 2  163  ? -25.248 -23.001 -33.791  1.00 111.17 ? 163  LYS C CG    1 
ATOM   4501  C  CD    . LYS C 2  163  ? -24.169 -23.407 -32.801  1.00 100.47 ? 163  LYS C CD    1 
ATOM   4502  C  CE    . LYS C 2  163  ? -23.031 -24.141 -33.492  1.00 112.97 ? 163  LYS C CE    1 
ATOM   4503  N  NZ    . LYS C 2  163  ? -22.001 -24.603 -32.521  1.00 100.04 ? 163  LYS C NZ    1 
ATOM   4504  N  N     . GLY C 2  164  ? -25.359 -19.909 -37.595  1.00 60.40  ? 164  GLY C N     1 
ATOM   4505  C  CA    . GLY C 2  164  ? -25.035 -18.624 -38.182  1.00 79.97  ? 164  GLY C CA    1 
ATOM   4506  C  C     . GLY C 2  164  ? -23.565 -18.276 -38.201  1.00 72.17  ? 164  GLY C C     1 
ATOM   4507  O  O     . GLY C 2  164  ? -23.224 -17.091 -38.270  1.00 79.22  ? 164  GLY C O     1 
ATOM   4508  N  N     . THR C 2  165  ? -22.682 -19.268 -38.147  1.00 69.32  ? 165  THR C N     1 
ATOM   4509  C  CA    . THR C 2  165  ? -21.247 -19.042 -38.112  1.00 73.92  ? 165  THR C CA    1 
ATOM   4510  C  C     . THR C 2  165  ? -20.566 -19.766 -39.266  1.00 69.93  ? 165  THR C C     1 
ATOM   4511  O  O     . THR C 2  165  ? -21.140 -20.655 -39.901  1.00 65.84  ? 165  THR C O     1 
ATOM   4512  C  CB    . THR C 2  165  ? -20.632 -19.522 -36.789  1.00 87.25  ? 165  THR C CB    1 
ATOM   4513  O  OG1   . THR C 2  165  ? -20.873 -20.926 -36.630  1.00 90.66  ? 165  THR C OG1   1 
ATOM   4514  C  CG2   . THR C 2  165  ? -21.232 -18.773 -35.615  1.00 99.93  ? 165  THR C CG2   1 
ATOM   4515  N  N     . PHE C 2  166  ? -19.327 -19.366 -39.528  1.00 59.99  ? 166  PHE C N     1 
ATOM   4516  C  CA    . PHE C 2  166  ? -18.437 -20.068 -40.435  1.00 65.52  ? 166  PHE C CA    1 
ATOM   4517  C  C     . PHE C 2  166  ? -17.306 -20.701 -39.636  1.00 76.57  ? 166  PHE C C     1 
ATOM   4518  O  O     . PHE C 2  166  ? -17.027 -20.313 -38.498  1.00 83.36  ? 166  PHE C O     1 
ATOM   4519  C  CB    . PHE C 2  166  ? -17.860 -19.125 -41.497  1.00 59.67  ? 166  PHE C CB    1 
ATOM   4520  C  CG    . PHE C 2  166  ? -18.891 -18.537 -42.417  1.00 60.24  ? 166  PHE C CG    1 
ATOM   4521  C  CD1   . PHE C 2  166  ? -19.445 -17.296 -42.154  1.00 73.63  ? 166  PHE C CD1   1 
ATOM   4522  C  CD2   . PHE C 2  166  ? -19.295 -19.219 -43.554  1.00 65.93  ? 166  PHE C CD2   1 
ATOM   4523  C  CE1   . PHE C 2  166  ? -20.389 -16.748 -43.002  1.00 80.03  ? 166  PHE C CE1   1 
ATOM   4524  C  CE2   . PHE C 2  166  ? -20.240 -18.676 -44.406  1.00 74.00  ? 166  PHE C CE2   1 
ATOM   4525  C  CZ    . PHE C 2  166  ? -20.788 -17.438 -44.129  1.00 77.72  ? 166  PHE C CZ    1 
ATOM   4526  N  N     . ILE C 2  167  ? -16.654 -21.688 -40.242  1.00 72.34  ? 167  ILE C N     1 
ATOM   4527  C  CA    . ILE C 2  167  ? -15.520 -22.373 -39.633  1.00 62.72  ? 167  ILE C CA    1 
ATOM   4528  C  C     . ILE C 2  167  ? -14.356 -22.266 -40.606  1.00 75.47  ? 167  ILE C C     1 
ATOM   4529  O  O     . ILE C 2  167  ? -14.334 -22.949 -41.638  1.00 71.50  ? 167  ILE C O     1 
ATOM   4530  C  CB    . ILE C 2  167  ? -15.834 -23.836 -39.299  1.00 57.02  ? 167  ILE C CB    1 
ATOM   4531  C  CG1   . ILE C 2  167  ? -17.001 -23.917 -38.313  1.00 62.46  ? 167  ILE C CG1   1 
ATOM   4532  C  CG2   . ILE C 2  167  ? -14.610 -24.523 -38.716  1.00 64.21  ? 167  ILE C CG2   1 
ATOM   4533  C  CD1   . ILE C 2  167  ? -17.367 -25.326 -37.927  1.00 67.28  ? 167  ILE C CD1   1 
ATOM   4534  N  N     . ILE C 2  168  ? -13.394 -21.405 -40.289  1.00 91.54  ? 168  ILE C N     1 
ATOM   4535  C  CA    . ILE C 2  168  ? -12.203 -21.208 -41.106  1.00 78.86  ? 168  ILE C CA    1 
ATOM   4536  C  C     . ILE C 2  168  ? -11.024 -21.772 -40.326  1.00 81.58  ? 168  ILE C C     1 
ATOM   4537  O  O     . ILE C 2  168  ? -10.644 -21.238 -39.275  1.00 91.00  ? 168  ILE C O     1 
ATOM   4538  C  CB    . ILE C 2  168  ? -11.992 -19.731 -41.473  1.00 78.74  ? 168  ILE C CB    1 
ATOM   4539  C  CG1   . ILE C 2  168  ? -12.913 -19.333 -42.629  1.00 70.34  ? 168  ILE C CG1   1 
ATOM   4540  C  CG2   . ILE C 2  168  ? -10.542 -19.463 -41.859  1.00 92.96  ? 168  ILE C CG2   1 
ATOM   4541  C  CD1   . ILE C 2  168  ? -14.356 -19.111 -42.240  1.00 61.43  ? 168  ILE C CD1   1 
ATOM   4542  N  N     . ASN C 2  169  ? -10.464 -22.873 -40.833  1.00 79.56  ? 169  ASN C N     1 
ATOM   4543  C  CA    . ASN C 2  169  ? -9.313  -23.540 -40.226  1.00 93.59  ? 169  ASN C CA    1 
ATOM   4544  C  C     . ASN C 2  169  ? -9.608  -23.969 -38.788  1.00 99.19  ? 169  ASN C C     1 
ATOM   4545  O  O     . ASN C 2  169  ? -8.764  -23.851 -37.897  1.00 111.95 ? 169  ASN C O     1 
ATOM   4546  C  CB    . ASN C 2  169  ? -8.064  -22.656 -40.298  1.00 92.41  ? 169  ASN C CB    1 
ATOM   4547  C  CG    . ASN C 2  169  ? -7.708  -22.256 -41.727  1.00 97.06  ? 169  ASN C CG    1 
ATOM   4548  O  OD1   . ASN C 2  169  ? -7.883  -23.034 -42.667  1.00 88.66  ? 169  ASN C OD1   1 
ATOM   4549  N  ND2   . ASN C 2  169  ? -7.207  -21.037 -41.891  1.00 106.63 ? 169  ASN C ND2   1 
ATOM   4550  N  N     . GLY C 2  170  ? -10.823 -24.468 -38.561  1.00 86.23  ? 170  GLY C N     1 
ATOM   4551  C  CA    . GLY C 2  170  ? -11.175 -25.062 -37.285  1.00 89.18  ? 170  GLY C CA    1 
ATOM   4552  C  C     . GLY C 2  170  ? -11.530 -24.100 -36.175  1.00 93.54  ? 170  GLY C C     1 
ATOM   4553  O  O     . GLY C 2  170  ? -11.477 -24.484 -35.003  1.00 102.98 ? 170  GLY C O     1 
ATOM   4554  N  N     . THR C 2  171  ? -11.888 -22.858 -36.498  1.00 87.75  ? 171  THR C N     1 
ATOM   4555  C  CA    . THR C 2  171  ? -12.296 -21.876 -35.499  1.00 85.89  ? 171  THR C CA    1 
ATOM   4556  C  C     . THR C 2  171  ? -13.572 -21.202 -35.978  1.00 69.57  ? 171  THR C C     1 
ATOM   4557  O  O     . THR C 2  171  ? -13.610 -20.661 -37.089  1.00 65.27  ? 171  THR C O     1 
ATOM   4558  C  CB    . THR C 2  171  ? -11.200 -20.834 -35.250  1.00 80.36  ? 171  THR C CB    1 
ATOM   4559  O  OG1   . THR C 2  171  ? -10.890 -20.158 -36.475  1.00 84.21  ? 171  THR C OG1   1 
ATOM   4560  C  CG2   . THR C 2  171  ? -9.937  -21.492 -34.704  1.00 90.82  ? 171  THR C CG2   1 
ATOM   4561  N  N     . GLU C 2  172  ? -14.612 -21.237 -35.148  1.00 71.41  ? 172  GLU C N     1 
ATOM   4562  C  CA    . GLU C 2  172  ? -15.878 -20.604 -35.499  1.00 59.81  ? 172  GLU C CA    1 
ATOM   4563  C  C     . GLU C 2  172  ? -15.693 -19.096 -35.600  1.00 58.57  ? 172  GLU C C     1 
ATOM   4564  O  O     . GLU C 2  172  ? -15.242 -18.452 -34.648  1.00 65.89  ? 172  GLU C O     1 
ATOM   4565  C  CB    . GLU C 2  172  ? -16.952 -20.945 -34.470  1.00 72.65  ? 172  GLU C CB    1 
ATOM   4566  C  CG    . GLU C 2  172  ? -17.852 -22.100 -34.880  1.00 94.51  ? 172  GLU C CG    1 
ATOM   4567  C  CD    . GLU C 2  172  ? -18.976 -22.348 -33.893  1.00 99.79  ? 172  GLU C CD    1 
ATOM   4568  O  OE1   . GLU C 2  172  ? -19.066 -21.604 -32.894  1.00 100.05 ? 172  GLU C OE1   1 
ATOM   4569  O  OE2   . GLU C 2  172  ? -19.770 -23.286 -34.117  1.00 100.07 ? 172  GLU C OE2   1 
ATOM   4570  N  N     . ARG C 2  173  ? -16.038 -18.538 -36.755  1.00 71.77  ? 173  ARG C N     1 
ATOM   4571  C  CA    . ARG C 2  173  ? -15.944 -17.109 -37.004  1.00 69.62  ? 173  ARG C CA    1 
ATOM   4572  C  C     . ARG C 2  173  ? -17.322 -16.561 -37.350  1.00 54.30  ? 173  ARG C C     1 
ATOM   4573  O  O     . ARG C 2  173  ? -18.226 -17.301 -37.752  1.00 61.65  ? 173  ARG C O     1 
ATOM   4574  C  CB    . ARG C 2  173  ? -14.951 -16.808 -38.135  1.00 62.65  ? 173  ARG C CB    1 
ATOM   4575  C  CG    . ARG C 2  173  ? -13.577 -17.427 -37.927  1.00 72.61  ? 173  ARG C CG    1 
ATOM   4576  C  CD    . ARG C 2  173  ? -12.593 -16.963 -38.986  1.00 69.52  ? 173  ARG C CD    1 
ATOM   4577  N  NE    . ARG C 2  173  ? -11.373 -16.431 -38.388  1.00 83.12  ? 173  ARG C NE    1 
ATOM   4578  C  CZ    . ARG C 2  173  ? -11.210 -15.161 -38.033  1.00 95.66  ? 173  ARG C CZ    1 
ATOM   4579  N  NH1   . ARG C 2  173  ? -12.192 -14.291 -38.219  1.00 94.95  ? 173  ARG C NH1   1 
ATOM   4580  N  NH2   . ARG C 2  173  ? -10.068 -14.759 -37.493  1.00 105.36 ? 173  ARG C NH2   1 
ATOM   4581  N  N     . VAL C 2  174  ? -17.478 -15.250 -37.185  1.00 48.97  ? 174  VAL C N     1 
ATOM   4582  C  CA    . VAL C 2  174  ? -18.748 -14.572 -37.415  1.00 63.76  ? 174  VAL C CA    1 
ATOM   4583  C  C     . VAL C 2  174  ? -18.506 -13.403 -38.358  1.00 68.06  ? 174  VAL C C     1 
ATOM   4584  O  O     . VAL C 2  174  ? -17.697 -12.516 -38.059  1.00 74.60  ? 174  VAL C O     1 
ATOM   4585  C  CB    . VAL C 2  174  ? -19.388 -14.081 -36.106  1.00 67.76  ? 174  VAL C CB    1 
ATOM   4586  C  CG1   . VAL C 2  174  ? -20.570 -13.173 -36.404  1.00 65.46  ? 174  VAL C CG1   1 
ATOM   4587  C  CG2   . VAL C 2  174  ? -19.825 -15.260 -35.253  1.00 69.38  ? 174  VAL C CG2   1 
ATOM   4588  N  N     . VAL C 2  175  ? -19.203 -13.401 -39.491  1.00 48.35  ? 175  VAL C N     1 
ATOM   4589  C  CA    . VAL C 2  175  ? -19.167 -12.277 -40.420  1.00 48.66  ? 175  VAL C CA    1 
ATOM   4590  C  C     . VAL C 2  175  ? -20.138 -11.219 -39.905  1.00 71.12  ? 175  VAL C C     1 
ATOM   4591  O  O     . VAL C 2  175  ? -21.353 -11.426 -39.899  1.00 85.22  ? 175  VAL C O     1 
ATOM   4592  C  CB    . VAL C 2  175  ? -19.521 -12.710 -41.847  1.00 57.57  ? 175  VAL C CB    1 
ATOM   4593  C  CG1   . VAL C 2  175  ? -19.637 -11.496 -42.755  1.00 59.55  ? 175  VAL C CG1   1 
ATOM   4594  C  CG2   . VAL C 2  175  ? -18.475 -13.679 -42.373  1.00 56.57  ? 175  VAL C CG2   1 
ATOM   4595  N  N     . VAL C 2  176  ? -19.602 -10.089 -39.474  1.00 70.94  ? 176  VAL C N     1 
ATOM   4596  C  CA    . VAL C 2  176  ? -20.385 -9.046  -38.823  1.00 65.54  ? 176  VAL C CA    1 
ATOM   4597  C  C     . VAL C 2  176  ? -20.994 -8.133  -39.876  1.00 70.01  ? 176  VAL C C     1 
ATOM   4598  O  O     . VAL C 2  176  ? -20.333 -7.747  -40.848  1.00 69.86  ? 176  VAL C O     1 
ATOM   4599  C  CB    . VAL C 2  176  ? -19.511 -8.255  -37.833  1.00 64.11  ? 176  VAL C CB    1 
ATOM   4600  C  CG1   . VAL C 2  176  ? -20.317 -7.149  -37.172  1.00 75.43  ? 176  VAL C CG1   1 
ATOM   4601  C  CG2   . VAL C 2  176  ? -18.926 -9.194  -36.791  1.00 49.98  ? 176  VAL C CG2   1 
ATOM   4602  N  N     . SER C 2  177  ? -22.265 -7.790  -39.682  1.00 66.53  ? 177  SER C N     1 
ATOM   4603  C  CA    . SER C 2  177  ? -22.938 -6.851  -40.567  1.00 63.85  ? 177  SER C CA    1 
ATOM   4604  C  C     . SER C 2  177  ? -22.329 -5.462  -40.413  1.00 70.33  ? 177  SER C C     1 
ATOM   4605  O  O     . SER C 2  177  ? -22.059 -5.005  -39.299  1.00 77.32  ? 177  SER C O     1 
ATOM   4606  C  CB    . SER C 2  177  ? -24.434 -6.816  -40.257  1.00 60.31  ? 177  SER C CB    1 
ATOM   4607  O  OG    . SER C 2  177  ? -24.953 -8.124  -40.082  1.00 70.93  ? 177  SER C OG    1 
ATOM   4608  N  N     . GLN C 2  178  ? -22.115 -4.788  -41.540  1.00 61.31  ? 178  GLN C N     1 
ATOM   4609  C  CA    . GLN C 2  178  ? -21.379 -3.531  -41.576  1.00 69.33  ? 178  GLN C CA    1 
ATOM   4610  C  C     . GLN C 2  178  ? -22.306 -2.376  -41.931  1.00 71.62  ? 178  GLN C C     1 
ATOM   4611  O  O     . GLN C 2  178  ? -23.069 -2.460  -42.899  1.00 53.92  ? 178  GLN C O     1 
ATOM   4612  C  CB    . GLN C 2  178  ? -20.226 -3.602  -42.580  1.00 63.88  ? 178  GLN C CB    1 
ATOM   4613  C  CG    . GLN C 2  178  ? -19.376 -2.341  -42.621  1.00 72.78  ? 178  GLN C CG    1 
ATOM   4614  C  CD    . GLN C 2  178  ? -18.241 -2.425  -43.622  1.00 80.12  ? 178  GLN C CD    1 
ATOM   4615  O  OE1   . GLN C 2  178  ? -18.202 -3.324  -44.463  1.00 84.24  ? 178  GLN C OE1   1 
ATOM   4616  N  NE2   . GLN C 2  178  ? -17.308 -1.485  -43.536  1.00 91.58  ? 178  GLN C NE2   1 
ATOM   4617  N  N     . LEU C 2  179  ? -22.227 -1.302  -41.148  1.00 83.97  ? 179  LEU C N     1 
ATOM   4618  C  CA    . LEU C 2  179  ? -22.928 -0.058  -41.440  1.00 77.07  ? 179  LEU C CA    1 
ATOM   4619  C  C     . LEU C 2  179  ? -22.065 0.792   -42.364  1.00 81.65  ? 179  LEU C C     1 
ATOM   4620  O  O     . LEU C 2  179  ? -20.949 1.177   -41.996  1.00 84.65  ? 179  LEU C O     1 
ATOM   4621  C  CB    . LEU C 2  179  ? -23.237 0.707   -40.153  1.00 78.30  ? 179  LEU C CB    1 
ATOM   4622  C  CG    . LEU C 2  179  ? -24.316 0.175   -39.211  1.00 73.02  ? 179  LEU C CG    1 
ATOM   4623  C  CD1   . LEU C 2  179  ? -24.328 0.983   -37.921  1.00 92.59  ? 179  LEU C CD1   1 
ATOM   4624  C  CD2   . LEU C 2  179  ? -25.676 0.220   -39.886  1.00 66.61  ? 179  LEU C CD2   1 
ATOM   4625  N  N     . VAL C 2  180  ? -22.577 1.089   -43.558  1.00 82.31  ? 180  VAL C N     1 
ATOM   4626  C  CA    . VAL C 2  180  ? -21.846 1.881   -44.535  1.00 93.14  ? 180  VAL C CA    1 
ATOM   4627  C  C     . VAL C 2  180  ? -22.732 3.005   -45.051  1.00 98.11  ? 180  VAL C C     1 
ATOM   4628  O  O     . VAL C 2  180  ? -23.955 2.996   -44.895  1.00 91.00  ? 180  VAL C O     1 
ATOM   4629  C  CB    . VAL C 2  180  ? -21.328 1.030   -45.717  1.00 102.54 ? 180  VAL C CB    1 
ATOM   4630  C  CG1   . VAL C 2  180  ? -20.160 0.163   -45.278  1.00 98.40  ? 180  VAL C CG1   1 
ATOM   4631  C  CG2   . VAL C 2  180  ? -22.449 0.178   -46.292  1.00 101.27 ? 180  VAL C CG2   1 
ATOM   4632  N  N     . ARG C 2  181  ? -22.084 3.986   -45.671  1.00 112.57 ? 181  ARG C N     1 
ATOM   4633  C  CA    . ARG C 2  181  ? -22.784 5.079   -46.330  1.00 104.65 ? 181  ARG C CA    1 
ATOM   4634  C  C     . ARG C 2  181  ? -23.508 4.540   -47.559  1.00 98.86  ? 181  ARG C C     1 
ATOM   4635  O  O     . ARG C 2  181  ? -22.876 3.978   -48.460  1.00 101.04 ? 181  ARG C O     1 
ATOM   4636  C  CB    . ARG C 2  181  ? -21.782 6.165   -46.715  1.00 111.12 ? 181  ARG C CB    1 
ATOM   4637  C  CG    . ARG C 2  181  ? -22.319 7.581   -46.773  1.00 103.65 ? 181  ARG C CG    1 
ATOM   4638  C  CD    . ARG C 2  181  ? -21.153 8.558   -46.854  1.00 126.43 ? 181  ARG C CD    1 
ATOM   4639  N  NE    . ARG C 2  181  ? -21.572 9.912   -47.203  1.00 147.63 ? 181  ARG C NE    1 
ATOM   4640  C  CZ    . ARG C 2  181  ? -20.734 10.921  -47.412  1.00 146.75 ? 181  ARG C CZ    1 
ATOM   4641  N  NH1   . ARG C 2  181  ? -19.425 10.730  -47.311  1.00 150.48 ? 181  ARG C NH1   1 
ATOM   4642  N  NH2   . ARG C 2  181  ? -21.203 12.121  -47.725  1.00 127.06 ? 181  ARG C NH2   1 
ATOM   4643  N  N     . SER C 2  182  ? -24.830 4.690   -47.588  1.00 103.88 ? 182  SER C N     1 
ATOM   4644  C  CA    . SER C 2  182  ? -25.613 4.168   -48.695  1.00 112.22 ? 182  SER C CA    1 
ATOM   4645  C  C     . SER C 2  182  ? -25.253 4.887   -49.995  1.00 112.01 ? 182  SER C C     1 
ATOM   4646  O  O     . SER C 2  182  ? -24.946 6.081   -49.989  1.00 127.11 ? 182  SER C O     1 
ATOM   4647  C  CB    . SER C 2  182  ? -27.106 4.329   -48.420  1.00 125.67 ? 182  SER C CB    1 
ATOM   4648  O  OG    . SER C 2  182  ? -27.877 3.914   -49.534  1.00 110.24 ? 182  SER C OG    1 
ATOM   4649  N  N     . PRO C 2  183  ? -25.271 4.177   -51.122  1.00 103.17 ? 183  PRO C N     1 
ATOM   4650  C  CA    . PRO C 2  183  ? -25.048 4.845   -52.410  1.00 98.83  ? 183  PRO C CA    1 
ATOM   4651  C  C     . PRO C 2  183  ? -26.166 5.832   -52.712  1.00 106.58 ? 183  PRO C C     1 
ATOM   4652  O  O     . PRO C 2  183  ? -27.338 5.578   -52.427  1.00 109.49 ? 183  PRO C O     1 
ATOM   4653  C  CB    . PRO C 2  183  ? -25.030 3.686   -53.415  1.00 95.77  ? 183  PRO C CB    1 
ATOM   4654  C  CG    . PRO C 2  183  ? -24.746 2.463   -52.595  1.00 114.90 ? 183  PRO C CG    1 
ATOM   4655  C  CD    . PRO C 2  183  ? -25.383 2.716   -51.266  1.00 110.40 ? 183  PRO C CD    1 
ATOM   4656  N  N     . GLY C 2  184  ? -25.793 6.967   -53.287  1.00 99.20  ? 184  GLY C N     1 
ATOM   4657  C  CA    . GLY C 2  184  ? -26.762 7.993   -53.609  1.00 112.22 ? 184  GLY C CA    1 
ATOM   4658  C  C     . GLY C 2  184  ? -26.099 9.354   -53.699  1.00 102.01 ? 184  GLY C C     1 
ATOM   4659  O  O     . GLY C 2  184  ? -24.878 9.482   -53.608  1.00 92.65  ? 184  GLY C O     1 
ATOM   4660  N  N     . VAL C 2  185  ? -26.941 10.367  -53.883  1.00 103.37 ? 185  VAL C N     1 
ATOM   4661  C  CA    . VAL C 2  185  ? -26.506 11.754  -54.012  1.00 100.24 ? 185  VAL C CA    1 
ATOM   4662  C  C     . VAL C 2  185  ? -26.847 12.472  -52.714  1.00 106.76 ? 185  VAL C C     1 
ATOM   4663  O  O     . VAL C 2  185  ? -28.009 12.476  -52.285  1.00 104.96 ? 185  VAL C O     1 
ATOM   4664  C  CB    . VAL C 2  185  ? -27.164 12.442  -55.219  1.00 107.38 ? 185  VAL C CB    1 
ATOM   4665  C  CG1   . VAL C 2  185  ? -26.652 13.864  -55.362  1.00 111.02 ? 185  VAL C CG1   1 
ATOM   4666  C  CG2   . VAL C 2  185  ? -26.901 11.645  -56.488  1.00 119.20 ? 185  VAL C CG2   1 
ATOM   4667  N  N     . TYR C 2  186  ? -25.840 13.078  -52.091  1.00 101.52 ? 186  TYR C N     1 
ATOM   4668  C  CA    . TYR C 2  186  ? -25.988 13.672  -50.771  1.00 106.02 ? 186  TYR C CA    1 
ATOM   4669  C  C     . TYR C 2  186  ? -25.501 15.111  -50.787  1.00 102.18 ? 186  TYR C C     1 
ATOM   4670  O  O     . TYR C 2  186  ? -24.504 15.434  -51.439  1.00 97.57  ? 186  TYR C O     1 
ATOM   4671  C  CB    . TYR C 2  186  ? -25.226 12.857  -49.724  1.00 116.16 ? 186  TYR C CB    1 
ATOM   4672  C  CG    . TYR C 2  186  ? -25.706 11.429  -49.647  1.00 114.81 ? 186  TYR C CG    1 
ATOM   4673  C  CD1   . TYR C 2  186  ? -27.064 11.136  -49.628  1.00 130.87 ? 186  TYR C CD1   1 
ATOM   4674  C  CD2   . TYR C 2  186  ? -24.808 10.373  -49.621  1.00 104.16 ? 186  TYR C CD2   1 
ATOM   4675  C  CE1   . TYR C 2  186  ? -27.514 9.834   -49.569  1.00 126.74 ? 186  TYR C CE1   1 
ATOM   4676  C  CE2   . TYR C 2  186  ? -25.249 9.068   -49.560  1.00 116.98 ? 186  TYR C CE2   1 
ATOM   4677  C  CZ    . TYR C 2  186  ? -26.602 8.803   -49.535  1.00 122.08 ? 186  TYR C CZ    1 
ATOM   4678  O  OH    . TYR C 2  186  ? -27.046 7.503   -49.476  1.00 122.39 ? 186  TYR C OH    1 
ATOM   4679  N  N     . PHE C 2  187  ? -26.210 15.968  -50.058  1.00 106.43 ? 187  PHE C N     1 
ATOM   4680  C  CA    . PHE C 2  187  ? -25.960 17.401  -50.043  1.00 103.81 ? 187  PHE C CA    1 
ATOM   4681  C  C     . PHE C 2  187  ? -25.642 17.845  -48.622  1.00 110.93 ? 187  PHE C C     1 
ATOM   4682  O  O     . PHE C 2  187  ? -26.216 17.330  -47.658  1.00 128.43 ? 187  PHE C O     1 
ATOM   4683  C  CB    . PHE C 2  187  ? -27.170 18.167  -50.593  1.00 117.05 ? 187  PHE C CB    1 
ATOM   4684  C  CG    . PHE C 2  187  ? -27.593 17.720  -51.967  1.00 127.59 ? 187  PHE C CG    1 
ATOM   4685  C  CD1   . PHE C 2  187  ? -28.407 16.611  -52.131  1.00 128.81 ? 187  PHE C CD1   1 
ATOM   4686  C  CD2   . PHE C 2  187  ? -27.169 18.404  -53.093  1.00 113.54 ? 187  PHE C CD2   1 
ATOM   4687  C  CE1   . PHE C 2  187  ? -28.789 16.193  -53.391  1.00 124.54 ? 187  PHE C CE1   1 
ATOM   4688  C  CE2   . PHE C 2  187  ? -27.549 17.991  -54.357  1.00 113.64 ? 187  PHE C CE2   1 
ATOM   4689  C  CZ    . PHE C 2  187  ? -28.359 16.883  -54.506  1.00 124.11 ? 187  PHE C CZ    1 
ATOM   4690  N  N     . ASP C 2  188  ? -24.723 18.801  -48.498  1.00 116.13 ? 188  ASP C N     1 
ATOM   4691  C  CA    . ASP C 2  188  ? -24.222 19.252  -47.208  1.00 134.52 ? 188  ASP C CA    1 
ATOM   4692  C  C     . ASP C 2  188  ? -24.236 20.772  -47.140  1.00 133.20 ? 188  ASP C C     1 
ATOM   4693  O  O     . ASP C 2  188  ? -23.959 21.449  -48.134  1.00 146.72 ? 188  ASP C O     1 
ATOM   4694  C  CB    . ASP C 2  188  ? -22.799 18.727  -46.960  1.00 154.92 ? 188  ASP C CB    1 
ATOM   4695  C  CG    . ASP C 2  188  ? -22.067 19.504  -45.884  1.00 173.57 ? 188  ASP C CG    1 
ATOM   4696  O  OD1   . ASP C 2  188  ? -22.481 19.432  -44.708  1.00 183.91 ? 188  ASP C OD1   1 
ATOM   4697  O  OD2   . ASP C 2  188  ? -21.075 20.186  -46.218  1.00 169.85 ? 188  ASP C OD2   1 
ATOM   4698  N  N     . GLU C 2  189  ? -24.561 21.302  -45.961  1.00 127.46 ? 189  GLU C N     1 
ATOM   4699  C  CA    . GLU C 2  189  ? -24.556 22.740  -45.694  1.00 138.33 ? 189  GLU C CA    1 
ATOM   4700  C  C     . GLU C 2  189  ? -23.412 23.026  -44.723  1.00 147.78 ? 189  GLU C C     1 
ATOM   4701  O  O     . GLU C 2  189  ? -23.575 22.949  -43.504  1.00 164.70 ? 189  GLU C O     1 
ATOM   4702  C  CB    . GLU C 2  189  ? -25.899 23.207  -45.134  1.00 140.93 ? 189  GLU C CB    1 
ATOM   4703  C  CG    . GLU C 2  189  ? -25.948 24.691  -44.798  1.00 154.97 ? 189  GLU C CG    1 
ATOM   4704  C  CD    . GLU C 2  189  ? -27.315 25.137  -44.319  1.00 150.74 ? 189  GLU C CD    1 
ATOM   4705  O  OE1   . GLU C 2  189  ? -27.739 26.255  -44.683  1.00 146.00 ? 189  GLU C OE1   1 
ATOM   4706  O  OE2   . GLU C 2  189  ? -27.968 24.368  -43.583  1.00 121.20 ? 189  GLU C OE2   1 
ATOM   4707  N  N     . THR C 2  190  ? -22.249 23.349  -45.276  1.00 139.85 ? 190  THR C N     1 
ATOM   4708  C  CA    . THR C 2  190  ? -21.073 23.687  -44.491  1.00 147.89 ? 190  THR C CA    1 
ATOM   4709  C  C     . THR C 2  190  ? -20.933 25.200  -44.383  1.00 157.62 ? 190  THR C C     1 
ATOM   4710  O  O     . THR C 2  190  ? -21.418 25.952  -45.233  1.00 168.58 ? 190  THR C O     1 
ATOM   4711  C  CB    . THR C 2  190  ? -19.807 23.086  -45.110  1.00 145.03 ? 190  THR C CB    1 
ATOM   4712  O  OG1   . THR C 2  190  ? -18.655 23.536  -44.384  1.00 157.32 ? 190  THR C OG1   1 
ATOM   4713  C  CG2   . THR C 2  190  ? -19.675 23.495  -46.570  1.00 135.61 ? 190  THR C CG2   1 
ATOM   4714  N  N     . ILE C 2  191  ? -20.270 25.640  -43.319  1.00 158.55 ? 191  ILE C N     1 
ATOM   4715  C  CA    . ILE C 2  191  ? -20.037 27.054  -43.055  1.00 157.24 ? 191  ILE C CA    1 
ATOM   4716  C  C     . ILE C 2  191  ? -18.551 27.328  -43.236  1.00 156.20 ? 191  ILE C C     1 
ATOM   4717  O  O     . ILE C 2  191  ? -17.709 26.621  -42.669  1.00 143.80 ? 191  ILE C O     1 
ATOM   4718  C  CB    . ILE C 2  191  ? -20.507 27.449  -41.645  1.00 149.40 ? 191  ILE C CB    1 
ATOM   4719  C  CG1   . ILE C 2  191  ? -21.900 26.880  -41.369  1.00 136.85 ? 191  ILE C CG1   1 
ATOM   4720  C  CG2   . ILE C 2  191  ? -20.519 28.961  -41.491  1.00 147.79 ? 191  ILE C CG2   1 
ATOM   4721  C  CD1   . ILE C 2  191  ? -22.981 27.437  -42.269  1.00 127.00 ? 191  ILE C CD1   1 
ATOM   4722  N  N     . ASP C 2  192  ? -18.231 28.348  -44.028  1.00 167.85 ? 192  ASP C N     1 
ATOM   4723  C  CA    . ASP C 2  192  ? -16.843 28.659  -44.331  1.00 168.14 ? 192  ASP C CA    1 
ATOM   4724  C  C     . ASP C 2  192  ? -16.133 29.227  -43.104  1.00 169.61 ? 192  ASP C C     1 
ATOM   4725  O  O     . ASP C 2  192  ? -16.752 29.780  -42.188  1.00 163.79 ? 192  ASP C O     1 
ATOM   4726  C  CB    . ASP C 2  192  ? -16.766 29.637  -45.506  1.00 177.48 ? 192  ASP C CB    1 
ATOM   4727  C  CG    . ASP C 2  192  ? -15.341 29.928  -45.936  1.00 180.18 ? 192  ASP C CG    1 
ATOM   4728  O  OD1   . ASP C 2  192  ? -14.942 31.112  -45.911  1.00 180.10 ? 192  ASP C OD1   1 
ATOM   4729  O  OD2   . ASP C 2  192  ? -14.614 28.972  -46.283  1.00 186.00 ? 192  ASP C OD2   1 
ATOM   4730  N  N     . LYS C 2  193  ? -14.807 29.078  -43.097  1.00 174.60 ? 193  LYS C N     1 
ATOM   4731  C  CA    . LYS C 2  193  ? -13.959 29.487  -41.983  1.00 173.16 ? 193  LYS C CA    1 
ATOM   4732  C  C     . LYS C 2  193  ? -13.591 30.969  -42.035  1.00 166.62 ? 193  LYS C C     1 
ATOM   4733  O  O     . LYS C 2  193  ? -13.681 31.666  -41.021  1.00 151.93 ? 193  LYS C O     1 
ATOM   4734  C  CB    . LYS C 2  193  ? -12.684 28.638  -41.966  1.00 176.44 ? 193  LYS C CB    1 
ATOM   4735  C  CG    . LYS C 2  193  ? -12.926 27.146  -42.142  1.00 171.76 ? 193  LYS C CG    1 
ATOM   4736  C  CD    . LYS C 2  193  ? -11.618 26.380  -42.232  1.00 164.52 ? 193  LYS C CD    1 
ATOM   4737  C  CE    . LYS C 2  193  ? -11.855 24.918  -42.573  1.00 128.67 ? 193  LYS C CE    1 
ATOM   4738  N  NZ    . LYS C 2  193  ? -12.669 24.222  -41.539  1.00 133.88 ? 193  LYS C NZ    1 
ATOM   4739  N  N     . SER C 2  194  ? -13.179 31.466  -43.205  1.00 175.81 ? 194  SER C N     1 
ATOM   4740  C  CA    . SER C 2  194  ? -12.616 32.809  -43.304  1.00 162.31 ? 194  SER C CA    1 
ATOM   4741  C  C     . SER C 2  194  ? -13.649 33.875  -43.650  1.00 163.87 ? 194  SER C C     1 
ATOM   4742  O  O     . SER C 2  194  ? -13.564 34.999  -43.144  1.00 154.33 ? 194  SER C O     1 
ATOM   4743  C  CB    . SER C 2  194  ? -11.489 32.830  -44.341  1.00 160.44 ? 194  SER C CB    1 
ATOM   4744  O  OG    . SER C 2  194  ? -11.947 32.385  -45.606  1.00 161.51 ? 194  SER C OG    1 
ATOM   4745  N  N     . THR C 2  195  ? -14.618 33.559  -44.510  1.00 173.22 ? 195  THR C N     1 
ATOM   4746  C  CA    . THR C 2  195  ? -15.595 34.545  -44.956  1.00 168.98 ? 195  THR C CA    1 
ATOM   4747  C  C     . THR C 2  195  ? -16.939 34.431  -44.248  1.00 171.25 ? 195  THR C C     1 
ATOM   4748  O  O     . THR C 2  195  ? -17.784 35.316  -44.420  1.00 165.47 ? 195  THR C O     1 
ATOM   4749  C  CB    . THR C 2  195  ? -15.808 34.436  -46.472  1.00 162.67 ? 195  THR C CB    1 
ATOM   4750  O  OG1   . THR C 2  195  ? -16.237 33.111  -46.805  1.00 176.52 ? 195  THR C OG1   1 
ATOM   4751  C  CG2   . THR C 2  195  ? -14.516 34.751  -47.213  1.00 146.74 ? 195  THR C CG2   1 
ATOM   4752  N  N     . ASP C 2  196  ? -17.158 33.368  -43.470  1.00 177.28 ? 196  ASP C N     1 
ATOM   4753  C  CA    . ASP C 2  196  ? -18.349 33.223  -42.629  1.00 175.47 ? 196  ASP C CA    1 
ATOM   4754  C  C     . ASP C 2  196  ? -19.636 33.234  -43.453  1.00 170.85 ? 196  ASP C C     1 
ATOM   4755  O  O     . ASP C 2  196  ? -20.658 33.780  -43.031  1.00 174.37 ? 196  ASP C O     1 
ATOM   4756  C  CB    . ASP C 2  196  ? -18.395 34.303  -41.545  1.00 149.74 ? 196  ASP C CB    1 
ATOM   4757  C  CG    . ASP C 2  196  ? -17.202 34.246  -40.614  1.00 139.47 ? 196  ASP C CG    1 
ATOM   4758  O  OD1   . ASP C 2  196  ? -16.628 33.150  -40.446  1.00 140.66 ? 196  ASP C OD1   1 
ATOM   4759  O  OD2   . ASP C 2  196  ? -16.841 35.298  -40.046  1.00 133.86 ? 196  ASP C OD2   1 
ATOM   4760  N  N     . LYS C 2  197  ? -19.591 32.628  -44.635  1.00 159.79 ? 197  LYS C N     1 
ATOM   4761  C  CA    . LYS C 2  197  ? -20.767 32.477  -45.477  1.00 166.80 ? 197  LYS C CA    1 
ATOM   4762  C  C     . LYS C 2  197  ? -21.142 31.004  -45.579  1.00 161.87 ? 197  LYS C C     1 
ATOM   4763  O  O     . LYS C 2  197  ? -20.288 30.119  -45.477  1.00 156.65 ? 197  LYS C O     1 
ATOM   4764  C  CB    . LYS C 2  197  ? -20.534 33.061  -46.875  1.00 172.90 ? 197  LYS C CB    1 
ATOM   4765  C  CG    . LYS C 2  197  ? -19.449 32.368  -47.680  1.00 172.62 ? 197  LYS C CG    1 
ATOM   4766  C  CD    . LYS C 2  197  ? -19.318 32.989  -49.063  1.00 166.45 ? 197  LYS C CD    1 
ATOM   4767  C  CE    . LYS C 2  197  ? -18.954 34.463  -48.975  1.00 154.53 ? 197  LYS C CE    1 
ATOM   4768  N  NZ    . LYS C 2  197  ? -18.859 35.094  -50.321  1.00 147.15 ? 197  LYS C NZ    1 
ATOM   4769  N  N     . THR C 2  198  ? -22.434 30.749  -45.775  1.00 169.71 ? 198  THR C N     1 
ATOM   4770  C  CA    . THR C 2  198  ? -22.956 29.386  -45.814  1.00 164.40 ? 198  THR C CA    1 
ATOM   4771  C  C     . THR C 2  198  ? -22.643 28.765  -47.171  1.00 170.01 ? 198  THR C C     1 
ATOM   4772  O  O     . THR C 2  198  ? -23.164 29.208  -48.200  1.00 163.83 ? 198  THR C O     1 
ATOM   4773  C  CB    . THR C 2  198  ? -24.458 29.381  -45.543  1.00 155.77 ? 198  THR C CB    1 
ATOM   4774  O  OG1   . THR C 2  198  ? -25.134 30.109  -46.577  1.00 166.08 ? 198  THR C OG1   1 
ATOM   4775  C  CG2   . THR C 2  198  ? -24.758 30.029  -44.199  1.00 127.83 ? 198  THR C CG2   1 
ATOM   4776  N  N     . LEU C 2  199  ? -21.796 27.741  -47.175  1.00 170.45 ? 199  LEU C N     1 
ATOM   4777  C  CA    . LEU C 2  199  ? -21.438 27.021  -48.387  1.00 154.85 ? 199  LEU C CA    1 
ATOM   4778  C  C     . LEU C 2  199  ? -22.289 25.762  -48.526  1.00 153.60 ? 199  LEU C C     1 
ATOM   4779  O  O     . LEU C 2  199  ? -23.030 25.375  -47.620  1.00 177.67 ? 199  LEU C O     1 
ATOM   4780  C  CB    . LEU C 2  199  ? -19.949 26.659  -48.382  1.00 132.78 ? 199  LEU C CB    1 
ATOM   4781  C  CG    . LEU C 2  199  ? -18.949 27.792  -48.143  1.00 135.99 ? 199  LEU C CG    1 
ATOM   4782  C  CD1   . LEU C 2  199  ? -17.521 27.265  -48.184  1.00 135.82 ? 199  LEU C CD1   1 
ATOM   4783  C  CD2   . LEU C 2  199  ? -19.145 28.907  -49.156  1.00 156.06 ? 199  LEU C CD2   1 
ATOM   4784  N  N     . HIS C 2  200  ? -22.172 25.120  -49.687  1.00 124.79 ? 200  HIS C N     1 
ATOM   4785  C  CA    . HIS C 2  200  ? -22.911 23.898  -49.966  1.00 125.07 ? 200  HIS C CA    1 
ATOM   4786  C  C     . HIS C 2  200  ? -22.062 22.988  -50.841  1.00 133.66 ? 200  HIS C C     1 
ATOM   4787  O  O     . HIS C 2  200  ? -21.254 23.457  -51.649  1.00 144.19 ? 200  HIS C O     1 
ATOM   4788  C  CB    . HIS C 2  200  ? -24.256 24.191  -50.643  1.00 131.23 ? 200  HIS C CB    1 
ATOM   4789  C  CG    . HIS C 2  200  ? -25.233 24.905  -49.762  1.00 150.25 ? 200  HIS C CG    1 
ATOM   4790  N  ND1   . HIS C 2  200  ? -25.234 26.274  -49.606  1.00 162.58 ? 200  HIS C ND1   1 
ATOM   4791  C  CD2   . HIS C 2  200  ? -26.236 24.437  -48.982  1.00 143.87 ? 200  HIS C CD2   1 
ATOM   4792  C  CE1   . HIS C 2  200  ? -26.198 26.620  -48.772  1.00 138.53 ? 200  HIS C CE1   1 
ATOM   4793  N  NE2   . HIS C 2  200  ? -26.821 25.524  -48.378  1.00 125.24 ? 200  HIS C NE2   1 
ATOM   4794  N  N     . SER C 2  201  ? -22.254 21.681  -50.675  1.00 136.42 ? 201  SER C N     1 
ATOM   4795  C  CA    . SER C 2  201  ? -21.470 20.697  -51.405  1.00 126.34 ? 201  SER C CA    1 
ATOM   4796  C  C     . SER C 2  201  ? -22.331 19.476  -51.694  1.00 111.12 ? 201  SER C C     1 
ATOM   4797  O  O     . SER C 2  201  ? -23.312 19.203  -50.998  1.00 117.48 ? 201  SER C O     1 
ATOM   4798  C  CB    . SER C 2  201  ? -20.211 20.295  -50.627  1.00 135.00 ? 201  SER C CB    1 
ATOM   4799  O  OG    . SER C 2  201  ? -20.546 19.793  -49.344  1.00 124.96 ? 201  SER C OG    1 
ATOM   4800  N  N     . VAL C 2  202  ? -21.950 18.744  -52.739  1.00 116.59 ? 202  VAL C N     1 
ATOM   4801  C  CA    . VAL C 2  202  ? -22.668 17.557  -53.189  1.00 115.85 ? 202  VAL C CA    1 
ATOM   4802  C  C     . VAL C 2  202  ? -21.674 16.413  -53.336  1.00 122.76 ? 202  VAL C C     1 
ATOM   4803  O  O     . VAL C 2  202  ? -20.520 16.629  -53.721  1.00 136.12 ? 202  VAL C O     1 
ATOM   4804  C  CB    . VAL C 2  202  ? -23.398 17.804  -54.528  1.00 124.89 ? 202  VAL C CB    1 
ATOM   4805  C  CG1   . VAL C 2  202  ? -24.359 16.667  -54.834  1.00 110.42 ? 202  VAL C CG1   1 
ATOM   4806  C  CG2   . VAL C 2  202  ? -24.121 19.139  -54.511  1.00 134.19 ? 202  VAL C CG2   1 
ATOM   4807  N  N     . LYS C 2  203  ? -22.124 15.196  -53.030  1.00 110.76 ? 203  LYS C N     1 
ATOM   4808  C  CA    . LYS C 2  203  ? -21.343 13.986  -53.247  1.00 110.53 ? 203  LYS C CA    1 
ATOM   4809  C  C     . LYS C 2  203  ? -22.205 12.947  -53.950  1.00 98.87  ? 203  LYS C C     1 
ATOM   4810  O  O     . LYS C 2  203  ? -23.360 12.728  -53.573  1.00 100.29 ? 203  LYS C O     1 
ATOM   4811  C  CB    . LYS C 2  203  ? -20.807 13.412  -51.928  1.00 135.74 ? 203  LYS C CB    1 
ATOM   4812  C  CG    . LYS C 2  203  ? -19.706 14.239  -51.286  1.00 126.70 ? 203  LYS C CG    1 
ATOM   4813  C  CD    . LYS C 2  203  ? -19.200 13.579  -50.015  1.00 150.27 ? 203  LYS C CD    1 
ATOM   4814  C  CE    . LYS C 2  203  ? -18.120 14.413  -49.349  1.00 163.24 ? 203  LYS C CE    1 
ATOM   4815  N  NZ    . LYS C 2  203  ? -17.676 13.805  -48.065  1.00 137.41 ? 203  LYS C NZ    1 
ATOM   4816  N  N     . VAL C 2  204  ? -21.641 12.315  -54.977  1.00 94.30  ? 204  VAL C N     1 
ATOM   4817  C  CA    . VAL C 2  204  ? -22.310 11.260  -55.734  1.00 99.59  ? 204  VAL C CA    1 
ATOM   4818  C  C     . VAL C 2  204  ? -21.510 9.986   -55.493  1.00 115.00 ? 204  VAL C C     1 
ATOM   4819  O  O     . VAL C 2  204  ? -20.482 9.754   -56.140  1.00 118.90 ? 204  VAL C O     1 
ATOM   4820  C  CB    . VAL C 2  204  ? -22.413 11.587  -57.228  1.00 101.25 ? 204  VAL C CB    1 
ATOM   4821  C  CG1   . VAL C 2  204  ? -23.104 10.458  -57.978  1.00 94.72  ? 204  VAL C CG1   1 
ATOM   4822  C  CG2   . VAL C 2  204  ? -23.156 12.901  -57.437  1.00 118.91 ? 204  VAL C CG2   1 
ATOM   4823  N  N     . ILE C 2  205  ? -21.974 9.157   -54.561  1.00 114.94 ? 205  ILE C N     1 
ATOM   4824  C  CA    . ILE C 2  205  ? -21.233 7.991   -54.096  1.00 104.50 ? 205  ILE C CA    1 
ATOM   4825  C  C     . ILE C 2  205  ? -21.787 6.758   -54.823  1.00 96.44  ? 205  ILE C C     1 
ATOM   4826  O  O     . ILE C 2  205  ? -22.906 6.327   -54.508  1.00 84.56  ? 205  ILE C O     1 
ATOM   4827  C  CB    . ILE C 2  205  ? -21.334 7.829   -52.575  1.00 105.43 ? 205  ILE C CB    1 
ATOM   4828  C  CG1   . ILE C 2  205  ? -20.844 9.101   -51.877  1.00 112.24 ? 205  ILE C CG1   1 
ATOM   4829  C  CG2   . ILE C 2  205  ? -20.538 6.618   -52.108  1.00 122.94 ? 205  ILE C CG2   1 
ATOM   4830  C  CD1   . ILE C 2  205  ? -20.981 9.070   -50.375  1.00 121.86 ? 205  ILE C CD1   1 
ATOM   4831  N  N     . PRO C 2  206  ? -21.056 6.186   -55.771  1.00 109.27 ? 206  PRO C N     1 
ATOM   4832  C  CA    . PRO C 2  206  ? -21.534 4.971   -56.439  1.00 102.02 ? 206  PRO C CA    1 
ATOM   4833  C  C     . PRO C 2  206  ? -21.291 3.731   -55.593  1.00 94.69  ? 206  PRO C C     1 
ATOM   4834  O  O     . PRO C 2  206  ? -20.488 3.726   -54.659  1.00 121.18 ? 206  PRO C O     1 
ATOM   4835  C  CB    . PRO C 2  206  ? -20.696 4.930   -57.721  1.00 118.28 ? 206  PRO C CB    1 
ATOM   4836  C  CG    . PRO C 2  206  ? -19.412 5.573   -57.324  1.00 114.89 ? 206  PRO C CG    1 
ATOM   4837  C  CD    . PRO C 2  206  ? -19.780 6.656   -56.334  1.00 121.75 ? 206  PRO C CD    1 
ATOM   4838  N  N     . SER C 2  207  ? -22.014 2.663   -55.942  1.00 92.52  ? 207  SER C N     1 
ATOM   4839  C  CA    . SER C 2  207  ? -21.786 1.374   -55.301  1.00 112.42 ? 207  SER C CA    1 
ATOM   4840  C  C     . SER C 2  207  ? -20.411 0.818   -55.643  1.00 132.03 ? 207  SER C C     1 
ATOM   4841  O  O     . SER C 2  207  ? -19.887 -0.018  -54.897  1.00 122.28 ? 207  SER C O     1 
ATOM   4842  C  CB    . SER C 2  207  ? -22.875 0.380   -55.713  1.00 121.76 ? 207  SER C CB    1 
ATOM   4843  O  OG    . SER C 2  207  ? -22.752 -0.842  -55.007  1.00 115.70 ? 207  SER C OG    1 
ATOM   4844  N  N     . ARG C 2  208  ? -19.832 1.261   -56.758  1.00 138.60 ? 208  ARG C N     1 
ATOM   4845  C  CA    . ARG C 2  208  ? -18.464 0.963   -57.151  1.00 137.67 ? 208  ARG C CA    1 
ATOM   4846  C  C     . ARG C 2  208  ? -18.070 1.900   -58.277  1.00 131.64 ? 208  ARG C C     1 
ATOM   4847  O  O     . ARG C 2  208  ? -18.910 2.314   -59.090  1.00 142.35 ? 208  ARG C O     1 
ATOM   4848  C  CB    . ARG C 2  208  ? -18.286 -0.498  -57.588  1.00 131.48 ? 208  ARG C CB    1 
ATOM   4849  C  CG    . ARG C 2  208  ? -19.130 -0.937  -58.778  1.00 126.91 ? 208  ARG C CG    1 
ATOM   4850  C  CD    . ARG C 2  208  ? -18.697 -2.316  -59.273  1.00 115.45 ? 208  ARG C CD    1 
ATOM   4851  N  NE    . ARG C 2  208  ? -19.718 -2.977  -60.084  1.00 130.38 ? 208  ARG C NE    1 
ATOM   4852  C  CZ    . ARG C 2  208  ? -19.754 -2.960  -61.414  1.00 153.76 ? 208  ARG C CZ    1 
ATOM   4853  N  NH1   . ARG C 2  208  ? -18.825 -2.309  -62.100  1.00 151.58 ? 208  ARG C NH1   1 
ATOM   4854  N  NH2   . ARG C 2  208  ? -20.725 -3.594  -62.058  1.00 165.08 ? 208  ARG C NH2   1 
ATOM   4855  N  N     . GLY C 2  209  ? -16.785 2.226   -58.306  1.00 125.78 ? 209  GLY C N     1 
ATOM   4856  C  CA    . GLY C 2  209  ? -16.201 3.036   -59.341  1.00 143.79 ? 209  GLY C CA    1 
ATOM   4857  C  C     . GLY C 2  209  ? -15.665 4.352   -58.818  1.00 156.70 ? 209  GLY C C     1 
ATOM   4858  O  O     . GLY C 2  209  ? -15.311 4.502   -57.647  1.00 154.79 ? 209  GLY C O     1 
ATOM   4859  N  N     . ALA C 2  210  ? -15.620 5.328   -59.719  1.00 157.89 ? 210  ALA C N     1 
ATOM   4860  C  CA    . ALA C 2  210  ? -15.060 6.631   -59.423  1.00 149.06 ? 210  ALA C CA    1 
ATOM   4861  C  C     . ALA C 2  210  ? -16.100 7.525   -58.764  1.00 135.44 ? 210  ALA C C     1 
ATOM   4862  O  O     . ALA C 2  210  ? -17.303 7.408   -59.009  1.00 115.33 ? 210  ALA C O     1 
ATOM   4863  C  CB    . ALA C 2  210  ? -14.534 7.281   -60.702  1.00 135.36 ? 210  ALA C CB    1 
ATOM   4864  N  N     . TRP C 2  211  ? -15.619 8.426   -57.914  1.00 126.32 ? 211  TRP C N     1 
ATOM   4865  C  CA    . TRP C 2  211  ? -16.471 9.358   -57.190  1.00 117.32 ? 211  TRP C CA    1 
ATOM   4866  C  C     . TRP C 2  211  ? -16.545 10.697  -57.916  1.00 116.14 ? 211  TRP C C     1 
ATOM   4867  O  O     . TRP C 2  211  ? -15.708 11.025  -58.760  1.00 120.98 ? 211  TRP C O     1 
ATOM   4868  C  CB    . TRP C 2  211  ? -15.967 9.559   -55.757  1.00 152.77 ? 211  TRP C CB    1 
ATOM   4869  C  CG    . TRP C 2  211  ? -16.289 8.402   -54.859  1.00 164.31 ? 211  TRP C CG    1 
ATOM   4870  C  CD1   . TRP C 2  211  ? -16.633 7.139   -55.245  1.00 172.15 ? 211  TRP C CD1   1 
ATOM   4871  C  CD2   . TRP C 2  211  ? -16.321 8.406   -53.426  1.00 158.26 ? 211  TRP C CD2   1 
ATOM   4872  N  NE1   . TRP C 2  211  ? -16.869 6.355   -54.143  1.00 170.63 ? 211  TRP C NE1   1 
ATOM   4873  C  CE2   . TRP C 2  211  ? -16.684 7.108   -53.014  1.00 168.84 ? 211  TRP C CE2   1 
ATOM   4874  C  CE3   . TRP C 2  211  ? -16.073 9.378   -52.453  1.00 165.72 ? 211  TRP C CE3   1 
ATOM   4875  C  CZ2   . TRP C 2  211  ? -16.805 6.757   -51.671  1.00 186.71 ? 211  TRP C CZ2   1 
ATOM   4876  C  CZ3   . TRP C 2  211  ? -16.195 9.027   -51.119  1.00 189.74 ? 211  TRP C CZ3   1 
ATOM   4877  C  CH2   . TRP C 2  211  ? -16.557 7.728   -50.741  1.00 198.54 ? 211  TRP C CH2   1 
ATOM   4878  N  N     . LEU C 2  212  ? -17.569 11.474  -57.565  1.00 119.68 ? 212  LEU C N     1 
ATOM   4879  C  CA    . LEU C 2  212  ? -17.874 12.722  -58.255  1.00 123.21 ? 212  LEU C CA    1 
ATOM   4880  C  C     . LEU C 2  212  ? -18.550 13.657  -57.265  1.00 116.69 ? 212  LEU C C     1 
ATOM   4881  O  O     . LEU C 2  212  ? -19.646 13.357  -56.781  1.00 126.32 ? 212  LEU C O     1 
ATOM   4882  C  CB    . LEU C 2  212  ? -18.777 12.458  -59.461  1.00 122.85 ? 212  LEU C CB    1 
ATOM   4883  C  CG    . LEU C 2  212  ? -18.946 13.566  -60.497  1.00 110.26 ? 212  LEU C CG    1 
ATOM   4884  C  CD1   . LEU C 2  212  ? -17.614 13.887  -61.152  1.00 133.88 ? 212  LEU C CD1   1 
ATOM   4885  C  CD2   . LEU C 2  212  ? -19.970 13.152  -61.540  1.00 106.16 ? 212  LEU C CD2   1 
ATOM   4886  N  N     . GLU C 2  213  ? -17.905 14.784  -56.966  1.00 109.69 ? 213  GLU C N     1 
ATOM   4887  C  CA    . GLU C 2  213  ? -18.406 15.730  -55.976  1.00 118.00 ? 213  GLU C CA    1 
ATOM   4888  C  C     . GLU C 2  213  ? -18.373 17.142  -56.543  1.00 137.55 ? 213  GLU C C     1 
ATOM   4889  O  O     . GLU C 2  213  ? -17.316 17.621  -56.969  1.00 152.28 ? 213  GLU C O     1 
ATOM   4890  C  CB    . GLU C 2  213  ? -17.599 15.648  -54.674  1.00 131.15 ? 213  GLU C CB    1 
ATOM   4891  C  CG    . GLU C 2  213  ? -16.088 15.646  -54.849  1.00 147.30 ? 213  GLU C CG    1 
ATOM   4892  C  CD    . GLU C 2  213  ? -15.351 15.479  -53.533  1.00 135.72 ? 213  GLU C CD    1 
ATOM   4893  O  OE1   . GLU C 2  213  ? -14.133 15.204  -53.561  1.00 135.83 ? 213  GLU C OE1   1 
ATOM   4894  O  OE2   . GLU C 2  213  ? -15.991 15.618  -52.469  1.00 111.29 ? 213  GLU C OE2   1 
ATOM   4895  N  N     . PHE C 2  214  ? -19.529 17.797  -56.549  1.00 131.82 ? 214  PHE C N     1 
ATOM   4896  C  CA    . PHE C 2  214  ? -19.669 19.197  -56.917  1.00 130.78 ? 214  PHE C CA    1 
ATOM   4897  C  C     . PHE C 2  214  ? -19.742 20.049  -55.655  1.00 142.57 ? 214  PHE C C     1 
ATOM   4898  O  O     . PHE C 2  214  ? -20.110 19.572  -54.579  1.00 163.97 ? 214  PHE C O     1 
ATOM   4899  C  CB    . PHE C 2  214  ? -20.923 19.415  -57.773  1.00 116.18 ? 214  PHE C CB    1 
ATOM   4900  C  CG    . PHE C 2  214  ? -20.962 18.580  -59.026  1.00 138.41 ? 214  PHE C CG    1 
ATOM   4901  C  CD1   . PHE C 2  214  ? -20.597 19.121  -60.246  1.00 149.19 ? 214  PHE C CD1   1 
ATOM   4902  C  CD2   . PHE C 2  214  ? -21.375 17.257  -58.984  1.00 122.40 ? 214  PHE C CD2   1 
ATOM   4903  C  CE1   . PHE C 2  214  ? -20.633 18.358  -61.400  1.00 139.85 ? 214  PHE C CE1   1 
ATOM   4904  C  CE2   . PHE C 2  214  ? -21.413 16.489  -60.134  1.00 108.93 ? 214  PHE C CE2   1 
ATOM   4905  C  CZ    . PHE C 2  214  ? -21.042 17.041  -61.343  1.00 132.35 ? 214  PHE C CZ    1 
ATOM   4906  N  N     . ASP C 2  215  ? -19.388 21.325  -55.795  1.00 134.53 ? 215  ASP C N     1 
ATOM   4907  C  CA    . ASP C 2  215  ? -19.353 22.202  -54.633  1.00 132.75 ? 215  ASP C CA    1 
ATOM   4908  C  C     . ASP C 2  215  ? -19.408 23.655  -55.079  1.00 131.09 ? 215  ASP C C     1 
ATOM   4909  O  O     . ASP C 2  215  ? -19.020 23.994  -56.200  1.00 147.94 ? 215  ASP C O     1 
ATOM   4910  C  CB    . ASP C 2  215  ? -18.098 21.958  -53.785  1.00 145.64 ? 215  ASP C CB    1 
ATOM   4911  C  CG    . ASP C 2  215  ? -16.820 22.369  -54.495  1.00 153.96 ? 215  ASP C CG    1 
ATOM   4912  O  OD1   . ASP C 2  215  ? -16.468 23.567  -54.449  1.00 143.70 ? 215  ASP C OD1   1 
ATOM   4913  O  OD2   . ASP C 2  215  ? -16.165 21.494  -55.100  1.00 163.27 ? 215  ASP C OD2   1 
ATOM   4914  N  N     . VAL C 2  216  ? -19.896 24.503  -54.179  1.00 126.36 ? 216  VAL C N     1 
ATOM   4915  C  CA    . VAL C 2  216  ? -19.877 25.951  -54.341  1.00 132.04 ? 216  VAL C CA    1 
ATOM   4916  C  C     . VAL C 2  216  ? -18.918 26.501  -53.294  1.00 141.34 ? 216  VAL C C     1 
ATOM   4917  O  O     . VAL C 2  216  ? -19.188 26.420  -52.089  1.00 153.96 ? 216  VAL C O     1 
ATOM   4918  C  CB    . VAL C 2  216  ? -21.275 26.567  -54.192  1.00 128.89 ? 216  VAL C CB    1 
ATOM   4919  C  CG1   . VAL C 2  216  ? -21.205 28.082  -54.327  1.00 132.60 ? 216  VAL C CG1   1 
ATOM   4920  C  CG2   . VAL C 2  216  ? -22.232 25.976  -55.217  1.00 135.63 ? 216  VAL C CG2   1 
ATOM   4921  N  N     . ASP C 2  217  ? -17.797 27.055  -53.745  1.00 146.62 ? 217  ASP C N     1 
ATOM   4922  C  CA    . ASP C 2  217  ? -16.793 27.597  -52.839  1.00 151.89 ? 217  ASP C CA    1 
ATOM   4923  C  C     . ASP C 2  217  ? -17.268 28.947  -52.300  1.00 173.03 ? 217  ASP C C     1 
ATOM   4924  O  O     . ASP C 2  217  ? -18.435 29.325  -52.436  1.00 177.68 ? 217  ASP C O     1 
ATOM   4925  C  CB    . ASP C 2  217  ? -15.441 27.687  -53.544  1.00 143.28 ? 217  ASP C CB    1 
ATOM   4926  C  CG    . ASP C 2  217  ? -15.529 28.361  -54.901  1.00 166.48 ? 217  ASP C CG    1 
ATOM   4927  O  OD1   . ASP C 2  217  ? -16.544 29.034  -55.175  1.00 184.11 ? 217  ASP C OD1   1 
ATOM   4928  O  OD2   . ASP C 2  217  ? -14.581 28.209  -55.701  1.00 163.91 ? 217  ASP C OD2   1 
ATOM   4929  N  N     . LYS C 2  218  ? -16.361 29.694  -51.675  1.00 174.74 ? 218  LYS C N     1 
ATOM   4930  C  CA    . LYS C 2  218  ? -16.699 30.982  -51.084  1.00 178.32 ? 218  LYS C CA    1 
ATOM   4931  C  C     . LYS C 2  218  ? -16.656 32.128  -52.086  1.00 187.18 ? 218  LYS C C     1 
ATOM   4932  O  O     . LYS C 2  218  ? -16.990 33.260  -51.723  1.00 180.86 ? 218  LYS C O     1 
ATOM   4933  C  CB    . LYS C 2  218  ? -15.760 31.288  -49.913  1.00 166.74 ? 218  LYS C CB    1 
ATOM   4934  C  CG    . LYS C 2  218  ? -14.289 31.336  -50.288  1.00 166.38 ? 218  LYS C CG    1 
ATOM   4935  C  CD    . LYS C 2  218  ? -13.431 31.702  -49.087  1.00 165.55 ? 218  LYS C CD    1 
ATOM   4936  C  CE    . LYS C 2  218  ? -11.957 31.767  -49.453  1.00 162.14 ? 218  LYS C CE    1 
ATOM   4937  N  NZ    . LYS C 2  218  ? -11.121 32.189  -48.295  1.00 157.95 ? 218  LYS C NZ    1 
ATOM   4938  N  N     . ARG C 2  219  ? -16.254 31.867  -53.330  1.00 191.50 ? 219  ARG C N     1 
ATOM   4939  C  CA    . ARG C 2  219  ? -16.192 32.890  -54.363  1.00 182.00 ? 219  ARG C CA    1 
ATOM   4940  C  C     . ARG C 2  219  ? -17.404 32.855  -55.288  1.00 170.45 ? 219  ARG C C     1 
ATOM   4941  O  O     . ARG C 2  219  ? -17.350 33.414  -56.389  1.00 173.51 ? 219  ARG C O     1 
ATOM   4942  C  CB    . ARG C 2  219  ? -14.901 32.746  -55.170  1.00 169.16 ? 219  ARG C CB    1 
ATOM   4943  C  CG    . ARG C 2  219  ? -13.640 32.774  -54.322  1.00 162.24 ? 219  ARG C CG    1 
ATOM   4944  C  CD    . ARG C 2  219  ? -13.547 34.059  -53.515  1.00 181.46 ? 219  ARG C CD    1 
ATOM   4945  N  NE    . ARG C 2  219  ? -12.515 33.985  -52.486  1.00 188.47 ? 219  ARG C NE    1 
ATOM   4946  C  CZ    . ARG C 2  219  ? -12.240 34.966  -51.633  1.00 195.40 ? 219  ARG C CZ    1 
ATOM   4947  N  NH1   . ARG C 2  219  ? -12.920 36.103  -51.688  1.00 195.22 ? 219  ARG C NH1   1 
ATOM   4948  N  NH2   . ARG C 2  219  ? -11.284 34.813  -50.727  1.00 180.55 ? 219  ARG C NH2   1 
ATOM   4949  N  N     . ASP C 2  220  ? -18.491 32.207  -54.860  1.00 163.13 ? 220  ASP C N     1 
ATOM   4950  C  CA    . ASP C 2  220  ? -19.732 32.129  -55.634  1.00 157.43 ? 220  ASP C CA    1 
ATOM   4951  C  C     . ASP C 2  220  ? -19.496 31.511  -57.012  1.00 159.29 ? 220  ASP C C     1 
ATOM   4952  O  O     . ASP C 2  220  ? -20.077 31.937  -58.012  1.00 169.04 ? 220  ASP C O     1 
ATOM   4953  C  CB    . ASP C 2  220  ? -20.395 33.504  -55.753  1.00 161.16 ? 220  ASP C CB    1 
ATOM   4954  C  CG    . ASP C 2  220  ? -21.256 33.843  -54.549  1.00 161.34 ? 220  ASP C CG    1 
ATOM   4955  O  OD1   . ASP C 2  220  ? -22.381 33.307  -54.452  1.00 151.24 ? 220  ASP C OD1   1 
ATOM   4956  O  OD2   . ASP C 2  220  ? -20.804 34.633  -53.693  1.00 148.33 ? 220  ASP C OD2   1 
ATOM   4957  N  N     . THR C 2  221  ? -18.635 30.497  -57.063  1.00 171.78 ? 221  THR C N     1 
ATOM   4958  C  CA    . THR C 2  221  ? -18.358 29.757  -58.284  1.00 171.75 ? 221  THR C CA    1 
ATOM   4959  C  C     . THR C 2  221  ? -18.561 28.270  -58.026  1.00 154.28 ? 221  THR C C     1 
ATOM   4960  O  O     . THR C 2  221  ? -18.428 27.796  -56.895  1.00 146.36 ? 221  THR C O     1 
ATOM   4961  C  CB    . THR C 2  221  ? -16.930 30.012  -58.794  1.00 170.20 ? 221  THR C CB    1 
ATOM   4962  O  OG1   . THR C 2  221  ? -15.985 29.634  -57.786  1.00 162.16 ? 221  THR C OG1   1 
ATOM   4963  C  CG2   . THR C 2  221  ? -16.741 31.485  -59.132  1.00 162.76 ? 221  THR C CG2   1 
ATOM   4964  N  N     . VAL C 2  222  ? -18.886 27.537  -59.088  1.00 160.65 ? 222  VAL C N     1 
ATOM   4965  C  CA    . VAL C 2  222  ? -19.219 26.120  -59.003  1.00 157.29 ? 222  VAL C CA    1 
ATOM   4966  C  C     . VAL C 2  222  ? -18.137 25.314  -59.709  1.00 159.80 ? 222  VAL C C     1 
ATOM   4967  O  O     . VAL C 2  222  ? -17.688 25.678  -60.803  1.00 161.07 ? 222  VAL C O     1 
ATOM   4968  C  CB    . VAL C 2  222  ? -20.608 25.838  -59.610  1.00 148.18 ? 222  VAL C CB    1 
ATOM   4969  C  CG1   . VAL C 2  222  ? -21.043 24.409  -59.324  1.00 164.09 ? 222  VAL C CG1   1 
ATOM   4970  C  CG2   . VAL C 2  222  ? -21.633 26.832  -59.078  1.00 139.21 ? 222  VAL C CG2   1 
ATOM   4971  N  N     . GLY C 2  223  ? -17.716 24.218  -59.072  1.00 165.95 ? 223  GLY C N     1 
ATOM   4972  C  CA    . GLY C 2  223  ? -16.700 23.344  -59.621  1.00 163.62 ? 223  GLY C CA    1 
ATOM   4973  C  C     . GLY C 2  223  ? -17.023 21.892  -59.325  1.00 153.49 ? 223  GLY C C     1 
ATOM   4974  O  O     . GLY C 2  223  ? -18.057 21.577  -58.732  1.00 145.03 ? 223  GLY C O     1 
ATOM   4975  N  N     . VAL C 2  224  ? -16.119 21.013  -59.747  1.00 150.46 ? 224  VAL C N     1 
ATOM   4976  C  CA    . VAL C 2  224  ? -16.325 19.574  -59.624  1.00 129.98 ? 224  VAL C CA    1 
ATOM   4977  C  C     . VAL C 2  224  ? -14.971 18.880  -59.582  1.00 144.46 ? 224  VAL C C     1 
ATOM   4978  O  O     . VAL C 2  224  ? -14.135 19.068  -60.472  1.00 158.11 ? 224  VAL C O     1 
ATOM   4979  C  CB    . VAL C 2  224  ? -17.188 19.011  -60.774  1.00 119.81 ? 224  VAL C CB    1 
ATOM   4980  C  CG1   . VAL C 2  224  ? -16.756 19.593  -62.113  1.00 148.19 ? 224  VAL C CG1   1 
ATOM   4981  C  CG2   . VAL C 2  224  ? -17.118 17.488  -60.801  1.00 111.93 ? 224  VAL C CG2   1 
ATOM   4982  N  N     . ARG C 2  225  ? -14.758 18.087  -58.537  1.00 138.20 ? 225  ARG C N     1 
ATOM   4983  C  CA    . ARG C 2  225  ? -13.611 17.195  -58.447  1.00 135.95 ? 225  ARG C CA    1 
ATOM   4984  C  C     . ARG C 2  225  ? -14.011 15.826  -58.980  1.00 127.79 ? 225  ARG C C     1 
ATOM   4985  O  O     . ARG C 2  225  ? -15.071 15.301  -58.622  1.00 117.90 ? 225  ARG C O     1 
ATOM   4986  C  CB    . ARG C 2  225  ? -13.126 17.078  -57.000  1.00 141.03 ? 225  ARG C CB    1 
ATOM   4987  C  CG    . ARG C 2  225  ? -12.816 18.414  -56.345  1.00 138.93 ? 225  ARG C CG    1 
ATOM   4988  C  CD    . ARG C 2  225  ? -12.611 18.290  -54.838  1.00 144.25 ? 225  ARG C CD    1 
ATOM   4989  N  NE    . ARG C 2  225  ? -11.219 18.041  -54.471  1.00 168.09 ? 225  ARG C NE    1 
ATOM   4990  C  CZ    . ARG C 2  225  ? -10.767 16.894  -53.974  1.00 168.34 ? 225  ARG C CZ    1 
ATOM   4991  N  NH1   . ARG C 2  225  ? -11.598 15.881  -53.776  1.00 159.68 ? 225  ARG C NH1   1 
ATOM   4992  N  NH2   . ARG C 2  225  ? -9.483  16.763  -53.667  1.00 161.62 ? 225  ARG C NH2   1 
ATOM   4993  N  N     . ILE C 2  226  ? -13.166 15.253  -59.832  1.00 135.83 ? 226  ILE C N     1 
ATOM   4994  C  CA    . ILE C 2  226  ? -13.429 13.963  -60.463  1.00 139.90 ? 226  ILE C CA    1 
ATOM   4995  C  C     . ILE C 2  226  ? -12.366 12.988  -59.980  1.00 141.13 ? 226  ILE C C     1 
ATOM   4996  O  O     . ILE C 2  226  ? -11.187 13.120  -60.332  1.00 145.96 ? 226  ILE C O     1 
ATOM   4997  C  CB    . ILE C 2  226  ? -13.433 14.061  -61.993  1.00 124.15 ? 226  ILE C CB    1 
ATOM   4998  C  CG1   . ILE C 2  226  ? -14.431 15.125  -62.456  1.00 120.04 ? 226  ILE C CG1   1 
ATOM   4999  C  CG2   . ILE C 2  226  ? -13.761 12.710  -62.608  1.00 103.25 ? 226  ILE C CG2   1 
ATOM   5000  C  CD1   . ILE C 2  226  ? -14.517 15.271  -63.959  1.00 106.33 ? 226  ILE C CD1   1 
ATOM   5001  N  N     . ASP C 2  227  ? -12.785 12.004  -59.179  1.00 134.58 ? 227  ASP C N     1 
ATOM   5002  C  CA    . ASP C 2  227  ? -11.886 10.998  -58.612  1.00 142.33 ? 227  ASP C CA    1 
ATOM   5003  C  C     . ASP C 2  227  ? -10.776 11.660  -57.796  1.00 152.25 ? 227  ASP C C     1 
ATOM   5004  O  O     . ASP C 2  227  ? -9.589  11.375  -57.970  1.00 155.77 ? 227  ASP C O     1 
ATOM   5005  C  CB    . ASP C 2  227  ? -11.308 10.094  -59.705  1.00 138.95 ? 227  ASP C CB    1 
ATOM   5006  C  CG    . ASP C 2  227  ? -10.899 8.730   -59.180  1.00 145.37 ? 227  ASP C CG    1 
ATOM   5007  O  OD1   . ASP C 2  227  ? -10.745 8.583   -57.950  1.00 172.13 ? 227  ASP C OD1   1 
ATOM   5008  O  OD2   . ASP C 2  227  ? -10.730 7.804   -60.001  1.00 128.37 ? 227  ASP C OD2   1 
ATOM   5009  N  N     . ARG C 2  228  ? -11.182 12.574  -56.914  1.00 152.42 ? 228  ARG C N     1 
ATOM   5010  C  CA    . ARG C 2  228  ? -10.333 13.314  -55.981  1.00 160.03 ? 228  ARG C CA    1 
ATOM   5011  C  C     . ARG C 2  228  ? -9.241  14.131  -56.670  1.00 159.92 ? 228  ARG C C     1 
ATOM   5012  O  O     . ARG C 2  228  ? -8.394  14.723  -55.989  1.00 165.44 ? 228  ARG C O     1 
ATOM   5013  C  CB    . ARG C 2  228  ? -9.719  12.384  -54.919  1.00 172.99 ? 228  ARG C CB    1 
ATOM   5014  C  CG    . ARG C 2  228  ? -8.351  11.796  -55.243  1.00 184.18 ? 228  ARG C CG    1 
ATOM   5015  C  CD    . ARG C 2  228  ? -8.023  10.670  -54.287  1.00 187.66 ? 228  ARG C CD    1 
ATOM   5016  N  NE    . ARG C 2  228  ? -8.979  9.576   -54.425  1.00 209.99 ? 228  ARG C NE    1 
ATOM   5017  C  CZ    . ARG C 2  228  ? -9.090  8.567   -53.569  1.00 206.02 ? 228  ARG C CZ    1 
ATOM   5018  N  NH1   . ARG C 2  228  ? -8.307  8.509   -52.501  1.00 195.18 ? 228  ARG C NH1   1 
ATOM   5019  N  NH2   . ARG C 2  228  ? -9.990  7.618   -53.781  1.00 205.72 ? 228  ARG C NH2   1 
ATOM   5020  N  N     . LYS C 2  229  ? -9.259  14.217  -57.996  1.00 156.96 ? 229  LYS C N     1 
ATOM   5021  C  CA    . LYS C 2  229  ? -8.260  14.986  -58.728  1.00 158.87 ? 229  LYS C CA    1 
ATOM   5022  C  C     . LYS C 2  229  ? -8.507  16.482  -58.518  1.00 153.17 ? 229  LYS C C     1 
ATOM   5023  O  O     . LYS C 2  229  ? -9.309  16.902  -57.679  1.00 145.08 ? 229  LYS C O     1 
ATOM   5024  C  CB    . LYS C 2  229  ? -8.278  14.603  -60.204  1.00 165.68 ? 229  LYS C CB    1 
ATOM   5025  C  CG    . LYS C 2  229  ? -7.860  13.166  -60.482  1.00 148.75 ? 229  LYS C CG    1 
ATOM   5026  C  CD    . LYS C 2  229  ? -6.400  12.932  -60.126  1.00 128.67 ? 229  LYS C CD    1 
ATOM   5027  C  CE    . LYS C 2  229  ? -5.951  11.536  -60.528  1.00 108.43 ? 229  LYS C CE    1 
ATOM   5028  N  NZ    . LYS C 2  229  ? -6.710  10.477  -59.809  1.00 114.48 ? 229  LYS C NZ    1 
ATOM   5029  N  N     . ARG C 2  230  ? -7.809  17.307  -59.296  1.00 163.75 ? 230  ARG C N     1 
ATOM   5030  C  CA    . ARG C 2  230  ? -7.916  18.753  -59.146  1.00 165.00 ? 230  ARG C CA    1 
ATOM   5031  C  C     . ARG C 2  230  ? -9.326  19.233  -59.469  1.00 161.26 ? 230  ARG C C     1 
ATOM   5032  O  O     . ARG C 2  230  ? -10.038 18.644  -60.286  1.00 155.44 ? 230  ARG C O     1 
ATOM   5033  C  CB    . ARG C 2  230  ? -6.900  19.458  -60.045  1.00 174.39 ? 230  ARG C CB    1 
ATOM   5034  C  CG    . ARG C 2  230  ? -5.480  19.431  -59.510  1.00 169.61 ? 230  ARG C CG    1 
ATOM   5035  C  CD    . ARG C 2  230  ? -5.421  20.043  -58.121  1.00 175.70 ? 230  ARG C CD    1 
ATOM   5036  N  NE    . ARG C 2  230  ? -6.001  21.382  -58.094  1.00 183.88 ? 230  ARG C NE    1 
ATOM   5037  C  CZ    . ARG C 2  230  ? -6.256  22.063  -56.982  1.00 178.09 ? 230  ARG C CZ    1 
ATOM   5038  N  NH1   . ARG C 2  230  ? -5.986  21.528  -55.799  1.00 169.56 ? 230  ARG C NH1   1 
ATOM   5039  N  NH2   . ARG C 2  230  ? -6.785  23.277  -57.051  1.00 162.63 ? 230  ARG C NH2   1 
ATOM   5040  N  N     . ARG C 2  231  ? -9.725  20.323  -58.815  1.00 160.46 ? 231  ARG C N     1 
ATOM   5041  C  CA    . ARG C 2  231  ? -11.074 20.866  -58.945  1.00 152.52 ? 231  ARG C CA    1 
ATOM   5042  C  C     . ARG C 2  231  ? -11.117 21.813  -60.139  1.00 155.16 ? 231  ARG C C     1 
ATOM   5043  O  O     . ARG C 2  231  ? -10.543 22.906  -60.098  1.00 151.55 ? 231  ARG C O     1 
ATOM   5044  C  CB    . ARG C 2  231  ? -11.494 21.583  -57.664  1.00 146.35 ? 231  ARG C CB    1 
ATOM   5045  C  CG    . ARG C 2  231  ? -12.990 21.849  -57.565  1.00 146.72 ? 231  ARG C CG    1 
ATOM   5046  C  CD    . ARG C 2  231  ? -13.335 22.628  -56.304  1.00 155.23 ? 231  ARG C CD    1 
ATOM   5047  N  NE    . ARG C 2  231  ? -13.164 24.066  -56.486  1.00 152.46 ? 231  ARG C NE    1 
ATOM   5048  C  CZ    . ARG C 2  231  ? -14.163 24.910  -56.722  1.00 160.80 ? 231  ARG C CZ    1 
ATOM   5049  N  NH1   . ARG C 2  231  ? -15.409 24.461  -56.796  1.00 149.71 ? 231  ARG C NH1   1 
ATOM   5050  N  NH2   . ARG C 2  231  ? -13.920 26.204  -56.877  1.00 178.23 ? 231  ARG C NH2   1 
ATOM   5051  N  N     . GLN C 2  232  ? -11.805 21.392  -61.204  1.00 160.09 ? 232  GLN C N     1 
ATOM   5052  C  CA    . GLN C 2  232  ? -12.069 22.124  -62.432  1.00 164.11 ? 232  GLN C CA    1 
ATOM   5053  C  C     . GLN C 2  232  ? -13.377 22.900  -62.311  1.00 164.69 ? 232  GLN C C     1 
ATOM   5054  O  O     . GLN C 2  232  ? -14.252 22.531  -61.522  1.00 170.63 ? 232  GLN C O     1 
ATOM   5055  C  CB    . GLN C 2  232  ? -12.158 21.162  -63.613  1.00 150.01 ? 232  GLN C CB    1 
ATOM   5056  C  CG    . GLN C 2  232  ? -11.015 20.165  -63.695  1.00 137.41 ? 232  GLN C CG    1 
ATOM   5057  C  CD    . GLN C 2  232  ? -9.810  20.717  -64.425  1.00 146.40 ? 232  GLN C CD    1 
ATOM   5058  O  OE1   . GLN C 2  232  ? -8.680  20.613  -63.949  1.00 148.38 ? 232  GLN C OE1   1 
ATOM   5059  N  NE2   . GLN C 2  232  ? -10.043 21.300  -65.595  1.00 150.47 ? 232  GLN C NE2   1 
ATOM   5060  N  N     . PRO C 2  233  ? -13.537 23.988  -63.066  1.00 150.53 ? 233  PRO C N     1 
ATOM   5061  C  CA    . PRO C 2  233  ? -14.837 24.665  -63.103  1.00 147.76 ? 233  PRO C CA    1 
ATOM   5062  C  C     . PRO C 2  233  ? -15.925 23.726  -63.606  1.00 153.50 ? 233  PRO C C     1 
ATOM   5063  O  O     . PRO C 2  233  ? -15.685 22.855  -64.445  1.00 153.41 ? 233  PRO C O     1 
ATOM   5064  C  CB    . PRO C 2  233  ? -14.605 25.830  -64.071  1.00 148.86 ? 233  PRO C CB    1 
ATOM   5065  C  CG    . PRO C 2  233  ? -13.138 26.088  -63.993  1.00 140.79 ? 233  PRO C CG    1 
ATOM   5066  C  CD    . PRO C 2  233  ? -12.503 24.739  -63.799  1.00 140.36 ? 233  PRO C CD    1 
ATOM   5067  N  N     . VAL C 2  234  ? -17.137 23.914  -63.076  1.00 147.58 ? 234  VAL C N     1 
ATOM   5068  C  CA    . VAL C 2  234  ? -18.230 22.986  -63.346  1.00 139.44 ? 234  VAL C CA    1 
ATOM   5069  C  C     . VAL C 2  234  ? -18.626 22.976  -64.817  1.00 146.79 ? 234  VAL C C     1 
ATOM   5070  O  O     . VAL C 2  234  ? -19.182 21.983  -65.299  1.00 144.51 ? 234  VAL C O     1 
ATOM   5071  C  CB    . VAL C 2  234  ? -19.444 23.319  -62.451  1.00 128.12 ? 234  VAL C CB    1 
ATOM   5072  C  CG1   . VAL C 2  234  ? -20.189 24.537  -62.978  1.00 141.72 ? 234  VAL C CG1   1 
ATOM   5073  C  CG2   . VAL C 2  234  ? -20.373 22.118  -62.337  1.00 116.89 ? 234  VAL C CG2   1 
ATOM   5074  N  N     . THR C 2  235  ? -18.347 24.055  -65.551  1.00 151.07 ? 235  THR C N     1 
ATOM   5075  C  CA    . THR C 2  235  ? -18.686 24.101  -66.967  1.00 157.31 ? 235  THR C CA    1 
ATOM   5076  C  C     . THR C 2  235  ? -17.672 23.370  -67.836  1.00 168.82 ? 235  THR C C     1 
ATOM   5077  O  O     . THR C 2  235  ? -17.984 23.045  -68.987  1.00 178.84 ? 235  THR C O     1 
ATOM   5078  C  CB    . THR C 2  235  ? -18.817 25.553  -67.436  1.00 182.29 ? 235  THR C CB    1 
ATOM   5079  O  OG1   . THR C 2  235  ? -17.654 26.292  -67.042  1.00 191.58 ? 235  THR C OG1   1 
ATOM   5080  C  CG2   . THR C 2  235  ? -20.056 26.199  -66.830  1.00 174.52 ? 235  THR C CG2   1 
ATOM   5081  N  N     . VAL C 2  236  ? -16.470 23.109  -67.316  1.00 167.96 ? 236  VAL C N     1 
ATOM   5082  C  CA    . VAL C 2  236  ? -15.502 22.297  -68.048  1.00 172.65 ? 236  VAL C CA    1 
ATOM   5083  C  C     . VAL C 2  236  ? -16.048 20.891  -68.261  1.00 161.29 ? 236  VAL C C     1 
ATOM   5084  O  O     . VAL C 2  236  ? -15.816 20.266  -69.304  1.00 152.56 ? 236  VAL C O     1 
ATOM   5085  C  CB    . VAL C 2  236  ? -14.152 22.283  -67.304  1.00 153.22 ? 236  VAL C CB    1 
ATOM   5086  C  CG1   . VAL C 2  236  ? -13.172 21.329  -67.971  1.00 149.55 ? 236  VAL C CG1   1 
ATOM   5087  C  CG2   . VAL C 2  236  ? -13.570 23.689  -67.235  1.00 156.09 ? 236  VAL C CG2   1 
ATOM   5088  N  N     . LEU C 2  237  ? -16.799 20.379  -67.284  1.00 157.79 ? 237  LEU C N     1 
ATOM   5089  C  CA    . LEU C 2  237  ? -17.416 19.066  -67.433  1.00 169.60 ? 237  LEU C CA    1 
ATOM   5090  C  C     . LEU C 2  237  ? -18.604 19.117  -68.386  1.00 172.02 ? 237  LEU C C     1 
ATOM   5091  O  O     . LEU C 2  237  ? -18.808 18.193  -69.182  1.00 171.52 ? 237  LEU C O     1 
ATOM   5092  C  CB    . LEU C 2  237  ? -17.846 18.534  -66.066  1.00 183.11 ? 237  LEU C CB    1 
ATOM   5093  C  CG    . LEU C 2  237  ? -18.600 17.202  -66.045  1.00 154.11 ? 237  LEU C CG    1 
ATOM   5094  C  CD1   . LEU C 2  237  ? -17.732 16.081  -66.598  1.00 142.91 ? 237  LEU C CD1   1 
ATOM   5095  C  CD2   . LEU C 2  237  ? -19.079 16.873  -64.639  1.00 131.94 ? 237  LEU C CD2   1 
ATOM   5096  N  N     . LEU C 2  238  ? -19.394 20.192  -68.324  1.00 175.07 ? 238  LEU C N     1 
ATOM   5097  C  CA    . LEU C 2  238  ? -20.576 20.296  -69.175  1.00 179.19 ? 238  LEU C CA    1 
ATOM   5098  C  C     . LEU C 2  238  ? -20.195 20.416  -70.646  1.00 177.06 ? 238  LEU C C     1 
ATOM   5099  O  O     . LEU C 2  238  ? -20.881 19.868  -71.516  1.00 156.30 ? 238  LEU C O     1 
ATOM   5100  C  CB    . LEU C 2  238  ? -21.427 21.489  -68.742  1.00 180.36 ? 238  LEU C CB    1 
ATOM   5101  C  CG    . LEU C 2  238  ? -21.982 21.465  -67.317  1.00 133.76 ? 238  LEU C CG    1 
ATOM   5102  C  CD1   . LEU C 2  238  ? -22.610 22.806  -66.971  1.00 123.72 ? 238  LEU C CD1   1 
ATOM   5103  C  CD2   . LEU C 2  238  ? -22.993 20.340  -67.151  1.00 120.88 ? 238  LEU C CD2   1 
ATOM   5104  N  N     . LYS C 2  239  ? -19.106 21.129  -70.943  1.00 182.03 ? 239  LYS C N     1 
ATOM   5105  C  CA    . LYS C 2  239  ? -18.680 21.279  -72.331  1.00 174.50 ? 239  LYS C CA    1 
ATOM   5106  C  C     . LYS C 2  239  ? -18.122 19.978  -72.895  1.00 168.35 ? 239  LYS C C     1 
ATOM   5107  O  O     . LYS C 2  239  ? -18.241 19.727  -74.100  1.00 163.42 ? 239  LYS C O     1 
ATOM   5108  C  CB    . LYS C 2  239  ? -17.639 22.392  -72.445  1.00 177.62 ? 239  LYS C CB    1 
ATOM   5109  C  CG    . LYS C 2  239  ? -18.172 23.779  -72.132  1.00 183.11 ? 239  LYS C CG    1 
ATOM   5110  C  CD    . LYS C 2  239  ? -17.050 24.803  -72.106  1.00 181.56 ? 239  LYS C CD    1 
ATOM   5111  C  CE    . LYS C 2  239  ? -17.589 26.196  -71.844  1.00 170.89 ? 239  LYS C CE    1 
ATOM   5112  N  NZ    . LYS C 2  239  ? -16.498 27.196  -71.688  1.00 165.42 ? 239  LYS C NZ    1 
ATOM   5113  N  N     . ALA C 2  240  ? -17.514 19.143  -72.049  1.00 164.32 ? 240  ALA C N     1 
ATOM   5114  C  CA    . ALA C 2  240  ? -16.935 17.891  -72.520  1.00 163.02 ? 240  ALA C CA    1 
ATOM   5115  C  C     . ALA C 2  240  ? -17.992 16.846  -72.852  1.00 158.32 ? 240  ALA C C     1 
ATOM   5116  O  O     . ALA C 2  240  ? -17.715 15.932  -73.636  1.00 147.07 ? 240  ALA C O     1 
ATOM   5117  C  CB    . ALA C 2  240  ? -15.966 17.333  -71.478  1.00 162.12 ? 240  ALA C CB    1 
ATOM   5118  N  N     . LEU C 2  241  ? -19.187 16.955  -72.276  1.00 164.08 ? 241  LEU C N     1 
ATOM   5119  C  CA    . LEU C 2  241  ? -20.262 16.003  -72.521  1.00 162.39 ? 241  LEU C CA    1 
ATOM   5120  C  C     . LEU C 2  241  ? -21.075 16.330  -73.767  1.00 173.57 ? 241  LEU C C     1 
ATOM   5121  O  O     . LEU C 2  241  ? -21.999 15.580  -74.099  1.00 161.11 ? 241  LEU C O     1 
ATOM   5122  C  CB    . LEU C 2  241  ? -21.195 15.935  -71.308  1.00 161.14 ? 241  LEU C CB    1 
ATOM   5123  C  CG    . LEU C 2  241  ? -20.583 15.429  -70.000  1.00 144.30 ? 241  LEU C CG    1 
ATOM   5124  C  CD1   . LEU C 2  241  ? -21.579 15.554  -68.856  1.00 144.77 ? 241  LEU C CD1   1 
ATOM   5125  C  CD2   . LEU C 2  241  ? -20.113 13.991  -70.151  1.00 135.75 ? 241  LEU C CD2   1 
ATOM   5126  N  N     . GLY C 2  242  ? -20.760 17.420  -74.456  1.00 186.35 ? 242  GLY C N     1 
ATOM   5127  C  CA    . GLY C 2  242  ? -21.488 17.811  -75.642  1.00 183.15 ? 242  GLY C CA    1 
ATOM   5128  C  C     . GLY C 2  242  ? -22.543 18.876  -75.445  1.00 173.91 ? 242  GLY C C     1 
ATOM   5129  O  O     . GLY C 2  242  ? -23.452 18.976  -76.277  1.00 154.71 ? 242  GLY C O     1 
ATOM   5130  N  N     . TRP C 2  243  ? -22.459 19.668  -74.380  1.00 175.90 ? 243  TRP C N     1 
ATOM   5131  C  CA    . TRP C 2  243  ? -23.410 20.743  -74.128  1.00 173.69 ? 243  TRP C CA    1 
ATOM   5132  C  C     . TRP C 2  243  ? -22.810 22.064  -74.589  1.00 186.69 ? 243  TRP C C     1 
ATOM   5133  O  O     . TRP C 2  243  ? -21.719 22.445  -74.148  1.00 179.11 ? 243  TRP C O     1 
ATOM   5134  C  CB    . TRP C 2  243  ? -23.789 20.813  -72.649  1.00 141.33 ? 243  TRP C CB    1 
ATOM   5135  C  CG    . TRP C 2  243  ? -25.056 20.085  -72.328  1.00 147.23 ? 243  TRP C CG    1 
ATOM   5136  C  CD1   . TRP C 2  243  ? -25.497 18.920  -72.885  1.00 144.44 ? 243  TRP C CD1   1 
ATOM   5137  C  CD2   . TRP C 2  243  ? -26.059 20.488  -71.390  1.00 146.28 ? 243  TRP C CD2   1 
ATOM   5138  N  NE1   . TRP C 2  243  ? -26.708 18.565  -72.341  1.00 135.33 ? 243  TRP C NE1   1 
ATOM   5139  C  CE2   . TRP C 2  243  ? -27.076 19.513  -71.421  1.00 150.03 ? 243  TRP C CE2   1 
ATOM   5140  C  CE3   . TRP C 2  243  ? -26.195 21.576  -70.523  1.00 131.83 ? 243  TRP C CE3   1 
ATOM   5141  C  CZ2   . TRP C 2  243  ? -28.212 19.593  -70.619  1.00 145.83 ? 243  TRP C CZ2   1 
ATOM   5142  C  CZ3   . TRP C 2  243  ? -27.323 21.654  -69.727  1.00 129.40 ? 243  TRP C CZ3   1 
ATOM   5143  C  CH2   . TRP C 2  243  ? -28.316 20.669  -69.780  1.00 135.63 ? 243  TRP C CH2   1 
ATOM   5144  N  N     . THR C 2  244  ? -23.525 22.757  -75.469  1.00 190.12 ? 244  THR C N     1 
ATOM   5145  C  CA    . THR C 2  244  ? -23.052 24.028  -75.990  1.00 176.74 ? 244  THR C CA    1 
ATOM   5146  C  C     . THR C 2  244  ? -23.053 25.091  -74.896  1.00 171.11 ? 244  THR C C     1 
ATOM   5147  O  O     . THR C 2  244  ? -23.785 25.006  -73.906  1.00 176.10 ? 244  THR C O     1 
ATOM   5148  C  CB    . THR C 2  244  ? -23.925 24.487  -77.157  1.00 169.82 ? 244  THR C CB    1 
ATOM   5149  O  OG1   . THR C 2  244  ? -25.258 24.729  -76.691  1.00 152.34 ? 244  THR C OG1   1 
ATOM   5150  C  CG2   . THR C 2  244  ? -23.962 23.420  -78.238  1.00 148.37 ? 244  THR C CG2   1 
ATOM   5151  N  N     . SER C 2  245  ? -22.215 26.112  -75.092  1.00 166.52 ? 245  SER C N     1 
ATOM   5152  C  CA    . SER C 2  245  ? -22.160 27.218  -74.144  1.00 164.86 ? 245  SER C CA    1 
ATOM   5153  C  C     . SER C 2  245  ? -23.464 28.002  -74.099  1.00 165.16 ? 245  SER C C     1 
ATOM   5154  O  O     . SER C 2  245  ? -23.682 28.764  -73.151  1.00 142.65 ? 245  SER C O     1 
ATOM   5155  C  CB    . SER C 2  245  ? -21.000 28.153  -74.492  1.00 142.92 ? 245  SER C CB    1 
ATOM   5156  O  OG    . SER C 2  245  ? -19.757 27.480  -74.394  1.00 139.80 ? 245  SER C OG    1 
ATOM   5157  N  N     . GLU C 2  246  ? -24.332 27.836  -75.099  1.00 183.62 ? 246  GLU C N     1 
ATOM   5158  C  CA    . GLU C 2  246  ? -25.624 28.513  -75.090  1.00 194.65 ? 246  GLU C CA    1 
ATOM   5159  C  C     . GLU C 2  246  ? -26.649 27.729  -74.280  1.00 184.52 ? 246  GLU C C     1 
ATOM   5160  O  O     . GLU C 2  246  ? -27.358 28.299  -73.443  1.00 172.98 ? 246  GLU C O     1 
ATOM   5161  C  CB    . GLU C 2  246  ? -26.118 28.717  -76.522  1.00 184.42 ? 246  GLU C CB    1 
ATOM   5162  C  CG    . GLU C 2  246  ? -25.028 29.116  -77.503  1.00 173.52 ? 246  GLU C CG    1 
ATOM   5163  C  CD    . GLU C 2  246  ? -24.458 30.492  -77.221  1.00 189.65 ? 246  GLU C CD    1 
ATOM   5164  O  OE1   . GLU C 2  246  ? -25.176 31.329  -76.636  1.00 199.17 ? 246  GLU C OE1   1 
ATOM   5165  O  OE2   . GLU C 2  246  ? -23.288 30.735  -77.585  1.00 187.74 ? 246  GLU C OE2   1 
ATOM   5166  N  N     . GLN C 2  247  ? -26.737 26.417  -74.517  1.00 174.57 ? 247  GLN C N     1 
ATOM   5167  C  CA    . GLN C 2  247  ? -27.670 25.577  -73.774  1.00 164.11 ? 247  GLN C CA    1 
ATOM   5168  C  C     . GLN C 2  247  ? -27.362 25.563  -72.282  1.00 162.70 ? 247  GLN C C     1 
ATOM   5169  O  O     . GLN C 2  247  ? -28.255 25.274  -71.477  1.00 158.76 ? 247  GLN C O     1 
ATOM   5170  C  CB    . GLN C 2  247  ? -27.646 24.153  -74.338  1.00 168.07 ? 247  GLN C CB    1 
ATOM   5171  C  CG    . GLN C 2  247  ? -28.813 23.276  -73.907  1.00 168.52 ? 247  GLN C CG    1 
ATOM   5172  C  CD    . GLN C 2  247  ? -28.780 21.903  -74.554  1.00 157.09 ? 247  GLN C CD    1 
ATOM   5173  O  OE1   . GLN C 2  247  ? -27.841 21.566  -75.274  1.00 143.67 ? 247  GLN C OE1   1 
ATOM   5174  N  NE2   . GLN C 2  247  ? -29.810 21.104  -74.299  1.00 145.12 ? 247  GLN C NE2   1 
ATOM   5175  N  N     . ILE C 2  248  ? -26.124 25.874  -71.897  1.00 178.66 ? 248  ILE C N     1 
ATOM   5176  C  CA    . ILE C 2  248  ? -25.787 25.979  -70.481  1.00 184.65 ? 248  ILE C CA    1 
ATOM   5177  C  C     . ILE C 2  248  ? -26.418 27.226  -69.873  1.00 183.41 ? 248  ILE C C     1 
ATOM   5178  O  O     . ILE C 2  248  ? -26.968 27.184  -68.766  1.00 177.09 ? 248  ILE C O     1 
ATOM   5179  C  CB    . ILE C 2  248  ? -24.259 25.964  -70.298  1.00 182.21 ? 248  ILE C CB    1 
ATOM   5180  C  CG1   . ILE C 2  248  ? -23.687 24.607  -70.710  1.00 177.70 ? 248  ILE C CG1   1 
ATOM   5181  C  CG2   . ILE C 2  248  ? -23.883 26.283  -68.861  1.00 141.20 ? 248  ILE C CG2   1 
ATOM   5182  C  CD1   . ILE C 2  248  ? -22.179 24.544  -70.657  1.00 168.40 ? 248  ILE C CD1   1 
ATOM   5183  N  N     . VAL C 2  249  ? -26.354 28.354  -70.586  1.00 180.17 ? 249  VAL C N     1 
ATOM   5184  C  CA    . VAL C 2  249  ? -26.954 29.587  -70.083  1.00 181.64 ? 249  VAL C CA    1 
ATOM   5185  C  C     . VAL C 2  249  ? -28.471 29.459  -70.008  1.00 187.37 ? 249  VAL C C     1 
ATOM   5186  O  O     . VAL C 2  249  ? -29.113 30.079  -69.151  1.00 168.44 ? 249  VAL C O     1 
ATOM   5187  C  CB    . VAL C 2  249  ? -26.524 30.779  -70.961  1.00 150.30 ? 249  VAL C CB    1 
ATOM   5188  C  CG1   . VAL C 2  249  ? -27.055 32.089  -70.395  1.00 143.74 ? 249  VAL C CG1   1 
ATOM   5189  C  CG2   . VAL C 2  249  ? -25.011 30.828  -71.078  1.00 138.58 ? 249  VAL C CG2   1 
ATOM   5190  N  N     . GLU C 2  250  ? -29.069 28.649  -70.885  1.00 181.57 ? 250  GLU C N     1 
ATOM   5191  C  CA    . GLU C 2  250  ? -30.516 28.462  -70.854  1.00 169.05 ? 250  GLU C CA    1 
ATOM   5192  C  C     . GLU C 2  250  ? -30.963 27.706  -69.608  1.00 177.75 ? 250  GLU C C     1 
ATOM   5193  O  O     . GLU C 2  250  ? -32.045 27.978  -69.074  1.00 169.19 ? 250  GLU C O     1 
ATOM   5194  C  CB    . GLU C 2  250  ? -30.973 27.728  -72.117  1.00 146.57 ? 250  GLU C CB    1 
ATOM   5195  C  CG    . GLU C 2  250  ? -32.421 27.259  -72.093  1.00 156.32 ? 250  GLU C CG    1 
ATOM   5196  C  CD    . GLU C 2  250  ? -32.803 26.491  -73.343  1.00 160.61 ? 250  GLU C CD    1 
ATOM   5197  O  OE1   . GLU C 2  250  ? -33.680 26.969  -74.094  1.00 141.10 ? 250  GLU C OE1   1 
ATOM   5198  O  OE2   . GLU C 2  250  ? -32.217 25.413  -73.580  1.00 146.11 ? 250  GLU C OE2   1 
ATOM   5199  N  N     . ARG C 2  251  ? -30.145 26.773  -69.122  1.00 187.90 ? 251  ARG C N     1 
ATOM   5200  C  CA    . ARG C 2  251  ? -30.529 25.923  -68.002  1.00 174.62 ? 251  ARG C CA    1 
ATOM   5201  C  C     . ARG C 2  251  ? -30.221 26.556  -66.649  1.00 172.90 ? 251  ARG C C     1 
ATOM   5202  O  O     . ARG C 2  251  ? -31.006 26.407  -65.706  1.00 166.91 ? 251  ARG C O     1 
ATOM   5203  C  CB    . ARG C 2  251  ? -29.823 24.569  -68.113  1.00 148.90 ? 251  ARG C CB    1 
ATOM   5204  C  CG    . ARG C 2  251  ? -30.253 23.543  -67.076  1.00 142.59 ? 251  ARG C CG    1 
ATOM   5205  C  CD    . ARG C 2  251  ? -31.704 23.132  -67.264  1.00 144.59 ? 251  ARG C CD    1 
ATOM   5206  N  NE    . ARG C 2  251  ? -32.067 22.022  -66.388  1.00 152.37 ? 251  ARG C NE    1 
ATOM   5207  C  CZ    . ARG C 2  251  ? -31.968 20.740  -66.726  1.00 146.45 ? 251  ARG C CZ    1 
ATOM   5208  N  NH1   . ARG C 2  251  ? -31.518 20.400  -67.927  1.00 148.66 ? 251  ARG C NH1   1 
ATOM   5209  N  NH2   . ARG C 2  251  ? -32.319 19.796  -65.864  1.00 130.11 ? 251  ARG C NH2   1 
ATOM   5210  N  N     . PHE C 2  252  ? -29.098 27.264  -66.533  1.00 167.44 ? 252  PHE C N     1 
ATOM   5211  C  CA    . PHE C 2  252  ? -28.628 27.795  -65.259  1.00 165.55 ? 252  PHE C CA    1 
ATOM   5212  C  C     . PHE C 2  252  ? -28.703 29.319  -65.205  1.00 166.41 ? 252  PHE C C     1 
ATOM   5213  O  O     . PHE C 2  252  ? -27.956 29.956  -64.459  1.00 161.20 ? 252  PHE C O     1 
ATOM   5214  C  CB    . PHE C 2  252  ? -27.198 27.328  -64.985  1.00 166.54 ? 252  PHE C CB    1 
ATOM   5215  C  CG    . PHE C 2  252  ? -27.006 25.839  -65.102  1.00 156.28 ? 252  PHE C CG    1 
ATOM   5216  C  CD1   . PHE C 2  252  ? -27.120 25.021  -63.990  1.00 154.35 ? 252  PHE C CD1   1 
ATOM   5217  C  CD2   . PHE C 2  252  ? -26.698 25.260  -66.323  1.00 155.86 ? 252  PHE C CD2   1 
ATOM   5218  C  CE1   . PHE C 2  252  ? -26.939 23.653  -64.097  1.00 159.87 ? 252  PHE C CE1   1 
ATOM   5219  C  CE2   . PHE C 2  252  ? -26.517 23.894  -66.436  1.00 156.01 ? 252  PHE C CE2   1 
ATOM   5220  C  CZ    . PHE C 2  252  ? -26.637 23.090  -65.322  1.00 148.64 ? 252  PHE C CZ    1 
ATOM   5221  N  N     . GLY C 2  253  ? -29.607 29.918  -65.985  1.00 165.31 ? 253  GLY C N     1 
ATOM   5222  C  CA    . GLY C 2  253  ? -29.668 31.367  -66.072  1.00 166.37 ? 253  GLY C CA    1 
ATOM   5223  C  C     . GLY C 2  253  ? -30.333 32.053  -64.898  1.00 187.48 ? 253  GLY C C     1 
ATOM   5224  O  O     . GLY C 2  253  ? -30.074 33.238  -64.662  1.00 193.13 ? 253  GLY C O     1 
ATOM   5225  N  N     . PHE C 2  254  ? -31.177 31.339  -64.153  1.00 191.97 ? 254  PHE C N     1 
ATOM   5226  C  CA    . PHE C 2  254  ? -31.922 31.956  -63.062  1.00 199.12 ? 254  PHE C CA    1 
ATOM   5227  C  C     . PHE C 2  254  ? -31.053 32.289  -61.856  1.00 192.04 ? 254  PHE C C     1 
ATOM   5228  O  O     . PHE C 2  254  ? -31.533 32.964  -60.939  1.00 173.82 ? 254  PHE C O     1 
ATOM   5229  C  CB    . PHE C 2  254  ? -33.074 31.045  -62.634  1.00 190.72 ? 254  PHE C CB    1 
ATOM   5230  C  CG    . PHE C 2  254  ? -32.644 29.654  -62.264  1.00 184.74 ? 254  PHE C CG    1 
ATOM   5231  C  CD1   . PHE C 2  254  ? -32.571 28.658  -63.224  1.00 171.09 ? 254  PHE C CD1   1 
ATOM   5232  C  CD2   . PHE C 2  254  ? -32.318 29.341  -60.954  1.00 172.26 ? 254  PHE C CD2   1 
ATOM   5233  C  CE1   . PHE C 2  254  ? -32.177 27.377  -62.886  1.00 154.79 ? 254  PHE C CE1   1 
ATOM   5234  C  CE2   . PHE C 2  254  ? -31.923 28.062  -60.610  1.00 163.69 ? 254  PHE C CE2   1 
ATOM   5235  C  CZ    . PHE C 2  254  ? -31.852 27.080  -61.578  1.00 156.07 ? 254  PHE C CZ    1 
ATOM   5236  N  N     . SER C 2  255  ? -29.803 31.836  -61.827  1.00 188.82 ? 255  SER C N     1 
ATOM   5237  C  CA    . SER C 2  255  ? -28.887 32.131  -60.736  1.00 180.12 ? 255  SER C CA    1 
ATOM   5238  C  C     . SER C 2  255  ? -27.717 32.948  -61.261  1.00 180.31 ? 255  SER C C     1 
ATOM   5239  O  O     . SER C 2  255  ? -27.222 32.703  -62.365  1.00 173.84 ? 255  SER C O     1 
ATOM   5240  C  CB    . SER C 2  255  ? -28.367 30.850  -60.080  1.00 168.99 ? 255  SER C CB    1 
ATOM   5241  O  OG    . SER C 2  255  ? -27.431 30.196  -60.920  1.00 167.55 ? 255  SER C OG    1 
ATOM   5242  N  N     . GLU C 2  256  ? -27.277 33.920  -60.463  1.00 180.19 ? 256  GLU C N     1 
ATOM   5243  C  CA    . GLU C 2  256  ? -26.135 34.732  -60.854  1.00 180.35 ? 256  GLU C CA    1 
ATOM   5244  C  C     . GLU C 2  256  ? -24.807 34.047  -60.562  1.00 180.14 ? 256  GLU C C     1 
ATOM   5245  O  O     . GLU C 2  256  ? -23.779 34.460  -61.110  1.00 172.14 ? 256  GLU C O     1 
ATOM   5246  C  CB    . GLU C 2  256  ? -26.185 36.089  -60.149  1.00 169.29 ? 256  GLU C CB    1 
ATOM   5247  C  CG    . GLU C 2  256  ? -25.574 37.215  -60.961  1.00 167.97 ? 256  GLU C CG    1 
ATOM   5248  C  CD    . GLU C 2  256  ? -26.294 37.432  -62.279  1.00 186.10 ? 256  GLU C CD    1 
ATOM   5249  O  OE1   . GLU C 2  256  ? -27.543 37.384  -62.291  1.00 183.78 ? 256  GLU C OE1   1 
ATOM   5250  O  OE2   . GLU C 2  256  ? -25.612 37.640  -63.304  1.00 186.14 ? 256  GLU C OE2   1 
ATOM   5251  N  N     . ILE C 2  257  ? -24.804 33.010  -59.722  1.00 183.16 ? 257  ILE C N     1 
ATOM   5252  C  CA    . ILE C 2  257  ? -23.560 32.314  -59.411  1.00 179.39 ? 257  ILE C CA    1 
ATOM   5253  C  C     . ILE C 2  257  ? -23.117 31.395  -60.542  1.00 165.38 ? 257  ILE C C     1 
ATOM   5254  O  O     . ILE C 2  257  ? -21.936 31.033  -60.607  1.00 159.37 ? 257  ILE C O     1 
ATOM   5255  C  CB    . ILE C 2  257  ? -23.687 31.516  -58.102  1.00 176.90 ? 257  ILE C CB    1 
ATOM   5256  C  CG1   . ILE C 2  257  ? -24.495 30.236  -58.321  1.00 162.58 ? 257  ILE C CG1   1 
ATOM   5257  C  CG2   . ILE C 2  257  ? -24.338 32.367  -57.023  1.00 179.33 ? 257  ILE C CG2   1 
ATOM   5258  C  CD1   . ILE C 2  257  ? -24.483 29.301  -57.129  1.00 162.24 ? 257  ILE C CD1   1 
ATOM   5259  N  N     . MET C 2  258  ? -24.028 31.004  -61.435  1.00 166.87 ? 258  MET C N     1 
ATOM   5260  C  CA    . MET C 2  258  ? -23.659 30.215  -62.604  1.00 173.52 ? 258  MET C CA    1 
ATOM   5261  C  C     . MET C 2  258  ? -23.254 31.083  -63.786  1.00 172.33 ? 258  MET C C     1 
ATOM   5262  O  O     . MET C 2  258  ? -22.411 30.666  -64.589  1.00 168.66 ? 258  MET C O     1 
ATOM   5263  C  CB    . MET C 2  258  ? -24.813 29.294  -63.011  1.00 173.83 ? 258  MET C CB    1 
ATOM   5264  C  CG    . MET C 2  258  ? -24.933 28.037  -62.164  1.00 171.99 ? 258  MET C CG    1 
ATOM   5265  S  SD    . MET C 2  258  ? -23.518 26.933  -62.355  1.00 169.35 ? 258  MET C SD    1 
ATOM   5266  C  CE    . MET C 2  258  ? -23.645 26.517  -64.093  1.00 134.38 ? 258  MET C CE    1 
ATOM   5267  N  N     . ARG C 2  259  ? -23.836 32.278  -63.913  1.00 179.04 ? 259  ARG C N     1 
ATOM   5268  C  CA    . ARG C 2  259  ? -23.378 33.218  -64.930  1.00 183.72 ? 259  ARG C CA    1 
ATOM   5269  C  C     . ARG C 2  259  ? -21.928 33.621  -64.698  1.00 175.60 ? 259  ARG C C     1 
ATOM   5270  O  O     . ARG C 2  259  ? -21.194 33.881  -65.658  1.00 169.15 ? 259  ARG C O     1 
ATOM   5271  C  CB    . ARG C 2  259  ? -24.277 34.453  -64.947  1.00 187.01 ? 259  ARG C CB    1 
ATOM   5272  C  CG    . ARG C 2  259  ? -25.691 34.186  -65.430  1.00 175.46 ? 259  ARG C CG    1 
ATOM   5273  C  CD    . ARG C 2  259  ? -25.729 33.990  -66.936  1.00 164.68 ? 259  ARG C CD    1 
ATOM   5274  N  NE    . ARG C 2  259  ? -27.064 33.633  -67.408  1.00 160.48 ? 259  ARG C NE    1 
ATOM   5275  C  CZ    . ARG C 2  259  ? -28.023 34.512  -67.678  1.00 156.90 ? 259  ARG C CZ    1 
ATOM   5276  N  NH1   . ARG C 2  259  ? -27.803 35.810  -67.521  1.00 151.61 ? 259  ARG C NH1   1 
ATOM   5277  N  NH2   . ARG C 2  259  ? -29.207 34.092  -68.105  1.00 154.48 ? 259  ARG C NH2   1 
ATOM   5278  N  N     . SER C 2  260  ? -21.501 33.679  -63.436  1.00 165.22 ? 260  SER C N     1 
ATOM   5279  C  CA    . SER C 2  260  ? -20.116 33.976  -63.100  1.00 161.53 ? 260  SER C CA    1 
ATOM   5280  C  C     . SER C 2  260  ? -19.187 32.788  -63.310  1.00 168.88 ? 260  SER C C     1 
ATOM   5281  O  O     . SER C 2  260  ? -17.965 32.965  -63.264  1.00 165.30 ? 260  SER C O     1 
ATOM   5282  C  CB    . SER C 2  260  ? -20.018 34.449  -61.647  1.00 151.12 ? 260  SER C CB    1 
ATOM   5283  O  OG    . SER C 2  260  ? -18.667 34.608  -61.250  1.00 152.21 ? 260  SER C OG    1 
ATOM   5284  N  N     . THR C 2  261  ? -19.728 31.592  -63.536  1.00 174.81 ? 261  THR C N     1 
ATOM   5285  C  CA    . THR C 2  261  ? -18.904 30.406  -63.733  1.00 174.75 ? 261  THR C CA    1 
ATOM   5286  C  C     . THR C 2  261  ? -18.478 30.246  -65.189  1.00 173.37 ? 261  THR C C     1 
ATOM   5287  O  O     . THR C 2  261  ? -17.296 30.027  -65.472  1.00 170.95 ? 261  THR C O     1 
ATOM   5288  C  CB    . THR C 2  261  ? -19.655 29.157  -63.262  1.00 155.86 ? 261  THR C CB    1 
ATOM   5289  O  OG1   . THR C 2  261  ? -20.005 29.303  -61.880  1.00 147.50 ? 261  THR C OG1   1 
ATOM   5290  C  CG2   . THR C 2  261  ? -18.785 27.922  -63.430  1.00 143.88 ? 261  THR C CG2   1 
ATOM   5291  N  N     . LEU C 2  262  ? -19.428 30.351  -66.122  1.00 157.69 ? 262  LEU C N     1 
ATOM   5292  C  CA    . LEU C 2  262  ? -19.093 30.260  -67.537  1.00 146.54 ? 262  LEU C CA    1 
ATOM   5293  C  C     . LEU C 2  262  ? -18.223 31.423  -67.997  1.00 158.61 ? 262  LEU C C     1 
ATOM   5294  O  O     . LEU C 2  262  ? -17.483 31.278  -68.976  1.00 163.74 ? 262  LEU C O     1 
ATOM   5295  C  CB    . LEU C 2  262  ? -20.371 30.198  -68.378  1.00 155.30 ? 262  LEU C CB    1 
ATOM   5296  C  CG    . LEU C 2  262  ? -20.199 29.776  -69.838  1.00 148.80 ? 262  LEU C CG    1 
ATOM   5297  C  CD1   . LEU C 2  262  ? -19.708 28.342  -69.920  1.00 138.93 ? 262  LEU C CD1   1 
ATOM   5298  C  CD2   . LEU C 2  262  ? -21.495 29.946  -70.613  1.00 139.59 ? 262  LEU C CD2   1 
ATOM   5299  N  N     . GLU C 2  263  ? -18.291 32.566  -67.312  1.00 167.25 ? 263  GLU C N     1 
ATOM   5300  C  CA    . GLU C 2  263  ? -17.460 33.706  -67.680  1.00 187.45 ? 263  GLU C CA    1 
ATOM   5301  C  C     . GLU C 2  263  ? -16.039 33.548  -67.151  1.00 182.53 ? 263  GLU C C     1 
ATOM   5302  O  O     . GLU C 2  263  ? -15.069 33.695  -67.902  1.00 187.19 ? 263  GLU C O     1 
ATOM   5303  C  CB    . GLU C 2  263  ? -18.086 35.001  -67.161  1.00 184.64 ? 263  GLU C CB    1 
ATOM   5304  C  CG    . GLU C 2  263  ? -18.069 36.138  -68.166  1.00 183.01 ? 263  GLU C CG    1 
ATOM   5305  C  CD    . GLU C 2  263  ? -16.666 36.522  -68.591  1.00 199.56 ? 263  GLU C CD    1 
ATOM   5306  O  OE1   . GLU C 2  263  ? -15.764 36.544  -67.727  1.00 224.69 ? 263  GLU C OE1   1 
ATOM   5307  O  OE2   . GLU C 2  263  ? -16.465 36.796  -69.793  1.00 178.19 ? 263  GLU C OE2   1 
ATOM   5308  N  N     . LYS C 2  264  ? -15.900 33.247  -65.857  1.00 172.97 ? 264  LYS C N     1 
ATOM   5309  C  CA    . LYS C 2  264  ? -14.585 32.991  -65.280  1.00 167.57 ? 264  LYS C CA    1 
ATOM   5310  C  C     . LYS C 2  264  ? -13.930 31.739  -65.845  1.00 164.80 ? 264  LYS C C     1 
ATOM   5311  O  O     . LYS C 2  264  ? -12.746 31.507  -65.576  1.00 155.03 ? 264  LYS C O     1 
ATOM   5312  C  CB    . LYS C 2  264  ? -14.689 32.861  -63.758  1.00 164.69 ? 264  LYS C CB    1 
ATOM   5313  C  CG    . LYS C 2  264  ? -15.021 34.148  -63.021  1.00 148.99 ? 264  LYS C CG    1 
ATOM   5314  C  CD    . LYS C 2  264  ? -15.141 33.886  -61.526  1.00 144.52 ? 264  LYS C CD    1 
ATOM   5315  C  CE    . LYS C 2  264  ? -15.439 35.158  -60.751  1.00 149.11 ? 264  LYS C CE    1 
ATOM   5316  N  NZ    . LYS C 2  264  ? -15.526 34.898  -59.287  1.00 135.08 ? 264  LYS C NZ    1 
ATOM   5317  N  N     . ASP C 2  265  ? -14.669 30.932  -66.605  1.00 173.76 ? 265  ASP C N     1 
ATOM   5318  C  CA    . ASP C 2  265  ? -14.124 29.715  -67.189  1.00 178.98 ? 265  ASP C CA    1 
ATOM   5319  C  C     . ASP C 2  265  ? -12.909 30.031  -68.056  1.00 184.89 ? 265  ASP C C     1 
ATOM   5320  O  O     . ASP C 2  265  ? -12.818 31.091  -68.680  1.00 169.21 ? 265  ASP C O     1 
ATOM   5321  C  CB    . ASP C 2  265  ? -15.198 29.007  -68.017  1.00 184.48 ? 265  ASP C CB    1 
ATOM   5322  C  CG    . ASP C 2  265  ? -14.729 27.679  -68.578  1.00 189.73 ? 265  ASP C CG    1 
ATOM   5323  O  OD1   . ASP C 2  265  ? -13.689 27.162  -68.117  1.00 192.86 ? 265  ASP C OD1   1 
ATOM   5324  O  OD2   . ASP C 2  265  ? -15.404 27.152  -69.486  1.00 182.03 ? 265  ASP C OD2   1 
ATOM   5325  N  N     . ASN C 2  266  ? -11.968 29.089  -68.088  1.00 192.58 ? 266  ASN C N     1 
ATOM   5326  C  CA    . ASN C 2  266  ? -10.713 29.280  -68.808  1.00 195.05 ? 266  ASN C CA    1 
ATOM   5327  C  C     . ASN C 2  266  ? -10.833 28.880  -70.276  1.00 197.29 ? 266  ASN C C     1 
ATOM   5328  O  O     . ASN C 2  266  ? -10.555 29.686  -71.170  1.00 198.50 ? 266  ASN C O     1 
ATOM   5329  C  CB    . ASN C 2  266  ? -9.594  28.486  -68.123  1.00 195.82 ? 266  ASN C CB    1 
ATOM   5330  C  CG    . ASN C 2  266  ? -8.251  28.667  -68.801  1.00 195.11 ? 266  ASN C CG    1 
ATOM   5331  O  OD1   . ASN C 2  266  ? -7.994  29.689  -69.437  1.00 191.12 ? 266  ASN C OD1   1 
ATOM   5332  N  ND2   . ASN C 2  266  ? -7.384  27.670  -68.668  1.00 189.53 ? 266  ASN C ND2   1 
ATOM   5333  N  N     . THR C 2  267  ? -11.245 27.643  -70.538  1.00 196.27 ? 267  THR C N     1 
ATOM   5334  C  CA    . THR C 2  267  ? -11.269 27.095  -71.885  1.00 194.27 ? 267  THR C CA    1 
ATOM   5335  C  C     . THR C 2  267  ? -12.699 26.812  -72.322  1.00 197.56 ? 267  THR C C     1 
ATOM   5336  O  O     . THR C 2  267  ? -13.558 26.455  -71.510  1.00 180.03 ? 267  THR C O     1 
ATOM   5337  C  CB    . THR C 2  267  ? -10.439 25.807  -71.975  1.00 176.35 ? 267  THR C CB    1 
ATOM   5338  O  OG1   . THR C 2  267  ? -10.946 24.843  -71.044  1.00 166.25 ? 267  THR C OG1   1 
ATOM   5339  C  CG2   . THR C 2  267  ? -8.979  26.093  -71.658  1.00 162.42 ? 267  THR C CG2   1 
ATOM   5340  N  N     . VAL C 2  268  ? -12.942 26.972  -73.621  1.00 202.03 ? 268  VAL C N     1 
ATOM   5341  C  CA    . VAL C 2  268  ? -14.245 26.719  -74.220  1.00 189.22 ? 268  VAL C CA    1 
ATOM   5342  C  C     . VAL C 2  268  ? -14.055 25.807  -75.424  1.00 166.94 ? 268  VAL C C     1 
ATOM   5343  O  O     . VAL C 2  268  ? -13.039 25.871  -76.123  1.00 140.48 ? 268  VAL C O     1 
ATOM   5344  C  CB    . VAL C 2  268  ? -14.957 28.034  -74.622  1.00 168.64 ? 268  VAL C CB    1 
ATOM   5345  C  CG1   . VAL C 2  268  ? -14.178 28.759  -75.710  1.00 144.19 ? 268  VAL C CG1   1 
ATOM   5346  C  CG2   . VAL C 2  268  ? -16.391 27.764  -75.059  1.00 151.47 ? 268  VAL C CG2   1 
ATOM   5347  N  N     . GLY C 2  269  ? -15.037 24.938  -75.651  1.00 161.30 ? 269  GLY C N     1 
ATOM   5348  C  CA    . GLY C 2  269  ? -14.977 23.996  -76.751  1.00 145.52 ? 269  GLY C CA    1 
ATOM   5349  C  C     . GLY C 2  269  ? -15.214 22.568  -76.306  1.00 165.94 ? 269  GLY C C     1 
ATOM   5350  O  O     . GLY C 2  269  ? -14.702 22.145  -75.265  1.00 175.15 ? 269  GLY C O     1 
ATOM   5351  N  N     . THR C 2  270  ? -15.993 21.815  -77.087  1.00 179.85 ? 270  THR C N     1 
ATOM   5352  C  CA    . THR C 2  270  ? -16.293 20.435  -76.716  1.00 175.09 ? 270  THR C CA    1 
ATOM   5353  C  C     . THR C 2  270  ? -15.042 19.567  -76.757  1.00 172.19 ? 270  THR C C     1 
ATOM   5354  O  O     . THR C 2  270  ? -14.826 18.736  -75.867  1.00 159.43 ? 270  THR C O     1 
ATOM   5355  C  CB    . THR C 2  270  ? -17.374 19.865  -77.636  1.00 166.47 ? 270  THR C CB    1 
ATOM   5356  O  OG1   . THR C 2  270  ? -18.548 20.683  -77.560  1.00 160.52 ? 270  THR C OG1   1 
ATOM   5357  C  CG2   . THR C 2  270  ? -17.729 18.443  -77.224  1.00 153.33 ? 270  THR C CG2   1 
ATOM   5358  N  N     . ASP C 2  271  ? -14.204 19.747  -77.776  1.00 181.89 ? 271  ASP C N     1 
ATOM   5359  C  CA    . ASP C 2  271  ? -12.950 19.014  -77.875  1.00 188.66 ? 271  ASP C CA    1 
ATOM   5360  C  C     . ASP C 2  271  ? -11.820 19.673  -77.097  1.00 188.80 ? 271  ASP C C     1 
ATOM   5361  O  O     . ASP C 2  271  ? -10.680 19.200  -77.169  1.00 188.94 ? 271  ASP C O     1 
ATOM   5362  C  CB    . ASP C 2  271  ? -12.543 18.864  -79.343  1.00 186.57 ? 271  ASP C CB    1 
ATOM   5363  C  CG    . ASP C 2  271  ? -13.644 18.267  -80.194  1.00 195.61 ? 271  ASP C CG    1 
ATOM   5364  O  OD1   . ASP C 2  271  ? -14.571 19.013  -80.577  1.00 189.64 ? 271  ASP C OD1   1 
ATOM   5365  O  OD2   . ASP C 2  271  ? -13.585 17.052  -80.478  1.00 197.97 ? 271  ASP C OD2   1 
ATOM   5366  N  N     . GLU C 2  272  ? -12.103 20.747  -76.362  1.00 188.46 ? 272  GLU C N     1 
ATOM   5367  C  CA    . GLU C 2  272  ? -11.098 21.465  -75.589  1.00 188.51 ? 272  GLU C CA    1 
ATOM   5368  C  C     . GLU C 2  272  ? -11.169 21.137  -74.103  1.00 185.42 ? 272  GLU C C     1 
ATOM   5369  O  O     . GLU C 2  272  ? -10.157 20.776  -73.496  1.00 184.54 ? 272  GLU C O     1 
ATOM   5370  C  CB    . GLU C 2  272  ? -11.257 22.974  -75.799  1.00 186.08 ? 272  GLU C CB    1 
ATOM   5371  C  CG    . GLU C 2  272  ? -11.344 23.381  -77.261  1.00 185.07 ? 272  GLU C CG    1 
ATOM   5372  C  CD    . GLU C 2  272  ? -10.102 23.010  -78.046  1.00 212.76 ? 272  GLU C CD    1 
ATOM   5373  O  OE1   . GLU C 2  272  ? -8.992  23.094  -77.480  1.00 225.16 ? 272  GLU C OE1   1 
ATOM   5374  O  OE2   . GLU C 2  272  ? -10.237 22.630  -79.228  1.00 205.81 ? 272  GLU C OE2   1 
ATOM   5375  N  N     . ALA C 2  273  ? -12.353 21.259  -73.502  1.00 198.09 ? 273  ALA C N     1 
ATOM   5376  C  CA    . ALA C 2  273  ? -12.511 20.890  -72.103  1.00 181.19 ? 273  ALA C CA    1 
ATOM   5377  C  C     . ALA C 2  273  ? -12.504 19.381  -71.908  1.00 170.84 ? 273  ALA C C     1 
ATOM   5378  O  O     . ALA C 2  273  ? -12.347 18.915  -70.774  1.00 162.13 ? 273  ALA C O     1 
ATOM   5379  C  CB    . ALA C 2  273  ? -13.798 21.495  -71.543  1.00 163.67 ? 273  ALA C CB    1 
ATOM   5380  N  N     . LEU C 2  274  ? -12.673 18.612  -72.984  1.00 163.05 ? 274  LEU C N     1 
ATOM   5381  C  CA    . LEU C 2  274  ? -12.565 17.162  -72.894  1.00 144.82 ? 274  LEU C CA    1 
ATOM   5382  C  C     . LEU C 2  274  ? -11.115 16.715  -72.768  1.00 155.84 ? 274  LEU C C     1 
ATOM   5383  O  O     . LEU C 2  274  ? -10.837 15.693  -72.130  1.00 165.36 ? 274  LEU C O     1 
ATOM   5384  C  CB    . LEU C 2  274  ? -13.220 16.511  -74.113  1.00 143.70 ? 274  LEU C CB    1 
ATOM   5385  C  CG    . LEU C 2  274  ? -13.242 14.982  -74.173  1.00 134.78 ? 274  LEU C CG    1 
ATOM   5386  C  CD1   . LEU C 2  274  ? -13.921 14.395  -72.944  1.00 130.17 ? 274  LEU C CD1   1 
ATOM   5387  C  CD2   . LEU C 2  274  ? -13.925 14.507  -75.447  1.00 163.78 ? 274  LEU C CD2   1 
ATOM   5388  N  N     . LEU C 2  275  ? -10.184 17.464  -73.363  1.00 157.87 ? 275  LEU C N     1 
ATOM   5389  C  CA    . LEU C 2  275  ? -8.766  17.188  -73.169  1.00 161.82 ? 275  LEU C CA    1 
ATOM   5390  C  C     . LEU C 2  275  ? -8.251  17.784  -71.867  1.00 169.55 ? 275  LEU C C     1 
ATOM   5391  O  O     . LEU C 2  275  ? -7.310  17.244  -71.274  1.00 169.83 ? 275  LEU C O     1 
ATOM   5392  C  CB    . LEU C 2  275  ? -7.955  17.727  -74.348  1.00 146.88 ? 275  LEU C CB    1 
ATOM   5393  C  CG    . LEU C 2  275  ? -8.323  17.209  -75.739  1.00 142.39 ? 275  LEU C CG    1 
ATOM   5394  C  CD1   . LEU C 2  275  ? -7.346  17.742  -76.775  1.00 137.89 ? 275  LEU C CD1   1 
ATOM   5395  C  CD2   . LEU C 2  275  ? -8.357  15.689  -75.758  1.00 132.76 ? 275  LEU C CD2   1 
ATOM   5396  N  N     . ASP C 2  276  ? -8.849  18.891  -71.415  1.00 178.05 ? 276  ASP C N     1 
ATOM   5397  C  CA    . ASP C 2  276  ? -8.473  19.472  -70.129  1.00 173.65 ? 276  ASP C CA    1 
ATOM   5398  C  C     . ASP C 2  276  ? -8.737  18.496  -68.991  1.00 159.54 ? 276  ASP C C     1 
ATOM   5399  O  O     . ASP C 2  276  ? -7.966  18.428  -68.027  1.00 151.88 ? 276  ASP C O     1 
ATOM   5400  C  CB    . ASP C 2  276  ? -9.235  20.781  -69.906  1.00 173.70 ? 276  ASP C CB    1 
ATOM   5401  C  CG    . ASP C 2  276  ? -8.834  21.488  -68.621  1.00 176.68 ? 276  ASP C CG    1 
ATOM   5402  O  OD1   . ASP C 2  276  ? -7.727  21.225  -68.105  1.00 174.14 ? 276  ASP C OD1   1 
ATOM   5403  O  OD2   . ASP C 2  276  ? -9.633  22.309  -68.122  1.00 176.34 ? 276  ASP C OD2   1 
ATOM   5404  N  N     . ILE C 2  277  ? -9.823  17.727  -69.087  1.00 153.88 ? 277  ILE C N     1 
ATOM   5405  C  CA    . ILE C 2  277  ? -10.110 16.715  -68.077  1.00 146.32 ? 277  ILE C CA    1 
ATOM   5406  C  C     . ILE C 2  277  ? -9.136  15.549  -68.201  1.00 141.28 ? 277  ILE C C     1 
ATOM   5407  O  O     . ILE C 2  277  ? -8.721  14.957  -67.197  1.00 157.91 ? 277  ILE C O     1 
ATOM   5408  C  CB    . ILE C 2  277  ? -11.576 16.256  -68.194  1.00 131.29 ? 277  ILE C CB    1 
ATOM   5409  C  CG1   . ILE C 2  277  ? -12.517 17.356  -67.696  1.00 129.46 ? 277  ILE C CG1   1 
ATOM   5410  C  CG2   . ILE C 2  277  ? -11.812 14.957  -67.434  1.00 130.07 ? 277  ILE C CG2   1 
ATOM   5411  C  CD1   . ILE C 2  277  ? -13.981 16.982  -67.761  1.00 138.45 ? 277  ILE C CD1   1 
ATOM   5412  N  N     . TYR C 2  278  ? -8.735  15.217  -69.432  1.00 127.24 ? 278  TYR C N     1 
ATOM   5413  C  CA    . TYR C 2  278  ? -7.857  14.072  -69.654  1.00 133.87 ? 278  TYR C CA    1 
ATOM   5414  C  C     . TYR C 2  278  ? -6.477  14.296  -69.046  1.00 131.31 ? 278  TYR C C     1 
ATOM   5415  O  O     . TYR C 2  278  ? -5.879  13.366  -68.493  1.00 140.34 ? 278  TYR C O     1 
ATOM   5416  C  CB    . TYR C 2  278  ? -7.741  13.786  -71.154  1.00 146.84 ? 278  TYR C CB    1 
ATOM   5417  C  CG    . TYR C 2  278  ? -7.015  12.499  -71.496  1.00 133.07 ? 278  TYR C CG    1 
ATOM   5418  C  CD1   . TYR C 2  278  ? -7.718  11.330  -71.752  1.00 130.00 ? 278  TYR C CD1   1 
ATOM   5419  C  CD2   . TYR C 2  278  ? -5.627  12.454  -71.570  1.00 137.97 ? 278  TYR C CD2   1 
ATOM   5420  C  CE1   . TYR C 2  278  ? -7.062  10.153  -72.066  1.00 138.48 ? 278  TYR C CE1   1 
ATOM   5421  C  CE2   . TYR C 2  278  ? -4.963  11.280  -71.880  1.00 155.44 ? 278  TYR C CE2   1 
ATOM   5422  C  CZ    . TYR C 2  278  ? -5.687  10.133  -72.127  1.00 150.22 ? 278  TYR C CZ    1 
ATOM   5423  O  OH    . TYR C 2  278  ? -5.034  8.962   -72.438  1.00 150.23 ? 278  TYR C OH    1 
ATOM   5424  N  N     . ARG C 2  279  ? -5.952  15.520  -69.139  1.00 138.04 ? 279  ARG C N     1 
ATOM   5425  C  CA    . ARG C 2  279  ? -4.592  15.785  -68.684  1.00 151.44 ? 279  ARG C CA    1 
ATOM   5426  C  C     . ARG C 2  279  ? -4.489  15.937  -67.171  1.00 157.12 ? 279  ARG C C     1 
ATOM   5427  O  O     . ARG C 2  279  ? -3.387  15.818  -66.626  1.00 152.34 ? 279  ARG C O     1 
ATOM   5428  C  CB    . ARG C 2  279  ? -4.041  17.035  -69.377  1.00 167.10 ? 279  ARG C CB    1 
ATOM   5429  C  CG    . ARG C 2  279  ? -4.882  18.286  -69.188  1.00 162.34 ? 279  ARG C CG    1 
ATOM   5430  C  CD    . ARG C 2  279  ? -4.448  19.400  -70.134  1.00 168.41 ? 279  ARG C CD    1 
ATOM   5431  N  NE    . ARG C 2  279  ? -4.882  19.159  -71.508  1.00 173.31 ? 279  ARG C NE    1 
ATOM   5432  C  CZ    . ARG C 2  279  ? -4.115  18.634  -72.459  1.00 155.38 ? 279  ARG C CZ    1 
ATOM   5433  N  NH1   . ARG C 2  279  ? -2.861  18.294  -72.191  1.00 161.64 ? 279  ARG C NH1   1 
ATOM   5434  N  NH2   . ARG C 2  279  ? -4.600  18.452  -73.679  1.00 127.31 ? 279  ARG C NH2   1 
ATOM   5435  N  N     . LYS C 2  280  ? -5.601  16.192  -66.484  1.00 164.97 ? 280  LYS C N     1 
ATOM   5436  C  CA    . LYS C 2  280  ? -5.602  16.225  -65.027  1.00 163.65 ? 280  LYS C CA    1 
ATOM   5437  C  C     . LYS C 2  280  ? -5.967  14.882  -64.412  1.00 143.15 ? 280  LYS C C     1 
ATOM   5438  O  O     . LYS C 2  280  ? -5.628  14.635  -63.248  1.00 133.36 ? 280  LYS C O     1 
ATOM   5439  C  CB    . LYS C 2  280  ? -6.578  17.290  -64.519  1.00 153.65 ? 280  LYS C CB    1 
ATOM   5440  C  CG    . LYS C 2  280  ? -6.422  18.654  -65.174  1.00 150.38 ? 280  LYS C CG    1 
ATOM   5441  C  CD    . LYS C 2  280  ? -5.323  19.482  -64.528  1.00 150.50 ? 280  LYS C CD    1 
ATOM   5442  C  CE    . LYS C 2  280  ? -5.265  20.875  -65.139  1.00 140.59 ? 280  LYS C CE    1 
ATOM   5443  N  NZ    . LYS C 2  280  ? -4.285  21.760  -64.450  1.00 141.87 ? 280  LYS C NZ    1 
ATOM   5444  N  N     . LEU C 2  281  ? -6.648  14.016  -65.162  1.00 136.15 ? 281  LEU C N     1 
ATOM   5445  C  CA    . LEU C 2  281  ? -7.087  12.718  -64.667  1.00 137.13 ? 281  LEU C CA    1 
ATOM   5446  C  C     . LEU C 2  281  ? -6.019  11.650  -64.874  1.00 149.64 ? 281  LEU C C     1 
ATOM   5447  O  O     . LEU C 2  281  ? -5.659  10.936  -63.932  1.00 187.08 ? 281  LEU C O     1 
ATOM   5448  C  CB    . LEU C 2  281  ? -8.395  12.314  -65.361  1.00 126.02 ? 281  LEU C CB    1 
ATOM   5449  C  CG    . LEU C 2  281  ? -9.325  11.305  -64.680  1.00 126.46 ? 281  LEU C CG    1 
ATOM   5450  C  CD1   . LEU C 2  281  ? -10.746 11.492  -65.187  1.00 119.77 ? 281  LEU C CD1   1 
ATOM   5451  C  CD2   . LEU C 2  281  ? -8.872  9.869   -64.904  1.00 133.11 ? 281  LEU C CD2   1 
ATOM   5452  N  N     . ARG C 2  282  ? -5.501  11.534  -66.097  1.00 138.67 ? 282  ARG C N     1 
ATOM   5453  C  CA    . ARG C 2  282  ? -4.452  10.575  -66.439  1.00 142.61 ? 282  ARG C CA    1 
ATOM   5454  C  C     . ARG C 2  282  ? -3.258  11.326  -67.018  1.00 151.34 ? 282  ARG C C     1 
ATOM   5455  O  O     . ARG C 2  282  ? -3.027  11.305  -68.235  1.00 150.61 ? 282  ARG C O     1 
ATOM   5456  C  CB    . ARG C 2  282  ? -4.974  9.529   -67.422  1.00 134.97 ? 282  ARG C CB    1 
ATOM   5457  C  CG    . ARG C 2  282  ? -6.063  8.658   -66.831  1.00 144.79 ? 282  ARG C CG    1 
ATOM   5458  C  CD    . ARG C 2  282  ? -6.719  7.794   -67.887  1.00 161.73 ? 282  ARG C CD    1 
ATOM   5459  N  NE    . ARG C 2  282  ? -7.487  6.704   -67.293  1.00 161.53 ? 282  ARG C NE    1 
ATOM   5460  C  CZ    . ARG C 2  282  ? -6.961  5.539   -66.930  1.00 177.54 ? 282  ARG C CZ    1 
ATOM   5461  N  NH1   . ARG C 2  282  ? -5.664  5.319   -67.095  1.00 189.83 ? 282  ARG C NH1   1 
ATOM   5462  N  NH2   . ARG C 2  282  ? -7.728  4.597   -66.398  1.00 182.27 ? 282  ARG C NH2   1 
ATOM   5463  N  N     . PRO C 2  283  ? -2.476  11.996  -66.174  1.00 157.21 ? 283  PRO C N     1 
ATOM   5464  C  CA    . PRO C 2  283  ? -1.368  12.809  -66.684  1.00 162.18 ? 283  PRO C CA    1 
ATOM   5465  C  C     . PRO C 2  283  ? -0.258  11.951  -67.272  1.00 156.52 ? 283  PRO C C     1 
ATOM   5466  O  O     . PRO C 2  283  ? -0.118  10.762  -66.975  1.00 155.88 ? 283  PRO C O     1 
ATOM   5467  C  CB    . PRO C 2  283  ? -0.880  13.570  -65.444  1.00 152.02 ? 283  PRO C CB    1 
ATOM   5468  C  CG    . PRO C 2  283  ? -1.980  13.429  -64.429  1.00 141.90 ? 283  PRO C CG    1 
ATOM   5469  C  CD    . PRO C 2  283  ? -2.608  12.104  -64.712  1.00 151.54 ? 283  PRO C CD    1 
ATOM   5470  N  N     . GLY C 2  284  ? 0.541   12.585  -68.129  1.00 139.91 ? 284  GLY C N     1 
ATOM   5471  C  CA    . GLY C 2  284  ? 1.652   11.927  -68.783  1.00 145.88 ? 284  GLY C CA    1 
ATOM   5472  C  C     . GLY C 2  284  ? 1.303   11.165  -70.042  1.00 159.00 ? 284  GLY C C     1 
ATOM   5473  O  O     . GLY C 2  284  ? 2.196   10.550  -70.639  1.00 166.25 ? 284  GLY C O     1 
ATOM   5474  N  N     . GLU C 2  285  ? 0.043   11.186  -70.467  1.00 161.58 ? 285  GLU C N     1 
ATOM   5475  C  CA    . GLU C 2  285  ? -0.408  10.455  -71.638  1.00 172.10 ? 285  GLU C CA    1 
ATOM   5476  C  C     . GLU C 2  285  ? -0.787  11.415  -72.762  1.00 184.97 ? 285  GLU C C     1 
ATOM   5477  O  O     . GLU C 2  285  ? -1.215  12.545  -72.504  1.00 195.31 ? 285  GLU C O     1 
ATOM   5478  C  CB    . GLU C 2  285  ? -1.612  9.570   -71.299  1.00 171.96 ? 285  GLU C CB    1 
ATOM   5479  C  CG    . GLU C 2  285  ? -1.276  8.385   -70.411  1.00 171.10 ? 285  GLU C CG    1 
ATOM   5480  C  CD    . GLU C 2  285  ? -2.504  7.608   -69.987  1.00 172.81 ? 285  GLU C CD    1 
ATOM   5481  O  OE1   . GLU C 2  285  ? -2.591  7.236   -68.798  1.00 163.87 ? 285  GLU C OE1   1 
ATOM   5482  O  OE2   . GLU C 2  285  ? -3.386  7.375   -70.840  1.00 171.81 ? 285  GLU C OE2   1 
ATOM   5483  N  N     . PRO C 2  286  ? -0.636  11.001  -74.017  1.00 170.13 ? 286  PRO C N     1 
ATOM   5484  C  CA    . PRO C 2  286  ? -1.026  11.864  -75.136  1.00 153.08 ? 286  PRO C CA    1 
ATOM   5485  C  C     . PRO C 2  286  ? -2.533  12.040  -75.182  1.00 146.54 ? 286  PRO C C     1 
ATOM   5486  O  O     . PRO C 2  286  ? -3.283  11.052  -75.205  1.00 128.90 ? 286  PRO C O     1 
ATOM   5487  C  CB    . PRO C 2  286  ? -0.511  11.104  -76.367  1.00 144.45 ? 286  PRO C CB    1 
ATOM   5488  C  CG    . PRO C 2  286  ? -0.440  9.680   -75.927  1.00 132.57 ? 286  PRO C CG    1 
ATOM   5489  C  CD    . PRO C 2  286  ? -0.064  9.723   -74.475  1.00 151.54 ? 286  PRO C CD    1 
ATOM   5490  N  N     . PRO C 2  287  ? -3.018  13.283  -75.198  1.00 150.36 ? 287  PRO C N     1 
ATOM   5491  C  CA    . PRO C 2  287  ? -4.467  13.508  -75.191  1.00 147.26 ? 287  PRO C CA    1 
ATOM   5492  C  C     . PRO C 2  287  ? -5.070  13.514  -76.586  1.00 133.40 ? 287  PRO C C     1 
ATOM   5493  O  O     . PRO C 2  287  ? -4.834  14.433  -77.376  1.00 140.19 ? 287  PRO C O     1 
ATOM   5494  C  CB    . PRO C 2  287  ? -4.602  14.877  -74.513  1.00 137.16 ? 287  PRO C CB    1 
ATOM   5495  C  CG    . PRO C 2  287  ? -3.244  15.549  -74.683  1.00 135.24 ? 287  PRO C CG    1 
ATOM   5496  C  CD    . PRO C 2  287  ? -2.270  14.548  -75.257  1.00 145.38 ? 287  PRO C CD    1 
ATOM   5497  N  N     . THR C 2  288  ? -5.851  12.484  -76.894  1.00 139.91 ? 288  THR C N     1 
ATOM   5498  C  CA    . THR C 2  288  ? -6.568  12.377  -78.156  1.00 164.75 ? 288  THR C CA    1 
ATOM   5499  C  C     . THR C 2  288  ? -8.044  12.661  -77.916  1.00 173.38 ? 288  THR C C     1 
ATOM   5500  O  O     . THR C 2  288  ? -8.592  12.295  -76.871  1.00 165.96 ? 288  THR C O     1 
ATOM   5501  C  CB    . THR C 2  288  ? -6.391  10.984  -78.772  1.00 160.35 ? 288  THR C CB    1 
ATOM   5502  O  OG1   . THR C 2  288  ? -4.994  10.695  -78.912  1.00 147.35 ? 288  THR C OG1   1 
ATOM   5503  C  CG2   . THR C 2  288  ? -7.055  10.904  -80.141  1.00 134.85 ? 288  THR C CG2   1 
ATOM   5504  N  N     . LYS C 2  289  ? -8.683  13.327  -78.883  1.00 174.31 ? 289  LYS C N     1 
ATOM   5505  C  CA    . LYS C 2  289  ? -10.110 13.613  -78.782  1.00 166.47 ? 289  LYS C CA    1 
ATOM   5506  C  C     . LYS C 2  289  ? -10.943 12.356  -78.574  1.00 173.93 ? 289  LYS C C     1 
ATOM   5507  O  O     . LYS C 2  289  ? -12.061 12.443  -78.052  1.00 152.07 ? 289  LYS C O     1 
ATOM   5508  C  CB    . LYS C 2  289  ? -10.595 14.341  -80.039  1.00 162.17 ? 289  LYS C CB    1 
ATOM   5509  C  CG    . LYS C 2  289  ? -10.002 15.725  -80.247  1.00 162.12 ? 289  LYS C CG    1 
ATOM   5510  C  CD    . LYS C 2  289  ? -10.575 16.368  -81.501  1.00 170.30 ? 289  LYS C CD    1 
ATOM   5511  C  CE    . LYS C 2  289  ? -10.014 17.763  -81.724  1.00 190.14 ? 289  LYS C CE    1 
ATOM   5512  N  NZ    . LYS C 2  289  ? -10.623 18.414  -82.917  1.00 175.48 ? 289  LYS C NZ    1 
ATOM   5513  N  N     . GLU C 2  290  ? -10.428 11.190  -78.967  1.00 187.82 ? 290  GLU C N     1 
ATOM   5514  C  CA    . GLU C 2  290  ? -11.157 9.938   -78.838  1.00 187.97 ? 290  GLU C CA    1 
ATOM   5515  C  C     . GLU C 2  290  ? -10.640 9.043   -77.721  1.00 195.57 ? 290  GLU C C     1 
ATOM   5516  O  O     . GLU C 2  290  ? -11.278 8.027   -77.422  1.00 201.30 ? 290  GLU C O     1 
ATOM   5517  C  CB    . GLU C 2  290  ? -11.125 9.168   -80.166  1.00 173.20 ? 290  GLU C CB    1 
ATOM   5518  C  CG    . GLU C 2  290  ? -11.648 9.978   -81.340  1.00 194.81 ? 290  GLU C CG    1 
ATOM   5519  C  CD    . GLU C 2  290  ? -12.983 10.634  -81.043  1.00 214.14 ? 290  GLU C CD    1 
ATOM   5520  O  OE1   . GLU C 2  290  ? -13.892 9.938   -80.543  1.00 204.56 ? 290  GLU C OE1   1 
ATOM   5521  O  OE2   . GLU C 2  290  ? -13.120 11.849  -81.300  1.00 226.79 ? 290  GLU C OE2   1 
ATOM   5522  N  N     . SER C 2  291  ? -9.508  9.381   -77.103  1.00 192.60 ? 291  SER C N     1 
ATOM   5523  C  CA    . SER C 2  291  ? -9.058  8.677   -75.910  1.00 175.08 ? 291  SER C CA    1 
ATOM   5524  C  C     . SER C 2  291  ? -9.669  9.241   -74.637  1.00 176.68 ? 291  SER C C     1 
ATOM   5525  O  O     . SER C 2  291  ? -9.725  8.534   -73.624  1.00 164.61 ? 291  SER C O     1 
ATOM   5526  C  CB    . SER C 2  291  ? -7.529  8.716   -75.809  1.00 166.05 ? 291  SER C CB    1 
ATOM   5527  O  OG    . SER C 2  291  ? -7.056  10.042  -75.655  1.00 176.78 ? 291  SER C OG    1 
ATOM   5528  N  N     . ALA C 2  292  ? -10.120 10.496  -74.663  1.00 184.82 ? 292  ALA C N     1 
ATOM   5529  C  CA    . ALA C 2  292  ? -10.899 11.059  -73.569  1.00 159.14 ? 292  ALA C CA    1 
ATOM   5530  C  C     . ALA C 2  292  ? -12.394 10.852  -73.765  1.00 155.12 ? 292  ALA C C     1 
ATOM   5531  O  O     . ALA C 2  292  ? -13.131 10.739  -72.779  1.00 132.45 ? 292  ALA C O     1 
ATOM   5532  C  CB    . ALA C 2  292  ? -10.600 12.553  -73.415  1.00 135.56 ? 292  ALA C CB    1 
ATOM   5533  N  N     . GLN C 2  293  ? -12.853 10.803  -75.018  1.00 176.38 ? 293  GLN C N     1 
ATOM   5534  C  CA    . GLN C 2  293  ? -14.233 10.430  -75.305  1.00 171.67 ? 293  GLN C CA    1 
ATOM   5535  C  C     . GLN C 2  293  ? -14.529 8.994   -74.892  1.00 166.02 ? 293  GLN C C     1 
ATOM   5536  O  O     . GLN C 2  293  ? -15.696 8.647   -74.677  1.00 156.28 ? 293  GLN C O     1 
ATOM   5537  C  CB    . GLN C 2  293  ? -14.523 10.628  -76.797  1.00 168.84 ? 293  GLN C CB    1 
ATOM   5538  C  CG    . GLN C 2  293  ? -15.968 10.384  -77.221  1.00 163.59 ? 293  GLN C CG    1 
ATOM   5539  C  CD    . GLN C 2  293  ? -16.924 11.440  -76.700  1.00 160.84 ? 293  GLN C CD    1 
ATOM   5540  O  OE1   . GLN C 2  293  ? -16.515 12.544  -76.339  1.00 160.94 ? 293  GLN C OE1   1 
ATOM   5541  N  NE2   . GLN C 2  293  ? -18.208 11.104  -76.659  1.00 145.81 ? 293  GLN C NE2   1 
ATOM   5542  N  N     . THR C 2  294  ? -13.499 8.158   -74.760  1.00 171.15 ? 294  THR C N     1 
ATOM   5543  C  CA    . THR C 2  294  ? -13.678 6.762   -74.382  1.00 175.25 ? 294  THR C CA    1 
ATOM   5544  C  C     . THR C 2  294  ? -13.758 6.573   -72.871  1.00 163.34 ? 294  THR C C     1 
ATOM   5545  O  O     . THR C 2  294  ? -14.605 5.812   -72.391  1.00 154.01 ? 294  THR C O     1 
ATOM   5546  C  CB    . THR C 2  294  ? -12.536 5.916   -74.953  1.00 163.50 ? 294  THR C CB    1 
ATOM   5547  O  OG1   . THR C 2  294  ? -12.506 6.052   -76.380  1.00 136.93 ? 294  THR C OG1   1 
ATOM   5548  C  CG2   . THR C 2  294  ? -12.721 4.447   -74.595  1.00 152.04 ? 294  THR C CG2   1 
ATOM   5549  N  N     . LEU C 2  295  ? -12.900 7.253   -72.106  1.00 160.79 ? 295  LEU C N     1 
ATOM   5550  C  CA    . LEU C 2  295  ? -12.859 7.007   -70.667  1.00 161.51 ? 295  LEU C CA    1 
ATOM   5551  C  C     . LEU C 2  295  ? -13.952 7.769   -69.926  1.00 141.13 ? 295  LEU C C     1 
ATOM   5552  O  O     . LEU C 2  295  ? -14.505 7.257   -68.947  1.00 145.90 ? 295  LEU C O     1 
ATOM   5553  C  CB    . LEU C 2  295  ? -11.476 7.353   -70.106  1.00 174.59 ? 295  LEU C CB    1 
ATOM   5554  C  CG    . LEU C 2  295  ? -11.007 8.798   -69.915  1.00 161.87 ? 295  LEU C CG    1 
ATOM   5555  C  CD1   . LEU C 2  295  ? -11.414 9.356   -68.556  1.00 144.97 ? 295  LEU C CD1   1 
ATOM   5556  C  CD2   . LEU C 2  295  ? -9.506  8.849   -70.066  1.00 145.65 ? 295  LEU C CD2   1 
ATOM   5557  N  N     . LEU C 2  296  ? -14.277 8.988   -70.367  1.00 127.75 ? 296  LEU C N     1 
ATOM   5558  C  CA    . LEU C 2  296  ? -15.355 9.731   -69.722  1.00 119.89 ? 296  LEU C CA    1 
ATOM   5559  C  C     . LEU C 2  296  ? -16.712 9.060   -69.891  1.00 127.02 ? 296  LEU C C     1 
ATOM   5560  O  O     . LEU C 2  296  ? -17.665 9.450   -69.208  1.00 114.18 ? 296  LEU C O     1 
ATOM   5561  C  CB    . LEU C 2  296  ? -15.412 11.167  -70.250  1.00 122.67 ? 296  LEU C CB    1 
ATOM   5562  C  CG    . LEU C 2  296  ? -14.597 12.203  -69.465  1.00 109.38 ? 296  LEU C CG    1 
ATOM   5563  C  CD1   . LEU C 2  296  ? -13.145 12.226  -69.915  1.00 121.84 ? 296  LEU C CD1   1 
ATOM   5564  C  CD2   . LEU C 2  296  ? -15.218 13.589  -69.568  1.00 113.76 ? 296  LEU C CD2   1 
ATOM   5565  N  N     . GLU C 2  297  ? -16.823 8.070   -70.777  1.00 146.63 ? 297  GLU C N     1 
ATOM   5566  C  CA    . GLU C 2  297  ? -18.009 7.226   -70.844  1.00 155.49 ? 297  GLU C CA    1 
ATOM   5567  C  C     . GLU C 2  297  ? -17.839 5.942   -70.041  1.00 147.25 ? 297  GLU C C     1 
ATOM   5568  O  O     . GLU C 2  297  ? -18.797 5.471   -69.418  1.00 143.95 ? 297  GLU C O     1 
ATOM   5569  C  CB    . GLU C 2  297  ? -18.342 6.883   -72.299  1.00 168.95 ? 297  GLU C CB    1 
ATOM   5570  C  CG    . GLU C 2  297  ? -18.700 8.077   -73.165  1.00 156.99 ? 297  GLU C CG    1 
ATOM   5571  C  CD    . GLU C 2  297  ? -19.152 7.670   -74.553  1.00 156.84 ? 297  GLU C CD    1 
ATOM   5572  O  OE1   . GLU C 2  297  ? -19.741 6.577   -74.690  1.00 132.12 ? 297  GLU C OE1   1 
ATOM   5573  O  OE2   . GLU C 2  297  ? -18.912 8.439   -75.507  1.00 167.47 ? 297  GLU C OE2   1 
ATOM   5574  N  N     . ASN C 2  298  ? -16.632 5.368   -70.040  1.00 142.56 ? 298  ASN C N     1 
ATOM   5575  C  CA    . ASN C 2  298  ? -16.403 4.117   -69.324  1.00 144.36 ? 298  ASN C CA    1 
ATOM   5576  C  C     . ASN C 2  298  ? -16.327 4.331   -67.816  1.00 147.94 ? 298  ASN C C     1 
ATOM   5577  O  O     . ASN C 2  298  ? -16.690 3.433   -67.047  1.00 133.33 ? 298  ASN C O     1 
ATOM   5578  C  CB    . ASN C 2  298  ? -15.121 3.445   -69.824  1.00 144.06 ? 298  ASN C CB    1 
ATOM   5579  C  CG    . ASN C 2  298  ? -15.198 3.037   -71.288  1.00 137.17 ? 298  ASN C CG    1 
ATOM   5580  O  OD1   . ASN C 2  298  ? -16.282 2.852   -71.840  1.00 134.11 ? 298  ASN C OD1   1 
ATOM   5581  N  ND2   . ASN C 2  298  ? -14.039 2.887   -71.920  1.00 148.11 ? 298  ASN C ND2   1 
ATOM   5582  N  N     . LEU C 2  299  ? -15.863 5.500   -67.372  1.00 160.22 ? 299  LEU C N     1 
ATOM   5583  C  CA    . LEU C 2  299  ? -15.701 5.762   -65.947  1.00 158.60 ? 299  LEU C CA    1 
ATOM   5584  C  C     . LEU C 2  299  ? -16.998 6.153   -65.250  1.00 141.02 ? 299  LEU C C     1 
ATOM   5585  O  O     . LEU C 2  299  ? -17.038 6.145   -64.015  1.00 140.47 ? 299  LEU C O     1 
ATOM   5586  C  CB    . LEU C 2  299  ? -14.661 6.864   -65.721  1.00 141.02 ? 299  LEU C CB    1 
ATOM   5587  C  CG    . LEU C 2  299  ? -13.187 6.460   -65.706  1.00 143.74 ? 299  LEU C CG    1 
ATOM   5588  C  CD1   . LEU C 2  299  ? -12.309 7.666   -65.415  1.00 118.21 ? 299  LEU C CD1   1 
ATOM   5589  C  CD2   . LEU C 2  299  ? -12.948 5.367   -64.679  1.00 151.46 ? 299  LEU C CD2   1 
ATOM   5590  N  N     . PHE C 2  300  ? -18.049 6.499   -65.996  1.00 130.89 ? 300  PHE C N     1 
ATOM   5591  C  CA    . PHE C 2  300  ? -19.286 6.968   -65.380  1.00 139.31 ? 300  PHE C CA    1 
ATOM   5592  C  C     . PHE C 2  300  ? -20.559 6.448   -66.030  1.00 157.73 ? 300  PHE C C     1 
ATOM   5593  O  O     . PHE C 2  300  ? -21.626 6.597   -65.428  1.00 156.94 ? 300  PHE C O     1 
ATOM   5594  C  CB    . PHE C 2  300  ? -19.332 8.505   -65.380  1.00 125.36 ? 300  PHE C CB    1 
ATOM   5595  C  CG    . PHE C 2  300  ? -18.330 9.147   -64.460  1.00 117.69 ? 300  PHE C CG    1 
ATOM   5596  C  CD1   . PHE C 2  300  ? -18.681 9.499   -63.166  1.00 125.06 ? 300  PHE C CD1   1 
ATOM   5597  C  CD2   . PHE C 2  300  ? -17.039 9.405   -64.891  1.00 111.41 ? 300  PHE C CD2   1 
ATOM   5598  C  CE1   . PHE C 2  300  ? -17.760 10.091  -62.319  1.00 132.29 ? 300  PHE C CE1   1 
ATOM   5599  C  CE2   . PHE C 2  300  ? -16.114 9.994   -64.049  1.00 102.94 ? 300  PHE C CE2   1 
ATOM   5600  C  CZ    . PHE C 2  300  ? -16.475 10.338  -62.763  1.00 126.22 ? 300  PHE C CZ    1 
ATOM   5601  N  N     . PHE C 2  301  ? -20.500 5.847   -67.221  1.00 153.67 ? 301  PHE C N     1 
ATOM   5602  C  CA    . PHE C 2  301  ? -21.708 5.462   -67.937  1.00 146.20 ? 301  PHE C CA    1 
ATOM   5603  C  C     . PHE C 2  301  ? -21.676 4.058   -68.520  1.00 148.72 ? 301  PHE C C     1 
ATOM   5604  O  O     . PHE C 2  301  ? -22.722 3.579   -68.972  1.00 146.54 ? 301  PHE C O     1 
ATOM   5605  C  CB    . PHE C 2  301  ? -22.000 6.465   -69.063  1.00 145.33 ? 301  PHE C CB    1 
ATOM   5606  C  CG    . PHE C 2  301  ? -21.995 7.893   -68.607  1.00 145.45 ? 301  PHE C CG    1 
ATOM   5607  C  CD1   . PHE C 2  301  ? -23.096 8.432   -67.962  1.00 145.96 ? 301  PHE C CD1   1 
ATOM   5608  C  CD2   . PHE C 2  301  ? -20.884 8.694   -68.809  1.00 134.74 ? 301  PHE C CD2   1 
ATOM   5609  C  CE1   . PHE C 2  301  ? -23.093 9.745   -67.534  1.00 145.54 ? 301  PHE C CE1   1 
ATOM   5610  C  CE2   . PHE C 2  301  ? -20.874 10.008  -68.385  1.00 130.53 ? 301  PHE C CE2   1 
ATOM   5611  C  CZ    . PHE C 2  301  ? -21.980 10.535  -67.746  1.00 140.32 ? 301  PHE C CZ    1 
ATOM   5612  N  N     . LYS C 2  302  ? -20.530 3.388   -68.532  1.00 147.45 ? 302  LYS C N     1 
ATOM   5613  C  CA    . LYS C 2  302  ? -20.464 1.978   -68.889  1.00 147.26 ? 302  LYS C CA    1 
ATOM   5614  C  C     . LYS C 2  302  ? -20.472 1.138   -67.620  1.00 148.06 ? 302  LYS C C     1 
ATOM   5615  O  O     . LYS C 2  302  ? -19.750 1.434   -66.664  1.00 155.94 ? 302  LYS C O     1 
ATOM   5616  C  CB    . LYS C 2  302  ? -19.214 1.675   -69.716  1.00 155.16 ? 302  LYS C CB    1 
ATOM   5617  C  CG    . LYS C 2  302  ? -19.305 2.135   -71.162  1.00 145.17 ? 302  LYS C CG    1 
ATOM   5618  C  CD    . LYS C 2  302  ? -19.474 0.961   -72.117  1.00 129.06 ? 302  LYS C CD    1 
ATOM   5619  C  CE    . LYS C 2  302  ? -18.246 0.063   -72.112  1.00 107.00 ? 302  LYS C CE    1 
ATOM   5620  N  NZ    . LYS C 2  302  ? -18.371 -1.056  -73.088  1.00 105.07 ? 302  LYS C NZ    1 
ATOM   5621  N  N     . GLU C 2  303  ? -21.287 0.084   -67.619  1.00 149.98 ? 303  GLU C N     1 
ATOM   5622  C  CA    . GLU C 2  303  ? -21.408 -0.791  -66.458  1.00 154.90 ? 303  GLU C CA    1 
ATOM   5623  C  C     . GLU C 2  303  ? -20.106 -1.504  -66.089  1.00 157.35 ? 303  GLU C C     1 
ATOM   5624  O  O     . GLU C 2  303  ? -20.086 -2.206  -65.073  1.00 153.78 ? 303  GLU C O     1 
ATOM   5625  C  CB    . GLU C 2  303  ? -22.509 -1.828  -66.698  1.00 170.73 ? 303  GLU C CB    1 
ATOM   5626  C  CG    . GLU C 2  303  ? -23.904 -1.235  -66.766  1.00 173.07 ? 303  GLU C CG    1 
ATOM   5627  C  CD    . GLU C 2  303  ? -24.977 -2.283  -66.970  1.00 204.65 ? 303  GLU C CD    1 
ATOM   5628  O  OE1   . GLU C 2  303  ? -24.657 -3.382  -67.473  1.00 224.84 ? 303  GLU C OE1   1 
ATOM   5629  O  OE2   . GLU C 2  303  ? -26.144 -2.006  -66.625  1.00 191.65 ? 303  GLU C OE2   1 
ATOM   5630  N  N     . LYS C 2  304  ? -19.030 -1.349  -66.866  1.00 157.86 ? 304  LYS C N     1 
ATOM   5631  C  CA    . LYS C 2  304  ? -17.771 -2.015  -66.537  1.00 156.93 ? 304  LYS C CA    1 
ATOM   5632  C  C     . LYS C 2  304  ? -17.099 -1.370  -65.329  1.00 143.93 ? 304  LYS C C     1 
ATOM   5633  O  O     . LYS C 2  304  ? -16.773 -2.049  -64.349  1.00 158.96 ? 304  LYS C O     1 
ATOM   5634  C  CB    . LYS C 2  304  ? -16.832 -1.995  -67.748  1.00 162.06 ? 304  LYS C CB    1 
ATOM   5635  C  CG    . LYS C 2  304  ? -17.367 -2.742  -68.960  1.00 158.90 ? 304  LYS C CG    1 
ATOM   5636  C  CD    . LYS C 2  304  ? -16.425 -2.632  -70.148  1.00 148.31 ? 304  LYS C CD    1 
ATOM   5637  C  CE    . LYS C 2  304  ? -16.910 -3.472  -71.319  1.00 125.50 ? 304  LYS C CE    1 
ATOM   5638  N  NZ    . LYS C 2  304  ? -16.027 -3.308  -72.507  1.00 97.72  ? 304  LYS C NZ    1 
ATOM   5639  N  N     . ARG C 2  305  ? -16.875 -0.054  -65.383  1.00 129.26 ? 305  ARG C N     1 
ATOM   5640  C  CA    . ARG C 2  305  ? -16.109 0.657   -64.365  1.00 143.89 ? 305  ARG C CA    1 
ATOM   5641  C  C     . ARG C 2  305  ? -16.980 1.590   -63.520  1.00 141.86 ? 305  ARG C C     1 
ATOM   5642  O  O     . ARG C 2  305  ? -16.456 2.444   -62.798  1.00 123.86 ? 305  ARG C O     1 
ATOM   5643  C  CB    . ARG C 2  305  ? -14.964 1.429   -65.027  1.00 144.58 ? 305  ARG C CB    1 
ATOM   5644  C  CG    . ARG C 2  305  ? -13.839 1.856   -64.095  1.00 150.50 ? 305  ARG C CG    1 
ATOM   5645  C  CD    . ARG C 2  305  ? -13.434 0.740   -63.149  1.00 163.84 ? 305  ARG C CD    1 
ATOM   5646  N  NE    . ARG C 2  305  ? -12.553 1.231   -62.094  1.00 197.61 ? 305  ARG C NE    1 
ATOM   5647  C  CZ    . ARG C 2  305  ? -12.183 0.518   -61.036  1.00 203.48 ? 305  ARG C CZ    1 
ATOM   5648  N  NH1   . ARG C 2  305  ? -12.618 -0.725  -60.888  1.00 200.33 ? 305  ARG C NH1   1 
ATOM   5649  N  NH2   . ARG C 2  305  ? -11.380 1.049   -60.124  1.00 185.01 ? 305  ARG C NH2   1 
ATOM   5650  N  N     . TYR C 2  306  ? -18.300 1.438   -63.585  1.00 144.95 ? 306  TYR C N     1 
ATOM   5651  C  CA    . TYR C 2  306  ? -19.192 2.262   -62.782  1.00 132.34 ? 306  TYR C CA    1 
ATOM   5652  C  C     . TYR C 2  306  ? -20.521 1.538   -62.628  1.00 142.65 ? 306  TYR C C     1 
ATOM   5653  O  O     . TYR C 2  306  ? -20.997 0.902   -63.572  1.00 156.54 ? 306  TYR C O     1 
ATOM   5654  C  CB    . TYR C 2  306  ? -19.404 3.640   -63.419  1.00 131.15 ? 306  TYR C CB    1 
ATOM   5655  C  CG    . TYR C 2  306  ? -19.950 4.681   -62.469  1.00 131.64 ? 306  TYR C CG    1 
ATOM   5656  C  CD1   . TYR C 2  306  ? -21.317 4.819   -62.269  1.00 128.49 ? 306  TYR C CD1   1 
ATOM   5657  C  CD2   . TYR C 2  306  ? -19.098 5.531   -61.778  1.00 143.05 ? 306  TYR C CD2   1 
ATOM   5658  C  CE1   . TYR C 2  306  ? -21.817 5.771   -61.403  1.00 134.84 ? 306  TYR C CE1   1 
ATOM   5659  C  CE2   . TYR C 2  306  ? -19.590 6.487   -60.913  1.00 143.81 ? 306  TYR C CE2   1 
ATOM   5660  C  CZ    . TYR C 2  306  ? -20.950 6.603   -60.730  1.00 136.02 ? 306  TYR C CZ    1 
ATOM   5661  O  OH    . TYR C 2  306  ? -21.447 7.553   -59.867  1.00 121.72 ? 306  TYR C OH    1 
ATOM   5662  N  N     . ASP C 2  307  ? -21.116 1.645   -61.438  1.00 131.93 ? 307  ASP C N     1 
ATOM   5663  C  CA    . ASP C 2  307  ? -22.375 0.963   -61.160  1.00 127.18 ? 307  ASP C CA    1 
ATOM   5664  C  C     . ASP C 2  307  ? -23.035 1.490   -59.892  1.00 125.74 ? 307  ASP C C     1 
ATOM   5665  O  O     . ASP C 2  307  ? -22.450 1.428   -58.806  1.00 128.60 ? 307  ASP C O     1 
ATOM   5666  C  CB    . ASP C 2  307  ? -22.144 -0.547  -61.038  1.00 133.82 ? 307  ASP C CB    1 
ATOM   5667  C  CG    . ASP C 2  307  ? -23.428 -1.355  -61.149  1.00 141.59 ? 307  ASP C CG    1 
ATOM   5668  O  OD1   . ASP C 2  307  ? -24.491 -0.879  -60.699  1.00 138.50 ? 307  ASP C OD1   1 
ATOM   5669  O  OD2   . ASP C 2  307  ? -23.372 -2.481  -61.688  1.00 148.74 ? 307  ASP C OD2   1 
ATOM   5670  N  N     . LEU C 2  308  ? -24.251 2.013   -60.025  1.00 137.63 ? 308  LEU C N     1 
ATOM   5671  C  CA    . LEU C 2  308  ? -25.121 2.248   -58.882  1.00 127.44 ? 308  LEU C CA    1 
ATOM   5672  C  C     . LEU C 2  308  ? -25.981 1.009   -58.676  1.00 128.50 ? 308  LEU C C     1 
ATOM   5673  O  O     . LEU C 2  308  ? -26.668 0.565   -59.603  1.00 159.63 ? 308  LEU C O     1 
ATOM   5674  C  CB    . LEU C 2  308  ? -26.014 3.471   -59.097  1.00 124.99 ? 308  LEU C CB    1 
ATOM   5675  C  CG    . LEU C 2  308  ? -25.407 4.790   -59.577  1.00 113.73 ? 308  LEU C CG    1 
ATOM   5676  C  CD1   . LEU C 2  308  ? -26.455 5.892   -59.532  1.00 116.67 ? 308  LEU C CD1   1 
ATOM   5677  C  CD2   . LEU C 2  308  ? -24.199 5.170   -58.751  1.00 107.24 ? 308  LEU C CD2   1 
ATOM   5678  N  N     . ALA C 2  309  ? -25.939 0.451   -57.469  1.00 99.68  ? 309  ALA C N     1 
ATOM   5679  C  CA    . ALA C 2  309  ? -26.723 -0.737  -57.175  1.00 110.98 ? 309  ALA C CA    1 
ATOM   5680  C  C     . ALA C 2  309  ? -28.216 -0.434  -57.299  1.00 115.57 ? 309  ALA C C     1 
ATOM   5681  O  O     . ALA C 2  309  ? -28.638 0.717   -57.442  1.00 116.84 ? 309  ALA C O     1 
ATOM   5682  C  CB    . ALA C 2  309  ? -26.398 -1.259  -55.776  1.00 135.44 ? 309  ALA C CB    1 
ATOM   5683  N  N     . ARG C 2  310  ? -29.025 -1.497  -57.244  1.00 115.98 ? 310  ARG C N     1 
ATOM   5684  C  CA    . ARG C 2  310  ? -30.474 -1.322  -57.281  1.00 117.44 ? 310  ARG C CA    1 
ATOM   5685  C  C     . ARG C 2  310  ? -30.953 -0.401  -56.167  1.00 129.03 ? 310  ARG C C     1 
ATOM   5686  O  O     . ARG C 2  310  ? -32.008 0.231   -56.294  1.00 131.24 ? 310  ARG C O     1 
ATOM   5687  C  CB    . ARG C 2  310  ? -31.176 -2.677  -57.187  1.00 130.49 ? 310  ARG C CB    1 
ATOM   5688  C  CG    . ARG C 2  310  ? -31.349 -3.388  -58.518  1.00 130.40 ? 310  ARG C CG    1 
ATOM   5689  C  CD    . ARG C 2  310  ? -32.295 -4.568  -58.373  1.00 133.44 ? 310  ARG C CD    1 
ATOM   5690  N  NE    . ARG C 2  310  ? -33.541 -4.183  -57.715  1.00 145.35 ? 310  ARG C NE    1 
ATOM   5691  C  CZ    . ARG C 2  310  ? -34.625 -3.754  -58.353  1.00 137.81 ? 310  ARG C CZ    1 
ATOM   5692  N  NH1   . ARG C 2  310  ? -34.624 -3.657  -59.676  1.00 166.79 ? 310  ARG C NH1   1 
ATOM   5693  N  NH2   . ARG C 2  310  ? -35.713 -3.425  -57.669  1.00 115.70 ? 310  ARG C NH2   1 
ATOM   5694  N  N     . VAL C 2  311  ? -30.196 -0.314  -55.076  1.00 134.96 ? 311  VAL C N     1 
ATOM   5695  C  CA    . VAL C 2  311  ? -30.491 0.655   -54.030  1.00 128.47 ? 311  VAL C CA    1 
ATOM   5696  C  C     . VAL C 2  311  ? -29.865 2.017   -54.333  1.00 130.93 ? 311  VAL C C     1 
ATOM   5697  O  O     . VAL C 2  311  ? -30.453 3.053   -54.006  1.00 142.19 ? 311  VAL C O     1 
ATOM   5698  C  CB    . VAL C 2  311  ? -30.027 0.114   -52.665  1.00 127.38 ? 311  VAL C CB    1 
ATOM   5699  C  CG1   . VAL C 2  311  ? -28.534 -0.196  -52.681  1.00 122.32 ? 311  VAL C CG1   1 
ATOM   5700  C  CG2   . VAL C 2  311  ? -30.363 1.093   -51.557  1.00 140.56 ? 311  VAL C CG2   1 
ATOM   5701  N  N     . GLY C 2  312  ? -28.691 2.040   -54.969  1.00 124.41 ? 312  GLY C N     1 
ATOM   5702  C  CA    . GLY C 2  312  ? -28.069 3.309   -55.308  1.00 127.33 ? 312  GLY C CA    1 
ATOM   5703  C  C     . GLY C 2  312  ? -28.840 4.072   -56.368  1.00 136.21 ? 312  GLY C C     1 
ATOM   5704  O  O     . GLY C 2  312  ? -29.022 5.288   -56.260  1.00 131.27 ? 312  GLY C O     1 
ATOM   5705  N  N     . ARG C 2  313  ? -29.299 3.371   -57.407  1.00 140.45 ? 313  ARG C N     1 
ATOM   5706  C  CA    . ARG C 2  313  ? -30.147 4.004   -58.412  1.00 135.53 ? 313  ARG C CA    1 
ATOM   5707  C  C     . ARG C 2  313  ? -31.445 4.507   -57.793  1.00 122.78 ? 313  ARG C C     1 
ATOM   5708  O  O     . ARG C 2  313  ? -31.913 5.605   -58.116  1.00 123.84 ? 313  ARG C O     1 
ATOM   5709  C  CB    . ARG C 2  313  ? -30.442 3.016   -59.541  1.00 138.65 ? 313  ARG C CB    1 
ATOM   5710  C  CG    . ARG C 2  313  ? -31.250 3.595   -60.688  1.00 132.48 ? 313  ARG C CG    1 
ATOM   5711  C  CD    . ARG C 2  313  ? -30.402 4.517   -61.544  1.00 128.69 ? 313  ARG C CD    1 
ATOM   5712  N  NE    . ARG C 2  313  ? -30.869 5.897   -61.495  1.00 130.23 ? 313  ARG C NE    1 
ATOM   5713  C  CZ    . ARG C 2  313  ? -30.331 6.891   -62.193  1.00 137.52 ? 313  ARG C CZ    1 
ATOM   5714  N  NH1   . ARG C 2  313  ? -29.303 6.658   -62.999  1.00 129.69 ? 313  ARG C NH1   1 
ATOM   5715  N  NH2   . ARG C 2  313  ? -30.821 8.117   -62.086  1.00 147.23 ? 313  ARG C NH2   1 
ATOM   5716  N  N     . TYR C 2  314  ? -32.035 3.717   -56.893  1.00 116.35 ? 314  TYR C N     1 
ATOM   5717  C  CA    . TYR C 2  314  ? -33.292 4.104   -56.263  1.00 132.58 ? 314  TYR C CA    1 
ATOM   5718  C  C     . TYR C 2  314  ? -33.108 5.304   -55.341  1.00 130.56 ? 314  TYR C C     1 
ATOM   5719  O  O     . TYR C 2  314  ? -33.990 6.166   -55.252  1.00 143.79 ? 314  TYR C O     1 
ATOM   5720  C  CB    . TYR C 2  314  ? -33.870 2.912   -55.501  1.00 133.47 ? 314  TYR C CB    1 
ATOM   5721  C  CG    . TYR C 2  314  ? -35.073 3.228   -54.644  1.00 145.02 ? 314  TYR C CG    1 
ATOM   5722  C  CD1   . TYR C 2  314  ? -36.288 3.580   -55.218  1.00 153.21 ? 314  TYR C CD1   1 
ATOM   5723  C  CD2   . TYR C 2  314  ? -34.999 3.152   -53.259  1.00 130.20 ? 314  TYR C CD2   1 
ATOM   5724  C  CE1   . TYR C 2  314  ? -37.391 3.862   -54.435  1.00 161.05 ? 314  TYR C CE1   1 
ATOM   5725  C  CE2   . TYR C 2  314  ? -36.096 3.430   -52.468  1.00 142.87 ? 314  TYR C CE2   1 
ATOM   5726  C  CZ    . TYR C 2  314  ? -37.289 3.783   -53.062  1.00 175.68 ? 314  TYR C CZ    1 
ATOM   5727  O  OH    . TYR C 2  314  ? -38.385 4.062   -52.278  1.00 201.21 ? 314  TYR C OH    1 
ATOM   5728  N  N     . LYS C 2  315  ? -31.968 5.382   -54.651  1.00 122.62 ? 315  LYS C N     1 
ATOM   5729  C  CA    . LYS C 2  315  ? -31.710 6.520   -53.777  1.00 132.10 ? 315  LYS C CA    1 
ATOM   5730  C  C     . LYS C 2  315  ? -31.466 7.803   -54.561  1.00 122.73 ? 315  LYS C C     1 
ATOM   5731  O  O     . LYS C 2  315  ? -31.602 8.895   -53.999  1.00 117.23 ? 315  LYS C O     1 
ATOM   5732  C  CB    . LYS C 2  315  ? -30.517 6.225   -52.866  1.00 143.09 ? 315  LYS C CB    1 
ATOM   5733  C  CG    . LYS C 2  315  ? -30.486 7.058   -51.595  1.00 126.57 ? 315  LYS C CG    1 
ATOM   5734  C  CD    . LYS C 2  315  ? -31.698 6.766   -50.725  1.00 111.02 ? 315  LYS C CD    1 
ATOM   5735  C  CE    . LYS C 2  315  ? -31.751 7.688   -49.520  1.00 110.02 ? 315  LYS C CE    1 
ATOM   5736  N  NZ    . LYS C 2  315  ? -32.956 7.439   -48.682  1.00 119.59 ? 315  LYS C NZ    1 
ATOM   5737  N  N     . VAL C 2  316  ? -31.107 7.695   -55.841  1.00 119.15 ? 316  VAL C N     1 
ATOM   5738  C  CA    . VAL C 2  316  ? -30.956 8.880   -56.679  1.00 120.10 ? 316  VAL C CA    1 
ATOM   5739  C  C     . VAL C 2  316  ? -32.298 9.296   -57.268  1.00 120.93 ? 316  VAL C C     1 
ATOM   5740  O  O     . VAL C 2  316  ? -32.628 10.486  -57.313  1.00 113.51 ? 316  VAL C O     1 
ATOM   5741  C  CB    . VAL C 2  316  ? -29.912 8.618   -57.781  1.00 99.47  ? 316  VAL C CB    1 
ATOM   5742  C  CG1   . VAL C 2  316  ? -29.856 9.788   -58.755  1.00 100.32 ? 316  VAL C CG1   1 
ATOM   5743  C  CG2   . VAL C 2  316  ? -28.544 8.359   -57.170  1.00 114.73 ? 316  VAL C CG2   1 
ATOM   5744  N  N     . ASN C 2  317  ? -33.095 8.323   -57.713  1.00 127.81 ? 317  ASN C N     1 
ATOM   5745  C  CA    . ASN C 2  317  ? -34.359 8.614   -58.378  1.00 130.25 ? 317  ASN C CA    1 
ATOM   5746  C  C     . ASN C 2  317  ? -35.412 9.187   -57.437  1.00 131.38 ? 317  ASN C C     1 
ATOM   5747  O  O     . ASN C 2  317  ? -36.422 9.712   -57.918  1.00 147.46 ? 317  ASN C O     1 
ATOM   5748  C  CB    . ASN C 2  317  ? -34.887 7.349   -59.055  1.00 131.78 ? 317  ASN C CB    1 
ATOM   5749  C  CG    . ASN C 2  317  ? -33.922 6.802   -60.090  1.00 128.44 ? 317  ASN C CG    1 
ATOM   5750  O  OD1   . ASN C 2  317  ? -33.006 7.498   -60.529  1.00 119.72 ? 317  ASN C OD1   1 
ATOM   5751  N  ND2   . ASN C 2  317  ? -34.124 5.551   -60.486  1.00 128.26 ? 317  ASN C ND2   1 
ATOM   5752  N  N     . LYS C 2  318  ? -35.211 9.095   -56.124  1.00 111.11 ? 318  LYS C N     1 
ATOM   5753  C  CA    . LYS C 2  318  ? -36.058 9.780   -55.155  1.00 109.62 ? 318  LYS C CA    1 
ATOM   5754  C  C     . LYS C 2  318  ? -35.484 11.118  -54.718  1.00 119.96 ? 318  LYS C C     1 
ATOM   5755  O  O     . LYS C 2  318  ? -36.236 12.079  -54.527  1.00 114.91 ? 318  LYS C O     1 
ATOM   5756  C  CB    . LYS C 2  318  ? -36.279 8.908   -53.915  1.00 130.83 ? 318  LYS C CB    1 
ATOM   5757  C  CG    . LYS C 2  318  ? -37.223 7.740   -54.119  1.00 143.62 ? 318  LYS C CG    1 
ATOM   5758  C  CD    . LYS C 2  318  ? -37.716 7.209   -52.782  1.00 184.57 ? 318  LYS C CD    1 
ATOM   5759  C  CE    . LYS C 2  318  ? -36.556 6.926   -51.840  1.00 189.09 ? 318  LYS C CE    1 
ATOM   5760  N  NZ    . LYS C 2  318  ? -37.019 6.419   -50.519  1.00 153.21 ? 318  LYS C NZ    1 
ATOM   5761  N  N     . LYS C 2  319  ? -34.163 11.199  -54.552  1.00 132.38 ? 319  LYS C N     1 
ATOM   5762  C  CA    . LYS C 2  319  ? -33.549 12.439  -54.090  1.00 137.04 ? 319  LYS C CA    1 
ATOM   5763  C  C     . LYS C 2  319  ? -33.658 13.536  -55.141  1.00 134.32 ? 319  LYS C C     1 
ATOM   5764  O  O     . LYS C 2  319  ? -33.854 14.709  -54.804  1.00 144.75 ? 319  LYS C O     1 
ATOM   5765  C  CB    . LYS C 2  319  ? -32.088 12.188  -53.714  1.00 131.98 ? 319  LYS C CB    1 
ATOM   5766  C  CG    . LYS C 2  319  ? -31.391 13.390  -53.104  1.00 123.92 ? 319  LYS C CG    1 
ATOM   5767  C  CD    . LYS C 2  319  ? -32.156 13.911  -51.899  1.00 118.60 ? 319  LYS C CD    1 
ATOM   5768  C  CE    . LYS C 2  319  ? -31.514 15.167  -51.338  1.00 120.50 ? 319  LYS C CE    1 
ATOM   5769  N  NZ    . LYS C 2  319  ? -32.336 15.770  -50.254  1.00 134.49 ? 319  LYS C NZ    1 
ATOM   5770  N  N     . LEU C 2  320  ? -33.541 13.175  -56.419  1.00 116.62 ? 320  LEU C N     1 
ATOM   5771  C  CA    . LEU C 2  320  ? -33.643 14.147  -57.500  1.00 115.54 ? 320  LEU C CA    1 
ATOM   5772  C  C     . LEU C 2  320  ? -35.053 14.275  -58.059  1.00 129.69 ? 320  LEU C C     1 
ATOM   5773  O  O     . LEU C 2  320  ? -35.350 15.271  -58.728  1.00 130.42 ? 320  LEU C O     1 
ATOM   5774  C  CB    . LEU C 2  320  ? -32.685 13.780  -58.636  1.00 118.86 ? 320  LEU C CB    1 
ATOM   5775  C  CG    . LEU C 2  320  ? -31.188 13.851  -58.333  1.00 106.51 ? 320  LEU C CG    1 
ATOM   5776  C  CD1   . LEU C 2  320  ? -30.386 13.451  -59.560  1.00 117.94 ? 320  LEU C CD1   1 
ATOM   5777  C  CD2   . LEU C 2  320  ? -30.793 15.243  -57.861  1.00 101.16 ? 320  LEU C CD2   1 
ATOM   5778  N  N     . GLY C 2  321  ? -35.919 13.300  -57.807  1.00 138.69 ? 321  GLY C N     1 
ATOM   5779  C  CA    . GLY C 2  321  ? -37.276 13.352  -58.318  1.00 143.34 ? 321  GLY C CA    1 
ATOM   5780  C  C     . GLY C 2  321  ? -37.405 13.057  -59.795  1.00 144.52 ? 321  GLY C C     1 
ATOM   5781  O  O     . GLY C 2  321  ? -38.137 13.760  -60.502  1.00 157.05 ? 321  GLY C O     1 
ATOM   5782  N  N     . LEU C 2  322  ? -36.714 12.031  -60.283  1.00 140.16 ? 322  LEU C N     1 
ATOM   5783  C  CA    . LEU C 2  322  ? -36.767 11.649  -61.685  1.00 157.09 ? 322  LEU C CA    1 
ATOM   5784  C  C     . LEU C 2  322  ? -36.835 10.133  -61.788  1.00 173.03 ? 322  LEU C C     1 
ATOM   5785  O  O     . LEU C 2  322  ? -36.259 9.418   -60.965  1.00 176.65 ? 322  LEU C O     1 
ATOM   5786  C  CB    . LEU C 2  322  ? -35.554 12.193  -62.461  1.00 162.58 ? 322  LEU C CB    1 
ATOM   5787  C  CG    . LEU C 2  322  ? -34.194 12.191  -61.753  1.00 144.05 ? 322  LEU C CG    1 
ATOM   5788  C  CD1   . LEU C 2  322  ? -33.500 10.840  -61.870  1.00 133.18 ? 322  LEU C CD1   1 
ATOM   5789  C  CD2   . LEU C 2  322  ? -33.297 13.305  -62.282  1.00 143.65 ? 322  LEU C CD2   1 
ATOM   5790  N  N     . HIS C 2  323  ? -37.557 9.651   -62.803  1.00 184.93 ? 323  HIS C N     1 
ATOM   5791  C  CA    . HIS C 2  323  ? -37.730 8.216   -63.041  1.00 165.65 ? 323  HIS C CA    1 
ATOM   5792  C  C     . HIS C 2  323  ? -38.346 7.514   -61.833  1.00 185.40 ? 323  HIS C C     1 
ATOM   5793  O  O     . HIS C 2  323  ? -38.152 6.312   -61.631  1.00 191.49 ? 323  HIS C O     1 
ATOM   5794  C  CB    . HIS C 2  323  ? -36.401 7.546   -63.416  1.00 145.76 ? 323  HIS C CB    1 
ATOM   5795  C  CG    . HIS C 2  323  ? -35.804 8.044   -64.697  1.00 160.16 ? 323  HIS C CG    1 
ATOM   5796  N  ND1   . HIS C 2  323  ? -35.807 7.297   -65.855  1.00 170.57 ? 323  HIS C ND1   1 
ATOM   5797  C  CD2   . HIS C 2  323  ? -35.169 9.202   -64.997  1.00 170.46 ? 323  HIS C CD2   1 
ATOM   5798  C  CE1   . HIS C 2  323  ? -35.208 7.977   -66.817  1.00 178.06 ? 323  HIS C CE1   1 
ATOM   5799  N  NE2   . HIS C 2  323  ? -34.812 9.136   -66.323  1.00 172.71 ? 323  HIS C NE2   1 
ATOM   5800  N  N     . VAL C 2  324  ? -39.103 8.251   -61.022  1.00 200.02 ? 324  VAL C N     1 
ATOM   5801  C  CA    . VAL C 2  324  ? -39.597 7.731   -59.751  1.00 200.50 ? 324  VAL C CA    1 
ATOM   5802  C  C     . VAL C 2  324  ? -40.740 6.748   -59.987  1.00 208.38 ? 324  VAL C C     1 
ATOM   5803  O  O     . VAL C 2  324  ? -41.278 6.166   -59.038  1.00 189.52 ? 324  VAL C O     1 
ATOM   5804  C  CB    . VAL C 2  324  ? -40.029 8.880   -58.820  1.00 176.28 ? 324  VAL C CB    1 
ATOM   5805  C  CG1   . VAL C 2  324  ? -41.415 9.383   -59.194  1.00 173.26 ? 324  VAL C CG1   1 
ATOM   5806  C  CG2   . VAL C 2  324  ? -39.968 8.442   -57.363  1.00 146.57 ? 324  VAL C CG2   1 
ATOM   5807  N  N     . GLY C 2  325  ? -41.111 6.542   -61.248  1.00 201.87 ? 325  GLY C N     1 
ATOM   5808  C  CA    . GLY C 2  325  ? -42.146 5.577   -61.571  1.00 182.32 ? 325  GLY C CA    1 
ATOM   5809  C  C     . GLY C 2  325  ? -41.668 4.446   -62.461  1.00 179.07 ? 325  GLY C C     1 
ATOM   5810  O  O     . GLY C 2  325  ? -42.306 3.391   -62.536  1.00 170.86 ? 325  GLY C O     1 
ATOM   5811  N  N     . GLU C 2  326  ? -40.547 4.660   -63.141  1.00 183.57 ? 326  GLU C N     1 
ATOM   5812  C  CA    . GLU C 2  326  ? -40.009 3.651   -64.042  1.00 184.00 ? 326  GLU C CA    1 
ATOM   5813  C  C     . GLU C 2  326  ? -39.494 2.450   -63.248  1.00 196.17 ? 326  GLU C C     1 
ATOM   5814  O  O     . GLU C 2  326  ? -38.930 2.620   -62.163  1.00 208.07 ? 326  GLU C O     1 
ATOM   5815  C  CB    . GLU C 2  326  ? -38.879 4.249   -64.884  1.00 172.19 ? 326  GLU C CB    1 
ATOM   5816  C  CG    . GLU C 2  326  ? -38.132 3.253   -65.756  1.00 174.46 ? 326  GLU C CG    1 
ATOM   5817  C  CD    . GLU C 2  326  ? -36.918 3.859   -66.430  1.00 184.54 ? 326  GLU C CD    1 
ATOM   5818  O  OE1   . GLU C 2  326  ? -36.817 5.103   -66.474  1.00 189.38 ? 326  GLU C OE1   1 
ATOM   5819  O  OE2   . GLU C 2  326  ? -36.062 3.088   -66.911  1.00 178.44 ? 326  GLU C OE2   1 
ATOM   5820  N  N     . PRO C 2  327  ? -39.685 1.229   -63.750  1.00 181.12 ? 327  PRO C N     1 
ATOM   5821  C  CA    . PRO C 2  327  ? -39.078 0.064   -63.093  1.00 185.39 ? 327  PRO C CA    1 
ATOM   5822  C  C     . PRO C 2  327  ? -37.558 0.153   -63.114  1.00 189.23 ? 327  PRO C C     1 
ATOM   5823  O  O     . PRO C 2  327  ? -36.955 0.567   -64.107  1.00 183.32 ? 327  PRO C O     1 
ATOM   5824  C  CB    . PRO C 2  327  ? -39.590 -1.121  -63.921  1.00 172.37 ? 327  PRO C CB    1 
ATOM   5825  C  CG    . PRO C 2  327  ? -40.003 -0.526  -65.233  1.00 173.41 ? 327  PRO C CG    1 
ATOM   5826  C  CD    . PRO C 2  327  ? -40.516 0.840   -64.902  1.00 154.95 ? 327  PRO C CD    1 
ATOM   5827  N  N     . ILE C 2  328  ? -36.942 -0.242  -62.001  1.00 186.07 ? 328  ILE C N     1 
ATOM   5828  C  CA    . ILE C 2  328  ? -35.500 -0.107  -61.817  1.00 176.67 ? 328  ILE C CA    1 
ATOM   5829  C  C     . ILE C 2  328  ? -34.762 -1.039  -62.769  1.00 171.60 ? 328  ILE C C     1 
ATOM   5830  O  O     . ILE C 2  328  ? -34.573 -2.225  -62.476  1.00 159.55 ? 328  ILE C O     1 
ATOM   5831  C  CB    . ILE C 2  328  ? -35.093 -0.383  -60.357  1.00 173.96 ? 328  ILE C CB    1 
ATOM   5832  C  CG1   . ILE C 2  328  ? -35.912 0.479   -59.394  1.00 171.42 ? 328  ILE C CG1   1 
ATOM   5833  C  CG2   . ILE C 2  328  ? -33.607 -0.123  -60.158  1.00 149.52 ? 328  ILE C CG2   1 
ATOM   5834  C  CD1   . ILE C 2  328  ? -37.067 -0.254  -58.746  1.00 152.98 ? 328  ILE C CD1   1 
ATOM   5835  N  N     . THR C 2  329  ? -34.340 -0.508  -63.915  1.00 179.16 ? 329  THR C N     1 
ATOM   5836  C  CA    . THR C 2  329  ? -33.538 -1.250  -64.877  1.00 183.05 ? 329  THR C CA    1 
ATOM   5837  C  C     . THR C 2  329  ? -32.166 -0.644  -65.122  1.00 175.33 ? 329  THR C C     1 
ATOM   5838  O  O     . THR C 2  329  ? -31.232 -1.381  -65.445  1.00 157.99 ? 329  THR C O     1 
ATOM   5839  C  CB    . THR C 2  329  ? -34.273 -1.363  -66.223  1.00 186.41 ? 329  THR C CB    1 
ATOM   5840  O  OG1   . THR C 2  329  ? -33.399 -1.938  -67.203  1.00 190.80 ? 329  THR C OG1   1 
ATOM   5841  C  CG2   . THR C 2  329  ? -34.734 0.007   -66.700  1.00 160.83 ? 329  THR C CG2   1 
ATOM   5842  N  N     . SER C 2  330  ? -32.016 0.670   -64.971  1.00 177.06 ? 330  SER C N     1 
ATOM   5843  C  CA    . SER C 2  330  ? -30.739 1.336   -65.200  1.00 171.81 ? 330  SER C CA    1 
ATOM   5844  C  C     . SER C 2  330  ? -29.826 1.094   -64.005  1.00 165.41 ? 330  SER C C     1 
ATOM   5845  O  O     . SER C 2  330  ? -30.048 1.642   -62.921  1.00 153.43 ? 330  SER C O     1 
ATOM   5846  C  CB    . SER C 2  330  ? -30.952 2.829   -65.432  1.00 146.49 ? 330  SER C CB    1 
ATOM   5847  O  OG    . SER C 2  330  ? -29.714 3.511   -65.534  1.00 136.69 ? 330  SER C OG    1 
ATOM   5848  N  N     . SER C 2  331  ? -28.797 0.268   -64.199  1.00 161.35 ? 331  SER C N     1 
ATOM   5849  C  CA    . SER C 2  331  ? -27.765 0.053   -63.193  1.00 148.65 ? 331  SER C CA    1 
ATOM   5850  C  C     . SER C 2  331  ? -26.599 1.021   -63.345  1.00 143.75 ? 331  SER C C     1 
ATOM   5851  O  O     . SER C 2  331  ? -25.467 0.688   -62.969  1.00 162.05 ? 331  SER C O     1 
ATOM   5852  C  CB    . SER C 2  331  ? -27.269 -1.393  -63.253  1.00 167.08 ? 331  SER C CB    1 
ATOM   5853  O  OG    . SER C 2  331  ? -28.345 -2.306  -63.135  1.00 184.07 ? 331  SER C OG    1 
ATOM   5854  N  N     . THR C 2  332  ? -26.846 2.214   -63.882  1.00 138.60 ? 332  THR C N     1 
ATOM   5855  C  CA    . THR C 2  332  ? -25.767 3.104   -64.280  1.00 153.03 ? 332  THR C CA    1 
ATOM   5856  C  C     . THR C 2  332  ? -26.177 4.554   -64.063  1.00 138.11 ? 332  THR C C     1 
ATOM   5857  O  O     . THR C 2  332  ? -27.361 4.897   -64.110  1.00 137.84 ? 332  THR C O     1 
ATOM   5858  C  CB    . THR C 2  332  ? -25.391 2.890   -65.751  1.00 157.52 ? 332  THR C CB    1 
ATOM   5859  O  OG1   . THR C 2  332  ? -25.384 1.488   -66.046  1.00 158.78 ? 332  THR C OG1   1 
ATOM   5860  C  CG2   . THR C 2  332  ? -24.016 3.455   -66.037  1.00 140.56 ? 332  THR C CG2   1 
ATOM   5861  N  N     . LEU C 2  333  ? -25.178 5.399   -63.823  1.00 137.27 ? 333  LEU C N     1 
ATOM   5862  C  CA    . LEU C 2  333  ? -25.380 6.839   -63.839  1.00 137.75 ? 333  LEU C CA    1 
ATOM   5863  C  C     . LEU C 2  333  ? -25.614 7.316   -65.268  1.00 151.03 ? 333  LEU C C     1 
ATOM   5864  O  O     . LEU C 2  333  ? -25.056 6.774   -66.226  1.00 142.43 ? 333  LEU C O     1 
ATOM   5865  C  CB    . LEU C 2  333  ? -24.168 7.549   -63.236  1.00 145.36 ? 333  LEU C CB    1 
ATOM   5866  C  CG    . LEU C 2  333  ? -24.150 9.077   -63.181  1.00 148.02 ? 333  LEU C CG    1 
ATOM   5867  C  CD1   . LEU C 2  333  ? -25.176 9.592   -62.187  1.00 138.49 ? 333  LEU C CD1   1 
ATOM   5868  C  CD2   . LEU C 2  333  ? -22.757 9.574   -62.830  1.00 123.00 ? 333  LEU C CD2   1 
ATOM   5869  N  N     . THR C 2  334  ? -26.456 8.334   -65.409  1.00 161.26 ? 334  THR C N     1 
ATOM   5870  C  CA    . THR C 2  334  ? -26.779 8.899   -66.710  1.00 160.76 ? 334  THR C CA    1 
ATOM   5871  C  C     . THR C 2  334  ? -26.403 10.375  -66.745  1.00 152.69 ? 334  THR C C     1 
ATOM   5872  O  O     . THR C 2  334  ? -26.201 11.012  -65.707  1.00 147.28 ? 334  THR C O     1 
ATOM   5873  C  CB    . THR C 2  334  ? -28.269 8.734   -67.037  1.00 160.10 ? 334  THR C CB    1 
ATOM   5874  O  OG1   . THR C 2  334  ? -29.051 9.511   -66.122  1.00 152.19 ? 334  THR C OG1   1 
ATOM   5875  C  CG2   . THR C 2  334  ? -28.680 7.273   -66.929  1.00 151.24 ? 334  THR C CG2   1 
ATOM   5876  N  N     . GLU C 2  335  ? -26.311 10.916  -67.964  1.00 154.08 ? 335  GLU C N     1 
ATOM   5877  C  CA    . GLU C 2  335  ? -25.996 12.333  -68.125  1.00 155.94 ? 335  GLU C CA    1 
ATOM   5878  C  C     . GLU C 2  335  ? -27.094 13.225  -67.560  1.00 151.36 ? 335  GLU C C     1 
ATOM   5879  O  O     . GLU C 2  335  ? -26.805 14.309  -67.042  1.00 139.80 ? 335  GLU C O     1 
ATOM   5880  C  CB    . GLU C 2  335  ? -25.773 12.660  -69.601  1.00 155.49 ? 335  GLU C CB    1 
ATOM   5881  C  CG    . GLU C 2  335  ? -24.847 11.700  -70.324  1.00 152.08 ? 335  GLU C CG    1 
ATOM   5882  C  CD    . GLU C 2  335  ? -24.585 12.117  -71.757  1.00 169.17 ? 335  GLU C CD    1 
ATOM   5883  O  OE1   . GLU C 2  335  ? -24.197 13.284  -71.980  1.00 172.56 ? 335  GLU C OE1   1 
ATOM   5884  O  OE2   . GLU C 2  335  ? -24.771 11.276  -72.661  1.00 178.21 ? 335  GLU C OE2   1 
ATOM   5885  N  N     . GLU C 2  336  ? -28.353 12.790  -67.659  1.00 146.97 ? 336  GLU C N     1 
ATOM   5886  C  CA    . GLU C 2  336  ? -29.464 13.564  -67.112  1.00 138.67 ? 336  GLU C CA    1 
ATOM   5887  C  C     . GLU C 2  336  ? -29.302 13.786  -65.613  1.00 147.44 ? 336  GLU C C     1 
ATOM   5888  O  O     . GLU C 2  336  ? -29.631 14.860  -65.096  1.00 143.90 ? 336  GLU C O     1 
ATOM   5889  C  CB    . GLU C 2  336  ? -30.783 12.850  -67.410  1.00 141.48 ? 336  GLU C CB    1 
ATOM   5890  C  CG    . GLU C 2  336  ? -31.974 13.337  -66.600  1.00 175.72 ? 336  GLU C CG    1 
ATOM   5891  C  CD    . GLU C 2  336  ? -32.983 12.234  -66.341  1.00 180.20 ? 336  GLU C CD    1 
ATOM   5892  O  OE1   . GLU C 2  336  ? -33.837 12.405  -65.445  1.00 180.36 ? 336  GLU C OE1   1 
ATOM   5893  O  OE2   . GLU C 2  336  ? -32.915 11.191  -67.026  1.00 181.68 ? 336  GLU C OE2   1 
ATOM   5894  N  N     . ASP C 2  337  ? -28.793 12.778  -64.899  1.00 156.51 ? 337  ASP C N     1 
ATOM   5895  C  CA    . ASP C 2  337  ? -28.615 12.906  -63.456  1.00 155.78 ? 337  ASP C CA    1 
ATOM   5896  C  C     . ASP C 2  337  ? -27.570 13.962  -63.115  1.00 144.21 ? 337  ASP C C     1 
ATOM   5897  O  O     . ASP C 2  337  ? -27.739 14.720  -62.152  1.00 142.11 ? 337  ASP C O     1 
ATOM   5898  C  CB    . ASP C 2  337  ? -28.220 11.558  -62.856  1.00 163.69 ? 337  ASP C CB    1 
ATOM   5899  C  CG    . ASP C 2  337  ? -29.179 10.449  -63.233  1.00 168.24 ? 337  ASP C CG    1 
ATOM   5900  O  OD1   . ASP C 2  337  ? -30.401 10.703  -63.268  1.00 181.25 ? 337  ASP C OD1   1 
ATOM   5901  O  OD2   . ASP C 2  337  ? -28.708 9.322   -63.498  1.00 145.56 ? 337  ASP C OD2   1 
ATOM   5902  N  N     . VAL C 2  338  ? -26.483 14.021  -63.889  1.00 134.67 ? 338  VAL C N     1 
ATOM   5903  C  CA    . VAL C 2  338  ? -25.416 14.980  -63.611  1.00 127.01 ? 338  VAL C CA    1 
ATOM   5904  C  C     . VAL C 2  338  ? -25.945 16.406  -63.692  1.00 128.53 ? 338  VAL C C     1 
ATOM   5905  O  O     . VAL C 2  338  ? -25.613 17.255  -62.857  1.00 115.66 ? 338  VAL C O     1 
ATOM   5906  C  CB    . VAL C 2  338  ? -24.234 14.758  -64.573  1.00 109.42 ? 338  VAL C CB    1 
ATOM   5907  C  CG1   . VAL C 2  338  ? -23.079 15.686  -64.224  1.00 103.35 ? 338  VAL C CG1   1 
ATOM   5908  C  CG2   . VAL C 2  338  ? -23.788 13.305  -64.539  1.00 109.10 ? 338  VAL C CG2   1 
ATOM   5909  N  N     . VAL C 2  339  ? -26.782 16.689  -64.692  1.00 129.24 ? 339  VAL C N     1 
ATOM   5910  C  CA    . VAL C 2  339  ? -27.363 18.022  -64.820  1.00 125.82 ? 339  VAL C CA    1 
ATOM   5911  C  C     . VAL C 2  339  ? -28.331 18.293  -63.674  1.00 131.03 ? 339  VAL C C     1 
ATOM   5912  O  O     . VAL C 2  339  ? -28.290 19.358  -63.046  1.00 128.07 ? 339  VAL C O     1 
ATOM   5913  C  CB    . VAL C 2  339  ? -28.052 18.179  -66.188  1.00 141.25 ? 339  VAL C CB    1 
ATOM   5914  C  CG1   . VAL C 2  339  ? -28.624 19.580  -66.334  1.00 158.19 ? 339  VAL C CG1   1 
ATOM   5915  C  CG2   . VAL C 2  339  ? -27.076 17.875  -67.314  1.00 148.24 ? 339  VAL C CG2   1 
ATOM   5916  N  N     . ALA C 2  340  ? -29.215 17.333  -63.385  1.00 131.45 ? 340  ALA C N     1 
ATOM   5917  C  CA    . ALA C 2  340  ? -30.176 17.512  -62.301  1.00 136.72 ? 340  ALA C CA    1 
ATOM   5918  C  C     . ALA C 2  340  ? -29.484 17.670  -60.955  1.00 129.69 ? 340  ALA C C     1 
ATOM   5919  O  O     . ALA C 2  340  ? -30.021 18.323  -60.053  1.00 120.72 ? 340  ALA C O     1 
ATOM   5920  C  CB    . ALA C 2  340  ? -31.151 16.335  -62.260  1.00 124.27 ? 340  ALA C CB    1 
ATOM   5921  N  N     . THR C 2  341  ? -28.297 17.081  -60.799  1.00 136.99 ? 341  THR C N     1 
ATOM   5922  C  CA    . THR C 2  341  ? -27.538 17.262  -59.566  1.00 141.39 ? 341  THR C CA    1 
ATOM   5923  C  C     . THR C 2  341  ? -27.018 18.690  -59.452  1.00 143.95 ? 341  THR C C     1 
ATOM   5924  O  O     . THR C 2  341  ? -27.162 19.332  -58.404  1.00 149.56 ? 341  THR C O     1 
ATOM   5925  C  CB    . THR C 2  341  ? -26.385 16.261  -59.507  1.00 120.63 ? 341  THR C CB    1 
ATOM   5926  O  OG1   . THR C 2  341  ? -26.909 14.935  -59.357  1.00 116.20 ? 341  THR C OG1   1 
ATOM   5927  C  CG2   . THR C 2  341  ? -25.469 16.575  -58.337  1.00 119.92 ? 341  THR C CG2   1 
ATOM   5928  N  N     . ILE C 2  342  ? -26.407 19.204  -60.523  1.00 123.45 ? 342  ILE C N     1 
ATOM   5929  C  CA    . ILE C 2  342  ? -25.949 20.590  -60.526  1.00 108.42 ? 342  ILE C CA    1 
ATOM   5930  C  C     . ILE C 2  342  ? -27.131 21.541  -60.403  1.00 116.80 ? 342  ILE C C     1 
ATOM   5931  O  O     . ILE C 2  342  ? -27.020 22.608  -59.786  1.00 117.79 ? 342  ILE C O     1 
ATOM   5932  C  CB    . ILE C 2  342  ? -25.118 20.878  -61.792  1.00 101.95 ? 342  ILE C CB    1 
ATOM   5933  C  CG1   . ILE C 2  342  ? -24.020 19.827  -61.963  1.00 107.72 ? 342  ILE C CG1   1 
ATOM   5934  C  CG2   . ILE C 2  342  ? -24.499 22.265  -61.722  1.00 116.25 ? 342  ILE C CG2   1 
ATOM   5935  C  CD1   . ILE C 2  342  ? -23.252 19.957  -63.261  1.00 134.21 ? 342  ILE C CD1   1 
ATOM   5936  N  N     . GLU C 2  343  ? -28.279 21.174  -60.979  1.00 129.86 ? 343  GLU C N     1 
ATOM   5937  C  CA    . GLU C 2  343  ? -29.485 21.975  -60.800  1.00 148.28 ? 343  GLU C CA    1 
ATOM   5938  C  C     . GLU C 2  343  ? -29.959 21.936  -59.351  1.00 140.04 ? 343  GLU C C     1 
ATOM   5939  O  O     . GLU C 2  343  ? -30.402 22.955  -58.808  1.00 135.35 ? 343  GLU C O     1 
ATOM   5940  C  CB    . GLU C 2  343  ? -30.585 21.481  -61.740  1.00 152.53 ? 343  GLU C CB    1 
ATOM   5941  C  CG    . GLU C 2  343  ? -31.864 22.302  -61.695  1.00 160.80 ? 343  GLU C CG    1 
ATOM   5942  C  CD    . GLU C 2  343  ? -32.945 21.747  -62.601  1.00 152.57 ? 343  GLU C CD    1 
ATOM   5943  O  OE1   . GLU C 2  343  ? -32.817 20.584  -63.038  1.00 157.34 ? 343  GLU C OE1   1 
ATOM   5944  O  OE2   . GLU C 2  343  ? -33.921 22.474  -62.879  1.00 139.74 ? 343  GLU C OE2   1 
ATOM   5945  N  N     . TYR C 2  344  ? -29.868 20.768  -58.712  1.00 121.30 ? 344  TYR C N     1 
ATOM   5946  C  CA    . TYR C 2  344  ? -30.262 20.645  -57.311  1.00 118.03 ? 344  TYR C CA    1 
ATOM   5947  C  C     . TYR C 2  344  ? -29.365 21.487  -56.411  1.00 140.36 ? 344  TYR C C     1 
ATOM   5948  O  O     . TYR C 2  344  ? -29.837 22.095  -55.443  1.00 161.45 ? 344  TYR C O     1 
ATOM   5949  C  CB    . TYR C 2  344  ? -30.211 19.174  -56.894  1.00 125.62 ? 344  TYR C CB    1 
ATOM   5950  C  CG    . TYR C 2  344  ? -31.040 18.808  -55.681  1.00 136.23 ? 344  TYR C CG    1 
ATOM   5951  C  CD1   . TYR C 2  344  ? -32.174 18.018  -55.809  1.00 140.33 ? 344  TYR C CD1   1 
ATOM   5952  C  CD2   . TYR C 2  344  ? -30.684 19.238  -54.409  1.00 134.06 ? 344  TYR C CD2   1 
ATOM   5953  C  CE1   . TYR C 2  344  ? -32.931 17.671  -54.709  1.00 135.21 ? 344  TYR C CE1   1 
ATOM   5954  C  CE2   . TYR C 2  344  ? -31.434 18.893  -53.302  1.00 124.22 ? 344  TYR C CE2   1 
ATOM   5955  C  CZ    . TYR C 2  344  ? -32.558 18.111  -53.459  1.00 126.55 ? 344  TYR C CZ    1 
ATOM   5956  O  OH    . TYR C 2  344  ? -33.311 17.766  -52.362  1.00 128.43 ? 344  TYR C OH    1 
ATOM   5957  N  N     . LEU C 2  345  ? -28.069 21.541  -56.721  1.00 136.32 ? 345  LEU C N     1 
ATOM   5958  C  CA    . LEU C 2  345  ? -27.117 22.233  -55.857  1.00 140.87 ? 345  LEU C CA    1 
ATOM   5959  C  C     . LEU C 2  345  ? -27.306 23.745  -55.910  1.00 140.09 ? 345  LEU C C     1 
ATOM   5960  O  O     . LEU C 2  345  ? -27.393 24.405  -54.868  1.00 118.99 ? 345  LEU C O     1 
ATOM   5961  C  CB    . LEU C 2  345  ? -25.689 21.856  -56.252  1.00 123.28 ? 345  LEU C CB    1 
ATOM   5962  C  CG    . LEU C 2  345  ? -24.558 22.741  -55.721  1.00 127.43 ? 345  LEU C CG    1 
ATOM   5963  C  CD1   . LEU C 2  345  ? -24.525 22.751  -54.198  1.00 136.63 ? 345  LEU C CD1   1 
ATOM   5964  C  CD2   . LEU C 2  345  ? -23.222 22.288  -56.289  1.00 118.87 ? 345  LEU C CD2   1 
ATOM   5965  N  N     . VAL C 2  346  ? -27.367 24.312  -57.118  1.00 139.43 ? 346  VAL C N     1 
ATOM   5966  C  CA    . VAL C 2  346  ? -27.377 25.766  -57.264  1.00 141.09 ? 346  VAL C CA    1 
ATOM   5967  C  C     . VAL C 2  346  ? -28.617 26.380  -56.626  1.00 155.81 ? 346  VAL C C     1 
ATOM   5968  O  O     . VAL C 2  346  ? -28.560 27.491  -56.084  1.00 174.66 ? 346  VAL C O     1 
ATOM   5969  C  CB    . VAL C 2  346  ? -27.250 26.149  -58.754  1.00 143.48 ? 346  VAL C CB    1 
ATOM   5970  C  CG1   . VAL C 2  346  ? -28.394 25.559  -59.567  1.00 144.96 ? 346  VAL C CG1   1 
ATOM   5971  C  CG2   . VAL C 2  346  ? -27.197 27.657  -58.916  1.00 172.04 ? 346  VAL C CG2   1 
ATOM   5972  N  N     . ARG C 2  347  ? -29.748 25.671  -56.661  1.00 147.90 ? 347  ARG C N     1 
ATOM   5973  C  CA    . ARG C 2  347  ? -30.963 26.202  -56.051  1.00 153.88 ? 347  ARG C CA    1 
ATOM   5974  C  C     . ARG C 2  347  ? -30.849 26.235  -54.532  1.00 149.00 ? 347  ARG C C     1 
ATOM   5975  O  O     . ARG C 2  347  ? -31.299 27.192  -53.891  1.00 155.17 ? 347  ARG C O     1 
ATOM   5976  C  CB    . ARG C 2  347  ? -32.173 25.376  -56.484  1.00 143.32 ? 347  ARG C CB    1 
ATOM   5977  C  CG    . ARG C 2  347  ? -32.406 25.358  -57.986  1.00 161.19 ? 347  ARG C CG    1 
ATOM   5978  C  CD    . ARG C 2  347  ? -33.738 24.712  -58.320  1.00 173.81 ? 347  ARG C CD    1 
ATOM   5979  N  NE    . ARG C 2  347  ? -33.899 24.473  -59.751  1.00 168.50 ? 347  ARG C NE    1 
ATOM   5980  C  CZ    . ARG C 2  347  ? -34.484 25.320  -60.591  1.00 161.72 ? 347  ARG C CZ    1 
ATOM   5981  N  NH1   . ARG C 2  347  ? -34.966 26.472  -60.144  1.00 172.01 ? 347  ARG C NH1   1 
ATOM   5982  N  NH2   . ARG C 2  347  ? -34.585 25.018  -61.878  1.00 151.12 ? 347  ARG C NH2   1 
ATOM   5983  N  N     . LEU C 2  348  ? -30.240 25.205  -53.939  1.00 133.13 ? 348  LEU C N     1 
ATOM   5984  C  CA    . LEU C 2  348  ? -30.073 25.177  -52.489  1.00 157.57 ? 348  LEU C CA    1 
ATOM   5985  C  C     . LEU C 2  348  ? -29.179 26.310  -52.004  1.00 164.70 ? 348  LEU C C     1 
ATOM   5986  O  O     . LEU C 2  348  ? -29.353 26.802  -50.882  1.00 164.35 ? 348  LEU C O     1 
ATOM   5987  C  CB    . LEU C 2  348  ? -29.498 23.827  -52.056  1.00 149.75 ? 348  LEU C CB    1 
ATOM   5988  C  CG    . LEU C 2  348  ? -29.300 23.602  -50.556  1.00 154.96 ? 348  LEU C CG    1 
ATOM   5989  C  CD1   . LEU C 2  348  ? -30.602 23.829  -49.805  1.00 139.12 ? 348  LEU C CD1   1 
ATOM   5990  C  CD2   . LEU C 2  348  ? -28.757 22.207  -50.284  1.00 150.82 ? 348  LEU C CD2   1 
ATOM   5991  N  N     . HIS C 2  349  ? -28.229 26.744  -52.836  1.00 154.74 ? 349  HIS C N     1 
ATOM   5992  C  CA    . HIS C 2  349  ? -27.287 27.777  -52.419  1.00 156.32 ? 349  HIS C CA    1 
ATOM   5993  C  C     . HIS C 2  349  ? -27.990 29.103  -52.155  1.00 152.09 ? 349  HIS C C     1 
ATOM   5994  O  O     . HIS C 2  349  ? -27.627 29.831  -51.224  1.00 136.86 ? 349  HIS C O     1 
ATOM   5995  C  CB    . HIS C 2  349  ? -26.203 27.951  -53.483  1.00 151.30 ? 349  HIS C CB    1 
ATOM   5996  C  CG    . HIS C 2  349  ? -25.138 28.932  -53.105  1.00 160.19 ? 349  HIS C CG    1 
ATOM   5997  N  ND1   . HIS C 2  349  ? -24.171 28.653  -52.163  1.00 150.04 ? 349  HIS C ND1   1 
ATOM   5998  C  CD2   . HIS C 2  349  ? -24.888 30.189  -53.540  1.00 168.45 ? 349  HIS C CD2   1 
ATOM   5999  C  CE1   . HIS C 2  349  ? -23.371 29.696  -52.035  1.00 140.77 ? 349  HIS C CE1   1 
ATOM   6000  N  NE2   . HIS C 2  349  ? -23.784 30.642  -52.860  1.00 151.91 ? 349  HIS C NE2   1 
ATOM   6001  N  N     . GLU C 2  350  ? -28.999 29.437  -52.962  1.00 154.45 ? 350  GLU C N     1 
ATOM   6002  C  CA    . GLU C 2  350  ? -29.700 30.711  -52.856  1.00 162.85 ? 350  GLU C CA    1 
ATOM   6003  C  C     . GLU C 2  350  ? -31.036 30.591  -52.128  1.00 153.32 ? 350  GLU C C     1 
ATOM   6004  O  O     . GLU C 2  350  ? -31.987 31.307  -52.455  1.00 170.36 ? 350  GLU C O     1 
ATOM   6005  C  CB    . GLU C 2  350  ? -29.899 31.322  -54.242  1.00 169.18 ? 350  GLU C CB    1 
ATOM   6006  C  CG    . GLU C 2  350  ? -30.546 30.393  -55.253  1.00 175.64 ? 350  GLU C CG    1 
ATOM   6007  C  CD    . GLU C 2  350  ? -30.484 30.944  -56.663  1.00 183.86 ? 350  GLU C CD    1 
ATOM   6008  O  OE1   . GLU C 2  350  ? -29.746 31.927  -56.886  1.00 182.36 ? 350  GLU C OE1   1 
ATOM   6009  O  OE2   . GLU C 2  350  ? -31.173 30.395  -57.548  1.00 179.06 ? 350  GLU C OE2   1 
ATOM   6010  N  N     . GLY C 2  351  ? -31.129 29.699  -51.146  1.00 129.04 ? 351  GLY C N     1 
ATOM   6011  C  CA    . GLY C 2  351  ? -32.284 29.668  -50.271  1.00 123.68 ? 351  GLY C CA    1 
ATOM   6012  C  C     . GLY C 2  351  ? -33.525 29.008  -50.826  1.00 133.84 ? 351  GLY C C     1 
ATOM   6013  O  O     . GLY C 2  351  ? -34.564 29.031  -50.157  1.00 122.43 ? 351  GLY C O     1 
ATOM   6014  N  N     . GLN C 2  352  ? -33.461 28.422  -52.019  1.00 143.82 ? 352  GLN C N     1 
ATOM   6015  C  CA    . GLN C 2  352  ? -34.621 27.730  -52.560  1.00 144.67 ? 352  GLN C CA    1 
ATOM   6016  C  C     . GLN C 2  352  ? -34.906 26.462  -51.764  1.00 150.14 ? 352  GLN C C     1 
ATOM   6017  O  O     . GLN C 2  352  ? -34.010 25.858  -51.169  1.00 163.89 ? 352  GLN C O     1 
ATOM   6018  C  CB    . GLN C 2  352  ? -34.413 27.382  -54.034  1.00 149.20 ? 352  GLN C CB    1 
ATOM   6019  C  CG    . GLN C 2  352  ? -34.434 28.575  -54.974  1.00 167.79 ? 352  GLN C CG    1 
ATOM   6020  C  CD    . GLN C 2  352  ? -34.630 28.164  -56.421  1.00 163.61 ? 352  GLN C CD    1 
ATOM   6021  O  OE1   . GLN C 2  352  ? -35.242 27.134  -56.705  1.00 147.10 ? 352  GLN C OE1   1 
ATOM   6022  N  NE2   . GLN C 2  352  ? -34.109 28.965  -57.343  1.00 170.99 ? 352  GLN C NE2   1 
ATOM   6023  N  N     . THR C 2  353  ? -36.178 26.062  -51.756  1.00 149.25 ? 353  THR C N     1 
ATOM   6024  C  CA    . THR C 2  353  ? -36.611 24.897  -51.002  1.00 159.50 ? 353  THR C CA    1 
ATOM   6025  C  C     . THR C 2  353  ? -37.353 23.867  -51.842  1.00 151.93 ? 353  THR C C     1 
ATOM   6026  O  O     . THR C 2  353  ? -37.761 22.834  -51.299  1.00 147.95 ? 353  THR C O     1 
ATOM   6027  C  CB    . THR C 2  353  ? -37.510 25.318  -49.829  1.00 158.64 ? 353  THR C CB    1 
ATOM   6028  O  OG1   . THR C 2  353  ? -38.696 25.943  -50.336  1.00 145.80 ? 353  THR C OG1   1 
ATOM   6029  C  CG2   . THR C 2  353  ? -36.782 26.293  -48.915  1.00 146.47 ? 353  THR C CG2   1 
ATOM   6030  N  N     . THR C 2  354  ? -37.544 24.108  -53.138  1.00 151.83 ? 354  THR C N     1 
ATOM   6031  C  CA    . THR C 2  354  ? -38.335 23.211  -53.968  1.00 156.90 ? 354  THR C CA    1 
ATOM   6032  C  C     . THR C 2  354  ? -37.822 23.260  -55.400  1.00 148.71 ? 354  THR C C     1 
ATOM   6033  O  O     . THR C 2  354  ? -37.461 24.330  -55.900  1.00 138.08 ? 354  THR C O     1 
ATOM   6034  C  CB    . THR C 2  354  ? -39.824 23.581  -53.925  1.00 160.79 ? 354  THR C CB    1 
ATOM   6035  O  OG1   . THR C 2  354  ? -40.256 23.691  -52.563  1.00 170.86 ? 354  THR C OG1   1 
ATOM   6036  C  CG2   . THR C 2  354  ? -40.651 22.518  -54.613  1.00 145.33 ? 354  THR C CG2   1 
ATOM   6037  N  N     . MET C 2  355  ? -37.797 22.099  -56.054  1.00 150.59 ? 355  MET C N     1 
ATOM   6038  C  CA    . MET C 2  355  ? -37.301 21.986  -57.419  1.00 142.34 ? 355  MET C CA    1 
ATOM   6039  C  C     . MET C 2  355  ? -37.929 20.778  -58.097  1.00 143.36 ? 355  MET C C     1 
ATOM   6040  O  O     . MET C 2  355  ? -38.113 19.732  -57.470  1.00 138.88 ? 355  MET C O     1 
ATOM   6041  C  CB    . MET C 2  355  ? -35.774 21.852  -57.451  1.00 128.40 ? 355  MET C CB    1 
ATOM   6042  C  CG    . MET C 2  355  ? -35.203 21.547  -58.828  1.00 129.78 ? 355  MET C CG    1 
ATOM   6043  S  SD    . MET C 2  355  ? -33.810 20.407  -58.766  1.00 148.05 ? 355  MET C SD    1 
ATOM   6044  C  CE    . MET C 2  355  ? -34.627 18.926  -58.178  1.00 169.69 ? 355  MET C CE    1 
ATOM   6045  N  N     . THR C 2  356  ? -38.257 20.933  -59.378  1.00 151.39 ? 356  THR C N     1 
ATOM   6046  C  CA    . THR C 2  356  ? -38.671 19.829  -60.233  1.00 149.51 ? 356  THR C CA    1 
ATOM   6047  C  C     . THR C 2  356  ? -37.748 19.774  -61.441  1.00 150.87 ? 356  THR C C     1 
ATOM   6048  O  O     . THR C 2  356  ? -37.584 20.776  -62.146  1.00 145.93 ? 356  THR C O     1 
ATOM   6049  C  CB    . THR C 2  356  ? -40.122 19.978  -60.700  1.00 141.35 ? 356  THR C CB    1 
ATOM   6050  O  OG1   . THR C 2  356  ? -40.159 20.765  -61.897  1.00 161.67 ? 356  THR C OG1   1 
ATOM   6051  C  CG2   . THR C 2  356  ? -40.958 20.663  -59.640  1.00 130.61 ? 356  THR C CG2   1 
ATOM   6052  N  N     . VAL C 2  357  ? -37.146 18.616  -61.670  1.00 153.46 ? 357  VAL C N     1 
ATOM   6053  C  CA    . VAL C 2  357  ? -36.308 18.431  -62.860  1.00 150.50 ? 357  VAL C CA    1 
ATOM   6054  C  C     . VAL C 2  357  ? -37.186 18.515  -64.102  1.00 148.15 ? 357  VAL C C     1 
ATOM   6055  O  O     . VAL C 2  357  ? -38.341 18.050  -64.066  1.00 155.61 ? 357  VAL C O     1 
ATOM   6056  C  CB    . VAL C 2  357  ? -35.577 17.087  -62.786  1.00 153.45 ? 357  VAL C CB    1 
ATOM   6057  C  CG1   . VAL C 2  357  ? -34.653 16.900  -63.980  1.00 149.22 ? 357  VAL C CG1   1 
ATOM   6058  C  CG2   . VAL C 2  357  ? -34.795 16.983  -61.486  1.00 154.75 ? 357  VAL C CG2   1 
ATOM   6059  N  N     . PRO C 2  358  ? -36.716 19.130  -65.204  1.00 135.69 ? 358  PRO C N     1 
ATOM   6060  C  CA    . PRO C 2  358  ? -37.491 19.110  -66.454  1.00 142.53 ? 358  PRO C CA    1 
ATOM   6061  C  C     . PRO C 2  358  ? -37.959 17.713  -66.832  1.00 146.95 ? 358  PRO C C     1 
ATOM   6062  O  O     . PRO C 2  358  ? -37.157 16.858  -67.222  1.00 126.40 ? 358  PRO C O     1 
ATOM   6063  C  CB    . PRO C 2  358  ? -36.501 19.671  -67.480  1.00 138.70 ? 358  PRO C CB    1 
ATOM   6064  C  CG    . PRO C 2  358  ? -35.663 20.614  -66.684  1.00 134.09 ? 358  PRO C CG    1 
ATOM   6065  C  CD    . PRO C 2  358  ? -35.543 20.018  -65.299  1.00 124.23 ? 358  PRO C CD    1 
ATOM   6066  N  N     . GLY C 2  359  ? -39.262 17.476  -66.709  1.00 151.21 ? 359  GLY C N     1 
ATOM   6067  C  CA    . GLY C 2  359  ? -39.802 16.150  -66.928  1.00 148.11 ? 359  GLY C CA    1 
ATOM   6068  C  C     . GLY C 2  359  ? -39.736 15.249  -65.718  1.00 145.85 ? 359  GLY C C     1 
ATOM   6069  O  O     . GLY C 2  359  ? -39.705 14.024  -65.867  1.00 148.08 ? 359  GLY C O     1 
ATOM   6070  N  N     . GLY C 2  360  ? -39.714 15.823  -64.515  1.00 132.73 ? 360  GLY C N     1 
ATOM   6071  C  CA    . GLY C 2  360  ? -39.592 15.036  -63.307  1.00 136.74 ? 360  GLY C CA    1 
ATOM   6072  C  C     . GLY C 2  360  ? -40.526 15.537  -62.224  1.00 149.20 ? 360  GLY C C     1 
ATOM   6073  O  O     . GLY C 2  360  ? -40.980 16.684  -62.238  1.00 154.91 ? 360  GLY C O     1 
ATOM   6074  N  N     . VAL C 2  361  ? -40.798 14.644  -61.269  1.00 145.33 ? 361  VAL C N     1 
ATOM   6075  C  CA    . VAL C 2  361  ? -41.715 14.961  -60.180  1.00 146.66 ? 361  VAL C CA    1 
ATOM   6076  C  C     . VAL C 2  361  ? -41.069 15.961  -59.221  1.00 148.61 ? 361  VAL C C     1 
ATOM   6077  O  O     . VAL C 2  361  ? -39.844 16.118  -59.160  1.00 139.41 ? 361  VAL C O     1 
ATOM   6078  C  CB    . VAL C 2  361  ? -42.141 13.677  -59.448  1.00 154.20 ? 361  VAL C CB    1 
ATOM   6079  C  CG1   . VAL C 2  361  ? -40.999 13.145  -58.596  1.00 159.26 ? 361  VAL C CG1   1 
ATOM   6080  C  CG2   . VAL C 2  361  ? -43.396 13.906  -58.607  1.00 166.19 ? 361  VAL C CG2   1 
ATOM   6081  N  N     . GLU C 2  362  ? -41.919 16.652  -58.466  1.00 154.31 ? 362  GLU C N     1 
ATOM   6082  C  CA    . GLU C 2  362  ? -41.453 17.639  -57.504  1.00 153.88 ? 362  GLU C CA    1 
ATOM   6083  C  C     . GLU C 2  362  ? -40.757 16.958  -56.331  1.00 170.10 ? 362  GLU C C     1 
ATOM   6084  O  O     . GLU C 2  362  ? -41.163 15.880  -55.888  1.00 177.37 ? 362  GLU C O     1 
ATOM   6085  C  CB    . GLU C 2  362  ? -42.633 18.476  -57.010  1.00 142.22 ? 362  GLU C CB    1 
ATOM   6086  C  CG    . GLU C 2  362  ? -42.267 19.842  -56.461  1.00 141.94 ? 362  GLU C CG    1 
ATOM   6087  C  CD    . GLU C 2  362  ? -43.251 20.913  -56.895  1.00 164.58 ? 362  GLU C CD    1 
ATOM   6088  O  OE1   . GLU C 2  362  ? -44.306 20.555  -57.460  1.00 163.97 ? 362  GLU C OE1   1 
ATOM   6089  O  OE2   . GLU C 2  362  ? -42.971 22.110  -56.684  1.00 181.97 ? 362  GLU C OE2   1 
ATOM   6090  N  N     . VAL C 2  363  ? -39.699 17.591  -55.831  1.00 170.12 ? 363  VAL C N     1 
ATOM   6091  C  CA    . VAL C 2  363  ? -38.934 17.065  -54.702  1.00 164.07 ? 363  VAL C CA    1 
ATOM   6092  C  C     . VAL C 2  363  ? -38.349 18.221  -53.899  1.00 148.61 ? 363  VAL C C     1 
ATOM   6093  O  O     . VAL C 2  363  ? -37.964 19.246  -54.480  1.00 153.59 ? 363  VAL C O     1 
ATOM   6094  C  CB    . VAL C 2  363  ? -37.822 16.113  -55.171  1.00 161.53 ? 363  VAL C CB    1 
ATOM   6095  C  CG1   . VAL C 2  363  ? -38.321 14.677  -55.182  1.00 152.57 ? 363  VAL C CG1   1 
ATOM   6096  C  CG2   . VAL C 2  363  ? -37.320 16.525  -56.545  1.00 160.97 ? 363  VAL C CG2   1 
ATOM   6097  N  N     . PRO C 2  364  ? -38.257 18.103  -52.576  1.00 157.26 ? 364  PRO C N     1 
ATOM   6098  C  CA    . PRO C 2  364  ? -37.690 19.193  -51.776  1.00 159.04 ? 364  PRO C CA    1 
ATOM   6099  C  C     . PRO C 2  364  ? -36.180 19.284  -51.938  1.00 152.30 ? 364  PRO C C     1 
ATOM   6100  O  O     . PRO C 2  364  ? -35.502 18.324  -52.312  1.00 138.27 ? 364  PRO C O     1 
ATOM   6101  C  CB    . PRO C 2  364  ? -38.071 18.815  -50.342  1.00 138.05 ? 364  PRO C CB    1 
ATOM   6102  C  CG    . PRO C 2  364  ? -38.180 17.327  -50.374  1.00 161.46 ? 364  PRO C CG    1 
ATOM   6103  C  CD    . PRO C 2  364  ? -38.718 16.983  -51.738  1.00 175.27 ? 364  PRO C CD    1 
ATOM   6104  N  N     . VAL C 2  365  ? -35.658 20.469  -51.639  1.00 152.16 ? 365  VAL C N     1 
ATOM   6105  C  CA    . VAL C 2  365  ? -34.238 20.773  -51.767  1.00 142.40 ? 365  VAL C CA    1 
ATOM   6106  C  C     . VAL C 2  365  ? -33.690 21.013  -50.367  1.00 145.76 ? 365  VAL C C     1 
ATOM   6107  O  O     . VAL C 2  365  ? -33.992 22.036  -49.739  1.00 149.08 ? 365  VAL C O     1 
ATOM   6108  C  CB    . VAL C 2  365  ? -33.997 21.985  -52.677  1.00 147.33 ? 365  VAL C CB    1 
ATOM   6109  C  CG1   . VAL C 2  365  ? -32.514 22.187  -52.910  1.00 145.52 ? 365  VAL C CG1   1 
ATOM   6110  C  CG2   . VAL C 2  365  ? -34.728 21.805  -53.997  1.00 152.73 ? 365  VAL C CG2   1 
ATOM   6111  N  N     . GLU C 2  366  ? -32.879 20.080  -49.877  1.00 143.32 ? 366  GLU C N     1 
ATOM   6112  C  CA    . GLU C 2  366  ? -32.353 20.154  -48.520  1.00 144.65 ? 366  GLU C CA    1 
ATOM   6113  C  C     . GLU C 2  366  ? -31.067 19.340  -48.444  1.00 137.49 ? 366  GLU C C     1 
ATOM   6114  O  O     . GLU C 2  366  ? -30.665 18.680  -49.407  1.00 137.24 ? 366  GLU C O     1 
ATOM   6115  C  CB    . GLU C 2  366  ? -33.387 19.660  -47.505  1.00 152.25 ? 366  GLU C CB    1 
ATOM   6116  C  CG    . GLU C 2  366  ? -33.944 18.280  -47.821  1.00 150.49 ? 366  GLU C CG    1 
ATOM   6117  C  CD    . GLU C 2  366  ? -35.012 17.843  -46.840  1.00 146.08 ? 366  GLU C CD    1 
ATOM   6118  O  OE1   . GLU C 2  366  ? -35.054 18.394  -45.720  1.00 118.61 ? 366  GLU C OE1   1 
ATOM   6119  O  OE2   . GLU C 2  366  ? -35.813 16.951  -47.191  1.00 141.18 ? 366  GLU C OE2   1 
ATOM   6120  N  N     . THR C 2  367  ? -30.424 19.391  -47.280  1.00 125.16 ? 367  THR C N     1 
ATOM   6121  C  CA    . THR C 2  367  ? -29.213 18.633  -47.010  1.00 122.86 ? 367  THR C CA    1 
ATOM   6122  C  C     . THR C 2  367  ? -29.556 17.344  -46.272  1.00 135.46 ? 367  THR C C     1 
ATOM   6123  O  O     . THR C 2  367  ? -30.566 17.258  -45.570  1.00 135.83 ? 367  THR C O     1 
ATOM   6124  C  CB    . THR C 2  367  ? -28.217 19.461  -46.193  1.00 107.83 ? 367  THR C CB    1 
ATOM   6125  O  OG1   . THR C 2  367  ? -28.853 19.946  -45.003  1.00 100.39 ? 367  THR C OG1   1 
ATOM   6126  C  CG2   . THR C 2  367  ? -27.713 20.640  -47.011  1.00 111.02 ? 367  THR C CG2   1 
ATOM   6127  N  N     . ASP C 2  368  ? -28.702 16.340  -46.443  1.00 133.72 ? 368  ASP C N     1 
ATOM   6128  C  CA    . ASP C 2  368  ? -28.949 15.001  -45.933  1.00 128.83 ? 368  ASP C CA    1 
ATOM   6129  C  C     . ASP C 2  368  ? -28.147 14.756  -44.660  1.00 141.64 ? 368  ASP C C     1 
ATOM   6130  O  O     . ASP C 2  368  ? -27.068 15.320  -44.464  1.00 136.54 ? 368  ASP C O     1 
ATOM   6131  C  CB    . ASP C 2  368  ? -28.599 13.953  -46.992  1.00 129.14 ? 368  ASP C CB    1 
ATOM   6132  C  CG    . ASP C 2  368  ? -29.105 14.334  -48.373  1.00 130.68 ? 368  ASP C CG    1 
ATOM   6133  O  OD1   . ASP C 2  368  ? -28.744 15.429  -48.854  1.00 107.19 ? 368  ASP C OD1   1 
ATOM   6134  O  OD2   . ASP C 2  368  ? -29.859 13.544  -48.979  1.00 148.75 ? 368  ASP C OD2   1 
ATOM   6135  N  N     . ASP C 2  369  ? -28.690 13.898  -43.793  1.00 140.84 ? 369  ASP C N     1 
ATOM   6136  C  CA    . ASP C 2  369  ? -28.081 13.679  -42.484  1.00 131.18 ? 369  ASP C CA    1 
ATOM   6137  C  C     . ASP C 2  369  ? -26.825 12.821  -42.587  1.00 118.56 ? 369  ASP C C     1 
ATOM   6138  O  O     . ASP C 2  369  ? -25.816 13.119  -41.939  1.00 127.09 ? 369  ASP C O     1 
ATOM   6139  C  CB    . ASP C 2  369  ? -29.091 13.027  -41.540  1.00 111.54 ? 369  ASP C CB    1 
ATOM   6140  C  CG    . ASP C 2  369  ? -28.739 13.226  -40.076  1.00 116.37 ? 369  ASP C CG    1 
ATOM   6141  O  OD1   . ASP C 2  369  ? -29.637 13.614  -39.300  1.00 120.30 ? 369  ASP C OD1   1 
ATOM   6142  O  OD2   . ASP C 2  369  ? -27.567 13.011  -39.703  1.00 119.35 ? 369  ASP C OD2   1 
ATOM   6143  N  N     . ILE C 2  370  ? -26.890 11.740  -43.373  1.00 95.37  ? 370  ILE C N     1 
ATOM   6144  C  CA    . ILE C 2  370  ? -25.845 10.728  -43.560  1.00 107.32 ? 370  ILE C CA    1 
ATOM   6145  C  C     . ILE C 2  370  ? -25.711 9.851   -42.318  1.00 113.45 ? 370  ILE C C     1 
ATOM   6146  O  O     . ILE C 2  370  ? -25.126 8.763   -42.376  1.00 116.02 ? 370  ILE C O     1 
ATOM   6147  C  CB    . ILE C 2  370  ? -24.491 11.349  -43.965  1.00 96.99  ? 370  ILE C CB    1 
ATOM   6148  C  CG1   . ILE C 2  370  ? -23.869 10.527  -45.090  1.00 112.78 ? 370  ILE C CG1   1 
ATOM   6149  C  CG2   . ILE C 2  370  ? -23.514 11.392  -42.793  1.00 100.82 ? 370  ILE C CG2   1 
ATOM   6150  C  CD1   . ILE C 2  370  ? -24.857 10.108  -46.157  1.00 123.99 ? 370  ILE C CD1   1 
ATOM   6151  N  N     . ASP C 2  371  ? -26.264 10.303  -41.193  1.00 118.11 ? 371  ASP C N     1 
ATOM   6152  C  CA    . ASP C 2  371  ? -26.431 9.449   -40.025  1.00 102.32 ? 371  ASP C CA    1 
ATOM   6153  C  C     . ASP C 2  371  ? -27.820 8.834   -39.942  1.00 102.99 ? 371  ASP C C     1 
ATOM   6154  O  O     . ASP C 2  371  ? -28.002 7.846   -39.221  1.00 106.32 ? 371  ASP C O     1 
ATOM   6155  C  CB    . ASP C 2  371  ? -26.148 10.235  -38.739  1.00 129.60 ? 371  ASP C CB    1 
ATOM   6156  C  CG    . ASP C 2  371  ? -24.676 10.549  -38.561  1.00 133.10 ? 371  ASP C CG    1 
ATOM   6157  O  OD1   . ASP C 2  371  ? -23.862 10.064  -39.375  1.00 114.69 ? 371  ASP C OD1   1 
ATOM   6158  O  OD2   . ASP C 2  371  ? -24.333 11.280  -37.608  1.00 135.45 ? 371  ASP C OD2   1 
ATOM   6159  N  N     . HIS C 2  372  ? -28.792 9.398   -40.657  1.00 101.45 ? 372  HIS C N     1 
ATOM   6160  C  CA    . HIS C 2  372  ? -30.123 8.813   -40.735  1.00 97.45  ? 372  HIS C CA    1 
ATOM   6161  C  C     . HIS C 2  372  ? -30.046 7.414   -41.335  1.00 104.52 ? 372  HIS C C     1 
ATOM   6162  O  O     . HIS C 2  372  ? -29.355 7.186   -42.332  1.00 110.21 ? 372  HIS C O     1 
ATOM   6163  C  CB    . HIS C 2  372  ? -31.032 9.709   -41.579  1.00 94.68  ? 372  HIS C CB    1 
ATOM   6164  C  CG    . HIS C 2  372  ? -32.478 9.322   -41.546  1.00 97.09  ? 372  HIS C CG    1 
ATOM   6165  N  ND1   . HIS C 2  372  ? -32.994 8.305   -42.319  1.00 95.23  ? 372  HIS C ND1   1 
ATOM   6166  C  CD2   . HIS C 2  372  ? -33.521 9.830   -40.848  1.00 93.70  ? 372  HIS C CD2   1 
ATOM   6167  C  CE1   . HIS C 2  372  ? -34.291 8.194   -42.090  1.00 112.23 ? 372  HIS C CE1   1 
ATOM   6168  N  NE2   . HIS C 2  372  ? -34.635 9.109   -41.201  1.00 117.71 ? 372  HIS C NE2   1 
ATOM   6169  N  N     . PHE C 2  373  ? -30.761 6.471   -40.720  1.00 105.93 ? 373  PHE C N     1 
ATOM   6170  C  CA    . PHE C 2  373  ? -30.698 5.072   -41.152  1.00 105.53 ? 373  PHE C CA    1 
ATOM   6171  C  C     . PHE C 2  373  ? -31.335 4.827   -42.519  1.00 111.12 ? 373  PHE C C     1 
ATOM   6172  O  O     . PHE C 2  373  ? -31.433 3.662   -42.930  1.00 101.26 ? 373  PHE C O     1 
ATOM   6173  C  CB    . PHE C 2  373  ? -31.348 4.167   -40.104  1.00 105.92 ? 373  PHE C CB    1 
ATOM   6174  C  CG    . PHE C 2  373  ? -30.361 3.481   -39.201  1.00 100.98 ? 373  PHE C CG    1 
ATOM   6175  C  CD1   . PHE C 2  373  ? -30.769 2.470   -38.346  1.00 87.29  ? 373  PHE C CD1   1 
ATOM   6176  C  CD2   . PHE C 2  373  ? -29.025 3.848   -39.207  1.00 92.25  ? 373  PHE C CD2   1 
ATOM   6177  C  CE1   . PHE C 2  373  ? -29.863 1.835   -37.518  1.00 78.32  ? 373  PHE C CE1   1 
ATOM   6178  C  CE2   . PHE C 2  373  ? -28.114 3.219   -38.380  1.00 80.76  ? 373  PHE C CE2   1 
ATOM   6179  C  CZ    . PHE C 2  373  ? -28.534 2.211   -37.534  1.00 87.19  ? 373  PHE C CZ    1 
ATOM   6180  N  N     . GLY C 2  374  ? -31.782 5.863   -43.222  1.00 117.58 ? 374  GLY C N     1 
ATOM   6181  C  CA    . GLY C 2  374  ? -32.261 5.717   -44.581  1.00 113.23 ? 374  GLY C CA    1 
ATOM   6182  C  C     . GLY C 2  374  ? -31.193 6.135   -45.567  1.00 108.87 ? 374  GLY C C     1 
ATOM   6183  O  O     . GLY C 2  374  ? -31.225 5.755   -46.741  1.00 121.24 ? 374  GLY C O     1 
ATOM   6184  N  N     . ASN C 2  375  ? -30.241 6.937   -45.092  1.00 108.34 ? 375  ASN C N     1 
ATOM   6185  C  CA    . ASN C 2  375  ? -29.052 7.277   -45.858  1.00 108.69 ? 375  ASN C CA    1 
ATOM   6186  C  C     . ASN C 2  375  ? -27.820 6.514   -45.394  1.00 100.01 ? 375  ASN C C     1 
ATOM   6187  O  O     . ASN C 2  375  ? -26.785 6.572   -46.067  1.00 94.78  ? 375  ASN C O     1 
ATOM   6188  C  CB    . ASN C 2  375  ? -28.780 8.784   -45.784  1.00 105.49 ? 375  ASN C CB    1 
ATOM   6189  C  CG    . ASN C 2  375  ? -29.896 9.606   -46.393  1.00 117.44 ? 375  ASN C CG    1 
ATOM   6190  O  OD1   . ASN C 2  375  ? -30.046 9.662   -47.613  1.00 113.90 ? 375  ASN C OD1   1 
ATOM   6191  N  ND2   . ASN C 2  375  ? -30.682 10.257  -45.544  1.00 125.79 ? 375  ASN C ND2   1 
ATOM   6192  N  N     . ARG C 2  376  ? -27.905 5.815   -44.266  1.00 99.76  ? 376  ARG C N     1 
ATOM   6193  C  CA    . ARG C 2  376  ? -26.848 4.936   -43.786  1.00 92.26  ? 376  ARG C CA    1 
ATOM   6194  C  C     . ARG C 2  376  ? -27.301 3.495   -43.979  1.00 91.38  ? 376  ARG C C     1 
ATOM   6195  O  O     . ARG C 2  376  ? -28.377 3.112   -43.508  1.00 83.61  ? 376  ARG C O     1 
ATOM   6196  C  CB    . ARG C 2  376  ? -26.531 5.211   -42.315  1.00 87.85  ? 376  ARG C CB    1 
ATOM   6197  C  CG    . ARG C 2  376  ? -25.326 4.458   -41.778  1.00 92.43  ? 376  ARG C CG    1 
ATOM   6198  C  CD    . ARG C 2  376  ? -24.212 5.416   -41.386  1.00 109.14 ? 376  ARG C CD    1 
ATOM   6199  N  NE    . ARG C 2  376  ? -23.211 4.774   -40.540  1.00 118.53 ? 376  ARG C NE    1 
ATOM   6200  C  CZ    . ARG C 2  376  ? -23.287 4.712   -39.215  1.00 108.96 ? 376  ARG C CZ    1 
ATOM   6201  N  NH1   . ARG C 2  376  ? -24.322 5.253   -38.586  1.00 84.91  ? 376  ARG C NH1   1 
ATOM   6202  N  NH2   . ARG C 2  376  ? -22.333 4.110   -38.518  1.00 92.35  ? 376  ARG C NH2   1 
ATOM   6203  N  N     . ARG C 2  377  ? -26.487 2.705   -44.669  1.00 99.59  ? 377  ARG C N     1 
ATOM   6204  C  CA    . ARG C 2  377  ? -26.891 1.388   -45.133  1.00 89.60  ? 377  ARG C CA    1 
ATOM   6205  C  C     . ARG C 2  377  ? -26.130 0.288   -44.401  1.00 77.19  ? 377  ARG C C     1 
ATOM   6206  O  O     . ARG C 2  377  ? -24.968 0.456   -44.020  1.00 81.18  ? 377  ARG C O     1 
ATOM   6207  C  CB    . ARG C 2  377  ? -26.672 1.263   -46.643  1.00 101.60 ? 377  ARG C CB    1 
ATOM   6208  C  CG    . ARG C 2  377  ? -27.250 0.010   -47.266  1.00 95.25  ? 377  ARG C CG    1 
ATOM   6209  C  CD    . ARG C 2  377  ? -27.121 0.056   -48.774  1.00 91.05  ? 377  ARG C CD    1 
ATOM   6210  N  NE    . ARG C 2  377  ? -27.322 -1.254  -49.381  1.00 108.93 ? 377  ARG C NE    1 
ATOM   6211  C  CZ    . ARG C 2  377  ? -26.350 -2.135  -49.587  1.00 101.58 ? 377  ARG C CZ    1 
ATOM   6212  N  NH1   . ARG C 2  377  ? -25.104 -1.847  -49.233  1.00 77.98  ? 377  ARG C NH1   1 
ATOM   6213  N  NH2   . ARG C 2  377  ? -26.622 -3.304  -50.149  1.00 95.50  ? 377  ARG C NH2   1 
ATOM   6214  N  N     . LEU C 2  378  ? -26.807 -0.843  -44.212  1.00 63.26  ? 378  LEU C N     1 
ATOM   6215  C  CA    . LEU C 2  378  ? -26.243 -2.023  -43.568  1.00 62.90  ? 378  LEU C CA    1 
ATOM   6216  C  C     . LEU C 2  378  ? -26.114 -3.132  -44.603  1.00 63.55  ? 378  LEU C C     1 
ATOM   6217  O  O     . LEU C 2  378  ? -27.121 -3.583  -45.160  1.00 82.18  ? 378  LEU C O     1 
ATOM   6218  C  CB    . LEU C 2  378  ? -27.125 -2.481  -42.406  1.00 65.11  ? 378  LEU C CB    1 
ATOM   6219  C  CG    . LEU C 2  378  ? -26.692 -3.753  -41.673  1.00 63.53  ? 378  LEU C CG    1 
ATOM   6220  C  CD1   . LEU C 2  378  ? -25.523 -3.454  -40.751  1.00 81.13  ? 378  LEU C CD1   1 
ATOM   6221  C  CD2   . LEU C 2  378  ? -27.854 -4.376  -40.907  1.00 50.39  ? 378  LEU C CD2   1 
ATOM   6222  N  N     . ARG C 2  379  ? -24.885 -3.570  -44.861  1.00 53.15  ? 379  ARG C N     1 
ATOM   6223  C  CA    . ARG C 2  379  ? -24.633 -4.695  -45.752  1.00 68.60  ? 379  ARG C CA    1 
ATOM   6224  C  C     . ARG C 2  379  ? -24.186 -5.896  -44.930  1.00 67.75  ? 379  ARG C C     1 
ATOM   6225  O  O     . ARG C 2  379  ? -23.247 -5.798  -44.132  1.00 59.35  ? 379  ARG C O     1 
ATOM   6226  C  CB    . ARG C 2  379  ? -23.600 -4.346  -46.828  1.00 87.28  ? 379  ARG C CB    1 
ATOM   6227  C  CG    . ARG C 2  379  ? -22.279 -3.758  -46.358  1.00 75.81  ? 379  ARG C CG    1 
ATOM   6228  C  CD    . ARG C 2  379  ? -21.377 -3.553  -47.572  1.00 72.99  ? 379  ARG C CD    1 
ATOM   6229  N  NE    . ARG C 2  379  ? -20.103 -2.913  -47.258  1.00 71.52  ? 379  ARG C NE    1 
ATOM   6230  C  CZ    . ARG C 2  379  ? -19.154 -2.676  -48.158  1.00 72.02  ? 379  ARG C CZ    1 
ATOM   6231  N  NH1   . ARG C 2  379  ? -19.339 -3.029  -49.423  1.00 66.84  ? 379  ARG C NH1   1 
ATOM   6232  N  NH2   . ARG C 2  379  ? -18.021 -2.088  -47.796  1.00 81.21  ? 379  ARG C NH2   1 
ATOM   6233  N  N     . THR C 2  380  ? -24.860 -7.022  -45.132  1.00 69.32  ? 380  THR C N     1 
ATOM   6234  C  CA    . THR C 2  380  ? -24.760 -8.184  -44.270  1.00 69.26  ? 380  THR C CA    1 
ATOM   6235  C  C     . THR C 2  380  ? -23.809 -9.222  -44.873  1.00 66.28  ? 380  THR C C     1 
ATOM   6236  O  O     . THR C 2  380  ? -22.987 -8.903  -45.739  1.00 60.59  ? 380  THR C O     1 
ATOM   6237  C  CB    . THR C 2  380  ? -26.165 -8.746  -44.036  1.00 69.77  ? 380  THR C CB    1 
ATOM   6238  O  OG1   . THR C 2  380  ? -26.854 -8.837  -45.289  1.00 67.59  ? 380  THR C OG1   1 
ATOM   6239  C  CG2   . THR C 2  380  ? -26.947 -7.843  -43.100  1.00 72.78  ? 380  THR C CG2   1 
ATOM   6240  N  N     . VAL C 2  381  ? -23.934 -10.475 -44.427  1.00 65.51  ? 381  VAL C N     1 
ATOM   6241  C  CA    . VAL C 2  381  ? -22.971 -11.513 -44.788  1.00 63.45  ? 381  VAL C CA    1 
ATOM   6242  C  C     . VAL C 2  381  ? -22.952 -11.733 -46.296  1.00 71.91  ? 381  VAL C C     1 
ATOM   6243  O  O     . VAL C 2  381  ? -21.887 -11.756 -46.923  1.00 72.82  ? 381  VAL C O     1 
ATOM   6244  C  CB    . VAL C 2  381  ? -23.288 -12.819 -44.038  1.00 49.49  ? 381  VAL C CB    1 
ATOM   6245  C  CG1   . VAL C 2  381  ? -22.165 -13.825 -44.227  1.00 56.13  ? 381  VAL C CG1   1 
ATOM   6246  C  CG2   . VAL C 2  381  ? -23.538 -12.540 -42.564  1.00 59.40  ? 381  VAL C CG2   1 
ATOM   6247  N  N     . GLY C 2  382  ? -24.132 -11.903 -46.897  1.00 68.82  ? 382  GLY C N     1 
ATOM   6248  C  CA    . GLY C 2  382  ? -24.194 -12.252 -48.309  1.00 71.75  ? 382  GLY C CA    1 
ATOM   6249  C  C     . GLY C 2  382  ? -23.533 -11.221 -49.204  1.00 81.24  ? 382  GLY C C     1 
ATOM   6250  O  O     . GLY C 2  382  ? -22.744 -11.563 -50.088  1.00 88.57  ? 382  GLY C O     1 
ATOM   6251  N  N     . GLU C 2  383  ? -23.845 -9.941  -48.986  1.00 79.93  ? 383  GLU C N     1 
ATOM   6252  C  CA    . GLU C 2  383  ? -23.259 -8.892  -49.814  1.00 76.79  ? 383  GLU C CA    1 
ATOM   6253  C  C     . GLU C 2  383  ? -21.752 -8.801  -49.611  1.00 76.89  ? 383  GLU C C     1 
ATOM   6254  O  O     . GLU C 2  383  ? -20.995 -8.672  -50.580  1.00 85.88  ? 383  GLU C O     1 
ATOM   6255  C  CB    . GLU C 2  383  ? -23.921 -7.548  -49.512  1.00 88.59  ? 383  GLU C CB    1 
ATOM   6256  C  CG    . GLU C 2  383  ? -23.287 -6.384  -50.254  1.00 98.68  ? 383  GLU C CG    1 
ATOM   6257  C  CD    . GLU C 2  383  ? -24.071 -5.100  -50.102  1.00 93.81  ? 383  GLU C CD    1 
ATOM   6258  O  OE1   . GLU C 2  383  ? -25.258 -5.171  -49.720  1.00 89.89  ? 383  GLU C OE1   1 
ATOM   6259  O  OE2   . GLU C 2  383  ? -23.500 -4.020  -50.362  1.00 79.66  ? 383  GLU C OE2   1 
ATOM   6260  N  N     . LEU C 2  384  ? -21.298 -8.866  -48.356  1.00 74.97  ? 384  LEU C N     1 
ATOM   6261  C  CA    . LEU C 2  384  ? -19.865 -8.803  -48.083  1.00 76.24  ? 384  LEU C CA    1 
ATOM   6262  C  C     . LEU C 2  384  ? -19.116 -9.957  -48.739  1.00 74.73  ? 384  LEU C C     1 
ATOM   6263  O  O     . LEU C 2  384  ? -17.961 -9.793  -49.148  1.00 84.69  ? 384  LEU C O     1 
ATOM   6264  C  CB    . LEU C 2  384  ? -19.621 -8.791  -46.574  1.00 60.17  ? 384  LEU C CB    1 
ATOM   6265  C  CG    . LEU C 2  384  ? -20.150 -7.558  -45.837  1.00 56.19  ? 384  LEU C CG    1 
ATOM   6266  C  CD1   . LEU C 2  384  ? -20.119 -7.772  -44.331  1.00 69.90  ? 384  LEU C CD1   1 
ATOM   6267  C  CD2   . LEU C 2  384  ? -19.359 -6.318  -46.227  1.00 74.15  ? 384  LEU C CD2   1 
ATOM   6268  N  N     . ILE C 2  385  ? -19.751 -11.124 -48.851  1.00 64.73  ? 385  ILE C N     1 
ATOM   6269  C  CA    . ILE C 2  385  ? -19.135 -12.236 -49.567  1.00 80.34  ? 385  ILE C CA    1 
ATOM   6270  C  C     . ILE C 2  385  ? -19.306 -12.066 -51.071  1.00 85.94  ? 385  ILE C C     1 
ATOM   6271  O  O     . ILE C 2  385  ? -18.394 -12.372 -51.848  1.00 82.29  ? 385  ILE C O     1 
ATOM   6272  C  CB    . ILE C 2  385  ? -19.717 -13.574 -49.076  1.00 63.81  ? 385  ILE C CB    1 
ATOM   6273  C  CG1   . ILE C 2  385  ? -19.451 -13.759 -47.582  1.00 62.52  ? 385  ILE C CG1   1 
ATOM   6274  C  CG2   . ILE C 2  385  ? -19.136 -14.739 -49.870  1.00 65.31  ? 385  ILE C CG2   1 
ATOM   6275  C  CD1   . ILE C 2  385  ? -20.049 -15.026 -47.010  1.00 73.83  ? 385  ILE C CD1   1 
ATOM   6276  N  N     . GLN C 2  386  ? -20.471 -11.573 -51.502  1.00 83.99  ? 386  GLN C N     1 
ATOM   6277  C  CA    . GLN C 2  386  ? -20.720 -11.376 -52.927  1.00 73.10  ? 386  GLN C CA    1 
ATOM   6278  C  C     . GLN C 2  386  ? -19.702 -10.425 -53.543  1.00 73.75  ? 386  GLN C C     1 
ATOM   6279  O  O     . GLN C 2  386  ? -19.202 -10.670 -54.647  1.00 93.95  ? 386  GLN C O     1 
ATOM   6280  C  CB    . GLN C 2  386  ? -22.139 -10.850 -53.145  1.00 77.48  ? 386  GLN C CB    1 
ATOM   6281  C  CG    . GLN C 2  386  ? -22.422 -10.405 -54.571  1.00 80.71  ? 386  GLN C CG    1 
ATOM   6282  C  CD    . GLN C 2  386  ? -23.818 -9.840  -54.746  1.00 91.80  ? 386  GLN C CD    1 
ATOM   6283  O  OE1   . GLN C 2  386  ? -24.750 -10.559 -55.106  1.00 80.68  ? 386  GLN C OE1   1 
ATOM   6284  N  NE2   . GLN C 2  386  ? -23.969 -8.543  -54.497  1.00 93.07  ? 386  GLN C NE2   1 
ATOM   6285  N  N     . ASN C 2  387  ? -19.382 -9.334  -52.843  1.00 73.44  ? 387  ASN C N     1 
ATOM   6286  C  CA    . ASN C 2  387  ? -18.400 -8.389  -53.364  1.00 82.81  ? 387  ASN C CA    1 
ATOM   6287  C  C     . ASN C 2  387  ? -17.032 -9.043  -53.507  1.00 88.08  ? 387  ASN C C     1 
ATOM   6288  O  O     . ASN C 2  387  ? -16.305 -8.774  -54.471  1.00 109.32 ? 387  ASN C O     1 
ATOM   6289  C  CB    . ASN C 2  387  ? -18.319 -7.162  -52.455  1.00 75.66  ? 387  ASN C CB    1 
ATOM   6290  C  CG    . ASN C 2  387  ? -19.672 -6.522  -52.218  1.00 92.62  ? 387  ASN C CG    1 
ATOM   6291  O  OD1   . ASN C 2  387  ? -20.604 -6.701  -53.003  1.00 84.72  ? 387  ASN C OD1   1 
ATOM   6292  N  ND2   . ASN C 2  387  ? -19.788 -5.770  -51.130  1.00 96.34  ? 387  ASN C ND2   1 
ATOM   6293  N  N     . GLN C 2  388  ? -16.665 -9.908  -52.558  1.00 67.15  ? 388  GLN C N     1 
ATOM   6294  C  CA    . GLN C 2  388  ? -15.395 -10.619 -52.656  1.00 77.78  ? 388  GLN C CA    1 
ATOM   6295  C  C     . GLN C 2  388  ? -15.413 -11.625 -53.800  1.00 81.57  ? 388  GLN C C     1 
ATOM   6296  O  O     . GLN C 2  388  ? -14.394 -11.830 -54.471  1.00 96.33  ? 388  GLN C O     1 
ATOM   6297  C  CB    . GLN C 2  388  ? -15.076 -11.311 -51.331  1.00 77.54  ? 388  GLN C CB    1 
ATOM   6298  C  CG    . GLN C 2  388  ? -14.621 -10.357 -50.242  1.00 81.39  ? 388  GLN C CG    1 
ATOM   6299  C  CD    . GLN C 2  388  ? -13.394 -9.564  -50.648  1.00 97.78  ? 388  GLN C CD    1 
ATOM   6300  O  OE1   . GLN C 2  388  ? -12.404 -10.125 -51.118  1.00 94.93  ? 388  GLN C OE1   1 
ATOM   6301  N  NE2   . GLN C 2  388  ? -13.458 -8.248  -50.480  1.00 115.45 ? 388  GLN C NE2   1 
ATOM   6302  N  N     . ILE C 2  389  ? -16.561 -12.263 -54.037  1.00 65.29  ? 389  ILE C N     1 
ATOM   6303  C  CA    . ILE C 2  389  ? -16.688 -13.155 -55.184  1.00 72.98  ? 389  ILE C CA    1 
ATOM   6304  C  C     . ILE C 2  389  ? -16.602 -12.365 -56.483  1.00 81.21  ? 389  ILE C C     1 
ATOM   6305  O  O     . ILE C 2  389  ? -15.950 -12.791 -57.443  1.00 90.74  ? 389  ILE C O     1 
ATOM   6306  C  CB    . ILE C 2  389  ? -18.000 -13.955 -55.095  1.00 77.81  ? 389  ILE C CB    1 
ATOM   6307  C  CG1   . ILE C 2  389  ? -18.018 -14.814 -53.830  1.00 92.86  ? 389  ILE C CG1   1 
ATOM   6308  C  CG2   . ILE C 2  389  ? -18.182 -14.822 -56.330  1.00 78.25  ? 389  ILE C CG2   1 
ATOM   6309  C  CD1   . ILE C 2  389  ? -19.331 -15.525 -53.605  1.00 92.96  ? 389  ILE C CD1   1 
ATOM   6310  N  N     . ARG C 2  390  ? -17.254 -11.200 -56.532  1.00 85.27  ? 390  ARG C N     1 
ATOM   6311  C  CA    . ARG C 2  390  ? -17.211 -10.369 -57.731  1.00 86.63  ? 390  ARG C CA    1 
ATOM   6312  C  C     . ARG C 2  390  ? -15.784 -9.957  -58.070  1.00 96.70  ? 390  ARG C C     1 
ATOM   6313  O  O     . ARG C 2  390  ? -15.379 -9.996  -59.238  1.00 115.21 ? 390  ARG C O     1 
ATOM   6314  C  CB    . ARG C 2  390  ? -18.096 -9.137  -57.545  1.00 99.26  ? 390  ARG C CB    1 
ATOM   6315  C  CG    . ARG C 2  390  ? -17.874 -8.053  -58.584  1.00 106.08 ? 390  ARG C CG    1 
ATOM   6316  C  CD    . ARG C 2  390  ? -18.850 -6.901  -58.409  1.00 107.24 ? 390  ARG C CD    1 
ATOM   6317  N  NE    . ARG C 2  390  ? -20.237 -7.327  -58.574  1.00 128.82 ? 390  ARG C NE    1 
ATOM   6318  C  CZ    . ARG C 2  390  ? -21.132 -7.363  -57.592  1.00 129.34 ? 390  ARG C CZ    1 
ATOM   6319  N  NH1   . ARG C 2  390  ? -20.794 -6.986  -56.367  1.00 118.78 ? 390  ARG C NH1   1 
ATOM   6320  N  NH2   . ARG C 2  390  ? -22.371 -7.767  -57.840  1.00 124.10 ? 390  ARG C NH2   1 
ATOM   6321  N  N     . VAL C 2  391  ? -15.006 -9.561  -57.061  1.00 94.83  ? 391  VAL C N     1 
ATOM   6322  C  CA    . VAL C 2  391  ? -13.614 -9.187  -57.295  1.00 98.30  ? 391  VAL C CA    1 
ATOM   6323  C  C     . VAL C 2  391  ? -12.798 -10.401 -57.723  1.00 92.05  ? 391  VAL C C     1 
ATOM   6324  O  O     . VAL C 2  391  ? -11.943 -10.310 -58.613  1.00 101.41 ? 391  VAL C O     1 
ATOM   6325  C  CB    . VAL C 2  391  ? -13.028 -8.515  -56.039  1.00 86.53  ? 391  VAL C CB    1 
ATOM   6326  C  CG1   . VAL C 2  391  ? -11.520 -8.349  -56.167  1.00 105.75 ? 391  VAL C CG1   1 
ATOM   6327  C  CG2   . VAL C 2  391  ? -13.696 -7.167  -55.802  1.00 107.12 ? 391  VAL C CG2   1 
ATOM   6328  N  N     . GLY C 2  392  ? -13.055 -11.558 -57.109  1.00 97.27  ? 392  GLY C N     1 
ATOM   6329  C  CA    . GLY C 2  392  ? -12.336 -12.761 -57.494  1.00 98.65  ? 392  GLY C CA    1 
ATOM   6330  C  C     . GLY C 2  392  ? -12.671 -13.217 -58.901  1.00 103.74 ? 392  GLY C C     1 
ATOM   6331  O  O     . GLY C 2  392  ? -11.804 -13.716 -59.624  1.00 119.85 ? 392  GLY C O     1 
ATOM   6332  N  N     . MET C 2  393  ? -13.932 -13.055 -59.309  1.00 104.24 ? 393  MET C N     1 
ATOM   6333  C  CA    . MET C 2  393  ? -14.321 -13.418 -60.668  1.00 103.90 ? 393  MET C CA    1 
ATOM   6334  C  C     . MET C 2  393  ? -13.662 -12.505 -61.694  1.00 111.11 ? 393  MET C C     1 
ATOM   6335  O  O     . MET C 2  393  ? -13.250 -12.963 -62.766  1.00 107.70 ? 393  MET C O     1 
ATOM   6336  C  CB    . MET C 2  393  ? -15.842 -13.374 -60.813  1.00 101.82 ? 393  MET C CB    1 
ATOM   6337  C  CG    . MET C 2  393  ? -16.586 -14.473 -60.074  1.00 93.45  ? 393  MET C CG    1 
ATOM   6338  S  SD    . MET C 2  393  ? -16.280 -16.121 -60.739  1.00 89.73  ? 393  MET C SD    1 
ATOM   6339  C  CE    . MET C 2  393  ? -17.615 -17.035 -59.970  1.00 67.44  ? 393  MET C CE    1 
ATOM   6340  N  N     . SER C 2  394  ? -13.550 -11.210 -61.381  1.00 118.52 ? 394  SER C N     1 
ATOM   6341  C  CA    . SER C 2  394  ? -12.955 -10.268 -62.325  1.00 116.93 ? 394  SER C CA    1 
ATOM   6342  C  C     . SER C 2  394  ? -11.483 -10.574 -62.572  1.00 120.07 ? 394  SER C C     1 
ATOM   6343  O  O     . SER C 2  394  ? -10.988 -10.375 -63.686  1.00 139.90 ? 394  SER C O     1 
ATOM   6344  C  CB    . SER C 2  394  ? -13.117 -8.837  -61.815  1.00 112.96 ? 394  SER C CB    1 
ATOM   6345  O  OG    . SER C 2  394  ? -12.137 -8.528  -60.841  1.00 111.04 ? 394  SER C OG    1 
ATOM   6346  N  N     . ARG C 2  395  ? -10.770 -11.052 -61.550  1.00 117.03 ? 395  ARG C N     1 
ATOM   6347  C  CA    . ARG C 2  395  ? -9.384  -11.464 -61.748  1.00 108.05 ? 395  ARG C CA    1 
ATOM   6348  C  C     . ARG C 2  395  ? -9.301  -12.685 -62.654  1.00 114.68 ? 395  ARG C C     1 
ATOM   6349  O  O     . ARG C 2  395  ? -8.411  -12.773 -63.507  1.00 146.27 ? 395  ARG C O     1 
ATOM   6350  C  CB    . ARG C 2  395  ? -8.721  -11.744 -60.399  1.00 124.19 ? 395  ARG C CB    1 
ATOM   6351  C  CG    . ARG C 2  395  ? -8.632  -10.526 -59.495  1.00 134.79 ? 395  ARG C CG    1 
ATOM   6352  C  CD    . ARG C 2  395  ? -8.140  -10.894 -58.105  1.00 115.38 ? 395  ARG C CD    1 
ATOM   6353  N  NE    . ARG C 2  395  ? -7.925  -9.714  -57.271  1.00 142.01 ? 395  ARG C NE    1 
ATOM   6354  C  CZ    . ARG C 2  395  ? -7.684  -9.756  -55.965  1.00 162.98 ? 395  ARG C CZ    1 
ATOM   6355  N  NH1   . ARG C 2  395  ? -7.633  -10.923 -55.336  1.00 147.94 ? 395  ARG C NH1   1 
ATOM   6356  N  NH2   . ARG C 2  395  ? -7.499  -8.633  -55.285  1.00 171.41 ? 395  ARG C NH2   1 
ATOM   6357  N  N     . MET C 2  396  ? -10.223 -13.637 -62.483  1.00 103.03 ? 396  MET C N     1 
ATOM   6358  C  CA    . MET C 2  396  ? -10.282 -14.790 -63.376  1.00 105.19 ? 396  MET C CA    1 
ATOM   6359  C  C     . MET C 2  396  ? -10.712 -14.387 -64.780  1.00 121.72 ? 396  MET C C     1 
ATOM   6360  O  O     . MET C 2  396  ? -10.248 -14.975 -65.764  1.00 132.43 ? 396  MET C O     1 
ATOM   6361  C  CB    . MET C 2  396  ? -11.239 -15.839 -62.807  1.00 115.34 ? 396  MET C CB    1 
ATOM   6362  C  CG    . MET C 2  396  ? -11.574 -16.975 -63.760  1.00 109.64 ? 396  MET C CG    1 
ATOM   6363  S  SD    . MET C 2  396  ? -13.313 -17.444 -63.681  1.00 119.21 ? 396  MET C SD    1 
ATOM   6364  C  CE    . MET C 2  396  ? -14.097 -15.896 -64.127  1.00 133.82 ? 396  MET C CE    1 
ATOM   6365  N  N     . GLU C 2  397  ? -11.597 -13.393 -64.890  1.00 130.80 ? 397  GLU C N     1 
ATOM   6366  C  CA    . GLU C 2  397  ? -12.060 -12.938 -66.198  1.00 125.99 ? 397  GLU C CA    1 
ATOM   6367  C  C     . GLU C 2  397  ? -10.900 -12.456 -67.059  1.00 119.41 ? 397  GLU C C     1 
ATOM   6368  O  O     . GLU C 2  397  ? -10.843 -12.749 -68.259  1.00 124.25 ? 397  GLU C O     1 
ATOM   6369  C  CB    . GLU C 2  397  ? -13.098 -11.830 -66.024  1.00 129.94 ? 397  GLU C CB    1 
ATOM   6370  C  CG    . GLU C 2  397  ? -13.500 -11.138 -67.313  1.00 132.97 ? 397  GLU C CG    1 
ATOM   6371  C  CD    . GLU C 2  397  ? -14.467 -9.994  -67.078  1.00 137.76 ? 397  GLU C CD    1 
ATOM   6372  O  OE1   . GLU C 2  397  ? -15.589 -10.041 -67.623  1.00 152.78 ? 397  GLU C OE1   1 
ATOM   6373  O  OE2   . GLU C 2  397  ? -14.108 -9.051  -66.339  1.00 125.55 ? 397  GLU C OE2   1 
ATOM   6374  N  N     . ARG C 2  398  ? -9.965  -11.712 -66.463  1.00 114.35 ? 398  ARG C N     1 
ATOM   6375  C  CA    . ARG C 2  398  ? -8.783  -11.281 -67.199  1.00 125.50 ? 398  ARG C CA    1 
ATOM   6376  C  C     . ARG C 2  398  ? -7.938  -12.469 -67.639  1.00 133.24 ? 398  ARG C C     1 
ATOM   6377  O  O     . ARG C 2  398  ? -7.299  -12.421 -68.696  1.00 158.28 ? 398  ARG C O     1 
ATOM   6378  C  CB    . ARG C 2  398  ? -7.959  -10.322 -66.341  1.00 134.42 ? 398  ARG C CB    1 
ATOM   6379  C  CG    . ARG C 2  398  ? -6.756  -9.730  -67.045  1.00 159.70 ? 398  ARG C CG    1 
ATOM   6380  C  CD    . ARG C 2  398  ? -6.050  -8.736  -66.146  1.00 160.64 ? 398  ARG C CD    1 
ATOM   6381  N  NE    . ARG C 2  398  ? -4.911  -8.106  -66.803  1.00 181.95 ? 398  ARG C NE    1 
ATOM   6382  C  CZ    . ARG C 2  398  ? -4.170  -7.155  -66.247  1.00 193.19 ? 398  ARG C CZ    1 
ATOM   6383  N  NH1   . ARG C 2  398  ? -4.451  -6.729  -65.025  1.00 187.87 ? 398  ARG C NH1   1 
ATOM   6384  N  NH2   . ARG C 2  398  ? -3.150  -6.630  -66.908  1.00 190.69 ? 398  ARG C NH2   1 
ATOM   6385  N  N     . VAL C 2  399  ? -7.923  -13.542 -66.845  1.00 120.48 ? 399  VAL C N     1 
ATOM   6386  C  CA    . VAL C 2  399  ? -7.241  -14.762 -67.261  1.00 136.78 ? 399  VAL C CA    1 
ATOM   6387  C  C     . VAL C 2  399  ? -7.943  -15.377 -68.466  1.00 147.22 ? 399  VAL C C     1 
ATOM   6388  O  O     . VAL C 2  399  ? -7.294  -15.908 -69.376  1.00 157.00 ? 399  VAL C O     1 
ATOM   6389  C  CB    . VAL C 2  399  ? -7.153  -15.748 -66.081  1.00 135.67 ? 399  VAL C CB    1 
ATOM   6390  C  CG1   . VAL C 2  399  ? -6.692  -17.120 -66.552  1.00 127.03 ? 399  VAL C CG1   1 
ATOM   6391  C  CG2   . VAL C 2  399  ? -6.218  -15.207 -65.009  1.00 142.34 ? 399  VAL C CG2   1 
ATOM   6392  N  N     . VAL C 2  400  ? -9.274  -15.298 -68.502  1.00 142.27 ? 400  VAL C N     1 
ATOM   6393  C  CA    . VAL C 2  400  ? -10.028 -15.870 -69.613  1.00 138.82 ? 400  VAL C CA    1 
ATOM   6394  C  C     . VAL C 2  400  ? -9.709  -15.138 -70.911  1.00 168.71 ? 400  VAL C C     1 
ATOM   6395  O  O     . VAL C 2  400  ? -9.348  -15.758 -71.918  1.00 185.03 ? 400  VAL C O     1 
ATOM   6396  C  CB    . VAL C 2  400  ? -11.536 -15.845 -69.310  1.00 127.76 ? 400  VAL C CB    1 
ATOM   6397  C  CG1   . VAL C 2  400  ? -12.329 -16.225 -70.550  1.00 133.02 ? 400  VAL C CG1   1 
ATOM   6398  C  CG2   . VAL C 2  400  ? -11.861 -16.779 -68.153  1.00 130.26 ? 400  VAL C CG2   1 
ATOM   6399  N  N     . ARG C 2  401  ? -9.838  -13.807 -70.909  1.00 159.00 ? 401  ARG C N     1 
ATOM   6400  C  CA    . ARG C 2  401  ? -9.566  -13.036 -72.119  1.00 157.27 ? 401  ARG C CA    1 
ATOM   6401  C  C     . ARG C 2  401  ? -8.127  -13.208 -72.586  1.00 164.35 ? 401  ARG C C     1 
ATOM   6402  O  O     . ARG C 2  401  ? -7.856  -13.154 -73.791  1.00 180.35 ? 401  ARG C O     1 
ATOM   6403  C  CB    . ARG C 2  401  ? -9.872  -11.556 -71.888  1.00 125.22 ? 401  ARG C CB    1 
ATOM   6404  C  CG    . ARG C 2  401  ? -11.344 -11.244 -71.686  1.00 113.35 ? 401  ARG C CG    1 
ATOM   6405  C  CD    . ARG C 2  401  ? -11.574 -9.751  -71.526  1.00 116.27 ? 401  ARG C CD    1 
ATOM   6406  N  NE    . ARG C 2  401  ? -12.965 -9.441  -71.212  1.00 127.77 ? 401  ARG C NE    1 
ATOM   6407  C  CZ    . ARG C 2  401  ? -13.417 -8.220  -70.946  1.00 151.98 ? 401  ARG C CZ    1 
ATOM   6408  N  NH1   . ARG C 2  401  ? -12.585 -7.187  -70.954  1.00 150.79 ? 401  ARG C NH1   1 
ATOM   6409  N  NH2   . ARG C 2  401  ? -14.700 -8.031  -70.670  1.00 149.63 ? 401  ARG C NH2   1 
ATOM   6410  N  N     . GLU C 2  402  ? -7.194  -13.417 -71.654  1.00 151.87 ? 402  GLU C N     1 
ATOM   6411  C  CA    . GLU C 2  402  ? -5.808  -13.655 -72.040  1.00 167.17 ? 402  GLU C CA    1 
ATOM   6412  C  C     . GLU C 2  402  ? -5.631  -15.054 -72.617  1.00 172.52 ? 402  GLU C C     1 
ATOM   6413  O  O     . GLU C 2  402  ? -4.901  -15.240 -73.598  1.00 186.10 ? 402  GLU C O     1 
ATOM   6414  C  CB    . GLU C 2  402  ? -4.886  -13.449 -70.837  1.00 172.71 ? 402  GLU C CB    1 
ATOM   6415  C  CG    . GLU C 2  402  ? -3.406  -13.690 -71.120  1.00 187.35 ? 402  GLU C CG    1 
ATOM   6416  C  CD    . GLU C 2  402  ? -2.772  -12.582 -71.942  1.00 204.97 ? 402  GLU C CD    1 
ATOM   6417  O  OE1   . GLU C 2  402  ? -3.385  -11.501 -72.062  1.00 221.66 ? 402  GLU C OE1   1 
ATOM   6418  O  OE2   . GLU C 2  402  ? -1.658  -12.792 -72.468  1.00 203.18 ? 402  GLU C OE2   1 
ATOM   6419  N  N     . ARG C 2  403  ? -6.296  -16.049 -72.026  1.00 156.71 ? 403  ARG C N     1 
ATOM   6420  C  CA    . ARG C 2  403  ? -6.176  -17.419 -72.510  1.00 153.57 ? 403  ARG C CA    1 
ATOM   6421  C  C     . ARG C 2  403  ? -6.888  -17.634 -73.839  1.00 162.07 ? 403  ARG C C     1 
ATOM   6422  O  O     . ARG C 2  403  ? -6.568  -18.594 -74.548  1.00 166.43 ? 403  ARG C O     1 
ATOM   6423  C  CB    . ARG C 2  403  ? -6.720  -18.398 -71.467  1.00 160.49 ? 403  ARG C CB    1 
ATOM   6424  C  CG    . ARG C 2  403  ? -5.820  -18.595 -70.256  1.00 163.44 ? 403  ARG C CG    1 
ATOM   6425  C  CD    . ARG C 2  403  ? -6.368  -19.682 -69.344  1.00 141.99 ? 403  ARG C CD    1 
ATOM   6426  N  NE    . ARG C 2  403  ? -5.475  -19.966 -68.224  1.00 133.28 ? 403  ARG C NE    1 
ATOM   6427  C  CZ    . ARG C 2  403  ? -5.643  -20.972 -67.371  1.00 138.61 ? 403  ARG C CZ    1 
ATOM   6428  N  NH1   . ARG C 2  403  ? -6.671  -21.798 -67.510  1.00 134.68 ? 403  ARG C NH1   1 
ATOM   6429  N  NH2   . ARG C 2  403  ? -4.780  -21.156 -66.381  1.00 144.57 ? 403  ARG C NH2   1 
ATOM   6430  N  N     . MET C 2  404  ? -7.843  -16.772 -74.194  1.00 180.16 ? 404  MET C N     1 
ATOM   6431  C  CA    . MET C 2  404  ? -8.546  -16.933 -75.463  1.00 198.27 ? 404  MET C CA    1 
ATOM   6432  C  C     . MET C 2  404  ? -7.640  -16.597 -76.641  1.00 189.78 ? 404  MET C C     1 
ATOM   6433  O  O     . MET C 2  404  ? -7.536  -17.373 -77.598  1.00 172.04 ? 404  MET C O     1 
ATOM   6434  C  CB    . MET C 2  404  ? -9.799  -16.057 -75.493  1.00 203.70 ? 404  MET C CB    1 
ATOM   6435  C  CG    . MET C 2  404  ? -10.905 -16.492 -74.550  1.00 185.94 ? 404  MET C CG    1 
ATOM   6436  S  SD    . MET C 2  404  ? -12.436 -15.585 -74.844  1.00 196.88 ? 404  MET C SD    1 
ATOM   6437  C  CE    . MET C 2  404  ? -11.829 -13.901 -74.904  1.00 163.91 ? 404  MET C CE    1 
ATOM   6438  N  N     . THR C 2  405  ? -6.977  -15.444 -76.587  1.00 183.48 ? 405  THR C N     1 
ATOM   6439  C  CA    . THR C 2  405  ? -6.191  -14.948 -77.708  1.00 160.81 ? 405  THR C CA    1 
ATOM   6440  C  C     . THR C 2  405  ? -4.834  -15.627 -77.844  1.00 160.07 ? 405  THR C C     1 
ATOM   6441  O  O     . THR C 2  405  ? -4.109  -15.332 -78.800  1.00 161.49 ? 405  THR C O     1 
ATOM   6442  C  CB    . THR C 2  405  ? -5.996  -13.435 -77.578  1.00 155.49 ? 405  THR C CB    1 
ATOM   6443  O  OG1   . THR C 2  405  ? -5.307  -13.144 -76.356  1.00 155.91 ? 405  THR C OG1   1 
ATOM   6444  C  CG2   . THR C 2  405  ? -7.343  -12.728 -77.576  1.00 148.71 ? 405  THR C CG2   1 
ATOM   6445  N  N     . THR C 2  406  ? -4.469  -16.518 -76.923  1.00 167.06 ? 406  THR C N     1 
ATOM   6446  C  CA    . THR C 2  406  ? -3.224  -17.272 -77.016  1.00 167.37 ? 406  THR C CA    1 
ATOM   6447  C  C     . THR C 2  406  ? -3.441  -18.679 -77.558  1.00 171.93 ? 406  THR C C     1 
ATOM   6448  O  O     . THR C 2  406  ? -2.746  -19.103 -78.486  1.00 185.36 ? 406  THR C O     1 
ATOM   6449  C  CB    . THR C 2  406  ? -2.542  -17.341 -75.644  1.00 164.23 ? 406  THR C CB    1 
ATOM   6450  O  OG1   . THR C 2  406  ? -2.144  -16.025 -75.238  1.00 160.70 ? 406  THR C OG1   1 
ATOM   6451  C  CG2   . THR C 2  406  ? -1.316  -18.243 -75.699  1.00 154.06 ? 406  THR C CG2   1 
ATOM   6452  N  N     . GLN C 2  407  ? -4.401  -19.410 -76.997  1.00 161.08 ? 407  GLN C N     1 
ATOM   6453  C  CA    . GLN C 2  407  ? -4.691  -20.761 -77.445  1.00 151.89 ? 407  GLN C CA    1 
ATOM   6454  C  C     . GLN C 2  407  ? -5.428  -20.730 -78.784  1.00 171.82 ? 407  GLN C C     1 
ATOM   6455  O  O     . GLN C 2  407  ? -5.868  -19.681 -79.263  1.00 170.13 ? 407  GLN C O     1 
ATOM   6456  C  CB    . GLN C 2  407  ? -5.520  -21.498 -76.394  1.00 148.67 ? 407  GLN C CB    1 
ATOM   6457  C  CG    . GLN C 2  407  ? -4.938  -21.427 -74.989  1.00 157.90 ? 407  GLN C CG    1 
ATOM   6458  C  CD    . GLN C 2  407  ? -5.957  -21.759 -73.915  1.00 172.20 ? 407  GLN C CD    1 
ATOM   6459  O  OE1   . GLN C 2  407  ? -7.113  -22.059 -74.210  1.00 174.81 ? 407  GLN C OE1   1 
ATOM   6460  N  NE2   . GLN C 2  407  ? -5.530  -21.703 -72.658  1.00 151.12 ? 407  GLN C NE2   1 
ATOM   6461  N  N     . ASP C 2  408  ? -5.558  -21.905 -79.393  1.00 174.05 ? 408  ASP C N     1 
ATOM   6462  C  CA    . ASP C 2  408  ? -6.273  -22.009 -80.654  1.00 164.81 ? 408  ASP C CA    1 
ATOM   6463  C  C     . ASP C 2  408  ? -7.778  -21.899 -80.424  1.00 155.55 ? 408  ASP C C     1 
ATOM   6464  O  O     . ASP C 2  408  ? -8.279  -22.076 -79.311  1.00 175.39 ? 408  ASP C O     1 
ATOM   6465  C  CB    . ASP C 2  408  ? -5.940  -23.322 -81.361  1.00 166.88 ? 408  ASP C CB    1 
ATOM   6466  C  CG    . ASP C 2  408  ? -6.468  -24.533 -80.621  1.00 160.56 ? 408  ASP C CG    1 
ATOM   6467  O  OD1   . ASP C 2  408  ? -6.289  -24.605 -79.387  1.00 155.70 ? 408  ASP C OD1   1 
ATOM   6468  O  OD2   . ASP C 2  408  ? -7.070  -25.409 -81.275  1.00 158.12 ? 408  ASP C OD2   1 
ATOM   6469  N  N     . VAL C 2  409  ? -8.503  -21.609 -81.504  1.00 142.59 ? 409  VAL C N     1 
ATOM   6470  C  CA    . VAL C 2  409  ? -9.934  -21.338 -81.423  1.00 146.68 ? 409  VAL C CA    1 
ATOM   6471  C  C     . VAL C 2  409  ? -10.724 -22.594 -81.774  1.00 140.41 ? 409  VAL C C     1 
ATOM   6472  O  O     . VAL C 2  409  ? -11.862 -22.513 -82.249  1.00 149.22 ? 409  VAL C O     1 
ATOM   6473  C  CB    . VAL C 2  409  ? -10.323 -20.163 -82.341  1.00 146.49 ? 409  VAL C CB    1 
ATOM   6474  C  CG1   . VAL C 2  409  ? -11.523 -19.416 -81.777  1.00 148.88 ? 409  VAL C CG1   1 
ATOM   6475  C  CG2   . VAL C 2  409  ? -9.143  -19.221 -82.527  1.00 124.88 ? 409  VAL C CG2   1 
ATOM   6476  N  N     . GLU C 2  410  ? -10.128 -23.765 -81.540  1.00 133.57 ? 410  GLU C N     1 
ATOM   6477  C  CA    . GLU C 2  410  ? -10.817 -25.025 -81.795  1.00 151.76 ? 410  GLU C CA    1 
ATOM   6478  C  C     . GLU C 2  410  ? -10.553 -26.112 -80.764  1.00 153.36 ? 410  GLU C C     1 
ATOM   6479  O  O     . GLU C 2  410  ? -11.302 -27.094 -80.741  1.00 148.03 ? 410  GLU C O     1 
ATOM   6480  C  CB    . GLU C 2  410  ? -10.455 -25.566 -83.186  1.00 162.01 ? 410  GLU C CB    1 
ATOM   6481  C  CG    . GLU C 2  410  ? -11.456 -25.191 -84.264  1.00 177.93 ? 410  GLU C CG    1 
ATOM   6482  C  CD    . GLU C 2  410  ? -12.882 -25.498 -83.852  1.00 183.65 ? 410  GLU C CD    1 
ATOM   6483  O  OE1   . GLU C 2  410  ? -13.712 -24.567 -83.843  1.00 180.85 ? 410  GLU C OE1   1 
ATOM   6484  O  OE2   . GLU C 2  410  ? -13.169 -26.667 -83.520  1.00 182.43 ? 410  GLU C OE2   1 
ATOM   6485  N  N     . ALA C 2  411  ? -9.529  -25.990 -79.920  1.00 157.22 ? 411  ALA C N     1 
ATOM   6486  C  CA    . ALA C 2  411  ? -9.299  -26.928 -78.829  1.00 160.06 ? 411  ALA C CA    1 
ATOM   6487  C  C     . ALA C 2  411  ? -9.654  -26.325 -77.475  1.00 176.58 ? 411  ALA C C     1 
ATOM   6488  O  O     . ALA C 2  411  ? -9.235  -26.846 -76.437  1.00 169.63 ? 411  ALA C O     1 
ATOM   6489  C  CB    . ALA C 2  411  ? -7.848  -27.410 -78.833  1.00 135.79 ? 411  ALA C CB    1 
ATOM   6490  N  N     . ILE C 2  412  ? -10.418 -25.238 -77.467  1.00 182.95 ? 412  ILE C N     1 
ATOM   6491  C  CA    . ILE C 2  412  ? -10.778 -24.541 -76.239  1.00 168.86 ? 412  ILE C CA    1 
ATOM   6492  C  C     . ILE C 2  412  ? -12.029 -25.176 -75.650  1.00 179.62 ? 412  ILE C C     1 
ATOM   6493  O  O     . ILE C 2  412  ? -13.037 -25.358 -76.345  1.00 154.37 ? 412  ILE C O     1 
ATOM   6494  C  CB    . ILE C 2  412  ? -10.990 -23.039 -76.499  1.00 158.50 ? 412  ILE C CB    1 
ATOM   6495  C  CG1   . ILE C 2  412  ? -9.655  -22.293 -76.443  1.00 159.30 ? 412  ILE C CG1   1 
ATOM   6496  C  CG2   . ILE C 2  412  ? -11.977 -22.447 -75.502  1.00 162.84 ? 412  ILE C CG2   1 
ATOM   6497  C  CD1   . ILE C 2  412  ? -9.776  -20.795 -76.641  1.00 143.03 ? 412  ILE C CD1   1 
ATOM   6498  N  N     . THR C 2  413  ? -11.958 -25.526 -74.374  1.00 196.57 ? 413  THR C N     1 
ATOM   6499  C  CA    . THR C 2  413  ? -13.086 -25.984 -73.585  1.00 185.92 ? 413  THR C CA    1 
ATOM   6500  C  C     . THR C 2  413  ? -13.279 -25.030 -72.414  1.00 161.89 ? 413  THR C C     1 
ATOM   6501  O  O     . THR C 2  413  ? -12.390 -24.225 -72.112  1.00 147.58 ? 413  THR C O     1 
ATOM   6502  C  CB    . THR C 2  413  ? -12.853 -27.411 -73.065  1.00 147.20 ? 413  THR C CB    1 
ATOM   6503  O  OG1   . THR C 2  413  ? -11.728 -27.418 -72.179  1.00 143.39 ? 413  THR C OG1   1 
ATOM   6504  C  CG2   . THR C 2  413  ? -12.589 -28.364 -74.221  1.00 141.20 ? 413  THR C CG2   1 
ATOM   6505  N  N     . PRO C 2  414  ? -14.435 -25.070 -71.745  1.00 148.37 ? 414  PRO C N     1 
ATOM   6506  C  CA    . PRO C 2  414  ? -14.584 -24.254 -70.529  1.00 142.13 ? 414  PRO C CA    1 
ATOM   6507  C  C     . PRO C 2  414  ? -13.522 -24.538 -69.481  1.00 141.58 ? 414  PRO C C     1 
ATOM   6508  O  O     . PRO C 2  414  ? -13.181 -23.642 -68.700  1.00 149.38 ? 414  PRO C O     1 
ATOM   6509  C  CB    . PRO C 2  414  ? -15.987 -24.625 -70.032  1.00 136.12 ? 414  PRO C CB    1 
ATOM   6510  C  CG    . PRO C 2  414  ? -16.721 -25.024 -71.261  1.00 118.94 ? 414  PRO C CG    1 
ATOM   6511  C  CD    . PRO C 2  414  ? -15.710 -25.690 -72.153  1.00 132.52 ? 414  PRO C CD    1 
ATOM   6512  N  N     . GLN C 2  415  ? -12.978 -25.757 -69.448  1.00 136.82 ? 415  GLN C N     1 
ATOM   6513  C  CA    . GLN C 2  415  ? -11.973 -26.099 -68.446  1.00 140.44 ? 415  GLN C CA    1 
ATOM   6514  C  C     . GLN C 2  415  ? -10.638 -25.418 -68.720  1.00 145.03 ? 415  GLN C C     1 
ATOM   6515  O  O     . GLN C 2  415  ? -9.891  -25.125 -67.780  1.00 136.21 ? 415  GLN C O     1 
ATOM   6516  C  CB    . GLN C 2  415  ? -11.787 -27.613 -68.392  1.00 143.10 ? 415  GLN C CB    1 
ATOM   6517  C  CG    . GLN C 2  415  ? -13.055 -28.380 -68.079  1.00 132.04 ? 415  GLN C CG    1 
ATOM   6518  C  CD    . GLN C 2  415  ? -13.310 -28.513 -66.593  1.00 148.60 ? 415  GLN C CD    1 
ATOM   6519  O  OE1   . GLN C 2  415  ? -12.523 -28.044 -65.772  1.00 170.24 ? 415  GLN C OE1   1 
ATOM   6520  N  NE2   . GLN C 2  415  ? -14.414 -29.160 -66.239  1.00 130.67 ? 415  GLN C NE2   1 
ATOM   6521  N  N     . THR C 2  416  ? -10.317 -25.163 -69.990  1.00 147.13 ? 416  THR C N     1 
ATOM   6522  C  CA    . THR C 2  416  ? -9.022  -24.580 -70.323  1.00 145.45 ? 416  THR C CA    1 
ATOM   6523  C  C     . THR C 2  416  ? -8.982  -23.077 -70.078  1.00 135.02 ? 416  THR C C     1 
ATOM   6524  O  O     . THR C 2  416  ? -7.927  -22.541 -69.724  1.00 123.05 ? 416  THR C O     1 
ATOM   6525  C  CB    . THR C 2  416  ? -8.667  -24.877 -71.780  1.00 142.63 ? 416  THR C CB    1 
ATOM   6526  O  OG1   . THR C 2  416  ? -9.665  -24.314 -72.641  1.00 151.46 ? 416  THR C OG1   1 
ATOM   6527  C  CG2   . THR C 2  416  ? -8.591  -26.377 -72.012  1.00 124.95 ? 416  THR C CG2   1 
ATOM   6528  N  N     . LEU C 2  417  ? -10.106 -22.385 -70.261  1.00 133.42 ? 417  LEU C N     1 
ATOM   6529  C  CA    . LEU C 2  417  ? -10.143 -20.943 -70.061  1.00 142.35 ? 417  LEU C CA    1 
ATOM   6530  C  C     . LEU C 2  417  ? -10.201 -20.548 -68.593  1.00 148.84 ? 417  LEU C C     1 
ATOM   6531  O  O     . LEU C 2  417  ? -9.905  -19.395 -68.265  1.00 145.07 ? 417  LEU C O     1 
ATOM   6532  C  CB    . LEU C 2  417  ? -11.350 -20.341 -70.780  1.00 148.67 ? 417  LEU C CB    1 
ATOM   6533  C  CG    . LEU C 2  417  ? -11.498 -20.627 -72.270  1.00 167.41 ? 417  LEU C CG    1 
ATOM   6534  C  CD1   . LEU C 2  417  ? -12.844 -20.123 -72.738  1.00 189.75 ? 417  LEU C CD1   1 
ATOM   6535  C  CD2   . LEU C 2  417  ? -10.376 -19.972 -73.055  1.00 164.85 ? 417  LEU C CD2   1 
ATOM   6536  N  N     . ILE C 2  418  ? -10.573 -21.468 -67.710  1.00 153.14 ? 418  ILE C N     1 
ATOM   6537  C  CA    . ILE C 2  418  ? -10.891 -21.145 -66.326  1.00 142.46 ? 418  ILE C CA    1 
ATOM   6538  C  C     . ILE C 2  418  ? -9.715  -21.526 -65.439  1.00 145.58 ? 418  ILE C C     1 
ATOM   6539  O  O     . ILE C 2  418  ? -9.308  -22.693 -65.392  1.00 136.66 ? 418  ILE C O     1 
ATOM   6540  C  CB    . ILE C 2  418  ? -12.178 -21.851 -65.876  1.00 116.26 ? 418  ILE C CB    1 
ATOM   6541  C  CG1   . ILE C 2  418  ? -13.384 -21.231 -66.584  1.00 114.31 ? 418  ILE C CG1   1 
ATOM   6542  C  CG2   . ILE C 2  418  ? -12.331 -21.777 -64.366  1.00 120.69 ? 418  ILE C CG2   1 
ATOM   6543  C  CD1   . ILE C 2  418  ? -14.674 -21.951 -66.325  1.00 115.00 ? 418  ILE C CD1   1 
ATOM   6544  N  N     . ASN C 2  419  ? -9.170  -20.536 -64.738  1.00 134.08 ? 419  ASN C N     1 
ATOM   6545  C  CA    . ASN C 2  419  ? -8.155  -20.741 -63.709  1.00 115.03 ? 419  ASN C CA    1 
ATOM   6546  C  C     . ASN C 2  419  ? -8.759  -20.237 -62.403  1.00 122.54 ? 419  ASN C C     1 
ATOM   6547  O  O     . ASN C 2  419  ? -8.870  -19.026 -62.189  1.00 134.77 ? 419  ASN C O     1 
ATOM   6548  C  CB    . ASN C 2  419  ? -6.855  -20.018 -64.056  1.00 128.69 ? 419  ASN C CB    1 
ATOM   6549  C  CG    . ASN C 2  419  ? -5.722  -20.364 -63.110  1.00 140.50 ? 419  ASN C CG    1 
ATOM   6550  O  OD1   . ASN C 2  419  ? -5.207  -19.501 -62.399  1.00 144.49 ? 419  ASN C OD1   1 
ATOM   6551  N  ND2   . ASN C 2  419  ? -5.332  -21.634 -63.092  1.00 133.15 ? 419  ASN C ND2   1 
ATOM   6552  N  N     . ILE C 2  420  ? -9.165  -21.172 -61.536  1.00 121.11 ? 420  ILE C N     1 
ATOM   6553  C  CA    . ILE C 2  420  ? -9.870  -20.812 -60.306  1.00 108.59 ? 420  ILE C CA    1 
ATOM   6554  C  C     . ILE C 2  420  ? -8.941  -20.344 -59.201  1.00 116.19 ? 420  ILE C C     1 
ATOM   6555  O  O     . ILE C 2  420  ? -9.408  -20.084 -58.085  1.00 108.95 ? 420  ILE C O     1 
ATOM   6556  C  CB    . ILE C 2  420  ? -10.701 -22.004 -59.792  1.00 89.24  ? 420  ILE C CB    1 
ATOM   6557  C  CG1   . ILE C 2  420  ? -9.782  -23.168 -59.425  1.00 92.98  ? 420  ILE C CG1   1 
ATOM   6558  C  CG2   . ILE C 2  420  ? -11.708 -22.439 -60.842  1.00 102.72 ? 420  ILE C CG2   1 
ATOM   6559  C  CD1   . ILE C 2  420  ? -10.519 -24.398 -58.960  1.00 75.75  ? 420  ILE C CD1   1 
ATOM   6560  N  N     . ARG C 2  421  ? -7.641  -20.230 -59.474  1.00 136.43 ? 421  ARG C N     1 
ATOM   6561  C  CA    . ARG C 2  421  ? -6.702  -19.784 -58.446  1.00 129.11 ? 421  ARG C CA    1 
ATOM   6562  C  C     . ARG C 2  421  ? -7.021  -18.389 -57.919  1.00 116.97 ? 421  ARG C C     1 
ATOM   6563  O  O     . ARG C 2  421  ? -7.064  -18.219 -56.688  1.00 126.20 ? 421  ARG C O     1 
ATOM   6564  C  CB    . ARG C 2  421  ? -5.271  -19.879 -58.988  1.00 153.00 ? 421  ARG C CB    1 
ATOM   6565  C  CG    . ARG C 2  421  ? -4.245  -19.068 -58.214  1.00 156.74 ? 421  ARG C CG    1 
ATOM   6566  C  CD    . ARG C 2  421  ? -2.821  -19.403 -58.646  1.00 169.48 ? 421  ARG C CD    1 
ATOM   6567  N  NE    . ARG C 2  421  ? -2.639  -19.328 -60.094  1.00 171.52 ? 421  ARG C NE    1 
ATOM   6568  C  CZ    . ARG C 2  421  ? -2.508  -20.388 -60.886  1.00 167.62 ? 421  ARG C CZ    1 
ATOM   6569  N  NH1   . ARG C 2  421  ? -2.535  -21.609 -60.371  1.00 180.88 ? 421  ARG C NH1   1 
ATOM   6570  N  NH2   . ARG C 2  421  ? -2.347  -20.228 -62.193  1.00 127.23 ? 421  ARG C NH2   1 
ATOM   6571  N  N     . PRO C 2  422  ? -7.257  -17.364 -58.749  1.00 111.84 ? 422  PRO C N     1 
ATOM   6572  C  CA    . PRO C 2  422  ? -7.607  -16.051 -58.185  1.00 125.27 ? 422  PRO C CA    1 
ATOM   6573  C  C     . PRO C 2  422  ? -8.996  -16.000 -57.571  1.00 113.20 ? 422  PRO C C     1 
ATOM   6574  O  O     . PRO C 2  422  ? -9.287  -15.056 -56.827  1.00 114.35 ? 422  PRO C O     1 
ATOM   6575  C  CB    . PRO C 2  422  ? -7.498  -15.103 -59.390  1.00 126.47 ? 422  PRO C CB    1 
ATOM   6576  C  CG    . PRO C 2  422  ? -6.709  -15.855 -60.413  1.00 128.03 ? 422  PRO C CG    1 
ATOM   6577  C  CD    . PRO C 2  422  ? -7.082  -17.283 -60.209  1.00 130.18 ? 422  PRO C CD    1 
ATOM   6578  N  N     . VAL C 2  423  ? -9.860  -16.975 -57.854  1.00 102.64 ? 423  VAL C N     1 
ATOM   6579  C  CA    . VAL C 2  423  ? -11.210 -16.962 -57.298  1.00 103.65 ? 423  VAL C CA    1 
ATOM   6580  C  C     . VAL C 2  423  ? -11.197 -17.417 -55.845  1.00 116.10 ? 423  VAL C C     1 
ATOM   6581  O  O     . VAL C 2  423  ? -11.640 -16.696 -54.944  1.00 113.42 ? 423  VAL C O     1 
ATOM   6582  C  CB    . VAL C 2  423  ? -12.154 -17.833 -58.148  1.00 98.45  ? 423  VAL C CB    1 
ATOM   6583  C  CG1   . VAL C 2  423  ? -13.563 -17.802 -57.573  1.00 79.14  ? 423  VAL C CG1   1 
ATOM   6584  C  CG2   . VAL C 2  423  ? -12.147 -17.368 -59.595  1.00 123.39 ? 423  VAL C CG2   1 
ATOM   6585  N  N     . VAL C 2  424  ? -10.684 -18.625 -55.599  1.00 113.29 ? 424  VAL C N     1 
ATOM   6586  C  CA    . VAL C 2  424  ? -10.679 -19.166 -54.244  1.00 104.72 ? 424  VAL C CA    1 
ATOM   6587  C  C     . VAL C 2  424  ? -9.727  -18.383 -53.350  1.00 106.66 ? 424  VAL C C     1 
ATOM   6588  O  O     . VAL C 2  424  ? -9.936  -18.299 -52.133  1.00 108.00 ? 424  VAL C O     1 
ATOM   6589  C  CB    . VAL C 2  424  ? -10.324 -20.664 -54.272  1.00 80.69  ? 424  VAL C CB    1 
ATOM   6590  C  CG1   . VAL C 2  424  ? -10.715 -21.324 -52.959  1.00 85.81  ? 424  VAL C CG1   1 
ATOM   6591  C  CG2   . VAL C 2  424  ? -11.004 -21.351 -55.449  1.00 98.11  ? 424  VAL C CG2   1 
ATOM   6592  N  N     . ALA C 2  425  ? -8.675  -17.795 -53.924  1.00 107.24 ? 425  ALA C N     1 
ATOM   6593  C  CA    . ALA C 2  425  ? -7.765  -16.969 -53.140  1.00 102.69 ? 425  ALA C CA    1 
ATOM   6594  C  C     . ALA C 2  425  ? -8.377  -15.633 -52.747  1.00 86.36  ? 425  ALA C C     1 
ATOM   6595  O  O     . ALA C 2  425  ? -7.805  -14.935 -51.902  1.00 82.75  ? 425  ALA C O     1 
ATOM   6596  C  CB    . ALA C 2  425  ? -6.466  -16.731 -53.911  1.00 101.90 ? 425  ALA C CB    1 
ATOM   6597  N  N     . ALA C 2  426  ? -9.511  -15.259 -53.338  1.00 78.43  ? 426  ALA C N     1 
ATOM   6598  C  CA    . ALA C 2  426  ? -10.200 -14.027 -52.976  1.00 86.97  ? 426  ALA C CA    1 
ATOM   6599  C  C     . ALA C 2  426  ? -11.190 -14.241 -51.838  1.00 85.55  ? 426  ALA C C     1 
ATOM   6600  O  O     . ALA C 2  426  ? -11.345 -13.366 -50.980  1.00 81.71  ? 426  ALA C O     1 
ATOM   6601  C  CB    . ALA C 2  426  ? -10.919 -13.445 -54.195  1.00 106.58 ? 426  ALA C CB    1 
ATOM   6602  N  N     . ILE C 2  427  ? -11.866 -15.390 -51.813  1.00 86.14  ? 427  ILE C N     1 
ATOM   6603  C  CA    . ILE C 2  427  ? -12.715 -15.703 -50.671  1.00 88.14  ? 427  ILE C CA    1 
ATOM   6604  C  C     . ILE C 2  427  ? -11.874 -16.133 -49.475  1.00 85.07  ? 427  ILE C C     1 
ATOM   6605  O  O     . ILE C 2  427  ? -12.266 -15.909 -48.324  1.00 71.55  ? 427  ILE C O     1 
ATOM   6606  C  CB    . ILE C 2  427  ? -13.755 -16.774 -51.046  1.00 80.41  ? 427  ILE C CB    1 
ATOM   6607  C  CG1   . ILE C 2  427  ? -13.076 -18.033 -51.592  1.00 90.73  ? 427  ILE C CG1   1 
ATOM   6608  C  CG2   . ILE C 2  427  ? -14.745 -16.222 -52.060  1.00 63.45  ? 427  ILE C CG2   1 
ATOM   6609  C  CD1   . ILE C 2  427  ? -12.932 -19.148 -50.575  1.00 77.40  ? 427  ILE C CD1   1 
ATOM   6610  N  N     . LYS C 2  428  ? -10.713 -16.746 -49.719  1.00 82.15  ? 428  LYS C N     1 
ATOM   6611  C  CA    . LYS C 2  428  ? -9.826  -17.125 -48.623  1.00 78.80  ? 428  LYS C CA    1 
ATOM   6612  C  C     . LYS C 2  428  ? -9.263  -15.893 -47.929  1.00 74.20  ? 428  LYS C C     1 
ATOM   6613  O  O     . LYS C 2  428  ? -9.216  -15.824 -46.695  1.00 78.54  ? 428  LYS C O     1 
ATOM   6614  C  CB    . LYS C 2  428  ? -8.697  -18.011 -49.150  1.00 74.16  ? 428  LYS C CB    1 
ATOM   6615  C  CG    . LYS C 2  428  ? -7.557  -18.219 -48.169  1.00 106.43 ? 428  LYS C CG    1 
ATOM   6616  C  CD    . LYS C 2  428  ? -6.523  -19.185 -48.724  1.00 109.25 ? 428  LYS C CD    1 
ATOM   6617  C  CE    . LYS C 2  428  ? -5.412  -19.432 -47.718  1.00 87.99  ? 428  LYS C CE    1 
ATOM   6618  N  NZ    . LYS C 2  428  ? -4.477  -20.501 -48.163  1.00 107.45 ? 428  LYS C NZ    1 
ATOM   6619  N  N     . GLU C 2  429  ? -8.827  -14.905 -48.715  1.00 80.68  ? 429  GLU C N     1 
ATOM   6620  C  CA    . GLU C 2  429  ? -8.286  -13.677 -48.143  1.00 86.65  ? 429  GLU C CA    1 
ATOM   6621  C  C     . GLU C 2  429  ? -9.327  -12.938 -47.314  1.00 90.45  ? 429  GLU C C     1 
ATOM   6622  O  O     . GLU C 2  429  ? -8.979  -12.269 -46.334  1.00 95.74  ? 429  GLU C O     1 
ATOM   6623  C  CB    . GLU C 2  429  ? -7.757  -12.778 -49.261  1.00 112.82 ? 429  GLU C CB    1 
ATOM   6624  C  CG    . GLU C 2  429  ? -7.225  -11.436 -48.793  1.00 106.66 ? 429  GLU C CG    1 
ATOM   6625  C  CD    . GLU C 2  429  ? -7.373  -10.361 -49.849  1.00 134.68 ? 429  GLU C CD    1 
ATOM   6626  O  OE1   . GLU C 2  429  ? -7.933  -10.663 -50.924  1.00 115.40 ? 429  GLU C OE1   1 
ATOM   6627  O  OE2   . GLU C 2  429  ? -6.937  -9.216  -49.605  1.00 171.55 ? 429  GLU C OE2   1 
ATOM   6628  N  N     . PHE C 2  430  ? -10.604 -13.050 -47.682  1.00 83.26  ? 430  PHE C N     1 
ATOM   6629  C  CA    . PHE C 2  430  ? -11.657 -12.370 -46.934  1.00 79.70  ? 430  PHE C CA    1 
ATOM   6630  C  C     . PHE C 2  430  ? -11.851 -13.002 -45.560  1.00 82.18  ? 430  PHE C C     1 
ATOM   6631  O  O     . PHE C 2  430  ? -11.662 -12.347 -44.529  1.00 86.05  ? 430  PHE C O     1 
ATOM   6632  C  CB    . PHE C 2  430  ? -12.961 -12.391 -47.732  1.00 85.95  ? 430  PHE C CB    1 
ATOM   6633  C  CG    . PHE C 2  430  ? -14.155 -11.928 -46.950  1.00 83.88  ? 430  PHE C CG    1 
ATOM   6634  C  CD1   . PHE C 2  430  ? -14.318 -10.590 -46.635  1.00 83.75  ? 430  PHE C CD1   1 
ATOM   6635  C  CD2   . PHE C 2  430  ? -15.116 -12.833 -46.531  1.00 69.26  ? 430  PHE C CD2   1 
ATOM   6636  C  CE1   . PHE C 2  430  ? -15.416 -10.163 -45.914  1.00 68.37  ? 430  PHE C CE1   1 
ATOM   6637  C  CE2   . PHE C 2  430  ? -16.216 -12.413 -45.810  1.00 65.13  ? 430  PHE C CE2   1 
ATOM   6638  C  CZ    . PHE C 2  430  ? -16.367 -11.076 -45.501  1.00 71.46  ? 430  PHE C CZ    1 
ATOM   6639  N  N     . PHE C 2  431  ? -12.230 -14.283 -45.527  1.00 74.64  ? 431  PHE C N     1 
ATOM   6640  C  CA    . PHE C 2  431  ? -12.441 -14.956 -44.249  1.00 71.52  ? 431  PHE C CA    1 
ATOM   6641  C  C     . PHE C 2  431  ? -11.158 -15.034 -43.431  1.00 76.20  ? 431  PHE C C     1 
ATOM   6642  O  O     . PHE C 2  431  ? -11.208 -15.026 -42.196  1.00 88.64  ? 431  PHE C O     1 
ATOM   6643  C  CB    . PHE C 2  431  ? -13.005 -16.358 -44.480  1.00 56.83  ? 431  PHE C CB    1 
ATOM   6644  C  CG    . PHE C 2  431  ? -14.457 -16.375 -44.866  1.00 73.82  ? 431  PHE C CG    1 
ATOM   6645  C  CD1   . PHE C 2  431  ? -15.440 -16.156 -43.916  1.00 72.96  ? 431  PHE C CD1   1 
ATOM   6646  C  CD2   . PHE C 2  431  ? -14.840 -16.623 -46.173  1.00 87.02  ? 431  PHE C CD2   1 
ATOM   6647  C  CE1   . PHE C 2  431  ? -16.777 -16.175 -44.264  1.00 64.24  ? 431  PHE C CE1   1 
ATOM   6648  C  CE2   . PHE C 2  431  ? -16.178 -16.644 -46.526  1.00 88.46  ? 431  PHE C CE2   1 
ATOM   6649  C  CZ    . PHE C 2  431  ? -17.146 -16.419 -45.569  1.00 74.36  ? 431  PHE C CZ    1 
ATOM   6650  N  N     . GLY C 2  432  ? -10.004 -15.108 -44.095  1.00 74.72  ? 432  GLY C N     1 
ATOM   6651  C  CA    . GLY C 2  432  ? -8.750  -15.181 -43.365  1.00 73.91  ? 432  GLY C CA    1 
ATOM   6652  C  C     . GLY C 2  432  ? -8.361  -13.860 -42.731  1.00 83.17  ? 432  GLY C C     1 
ATOM   6653  O  O     . GLY C 2  432  ? -7.902  -13.823 -41.585  1.00 94.51  ? 432  GLY C O     1 
ATOM   6654  N  N     . THR C 2  433  ? -8.542  -12.759 -43.458  1.00 75.43  ? 433  THR C N     1 
ATOM   6655  C  CA    . THR C 2  433  ? -8.156  -11.435 -42.976  1.00 86.41  ? 433  THR C CA    1 
ATOM   6656  C  C     . THR C 2  433  ? -9.229  -10.435 -43.382  1.00 90.00  ? 433  THR C C     1 
ATOM   6657  O  O     . THR C 2  433  ? -9.336  -10.083 -44.561  1.00 110.69 ? 433  THR C O     1 
ATOM   6658  C  CB    . THR C 2  433  ? -6.794  -11.019 -43.530  1.00 97.86  ? 433  THR C CB    1 
ATOM   6659  O  OG1   . THR C 2  433  ? -5.811  -11.999 -43.174  1.00 125.59 ? 433  THR C OG1   1 
ATOM   6660  C  CG2   . THR C 2  433  ? -6.382  -9.670  -42.962  1.00 114.91 ? 433  THR C CG2   1 
ATOM   6661  N  N     . SER C 2  434  ? -10.014 -9.977  -42.409  1.00 82.92  ? 434  SER C N     1 
ATOM   6662  C  CA    . SER C 2  434  ? -11.010 -8.942  -42.645  1.00 90.21  ? 434  SER C CA    1 
ATOM   6663  C  C     . SER C 2  434  ? -11.508 -8.425  -41.307  1.00 93.71  ? 434  SER C C     1 
ATOM   6664  O  O     . SER C 2  434  ? -11.630 -9.191  -40.348  1.00 107.78 ? 434  SER C O     1 
ATOM   6665  C  CB    . SER C 2  434  ? -12.189 -9.468  -43.476  1.00 93.33  ? 434  SER C CB    1 
ATOM   6666  O  OG    . SER C 2  434  ? -13.143 -8.448  -43.717  1.00 91.58  ? 434  SER C OG    1 
ATOM   6667  N  N     . GLN C 2  435  ? -11.792 -7.122  -41.253  1.00 99.23  ? 435  GLN C N     1 
ATOM   6668  C  CA    . GLN C 2  435  ? -12.409 -6.541  -40.068  1.00 108.97 ? 435  GLN C CA    1 
ATOM   6669  C  C     . GLN C 2  435  ? -13.808 -7.092  -39.830  1.00 110.55 ? 435  GLN C C     1 
ATOM   6670  O  O     . GLN C 2  435  ? -14.321 -6.996  -38.709  1.00 125.79 ? 435  GLN C O     1 
ATOM   6671  C  CB    . GLN C 2  435  ? -12.457 -5.018  -40.206  1.00 105.29 ? 435  GLN C CB    1 
ATOM   6672  C  CG    . GLN C 2  435  ? -12.210 -4.263  -38.914  1.00 113.72 ? 435  GLN C CG    1 
ATOM   6673  C  CD    . GLN C 2  435  ? -13.441 -4.179  -38.037  1.00 153.93 ? 435  GLN C CD    1 
ATOM   6674  O  OE1   . GLN C 2  435  ? -13.342 -4.110  -36.815  1.00 188.64 ? 435  GLN C OE1   1 
ATOM   6675  N  NE2   . GLN C 2  435  ? -14.614 -4.174  -38.662  1.00 175.96 ? 435  GLN C NE2   1 
ATOM   6676  N  N     . LEU C 2  436  ? -14.430 -7.670  -40.857  1.00 85.32  ? 436  LEU C N     1 
ATOM   6677  C  CA    . LEU C 2  436  ? -15.770 -8.228  -40.737  1.00 81.23  ? 436  LEU C CA    1 
ATOM   6678  C  C     . LEU C 2  436  ? -15.759 -9.708  -40.380  1.00 78.65  ? 436  LEU C C     1 
ATOM   6679  O  O     . LEU C 2  436  ? -16.701 -10.188 -39.738  1.00 78.34  ? 436  LEU C O     1 
ATOM   6680  C  CB    . LEU C 2  436  ? -16.549 -8.018  -42.039  1.00 81.48  ? 436  LEU C CB    1 
ATOM   6681  C  CG    . LEU C 2  436  ? -16.965 -6.586  -42.398  1.00 69.49  ? 436  LEU C CG    1 
ATOM   6682  C  CD1   . LEU C 2  436  ? -17.552 -5.869  -41.188  1.00 66.73  ? 436  LEU C CD1   1 
ATOM   6683  C  CD2   . LEU C 2  436  ? -15.818 -5.783  -43.007  1.00 67.63  ? 436  LEU C CD2   1 
ATOM   6684  N  N     . SER C 2  437  ? -14.726 -10.442 -40.788  1.00 72.09  ? 437  SER C N     1 
ATOM   6685  C  CA    . SER C 2  437  ? -14.540 -11.829 -40.368  1.00 75.80  ? 437  SER C CA    1 
ATOM   6686  C  C     . SER C 2  437  ? -13.858 -11.809 -39.007  1.00 92.05  ? 437  SER C C     1 
ATOM   6687  O  O     . SER C 2  437  ? -12.643 -11.622 -38.910  1.00 99.94  ? 437  SER C O     1 
ATOM   6688  C  CB    . SER C 2  437  ? -13.718 -12.602 -41.393  1.00 86.79  ? 437  SER C CB    1 
ATOM   6689  O  OG    . SER C 2  437  ? -13.379 -13.890 -40.908  1.00 92.14  ? 437  SER C OG    1 
ATOM   6690  N  N     . GLN C 2  438  ? -14.638 -12.002 -37.949  1.00 90.56  ? 438  GLN C N     1 
ATOM   6691  C  CA    . GLN C 2  438  ? -14.159 -11.831 -36.586  1.00 91.75  ? 438  GLN C CA    1 
ATOM   6692  C  C     . GLN C 2  438  ? -14.191 -13.150 -35.826  1.00 82.83  ? 438  GLN C C     1 
ATOM   6693  O  O     . GLN C 2  438  ? -15.154 -13.917 -35.927  1.00 74.38  ? 438  GLN C O     1 
ATOM   6694  C  CB    . GLN C 2  438  ? -14.994 -10.784 -35.844  1.00 77.91  ? 438  GLN C CB    1 
ATOM   6695  C  CG    . GLN C 2  438  ? -14.867 -9.387  -36.422  1.00 73.85  ? 438  GLN C CG    1 
ATOM   6696  C  CD    . GLN C 2  438  ? -15.727 -8.374  -35.697  1.00 72.79  ? 438  GLN C CD    1 
ATOM   6697  O  OE1   . GLN C 2  438  ? -16.454 -8.714  -34.764  1.00 89.66  ? 438  GLN C OE1   1 
ATOM   6698  N  NE2   . GLN C 2  438  ? -15.650 -7.121  -36.125  1.00 75.27  ? 438  GLN C NE2   1 
ATOM   6699  N  N     . PHE C 2  439  ? -13.119 -13.403 -35.078  1.00 73.09  ? 439  PHE C N     1 
ATOM   6700  C  CA    . PHE C 2  439  ? -13.068 -14.498 -34.119  1.00 62.96  ? 439  PHE C CA    1 
ATOM   6701  C  C     . PHE C 2  439  ? -14.272 -14.430 -33.188  1.00 79.41  ? 439  PHE C C     1 
ATOM   6702  O  O     . PHE C 2  439  ? -14.445 -13.453 -32.453  1.00 87.88  ? 439  PHE C O     1 
ATOM   6703  C  CB    . PHE C 2  439  ? -11.761 -14.401 -33.328  1.00 94.35  ? 439  PHE C CB    1 
ATOM   6704  C  CG    . PHE C 2  439  ? -11.453 -15.604 -32.484  1.00 98.45  ? 439  PHE C CG    1 
ATOM   6705  C  CD1   . PHE C 2  439  ? -11.959 -16.853 -32.799  1.00 82.44  ? 439  PHE C CD1   1 
ATOM   6706  C  CD2   . PHE C 2  439  ? -10.643 -15.477 -31.367  1.00 91.22  ? 439  PHE C CD2   1 
ATOM   6707  C  CE1   . PHE C 2  439  ? -11.660 -17.952 -32.013  1.00 85.11  ? 439  PHE C CE1   1 
ATOM   6708  C  CE2   . PHE C 2  439  ? -10.344 -16.568 -30.578  1.00 84.82  ? 439  PHE C CE2   1 
ATOM   6709  C  CZ    . PHE C 2  439  ? -10.852 -17.807 -30.901  1.00 83.10  ? 439  PHE C CZ    1 
ATOM   6710  N  N     . MET C 2  440  ? -15.104 -15.470 -33.225  1.00 65.54  ? 440  MET C N     1 
ATOM   6711  C  CA    . MET C 2  440  ? -16.409 -15.412 -32.576  1.00 61.11  ? 440  MET C CA    1 
ATOM   6712  C  C     . MET C 2  440  ? -16.283 -15.251 -31.066  1.00 67.82  ? 440  MET C C     1 
ATOM   6713  O  O     . MET C 2  440  ? -15.474 -15.916 -30.413  1.00 77.10  ? 440  MET C O     1 
ATOM   6714  C  CB    . MET C 2  440  ? -17.218 -16.671 -32.897  1.00 57.85  ? 440  MET C CB    1 
ATOM   6715  C  CG    . MET C 2  440  ? -18.558 -16.742 -32.175  1.00 54.66  ? 440  MET C CG    1 
ATOM   6716  S  SD    . MET C 2  440  ? -19.478 -18.263 -32.477  1.00 83.46  ? 440  MET C SD    1 
ATOM   6717  C  CE    . MET C 2  440  ? -20.912 -17.991 -31.440  1.00 55.42  ? 440  MET C CE    1 
ATOM   6718  N  N     . ASP C 2  441  ? -17.097 -14.351 -30.516  1.00 77.42  ? 441  ASP C N     1 
ATOM   6719  C  CA    . ASP C 2  441  ? -17.236 -14.213 -29.072  1.00 83.89  ? 441  ASP C CA    1 
ATOM   6720  C  C     . ASP C 2  441  ? -17.961 -15.436 -28.520  1.00 74.04  ? 441  ASP C C     1 
ATOM   6721  O  O     . ASP C 2  441  ? -19.129 -15.669 -28.846  1.00 66.70  ? 441  ASP C O     1 
ATOM   6722  C  CB    . ASP C 2  441  ? -18.009 -12.936 -28.746  1.00 85.95  ? 441  ASP C CB    1 
ATOM   6723  C  CG    . ASP C 2  441  ? -17.935 -12.555 -27.278  1.00 112.35 ? 441  ASP C CG    1 
ATOM   6724  O  OD1   . ASP C 2  441  ? -18.316 -11.410 -26.948  1.00 117.72 ? 441  ASP C OD1   1 
ATOM   6725  O  OD2   . ASP C 2  441  ? -17.485 -13.381 -26.456  1.00 120.79 ? 441  ASP C OD2   1 
ATOM   6726  N  N     . GLN C 2  442  ? -17.277 -16.217 -27.686  1.00 73.18  ? 442  GLN C N     1 
ATOM   6727  C  CA    . GLN C 2  442  ? -17.829 -17.462 -27.161  1.00 76.51  ? 442  GLN C CA    1 
ATOM   6728  C  C     . GLN C 2  442  ? -17.621 -17.575 -25.658  1.00 84.54  ? 442  GLN C C     1 
ATOM   6729  O  O     . GLN C 2  442  ? -17.293 -18.646 -25.140  1.00 91.79  ? 442  GLN C O     1 
ATOM   6730  C  CB    . GLN C 2  442  ? -17.226 -18.673 -27.868  1.00 81.63  ? 442  GLN C CB    1 
ATOM   6731  C  CG    . GLN C 2  442  ? -18.058 -19.194 -29.025  1.00 88.80  ? 442  GLN C CG    1 
ATOM   6732  C  CD    . GLN C 2  442  ? -17.540 -20.513 -29.564  1.00 93.15  ? 442  GLN C CD    1 
ATOM   6733  O  OE1   . GLN C 2  442  ? -16.535 -21.040 -29.086  1.00 88.57  ? 442  GLN C OE1   1 
ATOM   6734  N  NE2   . GLN C 2  442  ? -18.225 -21.053 -30.565  1.00 100.75 ? 442  GLN C NE2   1 
ATOM   6735  N  N     . ASN C 2  443  ? -17.811 -16.475 -24.927  1.00 86.08  ? 443  ASN C N     1 
ATOM   6736  C  CA    . ASN C 2  443  ? -17.816 -16.558 -23.469  1.00 48.79  ? 443  ASN C CA    1 
ATOM   6737  C  C     . ASN C 2  443  ? -19.036 -17.331 -22.982  1.00 48.91  ? 443  ASN C C     1 
ATOM   6738  O  O     . ASN C 2  443  ? -18.912 -18.331 -22.267  1.00 56.61  ? 443  ASN C O     1 
ATOM   6739  C  CB    . ASN C 2  443  ? -17.781 -15.156 -22.853  1.00 45.03  ? 443  ASN C CB    1 
ATOM   6740  C  CG    . ASN C 2  443  ? -16.372 -14.605 -22.724  1.00 65.18  ? 443  ASN C CG    1 
ATOM   6741  O  OD1   . ASN C 2  443  ? -15.562 -15.117 -21.951  1.00 71.31  ? 443  ASN C OD1   1 
ATOM   6742  N  ND2   . ASN C 2  443  ? -16.081 -13.542 -23.467  1.00 78.91  ? 443  ASN C ND2   1 
ATOM   6743  N  N     . ASN C 2  444  ? -20.226 -16.880 -23.371  1.00 46.43  ? 444  ASN C N     1 
ATOM   6744  C  CA    . ASN C 2  444  ? -21.489 -17.523 -23.034  1.00 44.46  ? 444  ASN C CA    1 
ATOM   6745  C  C     . ASN C 2  444  ? -22.395 -17.472 -24.260  1.00 50.06  ? 444  ASN C C     1 
ATOM   6746  O  O     . ASN C 2  444  ? -22.076 -16.765 -25.224  1.00 69.20  ? 444  ASN C O     1 
ATOM   6747  C  CB    . ASN C 2  444  ? -22.136 -16.839 -21.825  1.00 63.63  ? 444  ASN C CB    1 
ATOM   6748  C  CG    . ASN C 2  444  ? -22.273 -15.340 -22.002  1.00 70.77  ? 444  ASN C CG    1 
ATOM   6749  O  OD1   . ASN C 2  444  ? -23.036 -14.870 -22.845  1.00 79.51  ? 444  ASN C OD1   1 
ATOM   6750  N  ND2   . ASN C 2  444  ? -21.546 -14.580 -21.191  1.00 68.78  ? 444  ASN C ND2   1 
ATOM   6751  N  N     . PRO C 2  445  ? -23.509 -18.217 -24.283  1.00 48.03  ? 445  PRO C N     1 
ATOM   6752  C  CA    . PRO C 2  445  ? -24.406 -18.151 -25.453  1.00 69.18  ? 445  PRO C CA    1 
ATOM   6753  C  C     . PRO C 2  445  ? -24.854 -16.745 -25.825  1.00 66.78  ? 445  PRO C C     1 
ATOM   6754  O  O     . PRO C 2  445  ? -24.966 -16.440 -27.019  1.00 76.84  ? 445  PRO C O     1 
ATOM   6755  C  CB    . PRO C 2  445  ? -25.588 -19.027 -25.021  1.00 58.39  ? 445  PRO C CB    1 
ATOM   6756  C  CG    . PRO C 2  445  ? -24.977 -20.026 -24.121  1.00 62.62  ? 445  PRO C CG    1 
ATOM   6757  C  CD    . PRO C 2  445  ? -23.891 -19.307 -23.367  1.00 48.66  ? 445  PRO C CD    1 
ATOM   6758  N  N     . LEU C 2  446  ? -25.114 -15.879 -24.840  1.00 49.48  ? 446  LEU C N     1 
ATOM   6759  C  CA    . LEU C 2  446  ? -25.549 -14.519 -25.150  1.00 46.05  ? 446  LEU C CA    1 
ATOM   6760  C  C     . LEU C 2  446  ? -24.474 -13.752 -25.909  1.00 59.17  ? 446  LEU C C     1 
ATOM   6761  O  O     . LEU C 2  446  ? -24.775 -13.035 -26.871  1.00 69.84  ? 446  LEU C O     1 
ATOM   6762  C  CB    . LEU C 2  446  ? -25.928 -13.776 -23.868  1.00 52.74  ? 446  LEU C CB    1 
ATOM   6763  C  CG    . LEU C 2  446  ? -26.173 -12.269 -24.003  1.00 54.87  ? 446  LEU C CG    1 
ATOM   6764  C  CD1   . LEU C 2  446  ? -27.225 -11.971 -25.064  1.00 60.14  ? 446  LEU C CD1   1 
ATOM   6765  C  CD2   . LEU C 2  446  ? -26.574 -11.663 -22.668  1.00 65.41  ? 446  LEU C CD2   1 
ATOM   6766  N  N     . SER C 2  447  ? -23.214 -13.888 -25.489  1.00 54.58  ? 447  SER C N     1 
ATOM   6767  C  CA    . SER C 2  447  ? -22.124 -13.213 -26.186  1.00 65.51  ? 447  SER C CA    1 
ATOM   6768  C  C     . SER C 2  447  ? -22.035 -13.663 -27.639  1.00 67.43  ? 447  SER C C     1 
ATOM   6769  O  O     . SER C 2  447  ? -21.739 -12.857 -28.529  1.00 59.20  ? 447  SER C O     1 
ATOM   6770  C  CB    . SER C 2  447  ? -20.802 -13.466 -25.460  1.00 64.76  ? 447  SER C CB    1 
ATOM   6771  O  OG    . SER C 2  447  ? -20.568 -14.853 -25.286  1.00 63.83  ? 447  SER C OG    1 
ATOM   6772  N  N     . GLY C 2  448  ? -22.296 -14.945 -27.900  1.00 68.70  ? 448  GLY C N     1 
ATOM   6773  C  CA    . GLY C 2  448  ? -22.263 -15.427 -29.272  1.00 74.71  ? 448  GLY C CA    1 
ATOM   6774  C  C     . GLY C 2  448  ? -23.426 -14.908 -30.096  1.00 66.37  ? 448  GLY C C     1 
ATOM   6775  O  O     . GLY C 2  448  ? -23.250 -14.477 -31.239  1.00 78.46  ? 448  GLY C O     1 
ATOM   6776  N  N     . LEU C 2  449  ? -24.632 -14.942 -29.523  1.00 49.26  ? 449  LEU C N     1 
ATOM   6777  C  CA    . LEU C 2  449  ? -25.806 -14.440 -30.229  1.00 43.04  ? 449  LEU C CA    1 
ATOM   6778  C  C     . LEU C 2  449  ? -25.684 -12.948 -30.513  1.00 49.42  ? 449  LEU C C     1 
ATOM   6779  O  O     . LEU C 2  449  ? -26.066 -12.480 -31.592  1.00 62.26  ? 449  LEU C O     1 
ATOM   6780  C  CB    . LEU C 2  449  ? -27.070 -14.730 -29.419  1.00 53.48  ? 449  LEU C CB    1 
ATOM   6781  C  CG    . LEU C 2  449  ? -28.361 -14.074 -29.920  1.00 46.86  ? 449  LEU C CG    1 
ATOM   6782  C  CD1   . LEU C 2  449  ? -28.696 -14.521 -31.339  1.00 65.88  ? 449  LEU C CD1   1 
ATOM   6783  C  CD2   . LEU C 2  449  ? -29.521 -14.355 -28.974  1.00 51.64  ? 449  LEU C CD2   1 
ATOM   6784  N  N     . THR C 2  450  ? -25.154 -12.185 -29.554  1.00 55.21  ? 450  THR C N     1 
ATOM   6785  C  CA    . THR C 2  450  ? -24.967 -10.753 -29.765  1.00 69.57  ? 450  THR C CA    1 
ATOM   6786  C  C     . THR C 2  450  ? -23.945 -10.484 -30.864  1.00 63.84  ? 450  THR C C     1 
ATOM   6787  O  O     . THR C 2  450  ? -24.125 -9.566  -31.673  1.00 70.74  ? 450  THR C O     1 
ATOM   6788  C  CB    . THR C 2  450  ? -24.542 -10.083 -28.457  1.00 70.99  ? 450  THR C CB    1 
ATOM   6789  O  OG1   . THR C 2  450  ? -25.646 -10.071 -27.543  1.00 66.59  ? 450  THR C OG1   1 
ATOM   6790  C  CG2   . THR C 2  450  ? -24.075 -8.654  -28.704  1.00 80.82  ? 450  THR C CG2   1 
ATOM   6791  N  N     . HIS C 2  451  ? -22.875 -11.284 -30.917  1.00 50.14  ? 451  HIS C N     1 
ATOM   6792  C  CA    . HIS C 2  451  ? -21.824 -11.053 -31.904  1.00 51.91  ? 451  HIS C CA    1 
ATOM   6793  C  C     . HIS C 2  451  ? -22.359 -11.178 -33.325  1.00 51.73  ? 451  HIS C C     1 
ATOM   6794  O  O     . HIS C 2  451  ? -21.927 -10.450 -34.226  1.00 73.68  ? 451  HIS C O     1 
ATOM   6795  C  CB    . HIS C 2  451  ? -20.664 -12.024 -31.680  1.00 61.72  ? 451  HIS C CB    1 
ATOM   6796  C  CG    . HIS C 2  451  ? -19.397 -11.618 -32.368  1.00 66.54  ? 451  HIS C CG    1 
ATOM   6797  N  ND1   . HIS C 2  451  ? -18.307 -12.454 -32.478  1.00 75.14  ? 451  HIS C ND1   1 
ATOM   6798  C  CD2   . HIS C 2  451  ? -19.045 -10.460 -32.976  1.00 74.15  ? 451  HIS C CD2   1 
ATOM   6799  C  CE1   . HIS C 2  451  ? -17.339 -11.830 -33.127  1.00 79.64  ? 451  HIS C CE1   1 
ATOM   6800  N  NE2   . HIS C 2  451  ? -17.762 -10.619 -33.440  1.00 84.43  ? 451  HIS C NE2   1 
ATOM   6801  N  N     . LYS C 2  452  ? -23.306 -12.091 -33.545  1.00 55.83  ? 452  LYS C N     1 
ATOM   6802  C  CA    . LYS C 2  452  ? -23.865 -12.266 -34.881  1.00 58.51  ? 452  LYS C CA    1 
ATOM   6803  C  C     . LYS C 2  452  ? -24.798 -11.121 -35.257  1.00 70.55  ? 452  LYS C C     1 
ATOM   6804  O  O     . LYS C 2  452  ? -24.969 -10.830 -36.446  1.00 80.78  ? 452  LYS C O     1 
ATOM   6805  C  CB    . LYS C 2  452  ? -24.591 -13.607 -34.962  1.00 58.31  ? 452  LYS C CB    1 
ATOM   6806  C  CG    . LYS C 2  452  ? -23.694 -14.789 -34.640  1.00 65.29  ? 452  LYS C CG    1 
ATOM   6807  C  CD    . LYS C 2  452  ? -24.501 -16.020 -34.284  1.00 60.24  ? 452  LYS C CD    1 
ATOM   6808  C  CE    . LYS C 2  452  ? -23.635 -17.054 -33.595  1.00 69.79  ? 452  LYS C CE    1 
ATOM   6809  N  NZ    . LYS C 2  452  ? -24.425 -18.231 -33.146  1.00 66.00  ? 452  LYS C NZ    1 
ATOM   6810  N  N     . ARG C 2  453  ? -25.397 -10.459 -34.268  1.00 60.06  ? 453  ARG C N     1 
ATOM   6811  C  CA    . ARG C 2  453  ? -26.302 -9.342  -34.502  1.00 60.10  ? 453  ARG C CA    1 
ATOM   6812  C  C     . ARG C 2  453  ? -25.609 -7.989  -34.392  1.00 57.51  ? 453  ARG C C     1 
ATOM   6813  O  O     . ARG C 2  453  ? -26.292 -6.963  -34.296  1.00 54.81  ? 453  ARG C O     1 
ATOM   6814  C  CB    . ARG C 2  453  ? -27.480 -9.405  -33.526  1.00 55.80  ? 453  ARG C CB    1 
ATOM   6815  C  CG    . ARG C 2  453  ? -28.135 -10.773 -33.443  1.00 68.98  ? 453  ARG C CG    1 
ATOM   6816  C  CD    . ARG C 2  453  ? -29.381 -10.760 -32.571  1.00 59.53  ? 453  ARG C CD    1 
ATOM   6817  N  NE    . ARG C 2  453  ? -30.603 -10.592 -33.354  1.00 54.95  ? 453  ARG C NE    1 
ATOM   6818  C  CZ    . ARG C 2  453  ? -31.328 -9.479  -33.387  1.00 63.52  ? 453  ARG C CZ    1 
ATOM   6819  N  NH1   . ARG C 2  453  ? -30.963 -8.423  -32.673  1.00 69.72  ? 453  ARG C NH1   1 
ATOM   6820  N  NH2   . ARG C 2  453  ? -32.425 -9.426  -34.130  1.00 66.45  ? 453  ARG C NH2   1 
ATOM   6821  N  N     . ARG C 2  454  ? -24.279 -7.964  -34.404  1.00 59.24  ? 454  ARG C N     1 
ATOM   6822  C  CA    . ARG C 2  454  ? -23.545 -6.710  -34.308  1.00 63.47  ? 454  ARG C CA    1 
ATOM   6823  C  C     . ARG C 2  454  ? -23.642 -5.921  -35.606  1.00 72.39  ? 454  ARG C C     1 
ATOM   6824  O  O     . ARG C 2  454  ? -23.739 -6.482  -36.701  1.00 74.28  ? 454  ARG C O     1 
ATOM   6825  C  CB    . ARG C 2  454  ? -22.071 -6.964  -33.994  1.00 76.68  ? 454  ARG C CB    1 
ATOM   6826  C  CG    . ARG C 2  454  ? -21.800 -7.642  -32.675  1.00 90.98  ? 454  ARG C CG    1 
ATOM   6827  C  CD    . ARG C 2  454  ? -21.988 -6.712  -31.494  1.00 90.50  ? 454  ARG C CD    1 
ATOM   6828  N  NE    . ARG C 2  454  ? -21.382 -7.283  -30.298  1.00 96.58  ? 454  ARG C NE    1 
ATOM   6829  C  CZ    . ARG C 2  454  ? -20.087 -7.201  -30.013  1.00 115.31 ? 454  ARG C CZ    1 
ATOM   6830  N  NH1   . ARG C 2  454  ? -19.265 -6.565  -30.836  1.00 119.63 ? 454  ARG C NH1   1 
ATOM   6831  N  NH2   . ARG C 2  454  ? -19.610 -7.757  -28.909  1.00 119.25 ? 454  ARG C NH2   1 
ATOM   6832  N  N     . LEU C 2  455  ? -23.599 -4.600  -35.470  1.00 86.79  ? 455  LEU C N     1 
ATOM   6833  C  CA    . LEU C 2  455  ? -23.515 -3.681  -36.596  1.00 76.28  ? 455  LEU C CA    1 
ATOM   6834  C  C     . LEU C 2  455  ? -22.272 -2.827  -36.393  1.00 71.25  ? 455  LEU C C     1 
ATOM   6835  O  O     . LEU C 2  455  ? -22.194 -2.065  -35.423  1.00 86.97  ? 455  LEU C O     1 
ATOM   6836  C  CB    . LEU C 2  455  ? -24.769 -2.810  -36.693  1.00 81.37  ? 455  LEU C CB    1 
ATOM   6837  C  CG    . LEU C 2  455  ? -26.123 -3.500  -36.483  1.00 68.98  ? 455  LEU C CG    1 
ATOM   6838  C  CD1   . LEU C 2  455  ? -27.255 -2.495  -36.621  1.00 73.24  ? 455  LEU C CD1   1 
ATOM   6839  C  CD2   . LEU C 2  455  ? -26.323 -4.668  -37.440  1.00 67.76  ? 455  LEU C CD2   1 
ATOM   6840  N  N     . SER C 2  456  ? -21.299 -2.966  -37.288  1.00 53.17  ? 456  SER C N     1 
ATOM   6841  C  CA    . SER C 2  456  ? -19.999 -2.329  -37.131  1.00 75.72  ? 456  SER C CA    1 
ATOM   6842  C  C     . SER C 2  456  ? -19.810 -1.259  -38.197  1.00 81.15  ? 456  SER C C     1 
ATOM   6843  O  O     . SER C 2  456  ? -19.969 -1.532  -39.391  1.00 79.97  ? 456  SER C O     1 
ATOM   6844  C  CB    . SER C 2  456  ? -18.876 -3.366  -37.208  1.00 82.48  ? 456  SER C CB    1 
ATOM   6845  O  OG    . SER C 2  456  ? -17.600 -2.757  -37.120  1.00 90.14  ? 456  SER C OG    1 
ATOM   6846  N  N     . ALA C 2  457  ? -19.475 -0.042  -37.760  1.00 83.07  ? 457  ALA C N     1 
ATOM   6847  C  CA    . ALA C 2  457  ? -19.155 1.030   -38.696  1.00 92.78  ? 457  ALA C CA    1 
ATOM   6848  C  C     . ALA C 2  457  ? -17.746 0.891   -39.258  1.00 105.18 ? 457  ALA C C     1 
ATOM   6849  O  O     . ALA C 2  457  ? -17.488 1.319   -40.389  1.00 117.05 ? 457  ALA C O     1 
ATOM   6850  C  CB    . ALA C 2  457  ? -19.313 2.390   -38.014  1.00 89.70  ? 457  ALA C CB    1 
ATOM   6851  N  N     . LEU C 2  458  ? -16.835 0.297   -38.494  1.00 99.20  ? 458  LEU C N     1 
ATOM   6852  C  CA    . LEU C 2  458  ? -15.449 0.172   -38.911  1.00 110.02 ? 458  LEU C CA    1 
ATOM   6853  C  C     . LEU C 2  458  ? -15.301 -0.880  -40.008  1.00 107.04 ? 458  LEU C C     1 
ATOM   6854  O  O     . LEU C 2  458  ? -16.186 -1.709  -40.242  1.00 105.05 ? 458  LEU C O     1 
ATOM   6855  C  CB    . LEU C 2  458  ? -14.570 -0.193  -37.714  1.00 122.21 ? 458  LEU C CB    1 
ATOM   6856  C  CG    . LEU C 2  458  ? -14.756 0.688   -36.477  1.00 107.72 ? 458  LEU C CG    1 
ATOM   6857  C  CD1   . LEU C 2  458  ? -14.212 0.001   -35.236  1.00 105.16 ? 458  LEU C CD1   1 
ATOM   6858  C  CD2   . LEU C 2  458  ? -14.090 2.040   -36.678  1.00 129.52 ? 458  LEU C CD2   1 
ATOM   6859  N  N     . GLY C 2  459  ? -14.155 -0.837  -40.687  1.00 82.50  ? 459  GLY C N     1 
ATOM   6860  C  CA    . GLY C 2  459  ? -13.842 -1.794  -41.720  1.00 85.74  ? 459  GLY C CA    1 
ATOM   6861  C  C     . GLY C 2  459  ? -13.673 -1.158  -43.085  1.00 98.52  ? 459  GLY C C     1 
ATOM   6862  O  O     . GLY C 2  459  ? -13.799 0.060   -43.251  1.00 109.35 ? 459  GLY C O     1 
ATOM   6863  N  N     . PRO C 2  460  ? -13.381 -1.979  -44.093  1.00 89.02  ? 460  PRO C N     1 
ATOM   6864  C  CA    . PRO C 2  460  ? -13.229 -1.450  -45.454  1.00 80.76  ? 460  PRO C CA    1 
ATOM   6865  C  C     . PRO C 2  460  ? -14.562 -0.981  -46.016  1.00 85.96  ? 460  PRO C C     1 
ATOM   6866  O  O     . PRO C 2  460  ? -15.601 -1.614  -45.815  1.00 88.55  ? 460  PRO C O     1 
ATOM   6867  C  CB    . PRO C 2  460  ? -12.678 -2.645  -46.239  1.00 72.39  ? 460  PRO C CB    1 
ATOM   6868  C  CG    . PRO C 2  460  ? -13.170 -3.838  -45.486  1.00 56.70  ? 460  PRO C CG    1 
ATOM   6869  C  CD    . PRO C 2  460  ? -13.175 -3.436  -44.037  1.00 75.91  ? 460  PRO C CD    1 
ATOM   6870  N  N     . GLY C 2  461  ? -14.520 0.143   -46.732  1.00 91.42  ? 461  GLY C N     1 
ATOM   6871  C  CA    . GLY C 2  461  ? -15.712 0.768   -47.258  1.00 100.36 ? 461  GLY C CA    1 
ATOM   6872  C  C     . GLY C 2  461  ? -16.473 1.622   -46.270  1.00 112.00 ? 461  GLY C C     1 
ATOM   6873  O  O     . GLY C 2  461  ? -17.337 2.404   -46.686  1.00 126.10 ? 461  GLY C O     1 
ATOM   6874  N  N     . GLY C 2  462  ? -16.183 1.503   -44.978  1.00 107.27 ? 462  GLY C N     1 
ATOM   6875  C  CA    . GLY C 2  462  ? -16.855 2.299   -43.973  1.00 105.98 ? 462  GLY C CA    1 
ATOM   6876  C  C     . GLY C 2  462  ? -16.088 3.553   -43.610  1.00 128.47 ? 462  GLY C C     1 
ATOM   6877  O  O     . GLY C 2  462  ? -16.093 4.534   -44.360  1.00 124.24 ? 462  GLY C O     1 
ATOM   6878  N  N     . LEU C 2  463  ? -15.417 3.531   -42.460  1.00 130.27 ? 463  LEU C N     1 
ATOM   6879  C  CA    . LEU C 2  463  ? -14.685 4.694   -41.984  1.00 130.83 ? 463  LEU C CA    1 
ATOM   6880  C  C     . LEU C 2  463  ? -13.483 4.241   -41.172  1.00 129.21 ? 463  LEU C C     1 
ATOM   6881  O  O     . LEU C 2  463  ? -13.442 3.120   -40.655  1.00 119.74 ? 463  LEU C O     1 
ATOM   6882  C  CB    . LEU C 2  463  ? -15.585 5.618   -41.148  1.00 139.62 ? 463  LEU C CB    1 
ATOM   6883  C  CG    . LEU C 2  463  ? -16.408 5.003   -40.007  1.00 111.55 ? 463  LEU C CG    1 
ATOM   6884  C  CD1   . LEU C 2  463  ? -15.602 4.862   -38.717  1.00 119.35 ? 463  LEU C CD1   1 
ATOM   6885  C  CD2   . LEU C 2  463  ? -17.677 5.808   -39.759  1.00 132.05 ? 463  LEU C CD2   1 
ATOM   6886  N  N     . SER C 2  464  ? -12.503 5.135   -41.065  1.00 131.55 ? 464  SER C N     1 
ATOM   6887  C  CA    . SER C 2  464  ? -11.347 4.929   -40.206  1.00 142.39 ? 464  SER C CA    1 
ATOM   6888  C  C     . SER C 2  464  ? -11.672 5.350   -38.780  1.00 145.46 ? 464  SER C C     1 
ATOM   6889  O  O     . SER C 2  464  ? -12.425 6.299   -38.548  1.00 156.30 ? 464  SER C O     1 
ATOM   6890  C  CB    . SER C 2  464  ? -10.140 5.719   -40.715  1.00 145.22 ? 464  SER C CB    1 
ATOM   6891  O  OG    . SER C 2  464  ? -9.064  5.661   -39.791  1.00 167.46 ? 464  SER C OG    1 
ATOM   6892  N  N     . ARG C 2  465  ? -11.088 4.627   -37.820  1.00 139.02 ? 465  ARG C N     1 
ATOM   6893  C  CA    . ARG C 2  465  ? -11.277 4.970   -36.415  1.00 154.67 ? 465  ARG C CA    1 
ATOM   6894  C  C     . ARG C 2  465  ? -10.726 6.354   -36.103  1.00 164.51 ? 465  ARG C C     1 
ATOM   6895  O  O     . ARG C 2  465  ? -11.238 7.045   -35.214  1.00 164.85 ? 465  ARG C O     1 
ATOM   6896  C  CB    . ARG C 2  465  ? -10.616 3.913   -35.530  1.00 144.81 ? 465  ARG C CB    1 
ATOM   6897  C  CG    . ARG C 2  465  ? -10.722 4.183   -34.040  1.00 131.58 ? 465  ARG C CG    1 
ATOM   6898  C  CD    . ARG C 2  465  ? -10.112 3.047   -33.241  1.00 112.99 ? 465  ARG C CD    1 
ATOM   6899  N  NE    . ARG C 2  465  ? -10.848 1.801   -33.430  1.00 109.05 ? 465  ARG C NE    1 
ATOM   6900  C  CZ    . ARG C 2  465  ? -10.352 0.593   -33.185  1.00 151.01 ? 465  ARG C CZ    1 
ATOM   6901  N  NH1   . ARG C 2  465  ? -9.107  0.458   -32.748  1.00 160.83 ? 465  ARG C NH1   1 
ATOM   6902  N  NH2   . ARG C 2  465  ? -11.100 -0.483  -33.385  1.00 159.01 ? 465  ARG C NH2   1 
ATOM   6903  N  N     . GLU C 2  466  ? -9.695  6.781   -36.831  1.00 163.45 ? 466  GLU C N     1 
ATOM   6904  C  CA    . GLU C 2  466  ? -9.123  8.108   -36.652  1.00 171.76 ? 466  GLU C CA    1 
ATOM   6905  C  C     . GLU C 2  466  ? -9.932  9.202   -37.337  1.00 162.49 ? 466  GLU C C     1 
ATOM   6906  O  O     . GLU C 2  466  ? -9.674  10.384  -37.086  1.00 171.57 ? 466  GLU C O     1 
ATOM   6907  C  CB    . GLU C 2  466  ? -7.684  8.123   -37.170  1.00 176.81 ? 466  GLU C CB    1 
ATOM   6908  C  CG    . GLU C 2  466  ? -6.780  7.105   -36.491  1.00 183.53 ? 466  GLU C CG    1 
ATOM   6909  C  CD    . GLU C 2  466  ? -5.410  7.017   -37.131  1.00 191.26 ? 466  GLU C CD    1 
ATOM   6910  O  OE1   . GLU C 2  466  ? -5.218  7.606   -38.216  1.00 201.21 ? 466  GLU C OE1   1 
ATOM   6911  O  OE2   . GLU C 2  466  ? -4.523  6.358   -36.548  1.00 178.48 ? 466  GLU C OE2   1 
ATOM   6912  N  N     . ARG C 2  467  ? -10.894 8.847   -38.189  1.00 152.52 ? 467  ARG C N     1 
ATOM   6913  C  CA    . ARG C 2  467  ? -11.752 9.821   -38.850  1.00 151.73 ? 467  ARG C CA    1 
ATOM   6914  C  C     . ARG C 2  467  ? -13.175 9.832   -38.311  1.00 149.77 ? 467  ARG C C     1 
ATOM   6915  O  O     . ARG C 2  467  ? -14.016 10.567  -38.840  1.00 151.43 ? 467  ARG C O     1 
ATOM   6916  C  CB    . ARG C 2  467  ? -11.795 9.565   -40.361  1.00 147.38 ? 467  ARG C CB    1 
ATOM   6917  C  CG    . ARG C 2  467  ? -10.662 10.189  -41.154  1.00 144.20 ? 467  ARG C CG    1 
ATOM   6918  C  CD    . ARG C 2  467  ? -11.091 10.388  -42.600  1.00 143.34 ? 467  ARG C CD    1 
ATOM   6919  N  NE    . ARG C 2  467  ? -10.101 9.891   -43.550  1.00 168.70 ? 467  ARG C NE    1 
ATOM   6920  C  CZ    . ARG C 2  467  ? -9.205  10.654  -44.165  1.00 157.82 ? 467  ARG C CZ    1 
ATOM   6921  N  NH1   . ARG C 2  467  ? -9.170  11.959  -43.935  1.00 141.48 ? 467  ARG C NH1   1 
ATOM   6922  N  NH2   . ARG C 2  467  ? -8.343  10.111  -45.014  1.00 164.40 ? 467  ARG C NH2   1 
ATOM   6923  N  N     . ALA C 2  468  ? -13.472 9.037   -37.287  1.00 153.10 ? 468  ALA C N     1 
ATOM   6924  C  CA    . ALA C 2  468  ? -14.813 8.968   -36.716  1.00 152.76 ? 468  ALA C CA    1 
ATOM   6925  C  C     . ALA C 2  468  ? -14.933 10.017  -35.617  1.00 159.13 ? 468  ALA C C     1 
ATOM   6926  O  O     . ALA C 2  468  ? -14.334 9.876   -34.546  1.00 145.60 ? 468  ALA C O     1 
ATOM   6927  C  CB    . ALA C 2  468  ? -15.096 7.570   -36.173  1.00 161.05 ? 468  ALA C CB    1 
ATOM   6928  N  N     . GLY C 2  469  ? -15.709 11.067  -35.880  1.00 154.45 ? 469  GLY C N     1 
ATOM   6929  C  CA    . GLY C 2  469  ? -15.912 12.121  -34.912  1.00 131.66 ? 469  GLY C CA    1 
ATOM   6930  C  C     . GLY C 2  469  ? -17.015 11.800  -33.923  1.00 117.95 ? 469  GLY C C     1 
ATOM   6931  O  O     . GLY C 2  469  ? -17.627 10.732  -33.939  1.00 109.92 ? 469  GLY C O     1 
ATOM   6932  N  N     . LEU C 2  470  ? -17.278 12.768  -33.045  1.00 135.95 ? 470  LEU C N     1 
ATOM   6933  C  CA    . LEU C 2  470  ? -18.274 12.594  -31.993  1.00 152.24 ? 470  LEU C CA    1 
ATOM   6934  C  C     . LEU C 2  470  ? -19.707 12.637  -32.510  1.00 146.58 ? 470  LEU C C     1 
ATOM   6935  O  O     . LEU C 2  470  ? -20.633 12.535  -31.698  1.00 135.71 ? 470  LEU C O     1 
ATOM   6936  C  CB    . LEU C 2  470  ? -18.090 13.662  -30.913  1.00 145.91 ? 470  LEU C CB    1 
ATOM   6937  C  CG    . LEU C 2  470  ? -16.702 13.802  -30.286  1.00 125.30 ? 470  LEU C CG    1 
ATOM   6938  C  CD1   . LEU C 2  470  ? -16.746 14.794  -29.134  1.00 108.08 ? 470  LEU C CD1   1 
ATOM   6939  C  CD2   . LEU C 2  470  ? -16.168 12.456  -29.820  1.00 112.61 ? 470  LEU C CD2   1 
ATOM   6940  N  N     . GLU C 2  471  ? -19.920 12.787  -33.817  1.00 133.29 ? 471  GLU C N     1 
ATOM   6941  C  CA    . GLU C 2  471  ? -21.264 12.807  -34.381  1.00 124.82 ? 471  GLU C CA    1 
ATOM   6942  C  C     . GLU C 2  471  ? -21.687 11.469  -34.968  1.00 119.17 ? 471  GLU C C     1 
ATOM   6943  O  O     . GLU C 2  471  ? -22.883 11.160  -34.982  1.00 107.44 ? 471  GLU C O     1 
ATOM   6944  C  CB    . GLU C 2  471  ? -21.371 13.890  -35.462  1.00 128.78 ? 471  GLU C CB    1 
ATOM   6945  C  CG    . GLU C 2  471  ? -22.791 14.145  -35.947  1.00 155.42 ? 471  GLU C CG    1 
ATOM   6946  C  CD    . GLU C 2  471  ? -22.879 15.290  -36.936  1.00 161.88 ? 471  GLU C CD    1 
ATOM   6947  O  OE1   . GLU C 2  471  ? -21.841 15.932  -37.202  1.00 172.37 ? 471  GLU C OE1   1 
ATOM   6948  O  OE2   . GLU C 2  471  ? -23.989 15.549  -37.448  1.00 153.11 ? 471  GLU C OE2   1 
ATOM   6949  N  N     . VAL C 2  472  ? -20.737 10.665  -35.449  1.00 113.44 ? 472  VAL C N     1 
ATOM   6950  C  CA    . VAL C 2  472  ? -21.086 9.348   -35.970  1.00 115.09 ? 472  VAL C CA    1 
ATOM   6951  C  C     . VAL C 2  472  ? -21.459 8.404   -34.836  1.00 104.54 ? 472  VAL C C     1 
ATOM   6952  O  O     . VAL C 2  472  ? -22.242 7.466   -35.029  1.00 85.36  ? 472  VAL C O     1 
ATOM   6953  C  CB    . VAL C 2  472  ? -19.924 8.780   -36.807  1.00 109.35 ? 472  VAL C CB    1 
ATOM   6954  C  CG1   . VAL C 2  472  ? -20.414 7.659   -37.714  1.00 108.66 ? 472  VAL C CG1   1 
ATOM   6955  C  CG2   . VAL C 2  472  ? -19.257 9.880   -37.613  1.00 129.62 ? 472  VAL C CG2   1 
ATOM   6956  N  N     . ARG C 2  473  ? -20.926 8.640   -33.638  1.00 108.36 ? 473  ARG C N     1 
ATOM   6957  C  CA    . ARG C 2  473  ? -20.992 7.658   -32.565  1.00 92.14  ? 473  ARG C CA    1 
ATOM   6958  C  C     . ARG C 2  473  ? -22.244 7.774   -31.707  1.00 98.08  ? 473  ARG C C     1 
ATOM   6959  O  O     . ARG C 2  473  ? -22.667 6.777   -31.112  1.00 119.30 ? 473  ARG C O     1 
ATOM   6960  C  CB    . ARG C 2  473  ? -19.751 7.781   -31.673  1.00 84.52  ? 473  ARG C CB    1 
ATOM   6961  C  CG    . ARG C 2  473  ? -18.456 7.995   -32.445  1.00 82.15  ? 473  ARG C CG    1 
ATOM   6962  C  CD    . ARG C 2  473  ? -17.291 8.311   -31.516  1.00 83.09  ? 473  ARG C CD    1 
ATOM   6963  N  NE    . ARG C 2  473  ? -16.647 7.109   -30.990  1.00 81.30  ? 473  ARG C NE    1 
ATOM   6964  C  CZ    . ARG C 2  473  ? -15.494 6.624   -31.439  1.00 98.16  ? 473  ARG C CZ    1 
ATOM   6965  N  NH1   . ARG C 2  473  ? -14.851 7.239   -32.422  1.00 93.81  ? 473  ARG C NH1   1 
ATOM   6966  N  NH2   . ARG C 2  473  ? -14.979 5.527   -30.902  1.00 91.24  ? 473  ARG C NH2   1 
ATOM   6967  N  N     . ASP C 2  474  ? -22.851 8.952   -31.621  1.00 108.03 ? 474  ASP C N     1 
ATOM   6968  C  CA    . ASP C 2  474  ? -23.956 9.139   -30.695  1.00 115.02 ? 474  ASP C CA    1 
ATOM   6969  C  C     . ASP C 2  474  ? -25.279 8.681   -31.312  1.00 110.41 ? 474  ASP C C     1 
ATOM   6970  O  O     . ASP C 2  474  ? -25.376 8.383   -32.504  1.00 93.66  ? 474  ASP C O     1 
ATOM   6971  C  CB    . ASP C 2  474  ? -24.034 10.598  -30.243  1.00 100.45 ? 474  ASP C CB    1 
ATOM   6972  C  CG    . ASP C 2  474  ? -23.966 11.575  -31.398  1.00 131.81 ? 474  ASP C CG    1 
ATOM   6973  O  OD1   . ASP C 2  474  ? -24.187 11.158  -32.553  1.00 146.74 ? 474  ASP C OD1   1 
ATOM   6974  O  OD2   . ASP C 2  474  ? -23.683 12.766  -31.148  1.00 122.75 ? 474  ASP C OD2   1 
ATOM   6975  N  N     . VAL C 2  475  ? -26.310 8.629   -30.466  1.00 101.15 ? 475  VAL C N     1 
ATOM   6976  C  CA    . VAL C 2  475  ? -27.591 8.055   -30.859  1.00 77.19  ? 475  VAL C CA    1 
ATOM   6977  C  C     . VAL C 2  475  ? -28.334 9.006   -31.788  1.00 96.18  ? 475  VAL C C     1 
ATOM   6978  O  O     . VAL C 2  475  ? -28.386 10.222  -31.556  1.00 127.08 ? 475  VAL C O     1 
ATOM   6979  C  CB    . VAL C 2  475  ? -28.428 7.731   -29.609  1.00 100.14 ? 475  VAL C CB    1 
ATOM   6980  C  CG1   . VAL C 2  475  ? -29.763 7.118   -30.001  1.00 92.09  ? 475  VAL C CG1   1 
ATOM   6981  C  CG2   . VAL C 2  475  ? -27.659 6.798   -28.685  1.00 109.69 ? 475  VAL C CG2   1 
ATOM   6982  N  N     . HIS C 2  476  ? -28.924 8.445   -32.854  1.00 95.45  ? 476  HIS C N     1 
ATOM   6983  C  CA    . HIS C 2  476  ? -29.730 9.158   -33.831  1.00 100.50 ? 476  HIS C CA    1 
ATOM   6984  C  C     . HIS C 2  476  ? -31.202 8.783   -33.678  1.00 95.03  ? 476  HIS C C     1 
ATOM   6985  O  O     . HIS C 2  476  ? -31.513 7.621   -33.395  1.00 102.03 ? 476  HIS C O     1 
ATOM   6986  C  CB    . HIS C 2  476  ? -29.265 8.838   -35.258  1.00 105.73 ? 476  HIS C CB    1 
ATOM   6987  C  CG    . HIS C 2  476  ? -29.825 9.756   -36.298  1.00 94.16  ? 476  HIS C CG    1 
ATOM   6988  N  ND1   . HIS C 2  476  ? -31.008 9.499   -36.957  1.00 96.03  ? 476  HIS C ND1   1 
ATOM   6989  C  CD2   . HIS C 2  476  ? -29.369 10.932  -36.789  1.00 90.27  ? 476  HIS C CD2   1 
ATOM   6990  C  CE1   . HIS C 2  476  ? -31.255 10.476  -37.811  1.00 106.26 ? 476  HIS C CE1   1 
ATOM   6991  N  NE2   . HIS C 2  476  ? -30.276 11.359  -37.729  1.00 109.00 ? 476  HIS C NE2   1 
ATOM   6992  N  N     . PRO C 2  477  ? -32.126 9.734   -33.849  1.00 85.57  ? 477  PRO C N     1 
ATOM   6993  C  CA    . PRO C 2  477  ? -33.551 9.415   -33.649  1.00 100.50 ? 477  PRO C CA    1 
ATOM   6994  C  C     . PRO C 2  477  ? -34.097 8.380   -34.619  1.00 85.37  ? 477  PRO C C     1 
ATOM   6995  O  O     . PRO C 2  477  ? -35.159 7.807   -34.349  1.00 81.27  ? 477  PRO C O     1 
ATOM   6996  C  CB    . PRO C 2  477  ? -34.245 10.773  -33.829  1.00 110.42 ? 477  PRO C CB    1 
ATOM   6997  C  CG    . PRO C 2  477  ? -33.276 11.598  -34.611  1.00 105.77 ? 477  PRO C CG    1 
ATOM   6998  C  CD    . PRO C 2  477  ? -31.922 11.162  -34.147  1.00 81.82  ? 477  PRO C CD    1 
ATOM   6999  N  N     . SER C 2  478  ? -33.415 8.123   -35.735  1.00 69.01  ? 478  SER C N     1 
ATOM   7000  C  CA    . SER C 2  478  ? -33.848 7.083   -36.658  1.00 85.44  ? 478  SER C CA    1 
ATOM   7001  C  C     . SER C 2  478  ? -33.413 5.688   -36.224  1.00 95.78  ? 478  SER C C     1 
ATOM   7002  O  O     . SER C 2  478  ? -33.814 4.708   -36.860  1.00 97.97  ? 478  SER C O     1 
ATOM   7003  C  CB    . SER C 2  478  ? -33.321 7.372   -38.067  1.00 97.56  ? 478  SER C CB    1 
ATOM   7004  O  OG    . SER C 2  478  ? -31.905 7.399   -38.089  1.00 103.65 ? 478  SER C OG    1 
ATOM   7005  N  N     . HIS C 2  479  ? -32.609 5.576   -35.163  1.00 83.72  ? 479  HIS C N     1 
ATOM   7006  C  CA    . HIS C 2  479  ? -32.199 4.280   -34.636  1.00 80.74  ? 479  HIS C CA    1 
ATOM   7007  C  C     . HIS C 2  479  ? -33.293 3.595   -33.826  1.00 89.39  ? 479  HIS C C     1 
ATOM   7008  O  O     . HIS C 2  479  ? -33.097 2.450   -33.402  1.00 89.49  ? 479  HIS C O     1 
ATOM   7009  C  CB    . HIS C 2  479  ? -30.949 4.431   -33.762  1.00 78.94  ? 479  HIS C CB    1 
ATOM   7010  C  CG    . HIS C 2  479  ? -29.755 4.965   -34.491  1.00 79.40  ? 479  HIS C CG    1 
ATOM   7011  N  ND1   . HIS C 2  479  ? -28.616 5.390   -33.841  1.00 80.16  ? 479  HIS C ND1   1 
ATOM   7012  C  CD2   . HIS C 2  479  ? -29.521 5.139   -35.813  1.00 92.34  ? 479  HIS C CD2   1 
ATOM   7013  C  CE1   . HIS C 2  479  ? -27.733 5.806   -34.731  1.00 90.60  ? 479  HIS C CE1   1 
ATOM   7014  N  NE2   . HIS C 2  479  ? -28.257 5.665   -35.935  1.00 78.31  ? 479  HIS C NE2   1 
ATOM   7015  N  N     . TYR C 2  480  ? -34.423 4.263   -33.598  1.00 83.49  ? 480  TYR C N     1 
ATOM   7016  C  CA    . TYR C 2  480  ? -35.501 3.685   -32.803  1.00 79.45  ? 480  TYR C CA    1 
ATOM   7017  C  C     . TYR C 2  480  ? -36.015 2.404   -33.448  1.00 91.00  ? 480  TYR C C     1 
ATOM   7018  O  O     . TYR C 2  480  ? -36.409 2.396   -34.618  1.00 94.46  ? 480  TYR C O     1 
ATOM   7019  C  CB    . TYR C 2  480  ? -36.638 4.696   -32.650  1.00 76.64  ? 480  TYR C CB    1 
ATOM   7020  C  CG    . TYR C 2  480  ? -37.705 4.286   -31.659  1.00 99.35  ? 480  TYR C CG    1 
ATOM   7021  C  CD1   . TYR C 2  480  ? -38.716 3.404   -32.020  1.00 107.32 ? 480  TYR C CD1   1 
ATOM   7022  C  CD2   . TYR C 2  480  ? -37.708 4.790   -30.365  1.00 98.78  ? 480  TYR C CD2   1 
ATOM   7023  C  CE1   . TYR C 2  480  ? -39.690 3.028   -31.120  1.00 103.77 ? 480  TYR C CE1   1 
ATOM   7024  C  CE2   . TYR C 2  480  ? -38.684 4.422   -29.458  1.00 98.07  ? 480  TYR C CE2   1 
ATOM   7025  C  CZ    . TYR C 2  480  ? -39.673 3.542   -29.843  1.00 104.73 ? 480  TYR C CZ    1 
ATOM   7026  O  OH    . TYR C 2  480  ? -40.648 3.169   -28.949  1.00 109.93 ? 480  TYR C OH    1 
ATOM   7027  N  N     . GLY C 2  481  ? -36.015 1.321   -32.672  1.00 85.20  ? 481  GLY C N     1 
ATOM   7028  C  CA    . GLY C 2  481  ? -36.456 0.031   -33.156  1.00 96.70  ? 481  GLY C CA    1 
ATOM   7029  C  C     . GLY C 2  481  ? -35.552 -0.622  -34.176  1.00 84.92  ? 481  GLY C C     1 
ATOM   7030  O  O     . GLY C 2  481  ? -35.905 -1.686  -34.696  1.00 63.47  ? 481  GLY C O     1 
ATOM   7031  N  N     . ARG C 2  482  ? -34.398 -0.026  -34.479  1.00 74.79  ? 482  ARG C N     1 
ATOM   7032  C  CA    . ARG C 2  482  ? -33.473 -0.577  -35.464  1.00 67.01  ? 482  ARG C CA    1 
ATOM   7033  C  C     . ARG C 2  482  ? -32.127 -0.922  -34.844  1.00 67.89  ? 482  ARG C C     1 
ATOM   7034  O  O     . ARG C 2  482  ? -31.707 -2.082  -34.906  1.00 72.79  ? 482  ARG C O     1 
ATOM   7035  C  CB    . ARG C 2  482  ? -33.311 0.409   -36.627  1.00 85.10  ? 482  ARG C CB    1 
ATOM   7036  C  CG    . ARG C 2  482  ? -34.629 0.733   -37.303  1.00 100.58 ? 482  ARG C CG    1 
ATOM   7037  C  CD    . ARG C 2  482  ? -34.477 1.645   -38.505  1.00 101.83 ? 482  ARG C CD    1 
ATOM   7038  N  NE    . ARG C 2  482  ? -35.740 1.735   -39.230  1.00 86.64  ? 482  ARG C NE    1 
ATOM   7039  C  CZ    . ARG C 2  482  ? -36.726 2.565   -38.909  1.00 94.34  ? 482  ARG C CZ    1 
ATOM   7040  N  NH1   . ARG C 2  482  ? -36.593 3.388   -37.877  1.00 88.33  ? 482  ARG C NH1   1 
ATOM   7041  N  NH2   . ARG C 2  482  ? -37.846 2.574   -39.616  1.00 106.98 ? 482  ARG C NH2   1 
ATOM   7042  N  N     . MET C 2  483  ? -31.432 0.046   -34.254  1.00 73.13  ? 483  MET C N     1 
ATOM   7043  C  CA    . MET C 2  483  ? -30.207 -0.209  -33.512  1.00 87.58  ? 483  MET C CA    1 
ATOM   7044  C  C     . MET C 2  483  ? -30.410 0.199   -32.061  1.00 80.06  ? 483  MET C C     1 
ATOM   7045  O  O     . MET C 2  483  ? -31.080 1.196   -31.773  1.00 63.70  ? 483  MET C O     1 
ATOM   7046  C  CB    . MET C 2  483  ? -29.014 0.547   -34.107  1.00 89.61  ? 483  MET C CB    1 
ATOM   7047  C  CG    . MET C 2  483  ? -27.671 -0.122  -33.838  1.00 85.93  ? 483  MET C CG    1 
ATOM   7048  S  SD    . MET C 2  483  ? -26.261 0.859   -34.384  1.00 68.45  ? 483  MET C SD    1 
ATOM   7049  C  CE    . MET C 2  483  ? -26.258 2.154   -33.148  1.00 73.31  ? 483  MET C CE    1 
ATOM   7050  N  N     . CYS C 2  484  ? -29.831 -0.576  -31.153  1.00 74.81  ? 484  CYS C N     1 
ATOM   7051  C  CA    . CYS C 2  484  ? -30.024 -0.324  -29.735  1.00 73.11  ? 484  CYS C CA    1 
ATOM   7052  C  C     . CYS C 2  484  ? -29.288 0.947   -29.317  1.00 74.46  ? 484  CYS C C     1 
ATOM   7053  O  O     . CYS C 2  484  ? -28.148 1.172   -29.735  1.00 69.80  ? 484  CYS C O     1 
ATOM   7054  C  CB    . CYS C 2  484  ? -29.523 -1.507  -28.913  1.00 82.36  ? 484  CYS C CB    1 
ATOM   7055  S  SG    . CYS C 2  484  ? -29.958 -1.423  -27.165  1.00 80.50  ? 484  CYS C SG    1 
ATOM   7056  N  N     . PRO C 2  485  ? -29.912 1.800   -28.499  1.00 71.03  ? 485  PRO C N     1 
ATOM   7057  C  CA    . PRO C 2  485  ? -29.215 2.983   -27.984  1.00 77.76  ? 485  PRO C CA    1 
ATOM   7058  C  C     . PRO C 2  485  ? -28.392 2.721   -26.735  1.00 76.17  ? 485  PRO C C     1 
ATOM   7059  O  O     . PRO C 2  485  ? -27.693 3.633   -26.274  1.00 69.99  ? 485  PRO C O     1 
ATOM   7060  C  CB    . PRO C 2  485  ? -30.377 3.937   -27.673  1.00 71.31  ? 485  PRO C CB    1 
ATOM   7061  C  CG    . PRO C 2  485  ? -31.466 3.024   -27.243  1.00 51.96  ? 485  PRO C CG    1 
ATOM   7062  C  CD    . PRO C 2  485  ? -31.324 1.768   -28.077  1.00 61.76  ? 485  PRO C CD    1 
ATOM   7063  N  N     . ILE C 2  486  ? -28.452 1.511   -26.189  1.00 79.80  ? 486  ILE C N     1 
ATOM   7064  C  CA    . ILE C 2  486  ? -27.770 1.161   -24.950  1.00 76.14  ? 486  ILE C CA    1 
ATOM   7065  C  C     . ILE C 2  486  ? -26.559 0.275   -25.211  1.00 79.10  ? 486  ILE C C     1 
ATOM   7066  O  O     . ILE C 2  486  ? -25.445 0.590   -24.790  1.00 78.01  ? 486  ILE C O     1 
ATOM   7067  C  CB    . ILE C 2  486  ? -28.744 0.485   -23.959  1.00 72.13  ? 486  ILE C CB    1 
ATOM   7068  C  CG1   . ILE C 2  486  ? -29.901 1.423   -23.618  1.00 78.83  ? 486  ILE C CG1   1 
ATOM   7069  C  CG2   . ILE C 2  486  ? -28.011 0.064   -22.698  1.00 71.50  ? 486  ILE C CG2   1 
ATOM   7070  C  CD1   . ILE C 2  486  ? -29.472 2.652   -22.860  1.00 83.49  ? 486  ILE C CD1   1 
ATOM   7071  N  N     . GLU C 2  487  ? -26.760 -0.842  -25.908  1.00 81.12  ? 487  GLU C N     1 
ATOM   7072  C  CA    . GLU C 2  487  ? -25.698 -1.829  -26.076  1.00 81.91  ? 487  GLU C CA    1 
ATOM   7073  C  C     . GLU C 2  487  ? -24.654 -1.308  -27.055  1.00 74.98  ? 487  GLU C C     1 
ATOM   7074  O  O     . GLU C 2  487  ? -24.903 -1.229  -28.263  1.00 85.36  ? 487  GLU C O     1 
ATOM   7075  C  CB    . GLU C 2  487  ? -26.272 -3.161  -26.546  1.00 68.77  ? 487  GLU C CB    1 
ATOM   7076  C  CG    . GLU C 2  487  ? -25.225 -4.258  -26.641  1.00 81.26  ? 487  GLU C CG    1 
ATOM   7077  C  CD    . GLU C 2  487  ? -25.814 -5.650  -26.555  1.00 99.50  ? 487  GLU C CD    1 
ATOM   7078  O  OE1   . GLU C 2  487  ? -26.968 -5.842  -26.989  1.00 93.33  ? 487  GLU C OE1   1 
ATOM   7079  O  OE2   . GLU C 2  487  ? -25.121 -6.555  -26.045  1.00 105.02 ? 487  GLU C OE2   1 
ATOM   7080  N  N     . THR C 2  488  ? -23.486 -0.952  -26.526  1.00 75.57  ? 488  THR C N     1 
ATOM   7081  C  CA    . THR C 2  488  ? -22.316 -0.514  -27.276  1.00 72.22  ? 488  THR C CA    1 
ATOM   7082  C  C     . THR C 2  488  ? -21.128 -0.498  -26.321  1.00 69.46  ? 488  THR C C     1 
ATOM   7083  O  O     . THR C 2  488  ? -21.295 -0.182  -25.136  1.00 75.39  ? 488  THR C O     1 
ATOM   7084  C  CB    . THR C 2  488  ? -22.543 0.866   -27.903  1.00 78.89  ? 488  THR C CB    1 
ATOM   7085  O  OG1   . THR C 2  488  ? -21.306 1.373   -28.424  1.00 76.56  ? 488  THR C OG1   1 
ATOM   7086  C  CG2   . THR C 2  488  ? -23.098 1.843   -26.880  1.00 78.58  ? 488  THR C CG2   1 
ATOM   7087  N  N     . PRO C 2  489  ? -19.928 -0.853  -26.777  1.00 75.81  ? 489  PRO C N     1 
ATOM   7088  C  CA    . PRO C 2  489  ? -18.771 -0.833  -25.877  1.00 93.51  ? 489  PRO C CA    1 
ATOM   7089  C  C     . PRO C 2  489  ? -18.483 0.578   -25.385  1.00 84.54  ? 489  PRO C C     1 
ATOM   7090  O  O     . PRO C 2  489  ? -18.850 1.573   -26.012  1.00 98.23  ? 489  PRO C O     1 
ATOM   7091  C  CB    . PRO C 2  489  ? -17.628 -1.368  -26.749  1.00 103.29 ? 489  PRO C CB    1 
ATOM   7092  C  CG    . PRO C 2  489  ? -18.065 -1.086  -28.149  1.00 87.56  ? 489  PRO C CG    1 
ATOM   7093  C  CD    . PRO C 2  489  ? -19.556 -1.264  -28.141  1.00 86.84  ? 489  PRO C CD    1 
ATOM   7094  N  N     . GLU C 2  490  ? -17.834 0.654   -24.226  1.00 54.95  ? 490  GLU C N     1 
ATOM   7095  C  CA    . GLU C 2  490  ? -17.471 1.925   -23.618  1.00 60.63  ? 490  GLU C CA    1 
ATOM   7096  C  C     . GLU C 2  490  ? -16.009 2.278   -23.843  1.00 80.99  ? 490  GLU C C     1 
ATOM   7097  O  O     . GLU C 2  490  ? -15.534 3.289   -23.313  1.00 101.22 ? 490  GLU C O     1 
ATOM   7098  C  CB    . GLU C 2  490  ? -17.790 1.906   -22.123  1.00 96.24  ? 490  GLU C CB    1 
ATOM   7099  C  CG    . GLU C 2  490  ? -17.150 0.765   -21.352  1.00 134.19 ? 490  GLU C CG    1 
ATOM   7100  C  CD    . GLU C 2  490  ? -17.384 0.885   -19.860  1.00 125.10 ? 490  GLU C CD    1 
ATOM   7101  O  OE1   . GLU C 2  490  ? -17.871 1.950   -19.424  1.00 112.25 ? 490  GLU C OE1   1 
ATOM   7102  O  OE2   . GLU C 2  490  ? -17.084 -0.079  -19.125  1.00 115.38 ? 490  GLU C OE2   1 
ATOM   7103  N  N     . GLY C 2  491  ? -15.288 1.471   -24.617  1.00 76.97  ? 491  GLY C N     1 
ATOM   7104  C  CA    . GLY C 2  491  ? -13.904 1.734   -24.923  1.00 104.86 ? 491  GLY C CA    1 
ATOM   7105  C  C     . GLY C 2  491  ? -13.750 2.686   -26.090  1.00 85.11  ? 491  GLY C C     1 
ATOM   7106  O  O     . GLY C 2  491  ? -14.580 3.572   -26.315  1.00 71.64  ? 491  GLY C O     1 
ATOM   7107  N  N     . PRO C 2  492  ? -12.671 2.520   -26.862  1.00 85.50  ? 492  PRO C N     1 
ATOM   7108  C  CA    . PRO C 2  492  ? -12.463 3.388   -28.031  1.00 99.88  ? 492  PRO C CA    1 
ATOM   7109  C  C     . PRO C 2  492  ? -13.431 3.122   -29.173  1.00 90.58  ? 492  PRO C C     1 
ATOM   7110  O  O     . PRO C 2  492  ? -13.465 3.912   -30.125  1.00 84.51  ? 492  PRO C O     1 
ATOM   7111  C  CB    . PRO C 2  492  ? -11.020 3.074   -28.445  1.00 124.41 ? 492  PRO C CB    1 
ATOM   7112  C  CG    . PRO C 2  492  ? -10.802 1.674   -27.975  1.00 111.23 ? 492  PRO C CG    1 
ATOM   7113  C  CD    . PRO C 2  492  ? -11.583 1.542   -26.695  1.00 110.23 ? 492  PRO C CD    1 
ATOM   7114  N  N     . ASN C 2  493  ? -14.212 2.042   -29.113  1.00 87.41  ? 493  ASN C N     1 
ATOM   7115  C  CA    . ASN C 2  493  ? -15.172 1.701   -30.155  1.00 89.91  ? 493  ASN C CA    1 
ATOM   7116  C  C     . ASN C 2  493  ? -16.602 2.057   -29.767  1.00 85.29  ? 493  ASN C C     1 
ATOM   7117  O  O     . ASN C 2  493  ? -17.548 1.405   -30.222  1.00 84.95  ? 493  ASN C O     1 
ATOM   7118  C  CB    . ASN C 2  493  ? -15.076 0.214   -30.498  1.00 95.38  ? 493  ASN C CB    1 
ATOM   7119  C  CG    . ASN C 2  493  ? -13.763 -0.146  -31.155  1.00 104.15 ? 493  ASN C CG    1 
ATOM   7120  O  OD1   . ASN C 2  493  ? -13.218 0.627   -31.942  1.00 115.50 ? 493  ASN C OD1   1 
ATOM   7121  N  ND2   . ASN C 2  493  ? -13.244 -1.325  -30.833  1.00 103.79 ? 493  ASN C ND2   1 
ATOM   7122  N  N     . ILE C 2  494  ? -16.782 3.082   -28.934  1.00 79.10  ? 494  ILE C N     1 
ATOM   7123  C  CA    . ILE C 2  494  ? -18.120 3.457   -28.497  1.00 82.79  ? 494  ILE C CA    1 
ATOM   7124  C  C     . ILE C 2  494  ? -18.869 4.108   -29.652  1.00 83.25  ? 494  ILE C C     1 
ATOM   7125  O  O     . ILE C 2  494  ? -18.346 5.001   -30.331  1.00 73.66  ? 494  ILE C O     1 
ATOM   7126  C  CB    . ILE C 2  494  ? -18.051 4.381   -27.271  1.00 78.20  ? 494  ILE C CB    1 
ATOM   7127  C  CG1   . ILE C 2  494  ? -19.453 4.853   -26.879  1.00 63.95  ? 494  ILE C CG1   1 
ATOM   7128  C  CG2   . ILE C 2  494  ? -17.119 5.562   -27.524  1.00 84.75  ? 494  ILE C CG2   1 
ATOM   7129  C  CD1   . ILE C 2  494  ? -19.508 5.542   -25.538  1.00 77.67  ? 494  ILE C CD1   1 
ATOM   7130  N  N     . GLY C 2  495  ? -20.093 3.646   -29.894  1.00 88.66  ? 495  GLY C N     1 
ATOM   7131  C  CA    . GLY C 2  495  ? -20.907 4.191   -30.961  1.00 100.63 ? 495  GLY C CA    1 
ATOM   7132  C  C     . GLY C 2  495  ? -20.617 3.578   -32.315  1.00 80.30  ? 495  GLY C C     1 
ATOM   7133  O  O     . GLY C 2  495  ? -21.519 3.427   -33.144  1.00 66.22  ? 495  GLY C O     1 
ATOM   7134  N  N     . LEU C 2  496  ? -19.353 3.219   -32.549  1.00 68.46  ? 496  LEU C N     1 
ATOM   7135  C  CA    . LEU C 2  496  ? -18.964 2.608   -33.813  1.00 77.29  ? 496  LEU C CA    1 
ATOM   7136  C  C     . LEU C 2  496  ? -19.477 1.181   -33.949  1.00 84.48  ? 496  LEU C C     1 
ATOM   7137  O  O     . LEU C 2  496  ? -19.552 0.667   -35.071  1.00 78.83  ? 496  LEU C O     1 
ATOM   7138  C  CB    . LEU C 2  496  ? -17.442 2.628   -33.954  1.00 87.48  ? 496  LEU C CB    1 
ATOM   7139  C  CG    . LEU C 2  496  ? -16.792 3.997   -33.750  1.00 75.51  ? 496  LEU C CG    1 
ATOM   7140  C  CD1   . LEU C 2  496  ? -15.274 3.892   -33.792  1.00 99.83  ? 496  LEU C CD1   1 
ATOM   7141  C  CD2   . LEU C 2  496  ? -17.298 4.989   -34.786  1.00 87.22  ? 496  LEU C CD2   1 
ATOM   7142  N  N     . ILE C 2  497  ? -19.826 0.534   -32.840  1.00 75.48  ? 497  ILE C N     1 
ATOM   7143  C  CA    . ILE C 2  497  ? -20.321 -0.837  -32.839  1.00 59.05  ? 497  ILE C CA    1 
ATOM   7144  C  C     . ILE C 2  497  ? -21.631 -0.863  -32.068  1.00 55.21  ? 497  ILE C C     1 
ATOM   7145  O  O     . ILE C 2  497  ? -21.662 -0.526  -30.878  1.00 82.82  ? 497  ILE C O     1 
ATOM   7146  C  CB    . ILE C 2  497  ? -19.311 -1.817  -32.219  1.00 66.95  ? 497  ILE C CB    1 
ATOM   7147  C  CG1   . ILE C 2  497  ? -17.991 -1.784  -32.991  1.00 78.00  ? 497  ILE C CG1   1 
ATOM   7148  C  CG2   . ILE C 2  497  ? -19.880 -3.227  -32.200  1.00 78.96  ? 497  ILE C CG2   1 
ATOM   7149  C  CD1   . ILE C 2  497  ? -16.869 -2.536  -32.309  1.00 113.70 ? 497  ILE C CD1   1 
ATOM   7150  N  N     . GLY C 2  498  ? -22.713 -1.257  -32.745  1.00 64.38  ? 498  GLY C N     1 
ATOM   7151  C  CA    . GLY C 2  498  ? -24.008 -1.391  -32.123  1.00 71.71  ? 498  GLY C CA    1 
ATOM   7152  C  C     . GLY C 2  498  ? -24.559 -2.799  -32.298  1.00 80.98  ? 498  GLY C C     1 
ATOM   7153  O  O     . GLY C 2  498  ? -23.979 -3.646  -32.989  1.00 86.27  ? 498  GLY C O     1 
ATOM   7154  N  N     . SER C 2  499  ? -25.695 -3.038  -31.649  1.00 72.28  ? 499  SER C N     1 
ATOM   7155  C  CA    . SER C 2  499  ? -26.423 -4.293  -31.761  1.00 74.49  ? 499  SER C CA    1 
ATOM   7156  C  C     . SER C 2  499  ? -27.793 -4.027  -32.365  1.00 71.85  ? 499  SER C C     1 
ATOM   7157  O  O     . SER C 2  499  ? -28.438 -3.023  -32.045  1.00 82.44  ? 499  SER C O     1 
ATOM   7158  C  CB    . SER C 2  499  ? -26.573 -4.974  -30.398  1.00 90.41  ? 499  SER C CB    1 
ATOM   7159  O  OG    . SER C 2  499  ? -25.311 -5.361  -29.887  1.00 67.68  ? 499  SER C OG    1 
ATOM   7160  N  N     . LEU C 2  500  ? -28.228 -4.927  -33.241  1.00 66.99  ? 500  LEU C N     1 
ATOM   7161  C  CA    . LEU C 2  500  ? -29.518 -4.765  -33.891  1.00 67.16  ? 500  LEU C CA    1 
ATOM   7162  C  C     . LEU C 2  500  ? -30.643 -4.910  -32.876  1.00 73.68  ? 500  LEU C C     1 
ATOM   7163  O  O     . LEU C 2  500  ? -30.603 -5.776  -31.998  1.00 79.48  ? 500  LEU C O     1 
ATOM   7164  C  CB    . LEU C 2  500  ? -29.689 -5.793  -35.008  1.00 65.28  ? 500  LEU C CB    1 
ATOM   7165  C  CG    . LEU C 2  500  ? -30.983 -5.676  -35.818  1.00 70.06  ? 500  LEU C CG    1 
ATOM   7166  C  CD1   . LEU C 2  500  ? -30.809 -4.718  -36.990  1.00 67.15  ? 500  LEU C CD1   1 
ATOM   7167  C  CD2   . LEU C 2  500  ? -31.460 -7.038  -36.290  1.00 76.32  ? 500  LEU C CD2   1 
ATOM   7168  N  N     . SER C 2  501  ? -31.649 -4.049  -32.998  1.00 74.57  ? 501  SER C N     1 
ATOM   7169  C  CA    . SER C 2  501  ? -32.814 -4.152  -32.136  1.00 68.40  ? 501  SER C CA    1 
ATOM   7170  C  C     . SER C 2  501  ? -33.533 -5.478  -32.369  1.00 64.91  ? 501  SER C C     1 
ATOM   7171  O  O     . SER C 2  501  ? -33.339 -6.156  -33.384  1.00 57.13  ? 501  SER C O     1 
ATOM   7172  C  CB    . SER C 2  501  ? -33.762 -2.978  -32.377  1.00 80.33  ? 501  SER C CB    1 
ATOM   7173  O  OG    . SER C 2  501  ? -33.174 -1.761  -31.948  1.00 85.65  ? 501  SER C OG    1 
ATOM   7174  N  N     . VAL C 2  502  ? -34.380 -5.841  -31.405  1.00 70.51  ? 502  VAL C N     1 
ATOM   7175  C  CA    . VAL C 2  502  ? -35.011 -7.158  -31.357  1.00 72.82  ? 502  VAL C CA    1 
ATOM   7176  C  C     . VAL C 2  502  ? -35.857 -7.415  -32.598  1.00 74.19  ? 502  VAL C C     1 
ATOM   7177  O  O     . VAL C 2  502  ? -35.538 -8.296  -33.403  1.00 73.93  ? 502  VAL C O     1 
ATOM   7178  C  CB    . VAL C 2  502  ? -35.862 -7.308  -30.085  1.00 62.57  ? 502  VAL C CB    1 
ATOM   7179  C  CG1   . VAL C 2  502  ? -36.632 -8.617  -30.114  1.00 86.52  ? 502  VAL C CG1   1 
ATOM   7180  C  CG2   . VAL C 2  502  ? -34.980 -7.246  -28.849  1.00 55.31  ? 502  VAL C CG2   1 
ATOM   7181  N  N     . TYR C 2  503  ? -36.941 -6.658  -32.760  1.00 68.82  ? 503  TYR C N     1 
ATOM   7182  C  CA    . TYR C 2  503  ? -37.873 -6.890  -33.859  1.00 82.77  ? 503  TYR C CA    1 
ATOM   7183  C  C     . TYR C 2  503  ? -37.356 -6.395  -35.203  1.00 82.12  ? 503  TYR C C     1 
ATOM   7184  O  O     . TYR C 2  503  ? -38.046 -6.572  -36.212  1.00 71.47  ? 503  TYR C O     1 
ATOM   7185  C  CB    . TYR C 2  503  ? -39.219 -6.227  -33.552  1.00 80.59  ? 503  TYR C CB    1 
ATOM   7186  C  CG    . TYR C 2  503  ? -39.825 -6.682  -32.248  1.00 73.06  ? 503  TYR C CG    1 
ATOM   7187  C  CD1   . TYR C 2  503  ? -40.394 -7.941  -32.128  1.00 75.85  ? 503  TYR C CD1   1 
ATOM   7188  C  CD2   . TYR C 2  503  ? -39.825 -5.854  -31.134  1.00 86.46  ? 503  TYR C CD2   1 
ATOM   7189  C  CE1   . TYR C 2  503  ? -40.948 -8.365  -30.938  1.00 77.79  ? 503  TYR C CE1   1 
ATOM   7190  C  CE2   . TYR C 2  503  ? -40.375 -6.269  -29.939  1.00 98.27  ? 503  TYR C CE2   1 
ATOM   7191  C  CZ    . TYR C 2  503  ? -40.936 -7.525  -29.847  1.00 98.47  ? 503  TYR C CZ    1 
ATOM   7192  O  OH    . TYR C 2  503  ? -41.487 -7.946  -28.658  1.00 98.86  ? 503  TYR C OH    1 
ATOM   7193  N  N     . ALA C 2  504  ? -36.170 -5.796  -35.248  1.00 86.31  ? 504  ALA C N     1 
ATOM   7194  C  CA    . ALA C 2  504  ? -35.668 -5.220  -36.485  1.00 83.75  ? 504  ALA C CA    1 
ATOM   7195  C  C     . ALA C 2  504  ? -35.277 -6.309  -37.482  1.00 68.35  ? 504  ALA C C     1 
ATOM   7196  O  O     . ALA C 2  504  ? -35.001 -7.457  -37.121  1.00 78.50  ? 504  ALA C O     1 
ATOM   7197  C  CB    . ALA C 2  504  ? -34.471 -4.313  -36.202  1.00 88.45  ? 504  ALA C CB    1 
ATOM   7198  N  N     . ARG C 2  505  ? -35.263 -5.928  -38.758  1.00 63.29  ? 505  ARG C N     1 
ATOM   7199  C  CA    . ARG C 2  505  ? -34.819 -6.805  -39.832  1.00 78.28  ? 505  ARG C CA    1 
ATOM   7200  C  C     . ARG C 2  505  ? -34.264 -5.941  -40.956  1.00 80.92  ? 505  ARG C C     1 
ATOM   7201  O  O     . ARG C 2  505  ? -34.373 -4.713  -40.932  1.00 79.09  ? 505  ARG C O     1 
ATOM   7202  C  CB    . ARG C 2  505  ? -35.953 -7.698  -40.345  1.00 80.87  ? 505  ARG C CB    1 
ATOM   7203  C  CG    . ARG C 2  505  ? -36.930 -6.984  -41.263  1.00 77.25  ? 505  ARG C CG    1 
ATOM   7204  C  CD    . ARG C 2  505  ? -38.040 -7.913  -41.719  1.00 68.72  ? 505  ARG C CD    1 
ATOM   7205  N  NE    . ARG C 2  505  ? -38.928 -7.271  -42.684  1.00 80.29  ? 505  ARG C NE    1 
ATOM   7206  C  CZ    . ARG C 2  505  ? -40.055 -7.812  -43.136  1.00 107.58 ? 505  ARG C CZ    1 
ATOM   7207  N  NH1   . ARG C 2  505  ? -40.439 -9.006  -42.708  1.00 94.37  ? 505  ARG C NH1   1 
ATOM   7208  N  NH2   . ARG C 2  505  ? -40.801 -7.155  -44.015  1.00 126.37 ? 505  ARG C NH2   1 
ATOM   7209  N  N     . VAL C 2  506  ? -33.672 -6.596  -41.951  1.00 65.85  ? 506  VAL C N     1 
ATOM   7210  C  CA    . VAL C 2  506  ? -33.025 -5.917  -43.067  1.00 71.92  ? 506  VAL C CA    1 
ATOM   7211  C  C     . VAL C 2  506  ? -33.768 -6.266  -44.348  1.00 90.74  ? 506  VAL C C     1 
ATOM   7212  O  O     . VAL C 2  506  ? -34.073 -7.438  -44.595  1.00 98.29  ? 506  VAL C O     1 
ATOM   7213  C  CB    . VAL C 2  506  ? -31.538 -6.301  -43.183  1.00 62.28  ? 506  VAL C CB    1 
ATOM   7214  C  CG1   . VAL C 2  506  ? -30.766 -5.224  -43.935  1.00 87.52  ? 506  VAL C CG1   1 
ATOM   7215  C  CG2   . VAL C 2  506  ? -30.938 -6.548  -41.806  1.00 59.60  ? 506  VAL C CG2   1 
ATOM   7216  N  N     . ASN C 2  507  ? -34.056 -5.252  -45.159  1.00 98.67  ? 507  ASN C N     1 
ATOM   7217  C  CA    . ASN C 2  507  ? -34.660 -5.481  -46.459  1.00 81.39  ? 507  ASN C CA    1 
ATOM   7218  C  C     . ASN C 2  507  ? -33.577 -5.793  -47.491  1.00 92.22  ? 507  ASN C C     1 
ATOM   7219  O  O     . ASN C 2  507  ? -32.393 -5.544  -47.252  1.00 101.83 ? 507  ASN C O     1 
ATOM   7220  C  CB    . ASN C 2  507  ? -35.489 -4.265  -46.878  1.00 69.85  ? 507  ASN C CB    1 
ATOM   7221  C  CG    . ASN C 2  507  ? -34.691 -2.969  -46.889  1.00 90.34  ? 507  ASN C CG    1 
ATOM   7222  O  OD1   . ASN C 2  507  ? -33.461 -2.973  -46.854  1.00 94.69  ? 507  ASN C OD1   1 
ATOM   7223  N  ND2   . ASN C 2  507  ? -35.399 -1.846  -46.947  1.00 85.14  ? 507  ASN C ND2   1 
ATOM   7224  N  N     . PRO C 2  508  ? -33.951 -6.358  -48.645  1.00 95.93  ? 508  PRO C N     1 
ATOM   7225  C  CA    . PRO C 2  508  ? -32.939 -6.657  -49.676  1.00 103.22 ? 508  PRO C CA    1 
ATOM   7226  C  C     . PRO C 2  508  ? -32.183 -5.436  -50.189  1.00 103.78 ? 508  PRO C C     1 
ATOM   7227  O  O     . PRO C 2  508  ? -31.224 -5.609  -50.952  1.00 108.62 ? 508  PRO C O     1 
ATOM   7228  C  CB    . PRO C 2  508  ? -33.761 -7.310  -50.795  1.00 107.32 ? 508  PRO C CB    1 
ATOM   7229  C  CG    . PRO C 2  508  ? -34.939 -7.895  -50.096  1.00 113.15 ? 508  PRO C CG    1 
ATOM   7230  C  CD    . PRO C 2  508  ? -35.263 -6.938  -48.985  1.00 84.37  ? 508  PRO C CD    1 
ATOM   7231  N  N     . PHE C 2  509  ? -32.575 -4.219  -49.805  1.00 106.17 ? 509  PHE C N     1 
ATOM   7232  C  CA    . PHE C 2  509  ? -31.823 -3.038  -50.219  1.00 126.79 ? 509  PHE C CA    1 
ATOM   7233  C  C     . PHE C 2  509  ? -30.628 -2.782  -49.309  1.00 113.05 ? 509  PHE C C     1 
ATOM   7234  O  O     . PHE C 2  509  ? -29.552 -2.403  -49.786  1.00 114.59 ? 509  PHE C O     1 
ATOM   7235  C  CB    . PHE C 2  509  ? -32.738 -1.813  -50.252  1.00 128.49 ? 509  PHE C CB    1 
ATOM   7236  C  CG    . PHE C 2  509  ? -33.456 -1.628  -51.557  1.00 135.92 ? 509  PHE C CG    1 
ATOM   7237  C  CD1   . PHE C 2  509  ? -33.084 -2.356  -52.676  1.00 125.62 ? 509  PHE C CD1   1 
ATOM   7238  C  CD2   . PHE C 2  509  ? -34.495 -0.719  -51.669  1.00 124.39 ? 509  PHE C CD2   1 
ATOM   7239  C  CE1   . PHE C 2  509  ? -33.739 -2.187  -53.880  1.00 116.61 ? 509  PHE C CE1   1 
ATOM   7240  C  CE2   . PHE C 2  509  ? -35.154 -0.545  -52.870  1.00 132.35 ? 509  PHE C CE2   1 
ATOM   7241  C  CZ    . PHE C 2  509  ? -34.775 -1.281  -53.977  1.00 139.66 ? 509  PHE C CZ    1 
ATOM   7242  N  N     . GLY C 2  510  ? -30.794 -2.977  -48.003  1.00 97.92  ? 510  GLY C N     1 
ATOM   7243  C  CA    . GLY C 2  510  ? -29.709 -2.766  -47.065  1.00 97.50  ? 510  GLY C CA    1 
ATOM   7244  C  C     . GLY C 2  510  ? -30.103 -1.921  -45.871  1.00 98.08  ? 510  GLY C C     1 
ATOM   7245  O  O     . GLY C 2  510  ? -29.320 -1.760  -44.930  1.00 104.73 ? 510  GLY C O     1 
ATOM   7246  N  N     . PHE C 2  511  ? -31.311 -1.371  -45.899  1.00 92.35  ? 511  PHE C N     1 
ATOM   7247  C  CA    . PHE C 2  511  ? -31.820 -0.588  -44.786  1.00 100.10 ? 511  PHE C CA    1 
ATOM   7248  C  C     . PHE C 2  511  ? -32.523 -1.496  -43.783  1.00 89.96  ? 511  PHE C C     1 
ATOM   7249  O  O     . PHE C 2  511  ? -32.918 -2.622  -44.095  1.00 88.72  ? 511  PHE C O     1 
ATOM   7250  C  CB    . PHE C 2  511  ? -32.774 0.500   -45.281  1.00 120.80 ? 511  PHE C CB    1 
ATOM   7251  C  CG    . PHE C 2  511  ? -32.242 1.279   -46.448  1.00 111.11 ? 511  PHE C CG    1 
ATOM   7252  C  CD1   . PHE C 2  511  ? -31.138 2.102   -46.303  1.00 100.35 ? 511  PHE C CD1   1 
ATOM   7253  C  CD2   . PHE C 2  511  ? -32.846 1.188   -47.691  1.00 99.37  ? 511  PHE C CD2   1 
ATOM   7254  C  CE1   . PHE C 2  511  ? -30.643 2.816   -47.375  1.00 80.27  ? 511  PHE C CE1   1 
ATOM   7255  C  CE2   . PHE C 2  511  ? -32.358 1.902   -48.765  1.00 110.98 ? 511  PHE C CE2   1 
ATOM   7256  C  CZ    . PHE C 2  511  ? -31.255 2.719   -48.607  1.00 98.60  ? 511  PHE C CZ    1 
ATOM   7257  N  N     . ILE C 2  512  ? -32.674 -0.991  -42.563  1.00 88.31  ? 512  ILE C N     1 
ATOM   7258  C  CA    . ILE C 2  512  ? -33.214 -1.767  -41.453  1.00 80.27  ? 512  ILE C CA    1 
ATOM   7259  C  C     . ILE C 2  512  ? -34.673 -1.390  -41.248  1.00 71.28  ? 512  ILE C C     1 
ATOM   7260  O  O     . ILE C 2  512  ? -35.001 -0.209  -41.079  1.00 65.28  ? 512  ILE C O     1 
ATOM   7261  C  CB    . ILE C 2  512  ? -32.396 -1.540  -40.172  1.00 72.81  ? 512  ILE C CB    1 
ATOM   7262  C  CG1   . ILE C 2  512  ? -30.930 -1.900  -40.417  1.00 59.92  ? 512  ILE C CG1   1 
ATOM   7263  C  CG2   . ILE C 2  512  ? -32.967 -2.359  -39.024  1.00 75.40  ? 512  ILE C CG2   1 
ATOM   7264  C  CD1   . ILE C 2  512  ? -30.034 -1.656  -39.230  1.00 56.91  ? 512  ILE C CD1   1 
ATOM   7265  N  N     . GLU C 2  513  ? -35.547 -2.392  -41.260  1.00 65.19  ? 513  GLU C N     1 
ATOM   7266  C  CA    . GLU C 2  513  ? -36.976 -2.196  -41.079  1.00 73.47  ? 513  GLU C CA    1 
ATOM   7267  C  C     . GLU C 2  513  ? -37.399 -2.623  -39.678  1.00 77.14  ? 513  GLU C C     1 
ATOM   7268  O  O     . GLU C 2  513  ? -36.828 -3.545  -39.091  1.00 83.16  ? 513  GLU C O     1 
ATOM   7269  C  CB    . GLU C 2  513  ? -37.771 -2.987  -42.122  1.00 83.61  ? 513  GLU C CB    1 
ATOM   7270  C  CG    . GLU C 2  513  ? -37.433 -2.648  -43.567  1.00 93.74  ? 513  GLU C CG    1 
ATOM   7271  C  CD    . GLU C 2  513  ? -38.183 -3.520  -44.559  1.00 96.56  ? 513  GLU C CD    1 
ATOM   7272  O  OE1   . GLU C 2  513  ? -38.614 -4.625  -44.168  1.00 84.11  ? 513  GLU C OE1   1 
ATOM   7273  O  OE2   . GLU C 2  513  ? -38.347 -3.100  -45.725  1.00 110.35 ? 513  GLU C OE2   1 
ATOM   7274  N  N     . THR C 2  514  ? -38.411 -1.939  -39.148  1.00 79.45  ? 514  THR C N     1 
ATOM   7275  C  CA    . THR C 2  514  ? -38.978 -2.270  -37.852  1.00 81.89  ? 514  THR C CA    1 
ATOM   7276  C  C     . THR C 2  514  ? -40.497 -2.309  -37.957  1.00 87.63  ? 514  THR C C     1 
ATOM   7277  O  O     . THR C 2  514  ? -41.099 -1.461  -38.628  1.00 90.68  ? 514  THR C O     1 
ATOM   7278  C  CB    . THR C 2  514  ? -38.543 -1.259  -36.775  1.00 91.81  ? 514  THR C CB    1 
ATOM   7279  O  OG1   . THR C 2  514  ? -39.277 -1.490  -35.566  1.00 93.85  ? 514  THR C OG1   1 
ATOM   7280  C  CG2   . THR C 2  514  ? -38.767 0.169   -37.246  1.00 100.49 ? 514  THR C CG2   1 
ATOM   7281  N  N     . PRO C 2  515  ? -41.142 -3.283  -37.319  1.00 93.24  ? 515  PRO C N     1 
ATOM   7282  C  CA    . PRO C 2  515  ? -42.584 -3.465  -37.510  1.00 104.75 ? 515  PRO C CA    1 
ATOM   7283  C  C     . PRO C 2  515  ? -43.414 -2.457  -36.731  1.00 103.45 ? 515  PRO C C     1 
ATOM   7284  O  O     . PRO C 2  515  ? -42.995 -1.921  -35.702  1.00 100.68 ? 515  PRO C O     1 
ATOM   7285  C  CB    . PRO C 2  515  ? -42.823 -4.889  -36.992  1.00 107.97 ? 515  PRO C CB    1 
ATOM   7286  C  CG    . PRO C 2  515  ? -41.772 -5.076  -35.954  1.00 101.33 ? 515  PRO C CG    1 
ATOM   7287  C  CD    . PRO C 2  515  ? -40.565 -4.311  -36.435  1.00 93.19  ? 515  PRO C CD    1 
ATOM   7288  N  N     . TYR C 2  516  ? -44.618 -2.207  -37.246  1.00 100.23 ? 516  TYR C N     1 
ATOM   7289  C  CA    . TYR C 2  516  ? -45.569 -1.304  -36.615  1.00 94.55  ? 516  TYR C CA    1 
ATOM   7290  C  C     . TYR C 2  516  ? -46.984 -1.800  -36.879  1.00 114.04 ? 516  TYR C C     1 
ATOM   7291  O  O     . TYR C 2  516  ? -47.252 -2.442  -37.898  1.00 116.24 ? 516  TYR C O     1 
ATOM   7292  C  CB    . TYR C 2  516  ? -45.421 0.136   -37.128  1.00 98.10  ? 516  TYR C CB    1 
ATOM   7293  C  CG    . TYR C 2  516  ? -44.141 0.822   -36.705  1.00 97.47  ? 516  TYR C CG    1 
ATOM   7294  C  CD1   . TYR C 2  516  ? -43.964 1.257   -35.399  1.00 105.44 ? 516  TYR C CD1   1 
ATOM   7295  C  CD2   . TYR C 2  516  ? -43.116 1.047   -37.616  1.00 93.82  ? 516  TYR C CD2   1 
ATOM   7296  C  CE1   . TYR C 2  516  ? -42.799 1.888   -35.007  1.00 111.51 ? 516  TYR C CE1   1 
ATOM   7297  C  CE2   . TYR C 2  516  ? -41.947 1.680   -37.233  1.00 97.72  ? 516  TYR C CE2   1 
ATOM   7298  C  CZ    . TYR C 2  516  ? -41.794 2.097   -35.927  1.00 108.65 ? 516  TYR C CZ    1 
ATOM   7299  O  OH    . TYR C 2  516  ? -40.634 2.726   -35.537  1.00 110.60 ? 516  TYR C OH    1 
ATOM   7300  N  N     . ARG C 2  517  ? -47.887 -1.496  -35.949  1.00 112.01 ? 517  ARG C N     1 
ATOM   7301  C  CA    . ARG C 2  517  ? -49.304 -1.800  -36.110  1.00 123.59 ? 517  ARG C CA    1 
ATOM   7302  C  C     . ARG C 2  517  ? -49.997 -0.610  -36.763  1.00 139.33 ? 517  ARG C C     1 
ATOM   7303  O  O     . ARG C 2  517  ? -49.990 0.496   -36.211  1.00 137.93 ? 517  ARG C O     1 
ATOM   7304  C  CB    . ARG C 2  517  ? -49.954 -2.126  -34.765  1.00 134.18 ? 517  ARG C CB    1 
ATOM   7305  C  CG    . ARG C 2  517  ? -49.801 -3.575  -34.333  1.00 143.10 ? 517  ARG C CG    1 
ATOM   7306  C  CD    . ARG C 2  517  ? -50.693 -3.902  -33.142  1.00 136.57 ? 517  ARG C CD    1 
ATOM   7307  N  NE    . ARG C 2  517  ? -50.240 -3.255  -31.914  1.00 112.43 ? 517  ARG C NE    1 
ATOM   7308  C  CZ    . ARG C 2  517  ? -50.767 -3.480  -30.714  1.00 132.82 ? 517  ARG C CZ    1 
ATOM   7309  N  NH1   . ARG C 2  517  ? -51.769 -4.338  -30.579  1.00 121.36 ? 517  ARG C NH1   1 
ATOM   7310  N  NH2   . ARG C 2  517  ? -50.291 -2.849  -29.649  1.00 138.19 ? 517  ARG C NH2   1 
ATOM   7311  N  N     . LYS C 2  518  ? -50.599 -0.837  -37.928  1.00 135.93 ? 518  LYS C N     1 
ATOM   7312  C  CA    . LYS C 2  518  ? -51.230 0.247   -38.672  1.00 138.60 ? 518  LYS C CA    1 
ATOM   7313  C  C     . LYS C 2  518  ? -52.532 0.665   -38.000  1.00 147.81 ? 518  LYS C C     1 
ATOM   7314  O  O     . LYS C 2  518  ? -53.461 -0.139  -37.873  1.00 148.20 ? 518  LYS C O     1 
ATOM   7315  C  CB    . LYS C 2  518  ? -51.484 -0.171  -40.118  1.00 146.71 ? 518  LYS C CB    1 
ATOM   7316  C  CG    . LYS C 2  518  ? -52.168 0.912   -40.938  1.00 158.46 ? 518  LYS C CG    1 
ATOM   7317  C  CD    . LYS C 2  518  ? -52.010 0.690   -42.431  1.00 156.31 ? 518  LYS C CD    1 
ATOM   7318  C  CE    . LYS C 2  518  ? -52.613 1.846   -43.213  1.00 129.13 ? 518  LYS C CE    1 
ATOM   7319  N  NZ    . LYS C 2  518  ? -52.329 1.744   -44.670  1.00 111.43 ? 518  LYS C NZ    1 
ATOM   7320  N  N     . VAL C 2  519  ? -52.597 1.922   -37.577  1.00 155.04 ? 519  VAL C N     1 
ATOM   7321  C  CA    . VAL C 2  519  ? -53.798 2.508   -36.994  1.00 162.86 ? 519  VAL C CA    1 
ATOM   7322  C  C     . VAL C 2  519  ? -54.520 3.264   -38.102  1.00 169.31 ? 519  VAL C C     1 
ATOM   7323  O  O     . VAL C 2  519  ? -54.005 4.258   -38.625  1.00 165.55 ? 519  VAL C O     1 
ATOM   7324  C  CB    . VAL C 2  519  ? -53.461 3.427   -35.813  1.00 145.42 ? 519  VAL C CB    1 
ATOM   7325  C  CG1   . VAL C 2  519  ? -54.706 4.153   -35.334  1.00 166.15 ? 519  VAL C CG1   1 
ATOM   7326  C  CG2   . VAL C 2  519  ? -52.834 2.625   -34.682  1.00 133.53 ? 519  VAL C CG2   1 
ATOM   7327  N  N     . VAL C 2  520  ? -55.713 2.796   -38.463  1.00 170.43 ? 520  VAL C N     1 
ATOM   7328  C  CA    . VAL C 2  520  ? -56.466 3.375   -39.572  1.00 173.69 ? 520  VAL C CA    1 
ATOM   7329  C  C     . VAL C 2  520  ? -56.964 4.763   -39.189  1.00 177.25 ? 520  VAL C C     1 
ATOM   7330  O  O     . VAL C 2  520  ? -56.418 5.776   -39.640  1.00 179.12 ? 520  VAL C O     1 
ATOM   7331  C  CB    . VAL C 2  520  ? -57.632 2.458   -39.985  1.00 149.70 ? 520  VAL C CB    1 
ATOM   7332  C  CG1   . VAL C 2  520  ? -58.438 3.094   -41.106  1.00 132.25 ? 520  VAL C CG1   1 
ATOM   7333  C  CG2   . VAL C 2  520  ? -57.104 1.096   -40.406  1.00 125.76 ? 520  VAL C CG2   1 
ATOM   7334  N  N     . ASP C 2  521  ? -58.005 4.818   -38.353  1.00 164.83 ? 521  ASP C N     1 
ATOM   7335  C  CA    . ASP C 2  521  ? -58.590 6.078   -37.884  1.00 162.94 ? 521  ASP C CA    1 
ATOM   7336  C  C     . ASP C 2  521  ? -58.793 5.961   -36.377  1.00 157.05 ? 521  ASP C C     1 
ATOM   7337  O  O     . ASP C 2  521  ? -59.909 5.732   -35.905  1.00 161.64 ? 521  ASP C O     1 
ATOM   7338  C  CB    . ASP C 2  521  ? -59.893 6.387   -38.613  1.00 174.04 ? 521  ASP C CB    1 
ATOM   7339  C  CG    . ASP C 2  521  ? -59.684 7.252   -39.833  1.00 178.84 ? 521  ASP C CG    1 
ATOM   7340  O  OD1   . ASP C 2  521  ? -58.791 8.124   -39.790  1.00 149.94 ? 521  ASP C OD1   1 
ATOM   7341  O  OD2   . ASP C 2  521  ? -60.409 7.064   -40.832  1.00 209.15 ? 521  ASP C OD2   1 
ATOM   7342  N  N     . GLY C 2  522  ? -57.709 6.131   -35.625  1.00 152.18 ? 522  GLY C N     1 
ATOM   7343  C  CA    . GLY C 2  522  ? -57.765 5.923   -34.189  1.00 165.94 ? 522  GLY C CA    1 
ATOM   7344  C  C     . GLY C 2  522  ? -58.203 4.531   -33.801  1.00 177.74 ? 522  GLY C C     1 
ATOM   7345  O  O     . GLY C 2  522  ? -58.794 4.348   -32.734  1.00 168.09 ? 522  GLY C O     1 
ATOM   7346  N  N     . VAL C 2  523  ? -57.940 3.541   -34.651  1.00 186.21 ? 523  VAL C N     1 
ATOM   7347  C  CA    . VAL C 2  523  ? -58.356 2.163   -34.427  1.00 169.83 ? 523  VAL C CA    1 
ATOM   7348  C  C     . VAL C 2  523  ? -57.131 1.274   -34.583  1.00 155.16 ? 523  VAL C C     1 
ATOM   7349  O  O     . VAL C 2  523  ? -56.554 1.194   -35.674  1.00 143.56 ? 523  VAL C O     1 
ATOM   7350  C  CB    . VAL C 2  523  ? -59.465 1.727   -35.400  1.00 156.83 ? 523  VAL C CB    1 
ATOM   7351  C  CG1   . VAL C 2  523  ? -59.788 0.255   -35.208  1.00 149.03 ? 523  VAL C CG1   1 
ATOM   7352  C  CG2   . VAL C 2  523  ? -60.711 2.581   -35.209  1.00 167.05 ? 523  VAL C CG2   1 
ATOM   7353  N  N     . VAL C 2  524  ? -56.734 0.613   -33.496  1.00 151.52 ? 524  VAL C N     1 
ATOM   7354  C  CA    . VAL C 2  524  ? -55.599 -0.299  -33.548  1.00 142.85 ? 524  VAL C CA    1 
ATOM   7355  C  C     . VAL C 2  524  ? -55.987 -1.542  -34.335  1.00 145.15 ? 524  VAL C C     1 
ATOM   7356  O  O     . VAL C 2  524  ? -57.006 -2.186  -34.052  1.00 154.60 ? 524  VAL C O     1 
ATOM   7357  C  CB    . VAL C 2  524  ? -55.129 -0.656  -32.131  1.00 152.84 ? 524  VAL C CB    1 
ATOM   7358  C  CG1   . VAL C 2  524  ? -54.217 -1.874  -32.163  1.00 159.11 ? 524  VAL C CG1   1 
ATOM   7359  C  CG2   . VAL C 2  524  ? -54.410 0.526   -31.503  1.00 141.07 ? 524  VAL C CG2   1 
ATOM   7360  N  N     . SER C 2  525  ? -55.178 -1.880  -35.332  1.00 126.05 ? 525  SER C N     1 
ATOM   7361  C  CA    . SER C 2  525  ? -55.388 -3.063  -36.149  1.00 121.62 ? 525  SER C CA    1 
ATOM   7362  C  C     . SER C 2  525  ? -54.267 -4.063  -35.901  1.00 133.15 ? 525  SER C C     1 
ATOM   7363  O  O     . SER C 2  525  ? -53.137 -3.688  -35.578  1.00 149.49 ? 525  SER C O     1 
ATOM   7364  C  CB    . SER C 2  525  ? -55.442 -2.704  -37.638  1.00 138.08 ? 525  SER C CB    1 
ATOM   7365  O  OG    . SER C 2  525  ? -56.270 -1.575  -37.864  1.00 185.73 ? 525  SER C OG    1 
ATOM   7366  N  N     . ASP C 2  526  ? -54.593 -5.345  -36.050  1.00 141.71 ? 526  ASP C N     1 
ATOM   7367  C  CA    . ASP C 2  526  ? -53.587 -6.393  -35.956  1.00 140.66 ? 526  ASP C CA    1 
ATOM   7368  C  C     . ASP C 2  526  ? -52.766 -6.533  -37.229  1.00 123.41 ? 526  ASP C C     1 
ATOM   7369  O  O     . ASP C 2  526  ? -51.892 -7.404  -37.293  1.00 108.55 ? 526  ASP C O     1 
ATOM   7370  C  CB    . ASP C 2  526  ? -54.251 -7.728  -35.609  1.00 142.19 ? 526  ASP C CB    1 
ATOM   7371  C  CG    . ASP C 2  526  ? -54.924 -7.702  -34.253  1.00 140.28 ? 526  ASP C CG    1 
ATOM   7372  O  OD1   . ASP C 2  526  ? -54.391 -7.036  -33.340  1.00 108.29 ? 526  ASP C OD1   1 
ATOM   7373  O  OD2   . ASP C 2  526  ? -55.988 -8.339  -34.101  1.00 165.68 ? 526  ASP C OD2   1 
ATOM   7374  N  N     . GLU C 2  527  ? -53.026 -5.704  -38.238  1.00 129.63 ? 527  GLU C N     1 
ATOM   7375  C  CA    . GLU C 2  527  ? -52.198 -5.693  -39.435  1.00 152.80 ? 527  GLU C CA    1 
ATOM   7376  C  C     . GLU C 2  527  ? -50.861 -5.031  -39.129  1.00 137.75 ? 527  GLU C C     1 
ATOM   7377  O  O     . GLU C 2  527  ? -50.815 -3.919  -38.594  1.00 124.60 ? 527  GLU C O     1 
ATOM   7378  C  CB    . GLU C 2  527  ? -52.911 -4.958  -40.570  1.00 169.73 ? 527  GLU C CB    1 
ATOM   7379  C  CG    . GLU C 2  527  ? -52.123 -4.907  -41.871  1.00 165.92 ? 527  GLU C CG    1 
ATOM   7380  C  CD    . GLU C 2  527  ? -52.854 -4.157  -42.969  1.00 160.44 ? 527  GLU C CD    1 
ATOM   7381  O  OE1   . GLU C 2  527  ? -53.951 -3.625  -42.700  1.00 168.06 ? 527  GLU C OE1   1 
ATOM   7382  O  OE2   . GLU C 2  527  ? -52.331 -4.100  -44.103  1.00 150.44 ? 527  GLU C OE2   1 
ATOM   7383  N  N     . ILE C 2  528  ? -49.773 -5.717  -39.465  1.00 125.87 ? 528  ILE C N     1 
ATOM   7384  C  CA    . ILE C 2  528  ? -48.423 -5.267  -39.153  1.00 109.34 ? 528  ILE C CA    1 
ATOM   7385  C  C     . ILE C 2  528  ? -47.651 -5.114  -40.456  1.00 104.75 ? 528  ILE C C     1 
ATOM   7386  O  O     . ILE C 2  528  ? -47.682 -6.008  -41.309  1.00 123.52 ? 528  ILE C O     1 
ATOM   7387  C  CB    . ILE C 2  528  ? -47.712 -6.244  -38.199  1.00 111.36 ? 528  ILE C CB    1 
ATOM   7388  C  CG1   . ILE C 2  528  ? -48.487 -6.350  -36.884  1.00 127.44 ? 528  ILE C CG1   1 
ATOM   7389  C  CG2   . ILE C 2  528  ? -46.281 -5.803  -37.940  1.00 112.24 ? 528  ILE C CG2   1 
ATOM   7390  C  CD1   . ILE C 2  528  ? -48.009 -7.459  -35.981  1.00 131.67 ? 528  ILE C CD1   1 
ATOM   7391  N  N     . VAL C 2  529  ? -46.966 -3.982  -40.607  1.00 97.83  ? 529  VAL C N     1 
ATOM   7392  C  CA    . VAL C 2  529  ? -46.181 -3.681  -41.797  1.00 107.63 ? 529  VAL C CA    1 
ATOM   7393  C  C     . VAL C 2  529  ? -44.814 -3.170  -41.362  1.00 97.42  ? 529  VAL C C     1 
ATOM   7394  O  O     . VAL C 2  529  ? -44.697 -2.450  -40.364  1.00 92.46  ? 529  VAL C O     1 
ATOM   7395  C  CB    . VAL C 2  529  ? -46.899 -2.655  -42.705  1.00 122.60 ? 529  VAL C CB    1 
ATOM   7396  C  CG1   . VAL C 2  529  ? -47.184 -1.364  -41.950  1.00 108.00 ? 529  VAL C CG1   1 
ATOM   7397  C  CG2   . VAL C 2  529  ? -46.089 -2.380  -43.965  1.00 111.74 ? 529  VAL C CG2   1 
ATOM   7398  N  N     . TYR C 2  530  ? -43.776 -3.563  -42.099  1.00 96.53  ? 530  TYR C N     1 
ATOM   7399  C  CA    . TYR C 2  530  ? -42.412 -3.141  -41.811  1.00 102.49 ? 530  TYR C CA    1 
ATOM   7400  C  C     . TYR C 2  530  ? -42.085 -1.875  -42.593  1.00 92.68  ? 530  TYR C C     1 
ATOM   7401  O  O     . TYR C 2  530  ? -42.313 -1.809  -43.806  1.00 95.98  ? 530  TYR C O     1 
ATOM   7402  C  CB    . TYR C 2  530  ? -41.418 -4.251  -42.154  1.00 109.33 ? 530  TYR C CB    1 
ATOM   7403  C  CG    . TYR C 2  530  ? -41.332 -5.342  -41.109  1.00 104.62 ? 530  TYR C CG    1 
ATOM   7404  C  CD1   . TYR C 2  530  ? -42.301 -6.334  -41.027  1.00 106.96 ? 530  TYR C CD1   1 
ATOM   7405  C  CD2   . TYR C 2  530  ? -40.277 -5.382  -40.207  1.00 96.32  ? 530  TYR C CD2   1 
ATOM   7406  C  CE1   . TYR C 2  530  ? -42.224 -7.332  -40.073  1.00 102.40 ? 530  TYR C CE1   1 
ATOM   7407  C  CE2   . TYR C 2  530  ? -40.191 -6.376  -39.252  1.00 102.13 ? 530  TYR C CE2   1 
ATOM   7408  C  CZ    . TYR C 2  530  ? -41.167 -7.348  -39.189  1.00 99.31  ? 530  TYR C CZ    1 
ATOM   7409  O  OH    . TYR C 2  530  ? -41.084 -8.339  -38.238  1.00 102.83 ? 530  TYR C OH    1 
ATOM   7410  N  N     . LEU C 2  531  ? -41.554 -0.875  -41.896  1.00 88.14  ? 531  LEU C N     1 
ATOM   7411  C  CA    . LEU C 2  531  ? -41.210 0.409   -42.487  1.00 94.68  ? 531  LEU C CA    1 
ATOM   7412  C  C     . LEU C 2  531  ? -39.708 0.629   -42.391  1.00 100.32 ? 531  LEU C C     1 
ATOM   7413  O  O     . LEU C 2  531  ? -39.091 0.322   -41.367  1.00 98.58  ? 531  LEU C O     1 
ATOM   7414  C  CB    . LEU C 2  531  ? -41.942 1.566   -41.789  1.00 95.94  ? 531  LEU C CB    1 
ATOM   7415  C  CG    . LEU C 2  531  ? -43.453 1.746   -41.972  1.00 108.25 ? 531  LEU C CG    1 
ATOM   7416  C  CD1   . LEU C 2  531  ? -44.247 0.725   -41.171  1.00 112.55 ? 531  LEU C CD1   1 
ATOM   7417  C  CD2   . LEU C 2  531  ? -43.860 3.161   -41.586  1.00 99.85  ? 531  LEU C CD2   1 
ATOM   7418  N  N     . THR C 2  532  ? -39.124 1.165   -43.460  1.00 107.82 ? 532  THR C N     1 
ATOM   7419  C  CA    . THR C 2  532  ? -37.723 1.548   -43.426  1.00 110.03 ? 532  THR C CA    1 
ATOM   7420  C  C     . THR C 2  532  ? -37.562 2.829   -42.609  1.00 113.33 ? 532  THR C C     1 
ATOM   7421  O  O     . THR C 2  532  ? -38.512 3.345   -42.012  1.00 121.89 ? 532  THR C O     1 
ATOM   7422  C  CB    . THR C 2  532  ? -37.179 1.732   -44.840  1.00 123.08 ? 532  THR C CB    1 
ATOM   7423  O  OG1   . THR C 2  532  ? -37.611 2.994   -45.359  1.00 127.42 ? 532  THR C OG1   1 
ATOM   7424  C  CG2   . THR C 2  532  ? -37.680 0.620   -45.746  1.00 120.86 ? 532  THR C CG2   1 
ATOM   7425  N  N     . ALA C 2  533  ? -36.337 3.353   -42.583  1.00 116.20 ? 533  ALA C N     1 
ATOM   7426  C  CA    . ALA C 2  533  ? -36.059 4.524   -41.758  1.00 122.51 ? 533  ALA C CA    1 
ATOM   7427  C  C     . ALA C 2  533  ? -36.741 5.768   -42.315  1.00 124.98 ? 533  ALA C C     1 
ATOM   7428  O  O     . ALA C 2  533  ? -37.395 6.512   -41.576  1.00 109.23 ? 533  ALA C O     1 
ATOM   7429  C  CB    . ALA C 2  533  ? -34.552 4.738   -41.644  1.00 120.92 ? 533  ALA C CB    1 
ATOM   7430  N  N     . ASP C 2  534  ? -36.600 6.011   -43.619  1.00 142.04 ? 534  ASP C N     1 
ATOM   7431  C  CA    . ASP C 2  534  ? -37.243 7.175   -44.218  1.00 135.54 ? 534  ASP C CA    1 
ATOM   7432  C  C     . ASP C 2  534  ? -38.742 6.968   -44.402  1.00 120.24 ? 534  ASP C C     1 
ATOM   7433  O  O     . ASP C 2  534  ? -39.499 7.945   -44.399  1.00 128.74 ? 534  ASP C O     1 
ATOM   7434  C  CB    . ASP C 2  534  ? -36.581 7.520   -45.554  1.00 128.70 ? 534  ASP C CB    1 
ATOM   7435  C  CG    . ASP C 2  534  ? -36.241 6.291   -46.374  1.00 129.47 ? 534  ASP C CG    1 
ATOM   7436  O  OD1   . ASP C 2  534  ? -37.133 5.441   -46.575  1.00 141.11 ? 534  ASP C OD1   1 
ATOM   7437  O  OD2   . ASP C 2  534  ? -35.082 6.183   -46.829  1.00 103.43 ? 534  ASP C OD2   1 
ATOM   7438  N  N     . GLU C 2  535  ? -39.188 5.719   -44.563  1.00 111.42 ? 535  GLU C N     1 
ATOM   7439  C  CA    . GLU C 2  535  ? -40.622 5.450   -44.612  1.00 105.61 ? 535  GLU C CA    1 
ATOM   7440  C  C     . GLU C 2  535  ? -41.300 5.808   -43.296  1.00 114.18 ? 535  GLU C C     1 
ATOM   7441  O  O     . GLU C 2  535  ? -42.466 6.219   -43.288  1.00 126.02 ? 535  GLU C O     1 
ATOM   7442  C  CB    . GLU C 2  535  ? -40.878 3.978   -44.944  1.00 107.14 ? 535  GLU C CB    1 
ATOM   7443  C  CG    . GLU C 2  535  ? -40.547 3.575   -46.370  1.00 126.83 ? 535  GLU C CG    1 
ATOM   7444  C  CD    . GLU C 2  535  ? -40.840 2.109   -46.635  1.00 135.73 ? 535  GLU C CD    1 
ATOM   7445  O  OE1   . GLU C 2  535  ? -41.590 1.502   -45.841  1.00 114.00 ? 535  GLU C OE1   1 
ATOM   7446  O  OE2   . GLU C 2  535  ? -40.319 1.563   -47.630  1.00 152.95 ? 535  GLU C OE2   1 
ATOM   7447  N  N     . GLU C 2  536  ? -40.585 5.663   -42.179  1.00 115.88 ? 536  GLU C N     1 
ATOM   7448  C  CA    . GLU C 2  536  ? -41.166 5.944   -40.871  1.00 112.59 ? 536  GLU C CA    1 
ATOM   7449  C  C     . GLU C 2  536  ? -41.422 7.434   -40.670  1.00 110.72 ? 536  GLU C C     1 
ATOM   7450  O  O     . GLU C 2  536  ? -42.354 7.809   -39.949  1.00 120.37 ? 536  GLU C O     1 
ATOM   7451  C  CB    . GLU C 2  536  ? -40.244 5.404   -39.776  1.00 123.38 ? 536  GLU C CB    1 
ATOM   7452  C  CG    . GLU C 2  536  ? -40.717 5.658   -38.355  1.00 111.79 ? 536  GLU C CG    1 
ATOM   7453  C  CD    . GLU C 2  536  ? -39.781 5.062   -37.324  1.00 104.36 ? 536  GLU C CD    1 
ATOM   7454  O  OE1   . GLU C 2  536  ? -39.302 3.929   -37.540  1.00 108.81 ? 536  GLU C OE1   1 
ATOM   7455  O  OE2   . GLU C 2  536  ? -39.517 5.729   -36.302  1.00 100.44 ? 536  GLU C OE2   1 
ATOM   7456  N  N     . ASP C 2  537  ? -40.617 8.295   -41.298  1.00 104.85 ? 537  ASP C N     1 
ATOM   7457  C  CA    . ASP C 2  537  ? -40.761 9.731   -41.085  1.00 118.88 ? 537  ASP C CA    1 
ATOM   7458  C  C     . ASP C 2  537  ? -41.986 10.291  -41.794  1.00 126.82 ? 537  ASP C C     1 
ATOM   7459  O  O     . ASP C 2  537  ? -42.562 11.286  -41.338  1.00 126.23 ? 537  ASP C O     1 
ATOM   7460  C  CB    . ASP C 2  537  ? -39.499 10.459  -41.548  1.00 119.42 ? 537  ASP C CB    1 
ATOM   7461  C  CG    . ASP C 2  537  ? -38.279 10.089  -40.729  1.00 127.57 ? 537  ASP C CG    1 
ATOM   7462  O  OD1   . ASP C 2  537  ? -38.444 9.763   -39.535  1.00 114.14 ? 537  ASP C OD1   1 
ATOM   7463  O  OD2   . ASP C 2  537  ? -37.157 10.124  -41.276  1.00 136.06 ? 537  ASP C OD2   1 
ATOM   7464  N  N     . ARG C 2  538  ? -42.405 9.673   -42.898  1.00 138.34 ? 538  ARG C N     1 
ATOM   7465  C  CA    . ARG C 2  538  ? -43.573 10.160  -43.625  1.00 142.16 ? 538  ARG C CA    1 
ATOM   7466  C  C     . ARG C 2  538  ? -44.883 9.892   -42.897  1.00 133.24 ? 538  ARG C C     1 
ATOM   7467  O  O     . ARG C 2  538  ? -45.948 10.158  -43.466  1.00 128.12 ? 538  ARG C O     1 
ATOM   7468  C  CB    . ARG C 2  538  ? -43.625 9.537   -45.022  1.00 150.04 ? 538  ARG C CB    1 
ATOM   7469  C  CG    . ARG C 2  538  ? -42.570 10.070  -45.977  1.00 149.73 ? 538  ARG C CG    1 
ATOM   7470  C  CD    . ARG C 2  538  ? -42.810 9.609   -47.409  1.00 125.52 ? 538  ARG C CD    1 
ATOM   7471  N  NE    . ARG C 2  538  ? -42.573 8.179   -47.585  1.00 142.79 ? 538  ARG C NE    1 
ATOM   7472  C  CZ    . ARG C 2  538  ? -43.532 7.259   -47.622  1.00 139.15 ? 538  ARG C CZ    1 
ATOM   7473  N  NH1   . ARG C 2  538  ? -43.221 5.981   -47.786  1.00 115.46 ? 538  ARG C NH1   1 
ATOM   7474  N  NH2   . ARG C 2  538  ? -44.803 7.618   -47.498  1.00 137.06 ? 538  ARG C NH2   1 
ATOM   7475  N  N     . HIS C 2  539  ? -44.834 9.369   -41.674  1.00 130.55 ? 539  HIS C N     1 
ATOM   7476  C  CA    . HIS C 2  539  ? -46.016 9.157   -40.854  1.00 125.72 ? 539  HIS C CA    1 
ATOM   7477  C  C     . HIS C 2  539  ? -45.685 9.575   -39.427  1.00 128.40 ? 539  HIS C C     1 
ATOM   7478  O  O     . HIS C 2  539  ? -44.593 10.076  -39.142  1.00 137.83 ? 539  HIS C O     1 
ATOM   7479  C  CB    . HIS C 2  539  ? -46.479 7.694   -40.902  1.00 117.98 ? 539  HIS C CB    1 
ATOM   7480  C  CG    . HIS C 2  539  ? -46.627 7.147   -42.288  1.00 123.17 ? 539  HIS C CG    1 
ATOM   7481  N  ND1   . HIS C 2  539  ? -47.851 7.012   -42.908  1.00 138.37 ? 539  HIS C ND1   1 
ATOM   7482  C  CD2   . HIS C 2  539  ? -45.706 6.695   -43.171  1.00 114.36 ? 539  HIS C CD2   1 
ATOM   7483  C  CE1   . HIS C 2  539  ? -47.677 6.502   -44.115  1.00 130.06 ? 539  HIS C CE1   1 
ATOM   7484  N  NE2   . HIS C 2  539  ? -46.384 6.301   -44.299  1.00 105.85 ? 539  HIS C NE2   1 
ATOM   7485  N  N     . VAL C 2  540  ? -46.639 9.372   -38.524  1.00 117.71 ? 540  VAL C N     1 
ATOM   7486  C  CA    . VAL C 2  540  ? -46.422 9.562   -37.096  1.00 120.36 ? 540  VAL C CA    1 
ATOM   7487  C  C     . VAL C 2  540  ? -46.892 8.304   -36.379  1.00 123.81 ? 540  VAL C C     1 
ATOM   7488  O  O     . VAL C 2  540  ? -47.940 7.741   -36.715  1.00 123.41 ? 540  VAL C O     1 
ATOM   7489  C  CB    . VAL C 2  540  ? -47.140 10.819  -36.557  1.00 106.96 ? 540  VAL C CB    1 
ATOM   7490  C  CG1   . VAL C 2  540  ? -46.507 12.079  -37.130  1.00 126.62 ? 540  VAL C CG1   1 
ATOM   7491  C  CG2   . VAL C 2  540  ? -48.621 10.776  -36.880  1.00 104.06 ? 540  VAL C CG2   1 
ATOM   7492  N  N     . VAL C 2  541  ? -46.107 7.852   -35.406  1.00 129.01 ? 541  VAL C N     1 
ATOM   7493  C  CA    . VAL C 2  541  ? -46.332 6.574   -34.745  1.00 121.29 ? 541  VAL C CA    1 
ATOM   7494  C  C     . VAL C 2  541  ? -46.533 6.808   -33.255  1.00 116.84 ? 541  VAL C C     1 
ATOM   7495  O  O     . VAL C 2  541  ? -45.873 7.663   -32.654  1.00 106.34 ? 541  VAL C O     1 
ATOM   7496  C  CB    . VAL C 2  541  ? -45.164 5.598   -34.996  1.00 104.12 ? 541  VAL C CB    1 
ATOM   7497  C  CG1   . VAL C 2  541  ? -45.119 5.195   -36.461  1.00 125.97 ? 541  VAL C CG1   1 
ATOM   7498  C  CG2   . VAL C 2  541  ? -43.850 6.235   -34.588  1.00 111.88 ? 541  VAL C CG2   1 
ATOM   7499  N  N     . ALA C 2  542  ? -47.447 6.045   -32.662  1.00 107.74 ? 542  ALA C N     1 
ATOM   7500  C  CA    . ALA C 2  542  ? -47.734 6.149   -31.240  1.00 120.96 ? 542  ALA C CA    1 
ATOM   7501  C  C     . ALA C 2  542  ? -46.829 5.217   -30.446  1.00 121.83 ? 542  ALA C C     1 
ATOM   7502  O  O     . ALA C 2  542  ? -46.481 4.126   -30.908  1.00 122.38 ? 542  ALA C O     1 
ATOM   7503  C  CB    . ALA C 2  542  ? -49.199 5.818   -30.955  1.00 140.93 ? 542  ALA C CB    1 
ATOM   7504  N  N     . GLN C 2  543  ? -46.448 5.661   -29.250  1.00 108.91 ? 543  GLN C N     1 
ATOM   7505  C  CA    . GLN C 2  543  ? -45.650 4.832   -28.359  1.00 93.90  ? 543  GLN C CA    1 
ATOM   7506  C  C     . GLN C 2  543  ? -46.416 3.565   -27.995  1.00 126.82 ? 543  GLN C C     1 
ATOM   7507  O  O     . GLN C 2  543  ? -47.650 3.549   -27.954  1.00 144.50 ? 543  GLN C O     1 
ATOM   7508  C  CB    . GLN C 2  543  ? -45.282 5.622   -27.102  1.00 87.43  ? 543  GLN C CB    1 
ATOM   7509  C  CG    . GLN C 2  543  ? -44.214 4.985   -26.229  1.00 99.93  ? 543  GLN C CG    1 
ATOM   7510  C  CD    . GLN C 2  543  ? -43.795 5.892   -25.087  1.00 127.79 ? 543  GLN C CD    1 
ATOM   7511  O  OE1   . GLN C 2  543  ? -43.141 5.457   -24.139  1.00 139.17 ? 543  GLN C OE1   1 
ATOM   7512  N  NE2   . GLN C 2  543  ? -44.172 7.162   -25.173  1.00 129.63 ? 543  GLN C NE2   1 
ATOM   7513  N  N     . ALA C 2  544  ? -45.666 2.490   -27.736  1.00 121.47 ? 544  ALA C N     1 
ATOM   7514  C  CA    . ALA C 2  544  ? -46.280 1.178   -27.547  1.00 121.29 ? 544  ALA C CA    1 
ATOM   7515  C  C     . ALA C 2  544  ? -47.243 1.168   -26.367  1.00 128.77 ? 544  ALA C C     1 
ATOM   7516  O  O     . ALA C 2  544  ? -48.310 0.546   -26.434  1.00 109.77 ? 544  ALA C O     1 
ATOM   7517  C  CB    . ALA C 2  544  ? -45.199 0.116   -27.358  1.00 118.95 ? 544  ALA C CB    1 
ATOM   7518  N  N     . ASN C 2  545  ? -46.889 1.850   -25.280  1.00 137.31 ? 545  ASN C N     1 
ATOM   7519  C  CA    . ASN C 2  545  ? -47.720 1.825   -24.082  1.00 126.13 ? 545  ASN C CA    1 
ATOM   7520  C  C     . ASN C 2  545  ? -48.855 2.839   -24.164  1.00 114.61 ? 545  ASN C C     1 
ATOM   7521  O  O     . ASN C 2  545  ? -49.054 3.632   -23.237  1.00 107.71 ? 545  ASN C O     1 
ATOM   7522  C  CB    . ASN C 2  545  ? -46.864 2.077   -22.838  1.00 133.37 ? 545  ASN C CB    1 
ATOM   7523  C  CG    . ASN C 2  545  ? -45.965 3.290   -22.981  1.00 141.65 ? 545  ASN C CG    1 
ATOM   7524  O  OD1   . ASN C 2  545  ? -46.249 4.204   -23.755  1.00 139.43 ? 545  ASN C OD1   1 
ATOM   7525  N  ND2   . ASN C 2  545  ? -44.869 3.302   -22.232  1.00 123.44 ? 545  ASN C ND2   1 
ATOM   7526  N  N     . SER C 2  546  ? -49.605 2.822   -25.264  1.00 132.26 ? 546  SER C N     1 
ATOM   7527  C  CA    . SER C 2  546  ? -50.752 3.714   -25.389  1.00 133.55 ? 546  SER C CA    1 
ATOM   7528  C  C     . SER C 2  546  ? -51.989 3.054   -24.791  1.00 130.72 ? 546  SER C C     1 
ATOM   7529  O  O     . SER C 2  546  ? -52.233 1.869   -25.047  1.00 118.11 ? 546  SER C O     1 
ATOM   7530  C  CB    . SER C 2  546  ? -51.012 4.068   -26.848  1.00 132.46 ? 546  SER C CB    1 
ATOM   7531  O  OG    . SER C 2  546  ? -49.925 4.787   -27.403  1.00 126.66 ? 546  SER C OG    1 
ATOM   7532  N  N     . PRO C 2  547  ? -52.770 3.769   -23.980  1.00 135.02 ? 547  PRO C N     1 
ATOM   7533  C  CA    . PRO C 2  547  ? -54.046 3.218   -23.495  1.00 130.09 ? 547  PRO C CA    1 
ATOM   7534  C  C     . PRO C 2  547  ? -55.012 3.039   -24.656  1.00 129.49 ? 547  PRO C C     1 
ATOM   7535  O  O     . PRO C 2  547  ? -55.324 3.992   -25.372  1.00 132.55 ? 547  PRO C O     1 
ATOM   7536  C  CB    . PRO C 2  547  ? -54.539 4.278   -22.502  1.00 148.96 ? 547  PRO C CB    1 
ATOM   7537  C  CG    . PRO C 2  547  ? -53.318 5.061   -22.136  1.00 138.47 ? 547  PRO C CG    1 
ATOM   7538  C  CD    . PRO C 2  547  ? -52.464 5.070   -23.366  1.00 140.91 ? 547  PRO C CD    1 
ATOM   7539  N  N     . ILE C 2  548  ? -55.486 1.809   -24.839  1.00 133.19 ? 548  ILE C N     1 
ATOM   7540  C  CA    . ILE C 2  548  ? -56.244 1.428   -26.023  1.00 145.70 ? 548  ILE C CA    1 
ATOM   7541  C  C     . ILE C 2  548  ? -57.527 0.727   -25.599  1.00 144.38 ? 548  ILE C C     1 
ATOM   7542  O  O     . ILE C 2  548  ? -57.517 -0.119  -24.697  1.00 131.19 ? 548  ILE C O     1 
ATOM   7543  C  CB    . ILE C 2  548  ? -55.408 0.521   -26.952  1.00 129.47 ? 548  ILE C CB    1 
ATOM   7544  C  CG1   . ILE C 2  548  ? -54.159 1.258   -27.438  1.00 114.36 ? 548  ILE C CG1   1 
ATOM   7545  C  CG2   . ILE C 2  548  ? -56.227 0.061   -28.142  1.00 128.32 ? 548  ILE C CG2   1 
ATOM   7546  C  CD1   . ILE C 2  548  ? -53.117 0.349   -28.046  1.00 116.36 ? 548  ILE C CD1   1 
ATOM   7547  N  N     . ASP C 2  549  ? -58.630 1.085   -26.252  1.00 153.50 ? 549  ASP C N     1 
ATOM   7548  C  CA    . ASP C 2  549  ? -59.900 0.405   -26.051  1.00 160.67 ? 549  ASP C CA    1 
ATOM   7549  C  C     . ASP C 2  549  ? -59.801 -1.050  -26.508  1.00 156.88 ? 549  ASP C C     1 
ATOM   7550  O  O     . ASP C 2  549  ? -58.960 -1.415  -27.334  1.00 160.67 ? 549  ASP C O     1 
ATOM   7551  C  CB    . ASP C 2  549  ? -61.009 1.130   -26.818  1.00 169.71 ? 549  ASP C CB    1 
ATOM   7552  C  CG    . ASP C 2  549  ? -62.381 0.519   -26.599  1.00 169.33 ? 549  ASP C CG    1 
ATOM   7553  O  OD1   . ASP C 2  549  ? -62.533 -0.319  -25.686  1.00 170.00 ? 549  ASP C OD1   1 
ATOM   7554  O  OD2   . ASP C 2  549  ? -63.313 0.880   -27.350  1.00 168.50 ? 549  ASP C OD2   1 
ATOM   7555  N  N     . ALA C 2  550  ? -60.680 -1.889  -25.951  1.00 156.61 ? 550  ALA C N     1 
ATOM   7556  C  CA    . ALA C 2  550  ? -60.742 -3.284  -26.376  1.00 154.70 ? 550  ALA C CA    1 
ATOM   7557  C  C     . ALA C 2  550  ? -61.088 -3.400  -27.854  1.00 174.29 ? 550  ALA C C     1 
ATOM   7558  O  O     . ALA C 2  550  ? -60.714 -4.384  -28.504  1.00 171.37 ? 550  ALA C O     1 
ATOM   7559  C  CB    . ALA C 2  550  ? -61.756 -4.050  -25.527  1.00 128.33 ? 550  ALA C CB    1 
ATOM   7560  N  N     . ASP C 2  551  ? -61.800 -2.412  -28.400  1.00 172.61 ? 551  ASP C N     1 
ATOM   7561  C  CA    . ASP C 2  551  ? -62.029 -2.365  -29.838  1.00 168.95 ? 551  ASP C CA    1 
ATOM   7562  C  C     . ASP C 2  551  ? -60.809 -1.845  -30.585  1.00 160.63 ? 551  ASP C C     1 
ATOM   7563  O  O     . ASP C 2  551  ? -60.542 -2.286  -31.709  1.00 158.14 ? 551  ASP C O     1 
ATOM   7564  C  CB    . ASP C 2  551  ? -63.247 -1.494  -30.150  1.00 173.93 ? 551  ASP C CB    1 
ATOM   7565  C  CG    . ASP C 2  551  ? -64.503 -1.977  -29.454  1.00 175.92 ? 551  ASP C CG    1 
ATOM   7566  O  OD1   . ASP C 2  551  ? -64.612 -3.194  -29.197  1.00 170.99 ? 551  ASP C OD1   1 
ATOM   7567  O  OD2   . ASP C 2  551  ? -65.382 -1.138  -29.163  1.00 176.69 ? 551  ASP C OD2   1 
ATOM   7568  N  N     . GLY C 2  552  ? -60.064 -0.917  -29.987  1.00 148.01 ? 552  GLY C N     1 
ATOM   7569  C  CA    . GLY C 2  552  ? -58.851 -0.412  -30.600  1.00 143.08 ? 552  GLY C CA    1 
ATOM   7570  C  C     . GLY C 2  552  ? -58.698 1.094   -30.526  1.00 148.53 ? 552  GLY C C     1 
ATOM   7571  O  O     . GLY C 2  552  ? -57.652 1.634   -30.898  1.00 156.17 ? 552  GLY C O     1 
ATOM   7572  N  N     . ARG C 2  553  ? -59.726 1.782   -30.039  1.00 143.43 ? 553  ARG C N     1 
ATOM   7573  C  CA    . ARG C 2  553  ? -59.723 3.238   -30.028  1.00 154.07 ? 553  ARG C CA    1 
ATOM   7574  C  C     . ARG C 2  553  ? -58.891 3.783   -28.874  1.00 144.87 ? 553  ARG C C     1 
ATOM   7575  O  O     . ARG C 2  553  ? -58.948 3.278   -27.750  1.00 151.08 ? 553  ARG C O     1 
ATOM   7576  C  CB    . ARG C 2  553  ? -61.152 3.774   -29.951  1.00 157.63 ? 553  ARG C CB    1 
ATOM   7577  C  CG    . ARG C 2  553  ? -61.701 4.224   -31.297  1.00 148.34 ? 553  ARG C CG    1 
ATOM   7578  C  CD    . ARG C 2  553  ? -63.211 4.368   -31.271  1.00 155.20 ? 553  ARG C CD    1 
ATOM   7579  N  NE    . ARG C 2  553  ? -63.869 3.081   -31.075  1.00 180.81 ? 553  ARG C NE    1 
ATOM   7580  C  CZ    . ARG C 2  553  ? -64.161 2.234   -32.057  1.00 170.29 ? 553  ARG C CZ    1 
ATOM   7581  N  NH1   . ARG C 2  553  ? -63.854 2.537   -33.311  1.00 150.89 ? 553  ARG C NH1   1 
ATOM   7582  N  NH2   . ARG C 2  553  ? -64.761 1.084   -31.785  1.00 151.36 ? 553  ARG C NH2   1 
ATOM   7583  N  N     . PHE C 2  554  ? -58.110 4.821   -29.167  1.00 139.84 ? 554  PHE C N     1 
ATOM   7584  C  CA    . PHE C 2  554  ? -57.285 5.452   -28.147  1.00 147.16 ? 554  PHE C CA    1 
ATOM   7585  C  C     . PHE C 2  554  ? -58.161 6.089   -27.075  1.00 150.04 ? 554  PHE C C     1 
ATOM   7586  O  O     . PHE C 2  554  ? -59.209 6.671   -27.369  1.00 159.38 ? 554  PHE C O     1 
ATOM   7587  C  CB    . PHE C 2  554  ? -56.373 6.507   -28.778  1.00 154.47 ? 554  PHE C CB    1 
ATOM   7588  C  CG    . PHE C 2  554  ? -55.259 5.932   -29.609  1.00 134.21 ? 554  PHE C CG    1 
ATOM   7589  C  CD1   . PHE C 2  554  ? -53.956 5.931   -29.137  1.00 136.91 ? 554  PHE C CD1   1 
ATOM   7590  C  CD2   . PHE C 2  554  ? -55.512 5.398   -30.862  1.00 132.72 ? 554  PHE C CD2   1 
ATOM   7591  C  CE1   . PHE C 2  554  ? -52.928 5.407   -29.899  1.00 161.12 ? 554  PHE C CE1   1 
ATOM   7592  C  CE2   . PHE C 2  554  ? -54.490 4.871   -31.627  1.00 149.86 ? 554  PHE C CE2   1 
ATOM   7593  C  CZ    . PHE C 2  554  ? -53.196 4.876   -31.145  1.00 163.45 ? 554  PHE C CZ    1 
ATOM   7594  N  N     . VAL C 2  555  ? -57.724 5.972   -25.820  1.00 139.03 ? 555  VAL C N     1 
ATOM   7595  C  CA    . VAL C 2  555  ? -58.504 6.519   -24.715  1.00 143.18 ? 555  VAL C CA    1 
ATOM   7596  C  C     . VAL C 2  555  ? -58.388 8.038   -24.678  1.00 155.75 ? 555  VAL C C     1 
ATOM   7597  O  O     . VAL C 2  555  ? -59.384 8.745   -24.480  1.00 162.69 ? 555  VAL C O     1 
ATOM   7598  C  CB    . VAL C 2  555  ? -58.066 5.881   -23.385  1.00 156.34 ? 555  VAL C CB    1 
ATOM   7599  C  CG1   . VAL C 2  555  ? -58.906 6.416   -22.239  1.00 148.02 ? 555  VAL C CG1   1 
ATOM   7600  C  CG2   . VAL C 2  555  ? -58.174 4.367   -23.465  1.00 142.91 ? 555  VAL C CG2   1 
ATOM   7601  N  N     . GLU C 2  556  ? -57.179 8.564   -24.868  1.00 160.19 ? 556  GLU C N     1 
ATOM   7602  C  CA    . GLU C 2  556  ? -57.034 10.009  -24.863  1.00 162.12 ? 556  GLU C CA    1 
ATOM   7603  C  C     . GLU C 2  556  ? -57.037 10.557  -26.284  1.00 161.16 ? 556  GLU C C     1 
ATOM   7604  O  O     . GLU C 2  556  ? -56.535 9.909   -27.209  1.00 166.60 ? 556  GLU C O     1 
ATOM   7605  C  CB    . GLU C 2  556  ? -55.733 10.432  -24.173  1.00 141.94 ? 556  GLU C CB    1 
ATOM   7606  C  CG    . GLU C 2  556  ? -55.737 10.274  -22.663  1.00 139.53 ? 556  GLU C CG    1 
ATOM   7607  C  CD    . GLU C 2  556  ? -55.633 8.828   -22.225  1.00 152.75 ? 556  GLU C CD    1 
ATOM   7608  O  OE1   . GLU C 2  556  ? -55.124 8.002   -23.012  1.00 171.28 ? 556  GLU C OE1   1 
ATOM   7609  O  OE2   . GLU C 2  556  ? -56.064 8.518   -21.096  1.00 145.60 ? 556  GLU C OE2   1 
ATOM   7610  N  N     . PRO C 2  557  ? -57.607 11.747  -26.488  1.00 158.82 ? 557  PRO C N     1 
ATOM   7611  C  CA    . PRO C 2  557  ? -57.466 12.393  -27.802  1.00 160.99 ? 557  PRO C CA    1 
ATOM   7612  C  C     . PRO C 2  557  ? -56.022 12.710  -28.138  1.00 157.32 ? 557  PRO C C     1 
ATOM   7613  O  O     . PRO C 2  557  ? -55.578 12.460  -29.265  1.00 129.59 ? 557  PRO C O     1 
ATOM   7614  C  CB    . PRO C 2  557  ? -58.314 13.666  -27.659  1.00 176.58 ? 557  PRO C CB    1 
ATOM   7615  C  CG    . PRO C 2  557  ? -59.245 13.386  -26.523  1.00 155.56 ? 557  PRO C CG    1 
ATOM   7616  C  CD    . PRO C 2  557  ? -58.473 12.517  -25.581  1.00 143.02 ? 557  PRO C CD    1 
ATOM   7617  N  N     . ARG C 2  558  ? -55.271 13.243  -27.179  1.00 171.33 ? 558  ARG C N     1 
ATOM   7618  C  CA    . ARG C 2  558  ? -53.863 13.568  -27.358  1.00 164.61 ? 558  ARG C CA    1 
ATOM   7619  C  C     . ARG C 2  558  ? -53.017 12.443  -26.775  1.00 177.07 ? 558  ARG C C     1 
ATOM   7620  O  O     . ARG C 2  558  ? -53.168 12.094  -25.599  1.00 166.52 ? 558  ARG C O     1 
ATOM   7621  C  CB    . ARG C 2  558  ? -53.528 14.899  -26.688  1.00 157.11 ? 558  ARG C CB    1 
ATOM   7622  C  CG    . ARG C 2  558  ? -54.185 16.109  -27.332  1.00 134.23 ? 558  ARG C CG    1 
ATOM   7623  C  CD    . ARG C 2  558  ? -54.724 17.065  -26.279  1.00 148.03 ? 558  ARG C CD    1 
ATOM   7624  N  NE    . ARG C 2  558  ? -56.100 16.745  -25.906  1.00 171.72 ? 558  ARG C NE    1 
ATOM   7625  C  CZ    . ARG C 2  558  ? -56.728 17.255  -24.852  1.00 183.55 ? 558  ARG C CZ    1 
ATOM   7626  N  NH1   . ARG C 2  558  ? -56.100 18.106  -24.051  1.00 158.68 ? 558  ARG C NH1   1 
ATOM   7627  N  NH2   . ARG C 2  558  ? -57.982 16.910  -24.594  1.00 181.19 ? 558  ARG C NH2   1 
ATOM   7628  N  N     . VAL C 2  559  ? -52.133 11.878  -27.594  1.00 179.60 ? 559  VAL C N     1 
ATOM   7629  C  CA    . VAL C 2  559  ? -51.280 10.774  -27.177  1.00 179.21 ? 559  VAL C CA    1 
ATOM   7630  C  C     . VAL C 2  559  ? -49.834 11.101  -27.516  1.00 172.80 ? 559  VAL C C     1 
ATOM   7631  O  O     . VAL C 2  559  ? -49.547 11.802  -28.492  1.00 164.87 ? 559  VAL C O     1 
ATOM   7632  C  CB    . VAL C 2  559  ? -51.702 9.441   -27.834  1.00 153.28 ? 559  VAL C CB    1 
ATOM   7633  C  CG1   . VAL C 2  559  ? -52.999 8.934   -27.224  1.00 154.40 ? 559  VAL C CG1   1 
ATOM   7634  C  CG2   . VAL C 2  559  ? -51.854 9.621   -29.333  1.00 125.69 ? 559  VAL C CG2   1 
ATOM   7635  N  N     . LEU C 2  560  ? -48.920 10.587  -26.695  1.00 171.42 ? 560  LEU C N     1 
ATOM   7636  C  CA    . LEU C 2  560  ? -47.495 10.752  -26.952  1.00 149.48 ? 560  LEU C CA    1 
ATOM   7637  C  C     . LEU C 2  560  ? -47.113 10.043  -28.245  1.00 135.81 ? 560  LEU C C     1 
ATOM   7638  O  O     . LEU C 2  560  ? -47.298 8.828   -28.377  1.00 126.76 ? 560  LEU C O     1 
ATOM   7639  C  CB    . LEU C 2  560  ? -46.685 10.207  -25.777  1.00 150.20 ? 560  LEU C CB    1 
ATOM   7640  C  CG    . LEU C 2  560  ? -46.766 10.999  -24.471  1.00 158.54 ? 560  LEU C CG    1 
ATOM   7641  C  CD1   . LEU C 2  560  ? -46.065 10.254  -23.349  1.00 140.50 ? 560  LEU C CD1   1 
ATOM   7642  C  CD2   . LEU C 2  560  ? -46.162 12.382  -24.653  1.00 149.40 ? 560  LEU C CD2   1 
ATOM   7643  N  N     . VAL C 2  561  ? -46.579 10.804  -29.198  1.00 133.35 ? 561  VAL C N     1 
ATOM   7644  C  CA    . VAL C 2  561  ? -46.331 10.322  -30.552  1.00 136.33 ? 561  VAL C CA    1 
ATOM   7645  C  C     . VAL C 2  561  ? -44.971 10.826  -31.018  1.00 126.19 ? 561  VAL C C     1 
ATOM   7646  O  O     . VAL C 2  561  ? -44.588 11.966  -30.734  1.00 120.29 ? 561  VAL C O     1 
ATOM   7647  C  CB    . VAL C 2  561  ? -47.454 10.773  -31.514  1.00 139.61 ? 561  VAL C CB    1 
ATOM   7648  C  CG1   . VAL C 2  561  ? -47.047 10.586  -32.964  1.00 128.51 ? 561  VAL C CG1   1 
ATOM   7649  C  CG2   . VAL C 2  561  ? -48.736 10.007  -31.228  1.00 133.61 ? 561  VAL C CG2   1 
ATOM   7650  N  N     . ARG C 2  562  ? -44.238 9.968   -31.727  1.00 115.60 ? 562  ARG C N     1 
ATOM   7651  C  CA    . ARG C 2  562  ? -42.961 10.336  -32.322  1.00 130.65 ? 562  ARG C CA    1 
ATOM   7652  C  C     . ARG C 2  562  ? -43.176 10.896  -33.722  1.00 142.96 ? 562  ARG C C     1 
ATOM   7653  O  O     . ARG C 2  562  ? -43.979 10.371  -34.498  1.00 125.09 ? 562  ARG C O     1 
ATOM   7654  C  CB    . ARG C 2  562  ? -42.029 9.125   -32.387  1.00 134.51 ? 562  ARG C CB    1 
ATOM   7655  C  CG    . ARG C 2  562  ? -40.596 9.408   -31.967  1.00 129.81 ? 562  ARG C CG    1 
ATOM   7656  C  CD    . ARG C 2  562  ? -39.718 8.170   -32.104  1.00 109.29 ? 562  ARG C CD    1 
ATOM   7657  N  NE    . ARG C 2  562  ? -40.483 6.932   -31.969  1.00 109.77 ? 562  ARG C NE    1 
ATOM   7658  C  CZ    . ARG C 2  562  ? -40.726 6.092   -32.970  1.00 105.54 ? 562  ARG C CZ    1 
ATOM   7659  N  NH1   . ARG C 2  562  ? -41.437 4.993   -32.759  1.00 89.85  ? 562  ARG C NH1   1 
ATOM   7660  N  NH2   . ARG C 2  562  ? -40.256 6.349   -34.182  1.00 117.69 ? 562  ARG C NH2   1 
ATOM   7661  N  N     . ARG C 2  563  ? -42.450 11.964  -34.041  1.00 153.61 ? 563  ARG C N     1 
ATOM   7662  C  CA    . ARG C 2  563  ? -42.529 12.598  -35.347  1.00 147.29 ? 563  ARG C CA    1 
ATOM   7663  C  C     . ARG C 2  563  ? -41.124 12.736  -35.920  1.00 157.18 ? 563  ARG C C     1 
ATOM   7664  O  O     . ARG C 2  563  ? -40.126 12.603  -35.206  1.00 151.73 ? 563  ARG C O     1 
ATOM   7665  C  CB    . ARG C 2  563  ? -43.220 13.972  -35.263  1.00 146.00 ? 563  ARG C CB    1 
ATOM   7666  C  CG    . ARG C 2  563  ? -43.635 14.561  -36.608  1.00 135.25 ? 563  ARG C CG    1 
ATOM   7667  C  CD    . ARG C 2  563  ? -44.220 15.953  -36.457  1.00 154.45 ? 563  ARG C CD    1 
ATOM   7668  N  NE    . ARG C 2  563  ? -45.468 15.933  -35.701  1.00 171.92 ? 563  ARG C NE    1 
ATOM   7669  C  CZ    . ARG C 2  563  ? -46.663 15.726  -36.242  1.00 168.53 ? 563  ARG C CZ    1 
ATOM   7670  N  NH1   . ARG C 2  563  ? -46.779 15.521  -37.547  1.00 167.22 ? 563  ARG C NH1   1 
ATOM   7671  N  NH2   . ARG C 2  563  ? -47.745 15.724  -35.478  1.00 146.19 ? 563  ARG C NH2   1 
ATOM   7672  N  N     . LYS C 2  564  ? -41.064 12.990  -37.229  1.00 146.10 ? 564  LYS C N     1 
ATOM   7673  C  CA    . LYS C 2  564  ? -39.799 13.180  -37.927  1.00 139.70 ? 564  LYS C CA    1 
ATOM   7674  C  C     . LYS C 2  564  ? -38.932 14.210  -37.209  1.00 144.31 ? 564  LYS C C     1 
ATOM   7675  O  O     . LYS C 2  564  ? -39.435 15.131  -36.558  1.00 144.76 ? 564  LYS C O     1 
ATOM   7676  C  CB    . LYS C 2  564  ? -40.062 13.621  -39.370  1.00 125.71 ? 564  LYS C CB    1 
ATOM   7677  C  CG    . LYS C 2  564  ? -38.817 13.813  -40.224  1.00 144.36 ? 564  LYS C CG    1 
ATOM   7678  C  CD    . LYS C 2  564  ? -39.155 14.480  -41.547  1.00 141.76 ? 564  LYS C CD    1 
ATOM   7679  C  CE    . LYS C 2  564  ? -37.896 14.846  -42.316  1.00 133.22 ? 564  LYS C CE    1 
ATOM   7680  N  NZ    . LYS C 2  564  ? -38.200 15.603  -43.562  1.00 121.04 ? 564  LYS C NZ    1 
ATOM   7681  N  N     . ALA C 2  565  ? -37.614 14.029  -37.326  1.00 121.81 ? 565  ALA C N     1 
ATOM   7682  C  CA    . ALA C 2  565  ? -36.593 14.867  -36.704  1.00 119.49 ? 565  ALA C CA    1 
ATOM   7683  C  C     . ALA C 2  565  ? -36.590 14.757  -35.183  1.00 150.90 ? 565  ALA C C     1 
ATOM   7684  O  O     . ALA C 2  565  ? -36.137 15.678  -34.494  1.00 153.20 ? 565  ALA C O     1 
ATOM   7685  C  CB    . ALA C 2  565  ? -36.728 16.336  -37.127  1.00 134.12 ? 565  ALA C CB    1 
ATOM   7686  N  N     . GLY C 2  566  ? -37.081 13.642  -34.645  1.00 156.58 ? 566  GLY C N     1 
ATOM   7687  C  CA    . GLY C 2  566  ? -37.003 13.368  -33.223  1.00 158.79 ? 566  GLY C CA    1 
ATOM   7688  C  C     . GLY C 2  566  ? -37.800 14.320  -32.357  1.00 159.23 ? 566  GLY C C     1 
ATOM   7689  O  O     . GLY C 2  566  ? -37.294 14.817  -31.344  1.00 163.03 ? 566  GLY C O     1 
ATOM   7690  N  N     . GLU C 2  567  ? -39.045 14.583  -32.740  1.00 157.23 ? 567  GLU C N     1 
ATOM   7691  C  CA    . GLU C 2  567  ? -39.939 15.455  -31.991  1.00 165.94 ? 567  GLU C CA    1 
ATOM   7692  C  C     . GLU C 2  567  ? -40.977 14.609  -31.269  1.00 142.88 ? 567  GLU C C     1 
ATOM   7693  O  O     . GLU C 2  567  ? -41.585 13.719  -31.872  1.00 125.47 ? 567  GLU C O     1 
ATOM   7694  C  CB    . GLU C 2  567  ? -40.625 16.464  -32.914  1.00 177.00 ? 567  GLU C CB    1 
ATOM   7695  C  CG    . GLU C 2  567  ? -41.571 17.411  -32.195  1.00 174.02 ? 567  GLU C CG    1 
ATOM   7696  C  CD    . GLU C 2  567  ? -42.336 18.307  -33.148  1.00 181.04 ? 567  GLU C CD    1 
ATOM   7697  O  OE1   . GLU C 2  567  ? -42.233 18.093  -34.374  1.00 186.47 ? 567  GLU C OE1   1 
ATOM   7698  O  OE2   . GLU C 2  567  ? -43.039 19.223  -32.673  1.00 179.13 ? 567  GLU C OE2   1 
ATOM   7699  N  N     . VAL C 2  568  ? -41.173 14.887  -29.983  1.00 123.95 ? 568  VAL C N     1 
ATOM   7700  C  CA    . VAL C 2  568  ? -42.153 14.192  -29.157  1.00 137.72 ? 568  VAL C CA    1 
ATOM   7701  C  C     . VAL C 2  568  ? -43.167 15.212  -28.660  1.00 156.15 ? 568  VAL C C     1 
ATOM   7702  O  O     . VAL C 2  568  ? -42.794 16.214  -28.039  1.00 150.38 ? 568  VAL C O     1 
ATOM   7703  C  CB    . VAL C 2  568  ? -41.492 13.461  -27.974  1.00 140.78 ? 568  VAL C CB    1 
ATOM   7704  C  CG1   . VAL C 2  568  ? -42.546 12.770  -27.126  1.00 140.76 ? 568  VAL C CG1   1 
ATOM   7705  C  CG2   . VAL C 2  568  ? -40.464 12.458  -28.475  1.00 124.95 ? 568  VAL C CG2   1 
ATOM   7706  N  N     . GLU C 2  569  ? -44.444 14.950  -28.927  1.00 166.82 ? 569  GLU C N     1 
ATOM   7707  C  CA    . GLU C 2  569  ? -45.509 15.870  -28.556  1.00 159.13 ? 569  GLU C CA    1 
ATOM   7708  C  C     . GLU C 2  569  ? -46.837 15.132  -28.616  1.00 152.79 ? 569  GLU C C     1 
ATOM   7709  O  O     . GLU C 2  569  ? -46.955 14.078  -29.247  1.00 140.23 ? 569  GLU C O     1 
ATOM   7710  C  CB    . GLU C 2  569  ? -45.536 17.096  -29.475  1.00 159.24 ? 569  GLU C CB    1 
ATOM   7711  C  CG    . GLU C 2  569  ? -45.823 16.760  -30.930  1.00 151.33 ? 569  GLU C CG    1 
ATOM   7712  C  CD    . GLU C 2  569  ? -45.809 17.980  -31.829  1.00 168.15 ? 569  GLU C CD    1 
ATOM   7713  O  OE1   . GLU C 2  569  ? -45.625 19.101  -31.312  1.00 187.25 ? 569  GLU C OE1   1 
ATOM   7714  O  OE2   . GLU C 2  569  ? -45.981 17.816  -33.056  1.00 155.67 ? 569  GLU C OE2   1 
ATOM   7715  N  N     . TYR C 2  570  ? -47.834 15.701  -27.945  1.00 152.26 ? 570  TYR C N     1 
ATOM   7716  C  CA    . TYR C 2  570  ? -49.188 15.175  -28.024  1.00 155.78 ? 570  TYR C CA    1 
ATOM   7717  C  C     . TYR C 2  570  ? -49.811 15.529  -29.371  1.00 148.41 ? 570  TYR C C     1 
ATOM   7718  O  O     . TYR C 2  570  ? -49.450 16.524  -30.005  1.00 145.67 ? 570  TYR C O     1 
ATOM   7719  C  CB    . TYR C 2  570  ? -50.044 15.724  -26.882  1.00 170.83 ? 570  TYR C CB    1 
ATOM   7720  C  CG    . TYR C 2  570  ? -49.708 15.145  -25.524  1.00 182.03 ? 570  TYR C CG    1 
ATOM   7721  C  CD1   . TYR C 2  570  ? -50.518 14.180  -24.938  1.00 188.72 ? 570  TYR C CD1   1 
ATOM   7722  C  CD2   . TYR C 2  570  ? -48.580 15.562  -24.829  1.00 171.06 ? 570  TYR C CD2   1 
ATOM   7723  C  CE1   . TYR C 2  570  ? -50.215 13.649  -23.696  1.00 192.41 ? 570  TYR C CE1   1 
ATOM   7724  C  CE2   . TYR C 2  570  ? -48.269 15.036  -23.588  1.00 163.48 ? 570  TYR C CE2   1 
ATOM   7725  C  CZ    . TYR C 2  570  ? -49.089 14.080  -23.027  1.00 183.14 ? 570  TYR C CZ    1 
ATOM   7726  O  OH    . TYR C 2  570  ? -48.781 13.555  -21.793  1.00 174.51 ? 570  TYR C OH    1 
ATOM   7727  N  N     . VAL C 2  571  ? -50.756 14.702  -29.806  1.00 153.24 ? 571  VAL C N     1 
ATOM   7728  C  CA    . VAL C 2  571  ? -51.343 14.844  -31.137  1.00 146.15 ? 571  VAL C CA    1 
ATOM   7729  C  C     . VAL C 2  571  ? -52.705 14.157  -31.153  1.00 139.99 ? 571  VAL C C     1 
ATOM   7730  O  O     . VAL C 2  571  ? -52.922 13.207  -30.386  1.00 135.26 ? 571  VAL C O     1 
ATOM   7731  C  CB    . VAL C 2  571  ? -50.390 14.286  -32.209  1.00 144.50 ? 571  VAL C CB    1 
ATOM   7732  C  CG1   . VAL C 2  571  ? -50.988 13.075  -32.917  1.00 152.74 ? 571  VAL C CG1   1 
ATOM   7733  C  CG2   . VAL C 2  571  ? -50.016 15.374  -33.203  1.00 138.27 ? 571  VAL C CG2   1 
ATOM   7734  N  N     . PRO C 2  572  ? -53.650 14.601  -31.988  1.00 136.77 ? 572  PRO C N     1 
ATOM   7735  C  CA    . PRO C 2  572  ? -54.996 14.015  -31.959  1.00 139.12 ? 572  PRO C CA    1 
ATOM   7736  C  C     . PRO C 2  572  ? -54.990 12.524  -32.262  1.00 132.25 ? 572  PRO C C     1 
ATOM   7737  O  O     . PRO C 2  572  ? -54.103 12.005  -32.943  1.00 135.34 ? 572  PRO C O     1 
ATOM   7738  C  CB    . PRO C 2  572  ? -55.750 14.800  -33.041  1.00 128.76 ? 572  PRO C CB    1 
ATOM   7739  C  CG    . PRO C 2  572  ? -54.682 15.388  -33.908  1.00 131.81 ? 572  PRO C CG    1 
ATOM   7740  C  CD    . PRO C 2  572  ? -53.550 15.686  -32.979  1.00 139.98 ? 572  PRO C CD    1 
ATOM   7741  N  N     . SER C 2  573  ? -56.007 11.833  -31.735  1.00 132.64 ? 573  SER C N     1 
ATOM   7742  C  CA    . SER C 2  573  ? -56.126 10.395  -31.948  1.00 137.44 ? 573  SER C CA    1 
ATOM   7743  C  C     . SER C 2  573  ? -56.395 10.060  -33.409  1.00 149.30 ? 573  SER C C     1 
ATOM   7744  O  O     . SER C 2  573  ? -56.054 8.962   -33.865  1.00 154.40 ? 573  SER C O     1 
ATOM   7745  C  CB    . SER C 2  573  ? -57.234 9.824   -31.062  1.00 130.72 ? 573  SER C CB    1 
ATOM   7746  O  OG    . SER C 2  573  ? -57.457 8.453   -31.341  1.00 153.41 ? 573  SER C OG    1 
ATOM   7747  N  N     . SER C 2  574  ? -57.002 10.981  -34.153  1.00 152.39 ? 574  SER C N     1 
ATOM   7748  C  CA    . SER C 2  574  ? -57.256 10.792  -35.575  1.00 156.60 ? 574  SER C CA    1 
ATOM   7749  C  C     . SER C 2  574  ? -56.029 11.066  -36.435  1.00 161.70 ? 574  SER C C     1 
ATOM   7750  O  O     . SER C 2  574  ? -56.139 11.075  -37.665  1.00 149.29 ? 574  SER C O     1 
ATOM   7751  C  CB    . SER C 2  574  ? -58.415 11.687  -36.022  1.00 152.77 ? 574  SER C CB    1 
ATOM   7752  O  OG    . SER C 2  574  ? -58.198 13.031  -35.631  1.00 133.91 ? 574  SER C OG    1 
ATOM   7753  N  N     . GLU C 2  575  ? -54.871 11.292  -35.816  1.00 163.19 ? 575  GLU C N     1 
ATOM   7754  C  CA    . GLU C 2  575  ? -53.631 11.533  -36.535  1.00 165.27 ? 575  GLU C CA    1 
ATOM   7755  C  C     . GLU C 2  575  ? -52.663 10.361  -36.461  1.00 161.12 ? 575  GLU C C     1 
ATOM   7756  O  O     . GLU C 2  575  ? -51.727 10.299  -37.266  1.00 162.58 ? 575  GLU C O     1 
ATOM   7757  C  CB    . GLU C 2  575  ? -52.950 12.800  -35.991  1.00 152.71 ? 575  GLU C CB    1 
ATOM   7758  C  CG    . GLU C 2  575  ? -51.836 13.367  -36.861  1.00 151.51 ? 575  GLU C CG    1 
ATOM   7759  C  CD    . GLU C 2  575  ? -52.353 14.207  -38.014  1.00 161.91 ? 575  GLU C CD    1 
ATOM   7760  O  OE1   . GLU C 2  575  ? -53.583 14.234  -38.234  1.00 164.60 ? 575  GLU C OE1   1 
ATOM   7761  O  OE2   . GLU C 2  575  ? -51.527 14.847  -38.698  1.00 169.89 ? 575  GLU C OE2   1 
ATOM   7762  N  N     . VAL C 2  576  ? -52.875 9.425   -35.539  1.00 143.52 ? 576  VAL C N     1 
ATOM   7763  C  CA    . VAL C 2  576  ? -51.959 8.307   -35.333  1.00 128.43 ? 576  VAL C CA    1 
ATOM   7764  C  C     . VAL C 2  576  ? -52.079 7.351   -36.518  1.00 127.51 ? 576  VAL C C     1 
ATOM   7765  O  O     . VAL C 2  576  ? -53.128 6.736   -36.726  1.00 120.00 ? 576  VAL C O     1 
ATOM   7766  C  CB    . VAL C 2  576  ? -52.243 7.591   -34.009  1.00 148.25 ? 576  VAL C CB    1 
ATOM   7767  C  CG1   . VAL C 2  576  ? -51.374 6.358   -33.875  1.00 142.17 ? 576  VAL C CG1   1 
ATOM   7768  C  CG2   . VAL C 2  576  ? -52.015 8.535   -32.840  1.00 152.41 ? 576  VAL C CG2   1 
ATOM   7769  N  N     . ASP C 2  577  ? -51.001 7.220   -37.293  1.00 142.14 ? 577  ASP C N     1 
ATOM   7770  C  CA    . ASP C 2  577  ? -50.981 6.315   -38.436  1.00 149.18 ? 577  ASP C CA    1 
ATOM   7771  C  C     . ASP C 2  577  ? -50.549 4.904   -38.054  1.00 152.02 ? 577  ASP C C     1 
ATOM   7772  O  O     . ASP C 2  577  ? -51.128 3.927   -38.542  1.00 147.22 ? 577  ASP C O     1 
ATOM   7773  C  CB    . ASP C 2  577  ? -50.055 6.859   -39.527  1.00 122.13 ? 577  ASP C CB    1 
ATOM   7774  C  CG    . ASP C 2  577  ? -50.547 8.167   -40.112  1.00 157.81 ? 577  ASP C CG    1 
ATOM   7775  O  OD1   . ASP C 2  577  ? -51.765 8.433   -40.034  1.00 195.76 ? 577  ASP C OD1   1 
ATOM   7776  O  OD2   . ASP C 2  577  ? -49.718 8.927   -40.654  1.00 161.83 ? 577  ASP C OD2   1 
ATOM   7777  N  N     . TYR C 2  578  ? -49.536 4.778   -37.198  1.00 150.48 ? 578  TYR C N     1 
ATOM   7778  C  CA    . TYR C 2  578  ? -49.042 3.485   -36.746  1.00 136.68 ? 578  TYR C CA    1 
ATOM   7779  C  C     . TYR C 2  578  ? -48.737 3.575   -35.257  1.00 133.00 ? 578  TYR C C     1 
ATOM   7780  O  O     . TYR C 2  578  ? -48.848 4.640   -34.643  1.00 120.25 ? 578  TYR C O     1 
ATOM   7781  C  CB    . TYR C 2  578  ? -47.797 3.053   -37.533  1.00 130.59 ? 578  TYR C CB    1 
ATOM   7782  C  CG    . TYR C 2  578  ? -47.978 3.016   -39.034  1.00 124.85 ? 578  TYR C CG    1 
ATOM   7783  C  CD1   . TYR C 2  578  ? -48.347 1.845   -39.678  1.00 124.15 ? 578  TYR C CD1   1 
ATOM   7784  C  CD2   . TYR C 2  578  ? -47.766 4.150   -39.808  1.00 134.28 ? 578  TYR C CD2   1 
ATOM   7785  C  CE1   . TYR C 2  578  ? -48.512 1.804   -41.048  1.00 126.06 ? 578  TYR C CE1   1 
ATOM   7786  C  CE2   . TYR C 2  578  ? -47.928 4.118   -41.180  1.00 145.03 ? 578  TYR C CE2   1 
ATOM   7787  C  CZ    . TYR C 2  578  ? -48.301 2.942   -41.795  1.00 138.04 ? 578  TYR C CZ    1 
ATOM   7788  O  OH    . TYR C 2  578  ? -48.463 2.903   -43.161  1.00 122.12 ? 578  TYR C OH    1 
ATOM   7789  N  N     . MET C 2  579  ? -48.350 2.445   -34.669  1.00 138.81 ? 579  MET C N     1 
ATOM   7790  C  CA    . MET C 2  579  ? -47.892 2.428   -33.287  1.00 128.86 ? 579  MET C CA    1 
ATOM   7791  C  C     . MET C 2  579  ? -46.927 1.267   -33.101  1.00 119.86 ? 579  MET C C     1 
ATOM   7792  O  O     . MET C 2  579  ? -46.913 0.313   -33.884  1.00 105.60 ? 579  MET C O     1 
ATOM   7793  C  CB    . MET C 2  579  ? -49.056 2.328   -32.292  1.00 129.39 ? 579  MET C CB    1 
ATOM   7794  C  CG    . MET C 2  579  ? -49.570 0.918   -32.054  1.00 141.84 ? 579  MET C CG    1 
ATOM   7795  S  SD    . MET C 2  579  ? -50.725 0.845   -30.672  1.00 179.39 ? 579  MET C SD    1 
ATOM   7796  C  CE    . MET C 2  579  ? -49.691 1.442   -29.338  1.00 110.69 ? 579  MET C CE    1 
ATOM   7797  N  N     . ASP C 2  580  ? -46.117 1.363   -32.050  1.00 119.35 ? 580  ASP C N     1 
ATOM   7798  C  CA    . ASP C 2  580  ? -45.079 0.373   -31.804  1.00 109.80 ? 580  ASP C CA    1 
ATOM   7799  C  C     . ASP C 2  580  ? -45.685 -0.990  -31.486  1.00 102.13 ? 580  ASP C C     1 
ATOM   7800  O  O     . ASP C 2  580  ? -46.774 -1.098  -30.916  1.00 108.23 ? 580  ASP C O     1 
ATOM   7801  C  CB    . ASP C 2  580  ? -44.176 0.821   -30.655  1.00 103.30 ? 580  ASP C CB    1 
ATOM   7802  C  CG    . ASP C 2  580  ? -43.484 2.140   -30.935  1.00 118.02 ? 580  ASP C CG    1 
ATOM   7803  O  OD1   . ASP C 2  580  ? -43.619 2.658   -32.063  1.00 119.23 ? 580  ASP C OD1   1 
ATOM   7804  O  OD2   . ASP C 2  580  ? -42.807 2.659   -30.024  1.00 122.83 ? 580  ASP C OD2   1 
ATOM   7805  N  N     . VAL C 2  581  ? -44.959 -2.039  -31.867  1.00 97.99  ? 581  VAL C N     1 
ATOM   7806  C  CA    . VAL C 2  581  ? -45.379 -3.413  -31.618  1.00 83.28  ? 581  VAL C CA    1 
ATOM   7807  C  C     . VAL C 2  581  ? -45.321 -3.690  -30.123  1.00 93.67  ? 581  VAL C C     1 
ATOM   7808  O  O     . VAL C 2  581  ? -46.350 -3.924  -29.480  1.00 103.37 ? 581  VAL C O     1 
ATOM   7809  C  CB    . VAL C 2  581  ? -44.502 -4.408  -32.401  1.00 86.86  ? 581  VAL C CB    1 
ATOM   7810  C  CG1   . VAL C 2  581  ? -44.795 -5.838  -31.971  1.00 109.09 ? 581  VAL C CG1   1 
ATOM   7811  C  CG2   . VAL C 2  581  ? -44.722 -4.238  -33.895  1.00 82.61  ? 581  VAL C CG2   1 
ATOM   7812  N  N     . SER C 2  582  ? -44.116 -3.655  -29.561  1.00 103.04 ? 582  SER C N     1 
ATOM   7813  C  CA    . SER C 2  582  ? -43.878 -3.914  -28.154  1.00 99.41  ? 582  SER C CA    1 
ATOM   7814  C  C     . SER C 2  582  ? -43.154 -2.733  -27.519  1.00 96.68  ? 582  SER C C     1 
ATOM   7815  O  O     . SER C 2  582  ? -42.483 -1.968  -28.217  1.00 109.06 ? 582  SER C O     1 
ATOM   7816  C  CB    . SER C 2  582  ? -43.047 -5.192  -27.976  1.00 94.17  ? 582  SER C CB    1 
ATOM   7817  O  OG    . SER C 2  582  ? -42.594 -5.344  -26.644  1.00 104.62 ? 582  SER C OG    1 
ATOM   7818  N  N     . PRO C 2  583  ? -43.298 -2.535  -26.204  1.00 70.93  ? 583  PRO C N     1 
ATOM   7819  C  CA    . PRO C 2  583  ? -42.514 -1.477  -25.538  1.00 76.99  ? 583  PRO C CA    1 
ATOM   7820  C  C     . PRO C 2  583  ? -41.014 -1.617  -25.746  1.00 89.38  ? 583  PRO C C     1 
ATOM   7821  O  O     . PRO C 2  583  ? -40.343 -0.645  -26.116  1.00 85.11  ? 583  PRO C O     1 
ATOM   7822  C  CB    . PRO C 2  583  ? -42.912 -1.638  -24.066  1.00 93.68  ? 583  PRO C CB    1 
ATOM   7823  C  CG    . PRO C 2  583  ? -44.286 -2.207  -24.116  1.00 102.51 ? 583  PRO C CG    1 
ATOM   7824  C  CD    . PRO C 2  583  ? -44.310 -3.122  -25.307  1.00 79.09  ? 583  PRO C CD    1 
ATOM   7825  N  N     . ARG C 2  584  ? -40.474 -2.811  -25.529  1.00 96.10  ? 584  ARG C N     1 
ATOM   7826  C  CA    . ARG C 2  584  ? -39.060 -3.147  -25.684  1.00 99.07  ? 584  ARG C CA    1 
ATOM   7827  C  C     . ARG C 2  584  ? -38.587 -3.144  -27.149  1.00 86.33  ? 584  ARG C C     1 
ATOM   7828  O  O     . ARG C 2  584  ? -37.507 -3.683  -27.425  1.00 79.61  ? 584  ARG C O     1 
ATOM   7829  C  CB    . ARG C 2  584  ? -38.803 -4.516  -25.055  1.00 89.57  ? 584  ARG C CB    1 
ATOM   7830  C  CG    . ARG C 2  584  ? -39.511 -5.648  -25.779  1.00 116.68 ? 584  ARG C CG    1 
ATOM   7831  C  CD    . ARG C 2  584  ? -39.647 -6.883  -24.909  1.00 126.88 ? 584  ARG C CD    1 
ATOM   7832  N  NE    . ARG C 2  584  ? -40.062 -8.045  -25.691  1.00 124.43 ? 584  ARG C NE    1 
ATOM   7833  C  CZ    . ARG C 2  584  ? -40.284 -9.251  -25.180  1.00 115.78 ? 584  ARG C CZ    1 
ATOM   7834  N  NH1   . ARG C 2  584  ? -40.137 -9.459  -23.879  1.00 118.60 ? 584  ARG C NH1   1 
ATOM   7835  N  NH2   . ARG C 2  584  ? -40.654 -10.249 -25.970  1.00 81.67  ? 584  ARG C NH2   1 
ATOM   7836  N  N     . GLN C 2  585  ? -39.352 -2.550  -28.068  1.00 76.60  ? 585  GLN C N     1 
ATOM   7837  C  CA    . GLN C 2  585  ? -39.021 -2.589  -29.489  1.00 81.35  ? 585  GLN C CA    1 
ATOM   7838  C  C     . GLN C 2  585  ? -37.692 -1.914  -29.810  1.00 71.59  ? 585  GLN C C     1 
ATOM   7839  O  O     . GLN C 2  585  ? -37.071 -2.249  -30.825  1.00 74.47  ? 585  GLN C O     1 
ATOM   7840  C  CB    . GLN C 2  585  ? -40.153 -1.934  -30.285  1.00 93.46  ? 585  GLN C CB    1 
ATOM   7841  C  CG    . GLN C 2  585  ? -40.012 -1.997  -31.792  1.00 101.37 ? 585  GLN C CG    1 
ATOM   7842  C  CD    . GLN C 2  585  ? -41.255 -1.504  -32.503  1.00 95.43  ? 585  GLN C CD    1 
ATOM   7843  O  OE1   . GLN C 2  585  ? -42.344 -1.479  -31.928  1.00 91.79  ? 585  GLN C OE1   1 
ATOM   7844  N  NE2   . GLN C 2  585  ? -41.100 -1.108  -33.760  1.00 96.24  ? 585  GLN C NE2   1 
ATOM   7845  N  N     . MET C 2  586  ? -37.232 -0.989  -28.967  1.00 57.05  ? 586  MET C N     1 
ATOM   7846  C  CA    . MET C 2  586  ? -36.063 -0.171  -29.271  1.00 78.94  ? 586  MET C CA    1 
ATOM   7847  C  C     . MET C 2  586  ? -34.752 -0.741  -28.744  1.00 80.83  ? 586  MET C C     1 
ATOM   7848  O  O     . MET C 2  586  ? -33.686 -0.251  -29.134  1.00 82.94  ? 586  MET C O     1 
ATOM   7849  C  CB    . MET C 2  586  ? -36.245 1.243   -28.708  1.00 85.14  ? 586  MET C CB    1 
ATOM   7850  C  CG    . MET C 2  586  ? -36.736 1.280   -27.268  1.00 59.98  ? 586  MET C CG    1 
ATOM   7851  S  SD    . MET C 2  586  ? -36.436 2.861   -26.456  1.00 90.64  ? 586  MET C SD    1 
ATOM   7852  C  CE    . MET C 2  586  ? -34.735 2.653   -25.949  1.00 64.09  ? 586  MET C CE    1 
ATOM   7853  N  N     . VAL C 2  587  ? -34.790 -1.744  -27.877  1.00 72.35  ? 587  VAL C N     1 
ATOM   7854  C  CA    . VAL C 2  587  ? -33.595 -2.227  -27.212  1.00 74.41  ? 587  VAL C CA    1 
ATOM   7855  C  C     . VAL C 2  587  ? -33.088 -3.483  -27.910  1.00 72.74  ? 587  VAL C C     1 
ATOM   7856  O  O     . VAL C 2  587  ? -33.787 -4.110  -28.704  1.00 75.36  ? 587  VAL C O     1 
ATOM   7857  C  CB    . VAL C 2  587  ? -33.841 -2.488  -25.708  1.00 60.49  ? 587  VAL C CB    1 
ATOM   7858  C  CG1   . VAL C 2  587  ? -34.304 -1.215  -25.016  1.00 70.78  ? 587  VAL C CG1   1 
ATOM   7859  C  CG2   . VAL C 2  587  ? -34.850 -3.609  -25.523  1.00 57.79  ? 587  VAL C CG2   1 
ATOM   7860  N  N     . SER C 2  588  ? -31.847 -3.855  -27.610  1.00 60.48  ? 588  SER C N     1 
ATOM   7861  C  CA    . SER C 2  588  ? -31.263 -5.079  -28.127  1.00 64.62  ? 588  SER C CA    1 
ATOM   7862  C  C     . SER C 2  588  ? -31.701 -6.274  -27.285  1.00 74.12  ? 588  SER C C     1 
ATOM   7863  O  O     . SER C 2  588  ? -32.383 -6.137  -26.266  1.00 81.22  ? 588  SER C O     1 
ATOM   7864  C  CB    . SER C 2  588  ? -29.739 -4.971  -28.154  1.00 62.40  ? 588  SER C CB    1 
ATOM   7865  O  OG    . SER C 2  588  ? -29.130 -6.243  -28.283  1.00 64.14  ? 588  SER C OG    1 
ATOM   7866  N  N     . VAL C 2  589  ? -31.296 -7.466  -27.727  1.00 73.89  ? 589  VAL C N     1 
ATOM   7867  C  CA    . VAL C 2  589  ? -31.644 -8.686  -27.003  1.00 55.51  ? 589  VAL C CA    1 
ATOM   7868  C  C     . VAL C 2  589  ? -30.984 -8.696  -25.629  1.00 58.31  ? 589  VAL C C     1 
ATOM   7869  O  O     . VAL C 2  589  ? -31.630 -8.985  -24.615  1.00 61.39  ? 589  VAL C O     1 
ATOM   7870  C  CB    . VAL C 2  589  ? -31.257 -9.927  -27.827  1.00 76.69  ? 589  VAL C CB    1 
ATOM   7871  C  CG1   . VAL C 2  589  ? -31.763 -11.192 -27.151  1.00 53.91  ? 589  VAL C CG1   1 
ATOM   7872  C  CG2   . VAL C 2  589  ? -31.799 -9.815  -29.244  1.00 107.06 ? 589  VAL C CG2   1 
ATOM   7873  N  N     . ALA C 2  590  ? -29.688 -8.378  -25.575  1.00 74.41  ? 590  ALA C N     1 
ATOM   7874  C  CA    . ALA C 2  590  ? -28.991 -8.341  -24.293  1.00 80.37  ? 590  ALA C CA    1 
ATOM   7875  C  C     . ALA C 2  590  ? -29.529 -7.228  -23.402  1.00 75.97  ? 590  ALA C C     1 
ATOM   7876  O  O     . ALA C 2  590  ? -29.672 -7.413  -22.187  1.00 65.97  ? 590  ALA C O     1 
ATOM   7877  C  CB    . ALA C 2  590  ? -27.488 -8.173  -24.513  1.00 79.43  ? 590  ALA C CB    1 
ATOM   7878  N  N     . THR C 2  591  ? -29.832 -6.067  -23.987  1.00 79.47  ? 591  THR C N     1 
ATOM   7879  C  CA    . THR C 2  591  ? -30.411 -4.976  -23.211  1.00 69.31  ? 591  THR C CA    1 
ATOM   7880  C  C     . THR C 2  591  ? -31.776 -5.361  -22.656  1.00 58.63  ? 591  THR C C     1 
ATOM   7881  O  O     . THR C 2  591  ? -32.108 -5.028  -21.513  1.00 43.51  ? 591  THR C O     1 
ATOM   7882  C  CB    . THR C 2  591  ? -30.525 -3.719  -24.074  1.00 69.45  ? 591  THR C CB    1 
ATOM   7883  O  OG1   . THR C 2  591  ? -29.337 -3.568  -24.862  1.00 72.34  ? 591  THR C OG1   1 
ATOM   7884  C  CG2   . THR C 2  591  ? -30.700 -2.492  -23.195  1.00 55.94  ? 591  THR C CG2   1 
ATOM   7885  N  N     . ALA C 2  592  ? -32.576 -6.077  -23.449  1.00 67.71  ? 592  ALA C N     1 
ATOM   7886  C  CA    . ALA C 2  592  ? -33.908 -6.497  -23.030  1.00 64.72  ? 592  ALA C CA    1 
ATOM   7887  C  C     . ALA C 2  592  ? -33.889 -7.555  -21.935  1.00 65.74  ? 592  ALA C C     1 
ATOM   7888  O  O     . ALA C 2  592  ? -34.967 -7.964  -21.490  1.00 64.42  ? 592  ALA C O     1 
ATOM   7889  C  CB    . ALA C 2  592  ? -34.696 -7.021  -24.233  1.00 68.51  ? 592  ALA C CB    1 
ATOM   7890  N  N     . MET C 2  593  ? -32.717 -8.008  -21.493  1.00 67.38  ? 593  MET C N     1 
ATOM   7891  C  CA    . MET C 2  593  ? -32.614 -9.013  -20.444  1.00 74.58  ? 593  MET C CA    1 
ATOM   7892  C  C     . MET C 2  593  ? -32.402 -8.414  -19.062  1.00 75.10  ? 593  MET C C     1 
ATOM   7893  O  O     . MET C 2  593  ? -32.275 -9.164  -18.089  1.00 63.52  ? 593  MET C O     1 
ATOM   7894  C  CB    . MET C 2  593  ? -31.481 -9.993  -20.759  1.00 72.89  ? 593  MET C CB    1 
ATOM   7895  C  CG    . MET C 2  593  ? -31.960 -11.387 -21.123  1.00 79.09  ? 593  MET C CG    1 
ATOM   7896  S  SD    . MET C 2  593  ? -30.642 -12.436 -21.761  1.00 78.88  ? 593  MET C SD    1 
ATOM   7897  C  CE    . MET C 2  593  ? -30.273 -11.599 -23.298  1.00 67.92  ? 593  MET C CE    1 
ATOM   7898  N  N     . ILE C 2  594  ? -32.360 -7.089  -18.953  1.00 84.77  ? 594  ILE C N     1 
ATOM   7899  C  CA    . ILE C 2  594  ? -32.140 -6.412  -17.678  1.00 67.68  ? 594  ILE C CA    1 
ATOM   7900  C  C     . ILE C 2  594  ? -33.507 -6.077  -17.089  1.00 65.04  ? 594  ILE C C     1 
ATOM   7901  O  O     . ILE C 2  594  ? -34.184 -5.170  -17.604  1.00 76.37  ? 594  ILE C O     1 
ATOM   7902  C  CB    . ILE C 2  594  ? -31.289 -5.148  -17.858  1.00 55.68  ? 594  ILE C CB    1 
ATOM   7903  C  CG1   . ILE C 2  594  ? -29.931 -5.503  -18.469  1.00 53.38  ? 594  ILE C CG1   1 
ATOM   7904  C  CG2   . ILE C 2  594  ? -31.117 -4.432  -16.529  1.00 57.85  ? 594  ILE C CG2   1 
ATOM   7905  C  CD1   . ILE C 2  594  ? -29.099 -4.299  -18.861  1.00 64.19  ? 594  ILE C CD1   1 
ATOM   7906  N  N     . PRO C 2  595  ? -33.952 -6.768  -16.039  1.00 61.21  ? 595  PRO C N     1 
ATOM   7907  C  CA    . PRO C 2  595  ? -35.240 -6.426  -15.428  1.00 54.15  ? 595  PRO C CA    1 
ATOM   7908  C  C     . PRO C 2  595  ? -35.186 -5.045  -14.795  1.00 57.54  ? 595  PRO C C     1 
ATOM   7909  O  O     . PRO C 2  595  ? -34.135 -4.588  -14.343  1.00 62.17  ? 595  PRO C O     1 
ATOM   7910  C  CB    . PRO C 2  595  ? -35.434 -7.521  -14.374  1.00 61.29  ? 595  PRO C CB    1 
ATOM   7911  C  CG    . PRO C 2  595  ? -34.042 -7.944  -14.028  1.00 73.97  ? 595  PRO C CG    1 
ATOM   7912  C  CD    . PRO C 2  595  ? -33.258 -7.842  -15.307  1.00 85.81  ? 595  PRO C CD    1 
ATOM   7913  N  N     . PHE C 2  596  ? -36.342 -4.379  -14.773  1.00 57.38  ? 596  PHE C N     1 
ATOM   7914  C  CA    . PHE C 2  596  ? -36.456 -3.011  -14.265  1.00 68.42  ? 596  PHE C CA    1 
ATOM   7915  C  C     . PHE C 2  596  ? -35.444 -2.088  -14.940  1.00 70.25  ? 596  PHE C C     1 
ATOM   7916  O  O     . PHE C 2  596  ? -34.834 -1.226  -14.303  1.00 72.48  ? 596  PHE C O     1 
ATOM   7917  C  CB    . PHE C 2  596  ? -36.300 -2.969  -12.743  1.00 77.63  ? 596  PHE C CB    1 
ATOM   7918  C  CG    . PHE C 2  596  ? -37.322 -3.785  -12.006  1.00 83.34  ? 596  PHE C CG    1 
ATOM   7919  C  CD1   . PHE C 2  596  ? -38.663 -3.444  -12.050  1.00 97.43  ? 596  PHE C CD1   1 
ATOM   7920  C  CD2   . PHE C 2  596  ? -36.939 -4.887  -11.259  1.00 74.15  ? 596  PHE C CD2   1 
ATOM   7921  C  CE1   . PHE C 2  596  ? -39.605 -4.193  -11.370  1.00 102.70 ? 596  PHE C CE1   1 
ATOM   7922  C  CE2   . PHE C 2  596  ? -37.875 -5.639  -10.575  1.00 79.27  ? 596  PHE C CE2   1 
ATOM   7923  C  CZ    . PHE C 2  596  ? -39.210 -5.292  -10.631  1.00 88.65  ? 596  PHE C CZ    1 
ATOM   7924  N  N     . LEU C 2  597  ? -35.260 -2.281  -16.249  1.00 71.97  ? 597  LEU C N     1 
ATOM   7925  C  CA    . LEU C 2  597  ? -34.310 -1.462  -16.996  1.00 75.68  ? 597  LEU C CA    1 
ATOM   7926  C  C     . LEU C 2  597  ? -34.709 0.007   -16.986  1.00 74.35  ? 597  LEU C C     1 
ATOM   7927  O  O     . LEU C 2  597  ? -33.840 0.886   -16.999  1.00 74.01  ? 597  LEU C O     1 
ATOM   7928  C  CB    . LEU C 2  597  ? -34.193 -1.975  -18.434  1.00 77.34  ? 597  LEU C CB    1 
ATOM   7929  C  CG    . LEU C 2  597  ? -33.268 -1.188  -19.366  1.00 76.96  ? 597  LEU C CG    1 
ATOM   7930  C  CD1   . LEU C 2  597  ? -31.843 -1.191  -18.836  1.00 67.05  ? 597  LEU C CD1   1 
ATOM   7931  C  CD2   . LEU C 2  597  ? -33.317 -1.734  -20.785  1.00 84.28  ? 597  LEU C CD2   1 
ATOM   7932  N  N     . GLU C 2  598  ? -36.012 0.293   -16.943  1.00 66.99  ? 598  GLU C N     1 
ATOM   7933  C  CA    . GLU C 2  598  ? -36.512 1.663   -16.919  1.00 79.24  ? 598  GLU C CA    1 
ATOM   7934  C  C     . GLU C 2  598  ? -36.150 2.414   -15.641  1.00 86.74  ? 598  GLU C C     1 
ATOM   7935  O  O     . GLU C 2  598  ? -36.430 3.615   -15.556  1.00 99.00  ? 598  GLU C O     1 
ATOM   7936  C  CB    . GLU C 2  598  ? -38.032 1.672   -17.110  1.00 78.28  ? 598  GLU C CB    1 
ATOM   7937  C  CG    . GLU C 2  598  ? -38.815 0.883   -16.066  1.00 88.66  ? 598  GLU C CG    1 
ATOM   7938  C  CD    . GLU C 2  598  ? -38.878 -0.604  -16.368  1.00 94.33  ? 598  GLU C CD    1 
ATOM   7939  O  OE1   . GLU C 2  598  ? -38.338 -1.025  -17.414  1.00 86.71  ? 598  GLU C OE1   1 
ATOM   7940  O  OE2   . GLU C 2  598  ? -39.471 -1.350  -15.560  1.00 96.56  ? 598  GLU C OE2   1 
ATOM   7941  N  N     . HIS C 2  599  ? -35.543 1.752   -14.655  1.00 69.99  ? 599  HIS C N     1 
ATOM   7942  C  CA    . HIS C 2  599  ? -35.113 2.396   -13.420  1.00 75.21  ? 599  HIS C CA    1 
ATOM   7943  C  C     . HIS C 2  599  ? -33.600 2.556   -13.343  1.00 82.72  ? 599  HIS C C     1 
ATOM   7944  O  O     . HIS C 2  599  ? -33.084 3.001   -12.312  1.00 82.98  ? 599  HIS C O     1 
ATOM   7945  C  CB    . HIS C 2  599  ? -35.620 1.609   -12.210  1.00 77.16  ? 599  HIS C CB    1 
ATOM   7946  C  CG    . HIS C 2  599  ? -37.101 1.398   -12.208  1.00 82.87  ? 599  HIS C CG    1 
ATOM   7947  N  ND1   . HIS C 2  599  ? -37.979 2.282   -11.620  1.00 90.47  ? 599  HIS C ND1   1 
ATOM   7948  C  CD2   . HIS C 2  599  ? -37.860 0.403   -12.726  1.00 93.88  ? 599  HIS C CD2   1 
ATOM   7949  C  CE1   . HIS C 2  599  ? -39.215 1.841   -11.775  1.00 92.47  ? 599  HIS C CE1   1 
ATOM   7950  N  NE2   . HIS C 2  599  ? -39.170 0.703   -12.443  1.00 88.86  ? 599  HIS C NE2   1 
ATOM   7951  N  N     . ASP C 2  600  ? -32.878 2.203   -14.403  1.00 70.69  ? 600  ASP C N     1 
ATOM   7952  C  CA    . ASP C 2  600  ? -31.429 2.326   -14.452  1.00 67.06  ? 600  ASP C CA    1 
ATOM   7953  C  C     . ASP C 2  600  ? -31.043 3.345   -15.514  1.00 65.53  ? 600  ASP C C     1 
ATOM   7954  O  O     . ASP C 2  600  ? -31.611 3.358   -16.610  1.00 70.92  ? 600  ASP C O     1 
ATOM   7955  C  CB    . ASP C 2  600  ? -30.766 0.978   -14.758  1.00 77.35  ? 600  ASP C CB    1 
ATOM   7956  C  CG    . ASP C 2  600  ? -31.148 -0.099  -13.763  1.00 97.74  ? 600  ASP C CG    1 
ATOM   7957  O  OD1   . ASP C 2  600  ? -31.489 0.245   -12.612  1.00 108.30 ? 600  ASP C OD1   1 
ATOM   7958  O  OD2   . ASP C 2  600  ? -31.106 -1.291  -14.134  1.00 91.53  ? 600  ASP C OD2   1 
ATOM   7959  N  N     . ASP C 2  601  ? -30.077 4.199   -15.184  1.00 78.42  ? 601  ASP C N     1 
ATOM   7960  C  CA    . ASP C 2  601  ? -29.600 5.187   -16.139  1.00 87.42  ? 601  ASP C CA    1 
ATOM   7961  C  C     . ASP C 2  601  ? -28.863 4.503   -17.287  1.00 81.72  ? 601  ASP C C     1 
ATOM   7962  O  O     . ASP C 2  601  ? -28.341 3.393   -17.147  1.00 80.57  ? 601  ASP C O     1 
ATOM   7963  C  CB    . ASP C 2  601  ? -28.684 6.201   -15.452  1.00 95.28  ? 601  ASP C CB    1 
ATOM   7964  C  CG    . ASP C 2  601  ? -28.412 7.420   -16.315  1.00 104.59 ? 601  ASP C CG    1 
ATOM   7965  O  OD1   . ASP C 2  601  ? -29.230 8.363   -16.287  1.00 99.27  ? 601  ASP C OD1   1 
ATOM   7966  O  OD2   . ASP C 2  601  ? -27.384 7.432   -17.026  1.00 107.90 ? 601  ASP C OD2   1 
ATOM   7967  N  N     . ALA C 2  602  ? -28.823 5.186   -18.434  1.00 69.30  ? 602  ALA C N     1 
ATOM   7968  C  CA    . ALA C 2  602  ? -28.233 4.598   -19.633  1.00 64.82  ? 602  ALA C CA    1 
ATOM   7969  C  C     . ALA C 2  602  ? -26.761 4.255   -19.439  1.00 73.12  ? 602  ALA C C     1 
ATOM   7970  O  O     . ALA C 2  602  ? -26.261 3.308   -20.057  1.00 75.06  ? 602  ALA C O     1 
ATOM   7971  C  CB    . ALA C 2  602  ? -28.400 5.550   -20.817  1.00 81.64  ? 602  ALA C CB    1 
ATOM   7972  N  N     . ASN C 2  603  ? -26.055 5.008   -18.593  1.00 76.27  ? 603  ASN C N     1 
ATOM   7973  C  CA    . ASN C 2  603  ? -24.639 4.746   -18.354  1.00 80.23  ? 603  ASN C CA    1 
ATOM   7974  C  C     . ASN C 2  603  ? -24.425 3.344   -17.793  1.00 78.63  ? 603  ASN C C     1 
ATOM   7975  O  O     . ASN C 2  603  ? -23.716 2.524   -18.387  1.00 81.56  ? 603  ASN C O     1 
ATOM   7976  C  CB    . ASN C 2  603  ? -24.065 5.805   -17.409  1.00 106.04 ? 603  ASN C CB    1 
ATOM   7977  C  CG    . ASN C 2  603  ? -23.586 7.044   -18.143  1.00 113.98 ? 603  ASN C CG    1 
ATOM   7978  O  OD1   . ASN C 2  603  ? -23.803 7.188   -19.347  1.00 98.14  ? 603  ASN C OD1   1 
ATOM   7979  N  ND2   . ASN C 2  603  ? -22.930 7.946   -17.421  1.00 94.28  ? 603  ASN C ND2   1 
ATOM   7980  N  N     . ARG C 2  604  ? -25.038 3.050   -16.645  1.00 83.69  ? 604  ARG C N     1 
ATOM   7981  C  CA    . ARG C 2  604  ? -24.895 1.729   -16.043  1.00 78.47  ? 604  ARG C CA    1 
ATOM   7982  C  C     . ARG C 2  604  ? -25.685 0.662   -16.790  1.00 72.17  ? 604  ARG C C     1 
ATOM   7983  O  O     . ARG C 2  604  ? -25.368 -0.525  -16.665  1.00 84.94  ? 604  ARG C O     1 
ATOM   7984  C  CB    . ARG C 2  604  ? -25.329 1.767   -14.576  1.00 85.97  ? 604  ARG C CB    1 
ATOM   7985  C  CG    . ARG C 2  604  ? -24.898 3.020   -13.830  1.00 104.97 ? 604  ARG C CG    1 
ATOM   7986  C  CD    . ARG C 2  604  ? -23.384 3.192   -13.782  1.00 88.11  ? 604  ARG C CD    1 
ATOM   7987  N  NE    . ARG C 2  604  ? -22.720 2.116   -13.053  1.00 65.92  ? 604  ARG C NE    1 
ATOM   7988  C  CZ    . ARG C 2  604  ? -21.508 2.217   -12.515  1.00 63.17  ? 604  ARG C CZ    1 
ATOM   7989  N  NH1   . ARG C 2  604  ? -20.829 3.352   -12.613  1.00 63.37  ? 604  ARG C NH1   1 
ATOM   7990  N  NH2   . ARG C 2  604  ? -20.979 1.186   -11.871  1.00 73.29  ? 604  ARG C NH2   1 
ATOM   7991  N  N     . ALA C 2  605  ? -26.707 1.053   -17.557  1.00 67.82  ? 605  ALA C N     1 
ATOM   7992  C  CA    . ALA C 2  605  ? -27.431 0.080   -18.370  1.00 65.51  ? 605  ALA C CA    1 
ATOM   7993  C  C     . ALA C 2  605  ? -26.547 -0.471  -19.480  1.00 66.87  ? 605  ALA C C     1 
ATOM   7994  O  O     . ALA C 2  605  ? -26.605 -1.666  -19.795  1.00 56.74  ? 605  ALA C O     1 
ATOM   7995  C  CB    . ALA C 2  605  ? -28.692 0.714   -18.954  1.00 60.50  ? 605  ALA C CB    1 
ATOM   7996  N  N     . LEU C 2  606  ? -25.731 0.392   -20.089  1.00 71.81  ? 606  LEU C N     1 
ATOM   7997  C  CA    . LEU C 2  606  ? -24.759 -0.053  -21.082  1.00 65.53  ? 606  LEU C CA    1 
ATOM   7998  C  C     . LEU C 2  606  ? -23.840 -1.119  -20.501  1.00 70.00  ? 606  LEU C C     1 
ATOM   7999  O  O     . LEU C 2  606  ? -23.643 -2.184  -21.096  1.00 66.72  ? 606  LEU C O     1 
ATOM   8000  C  CB    . LEU C 2  606  ? -23.956 1.152   -21.580  1.00 69.23  ? 606  LEU C CB    1 
ATOM   8001  C  CG    . LEU C 2  606  ? -22.794 0.996   -22.563  1.00 71.91  ? 606  LEU C CG    1 
ATOM   8002  C  CD1   . LEU C 2  606  ? -22.652 2.273   -23.365  1.00 69.22  ? 606  LEU C CD1   1 
ATOM   8003  C  CD2   . LEU C 2  606  ? -21.484 0.692   -21.849  1.00 79.31  ? 606  LEU C CD2   1 
ATOM   8004  N  N     . MET C 2  607  ? -23.264 -0.840  -19.330  1.00 77.63  ? 607  MET C N     1 
ATOM   8005  C  CA    . MET C 2  607  ? -22.387 -1.807  -18.682  1.00 77.09  ? 607  MET C CA    1 
ATOM   8006  C  C     . MET C 2  607  ? -23.136 -3.077  -18.302  1.00 74.32  ? 607  MET C C     1 
ATOM   8007  O  O     . MET C 2  607  ? -22.546 -4.162  -18.290  1.00 72.28  ? 607  MET C O     1 
ATOM   8008  C  CB    . MET C 2  607  ? -21.743 -1.177  -17.447  1.00 79.90  ? 607  MET C CB    1 
ATOM   8009  C  CG    . MET C 2  607  ? -21.040 0.146   -17.713  1.00 90.24  ? 607  MET C CG    1 
ATOM   8010  S  SD    . MET C 2  607  ? -20.431 0.904   -16.193  1.00 89.18  ? 607  MET C SD    1 
ATOM   8011  C  CE    . MET C 2  607  ? -19.715 2.419   -16.824  1.00 81.03  ? 607  MET C CE    1 
ATOM   8012  N  N     . GLY C 2  608  ? -24.429 -2.965  -17.994  1.00 71.48  ? 608  GLY C N     1 
ATOM   8013  C  CA    . GLY C 2  608  ? -25.192 -4.145  -17.618  1.00 79.05  ? 608  GLY C CA    1 
ATOM   8014  C  C     . GLY C 2  608  ? -25.318 -5.143  -18.755  1.00 71.59  ? 608  GLY C C     1 
ATOM   8015  O  O     . GLY C 2  608  ? -25.138 -6.348  -18.562  1.00 68.67  ? 608  GLY C O     1 
ATOM   8016  N  N     . ALA C 2  609  ? -25.627 -4.652  -19.957  1.00 55.81  ? 609  ALA C N     1 
ATOM   8017  C  CA    . ALA C 2  609  ? -25.729 -5.536  -21.112  1.00 54.51  ? 609  ALA C CA    1 
ATOM   8018  C  C     . ALA C 2  609  ? -24.355 -6.016  -21.565  1.00 67.30  ? 609  ALA C C     1 
ATOM   8019  O  O     . ALA C 2  609  ? -24.196 -7.180  -21.951  1.00 85.62  ? 609  ALA C O     1 
ATOM   8020  C  CB    . ALA C 2  609  ? -26.453 -4.823  -22.254  1.00 72.35  ? 609  ALA C CB    1 
ATOM   8021  N  N     . ASN C 2  610  ? -23.351 -5.134  -21.524  1.00 64.84  ? 610  ASN C N     1 
ATOM   8022  C  CA    . ASN C 2  610  ? -22.012 -5.505  -21.972  1.00 65.86  ? 610  ASN C CA    1 
ATOM   8023  C  C     . ASN C 2  610  ? -21.371 -6.542  -21.056  1.00 72.38  ? 610  ASN C C     1 
ATOM   8024  O  O     . ASN C 2  610  ? -20.563 -7.355  -21.518  1.00 79.10  ? 610  ASN C O     1 
ATOM   8025  C  CB    . ASN C 2  610  ? -21.121 -4.264  -22.073  1.00 63.56  ? 610  ASN C CB    1 
ATOM   8026  C  CG    . ASN C 2  610  ? -21.345 -3.477  -23.357  1.00 84.34  ? 610  ASN C CG    1 
ATOM   8027  O  OD1   . ASN C 2  610  ? -21.917 -3.987  -24.322  1.00 82.53  ? 610  ASN C OD1   1 
ATOM   8028  N  ND2   . ASN C 2  610  ? -20.880 -2.232  -23.378  1.00 94.21  ? 610  ASN C ND2   1 
ATOM   8029  N  N     . MET C 2  611  ? -21.709 -6.533  -19.766  1.00 77.32  ? 611  MET C N     1 
ATOM   8030  C  CA    . MET C 2  611  ? -21.146 -7.506  -18.838  1.00 75.19  ? 611  MET C CA    1 
ATOM   8031  C  C     . MET C 2  611  ? -21.911 -8.822  -18.812  1.00 66.13  ? 611  MET C C     1 
ATOM   8032  O  O     . MET C 2  611  ? -21.348 -9.837  -18.388  1.00 71.14  ? 611  MET C O     1 
ATOM   8033  C  CB    . MET C 2  611  ? -21.083 -6.922  -17.425  1.00 67.91  ? 611  MET C CB    1 
ATOM   8034  C  CG    . MET C 2  611  ? -20.050 -5.819  -17.277  1.00 66.08  ? 611  MET C CG    1 
ATOM   8035  S  SD    . MET C 2  611  ? -19.895 -5.227  -15.586  1.00 94.92  ? 611  MET C SD    1 
ATOM   8036  C  CE    . MET C 2  611  ? -21.611 -4.900  -15.203  1.00 77.27  ? 611  MET C CE    1 
ATOM   8037  N  N     . GLN C 2  612  ? -23.173 -8.833  -19.249  1.00 49.22  ? 612  GLN C N     1 
ATOM   8038  C  CA    . GLN C 2  612  ? -23.876 -10.101 -19.410  1.00 64.11  ? 612  GLN C CA    1 
ATOM   8039  C  C     . GLN C 2  612  ? -23.191 -10.984 -20.444  1.00 63.15  ? 612  GLN C C     1 
ATOM   8040  O  O     . GLN C 2  612  ? -23.172 -12.212 -20.301  1.00 64.14  ? 612  GLN C O     1 
ATOM   8041  C  CB    . GLN C 2  612  ? -25.333 -9.856  -19.804  1.00 68.12  ? 612  GLN C CB    1 
ATOM   8042  C  CG    . GLN C 2  612  ? -26.275 -9.590  -18.640  1.00 68.56  ? 612  GLN C CG    1 
ATOM   8043  C  CD    . GLN C 2  612  ? -27.735 -9.577  -19.065  1.00 82.70  ? 612  GLN C CD    1 
ATOM   8044  O  OE1   . GLN C 2  612  ? -28.494 -10.492 -18.745  1.00 70.98  ? 612  GLN C OE1   1 
ATOM   8045  N  NE2   . GLN C 2  612  ? -28.132 -8.537  -19.791  1.00 85.83  ? 612  GLN C NE2   1 
ATOM   8046  N  N     . ARG C 2  613  ? -22.622 -10.379 -21.488  1.00 49.93  ? 613  ARG C N     1 
ATOM   8047  C  CA    . ARG C 2  613  ? -21.851 -11.119 -22.478  1.00 55.35  ? 613  ARG C CA    1 
ATOM   8048  C  C     . ARG C 2  613  ? -20.505 -11.589 -21.943  1.00 64.52  ? 613  ARG C C     1 
ATOM   8049  O  O     . ARG C 2  613  ? -19.831 -12.377 -22.615  1.00 63.09  ? 613  ARG C O     1 
ATOM   8050  C  CB    . ARG C 2  613  ? -21.633 -10.257 -23.721  1.00 68.52  ? 613  ARG C CB    1 
ATOM   8051  C  CG    . ARG C 2  613  ? -22.898 -9.940  -24.498  1.00 68.08  ? 613  ARG C CG    1 
ATOM   8052  C  CD    . ARG C 2  613  ? -22.738 -8.629  -25.241  1.00 59.81  ? 613  ARG C CD    1 
ATOM   8053  N  NE    . ARG C 2  613  ? -21.338 -8.372  -25.560  1.00 67.90  ? 613  ARG C NE    1 
ATOM   8054  C  CZ    . ARG C 2  613  ? -20.848 -7.178  -25.876  1.00 84.65  ? 613  ARG C CZ    1 
ATOM   8055  N  NH1   . ARG C 2  613  ? -21.646 -6.120  -25.914  1.00 94.26  ? 613  ARG C NH1   1 
ATOM   8056  N  NH2   . ARG C 2  613  ? -19.557 -7.042  -26.144  1.00 81.67  ? 613  ARG C NH2   1 
ATOM   8057  N  N     . GLN C 2  614  ? -20.096 -11.123 -20.765  1.00 62.81  ? 614  GLN C N     1 
ATOM   8058  C  CA    . GLN C 2  614  ? -18.843 -11.533 -20.150  1.00 60.06  ? 614  GLN C CA    1 
ATOM   8059  C  C     . GLN C 2  614  ? -19.040 -12.592 -19.072  1.00 55.91  ? 614  GLN C C     1 
ATOM   8060  O  O     . GLN C 2  614  ? -18.075 -12.958 -18.395  1.00 56.01  ? 614  GLN C O     1 
ATOM   8061  C  CB    . GLN C 2  614  ? -18.120 -10.317 -19.567  1.00 45.89  ? 614  GLN C CB    1 
ATOM   8062  C  CG    . GLN C 2  614  ? -17.789 -9.247  -20.597  1.00 66.15  ? 614  GLN C CG    1 
ATOM   8063  C  CD    . GLN C 2  614  ? -16.927 -8.134  -20.032  1.00 82.07  ? 614  GLN C CD    1 
ATOM   8064  O  OE1   . GLN C 2  614  ? -16.160 -7.499  -20.758  1.00 129.41 ? 614  GLN C OE1   1 
ATOM   8065  N  NE2   . GLN C 2  614  ? -17.052 -7.888  -18.734  1.00 98.09  ? 614  GLN C NE2   1 
ATOM   8066  N  N     . ALA C 2  615  ? -20.262 -13.092 -18.902  1.00 52.67  ? 615  ALA C N     1 
ATOM   8067  C  CA    . ALA C 2  615  ? -20.516 -14.116 -17.900  1.00 63.34  ? 615  ALA C CA    1 
ATOM   8068  C  C     . ALA C 2  615  ? -19.798 -15.411 -18.264  1.00 66.98  ? 615  ALA C C     1 
ATOM   8069  O  O     . ALA C 2  615  ? -19.568 -15.714 -19.438  1.00 76.34  ? 615  ALA C O     1 
ATOM   8070  C  CB    . ALA C 2  615  ? -22.018 -14.364 -17.760  1.00 62.77  ? 615  ALA C CB    1 
ATOM   8071  N  N     . VAL C 2  616  ? -19.438 -16.171 -17.241  1.00 53.98  ? 616  VAL C N     1 
ATOM   8072  C  CA    . VAL C 2  616  ? -18.698 -17.423 -17.388  1.00 39.42  ? 616  VAL C CA    1 
ATOM   8073  C  C     . VAL C 2  616  ? -19.660 -18.574 -17.132  1.00 64.06  ? 616  VAL C C     1 
ATOM   8074  O  O     . VAL C 2  616  ? -20.400 -18.538 -16.141  1.00 83.98  ? 616  VAL C O     1 
ATOM   8075  C  CB    . VAL C 2  616  ? -17.499 -17.498 -16.423  1.00 43.30  ? 616  VAL C CB    1 
ATOM   8076  C  CG1   . VAL C 2  616  ? -16.766 -18.815 -16.590  1.00 46.34  ? 616  VAL C CG1   1 
ATOM   8077  C  CG2   . VAL C 2  616  ? -16.558 -16.343 -16.662  1.00 46.94  ? 616  VAL C CG2   1 
ATOM   8078  N  N     . PRO C 2  617  ? -19.690 -19.600 -17.984  1.00 59.96  ? 617  PRO C N     1 
ATOM   8079  C  CA    . PRO C 2  617  ? -20.577 -20.749 -17.741  1.00 68.77  ? 617  PRO C CA    1 
ATOM   8080  C  C     . PRO C 2  617  ? -20.122 -21.541 -16.524  1.00 67.84  ? 617  PRO C C     1 
ATOM   8081  O  O     . PRO C 2  617  ? -19.003 -22.058 -16.483  1.00 63.25  ? 617  PRO C O     1 
ATOM   8082  C  CB    . PRO C 2  617  ? -20.460 -21.567 -19.032  1.00 67.05  ? 617  PRO C CB    1 
ATOM   8083  C  CG    . PRO C 2  617  ? -19.149 -21.162 -19.620  1.00 59.97  ? 617  PRO C CG    1 
ATOM   8084  C  CD    . PRO C 2  617  ? -18.966 -19.718 -19.261  1.00 52.95  ? 617  PRO C CD    1 
ATOM   8085  N  N     . LEU C 2  618  ? -21.002 -21.636 -15.531  1.00 51.39  ? 618  LEU C N     1 
ATOM   8086  C  CA    . LEU C 2  618  ? -20.689 -22.311 -14.284  1.00 59.22  ? 618  LEU C CA    1 
ATOM   8087  C  C     . LEU C 2  618  ? -20.847 -23.824 -14.437  1.00 62.16  ? 618  LEU C C     1 
ATOM   8088  O  O     . LEU C 2  618  ? -21.321 -24.328 -15.458  1.00 77.88  ? 618  LEU C O     1 
ATOM   8089  C  CB    . LEU C 2  618  ? -21.582 -21.784 -13.163  1.00 78.68  ? 618  LEU C CB    1 
ATOM   8090  C  CG    . LEU C 2  618  ? -21.592 -20.258 -13.035  1.00 83.53  ? 618  LEU C CG    1 
ATOM   8091  C  CD1   . LEU C 2  618  ? -22.685 -19.792 -12.090  1.00 85.07  ? 618  LEU C CD1   1 
ATOM   8092  C  CD2   . LEU C 2  618  ? -20.233 -19.750 -12.577  1.00 67.72  ? 618  LEU C CD2   1 
ATOM   8093  N  N     . VAL C 2  619  ? -20.428 -24.551 -13.397  1.00 59.48  ? 619  VAL C N     1 
ATOM   8094  C  CA    . VAL C 2  619  ? -20.541 -26.010 -13.400  1.00 60.51  ? 619  VAL C CA    1 
ATOM   8095  C  C     . VAL C 2  619  ? -22.000 -26.422 -13.560  1.00 57.05  ? 619  VAL C C     1 
ATOM   8096  O  O     . VAL C 2  619  ? -22.372 -27.120 -14.511  1.00 66.49  ? 619  VAL C O     1 
ATOM   8097  C  CB    . VAL C 2  619  ? -19.925 -26.600 -12.120  1.00 62.54  ? 619  VAL C CB    1 
ATOM   8098  C  CG1   . VAL C 2  619  ? -20.133 -28.105 -12.070  1.00 88.23  ? 619  VAL C CG1   1 
ATOM   8099  C  CG2   . VAL C 2  619  ? -18.443 -26.265 -12.040  1.00 65.12  ? 619  VAL C CG2   1 
ATOM   8100  N  N     . ARG C 2  620  ? -22.844 -25.993 -12.628  1.00 56.36  ? 620  ARG C N     1 
ATOM   8101  C  CA    . ARG C 2  620  ? -24.289 -26.095 -12.751  1.00 63.98  ? 620  ARG C CA    1 
ATOM   8102  C  C     . ARG C 2  620  ? -24.863 -24.693 -12.920  1.00 68.26  ? 620  ARG C C     1 
ATOM   8103  O  O     . ARG C 2  620  ? -24.268 -23.707 -12.476  1.00 80.14  ? 620  ARG C O     1 
ATOM   8104  C  CB    . ARG C 2  620  ? -24.902 -26.783 -11.526  1.00 72.62  ? 620  ARG C CB    1 
ATOM   8105  C  CG    . ARG C 2  620  ? -26.321 -27.295 -11.731  1.00 70.51  ? 620  ARG C CG    1 
ATOM   8106  C  CD    . ARG C 2  620  ? -26.427 -28.777 -11.398  1.00 99.73  ? 620  ARG C CD    1 
ATOM   8107  N  NE    . ARG C 2  620  ? -26.045 -29.058 -10.016  1.00 109.64 ? 620  ARG C NE    1 
ATOM   8108  C  CZ    . ARG C 2  620  ? -25.995 -30.277 -9.486   1.00 109.06 ? 620  ARG C CZ    1 
ATOM   8109  N  NH1   . ARG C 2  620  ? -25.636 -30.438 -8.219   1.00 76.05  ? 620  ARG C NH1   1 
ATOM   8110  N  NH2   . ARG C 2  620  ? -26.301 -31.336 -10.222  1.00 120.04 ? 620  ARG C NH2   1 
ATOM   8111  N  N     . SER C 2  621  ? -26.016 -24.605 -13.578  1.00 61.41  ? 621  SER C N     1 
ATOM   8112  C  CA    . SER C 2  621  ? -26.622 -23.324 -13.911  1.00 64.33  ? 621  SER C CA    1 
ATOM   8113  C  C     . SER C 2  621  ? -28.038 -23.241 -13.356  1.00 66.96  ? 621  SER C C     1 
ATOM   8114  O  O     . SER C 2  621  ? -28.802 -24.209 -13.425  1.00 73.54  ? 621  SER C O     1 
ATOM   8115  C  CB    . SER C 2  621  ? -26.636 -23.104 -15.428  1.00 80.86  ? 621  SER C CB    1 
ATOM   8116  O  OG    . SER C 2  621  ? -25.323 -22.891 -15.918  1.00 76.17  ? 621  SER C OG    1 
ATOM   8117  N  N     . GLU C 2  622  ? -28.375 -22.076 -12.805  1.00 68.61  ? 622  GLU C N     1 
ATOM   8118  C  CA    . GLU C 2  622  ? -29.702 -21.790 -12.278  1.00 75.05  ? 622  GLU C CA    1 
ATOM   8119  C  C     . GLU C 2  622  ? -30.295 -20.607 -13.030  1.00 64.61  ? 622  GLU C C     1 
ATOM   8120  O  O     . GLU C 2  622  ? -29.630 -19.580 -13.199  1.00 71.79  ? 622  GLU C O     1 
ATOM   8121  C  CB    . GLU C 2  622  ? -29.655 -21.471 -10.781  1.00 95.43  ? 622  GLU C CB    1 
ATOM   8122  C  CG    . GLU C 2  622  ? -29.120 -22.582 -9.899   1.00 112.85 ? 622  GLU C CG    1 
ATOM   8123  C  CD    . GLU C 2  622  ? -29.027 -22.158 -8.447   1.00 114.69 ? 622  GLU C CD    1 
ATOM   8124  O  OE1   . GLU C 2  622  ? -29.423 -21.014 -8.139   1.00 65.41  ? 622  GLU C OE1   1 
ATOM   8125  O  OE2   . GLU C 2  622  ? -28.558 -22.964 -7.616   1.00 152.11 ? 622  GLU C OE2   1 
ATOM   8126  N  N     . ALA C 2  623  ? -31.542 -20.752 -13.471  1.00 58.23  ? 623  ALA C N     1 
ATOM   8127  C  CA    . ALA C 2  623  ? -32.248 -19.637 -14.077  1.00 58.04  ? 623  ALA C CA    1 
ATOM   8128  C  C     . ALA C 2  623  ? -32.606 -18.602 -13.010  1.00 49.27  ? 623  ALA C C     1 
ATOM   8129  O  O     . ALA C 2  623  ? -32.906 -18.956 -11.867  1.00 48.34  ? 623  ALA C O     1 
ATOM   8130  C  CB    . ALA C 2  623  ? -33.513 -20.121 -14.780  1.00 54.13  ? 623  ALA C CB    1 
ATOM   8131  N  N     . PRO C 2  624  ? -32.584 -17.318 -13.358  1.00 41.12  ? 624  PRO C N     1 
ATOM   8132  C  CA    . PRO C 2  624  ? -32.868 -16.282 -12.359  1.00 55.20  ? 624  PRO C CA    1 
ATOM   8133  C  C     . PRO C 2  624  ? -34.325 -16.289 -11.923  1.00 65.37  ? 624  PRO C C     1 
ATOM   8134  O  O     . PRO C 2  624  ? -35.233 -16.593 -12.701  1.00 65.15  ? 624  PRO C O     1 
ATOM   8135  C  CB    . PRO C 2  624  ? -32.517 -14.980 -13.088  1.00 50.68  ? 624  PRO C CB    1 
ATOM   8136  C  CG    . PRO C 2  624  ? -32.667 -15.309 -14.537  1.00 59.05  ? 624  PRO C CG    1 
ATOM   8137  C  CD    . PRO C 2  624  ? -32.269 -16.748 -14.680  1.00 51.64  ? 624  PRO C CD    1 
ATOM   8138  N  N     . LEU C 2  625  ? -34.538 -15.948 -10.649  1.00 58.90  ? 625  LEU C N     1 
ATOM   8139  C  CA    . LEU C 2  625  ? -35.896 -15.779 -10.142  1.00 57.49  ? 625  LEU C CA    1 
ATOM   8140  C  C     . LEU C 2  625  ? -36.584 -14.596 -10.812  1.00 59.46  ? 625  LEU C C     1 
ATOM   8141  O  O     . LEU C 2  625  ? -37.721 -14.710 -11.284  1.00 66.18  ? 625  LEU C O     1 
ATOM   8142  C  CB    . LEU C 2  625  ? -35.875 -15.601 -8.623   1.00 50.69  ? 625  LEU C CB    1 
ATOM   8143  C  CG    . LEU C 2  625  ? -35.553 -16.836 -7.780   1.00 48.29  ? 625  LEU C CG    1 
ATOM   8144  C  CD1   . LEU C 2  625  ? -35.473 -16.470 -6.306   1.00 42.02  ? 625  LEU C CD1   1 
ATOM   8145  C  CD2   . LEU C 2  625  ? -36.591 -17.924 -8.011   1.00 66.37  ? 625  LEU C CD2   1 
ATOM   8146  N  N     . VAL C 2  626  ? -35.909 -13.451 -10.862  1.00 54.36  ? 626  VAL C N     1 
ATOM   8147  C  CA    . VAL C 2  626  ? -36.435 -12.259 -11.517  1.00 59.95  ? 626  VAL C CA    1 
ATOM   8148  C  C     . VAL C 2  626  ? -35.952 -12.269 -12.962  1.00 67.02  ? 626  VAL C C     1 
ATOM   8149  O  O     . VAL C 2  626  ? -34.756 -12.126 -13.228  1.00 72.60  ? 626  VAL C O     1 
ATOM   8150  C  CB    . VAL C 2  626  ? -36.000 -10.978 -10.796  1.00 82.48  ? 626  VAL C CB    1 
ATOM   8151  C  CG1   . VAL C 2  626  ? -36.499 -9.751  -11.546  1.00 73.56  ? 626  VAL C CG1   1 
ATOM   8152  C  CG2   . VAL C 2  626  ? -36.515 -10.974 -9.371   1.00 78.49  ? 626  VAL C CG2   1 
ATOM   8153  N  N     . GLY C 2  627  ? -36.886 -12.437 -13.898  1.00 72.70  ? 627  GLY C N     1 
ATOM   8154  C  CA    . GLY C 2  627  ? -36.574 -12.477 -15.306  1.00 76.23  ? 627  GLY C CA    1 
ATOM   8155  C  C     . GLY C 2  627  ? -37.292 -11.384 -16.081  1.00 74.07  ? 627  GLY C C     1 
ATOM   8156  O  O     . GLY C 2  627  ? -37.988 -10.535 -15.520  1.00 80.10  ? 627  GLY C O     1 
ATOM   8157  N  N     . THR C 2  628  ? -37.095 -11.425 -17.395  1.00 64.52  ? 628  THR C N     1 
ATOM   8158  C  CA    . THR C 2  628  ? -37.739 -10.503 -18.316  1.00 73.56  ? 628  THR C CA    1 
ATOM   8159  C  C     . THR C 2  628  ? -38.559 -11.216 -19.378  1.00 76.38  ? 628  THR C C     1 
ATOM   8160  O  O     . THR C 2  628  ? -39.216 -10.548 -20.186  1.00 78.79  ? 628  THR C O     1 
ATOM   8161  C  CB    . THR C 2  628  ? -36.692 -9.622  -19.005  1.00 75.29  ? 628  THR C CB    1 
ATOM   8162  O  OG1   . THR C 2  628  ? -37.338 -8.751  -19.942  1.00 98.12  ? 628  THR C OG1   1 
ATOM   8163  C  CG2   . THR C 2  628  ? -35.700 -10.496 -19.743  1.00 78.28  ? 628  THR C CG2   1 
ATOM   8164  N  N     . GLY C 2  629  ? -38.538 -12.548 -19.403  1.00 78.48  ? 629  GLY C N     1 
ATOM   8165  C  CA    . GLY C 2  629  ? -39.150 -13.325 -20.452  1.00 82.86  ? 629  GLY C CA    1 
ATOM   8166  C  C     . GLY C 2  629  ? -38.249 -13.565 -21.647  1.00 87.93  ? 629  GLY C C     1 
ATOM   8167  O  O     . GLY C 2  629  ? -38.405 -14.576 -22.339  1.00 96.91  ? 629  GLY C O     1 
ATOM   8168  N  N     . MET C 2  630  ? -37.301 -12.658 -21.897  1.00 82.05  ? 630  MET C N     1 
ATOM   8169  C  CA    . MET C 2  630  ? -36.382 -12.796 -23.021  1.00 77.41  ? 630  MET C CA    1 
ATOM   8170  C  C     . MET C 2  630  ? -35.390 -13.937 -22.824  1.00 81.76  ? 630  MET C C     1 
ATOM   8171  O  O     . MET C 2  630  ? -34.815 -14.417 -23.807  1.00 82.72  ? 630  MET C O     1 
ATOM   8172  C  CB    . MET C 2  630  ? -35.639 -11.472 -23.235  1.00 62.18  ? 630  MET C CB    1 
ATOM   8173  C  CG    . MET C 2  630  ? -34.675 -11.438 -24.414  1.00 70.40  ? 630  MET C CG    1 
ATOM   8174  S  SD    . MET C 2  630  ? -35.496 -11.600 -26.010  1.00 75.86  ? 630  MET C SD    1 
ATOM   8175  C  CE    . MET C 2  630  ? -36.590 -10.184 -25.968  1.00 101.85 ? 630  MET C CE    1 
ATOM   8176  N  N     . GLU C 2  631  ? -35.195 -14.397 -21.583  1.00 74.24  ? 631  GLU C N     1 
ATOM   8177  C  CA    . GLU C 2  631  ? -34.174 -15.406 -21.312  1.00 68.10  ? 631  GLU C CA    1 
ATOM   8178  C  C     . GLU C 2  631  ? -34.432 -16.704 -22.067  1.00 65.32  ? 631  GLU C C     1 
ATOM   8179  O  O     . GLU C 2  631  ? -33.486 -17.439 -22.373  1.00 58.56  ? 631  GLU C O     1 
ATOM   8180  C  CB    . GLU C 2  631  ? -34.090 -15.688 -19.811  1.00 60.94  ? 631  GLU C CB    1 
ATOM   8181  C  CG    . GLU C 2  631  ? -33.616 -14.515 -18.971  1.00 73.93  ? 631  GLU C CG    1 
ATOM   8182  C  CD    . GLU C 2  631  ? -34.752 -13.629 -18.501  1.00 90.74  ? 631  GLU C CD    1 
ATOM   8183  O  OE1   . GLU C 2  631  ? -35.911 -13.881 -18.894  1.00 95.94  ? 631  GLU C OE1   1 
ATOM   8184  O  OE2   . GLU C 2  631  ? -34.482 -12.681 -17.733  1.00 77.38  ? 631  GLU C OE2   1 
ATOM   8185  N  N     . LEU C 2  632  ? -35.694 -17.008 -22.372  1.00 75.19  ? 632  LEU C N     1 
ATOM   8186  C  CA    . LEU C 2  632  ? -36.009 -18.250 -23.072  1.00 73.46  ? 632  LEU C CA    1 
ATOM   8187  C  C     . LEU C 2  632  ? -35.586 -18.181 -24.535  1.00 70.92  ? 632  LEU C C     1 
ATOM   8188  O  O     . LEU C 2  632  ? -34.798 -19.008 -25.008  1.00 65.01  ? 632  LEU C O     1 
ATOM   8189  C  CB    . LEU C 2  632  ? -37.503 -18.554 -22.960  1.00 75.94  ? 632  LEU C CB    1 
ATOM   8190  C  CG    . LEU C 2  632  ? -37.973 -19.693 -23.867  1.00 77.31  ? 632  LEU C CG    1 
ATOM   8191  C  CD1   . LEU C 2  632  ? -37.405 -21.027 -23.401  1.00 70.87  ? 632  LEU C CD1   1 
ATOM   8192  C  CD2   . LEU C 2  632  ? -39.490 -19.737 -23.955  1.00 96.44  ? 632  LEU C CD2   1 
ATOM   8193  N  N     . ARG C 2  633  ? -36.113 -17.200 -25.274  1.00 73.46  ? 633  ARG C N     1 
ATOM   8194  C  CA    . ARG C 2  633  ? -35.804 -17.092 -26.696  1.00 71.86  ? 633  ARG C CA    1 
ATOM   8195  C  C     . ARG C 2  633  ? -34.331 -16.785 -26.939  1.00 72.28  ? 633  ARG C C     1 
ATOM   8196  O  O     . ARG C 2  633  ? -33.773 -17.208 -27.958  1.00 73.82  ? 633  ARG C O     1 
ATOM   8197  C  CB    . ARG C 2  633  ? -36.684 -16.021 -27.341  1.00 82.25  ? 633  ARG C CB    1 
ATOM   8198  C  CG    . ARG C 2  633  ? -38.126 -16.452 -27.552  1.00 81.97  ? 633  ARG C CG    1 
ATOM   8199  C  CD    . ARG C 2  633  ? -38.212 -17.600 -28.546  1.00 75.78  ? 633  ARG C CD    1 
ATOM   8200  N  NE    . ARG C 2  633  ? -37.579 -17.262 -29.817  1.00 66.59  ? 633  ARG C NE    1 
ATOM   8201  C  CZ    . ARG C 2  633  ? -38.187 -16.613 -30.805  1.00 86.93  ? 633  ARG C CZ    1 
ATOM   8202  N  NH1   . ARG C 2  633  ? -39.449 -16.227 -30.672  1.00 97.27  ? 633  ARG C NH1   1 
ATOM   8203  N  NH2   . ARG C 2  633  ? -37.531 -16.348 -31.927  1.00 92.27  ? 633  ARG C NH2   1 
ATOM   8204  N  N     . ALA C 2  634  ? -33.688 -16.056 -26.022  1.00 56.62  ? 634  ALA C N     1 
ATOM   8205  C  CA    . ALA C 2  634  ? -32.268 -15.756 -26.176  1.00 56.64  ? 634  ALA C CA    1 
ATOM   8206  C  C     . ALA C 2  634  ? -31.428 -17.027 -26.166  1.00 57.92  ? 634  ALA C C     1 
ATOM   8207  O  O     . ALA C 2  634  ? -30.456 -17.143 -26.922  1.00 65.96  ? 634  ALA C O     1 
ATOM   8208  C  CB    . ALA C 2  634  ? -31.810 -14.800 -25.075  1.00 75.62  ? 634  ALA C CB    1 
ATOM   8209  N  N     . ALA C 2  635  ? -31.790 -17.996 -25.321  1.00 61.33  ? 635  ALA C N     1 
ATOM   8210  C  CA    . ALA C 2  635  ? -31.059 -19.259 -25.268  1.00 72.68  ? 635  ALA C CA    1 
ATOM   8211  C  C     . ALA C 2  635  ? -31.357 -20.141 -26.477  1.00 70.26  ? 635  ALA C C     1 
ATOM   8212  O  O     . ALA C 2  635  ? -30.438 -20.733 -27.054  1.00 84.00  ? 635  ALA C O     1 
ATOM   8213  C  CB    . ALA C 2  635  ? -31.394 -20.005 -23.975  1.00 86.27  ? 635  ALA C CB    1 
ATOM   8214  N  N     . ILE C 2  636  ? -32.629 -20.243 -26.873  1.00 59.68  ? 636  ILE C N     1 
ATOM   8215  C  CA    . ILE C 2  636  ? -32.995 -21.098 -28.003  1.00 58.31  ? 636  ILE C CA    1 
ATOM   8216  C  C     . ILE C 2  636  ? -32.395 -20.559 -29.296  1.00 65.63  ? 636  ILE C C     1 
ATOM   8217  O  O     . ILE C 2  636  ? -31.770 -21.296 -30.067  1.00 72.41  ? 636  ILE C O     1 
ATOM   8218  C  CB    . ILE C 2  636  ? -34.526 -21.232 -28.106  1.00 49.61  ? 636  ILE C CB    1 
ATOM   8219  C  CG1   . ILE C 2  636  ? -35.088 -21.976 -26.889  1.00 62.80  ? 636  ILE C CG1   1 
ATOM   8220  C  CG2   . ILE C 2  636  ? -34.923 -21.931 -29.406  1.00 53.75  ? 636  ILE C CG2   1 
ATOM   8221  C  CD1   . ILE C 2  636  ? -36.601 -22.127 -26.902  1.00 67.29  ? 636  ILE C CD1   1 
ATOM   8222  N  N     . ASP C 2  637  ? -32.575 -19.260 -29.551  1.00 59.26  ? 637  ASP C N     1 
ATOM   8223  C  CA    . ASP C 2  637  ? -32.089 -18.667 -30.792  1.00 79.65  ? 637  ASP C CA    1 
ATOM   8224  C  C     . ASP C 2  637  ? -30.568 -18.594 -30.857  1.00 65.72  ? 637  ASP C C     1 
ATOM   8225  O  O     . ASP C 2  637  ? -30.014 -18.525 -31.959  1.00 85.58  ? 637  ASP C O     1 
ATOM   8226  C  CB    . ASP C 2  637  ? -32.682 -17.269 -30.981  1.00 96.01  ? 637  ASP C CB    1 
ATOM   8227  C  CG    . ASP C 2  637  ? -34.160 -17.304 -31.326  1.00 88.44  ? 637  ASP C CG    1 
ATOM   8228  O  OD1   . ASP C 2  637  ? -34.812 -18.333 -31.048  1.00 68.57  ? 637  ASP C OD1   1 
ATOM   8229  O  OD2   . ASP C 2  637  ? -34.666 -16.309 -31.886  1.00 80.88  ? 637  ASP C OD2   1 
ATOM   8230  N  N     . ALA C 2  638  ? -29.880 -18.603 -29.711  1.00 51.21  ? 638  ALA C N     1 
ATOM   8231  C  CA    . ALA C 2  638  ? -28.421 -18.580 -29.730  1.00 59.80  ? 638  ALA C CA    1 
ATOM   8232  C  C     . ALA C 2  638  ? -27.844 -19.839 -30.365  1.00 72.26  ? 638  ALA C C     1 
ATOM   8233  O  O     . ALA C 2  638  ? -26.802 -19.776 -31.026  1.00 79.87  ? 638  ALA C O     1 
ATOM   8234  C  CB    . ALA C 2  638  ? -27.875 -18.405 -28.314  1.00 77.84  ? 638  ALA C CB    1 
ATOM   8235  N  N     . GLY C 2  639  ? -28.497 -20.982 -30.178  1.00 72.88  ? 639  GLY C N     1 
ATOM   8236  C  CA    . GLY C 2  639  ? -28.059 -22.211 -30.806  1.00 95.86  ? 639  GLY C CA    1 
ATOM   8237  C  C     . GLY C 2  639  ? -27.116 -23.063 -29.991  1.00 96.10  ? 639  GLY C C     1 
ATOM   8238  O  O     . GLY C 2  639  ? -26.455 -23.941 -30.558  1.00 100.17 ? 639  GLY C O     1 
ATOM   8239  N  N     . ASP C 2  640  ? -27.026 -22.839 -28.682  1.00 82.76  ? 640  ASP C N     1 
ATOM   8240  C  CA    . ASP C 2  640  ? -26.188 -23.654 -27.816  1.00 87.15  ? 640  ASP C CA    1 
ATOM   8241  C  C     . ASP C 2  640  ? -26.982 -24.674 -27.012  1.00 76.19  ? 640  ASP C C     1 
ATOM   8242  O  O     . ASP C 2  640  ? -26.395 -25.396 -26.201  1.00 81.03  ? 640  ASP C O     1 
ATOM   8243  C  CB    . ASP C 2  640  ? -25.375 -22.765 -26.872  1.00 92.12  ? 640  ASP C CB    1 
ATOM   8244  C  CG    . ASP C 2  640  ? -24.151 -22.174 -27.542  1.00 119.86 ? 640  ASP C CG    1 
ATOM   8245  O  OD1   . ASP C 2  640  ? -24.072 -22.226 -28.788  1.00 140.62 ? 640  ASP C OD1   1 
ATOM   8246  O  OD2   . ASP C 2  640  ? -23.263 -21.669 -26.823  1.00 120.18 ? 640  ASP C OD2   1 
ATOM   8247  N  N     . VAL C 2  641  ? -28.297 -24.747 -27.213  1.00 70.40  ? 641  VAL C N     1 
ATOM   8248  C  CA    . VAL C 2  641  ? -29.117 -25.793 -26.611  1.00 59.64  ? 641  VAL C CA    1 
ATOM   8249  C  C     . VAL C 2  641  ? -29.373 -26.860 -27.666  1.00 63.56  ? 641  VAL C C     1 
ATOM   8250  O  O     . VAL C 2  641  ? -28.800 -26.815 -28.761  1.00 79.01  ? 641  VAL C O     1 
ATOM   8251  C  CB    . VAL C 2  641  ? -30.436 -25.230 -26.050  1.00 50.17  ? 641  VAL C CB    1 
ATOM   8252  C  CG1   . VAL C 2  641  ? -30.155 -24.144 -25.020  1.00 71.53  ? 641  VAL C CG1   1 
ATOM   8253  C  CG2   . VAL C 2  641  ? -31.316 -24.698 -27.175  1.00 64.86  ? 641  VAL C CG2   1 
ATOM   8254  N  N     . VAL C 2  642  ? -30.227 -27.830 -27.349  1.00 59.95  ? 642  VAL C N     1 
ATOM   8255  C  CA    . VAL C 2  642  ? -30.571 -28.912 -28.265  1.00 63.05  ? 642  VAL C CA    1 
ATOM   8256  C  C     . VAL C 2  642  ? -32.093 -28.965 -28.333  1.00 62.57  ? 642  VAL C C     1 
ATOM   8257  O  O     . VAL C 2  642  ? -32.749 -29.434 -27.393  1.00 57.78  ? 642  VAL C O     1 
ATOM   8258  C  CB    . VAL C 2  642  ? -29.988 -30.261 -27.826  1.00 55.55  ? 642  VAL C CB    1 
ATOM   8259  C  CG1   . VAL C 2  642  ? -30.424 -31.362 -28.775  1.00 62.71  ? 642  VAL C CG1   1 
ATOM   8260  C  CG2   . VAL C 2  642  ? -28.468 -30.186 -27.762  1.00 71.09  ? 642  VAL C CG2   1 
ATOM   8261  N  N     . VAL C 2  643  ? -32.658 -28.482 -29.435  1.00 59.29  ? 643  VAL C N     1 
ATOM   8262  C  CA    . VAL C 2  643  ? -34.103 -28.440 -29.630  1.00 60.77  ? 643  VAL C CA    1 
ATOM   8263  C  C     . VAL C 2  643  ? -34.523 -29.621 -30.491  1.00 74.09  ? 643  VAL C C     1 
ATOM   8264  O  O     . VAL C 2  643  ? -33.791 -30.041 -31.397  1.00 84.31  ? 643  VAL C O     1 
ATOM   8265  C  CB    . VAL C 2  643  ? -34.543 -27.106 -30.265  1.00 67.48  ? 643  VAL C CB    1 
ATOM   8266  C  CG1   . VAL C 2  643  ? -34.352 -25.961 -29.281  1.00 70.64  ? 643  VAL C CG1   1 
ATOM   8267  C  CG2   . VAL C 2  643  ? -33.772 -26.844 -31.553  1.00 76.42  ? 643  VAL C CG2   1 
ATOM   8268  N  N     . ALA C 2  644  ? -35.704 -30.163 -30.208  1.00 73.59  ? 644  ALA C N     1 
ATOM   8269  C  CA    . ALA C 2  644  ? -36.226 -31.285 -30.976  1.00 73.85  ? 644  ALA C CA    1 
ATOM   8270  C  C     . ALA C 2  644  ? -36.722 -30.797 -32.331  1.00 84.74  ? 644  ALA C C     1 
ATOM   8271  O  O     . ALA C 2  644  ? -37.559 -29.890 -32.405  1.00 90.05  ? 644  ALA C O     1 
ATOM   8272  C  CB    . ALA C 2  644  ? -37.350 -31.975 -30.206  1.00 73.47  ? 644  ALA C CB    1 
ATOM   8273  N  N     . GLU C 2  645  ? -36.202 -31.396 -33.406  1.00 89.79  ? 645  GLU C N     1 
ATOM   8274  C  CA    . GLU C 2  645  ? -36.624 -31.004 -34.747  1.00 99.04  ? 645  GLU C CA    1 
ATOM   8275  C  C     . GLU C 2  645  ? -38.046 -31.468 -35.030  1.00 100.99 ? 645  GLU C C     1 
ATOM   8276  O  O     . GLU C 2  645  ? -38.869 -30.703 -35.549  1.00 111.56 ? 645  GLU C O     1 
ATOM   8277  C  CB    . GLU C 2  645  ? -35.657 -31.568 -35.789  1.00 112.72 ? 645  GLU C CB    1 
ATOM   8278  C  CG    . GLU C 2  645  ? -34.207 -31.173 -35.574  1.00 114.20 ? 645  GLU C CG    1 
ATOM   8279  C  CD    . GLU C 2  645  ? -33.286 -31.753 -36.628  1.00 135.54 ? 645  GLU C CD    1 
ATOM   8280  O  OE1   . GLU C 2  645  ? -33.780 -32.107 -37.719  1.00 142.92 ? 645  GLU C OE1   1 
ATOM   8281  O  OE2   . GLU C 2  645  ? -32.071 -31.861 -36.363  1.00 136.58 ? 645  GLU C OE2   1 
ATOM   8282  N  N     . GLU C 2  646  ? -38.356 -32.719 -34.693  1.00 81.12  ? 646  GLU C N     1 
ATOM   8283  C  CA    . GLU C 2  646  ? -39.665 -33.298 -34.946  1.00 91.34  ? 646  GLU C CA    1 
ATOM   8284  C  C     . GLU C 2  646  ? -40.221 -33.887 -33.658  1.00 84.68  ? 646  GLU C C     1 
ATOM   8285  O  O     . GLU C 2  646  ? -39.472 -34.348 -32.793  1.00 76.08  ? 646  GLU C O     1 
ATOM   8286  C  CB    . GLU C 2  646  ? -39.595 -34.381 -36.031  1.00 109.82 ? 646  GLU C CB    1 
ATOM   8287  C  CG    . GLU C 2  646  ? -38.884 -33.935 -37.301  1.00 129.51 ? 646  GLU C CG    1 
ATOM   8288  C  CD    . GLU C 2  646  ? -38.718 -35.059 -38.304  1.00 121.01 ? 646  GLU C CD    1 
ATOM   8289  O  OE1   . GLU C 2  646  ? -39.513 -36.021 -38.254  1.00 129.81 ? 646  GLU C OE1   1 
ATOM   8290  O  OE2   . GLU C 2  646  ? -37.791 -34.984 -39.138  1.00 104.91 ? 646  GLU C OE2   1 
ATOM   8291  N  N     . SER C 2  647  ? -41.546 -33.869 -33.541  1.00 96.79  ? 647  SER C N     1 
ATOM   8292  C  CA    . SER C 2  647  ? -42.200 -34.396 -32.353  1.00 86.52  ? 647  SER C CA    1 
ATOM   8293  C  C     . SER C 2  647  ? -42.042 -35.910 -32.280  1.00 94.10  ? 647  SER C C     1 
ATOM   8294  O  O     . SER C 2  647  ? -41.965 -36.601 -33.299  1.00 112.66 ? 647  SER C O     1 
ATOM   8295  C  CB    . SER C 2  647  ? -43.683 -34.025 -32.348  1.00 94.22  ? 647  SER C CB    1 
ATOM   8296  O  OG    . SER C 2  647  ? -43.857 -32.620 -32.417  1.00 112.10 ? 647  SER C OG    1 
ATOM   8297  N  N     . GLY C 2  648  ? -41.991 -36.424 -31.055  1.00 93.67  ? 648  GLY C N     1 
ATOM   8298  C  CA    . GLY C 2  648  ? -41.853 -37.854 -30.859  1.00 91.91  ? 648  GLY C CA    1 
ATOM   8299  C  C     . GLY C 2  648  ? -41.672 -38.180 -29.390  1.00 84.80  ? 648  GLY C C     1 
ATOM   8300  O  O     . GLY C 2  648  ? -41.963 -37.360 -28.518  1.00 88.93  ? 648  GLY C O     1 
ATOM   8301  N  N     . VAL C 2  649  ? -41.187 -39.393 -29.135  1.00 78.97  ? 649  VAL C N     1 
ATOM   8302  C  CA    . VAL C 2  649  ? -40.929 -39.871 -27.784  1.00 77.82  ? 649  VAL C CA    1 
ATOM   8303  C  C     . VAL C 2  649  ? -39.446 -40.192 -27.661  1.00 75.43  ? 649  VAL C C     1 
ATOM   8304  O  O     . VAL C 2  649  ? -38.768 -40.479 -28.653  1.00 78.23  ? 649  VAL C O     1 
ATOM   8305  C  CB    . VAL C 2  649  ? -41.800 -41.101 -27.434  1.00 79.72  ? 649  VAL C CB    1 
ATOM   8306  C  CG1   . VAL C 2  649  ? -41.268 -42.356 -28.114  1.00 86.16  ? 649  VAL C CG1   1 
ATOM   8307  C  CG2   . VAL C 2  649  ? -41.901 -41.290 -25.923  1.00 84.93  ? 649  VAL C CG2   1 
ATOM   8308  N  N     . ILE C 2  650  ? -38.939 -40.128 -26.432  1.00 72.24  ? 650  ILE C N     1 
ATOM   8309  C  CA    . ILE C 2  650  ? -37.523 -40.358 -26.167  1.00 69.35  ? 650  ILE C CA    1 
ATOM   8310  C  C     . ILE C 2  650  ? -37.283 -41.864 -26.106  1.00 74.85  ? 650  ILE C C     1 
ATOM   8311  O  O     . ILE C 2  650  ? -37.738 -42.538 -25.180  1.00 85.41  ? 650  ILE C O     1 
ATOM   8312  C  CB    . ILE C 2  650  ? -37.074 -39.672 -24.874  1.00 60.44  ? 650  ILE C CB    1 
ATOM   8313  C  CG1   . ILE C 2  650  ? -37.400 -38.180 -24.931  1.00 70.72  ? 650  ILE C CG1   1 
ATOM   8314  C  CG2   . ILE C 2  650  ? -35.585 -39.886 -24.643  1.00 69.96  ? 650  ILE C CG2   1 
ATOM   8315  C  CD1   . ILE C 2  650  ? -36.772 -37.466 -26.109  1.00 81.32  ? 650  ILE C CD1   1 
ATOM   8316  N  N     . GLU C 2  651  ? -36.560 -42.391 -27.095  1.00 79.87  ? 651  GLU C N     1 
ATOM   8317  C  CA    . GLU C 2  651  ? -36.253 -43.817 -27.130  1.00 87.85  ? 651  GLU C CA    1 
ATOM   8318  C  C     . GLU C 2  651  ? -35.145 -44.172 -26.145  1.00 81.79  ? 651  GLU C C     1 
ATOM   8319  O  O     . GLU C 2  651  ? -35.314 -45.061 -25.303  1.00 81.37  ? 651  GLU C O     1 
ATOM   8320  C  CB    . GLU C 2  651  ? -35.865 -44.230 -28.550  1.00 95.93  ? 651  GLU C CB    1 
ATOM   8321  C  CG    . GLU C 2  651  ? -35.224 -45.602 -28.655  1.00 122.30 ? 651  GLU C CG    1 
ATOM   8322  C  CD    . GLU C 2  651  ? -35.024 -46.029 -30.094  1.00 106.22 ? 651  GLU C CD    1 
ATOM   8323  O  OE1   . GLU C 2  651  ? -35.966 -45.855 -30.895  1.00 91.64  ? 651  GLU C OE1   1 
ATOM   8324  O  OE2   . GLU C 2  651  ? -33.927 -46.526 -30.425  1.00 93.63  ? 651  GLU C OE2   1 
ATOM   8325  N  N     . GLU C 2  652  ? -34.006 -43.490 -26.237  1.00 77.91  ? 652  GLU C N     1 
ATOM   8326  C  CA    . GLU C 2  652  ? -32.886 -43.717 -25.336  1.00 75.05  ? 652  GLU C CA    1 
ATOM   8327  C  C     . GLU C 2  652  ? -32.209 -42.387 -25.043  1.00 74.47  ? 652  GLU C C     1 
ATOM   8328  O  O     . GLU C 2  652  ? -32.041 -41.558 -25.941  1.00 75.66  ? 652  GLU C O     1 
ATOM   8329  C  CB    . GLU C 2  652  ? -31.881 -44.710 -25.936  1.00 88.99  ? 652  GLU C CB    1 
ATOM   8330  C  CG    . GLU C 2  652  ? -30.634 -44.924 -25.095  1.00 115.88 ? 652  GLU C CG    1 
ATOM   8331  C  CD    . GLU C 2  652  ? -29.722 -45.989 -25.667  1.00 119.66 ? 652  GLU C CD    1 
ATOM   8332  O  OE1   . GLU C 2  652  ? -30.211 -46.840 -26.440  1.00 123.08 ? 652  GLU C OE1   1 
ATOM   8333  O  OE2   . GLU C 2  652  ? -28.515 -45.975 -25.344  1.00 113.80 ? 652  GLU C OE2   1 
ATOM   8334  N  N     . VAL C 2  653  ? -31.836 -42.182 -23.781  1.00 76.82  ? 653  VAL C N     1 
ATOM   8335  C  CA    . VAL C 2  653  ? -31.151 -40.971 -23.345  1.00 56.26  ? 653  VAL C CA    1 
ATOM   8336  C  C     . VAL C 2  653  ? -29.917 -41.372 -22.549  1.00 71.56  ? 653  VAL C C     1 
ATOM   8337  O  O     . VAL C 2  653  ? -29.989 -42.240 -21.671  1.00 76.90  ? 653  VAL C O     1 
ATOM   8338  C  CB    . VAL C 2  653  ? -32.071 -40.054 -22.512  1.00 56.18  ? 653  VAL C CB    1 
ATOM   8339  C  CG1   . VAL C 2  653  ? -32.732 -40.828 -21.378  1.00 103.50 ? 653  VAL C CG1   1 
ATOM   8340  C  CG2   . VAL C 2  653  ? -31.295 -38.857 -21.975  1.00 62.04  ? 653  VAL C CG2   1 
ATOM   8341  N  N     . SER C 2  654  ? -28.783 -40.755 -22.872  1.00 70.80  ? 654  SER C N     1 
ATOM   8342  C  CA    . SER C 2  654  ? -27.527 -40.989 -22.179  1.00 71.50  ? 654  SER C CA    1 
ATOM   8343  C  C     . SER C 2  654  ? -26.804 -39.660 -22.030  1.00 69.76  ? 654  SER C C     1 
ATOM   8344  O  O     . SER C 2  654  ? -27.189 -38.650 -22.627  1.00 74.90  ? 654  SER C O     1 
ATOM   8345  C  CB    . SER C 2  654  ? -26.648 -42.000 -22.929  1.00 82.19  ? 654  SER C CB    1 
ATOM   8346  O  OG    . SER C 2  654  ? -25.333 -42.028 -22.401  1.00 99.47  ? 654  SER C OG    1 
ATOM   8347  N  N     . ALA C 2  655  ? -25.741 -39.661 -21.223  1.00 68.53  ? 655  ALA C N     1 
ATOM   8348  C  CA    . ALA C 2  655  ? -24.898 -38.475 -21.139  1.00 66.71  ? 655  ALA C CA    1 
ATOM   8349  C  C     . ALA C 2  655  ? -24.200 -38.186 -22.459  1.00 69.94  ? 655  ALA C C     1 
ATOM   8350  O  O     . ALA C 2  655  ? -23.691 -37.077 -22.652  1.00 69.67  ? 655  ALA C O     1 
ATOM   8351  C  CB    . ALA C 2  655  ? -23.862 -38.631 -20.025  1.00 67.05  ? 655  ALA C CB    1 
ATOM   8352  N  N     . ASP C 2  656  ? -24.178 -39.155 -23.374  1.00 69.99  ? 656  ASP C N     1 
ATOM   8353  C  CA    . ASP C 2  656  ? -23.505 -39.009 -24.657  1.00 58.84  ? 656  ASP C CA    1 
ATOM   8354  C  C     . ASP C 2  656  ? -24.443 -38.534 -25.763  1.00 61.65  ? 656  ASP C C     1 
ATOM   8355  O  O     . ASP C 2  656  ? -24.072 -37.652 -26.544  1.00 69.38  ? 656  ASP C O     1 
ATOM   8356  C  CB    . ASP C 2  656  ? -22.855 -40.338 -25.054  1.00 73.31  ? 656  ASP C CB    1 
ATOM   8357  C  CG    . ASP C 2  656  ? -21.725 -40.737 -24.121  1.00 89.62  ? 656  ASP C CG    1 
ATOM   8358  O  OD1   . ASP C 2  656  ? -20.737 -39.979 -24.020  1.00 88.73  ? 656  ASP C OD1   1 
ATOM   8359  O  OD2   . ASP C 2  656  ? -21.830 -41.805 -23.480  1.00 85.29  ? 656  ASP C OD2   1 
ATOM   8360  N  N     . TYR C 2  657  ? -25.650 -39.094 -25.851  1.00 58.81  ? 657  TYR C N     1 
ATOM   8361  C  CA    . TYR C 2  657  ? -26.560 -38.727 -26.927  1.00 63.30  ? 657  TYR C CA    1 
ATOM   8362  C  C     . TYR C 2  657  ? -28.003 -38.950 -26.494  1.00 53.50  ? 657  TYR C C     1 
ATOM   8363  O  O     . TYR C 2  657  ? -28.284 -39.662 -25.527  1.00 63.54  ? 657  TYR C O     1 
ATOM   8364  C  CB    . TYR C 2  657  ? -26.261 -39.515 -28.212  1.00 77.58  ? 657  TYR C CB    1 
ATOM   8365  C  CG    . TYR C 2  657  ? -26.450 -41.014 -28.099  1.00 80.30  ? 657  TYR C CG    1 
ATOM   8366  C  CD1   . TYR C 2  657  ? -27.669 -41.606 -28.411  1.00 88.84  ? 657  TYR C CD1   1 
ATOM   8367  C  CD2   . TYR C 2  657  ? -25.407 -41.837 -27.698  1.00 82.53  ? 657  TYR C CD2   1 
ATOM   8368  C  CE1   . TYR C 2  657  ? -27.845 -42.973 -28.316  1.00 99.56  ? 657  TYR C CE1   1 
ATOM   8369  C  CE2   . TYR C 2  657  ? -25.575 -43.205 -27.601  1.00 107.62 ? 657  TYR C CE2   1 
ATOM   8370  C  CZ    . TYR C 2  657  ? -26.794 -43.767 -27.911  1.00 105.40 ? 657  TYR C CZ    1 
ATOM   8371  O  OH    . TYR C 2  657  ? -26.963 -45.129 -27.815  1.00 83.11  ? 657  TYR C OH    1 
ATOM   8372  N  N     . ILE C 2  658  ? -28.915 -38.321 -27.233  1.00 46.93  ? 658  ILE C N     1 
ATOM   8373  C  CA    . ILE C 2  658  ? -30.352 -38.451 -27.031  1.00 52.08  ? 658  ILE C CA    1 
ATOM   8374  C  C     . ILE C 2  658  ? -30.969 -38.922 -28.340  1.00 70.04  ? 658  ILE C C     1 
ATOM   8375  O  O     . ILE C 2  658  ? -30.735 -38.316 -29.392  1.00 69.48  ? 658  ILE C O     1 
ATOM   8376  C  CB    . ILE C 2  658  ? -30.990 -37.123 -26.583  1.00 50.16  ? 658  ILE C CB    1 
ATOM   8377  C  CG1   . ILE C 2  658  ? -30.271 -36.560 -25.357  1.00 58.50  ? 658  ILE C CG1   1 
ATOM   8378  C  CG2   . ILE C 2  658  ? -32.473 -37.313 -26.296  1.00 52.50  ? 658  ILE C CG2   1 
ATOM   8379  C  CD1   . ILE C 2  658  ? -30.797 -35.209 -24.918  1.00 67.39  ? 658  ILE C CD1   1 
ATOM   8380  N  N     . THR C 2  659  ? -31.756 -39.992 -28.275  1.00 76.92  ? 659  THR C N     1 
ATOM   8381  C  CA    . THR C 2  659  ? -32.427 -40.554 -29.440  1.00 63.64  ? 659  THR C CA    1 
ATOM   8382  C  C     . THR C 2  659  ? -33.927 -40.321 -29.318  1.00 68.35  ? 659  THR C C     1 
ATOM   8383  O  O     . THR C 2  659  ? -34.515 -40.583 -28.263  1.00 81.36  ? 659  THR C O     1 
ATOM   8384  C  CB    . THR C 2  659  ? -32.130 -42.049 -29.578  1.00 77.41  ? 659  THR C CB    1 
ATOM   8385  O  OG1   . THR C 2  659  ? -30.714 -42.249 -29.671  1.00 75.28  ? 659  THR C OG1   1 
ATOM   8386  C  CG2   . THR C 2  659  ? -32.797 -42.616 -30.823  1.00 87.25  ? 659  THR C CG2   1 
ATOM   8387  N  N     . VAL C 2  660  ? -34.539 -39.831 -30.394  1.00 62.41  ? 660  VAL C N     1 
ATOM   8388  C  CA    . VAL C 2  660  ? -35.961 -39.506 -30.423  1.00 74.48  ? 660  VAL C CA    1 
ATOM   8389  C  C     . VAL C 2  660  ? -36.633 -40.385 -31.469  1.00 85.24  ? 660  VAL C C     1 
ATOM   8390  O  O     . VAL C 2  660  ? -36.224 -40.393 -32.638  1.00 93.13  ? 660  VAL C O     1 
ATOM   8391  C  CB    . VAL C 2  660  ? -36.202 -38.018 -30.726  1.00 72.07  ? 660  VAL C CB    1 
ATOM   8392  C  CG1   . VAL C 2  660  ? -37.694 -37.719 -30.773  1.00 77.36  ? 660  VAL C CG1   1 
ATOM   8393  C  CG2   . VAL C 2  660  ? -35.512 -37.145 -29.689  1.00 68.57  ? 660  VAL C CG2   1 
ATOM   8394  N  N     . MET C 2  661  ? -37.659 -41.122 -31.049  1.00 84.60  ? 661  MET C N     1 
ATOM   8395  C  CA    . MET C 2  661  ? -38.467 -41.937 -31.949  1.00 95.32  ? 661  MET C CA    1 
ATOM   8396  C  C     . MET C 2  661  ? -39.661 -41.106 -32.406  1.00 96.43  ? 661  MET C C     1 
ATOM   8397  O  O     . MET C 2  661  ? -40.542 -40.778 -31.605  1.00 88.02  ? 661  MET C O     1 
ATOM   8398  C  CB    . MET C 2  661  ? -38.919 -43.220 -31.256  1.00 98.38  ? 661  MET C CB    1 
ATOM   8399  C  CG    . MET C 2  661  ? -39.901 -44.058 -32.058  1.00 98.80  ? 661  MET C CG    1 
ATOM   8400  S  SD    . MET C 2  661  ? -39.225 -44.645 -33.622  1.00 108.13 ? 661  MET C SD    1 
ATOM   8401  C  CE    . MET C 2  661  ? -40.557 -45.704 -34.178  1.00 82.57  ? 661  MET C CE    1 
ATOM   8402  N  N     . HIS C 2  662  ? -39.686 -40.763 -33.691  1.00 94.18  ? 662  HIS C N     1 
ATOM   8403  C  CA    . HIS C 2  662  ? -40.736 -39.919 -34.234  1.00 86.04  ? 662  HIS C CA    1 
ATOM   8404  C  C     . HIS C 2  662  ? -42.039 -40.703 -34.383  1.00 86.45  ? 662  HIS C C     1 
ATOM   8405  O  O     . HIS C 2  662  ? -42.087 -41.927 -34.229  1.00 93.88  ? 662  HIS C O     1 
ATOM   8406  C  CB    . HIS C 2  662  ? -40.302 -39.335 -35.578  1.00 72.02  ? 662  HIS C CB    1 
ATOM   8407  C  CG    . HIS C 2  662  ? -39.060 -38.501 -35.504  1.00 81.05  ? 662  HIS C CG    1 
ATOM   8408  N  ND1   . HIS C 2  662  ? -38.021 -38.630 -36.400  1.00 75.98  ? 662  HIS C ND1   1 
ATOM   8409  C  CD2   . HIS C 2  662  ? -38.694 -37.522 -34.642  1.00 96.54  ? 662  HIS C CD2   1 
ATOM   8410  C  CE1   . HIS C 2  662  ? -37.067 -37.770 -36.092  1.00 93.68  ? 662  HIS C CE1   1 
ATOM   8411  N  NE2   . HIS C 2  662  ? -37.450 -37.086 -35.030  1.00 95.18  ? 662  HIS C NE2   1 
ATOM   8412  N  N     . ASP C 2  663  ? -43.114 -39.970 -34.684  1.00 82.02  ? 663  ASP C N     1 
ATOM   8413  C  CA    . ASP C 2  663  ? -44.417 -40.603 -34.862  1.00 96.09  ? 663  ASP C CA    1 
ATOM   8414  C  C     . ASP C 2  663  ? -44.461 -41.435 -36.137  1.00 102.98 ? 663  ASP C C     1 
ATOM   8415  O  O     . ASP C 2  663  ? -45.032 -42.532 -36.150  1.00 95.35  ? 663  ASP C O     1 
ATOM   8416  C  CB    . ASP C 2  663  ? -45.517 -39.542 -34.878  1.00 108.00 ? 663  ASP C CB    1 
ATOM   8417  C  CG    . ASP C 2  663  ? -45.767 -38.941 -33.509  1.00 114.80 ? 663  ASP C CG    1 
ATOM   8418  O  OD1   . ASP C 2  663  ? -45.709 -39.693 -32.514  1.00 117.97 ? 663  ASP C OD1   1 
ATOM   8419  O  OD2   . ASP C 2  663  ? -46.020 -37.721 -33.427  1.00 112.41 ? 663  ASP C OD2   1 
ATOM   8420  N  N     . ASN C 2  664  ? -43.864 -40.929 -37.220  1.00 107.89 ? 664  ASN C N     1 
ATOM   8421  C  CA    . ASN C 2  664  ? -43.876 -41.666 -38.479  1.00 88.32  ? 664  ASN C CA    1 
ATOM   8422  C  C     . ASN C 2  664  ? -43.095 -42.971 -38.364  1.00 96.93  ? 664  ASN C C     1 
ATOM   8423  O  O     . ASN C 2  664  ? -43.486 -43.988 -38.948  1.00 125.01 ? 664  ASN C O     1 
ATOM   8424  C  CB    . ASN C 2  664  ? -43.314 -40.793 -39.603  1.00 78.68  ? 664  ASN C CB    1 
ATOM   8425  C  CG    . ASN C 2  664  ? -41.928 -40.264 -39.294  1.00 74.69  ? 664  ASN C CG    1 
ATOM   8426  O  OD1   . ASN C 2  664  ? -40.937 -40.986 -39.406  1.00 61.84  ? 664  ASN C OD1   1 
ATOM   8427  N  ND2   . ASN C 2  664  ? -41.849 -38.994 -38.913  1.00 90.77  ? 664  ASN C ND2   1 
ATOM   8428  N  N     . GLY C 2  665  ? -41.997 -42.964 -37.612  1.00 78.09  ? 665  GLY C N     1 
ATOM   8429  C  CA    . GLY C 2  665  ? -41.209 -44.167 -37.421  1.00 73.55  ? 665  GLY C CA    1 
ATOM   8430  C  C     . GLY C 2  665  ? -39.711 -43.949 -37.499  1.00 70.39  ? 665  GLY C C     1 
ATOM   8431  O  O     . GLY C 2  665  ? -38.932 -44.833 -37.129  1.00 77.80  ? 665  GLY C O     1 
ATOM   8432  N  N     . THR C 2  666  ? -39.294 -42.780 -37.978  1.00 60.44  ? 666  THR C N     1 
ATOM   8433  C  CA    . THR C 2  666  ? -37.876 -42.489 -38.119  1.00 71.93  ? 666  THR C CA    1 
ATOM   8434  C  C     . THR C 2  666  ? -37.277 -42.058 -36.782  1.00 83.37  ? 666  THR C C     1 
ATOM   8435  O  O     . THR C 2  666  ? -37.976 -41.607 -35.871  1.00 76.13  ? 666  THR C O     1 
ATOM   8436  C  CB    . THR C 2  666  ? -37.645 -41.402 -39.172  1.00 66.12  ? 666  THR C CB    1 
ATOM   8437  O  OG1   . THR C 2  666  ? -38.492 -40.277 -38.901  1.00 76.55  ? 666  THR C OG1   1 
ATOM   8438  C  CG2   . THR C 2  666  ? -37.944 -41.935 -40.569  1.00 82.74  ? 666  THR C CG2   1 
ATOM   8439  N  N     . ARG C 2  667  ? -35.960 -42.211 -36.673  1.00 81.86  ? 667  ARG C N     1 
ATOM   8440  C  CA    . ARG C 2  667  ? -35.223 -41.872 -35.464  1.00 72.84  ? 667  ARG C CA    1 
ATOM   8441  C  C     . ARG C 2  667  ? -34.181 -40.813 -35.785  1.00 76.36  ? 667  ARG C C     1 
ATOM   8442  O  O     . ARG C 2  667  ? -33.427 -40.952 -36.753  1.00 87.07  ? 667  ARG C O     1 
ATOM   8443  C  CB    . ARG C 2  667  ? -34.541 -43.104 -34.861  1.00 75.18  ? 667  ARG C CB    1 
ATOM   8444  C  CG    . ARG C 2  667  ? -35.473 -44.260 -34.558  1.00 88.77  ? 667  ARG C CG    1 
ATOM   8445  C  CD    . ARG C 2  667  ? -34.748 -45.346 -33.780  1.00 89.10  ? 667  ARG C CD    1 
ATOM   8446  N  NE    . ARG C 2  667  ? -33.558 -45.829 -34.476  1.00 93.90  ? 667  ARG C NE    1 
ATOM   8447  C  CZ    . ARG C 2  667  ? -32.733 -46.751 -33.991  1.00 109.81 ? 667  ARG C CZ    1 
ATOM   8448  N  NH1   . ARG C 2  667  ? -32.965 -47.293 -32.803  1.00 108.76 ? 667  ARG C NH1   1 
ATOM   8449  N  NH2   . ARG C 2  667  ? -31.674 -47.133 -34.693  1.00 118.77 ? 667  ARG C NH2   1 
ATOM   8450  N  N     . ARG C 2  668  ? -34.145 -39.760 -34.976  1.00 72.94  ? 668  ARG C N     1 
ATOM   8451  C  CA    . ARG C 2  668  ? -33.096 -38.755 -35.040  1.00 76.30  ? 668  ARG C CA    1 
ATOM   8452  C  C     . ARG C 2  668  ? -32.382 -38.724 -33.698  1.00 70.31  ? 668  ARG C C     1 
ATOM   8453  O  O     . ARG C 2  668  ? -33.029 -38.699 -32.646  1.00 78.99  ? 668  ARG C O     1 
ATOM   8454  C  CB    . ARG C 2  668  ? -33.659 -37.375 -35.385  1.00 95.68  ? 668  ARG C CB    1 
ATOM   8455  C  CG    . ARG C 2  668  ? -32.603 -36.386 -35.844  1.00 89.14  ? 668  ARG C CG    1 
ATOM   8456  C  CD    . ARG C 2  668  ? -33.245 -35.150 -36.441  1.00 97.93  ? 668  ARG C CD    1 
ATOM   8457  N  NE    . ARG C 2  668  ? -34.138 -35.481 -37.548  1.00 132.53 ? 668  ARG C NE    1 
ATOM   8458  C  CZ    . ARG C 2  668  ? -33.791 -35.432 -38.830  1.00 131.85 ? 668  ARG C CZ    1 
ATOM   8459  N  NH1   . ARG C 2  668  ? -32.566 -35.059 -39.174  1.00 141.64 ? 668  ARG C NH1   1 
ATOM   8460  N  NH2   . ARG C 2  668  ? -34.671 -35.751 -39.770  1.00 99.58  ? 668  ARG C NH2   1 
ATOM   8461  N  N     . THR C 2  669  ? -31.053 -38.746 -33.736  1.00 70.79  ? 669  THR C N     1 
ATOM   8462  C  CA    . THR C 2  669  ? -30.233 -38.801 -32.534  1.00 73.71  ? 669  THR C CA    1 
ATOM   8463  C  C     . THR C 2  669  ? -29.382 -37.544 -32.439  1.00 81.74  ? 669  THR C C     1 
ATOM   8464  O  O     . THR C 2  669  ? -28.649 -37.210 -33.377  1.00 84.19  ? 669  THR C O     1 
ATOM   8465  C  CB    . THR C 2  669  ? -29.339 -40.044 -32.529  1.00 65.50  ? 669  THR C CB    1 
ATOM   8466  O  OG1   . THR C 2  669  ? -30.144 -41.214 -32.340  1.00 57.30  ? 669  THR C OG1   1 
ATOM   8467  C  CG2   . THR C 2  669  ? -28.313 -39.953 -31.412  1.00 59.35  ? 669  THR C CG2   1 
ATOM   8468  N  N     . TYR C 2  670  ? -29.477 -36.857 -31.305  1.00 73.24  ? 670  TYR C N     1 
ATOM   8469  C  CA    . TYR C 2  670  ? -28.732 -35.631 -31.055  1.00 69.15  ? 670  TYR C CA    1 
ATOM   8470  C  C     . TYR C 2  670  ? -27.579 -35.942 -30.110  1.00 62.96  ? 670  TYR C C     1 
ATOM   8471  O  O     . TYR C 2  670  ? -27.799 -36.442 -29.001  1.00 56.48  ? 670  TYR C O     1 
ATOM   8472  C  CB    . TYR C 2  670  ? -29.641 -34.555 -30.460  1.00 68.56  ? 670  TYR C CB    1 
ATOM   8473  C  CG    . TYR C 2  670  ? -30.940 -34.352 -31.211  1.00 77.00  ? 670  TYR C CG    1 
ATOM   8474  C  CD1   . TYR C 2  670  ? -31.063 -33.358 -32.172  1.00 88.22  ? 670  TYR C CD1   1 
ATOM   8475  C  CD2   . TYR C 2  670  ? -32.045 -35.155 -30.954  1.00 73.80  ? 670  TYR C CD2   1 
ATOM   8476  C  CE1   . TYR C 2  670  ? -32.248 -33.171 -32.858  1.00 93.66  ? 670  TYR C CE1   1 
ATOM   8477  C  CE2   . TYR C 2  670  ? -33.231 -34.976 -31.635  1.00 83.03  ? 670  TYR C CE2   1 
ATOM   8478  C  CZ    . TYR C 2  670  ? -33.329 -33.984 -32.585  1.00 89.77  ? 670  TYR C CZ    1 
ATOM   8479  O  OH    . TYR C 2  670  ? -34.512 -33.805 -33.262  1.00 80.76  ? 670  TYR C OH    1 
ATOM   8480  N  N     . ARG C 2  671  ? -26.359 -35.647 -30.547  1.00 73.22  ? 671  ARG C N     1 
ATOM   8481  C  CA    . ARG C 2  671  ? -25.170 -35.902 -29.746  1.00 63.76  ? 671  ARG C CA    1 
ATOM   8482  C  C     . ARG C 2  671  ? -24.830 -34.684 -28.898  1.00 66.28  ? 671  ARG C C     1 
ATOM   8483  O  O     . ARG C 2  671  ? -24.853 -33.548 -29.380  1.00 73.93  ? 671  ARG C O     1 
ATOM   8484  C  CB    . ARG C 2  671  ? -23.984 -36.259 -30.639  1.00 88.36  ? 671  ARG C CB    1 
ATOM   8485  C  CG    . ARG C 2  671  ? -24.198 -37.493 -31.494  1.00 91.30  ? 671  ARG C CG    1 
ATOM   8486  C  CD    . ARG C 2  671  ? -23.039 -37.674 -32.452  1.00 85.71  ? 671  ARG C CD    1 
ATOM   8487  N  NE    . ARG C 2  671  ? -21.762 -37.704 -31.747  1.00 93.35  ? 671  ARG C NE    1 
ATOM   8488  C  CZ    . ARG C 2  671  ? -20.588 -37.460 -32.320  1.00 95.78  ? 671  ARG C CZ    1 
ATOM   8489  N  NH1   . ARG C 2  671  ? -20.530 -37.156 -33.609  1.00 97.00  ? 671  ARG C NH1   1 
ATOM   8490  N  NH2   . ARG C 2  671  ? -19.474 -37.510 -31.603  1.00 72.62  ? 671  ARG C NH2   1 
ATOM   8491  N  N     . MET C 2  672  ? -24.503 -34.934 -27.632  1.00 69.29  ? 672  MET C N     1 
ATOM   8492  C  CA    . MET C 2  672  ? -24.207 -33.861 -26.696  1.00 62.50  ? 672  MET C CA    1 
ATOM   8493  C  C     . MET C 2  672  ? -22.748 -33.438 -26.803  1.00 62.73  ? 672  MET C C     1 
ATOM   8494  O  O     . MET C 2  672  ? -21.849 -34.273 -26.936  1.00 70.84  ? 672  MET C O     1 
ATOM   8495  C  CB    . MET C 2  672  ? -24.518 -34.304 -25.265  1.00 66.23  ? 672  MET C CB    1 
ATOM   8496  C  CG    . MET C 2  672  ? -25.931 -34.841 -25.049  1.00 63.40  ? 672  MET C CG    1 
ATOM   8497  S  SD    . MET C 2  672  ? -27.230 -33.592 -25.160  1.00 82.99  ? 672  MET C SD    1 
ATOM   8498  C  CE    . MET C 2  672  ? -27.749 -33.773 -26.866  1.00 82.52  ? 672  MET C CE    1 
ATOM   8499  N  N     . ARG C 2  673  ? -22.521 -32.128 -26.746  1.00 52.66  ? 673  ARG C N     1 
ATOM   8500  C  CA    . ARG C 2  673  ? -21.175 -31.565 -26.724  1.00 68.69  ? 673  ARG C CA    1 
ATOM   8501  C  C     . ARG C 2  673  ? -20.718 -31.506 -25.271  1.00 70.00  ? 673  ARG C C     1 
ATOM   8502  O  O     . ARG C 2  673  ? -21.237 -30.710 -24.481  1.00 85.69  ? 673  ARG C O     1 
ATOM   8503  C  CB    . ARG C 2  673  ? -21.162 -30.186 -27.380  1.00 79.50  ? 673  ARG C CB    1 
ATOM   8504  C  CG    . ARG C 2  673  ? -19.780 -29.604 -27.611  1.00 89.82  ? 673  ARG C CG    1 
ATOM   8505  C  CD    . ARG C 2  673  ? -19.826 -28.497 -28.655  1.00 96.32  ? 673  ARG C CD    1 
ATOM   8506  N  NE    . ARG C 2  673  ? -20.909 -27.551 -28.402  1.00 111.30 ? 673  ARG C NE    1 
ATOM   8507  C  CZ    . ARG C 2  673  ? -21.174 -26.494 -29.163  1.00 112.56 ? 673  ARG C CZ    1 
ATOM   8508  N  NH1   . ARG C 2  673  ? -20.430 -26.241 -30.232  1.00 112.26 ? 673  ARG C NH1   1 
ATOM   8509  N  NH2   . ARG C 2  673  ? -22.181 -25.689 -28.856  1.00 103.23 ? 673  ARG C NH2   1 
ATOM   8510  N  N     . LYS C 2  674  ? -19.755 -32.353 -24.919  1.00 55.75  ? 674  LYS C N     1 
ATOM   8511  C  CA    . LYS C 2  674  ? -19.348 -32.563 -23.535  1.00 46.67  ? 674  LYS C CA    1 
ATOM   8512  C  C     . LYS C 2  674  ? -17.941 -32.022 -23.322  1.00 52.09  ? 674  LYS C C     1 
ATOM   8513  O  O     . LYS C 2  674  ? -16.988 -32.497 -23.952  1.00 51.02  ? 674  LYS C O     1 
ATOM   8514  C  CB    . LYS C 2  674  ? -19.408 -34.048 -23.172  1.00 44.50  ? 674  LYS C CB    1 
ATOM   8515  C  CG    . LYS C 2  674  ? -20.791 -34.669 -23.290  1.00 61.90  ? 674  LYS C CG    1 
ATOM   8516  C  CD    . LYS C 2  674  ? -21.781 -34.034 -22.323  1.00 72.37  ? 674  LYS C CD    1 
ATOM   8517  C  CE    . LYS C 2  674  ? -21.345 -34.214 -20.877  1.00 64.02  ? 674  LYS C CE    1 
ATOM   8518  N  NZ    . LYS C 2  674  ? -22.417 -33.839 -19.916  1.00 71.34  ? 674  LYS C NZ    1 
ATOM   8519  N  N     . PHE C 2  675  ? -17.821 -31.036 -22.432  1.00 49.84  ? 675  PHE C N     1 
ATOM   8520  C  CA    . PHE C 2  675  ? -16.534 -30.499 -21.989  1.00 55.84  ? 675  PHE C CA    1 
ATOM   8521  C  C     . PHE C 2  675  ? -15.671 -30.062 -23.171  1.00 64.31  ? 675  PHE C C     1 
ATOM   8522  O  O     . PHE C 2  675  ? -14.515 -30.465 -23.319  1.00 72.56  ? 675  PHE C O     1 
ATOM   8523  C  CB    . PHE C 2  675  ? -15.796 -31.513 -21.111  1.00 57.81  ? 675  PHE C CB    1 
ATOM   8524  C  CG    . PHE C 2  675  ? -16.575 -31.948 -19.899  1.00 49.96  ? 675  PHE C CG    1 
ATOM   8525  C  CD1   . PHE C 2  675  ? -16.741 -31.093 -18.821  1.00 48.00  ? 675  PHE C CD1   1 
ATOM   8526  C  CD2   . PHE C 2  675  ? -17.136 -33.213 -19.836  1.00 47.35  ? 675  PHE C CD2   1 
ATOM   8527  C  CE1   . PHE C 2  675  ? -17.456 -31.491 -17.705  1.00 56.21  ? 675  PHE C CE1   1 
ATOM   8528  C  CE2   . PHE C 2  675  ? -17.851 -33.616 -18.722  1.00 45.49  ? 675  PHE C CE2   1 
ATOM   8529  C  CZ    . PHE C 2  675  ? -18.010 -32.754 -17.656  1.00 59.24  ? 675  PHE C CZ    1 
ATOM   8530  N  N     . ALA C 2  676  ? -16.248 -29.223 -24.024  1.00 57.21  ? 676  ALA C N     1 
ATOM   8531  C  CA    . ALA C 2  676  ? -15.551 -28.690 -25.184  1.00 64.00  ? 676  ALA C CA    1 
ATOM   8532  C  C     . ALA C 2  676  ? -15.050 -27.285 -24.884  1.00 57.91  ? 676  ALA C C     1 
ATOM   8533  O  O     . ALA C 2  676  ? -15.750 -26.484 -24.256  1.00 52.43  ? 676  ALA C O     1 
ATOM   8534  C  CB    . ALA C 2  676  ? -16.463 -28.671 -26.411  1.00 75.12  ? 676  ALA C CB    1 
ATOM   8535  N  N     . ARG C 2  677  ? -13.832 -26.992 -25.330  1.00 60.00  ? 677  ARG C N     1 
ATOM   8536  C  CA    . ARG C 2  677  ? -13.249 -25.675 -25.126  1.00 53.70  ? 677  ARG C CA    1 
ATOM   8537  C  C     . ARG C 2  677  ? -13.887 -24.674 -26.079  1.00 55.23  ? 677  ARG C C     1 
ATOM   8538  O  O     . ARG C 2  677  ? -13.976 -24.924 -27.286  1.00 58.21  ? 677  ARG C O     1 
ATOM   8539  C  CB    . ARG C 2  677  ? -11.736 -25.716 -25.340  1.00 62.68  ? 677  ARG C CB    1 
ATOM   8540  C  CG    . ARG C 2  677  ? -11.033 -24.399 -25.039  1.00 54.19  ? 677  ARG C CG    1 
ATOM   8541  C  CD    . ARG C 2  677  ? -9.628  -24.359 -25.624  1.00 57.39  ? 677  ARG C CD    1 
ATOM   8542  N  NE    . ARG C 2  677  ? -8.811  -23.315 -25.009  1.00 75.93  ? 677  ARG C NE    1 
ATOM   8543  C  CZ    . ARG C 2  677  ? -8.750  -22.057 -25.434  1.00 85.55  ? 677  ARG C CZ    1 
ATOM   8544  N  NH1   . ARG C 2  677  ? -9.460  -21.671 -26.485  1.00 69.28  ? 677  ARG C NH1   1 
ATOM   8545  N  NH2   . ARG C 2  677  ? -7.977  -21.182 -24.805  1.00 90.81  ? 677  ARG C NH2   1 
ATOM   8546  N  N     . SER C 2  678  ? -14.338 -23.546 -25.536  1.00 56.31  ? 678  SER C N     1 
ATOM   8547  C  CA    . SER C 2  678  ? -14.886 -22.481 -26.358  1.00 63.15  ? 678  SER C CA    1 
ATOM   8548  C  C     . SER C 2  678  ? -13.748 -21.646 -26.943  1.00 73.72  ? 678  SER C C     1 
ATOM   8549  O  O     . SER C 2  678  ? -12.565 -21.896 -26.695  1.00 76.71  ? 678  SER C O     1 
ATOM   8550  C  CB    . SER C 2  678  ? -15.849 -21.616 -25.545  1.00 81.68  ? 678  SER C CB    1 
ATOM   8551  O  OG    . SER C 2  678  ? -15.156 -20.696 -24.717  1.00 80.52  ? 678  SER C OG    1 
ATOM   8552  N  N     . ASN C 2  679  ? -14.113 -20.637 -27.737  1.00 79.22  ? 679  ASN C N     1 
ATOM   8553  C  CA    . ASN C 2  679  ? -13.111 -19.743 -28.309  1.00 89.39  ? 679  ASN C CA    1 
ATOM   8554  C  C     . ASN C 2  679  ? -12.335 -19.008 -27.223  1.00 84.40  ? 679  ASN C C     1 
ATOM   8555  O  O     . ASN C 2  679  ? -11.133 -18.756 -27.371  1.00 90.83  ? 679  ASN C O     1 
ATOM   8556  C  CB    . ASN C 2  679  ? -13.780 -18.744 -29.253  1.00 85.71  ? 679  ASN C CB    1 
ATOM   8557  C  CG    . ASN C 2  679  ? -14.280 -19.389 -30.530  1.00 88.98  ? 679  ASN C CG    1 
ATOM   8558  O  OD1   . ASN C 2  679  ? -13.694 -20.352 -31.025  1.00 88.53  ? 679  ASN C OD1   1 
ATOM   8559  N  ND2   . ASN C 2  679  ? -15.366 -18.855 -31.077  1.00 87.11  ? 679  ASN C ND2   1 
ATOM   8560  N  N     . HIS C 2  680  ? -13.002 -18.662 -26.120  1.00 66.59  ? 680  HIS C N     1 
ATOM   8561  C  CA    . HIS C 2  680  ? -12.400 -17.874 -25.052  1.00 69.38  ? 680  HIS C CA    1 
ATOM   8562  C  C     . HIS C 2  680  ? -12.097 -18.704 -23.809  1.00 80.83  ? 680  HIS C C     1 
ATOM   8563  O  O     . HIS C 2  680  ? -12.033 -18.158 -22.704  1.00 98.18  ? 680  HIS C O     1 
ATOM   8564  C  CB    . HIS C 2  680  ? -13.304 -16.693 -24.700  1.00 76.33  ? 680  HIS C CB    1 
ATOM   8565  C  CG    . HIS C 2  680  ? -13.582 -15.786 -25.857  1.00 80.87  ? 680  HIS C CG    1 
ATOM   8566  N  ND1   . HIS C 2  680  ? -12.646 -15.520 -26.832  1.00 84.75  ? 680  HIS C ND1   1 
ATOM   8567  C  CD2   . HIS C 2  680  ? -14.694 -15.096 -26.205  1.00 79.66  ? 680  HIS C CD2   1 
ATOM   8568  C  CE1   . HIS C 2  680  ? -13.165 -14.699 -27.727  1.00 82.43  ? 680  HIS C CE1   1 
ATOM   8569  N  NE2   . HIS C 2  680  ? -14.407 -14.426 -27.370  1.00 85.13  ? 680  HIS C NE2   1 
ATOM   8570  N  N     . GLY C 2  681  ? -11.909 -20.012 -23.964  1.00 73.73  ? 681  GLY C N     1 
ATOM   8571  C  CA    . GLY C 2  681  ? -11.508 -20.853 -22.856  1.00 70.60  ? 681  GLY C CA    1 
ATOM   8572  C  C     . GLY C 2  681  ? -12.602 -21.220 -21.880  1.00 59.17  ? 681  GLY C C     1 
ATOM   8573  O  O     . GLY C 2  681  ? -12.310 -21.856 -20.861  1.00 61.13  ? 681  GLY C O     1 
ATOM   8574  N  N     . THR C 2  682  ? -13.847 -20.838 -22.147  1.00 72.20  ? 682  THR C N     1 
ATOM   8575  C  CA    . THR C 2  682  ? -14.946 -21.257 -21.295  1.00 59.20  ? 682  THR C CA    1 
ATOM   8576  C  C     . THR C 2  682  ? -15.393 -22.666 -21.673  1.00 54.37  ? 682  THR C C     1 
ATOM   8577  O  O     . THR C 2  682  ? -15.128 -23.158 -22.773  1.00 67.85  ? 682  THR C O     1 
ATOM   8578  C  CB    . THR C 2  682  ? -16.119 -20.281 -21.401  1.00 52.32  ? 682  THR C CB    1 
ATOM   8579  O  OG1   . THR C 2  682  ? -16.817 -20.495 -22.633  1.00 70.16  ? 682  THR C OG1   1 
ATOM   8580  C  CG2   . THR C 2  682  ? -15.620 -18.843 -21.350  1.00 56.94  ? 682  THR C CG2   1 
ATOM   8581  N  N     . CYS C 2  683  ? -16.076 -23.321 -20.738  1.00 45.20  ? 683  CYS C N     1 
ATOM   8582  C  CA    . CYS C 2  683  ? -16.498 -24.707 -20.913  1.00 58.48  ? 683  CYS C CA    1 
ATOM   8583  C  C     . CYS C 2  683  ? -17.890 -24.740 -21.532  1.00 59.98  ? 683  CYS C C     1 
ATOM   8584  O  O     . CYS C 2  683  ? -18.877 -24.377 -20.884  1.00 69.98  ? 683  CYS C O     1 
ATOM   8585  C  CB    . CYS C 2  683  ? -16.477 -25.451 -19.581  1.00 77.92  ? 683  CYS C CB    1 
ATOM   8586  S  SG    . CYS C 2  683  ? -17.135 -27.134 -19.668  1.00 75.55  ? 683  CYS C SG    1 
ATOM   8587  N  N     . ALA C 2  684  ? -17.968 -25.179 -22.787  1.00 61.79  ? 684  ALA C N     1 
ATOM   8588  C  CA    . ALA C 2  684  ? -19.240 -25.444 -23.450  1.00 62.23  ? 684  ALA C CA    1 
ATOM   8589  C  C     . ALA C 2  684  ? -19.600 -26.906 -23.213  1.00 64.18  ? 684  ALA C C     1 
ATOM   8590  O  O     . ALA C 2  684  ? -18.982 -27.806 -23.791  1.00 72.72  ? 684  ALA C O     1 
ATOM   8591  C  CB    . ALA C 2  684  ? -19.152 -25.131 -24.942  1.00 81.56  ? 684  ALA C CB    1 
ATOM   8592  N  N     . ASN C 2  685  ? -20.595 -27.142 -22.360  1.00 58.80  ? 685  ASN C N     1 
ATOM   8593  C  CA    . ASN C 2  685  ? -20.995 -28.493 -21.980  1.00 62.76  ? 685  ASN C CA    1 
ATOM   8594  C  C     . ASN C 2  685  ? -22.512 -28.584 -22.016  1.00 62.18  ? 685  ASN C C     1 
ATOM   8595  O  O     . ASN C 2  685  ? -23.197 -27.829 -21.319  1.00 79.59  ? 685  ASN C O     1 
ATOM   8596  C  CB    . ASN C 2  685  ? -20.469 -28.856 -20.588  1.00 70.40  ? 685  ASN C CB    1 
ATOM   8597  C  CG    . ASN C 2  685  ? -20.631 -30.331 -20.267  1.00 62.81  ? 685  ASN C CG    1 
ATOM   8598  O  OD1   . ASN C 2  685  ? -19.726 -31.130 -20.508  1.00 53.72  ? 685  ASN C OD1   1 
ATOM   8599  N  ND2   . ASN C 2  685  ? -21.784 -30.698 -19.720  1.00 74.30  ? 685  ASN C ND2   1 
ATOM   8600  N  N     . GLN C 2  686  ? -23.029 -29.505 -22.820  1.00 61.67  ? 686  GLN C N     1 
ATOM   8601  C  CA    . GLN C 2  686  ? -24.459 -29.741 -22.931  1.00 62.32  ? 686  GLN C CA    1 
ATOM   8602  C  C     . GLN C 2  686  ? -24.871 -30.898 -22.027  1.00 67.73  ? 686  GLN C C     1 
ATOM   8603  O  O     . GLN C 2  686  ? -24.098 -31.830 -21.788  1.00 76.93  ? 686  GLN C O     1 
ATOM   8604  C  CB    . GLN C 2  686  ? -24.848 -30.042 -24.380  1.00 67.31  ? 686  GLN C CB    1 
ATOM   8605  C  CG    . GLN C 2  686  ? -24.576 -28.898 -25.346  1.00 64.37  ? 686  GLN C CG    1 
ATOM   8606  C  CD    . GLN C 2  686  ? -24.872 -29.267 -26.787  1.00 64.66  ? 686  GLN C CD    1 
ATOM   8607  O  OE1   . GLN C 2  686  ? -24.877 -30.443 -27.150  1.00 64.31  ? 686  GLN C OE1   1 
ATOM   8608  N  NE2   . GLN C 2  686  ? -25.124 -28.261 -27.616  1.00 64.03  ? 686  GLN C NE2   1 
ATOM   8609  N  N     . CYS C 2  687  ? -26.102 -30.826 -21.521  1.00 58.58  ? 687  CYS C N     1 
ATOM   8610  C  CA    . CYS C 2  687  ? -26.642 -31.854 -20.646  1.00 54.05  ? 687  CYS C CA    1 
ATOM   8611  C  C     . CYS C 2  687  ? -28.077 -32.177 -21.039  1.00 61.19  ? 687  CYS C C     1 
ATOM   8612  O  O     . CYS C 2  687  ? -28.873 -31.261 -21.296  1.00 55.28  ? 687  CYS C O     1 
ATOM   8613  C  CB    . CYS C 2  687  ? -26.598 -31.425 -19.172  1.00 59.65  ? 687  CYS C CB    1 
ATOM   8614  S  SG    . CYS C 2  687  ? -25.062 -31.839 -18.313  1.00 110.04 ? 687  CYS C SG    1 
ATOM   8615  N  N     . PRO C 2  688  ? -28.428 -33.460 -21.101  1.00 66.70  ? 688  PRO C N     1 
ATOM   8616  C  CA    . PRO C 2  688  ? -29.812 -33.833 -21.410  1.00 59.23  ? 688  PRO C CA    1 
ATOM   8617  C  C     . PRO C 2  688  ? -30.774 -33.351 -20.336  1.00 67.03  ? 688  PRO C C     1 
ATOM   8618  O  O     . PRO C 2  688  ? -30.443 -33.294 -19.149  1.00 77.11  ? 688  PRO C O     1 
ATOM   8619  C  CB    . PRO C 2  688  ? -29.763 -35.365 -21.467  1.00 67.87  ? 688  PRO C CB    1 
ATOM   8620  C  CG    . PRO C 2  688  ? -28.324 -35.688 -21.741  1.00 83.43  ? 688  PRO C CG    1 
ATOM   8621  C  CD    . PRO C 2  688  ? -27.543 -34.633 -21.020  1.00 77.09  ? 688  PRO C CD    1 
ATOM   8622  N  N     . ILE C 2  689  ? -31.981 -32.998 -20.772  1.00 70.14  ? 689  ILE C N     1 
ATOM   8623  C  CA    . ILE C 2  689  ? -33.047 -32.568 -19.882  1.00 67.88  ? 689  ILE C CA    1 
ATOM   8624  C  C     . ILE C 2  689  ? -34.138 -33.624 -19.764  1.00 77.99  ? 689  ILE C C     1 
ATOM   8625  O  O     . ILE C 2  689  ? -34.594 -33.929 -18.659  1.00 103.34 ? 689  ILE C O     1 
ATOM   8626  C  CB    . ILE C 2  689  ? -33.634 -31.219 -20.354  1.00 70.99  ? 689  ILE C CB    1 
ATOM   8627  C  CG1   . ILE C 2  689  ? -32.656 -30.078 -20.069  1.00 75.39  ? 689  ILE C CG1   1 
ATOM   8628  C  CG2   . ILE C 2  689  ? -34.985 -30.953 -19.704  1.00 62.36  ? 689  ILE C CG2   1 
ATOM   8629  C  CD1   . ILE C 2  689  ? -33.133 -28.731 -20.573  1.00 97.85  ? 689  ILE C CD1   1 
ATOM   8630  N  N     . VAL C 2  690  ? -34.556 -34.201 -20.889  1.00 75.50  ? 690  VAL C N     1 
ATOM   8631  C  CA    . VAL C 2  690  ? -35.636 -35.180 -20.922  1.00 79.83  ? 690  VAL C CA    1 
ATOM   8632  C  C     . VAL C 2  690  ? -35.153 -36.503 -20.345  1.00 71.55  ? 690  VAL C C     1 
ATOM   8633  O  O     . VAL C 2  690  ? -33.949 -36.709 -20.152  1.00 59.57  ? 690  VAL C O     1 
ATOM   8634  C  CB    . VAL C 2  690  ? -36.167 -35.369 -22.355  1.00 100.11 ? 690  VAL C CB    1 
ATOM   8635  C  CG1   . VAL C 2  690  ? -36.706 -34.055 -22.905  1.00 109.24 ? 690  VAL C CG1   1 
ATOM   8636  C  CG2   . VAL C 2  690  ? -35.071 -35.917 -23.256  1.00 81.79  ? 690  VAL C CG2   1 
ATOM   8637  N  N     . ASP C 2  691  ? -36.086 -37.406 -20.070  1.00 76.83  ? 691  ASP C N     1 
ATOM   8638  C  CA    . ASP C 2  691  ? -35.793 -38.742 -19.566  1.00 81.37  ? 691  ASP C CA    1 
ATOM   8639  C  C     . ASP C 2  691  ? -36.325 -39.784 -20.547  1.00 82.67  ? 691  ASP C C     1 
ATOM   8640  O  O     . ASP C 2  691  ? -36.829 -39.458 -21.625  1.00 86.32  ? 691  ASP C O     1 
ATOM   8641  C  CB    . ASP C 2  691  ? -36.386 -38.941 -18.167  1.00 98.77  ? 691  ASP C CB    1 
ATOM   8642  C  CG    . ASP C 2  691  ? -35.358 -38.760 -17.063  1.00 115.74 ? 691  ASP C CG    1 
ATOM   8643  O  OD1   . ASP C 2  691  ? -34.259 -39.346 -17.170  1.00 117.70 ? 691  ASP C OD1   1 
ATOM   8644  O  OD2   . ASP C 2  691  ? -35.648 -38.033 -16.089  1.00 117.43 ? 691  ASP C OD2   1 
ATOM   8645  N  N     . ALA C 2  692  ? -36.209 -41.051 -20.158  1.00 73.67  ? 692  ALA C N     1 
ATOM   8646  C  CA    . ALA C 2  692  ? -36.618 -42.152 -21.022  1.00 74.86  ? 692  ALA C CA    1 
ATOM   8647  C  C     . ALA C 2  692  ? -38.135 -42.181 -21.159  1.00 84.30  ? 692  ALA C C     1 
ATOM   8648  O  O     . ALA C 2  692  ? -38.857 -42.248 -20.158  1.00 95.00  ? 692  ALA C O     1 
ATOM   8649  C  CB    . ALA C 2  692  ? -36.104 -43.476 -20.464  1.00 95.27  ? 692  ALA C CB    1 
ATOM   8650  N  N     . GLY C 2  693  ? -38.617 -42.129 -22.396  1.00 79.84  ? 693  GLY C N     1 
ATOM   8651  C  CA    . GLY C 2  693  ? -40.040 -42.241 -22.656  1.00 74.57  ? 693  GLY C CA    1 
ATOM   8652  C  C     . GLY C 2  693  ? -40.843 -40.986 -22.401  1.00 75.48  ? 693  GLY C C     1 
ATOM   8653  O  O     . GLY C 2  693  ? -41.960 -41.067 -21.872  1.00 77.95  ? 693  GLY C O     1 
ATOM   8654  N  N     . ASP C 2  694  ? -40.315 -39.822 -22.768  1.00 76.69  ? 694  ASP C N     1 
ATOM   8655  C  CA    . ASP C 2  694  ? -41.002 -38.550 -22.585  1.00 82.51  ? 694  ASP C CA    1 
ATOM   8656  C  C     . ASP C 2  694  ? -41.511 -38.046 -23.929  1.00 75.90  ? 694  ASP C C     1 
ATOM   8657  O  O     . ASP C 2  694  ? -40.743 -37.946 -24.891  1.00 77.19  ? 694  ASP C O     1 
ATOM   8658  C  CB    . ASP C 2  694  ? -40.077 -37.511 -21.946  1.00 86.52  ? 694  ASP C CB    1 
ATOM   8659  C  CG    . ASP C 2  694  ? -39.649 -37.894 -20.541  1.00 94.87  ? 694  ASP C CG    1 
ATOM   8660  O  OD1   . ASP C 2  694  ? -39.911 -39.043 -20.127  1.00 105.26 ? 694  ASP C OD1   1 
ATOM   8661  O  OD2   . ASP C 2  694  ? -39.053 -37.041 -19.848  1.00 97.14  ? 694  ASP C OD2   1 
ATOM   8662  N  N     . ARG C 2  695  ? -42.804 -37.735 -23.992  1.00 79.08  ? 695  ARG C N     1 
ATOM   8663  C  CA    . ARG C 2  695  ? -43.381 -37.136 -25.189  1.00 88.08  ? 695  ARG C CA    1 
ATOM   8664  C  C     . ARG C 2  695  ? -42.895 -35.698 -25.325  1.00 86.51  ? 695  ARG C C     1 
ATOM   8665  O  O     . ARG C 2  695  ? -43.138 -34.867 -24.442  1.00 86.03  ? 695  ARG C O     1 
ATOM   8666  C  CB    . ARG C 2  695  ? -44.906 -37.186 -25.125  1.00 107.77 ? 695  ARG C CB    1 
ATOM   8667  C  CG    . ARG C 2  695  ? -45.604 -36.265 -26.114  1.00 109.68 ? 695  ARG C CG    1 
ATOM   8668  C  CD    . ARG C 2  695  ? -45.419 -36.730 -27.549  1.00 101.11 ? 695  ARG C CD    1 
ATOM   8669  N  NE    . ARG C 2  695  ? -45.943 -35.755 -28.500  1.00 112.98 ? 695  ARG C NE    1 
ATOM   8670  C  CZ    . ARG C 2  695  ? -46.055 -35.966 -29.807  1.00 122.74 ? 695  ARG C CZ    1 
ATOM   8671  N  NH1   . ARG C 2  695  ? -45.685 -37.128 -30.329  1.00 124.46 ? 695  ARG C NH1   1 
ATOM   8672  N  NH2   . ARG C 2  695  ? -46.543 -35.016 -30.593  1.00 115.42 ? 695  ARG C NH2   1 
ATOM   8673  N  N     . VAL C 2  696  ? -42.207 -35.403 -26.425  1.00 75.31  ? 696  VAL C N     1 
ATOM   8674  C  CA    . VAL C 2  696  ? -41.610 -34.095 -26.663  1.00 70.71  ? 696  VAL C CA    1 
ATOM   8675  C  C     . VAL C 2  696  ? -42.189 -33.521 -27.948  1.00 90.40  ? 696  VAL C C     1 
ATOM   8676  O  O     . VAL C 2  696  ? -42.199 -34.194 -28.985  1.00 100.95 ? 696  VAL C O     1 
ATOM   8677  C  CB    . VAL C 2  696  ? -40.075 -34.177 -26.748  1.00 54.85  ? 696  VAL C CB    1 
ATOM   8678  C  CG1   . VAL C 2  696  ? -39.491 -32.814 -27.086  1.00 81.83  ? 696  VAL C CG1   1 
ATOM   8679  C  CG2   . VAL C 2  696  ? -39.495 -34.709 -25.443  1.00 77.28  ? 696  VAL C CG2   1 
ATOM   8680  N  N     . GLU C 2  697  ? -42.663 -32.281 -27.876  1.00 92.25  ? 697  GLU C N     1 
ATOM   8681  C  CA    . GLU C 2  697  ? -43.207 -31.594 -29.035  1.00 87.13  ? 697  GLU C CA    1 
ATOM   8682  C  C     . GLU C 2  697  ? -42.079 -31.053 -29.914  1.00 86.74  ? 697  GLU C C     1 
ATOM   8683  O  O     . GLU C 2  697  ? -40.911 -31.004 -29.519  1.00 75.23  ? 697  GLU C O     1 
ATOM   8684  C  CB    . GLU C 2  697  ? -44.132 -30.461 -28.595  1.00 123.07 ? 697  GLU C CB    1 
ATOM   8685  C  CG    . GLU C 2  697  ? -45.318 -30.916 -27.760  1.00 164.47 ? 697  GLU C CG    1 
ATOM   8686  C  CD    . GLU C 2  697  ? -46.097 -29.754 -27.177  1.00 187.94 ? 697  GLU C CD    1 
ATOM   8687  O  OE1   . GLU C 2  697  ? -45.588 -28.614 -27.227  1.00 166.42 ? 697  GLU C OE1   1 
ATOM   8688  O  OE2   . GLU C 2  697  ? -47.217 -29.979 -26.671  1.00 164.85 ? 697  GLU C OE2   1 
ATOM   8689  N  N     . ALA C 2  698  ? -42.446 -30.640 -31.124  1.00 86.99  ? 698  ALA C N     1 
ATOM   8690  C  CA    . ALA C 2  698  ? -41.464 -30.117 -32.063  1.00 76.59  ? 698  ALA C CA    1 
ATOM   8691  C  C     . ALA C 2  698  ? -40.983 -28.740 -31.624  1.00 83.62  ? 698  ALA C C     1 
ATOM   8692  O  O     . ALA C 2  698  ? -41.760 -27.923 -31.121  1.00 94.35  ? 698  ALA C O     1 
ATOM   8693  C  CB    . ALA C 2  698  ? -42.059 -30.046 -33.469  1.00 82.27  ? 698  ALA C CB    1 
ATOM   8694  N  N     . GLY C 2  699  ? -39.691 -28.484 -31.818  1.00 85.66  ? 699  GLY C N     1 
ATOM   8695  C  CA    . GLY C 2  699  ? -39.119 -27.212 -31.427  1.00 82.75  ? 699  GLY C CA    1 
ATOM   8696  C  C     . GLY C 2  699  ? -38.959 -27.024 -29.937  1.00 78.96  ? 699  GLY C C     1 
ATOM   8697  O  O     . GLY C 2  699  ? -38.838 -25.886 -29.475  1.00 80.06  ? 699  GLY C O     1 
ATOM   8698  N  N     . GLN C 2  700  ? -38.956 -28.108 -29.170  1.00 80.34  ? 700  GLN C N     1 
ATOM   8699  C  CA    . GLN C 2  700  ? -38.839 -28.052 -27.721  1.00 81.20  ? 700  GLN C CA    1 
ATOM   8700  C  C     . GLN C 2  700  ? -37.423 -28.419 -27.292  1.00 75.49  ? 700  GLN C C     1 
ATOM   8701  O  O     . GLN C 2  700  ? -36.747 -29.223 -27.940  1.00 91.55  ? 700  GLN C O     1 
ATOM   8702  C  CB    . GLN C 2  700  ? -39.851 -28.993 -27.063  1.00 89.14  ? 700  GLN C CB    1 
ATOM   8703  C  CG    . GLN C 2  700  ? -39.925 -28.883 -25.551  1.00 78.60  ? 700  GLN C CG    1 
ATOM   8704  C  CD    . GLN C 2  700  ? -40.398 -30.166 -24.902  1.00 76.56  ? 700  GLN C CD    1 
ATOM   8705  O  OE1   . GLN C 2  700  ? -41.536 -30.593 -25.097  1.00 84.52  ? 700  GLN C OE1   1 
ATOM   8706  N  NE2   . GLN C 2  700  ? -39.519 -30.796 -24.131  1.00 64.21  ? 700  GLN C NE2   1 
ATOM   8707  N  N     . VAL C 2  701  ? -36.981 -27.821 -26.189  1.00 47.50  ? 701  VAL C N     1 
ATOM   8708  C  CA    . VAL C 2  701  ? -35.625 -28.020 -25.687  1.00 64.80  ? 701  VAL C CA    1 
ATOM   8709  C  C     . VAL C 2  701  ? -35.557 -29.378 -24.993  1.00 66.86  ? 701  VAL C C     1 
ATOM   8710  O  O     . VAL C 2  701  ? -36.189 -29.588 -23.955  1.00 62.64  ? 701  VAL C O     1 
ATOM   8711  C  CB    . VAL C 2  701  ? -35.208 -26.892 -24.738  1.00 52.54  ? 701  VAL C CB    1 
ATOM   8712  C  CG1   . VAL C 2  701  ? -33.834 -27.176 -24.149  1.00 46.67  ? 701  VAL C CG1   1 
ATOM   8713  C  CG2   . VAL C 2  701  ? -35.218 -25.552 -25.464  1.00 56.53  ? 701  VAL C CG2   1 
ATOM   8714  N  N     . ILE C 2  702  ? -34.785 -30.304 -25.568  1.00 71.31  ? 702  ILE C N     1 
ATOM   8715  C  CA    . ILE C 2  702  ? -34.573 -31.619 -24.968  1.00 74.60  ? 702  ILE C CA    1 
ATOM   8716  C  C     . ILE C 2  702  ? -33.252 -31.709 -24.221  1.00 71.53  ? 702  ILE C C     1 
ATOM   8717  O  O     . ILE C 2  702  ? -33.001 -32.723 -23.548  1.00 75.55  ? 702  ILE C O     1 
ATOM   8718  C  CB    . ILE C 2  702  ? -34.635 -32.734 -26.032  1.00 74.27  ? 702  ILE C CB    1 
ATOM   8719  C  CG1   . ILE C 2  702  ? -33.433 -32.632 -26.972  1.00 62.55  ? 702  ILE C CG1   1 
ATOM   8720  C  CG2   . ILE C 2  702  ? -35.928 -32.644 -26.815  1.00 68.06  ? 702  ILE C CG2   1 
ATOM   8721  C  CD1   . ILE C 2  702  ? -33.353 -33.753 -27.982  1.00 71.27  ? 702  ILE C CD1   1 
ATOM   8722  N  N     . ALA C 2  703  ? -32.401 -30.692 -24.324  1.00 63.24  ? 703  ALA C N     1 
ATOM   8723  C  CA    . ALA C 2  703  ? -31.099 -30.631 -23.678  1.00 57.10  ? 703  ALA C CA    1 
ATOM   8724  C  C     . ALA C 2  703  ? -30.578 -29.211 -23.820  1.00 72.45  ? 703  ALA C C     1 
ATOM   8725  O  O     . ALA C 2  703  ? -30.818 -28.554 -24.837  1.00 100.37 ? 703  ALA C O     1 
ATOM   8726  C  CB    . ALA C 2  703  ? -30.110 -31.627 -24.295  1.00 60.60  ? 703  ALA C CB    1 
ATOM   8727  N  N     . ASP C 2  704  ? -29.869 -28.743 -22.796  1.00 56.19  ? 704  ASP C N     1 
ATOM   8728  C  CA    . ASP C 2  704  ? -29.364 -27.379 -22.771  1.00 79.15  ? 704  ASP C CA    1 
ATOM   8729  C  C     . ASP C 2  704  ? -27.868 -27.382 -22.489  1.00 68.79  ? 704  ASP C C     1 
ATOM   8730  O  O     . ASP C 2  704  ? -27.343 -28.286 -21.834  1.00 57.48  ? 704  ASP C O     1 
ATOM   8731  C  CB    . ASP C 2  704  ? -30.111 -26.527 -21.730  1.00 79.43  ? 704  ASP C CB    1 
ATOM   8732  C  CG    . ASP C 2  704  ? -30.090 -27.137 -20.341  1.00 91.12  ? 704  ASP C CG    1 
ATOM   8733  O  OD1   . ASP C 2  704  ? -29.784 -28.342 -20.214  1.00 110.63 ? 704  ASP C OD1   1 
ATOM   8734  O  OD2   . ASP C 2  704  ? -30.400 -26.409 -19.373  1.00 78.83  ? 704  ASP C OD2   1 
ATOM   8735  N  N     . GLY C 2  705  ? -27.185 -26.357 -22.997  1.00 71.33  ? 705  GLY C N     1 
ATOM   8736  C  CA    . GLY C 2  705  ? -25.748 -26.264 -22.888  1.00 65.44  ? 705  GLY C CA    1 
ATOM   8737  C  C     . GLY C 2  705  ? -25.293 -25.297 -21.813  1.00 64.80  ? 705  GLY C C     1 
ATOM   8738  O  O     . GLY C 2  705  ? -25.904 -25.184 -20.746  1.00 88.36  ? 705  GLY C O     1 
ATOM   8739  N  N     . PRO C 2  706  ? -24.207 -24.574 -22.081  1.00 52.28  ? 706  PRO C N     1 
ATOM   8740  C  CA    . PRO C 2  706  ? -23.674 -23.643 -21.079  1.00 54.22  ? 706  PRO C CA    1 
ATOM   8741  C  C     . PRO C 2  706  ? -24.608 -22.465 -20.853  1.00 54.77  ? 706  PRO C C     1 
ATOM   8742  O  O     . PRO C 2  706  ? -25.272 -21.984 -21.774  1.00 46.79  ? 706  PRO C O     1 
ATOM   8743  C  CB    . PRO C 2  706  ? -22.347 -23.187 -21.692  1.00 58.82  ? 706  PRO C CB    1 
ATOM   8744  C  CG    . PRO C 2  706  ? -22.552 -23.337 -23.164  1.00 69.56  ? 706  PRO C CG    1 
ATOM   8745  C  CD    . PRO C 2  706  ? -23.440 -24.538 -23.338  1.00 68.29  ? 706  PRO C CD    1 
ATOM   8746  N  N     . CYS C 2  707  ? -24.648 -22.004 -19.601  1.00 58.52  ? 707  CYS C N     1 
ATOM   8747  C  CA    . CYS C 2  707  ? -25.462 -20.853 -19.198  1.00 55.95  ? 707  CYS C CA    1 
ATOM   8748  C  C     . CYS C 2  707  ? -26.924 -21.031 -19.603  1.00 57.74  ? 707  CYS C C     1 
ATOM   8749  O  O     . CYS C 2  707  ? -27.576 -20.103 -20.084  1.00 51.06  ? 707  CYS C O     1 
ATOM   8750  C  CB    . CYS C 2  707  ? -24.899 -19.549 -19.769  1.00 56.66  ? 707  CYS C CB    1 
ATOM   8751  S  SG    . CYS C 2  707  ? -23.339 -18.997 -19.040  1.00 81.52  ? 707  CYS C SG    1 
ATOM   8752  N  N     . THR C 2  708  ? -27.441 -22.242 -19.414  1.00 61.84  ? 708  THR C N     1 
ATOM   8753  C  CA    . THR C 2  708  ? -28.832 -22.546 -19.716  1.00 59.25  ? 708  THR C CA    1 
ATOM   8754  C  C     . THR C 2  708  ? -29.394 -23.455 -18.633  1.00 62.49  ? 708  THR C C     1 
ATOM   8755  O  O     . THR C 2  708  ? -28.726 -24.391 -18.186  1.00 68.30  ? 708  THR C O     1 
ATOM   8756  C  CB    . THR C 2  708  ? -28.988 -23.212 -21.092  1.00 67.11  ? 708  THR C CB    1 
ATOM   8757  O  OG1   . THR C 2  708  ? -28.014 -24.252 -21.237  1.00 73.92  ? 708  THR C OG1   1 
ATOM   8758  C  CG2   . THR C 2  708  ? -28.819 -22.195 -22.216  1.00 63.51  ? 708  THR C CG2   1 
ATOM   8759  N  N     . ASP C 2  709  ? -30.623 -23.163 -18.210  1.00 74.64  ? 709  ASP C N     1 
ATOM   8760  C  CA    . ASP C 2  709  ? -31.322 -23.958 -17.203  1.00 83.63  ? 709  ASP C CA    1 
ATOM   8761  C  C     . ASP C 2  709  ? -32.767 -24.102 -17.659  1.00 80.75  ? 709  ASP C C     1 
ATOM   8762  O  O     . ASP C 2  709  ? -33.516 -23.121 -17.664  1.00 88.09  ? 709  ASP C O     1 
ATOM   8763  C  CB    . ASP C 2  709  ? -31.243 -23.308 -15.821  1.00 81.54  ? 709  ASP C CB    1 
ATOM   8764  C  CG    . ASP C 2  709  ? -31.934 -24.129 -14.748  1.00 93.68  ? 709  ASP C CG    1 
ATOM   8765  O  OD1   . ASP C 2  709  ? -32.208 -25.323 -14.994  1.00 109.17 ? 709  ASP C OD1   1 
ATOM   8766  O  OD2   . ASP C 2  709  ? -32.210 -23.577 -13.661  1.00 94.87  ? 709  ASP C OD2   1 
ATOM   8767  N  N     . ASP C 2  710  ? -33.148 -25.319 -18.051  1.00 69.26  ? 710  ASP C N     1 
ATOM   8768  C  CA    . ASP C 2  710  ? -34.480 -25.607 -18.585  1.00 68.55  ? 710  ASP C CA    1 
ATOM   8769  C  C     . ASP C 2  710  ? -34.796 -24.751 -19.811  1.00 71.20  ? 710  ASP C C     1 
ATOM   8770  O  O     . ASP C 2  710  ? -35.961 -24.475 -20.104  1.00 93.11  ? 710  ASP C O     1 
ATOM   8771  C  CB    . ASP C 2  710  ? -35.559 -25.433 -17.509  1.00 88.16  ? 710  ASP C CB    1 
ATOM   8772  C  CG    . ASP C 2  710  ? -36.661 -26.471 -17.612  1.00 86.88  ? 710  ASP C CG    1 
ATOM   8773  O  OD1   . ASP C 2  710  ? -37.294 -26.567 -18.683  1.00 109.33 ? 710  ASP C OD1   1 
ATOM   8774  O  OD2   . ASP C 2  710  ? -36.885 -27.201 -16.622  1.00 78.58  ? 710  ASP C OD2   1 
ATOM   8775  N  N     . GLY C 2  711  ? -33.762 -24.321 -20.533  1.00 59.93  ? 711  GLY C N     1 
ATOM   8776  C  CA    . GLY C 2  711  ? -33.931 -23.560 -21.753  1.00 74.63  ? 711  GLY C CA    1 
ATOM   8777  C  C     . GLY C 2  711  ? -33.864 -22.052 -21.624  1.00 73.00  ? 711  GLY C C     1 
ATOM   8778  O  O     . GLY C 2  711  ? -34.234 -21.355 -22.576  1.00 90.72  ? 711  GLY C O     1 
ATOM   8779  N  N     . GLU C 2  712  ? -33.400 -21.524 -20.494  1.00 58.77  ? 712  GLU C N     1 
ATOM   8780  C  CA    . GLU C 2  712  ? -33.346 -20.086 -20.265  1.00 56.68  ? 712  GLU C CA    1 
ATOM   8781  C  C     . GLU C 2  712  ? -31.921 -19.656 -19.939  1.00 47.29  ? 712  GLU C C     1 
ATOM   8782  O  O     . GLU C 2  712  ? -31.141 -20.423 -19.368  1.00 56.34  ? 712  GLU C O     1 
ATOM   8783  C  CB    . GLU C 2  712  ? -34.295 -19.676 -19.132  1.00 70.20  ? 712  GLU C CB    1 
ATOM   8784  C  CG    . GLU C 2  712  ? -35.762 -19.935 -19.442  1.00 86.45  ? 712  GLU C CG    1 
ATOM   8785  C  CD    . GLU C 2  712  ? -36.658 -19.774 -18.230  1.00 88.99  ? 712  GLU C CD    1 
ATOM   8786  O  OE1   . GLU C 2  712  ? -36.460 -20.509 -17.239  1.00 93.41  ? 712  GLU C OE1   1 
ATOM   8787  O  OE2   . GLU C 2  712  ? -37.558 -18.908 -18.268  1.00 86.04  ? 712  GLU C OE2   1 
ATOM   8788  N  N     . MET C 2  713  ? -31.589 -18.418 -20.305  1.00 48.75  ? 713  MET C N     1 
ATOM   8789  C  CA    . MET C 2  713  ? -30.240 -17.889 -20.107  1.00 57.62  ? 713  MET C CA    1 
ATOM   8790  C  C     . MET C 2  713  ? -29.932 -17.809 -18.617  1.00 51.35  ? 713  MET C C     1 
ATOM   8791  O  O     . MET C 2  713  ? -30.521 -17.001 -17.893  1.00 48.64  ? 713  MET C O     1 
ATOM   8792  C  CB    . MET C 2  713  ? -30.103 -16.520 -20.768  1.00 53.16  ? 713  MET C CB    1 
ATOM   8793  C  CG    . MET C 2  713  ? -30.058 -16.563 -22.288  1.00 64.72  ? 713  MET C CG    1 
ATOM   8794  S  SD    . MET C 2  713  ? -28.647 -17.499 -22.909  1.00 83.25  ? 713  MET C SD    1 
ATOM   8795  C  CE    . MET C 2  713  ? -27.296 -16.640 -22.109  1.00 62.38  ? 713  MET C CE    1 
ATOM   8796  N  N     . ALA C 2  714  ? -29.006 -18.645 -18.160  1.00 69.20  ? 714  ALA C N     1 
ATOM   8797  C  CA    . ALA C 2  714  ? -28.621 -18.711 -16.756  1.00 75.39  ? 714  ALA C CA    1 
ATOM   8798  C  C     . ALA C 2  714  ? -27.196 -18.190 -16.601  1.00 76.43  ? 714  ALA C C     1 
ATOM   8799  O  O     . ALA C 2  714  ? -26.255 -18.937 -16.321  1.00 79.58  ? 714  ALA C O     1 
ATOM   8800  C  CB    . ALA C 2  714  ? -28.759 -20.148 -16.235  1.00 81.40  ? 714  ALA C CB    1 
ATOM   8801  N  N     . LEU C 2  715  ? -27.043 -16.877 -16.783  1.00 61.22  ? 715  LEU C N     1 
ATOM   8802  C  CA    . LEU C 2  715  ? -25.725 -16.256 -16.755  1.00 67.63  ? 715  LEU C CA    1 
ATOM   8803  C  C     . LEU C 2  715  ? -25.126 -16.176 -15.357  1.00 75.78  ? 715  LEU C C     1 
ATOM   8804  O  O     . LEU C 2  715  ? -23.957 -15.797 -15.229  1.00 74.56  ? 715  LEU C O     1 
ATOM   8805  C  CB    . LEU C 2  715  ? -25.797 -14.855 -17.364  1.00 75.83  ? 715  LEU C CB    1 
ATOM   8806  C  CG    . LEU C 2  715  ? -26.081 -14.826 -18.865  1.00 62.81  ? 715  LEU C CG    1 
ATOM   8807  C  CD1   . LEU C 2  715  ? -26.283 -13.402 -19.351  1.00 74.66  ? 715  LEU C CD1   1 
ATOM   8808  C  CD2   . LEU C 2  715  ? -24.950 -15.500 -19.624  1.00 47.10  ? 715  LEU C CD2   1 
ATOM   8809  N  N     . GLY C 2  716  ? -25.877 -16.516 -14.325  1.00 75.30  ? 716  GLY C N     1 
ATOM   8810  C  CA    . GLY C 2  716  ? -25.371 -16.457 -12.968  1.00 76.24  ? 716  GLY C CA    1 
ATOM   8811  C  C     . GLY C 2  716  ? -26.188 -17.285 -12.002  1.00 69.95  ? 716  GLY C C     1 
ATOM   8812  O  O     . GLY C 2  716  ? -26.819 -18.274 -12.381  1.00 68.87  ? 716  GLY C O     1 
ATOM   8813  N  N     . LYS C 2  717  ? -26.171 -16.873 -10.735  1.00 67.83  ? 717  LYS C N     1 
ATOM   8814  C  CA    . LYS C 2  717  ? -26.865 -17.574 -9.666   1.00 65.11  ? 717  LYS C CA    1 
ATOM   8815  C  C     . LYS C 2  717  ? -27.682 -16.586 -8.845   1.00 69.30  ? 717  LYS C C     1 
ATOM   8816  O  O     . LYS C 2  717  ? -27.428 -15.379 -8.849   1.00 57.19  ? 717  LYS C O     1 
ATOM   8817  C  CB    . LYS C 2  717  ? -25.886 -18.315 -8.740   1.00 51.23  ? 717  LYS C CB    1 
ATOM   8818  C  CG    . LYS C 2  717  ? -25.069 -19.406 -9.407   1.00 45.09  ? 717  LYS C CG    1 
ATOM   8819  C  CD    . LYS C 2  717  ? -25.959 -20.463 -10.032  1.00 66.57  ? 717  LYS C CD    1 
ATOM   8820  C  CE    . LYS C 2  717  ? -25.211 -21.771 -10.212  1.00 69.28  ? 717  LYS C CE    1 
ATOM   8821  N  NZ    . LYS C 2  717  ? -24.820 -22.364 -8.902   1.00 72.17  ? 717  LYS C NZ    1 
ATOM   8822  N  N     . ASN C 2  718  ? -28.670 -17.121 -8.131   1.00 56.46  ? 718  ASN C N     1 
ATOM   8823  C  CA    . ASN C 2  718  ? -29.481 -16.334 -7.211   1.00 45.63  ? 718  ASN C CA    1 
ATOM   8824  C  C     . ASN C 2  718  ? -28.811 -16.337 -5.840   1.00 64.01  ? 718  ASN C C     1 
ATOM   8825  O  O     . ASN C 2  718  ? -28.706 -17.388 -5.198   1.00 83.00  ? 718  ASN C O     1 
ATOM   8826  C  CB    . ASN C 2  718  ? -30.899 -16.896 -7.125   1.00 40.90  ? 718  ASN C CB    1 
ATOM   8827  C  CG    . ASN C 2  718  ? -31.575 -16.988 -8.481   1.00 54.95  ? 718  ASN C CG    1 
ATOM   8828  O  OD1   . ASN C 2  718  ? -32.242 -16.051 -8.922   1.00 48.23  ? 718  ASN C OD1   1 
ATOM   8829  N  ND2   . ASN C 2  718  ? -31.409 -18.124 -9.148   1.00 72.79  ? 718  ASN C ND2   1 
ATOM   8830  N  N     . LEU C 2  719  ? -28.358 -15.167 -5.397   1.00 52.37  ? 719  LEU C N     1 
ATOM   8831  C  CA    . LEU C 2  719  ? -27.609 -15.027 -4.156   1.00 53.49  ? 719  LEU C CA    1 
ATOM   8832  C  C     . LEU C 2  719  ? -28.400 -14.196 -3.156   1.00 58.50  ? 719  LEU C C     1 
ATOM   8833  O  O     . LEU C 2  719  ? -29.030 -13.199 -3.522   1.00 49.64  ? 719  LEU C O     1 
ATOM   8834  C  CB    . LEU C 2  719  ? -26.242 -14.377 -4.409   1.00 59.52  ? 719  LEU C CB    1 
ATOM   8835  C  CG    . LEU C 2  719  ? -25.036 -15.291 -4.648   1.00 62.96  ? 719  LEU C CG    1 
ATOM   8836  C  CD1   . LEU C 2  719  ? -25.374 -16.449 -5.576   1.00 69.76  ? 719  LEU C CD1   1 
ATOM   8837  C  CD2   . LEU C 2  719  ? -23.879 -14.482 -5.211   1.00 47.90  ? 719  LEU C CD2   1 
ATOM   8838  N  N     . LEU C 2  720  ? -28.366 -14.616 -1.892   1.00 76.06  ? 720  LEU C N     1 
ATOM   8839  C  CA    . LEU C 2  720  ? -29.004 -13.872 -0.811   1.00 75.47  ? 720  LEU C CA    1 
ATOM   8840  C  C     . LEU C 2  720  ? -28.135 -12.665 -0.478   1.00 63.24  ? 720  LEU C C     1 
ATOM   8841  O  O     . LEU C 2  720  ? -27.035 -12.813 0.065    1.00 59.11  ? 720  LEU C O     1 
ATOM   8842  C  CB    . LEU C 2  720  ? -29.207 -14.768 0.409    1.00 65.17  ? 720  LEU C CB    1 
ATOM   8843  C  CG    . LEU C 2  720  ? -29.922 -14.138 1.606    1.00 57.34  ? 720  LEU C CG    1 
ATOM   8844  C  CD1   . LEU C 2  720  ? -31.300 -13.630 1.209    1.00 55.74  ? 720  LEU C CD1   1 
ATOM   8845  C  CD2   . LEU C 2  720  ? -30.029 -15.129 2.755    1.00 57.04  ? 720  LEU C CD2   1 
ATOM   8846  N  N     . VAL C 2  721  ? -28.623 -11.471 -0.804   1.00 46.70  ? 721  VAL C N     1 
ATOM   8847  C  CA    . VAL C 2  721  ? -27.839 -10.245 -0.725   1.00 48.18  ? 721  VAL C CA    1 
ATOM   8848  C  C     . VAL C 2  721  ? -28.353 -9.385  0.422    1.00 64.32  ? 721  VAL C C     1 
ATOM   8849  O  O     . VAL C 2  721  ? -29.560 -9.332  0.685    1.00 58.08  ? 721  VAL C O     1 
ATOM   8850  C  CB    . VAL C 2  721  ? -27.882 -9.472  -2.061   1.00 51.14  ? 721  VAL C CB    1 
ATOM   8851  C  CG1   . VAL C 2  721  ? -29.317 -9.161  -2.459   1.00 44.59  ? 721  VAL C CG1   1 
ATOM   8852  C  CG2   . VAL C 2  721  ? -27.054 -8.196  -1.980   1.00 54.99  ? 721  VAL C CG2   1 
ATOM   8853  N  N     . ALA C 2  722  ? -27.425 -8.727  1.114    1.00 71.81  ? 722  ALA C N     1 
ATOM   8854  C  CA    . ALA C 2  722  ? -27.732 -7.698  2.097    1.00 65.41  ? 722  ALA C CA    1 
ATOM   8855  C  C     . ALA C 2  722  ? -27.060 -6.401  1.672    1.00 61.08  ? 722  ALA C C     1 
ATOM   8856  O  O     . ALA C 2  722  ? -25.900 -6.405  1.247    1.00 57.78  ? 722  ALA C O     1 
ATOM   8857  C  CB    . ALA C 2  722  ? -27.264 -8.103  3.498    1.00 70.34  ? 722  ALA C CB    1 
ATOM   8858  N  N     . ILE C 2  723  ? -27.788 -5.296  1.777    1.00 60.46  ? 723  ILE C N     1 
ATOM   8859  C  CA    . ILE C 2  723  ? -27.304 -3.993  1.324    1.00 61.88  ? 723  ILE C CA    1 
ATOM   8860  C  C     . ILE C 2  723  ? -26.839 -3.246  2.569    1.00 72.19  ? 723  ILE C C     1 
ATOM   8861  O  O     . ILE C 2  723  ? -27.619 -2.587  3.255    1.00 75.64  ? 723  ILE C O     1 
ATOM   8862  C  CB    . ILE C 2  723  ? -28.374 -3.225  0.551    1.00 51.38  ? 723  ILE C CB    1 
ATOM   8863  C  CG1   . ILE C 2  723  ? -28.980 -4.109  -0.541   1.00 54.57  ? 723  ILE C CG1   1 
ATOM   8864  C  CG2   . ILE C 2  723  ? -27.786 -1.959  -0.053   1.00 66.48  ? 723  ILE C CG2   1 
ATOM   8865  C  CD1   . ILE C 2  723  ? -27.980 -4.590  -1.571   1.00 55.50  ? 723  ILE C CD1   1 
ATOM   8866  N  N     . MET C 2  724  ? -25.544 -3.345  2.862    1.00 64.11  ? 724  MET C N     1 
ATOM   8867  C  CA    . MET C 2  724  ? -24.989 -2.712  4.052    1.00 43.85  ? 724  MET C CA    1 
ATOM   8868  C  C     . MET C 2  724  ? -23.467 -2.677  3.993    1.00 56.60  ? 724  MET C C     1 
ATOM   8869  O  O     . MET C 2  724  ? -22.843 -3.612  3.475    1.00 58.41  ? 724  MET C O     1 
ATOM   8870  C  CB    . MET C 2  724  ? -25.442 -3.450  5.315    1.00 46.84  ? 724  MET C CB    1 
ATOM   8871  C  CG    . MET C 2  724  ? -25.229 -4.960  5.262    1.00 54.58  ? 724  MET C CG    1 
ATOM   8872  S  SD    . MET C 2  724  ? -25.392 -5.771  6.866    1.00 80.56  ? 724  MET C SD    1 
ATOM   8873  C  CE    . MET C 2  724  ? -23.947 -5.136  7.714    1.00 51.28  ? 724  MET C CE    1 
ATOM   8874  N  N     . PRO C 2  725  ? -22.836 -1.623  4.505    1.00 64.81  ? 725  PRO C N     1 
ATOM   8875  C  CA    . PRO C 2  725  ? -21.382 -1.657  4.683    1.00 59.12  ? 725  PRO C CA    1 
ATOM   8876  C  C     . PRO C 2  725  ? -21.013 -2.660  5.763    1.00 55.29  ? 725  PRO C C     1 
ATOM   8877  O  O     . PRO C 2  725  ? -21.752 -2.864  6.729    1.00 63.37  ? 725  PRO C O     1 
ATOM   8878  C  CB    . PRO C 2  725  ? -21.034 -0.225  5.109    1.00 59.36  ? 725  PRO C CB    1 
ATOM   8879  C  CG    . PRO C 2  725  ? -22.261 0.597   4.798    1.00 77.09  ? 725  PRO C CG    1 
ATOM   8880  C  CD    . PRO C 2  725  ? -23.416 -0.339  4.927    1.00 63.84  ? 725  PRO C CD    1 
ATOM   8881  N  N     . TRP C 2  726  ? -19.855 -3.298  5.589    1.00 51.31  ? 726  TRP C N     1 
ATOM   8882  C  CA    . TRP C 2  726  ? -19.430 -4.367  6.497    1.00 54.73  ? 726  TRP C CA    1 
ATOM   8883  C  C     . TRP C 2  726  ? -17.924 -4.252  6.727    1.00 55.61  ? 726  TRP C C     1 
ATOM   8884  O  O     . TRP C 2  726  ? -17.125 -4.807  5.967    1.00 62.32  ? 726  TRP C O     1 
ATOM   8885  C  CB    . TRP C 2  726  ? -19.813 -5.736  5.948    1.00 45.97  ? 726  TRP C CB    1 
ATOM   8886  C  CG    . TRP C 2  726  ? -19.859 -6.796  7.004    1.00 44.93  ? 726  TRP C CG    1 
ATOM   8887  C  CD1   . TRP C 2  726  ? -20.950 -7.191  7.719    1.00 52.69  ? 726  TRP C CD1   1 
ATOM   8888  C  CD2   . TRP C 2  726  ? -18.762 -7.588  7.475    1.00 50.73  ? 726  TRP C CD2   1 
ATOM   8889  N  NE1   . TRP C 2  726  ? -20.603 -8.182  8.604    1.00 66.52  ? 726  TRP C NE1   1 
ATOM   8890  C  CE2   . TRP C 2  726  ? -19.265 -8.445  8.474    1.00 59.90  ? 726  TRP C CE2   1 
ATOM   8891  C  CE3   . TRP C 2  726  ? -17.405 -7.658  7.148    1.00 53.96  ? 726  TRP C CE3   1 
ATOM   8892  C  CZ2   . TRP C 2  726  ? -18.460 -9.359  9.148    1.00 61.15  ? 726  TRP C CZ2   1 
ATOM   8893  C  CZ3   . TRP C 2  726  ? -16.606 -8.565  7.819    1.00 59.79  ? 726  TRP C CZ3   1 
ATOM   8894  C  CH2   . TRP C 2  726  ? -17.136 -9.403  8.808    1.00 72.78  ? 726  TRP C CH2   1 
ATOM   8895  N  N     . GLU C 2  727  ? -17.550 -3.519  7.777    1.00 51.41  ? 727  GLU C N     1 
ATOM   8896  C  CA    . GLU C 2  727  ? -16.177 -3.457  8.282    1.00 54.65  ? 727  GLU C CA    1 
ATOM   8897  C  C     . GLU C 2  727  ? -15.175 -3.035  7.209    1.00 68.55  ? 727  GLU C C     1 
ATOM   8898  O  O     . GLU C 2  727  ? -13.980 -3.327  7.319    1.00 86.35  ? 727  GLU C O     1 
ATOM   8899  C  CB    . GLU C 2  727  ? -15.763 -4.796  8.903    1.00 58.79  ? 727  GLU C CB    1 
ATOM   8900  C  CG    . GLU C 2  727  ? -16.808 -5.392  9.842    1.00 78.95  ? 727  GLU C CG    1 
ATOM   8901  C  CD    . GLU C 2  727  ? -16.746 -4.823  11.249   1.00 90.29  ? 727  GLU C CD    1 
ATOM   8902  O  OE1   . GLU C 2  727  ? -16.558 -5.612  12.199   1.00 88.35  ? 727  GLU C OE1   1 
ATOM   8903  O  OE2   . GLU C 2  727  ? -16.883 -3.591  11.407   1.00 80.34  ? 727  GLU C OE2   1 
ATOM   8904  N  N     . GLY C 2  728  ? -15.641 -2.354  6.163    1.00 66.08  ? 728  GLY C N     1 
ATOM   8905  C  CA    . GLY C 2  728  ? -14.767 -1.843  5.130    1.00 74.69  ? 728  GLY C CA    1 
ATOM   8906  C  C     . GLY C 2  728  ? -14.311 -2.845  4.092    1.00 74.78  ? 728  GLY C C     1 
ATOM   8907  O  O     . GLY C 2  728  ? -13.594 -2.457  3.161    1.00 74.65  ? 728  GLY C O     1 
ATOM   8908  N  N     . HIS C 2  729  ? -14.687 -4.120  4.216    1.00 67.08  ? 729  HIS C N     1 
ATOM   8909  C  CA    . HIS C 2  729  ? -14.290 -5.100  3.212    1.00 59.92  ? 729  HIS C CA    1 
ATOM   8910  C  C     . HIS C 2  729  ? -15.045 -4.932  1.898    1.00 64.63  ? 729  HIS C C     1 
ATOM   8911  O  O     . HIS C 2  729  ? -14.633 -5.513  0.889    1.00 85.83  ? 729  HIS C O     1 
ATOM   8912  C  CB    . HIS C 2  729  ? -14.477 -6.520  3.754    1.00 50.83  ? 729  HIS C CB    1 
ATOM   8913  C  CG    . HIS C 2  729  ? -13.394 -6.962  4.692    1.00 74.87  ? 729  HIS C CG    1 
ATOM   8914  N  ND1   . HIS C 2  729  ? -13.598 -7.126  6.045    1.00 97.41  ? 729  HIS C ND1   1 
ATOM   8915  C  CD2   . HIS C 2  729  ? -12.097 -7.283  4.467    1.00 83.07  ? 729  HIS C CD2   1 
ATOM   8916  C  CE1   . HIS C 2  729  ? -12.474 -7.526  6.614    1.00 96.94  ? 729  HIS C CE1   1 
ATOM   8917  N  NE2   . HIS C 2  729  ? -11.548 -7.628  5.678    1.00 102.73 ? 729  HIS C NE2   1 
ATOM   8918  N  N     . ASN C 2  730  ? -16.132 -4.159  1.885    1.00 57.11  ? 730  ASN C N     1 
ATOM   8919  C  CA    . ASN C 2  730  ? -16.825 -3.817  0.648    1.00 61.91  ? 730  ASN C CA    1 
ATOM   8920  C  C     . ASN C 2  730  ? -16.781 -2.306  0.450    1.00 74.39  ? 730  ASN C C     1 
ATOM   8921  O  O     . ASN C 2  730  ? -17.818 -1.636  0.440    1.00 71.60  ? 730  ASN C O     1 
ATOM   8922  C  CB    . ASN C 2  730  ? -18.269 -4.334  0.664    1.00 51.71  ? 730  ASN C CB    1 
ATOM   8923  C  CG    . ASN C 2  730  ? -19.030 -3.927  1.914    1.00 76.16  ? 730  ASN C CG    1 
ATOM   8924  O  OD1   . ASN C 2  730  ? -18.510 -3.211  2.770    1.00 78.49  ? 730  ASN C OD1   1 
ATOM   8925  N  ND2   . ASN C 2  730  ? -20.276 -4.377  2.018    1.00 81.89  ? 730  ASN C ND2   1 
ATOM   8926  N  N     . TYR C 2  731  ? -15.576 -1.766  0.294    1.00 80.76  ? 731  TYR C N     1 
ATOM   8927  C  CA    . TYR C 2  731  ? -15.344 -0.327  0.264    1.00 77.73  ? 731  TYR C CA    1 
ATOM   8928  C  C     . TYR C 2  731  ? -15.224 0.131   -1.185   1.00 77.44  ? 731  TYR C C     1 
ATOM   8929  O  O     . TYR C 2  731  ? -14.375 -0.371  -1.930   1.00 76.95  ? 731  TYR C O     1 
ATOM   8930  C  CB    . TYR C 2  731  ? -14.093 0.015   1.075    1.00 78.20  ? 731  TYR C CB    1 
ATOM   8931  C  CG    . TYR C 2  731  ? -13.590 1.435   0.946    1.00 73.99  ? 731  TYR C CG    1 
ATOM   8932  C  CD1   . TYR C 2  731  ? -14.355 2.512   1.374    1.00 67.25  ? 731  TYR C CD1   1 
ATOM   8933  C  CD2   . TYR C 2  731  ? -12.329 1.694   0.428    1.00 76.22  ? 731  TYR C CD2   1 
ATOM   8934  C  CE1   . TYR C 2  731  ? -13.883 3.808   1.265    1.00 75.19  ? 731  TYR C CE1   1 
ATOM   8935  C  CE2   . TYR C 2  731  ? -11.850 2.985   0.316    1.00 73.46  ? 731  TYR C CE2   1 
ATOM   8936  C  CZ    . TYR C 2  731  ? -12.631 4.038   0.735    1.00 74.05  ? 731  TYR C CZ    1 
ATOM   8937  O  OH    . TYR C 2  731  ? -12.161 5.326   0.627    1.00 87.99  ? 731  TYR C OH    1 
ATOM   8938  N  N     . GLU C 2  732  ? -16.062 1.101   -1.563   1.00 86.27  ? 732  GLU C N     1 
ATOM   8939  C  CA    . GLU C 2  732  ? -16.337 1.499   -2.945   1.00 123.57 ? 732  GLU C CA    1 
ATOM   8940  C  C     . GLU C 2  732  ? -16.241 0.347   -3.942   1.00 97.16  ? 732  GLU C C     1 
ATOM   8941  O  O     . GLU C 2  732  ? -15.188 0.117   -4.547   1.00 70.82  ? 732  GLU C O     1 
ATOM   8942  C  CB    . GLU C 2  732  ? -15.431 2.661   -3.387   1.00 111.77 ? 732  GLU C CB    1 
ATOM   8943  C  CG    . GLU C 2  732  ? -13.929 2.516   -3.186   1.00 89.76  ? 732  GLU C CG    1 
ATOM   8944  C  CD    . GLU C 2  732  ? -13.157 3.641   -3.859   1.00 94.10  ? 732  GLU C CD    1 
ATOM   8945  O  OE1   . GLU C 2  732  ? -13.806 4.554   -4.412   1.00 88.30  ? 732  GLU C OE1   1 
ATOM   8946  O  OE2   . GLU C 2  732  ? -11.909 3.613   -3.839   1.00 117.58 ? 732  GLU C OE2   1 
ATOM   8947  N  N     . ASP C 2  733  ? -17.347 -0.376  -4.113   1.00 103.01 ? 733  ASP C N     1 
ATOM   8948  C  CA    . ASP C 2  733  ? -17.606 -1.379  -5.148   1.00 80.53  ? 733  ASP C CA    1 
ATOM   8949  C  C     . ASP C 2  733  ? -16.937 -2.727  -4.892   1.00 69.47  ? 733  ASP C C     1 
ATOM   8950  O  O     . ASP C 2  733  ? -17.074 -3.621  -5.732   1.00 71.27  ? 733  ASP C O     1 
ATOM   8951  C  CB    . ASP C 2  733  ? -17.204 -0.888  -6.548   1.00 102.62 ? 733  ASP C CB    1 
ATOM   8952  C  CG    . ASP C 2  733  ? -17.793 0.468   -6.871   1.00 101.95 ? 733  ASP C CG    1 
ATOM   8953  O  OD1   . ASP C 2  733  ? -18.894 0.763   -6.362   1.00 93.72  ? 733  ASP C OD1   1 
ATOM   8954  O  OD2   . ASP C 2  733  ? -17.158 1.241   -7.619   1.00 108.54 ? 733  ASP C OD2   1 
ATOM   8955  N  N     . ALA C 2  734  ? -16.227 -2.915  -3.782   1.00 64.55  ? 734  ALA C N     1 
ATOM   8956  C  CA    . ALA C 2  734  ? -15.752 -4.249  -3.445   1.00 49.19  ? 734  ALA C CA    1 
ATOM   8957  C  C     . ALA C 2  734  ? -16.918 -5.112  -2.968   1.00 57.85  ? 734  ALA C C     1 
ATOM   8958  O  O     . ALA C 2  734  ? -17.973 -4.611  -2.572   1.00 70.54  ? 734  ALA C O     1 
ATOM   8959  C  CB    . ALA C 2  734  ? -14.663 -4.183  -2.375   1.00 51.39  ? 734  ALA C CB    1 
ATOM   8960  N  N     . ILE C 2  735  ? -16.721 -6.428  -3.010   1.00 50.62  ? 735  ILE C N     1 
ATOM   8961  C  CA    . ILE C 2  735  ? -17.788 -7.381  -2.727   1.00 53.91  ? 735  ILE C CA    1 
ATOM   8962  C  C     . ILE C 2  735  ? -17.312 -8.391  -1.692   1.00 54.68  ? 735  ILE C C     1 
ATOM   8963  O  O     . ILE C 2  735  ? -16.175 -8.874  -1.753   1.00 54.34  ? 735  ILE C O     1 
ATOM   8964  C  CB    . ILE C 2  735  ? -18.261 -8.097  -4.010   1.00 42.80  ? 735  ILE C CB    1 
ATOM   8965  C  CG1   . ILE C 2  735  ? -18.850 -7.083  -4.995   1.00 54.69  ? 735  ILE C CG1   1 
ATOM   8966  C  CG2   . ILE C 2  735  ? -19.282 -9.176  -3.684   1.00 37.14  ? 735  ILE C CG2   1 
ATOM   8967  C  CD1   . ILE C 2  735  ? -19.474 -7.711  -6.222   1.00 84.66  ? 735  ILE C CD1   1 
ATOM   8968  N  N     . ILE C 2  736  ? -18.190 -8.708  -0.742   1.00 55.72  ? 736  ILE C N     1 
ATOM   8969  C  CA    . ILE C 2  736  ? -17.946 -9.715  0.284    1.00 51.51  ? 736  ILE C CA    1 
ATOM   8970  C  C     . ILE C 2  736  ? -18.823 -10.921 -0.021   1.00 49.72  ? 736  ILE C C     1 
ATOM   8971  O  O     . ILE C 2  736  ? -20.026 -10.772 -0.267   1.00 55.48  ? 736  ILE C O     1 
ATOM   8972  C  CB    . ILE C 2  736  ? -18.243 -9.164  1.689    1.00 50.00  ? 736  ILE C CB    1 
ATOM   8973  C  CG1   . ILE C 2  736  ? -17.504 -7.842  1.911    1.00 54.36  ? 736  ILE C CG1   1 
ATOM   8974  C  CG2   . ILE C 2  736  ? -17.870 -10.186 2.748    1.00 57.75  ? 736  ILE C CG2   1 
ATOM   8975  C  CD1   . ILE C 2  736  ? -17.951 -7.098  3.147    1.00 69.33  ? 736  ILE C CD1   1 
ATOM   8976  N  N     . LEU C 2  737  ? -18.228 -12.113 0.001    1.00 47.93  ? 737  LEU C N     1 
ATOM   8977  C  CA    . LEU C 2  737  ? -18.930 -13.344 -0.333   1.00 48.42  ? 737  LEU C CA    1 
ATOM   8978  C  C     . LEU C 2  737  ? -18.921 -14.312 0.841    1.00 52.65  ? 737  LEU C C     1 
ATOM   8979  O  O     . LEU C 2  737  ? -17.940 -14.399 1.586    1.00 49.76  ? 737  LEU C O     1 
ATOM   8980  C  CB    . LEU C 2  737  ? -18.306 -14.033 -1.553   1.00 60.90  ? 737  LEU C CB    1 
ATOM   8981  C  CG    . LEU C 2  737  ? -18.655 -13.472 -2.930   1.00 58.21  ? 737  LEU C CG    1 
ATOM   8982  C  CD1   . LEU C 2  737  ? -18.276 -14.472 -4.008   1.00 40.58  ? 737  LEU C CD1   1 
ATOM   8983  C  CD2   . LEU C 2  737  ? -20.129 -13.110 -3.018   1.00 49.00  ? 737  LEU C CD2   1 
ATOM   8984  N  N     . SER C 2  738  ? -20.023 -15.042 0.997    1.00 55.86  ? 738  SER C N     1 
ATOM   8985  C  CA    . SER C 2  738  ? -20.060 -16.152 1.936    1.00 67.43  ? 738  SER C CA    1 
ATOM   8986  C  C     . SER C 2  738  ? -19.267 -17.324 1.372    1.00 53.50  ? 738  SER C C     1 
ATOM   8987  O  O     . SER C 2  738  ? -19.379 -17.646 0.185    1.00 64.56  ? 738  SER C O     1 
ATOM   8988  C  CB    . SER C 2  738  ? -21.506 -16.568 2.211    1.00 67.56  ? 738  SER C CB    1 
ATOM   8989  O  OG    . SER C 2  738  ? -21.567 -17.829 2.853    1.00 59.15  ? 738  SER C OG    1 
ATOM   8990  N  N     . ASN C 2  739  ? -18.464 -17.967 2.224    1.00 44.94  ? 739  ASN C N     1 
ATOM   8991  C  CA    . ASN C 2  739  ? -17.673 -19.113 1.787    1.00 45.63  ? 739  ASN C CA    1 
ATOM   8992  C  C     . ASN C 2  739  ? -18.539 -20.282 1.335    1.00 54.58  ? 739  ASN C C     1 
ATOM   8993  O  O     . ASN C 2  739  ? -18.005 -21.245 0.773    1.00 63.17  ? 739  ASN C O     1 
ATOM   8994  C  CB    . ASN C 2  739  ? -16.734 -19.565 2.910    1.00 73.32  ? 739  ASN C CB    1 
ATOM   8995  C  CG    . ASN C 2  739  ? -15.558 -20.378 2.398    1.00 64.81  ? 739  ASN C CG    1 
ATOM   8996  O  OD1   . ASN C 2  739  ? -15.606 -21.608 2.357    1.00 67.08  ? 739  ASN C OD1   1 
ATOM   8997  N  ND2   . ASN C 2  739  ? -14.491 -19.691 2.006    1.00 67.45  ? 739  ASN C ND2   1 
ATOM   8998  N  N     . ARG C 2  740  ? -19.852 -20.221 1.574    1.00 50.82  ? 740  ARG C N     1 
ATOM   8999  C  CA    . ARG C 2  740  ? -20.760 -21.235 1.050    1.00 58.90  ? 740  ARG C CA    1 
ATOM   9000  C  C     . ARG C 2  740  ? -20.659 -21.335 -0.467   1.00 66.82  ? 740  ARG C C     1 
ATOM   9001  O  O     . ARG C 2  740  ? -20.756 -22.431 -1.033   1.00 76.78  ? 740  ARG C O     1 
ATOM   9002  C  CB    . ARG C 2  740  ? -22.196 -20.912 1.465    1.00 65.46  ? 740  ARG C CB    1 
ATOM   9003  C  CG    . ARG C 2  740  ? -23.215 -21.955 1.041    1.00 67.31  ? 740  ARG C CG    1 
ATOM   9004  C  CD    . ARG C 2  740  ? -24.636 -21.425 1.148    1.00 73.80  ? 740  ARG C CD    1 
ATOM   9005  N  NE    . ARG C 2  740  ? -24.953 -20.475 0.084    1.00 72.13  ? 740  ARG C NE    1 
ATOM   9006  C  CZ    . ARG C 2  740  ? -25.529 -20.810 -1.068   1.00 73.28  ? 740  ARG C CZ    1 
ATOM   9007  N  NH1   . ARG C 2  740  ? -25.852 -22.074 -1.305   1.00 59.88  ? 740  ARG C NH1   1 
ATOM   9008  N  NH2   . ARG C 2  740  ? -25.783 -19.884 -1.982   1.00 88.14  ? 740  ARG C NH2   1 
ATOM   9009  N  N     . LEU C 2  741  ? -20.462 -20.200 -1.143   1.00 58.32  ? 741  LEU C N     1 
ATOM   9010  C  CA    . LEU C 2  741  ? -20.316 -20.213 -2.594   1.00 63.22  ? 741  LEU C CA    1 
ATOM   9011  C  C     . LEU C 2  741  ? -19.068 -20.963 -3.037   1.00 62.63  ? 741  LEU C C     1 
ATOM   9012  O  O     . LEU C 2  741  ? -18.993 -21.395 -4.193   1.00 65.78  ? 741  LEU C O     1 
ATOM   9013  C  CB    . LEU C 2  741  ? -20.286 -18.781 -3.130   1.00 53.74  ? 741  LEU C CB    1 
ATOM   9014  C  CG    . LEU C 2  741  ? -21.411 -17.863 -2.646   1.00 49.48  ? 741  LEU C CG    1 
ATOM   9015  C  CD1   . LEU C 2  741  ? -21.326 -16.508 -3.326   1.00 37.36  ? 741  LEU C CD1   1 
ATOM   9016  C  CD2   . LEU C 2  741  ? -22.777 -18.495 -2.871   1.00 60.55  ? 741  LEU C CD2   1 
ATOM   9017  N  N     . VAL C 2  742  ? -18.090 -21.125 -2.150   1.00 54.62  ? 742  VAL C N     1 
ATOM   9018  C  CA    . VAL C 2  742  ? -16.906 -21.924 -2.447   1.00 54.77  ? 742  VAL C CA    1 
ATOM   9019  C  C     . VAL C 2  742  ? -17.127 -23.387 -2.092   1.00 57.44  ? 742  VAL C C     1 
ATOM   9020  O  O     . VAL C 2  742  ? -16.817 -24.283 -2.882   1.00 72.53  ? 742  VAL C O     1 
ATOM   9021  C  CB    . VAL C 2  742  ? -15.681 -21.348 -1.704   1.00 59.58  ? 742  VAL C CB    1 
ATOM   9022  C  CG1   . VAL C 2  742  ? -14.451 -22.199 -1.972   1.00 54.20  ? 742  VAL C CG1   1 
ATOM   9023  C  CG2   . VAL C 2  742  ? -15.439 -19.906 -2.112   1.00 56.28  ? 742  VAL C CG2   1 
ATOM   9024  N  N     . GLU C 2  743  ? -17.673 -23.645 -0.899   1.00 55.01  ? 743  GLU C N     1 
ATOM   9025  C  CA    . GLU C 2  743  ? -17.875 -25.019 -0.449   1.00 65.54  ? 743  GLU C CA    1 
ATOM   9026  C  C     . GLU C 2  743  ? -18.849 -25.776 -1.341   1.00 64.77  ? 743  GLU C C     1 
ATOM   9027  O  O     . GLU C 2  743  ? -18.719 -26.995 -1.506   1.00 63.03  ? 743  GLU C O     1 
ATOM   9028  C  CB    . GLU C 2  743  ? -18.379 -25.032 0.996    1.00 78.63  ? 743  GLU C CB    1 
ATOM   9029  C  CG    . GLU C 2  743  ? -17.464 -24.347 1.993    1.00 84.32  ? 743  GLU C CG    1 
ATOM   9030  C  CD    . GLU C 2  743  ? -17.996 -24.422 3.412    1.00 86.92  ? 743  GLU C CD    1 
ATOM   9031  O  OE1   . GLU C 2  743  ? -18.931 -25.213 3.658    1.00 76.10  ? 743  GLU C OE1   1 
ATOM   9032  O  OE2   . GLU C 2  743  ? -17.480 -23.688 4.281    1.00 94.08  ? 743  GLU C OE2   1 
ATOM   9033  N  N     . GLU C 2  744  ? -19.826 -25.082 -1.923   1.00 57.03  ? 744  GLU C N     1 
ATOM   9034  C  CA    . GLU C 2  744  ? -20.880 -25.722 -2.699   1.00 65.00  ? 744  GLU C CA    1 
ATOM   9035  C  C     . GLU C 2  744  ? -20.764 -25.458 -4.196   1.00 69.30  ? 744  GLU C C     1 
ATOM   9036  O  O     . GLU C 2  744  ? -21.724 -25.714 -4.933   1.00 81.11  ? 744  GLU C O     1 
ATOM   9037  C  CB    . GLU C 2  744  ? -22.251 -25.276 -2.184   1.00 51.65  ? 744  GLU C CB    1 
ATOM   9038  C  CG    . GLU C 2  744  ? -22.495 -25.633 -0.722   1.00 69.45  ? 744  GLU C CG    1 
ATOM   9039  C  CD    . GLU C 2  744  ? -23.823 -25.118 -0.201   1.00 92.95  ? 744  GLU C CD    1 
ATOM   9040  O  OE1   . GLU C 2  744  ? -24.489 -24.346 -0.921   1.00 90.55  ? 744  GLU C OE1   1 
ATOM   9041  O  OE2   . GLU C 2  744  ? -24.199 -25.486 0.933    1.00 100.76 ? 744  GLU C OE2   1 
ATOM   9042  N  N     . ASP C 2  745  ? -19.616 -24.960 -4.662   1.00 63.07  ? 745  ASP C N     1 
ATOM   9043  C  CA    . ASP C 2  745  ? -19.355 -24.772 -6.092   1.00 73.56  ? 745  ASP C CA    1 
ATOM   9044  C  C     . ASP C 2  745  ? -20.437 -23.927 -6.759   1.00 70.07  ? 745  ASP C C     1 
ATOM   9045  O  O     . ASP C 2  745  ? -20.820 -24.161 -7.908   1.00 70.73  ? 745  ASP C O     1 
ATOM   9046  C  CB    . ASP C 2  745  ? -19.205 -26.117 -6.805   1.00 87.44  ? 745  ASP C CB    1 
ATOM   9047  C  CG    . ASP C 2  745  ? -17.908 -26.813 -6.461   1.00 90.89  ? 745  ASP C CG    1 
ATOM   9048  O  OD1   . ASP C 2  745  ? -16.892 -26.110 -6.276   1.00 83.20  ? 745  ASP C OD1   1 
ATOM   9049  O  OD2   . ASP C 2  745  ? -17.905 -28.059 -6.372   1.00 84.27  ? 745  ASP C OD2   1 
ATOM   9050  N  N     . VAL C 2  746  ? -20.936 -22.929 -6.028   1.00 67.20  ? 746  VAL C N     1 
ATOM   9051  C  CA    . VAL C 2  746  ? -21.990 -22.079 -6.570   1.00 62.85  ? 746  VAL C CA    1 
ATOM   9052  C  C     . VAL C 2  746  ? -21.442 -21.191 -7.681   1.00 63.18  ? 746  VAL C C     1 
ATOM   9053  O  O     . VAL C 2  746  ? -22.067 -21.039 -8.737   1.00 63.54  ? 746  VAL C O     1 
ATOM   9054  C  CB    . VAL C 2  746  ? -22.643 -21.250 -5.450   1.00 50.11  ? 746  VAL C CB    1 
ATOM   9055  C  CG1   . VAL C 2  746  ? -23.878 -20.536 -5.976   1.00 66.66  ? 746  VAL C CG1   1 
ATOM   9056  C  CG2   . VAL C 2  746  ? -22.992 -22.137 -4.261   1.00 70.09  ? 746  VAL C CG2   1 
ATOM   9057  N  N     . LEU C 2  747  ? -20.269 -20.593 -7.465   1.00 59.20  ? 747  LEU C N     1 
ATOM   9058  C  CA    . LEU C 2  747  ? -19.604 -19.771 -8.468   1.00 59.51  ? 747  LEU C CA    1 
ATOM   9059  C  C     . LEU C 2  747  ? -18.342 -20.443 -9.003   1.00 66.40  ? 747  LEU C C     1 
ATOM   9060  O  O     . LEU C 2  747  ? -17.368 -19.769 -9.348   1.00 83.17  ? 747  LEU C O     1 
ATOM   9061  C  CB    . LEU C 2  747  ? -19.275 -18.390 -7.904   1.00 57.72  ? 747  LEU C CB    1 
ATOM   9062  C  CG    . LEU C 2  747  ? -20.471 -17.553 -7.450   1.00 47.02  ? 747  LEU C CG    1 
ATOM   9063  C  CD1   . LEU C 2  747  ? -20.027 -16.172 -6.996   1.00 44.09  ? 747  LEU C CD1   1 
ATOM   9064  C  CD2   . LEU C 2  747  ? -21.503 -17.453 -8.561   1.00 36.47  ? 747  LEU C CD2   1 
ATOM   9065  N  N     . THR C 2  748  ? -18.349 -21.771 -9.070   1.00 56.46  ? 748  THR C N     1 
ATOM   9066  C  CA    . THR C 2  748  ? -17.247 -22.529 -9.641   1.00 66.16  ? 748  THR C CA    1 
ATOM   9067  C  C     . THR C 2  748  ? -17.486 -22.743 -11.130  1.00 64.72  ? 748  THR C C     1 
ATOM   9068  O  O     . THR C 2  748  ? -18.597 -23.074 -11.552  1.00 68.80  ? 748  THR C O     1 
ATOM   9069  C  CB    . THR C 2  748  ? -17.092 -23.876 -8.930   1.00 71.90  ? 748  THR C CB    1 
ATOM   9070  O  OG1   . THR C 2  748  ? -16.731 -23.655 -7.561   1.00 64.89  ? 748  THR C OG1   1 
ATOM   9071  C  CG2   . THR C 2  748  ? -16.017 -24.721 -9.594   1.00 80.64  ? 748  THR C CG2   1 
ATOM   9072  N  N     . SER C 2  749  ? -16.436 -22.542 -11.925  1.00 59.81  ? 749  SER C N     1 
ATOM   9073  C  CA    . SER C 2  749  ? -16.522 -22.637 -13.373  1.00 73.12  ? 749  SER C CA    1 
ATOM   9074  C  C     . SER C 2  749  ? -15.353 -23.443 -13.919  1.00 74.55  ? 749  SER C C     1 
ATOM   9075  O  O     . SER C 2  749  ? -14.251 -23.426 -13.364  1.00 73.66  ? 749  SER C O     1 
ATOM   9076  C  CB    . SER C 2  749  ? -16.535 -21.250 -14.022  1.00 62.82  ? 749  SER C CB    1 
ATOM   9077  O  OG    . SER C 2  749  ? -15.377 -20.515 -13.668  1.00 51.93  ? 749  SER C OG    1 
ATOM   9078  N  N     . ILE C 2  750  ? -15.607 -24.143 -15.020  1.00 65.35  ? 750  ILE C N     1 
ATOM   9079  C  CA    . ILE C 2  750  ? -14.594 -24.945 -15.696  1.00 57.47  ? 750  ILE C CA    1 
ATOM   9080  C  C     . ILE C 2  750  ? -13.959 -24.109 -16.796  1.00 61.34  ? 750  ILE C C     1 
ATOM   9081  O  O     . ILE C 2  750  ? -14.647 -23.386 -17.527  1.00 69.06  ? 750  ILE C O     1 
ATOM   9082  C  CB    . ILE C 2  750  ? -15.205 -26.240 -16.263  1.00 54.24  ? 750  ILE C CB    1 
ATOM   9083  C  CG1   . ILE C 2  750  ? -15.920 -27.027 -15.164  1.00 64.76  ? 750  ILE C CG1   1 
ATOM   9084  C  CG2   . ILE C 2  750  ? -14.133 -27.099 -16.922  1.00 49.66  ? 750  ILE C CG2   1 
ATOM   9085  C  CD1   . ILE C 2  750  ? -16.551 -28.319 -15.651  1.00 50.86  ? 750  ILE C CD1   1 
ATOM   9086  N  N     . HIS C 2  751  ? -12.638 -24.202 -16.910  1.00 59.17  ? 751  HIS C N     1 
ATOM   9087  C  CA    . HIS C 2  751  ? -11.884 -23.513 -17.946  1.00 64.67  ? 751  HIS C CA    1 
ATOM   9088  C  C     . HIS C 2  751  ? -10.927 -24.498 -18.596  1.00 65.37  ? 751  HIS C C     1 
ATOM   9089  O  O     . HIS C 2  751  ? -10.358 -25.361 -17.921  1.00 86.59  ? 751  HIS C O     1 
ATOM   9090  C  CB    . HIS C 2  751  ? -11.112 -22.321 -17.374  1.00 60.98  ? 751  HIS C CB    1 
ATOM   9091  C  CG    . HIS C 2  751  ? -11.984 -21.293 -16.723  1.00 61.87  ? 751  HIS C CG    1 
ATOM   9092  N  ND1   . HIS C 2  751  ? -12.193 -20.043 -17.265  1.00 74.90  ? 751  HIS C ND1   1 
ATOM   9093  C  CD2   . HIS C 2  751  ? -12.703 -21.330 -15.576  1.00 58.14  ? 751  HIS C CD2   1 
ATOM   9094  C  CE1   . HIS C 2  751  ? -13.000 -19.354 -16.478  1.00 71.32  ? 751  HIS C CE1   1 
ATOM   9095  N  NE2   . HIS C 2  751  ? -13.324 -20.112 -15.446  1.00 66.90  ? 751  HIS C NE2   1 
ATOM   9096  N  N     . ILE C 2  752  ? -10.755 -24.370 -19.909  1.00 54.38  ? 752  ILE C N     1 
ATOM   9097  C  CA    . ILE C 2  752  ? -9.934  -25.286 -20.689  1.00 62.59  ? 752  ILE C CA    1 
ATOM   9098  C  C     . ILE C 2  752  ? -8.943  -24.473 -21.508  1.00 70.76  ? 752  ILE C C     1 
ATOM   9099  O  O     . ILE C 2  752  ? -9.332  -23.530 -22.205  1.00 74.28  ? 752  ILE C O     1 
ATOM   9100  C  CB    . ILE C 2  752  ? -10.788 -26.180 -21.609  1.00 53.58  ? 752  ILE C CB    1 
ATOM   9101  C  CG1   . ILE C 2  752  ? -11.854 -26.926 -20.802  1.00 59.57  ? 752  ILE C CG1   1 
ATOM   9102  C  CG2   . ILE C 2  752  ? -9.909  -27.170 -22.353  1.00 48.42  ? 752  ILE C CG2   1 
ATOM   9103  C  CD1   . ILE C 2  752  ? -12.803 -27.748 -21.655  1.00 55.45  ? 752  ILE C CD1   1 
ATOM   9104  N  N     . GLU C 2  753  ? -7.667  -24.838 -21.421  1.00 78.67  ? 753  GLU C N     1 
ATOM   9105  C  CA    . GLU C 2  753  ? -6.607  -24.228 -22.206  1.00 68.76  ? 753  GLU C CA    1 
ATOM   9106  C  C     . GLU C 2  753  ? -6.056  -25.240 -23.201  1.00 71.97  ? 753  GLU C C     1 
ATOM   9107  O  O     . GLU C 2  753  ? -6.018  -26.444 -22.930  1.00 77.22  ? 753  GLU C O     1 
ATOM   9108  C  CB    . GLU C 2  753  ? -5.476  -23.716 -21.308  1.00 99.39  ? 753  GLU C CB    1 
ATOM   9109  C  CG    . GLU C 2  753  ? -5.917  -22.704 -20.261  1.00 132.26 ? 753  GLU C CG    1 
ATOM   9110  C  CD    . GLU C 2  753  ? -6.370  -21.389 -20.869  1.00 154.87 ? 753  GLU C CD    1 
ATOM   9111  O  OE1   . GLU C 2  753  ? -5.953  -21.079 -22.005  1.00 150.21 ? 753  GLU C OE1   1 
ATOM   9112  O  OE2   . GLU C 2  753  ? -7.145  -20.664 -20.207  1.00 148.69 ? 753  GLU C OE2   1 
ATOM   9113  N  N     . GLU C 2  754  ? -5.631  -24.741 -24.359  1.00 79.63  ? 754  GLU C N     1 
ATOM   9114  C  CA    . GLU C 2  754  ? -5.037  -25.567 -25.402  1.00 81.05  ? 754  GLU C CA    1 
ATOM   9115  C  C     . GLU C 2  754  ? -3.537  -25.313 -25.456  1.00 74.76  ? 754  GLU C C     1 
ATOM   9116  O  O     . GLU C 2  754  ? -3.102  -24.165 -25.594  1.00 93.97  ? 754  GLU C O     1 
ATOM   9117  C  CB    . GLU C 2  754  ? -5.666  -25.279 -26.768  1.00 91.91  ? 754  GLU C CB    1 
ATOM   9118  C  CG    . GLU C 2  754  ? -5.182  -26.219 -27.864  1.00 87.36  ? 754  GLU C CG    1 
ATOM   9119  C  CD    . GLU C 2  754  ? -5.839  -25.954 -29.203  1.00 94.37  ? 754  GLU C CD    1 
ATOM   9120  O  OE1   . GLU C 2  754  ? -5.352  -25.074 -29.943  1.00 113.62 ? 754  GLU C OE1   1 
ATOM   9121  O  OE2   . GLU C 2  754  ? -6.848  -26.623 -29.512  1.00 92.10  ? 754  GLU C OE2   1 
ATOM   9122  N  N     . HIS C 2  755  ? -2.757  -26.384 -25.344  1.00 48.23  ? 755  HIS C N     1 
ATOM   9123  C  CA    . HIS C 2  755  ? -1.309  -26.323 -25.454  1.00 64.23  ? 755  HIS C CA    1 
ATOM   9124  C  C     . HIS C 2  755  ? -0.861  -27.166 -26.641  1.00 81.37  ? 755  HIS C C     1 
ATOM   9125  O  O     . HIS C 2  755  ? -1.452  -28.207 -26.942  1.00 81.44  ? 755  HIS C O     1 
ATOM   9126  C  CB    . HIS C 2  755  ? -0.634  -26.796 -24.161  1.00 61.90  ? 755  HIS C CB    1 
ATOM   9127  C  CG    . HIS C 2  755  ? -0.969  -25.954 -22.969  1.00 64.73  ? 755  HIS C CG    1 
ATOM   9128  N  ND1   . HIS C 2  755  ? -1.941  -26.306 -22.057  1.00 81.61  ? 755  HIS C ND1   1 
ATOM   9129  C  CD2   . HIS C 2  755  ? -0.473  -24.765 -22.550  1.00 85.40  ? 755  HIS C CD2   1 
ATOM   9130  C  CE1   . HIS C 2  755  ? -2.022  -25.376 -21.122  1.00 91.80  ? 755  HIS C CE1   1 
ATOM   9131  N  NE2   . HIS C 2  755  ? -1.143  -24.429 -21.399  1.00 103.72 ? 755  HIS C NE2   1 
ATOM   9132  N  N     . GLU C 2  756  ? 0.187   -26.702 -27.317  1.00 84.45  ? 756  GLU C N     1 
ATOM   9133  C  CA    . GLU C 2  756  ? 0.550   -27.241 -28.619  1.00 70.08  ? 756  GLU C CA    1 
ATOM   9134  C  C     . GLU C 2  756  ? 2.056   -27.151 -28.811  1.00 67.05  ? 756  GLU C C     1 
ATOM   9135  O  O     . GLU C 2  756  ? 2.689   -26.189 -28.370  1.00 55.38  ? 756  GLU C O     1 
ATOM   9136  C  CB    . GLU C 2  756  ? -0.176  -26.478 -29.733  1.00 86.54  ? 756  GLU C CB    1 
ATOM   9137  C  CG    . GLU C 2  756  ? -0.012  -27.056 -31.123  1.00 102.54 ? 756  GLU C CG    1 
ATOM   9138  C  CD    . GLU C 2  756  ? -0.702  -26.209 -32.172  1.00 112.98 ? 756  GLU C CD    1 
ATOM   9139  O  OE1   . GLU C 2  756  ? -0.857  -24.992 -31.940  1.00 123.78 ? 756  GLU C OE1   1 
ATOM   9140  O  OE2   . GLU C 2  756  ? -1.097  -26.759 -33.221  1.00 109.64 ? 756  GLU C OE2   1 
ATOM   9141  N  N     . ILE C 2  757  ? 2.621   -28.165 -29.467  1.00 70.99  ? 757  ILE C N     1 
ATOM   9142  C  CA    . ILE C 2  757  ? 4.029   -28.159 -29.849  1.00 71.71  ? 757  ILE C CA    1 
ATOM   9143  C  C     . ILE C 2  757  ? 4.193   -29.135 -31.003  1.00 81.34  ? 757  ILE C C     1 
ATOM   9144  O  O     . ILE C 2  757  ? 3.401   -30.065 -31.168  1.00 74.86  ? 757  ILE C O     1 
ATOM   9145  C  CB    . ILE C 2  757  ? 4.951   -28.517 -28.653  1.00 51.26  ? 757  ILE C CB    1 
ATOM   9146  C  CG1   . ILE C 2  757  ? 6.394   -28.097 -28.943  1.00 68.35  ? 757  ILE C CG1   1 
ATOM   9147  C  CG2   . ILE C 2  757  ? 4.884   -30.002 -28.341  1.00 50.83  ? 757  ILE C CG2   1 
ATOM   9148  C  CD1   . ILE C 2  757  ? 7.350   -28.349 -27.795  1.00 85.75  ? 757  ILE C CD1   1 
ATOM   9149  N  N     . ASP C 2  758  ? 5.221   -28.916 -31.819  1.00 85.33  ? 758  ASP C N     1 
ATOM   9150  C  CA    . ASP C 2  758  ? 5.450   -29.719 -33.009  1.00 89.56  ? 758  ASP C CA    1 
ATOM   9151  C  C     . ASP C 2  758  ? 6.917   -30.120 -33.096  1.00 91.28  ? 758  ASP C C     1 
ATOM   9152  O  O     . ASP C 2  758  ? 7.797   -29.478 -32.516  1.00 78.65  ? 758  ASP C O     1 
ATOM   9153  C  CB    . ASP C 2  758  ? 5.027   -28.966 -34.280  1.00 86.95  ? 758  ASP C CB    1 
ATOM   9154  C  CG    . ASP C 2  758  ? 5.514   -27.530 -34.297  1.00 99.51  ? 758  ASP C CG    1 
ATOM   9155  O  OD1   . ASP C 2  758  ? 6.744   -27.317 -34.275  1.00 111.18 ? 758  ASP C OD1   1 
ATOM   9156  O  OD2   . ASP C 2  758  ? 4.666   -26.612 -34.336  1.00 94.46  ? 758  ASP C OD2   1 
ATOM   9157  N  N     . ALA C 2  759  ? 7.167   -31.201 -33.832  1.00 77.33  ? 759  ALA C N     1 
ATOM   9158  C  CA    . ALA C 2  759  ? 8.509   -31.734 -34.045  1.00 89.73  ? 759  ALA C CA    1 
ATOM   9159  C  C     . ALA C 2  759  ? 8.890   -31.490 -35.500  1.00 100.43 ? 759  ALA C C     1 
ATOM   9160  O  O     . ALA C 2  759  ? 8.290   -32.072 -36.411  1.00 99.58  ? 759  ALA C O     1 
ATOM   9161  C  CB    . ALA C 2  759  ? 8.566   -33.220 -33.698  1.00 85.42  ? 759  ALA C CB    1 
ATOM   9162  N  N     . ARG C 2  760  ? 9.889   -30.638 -35.716  1.00 106.23 ? 760  ARG C N     1 
ATOM   9163  C  CA    . ARG C 2  760  ? 10.274  -30.210 -37.050  1.00 99.69  ? 760  ARG C CA    1 
ATOM   9164  C  C     . ARG C 2  760  ? 11.553  -30.907 -37.507  1.00 102.92 ? 760  ARG C C     1 
ATOM   9165  O  O     . ARG C 2  760  ? 12.172  -31.687 -36.780  1.00 99.17  ? 760  ARG C O     1 
ATOM   9166  C  CB    . ARG C 2  760  ? 10.458  -28.692 -37.097  1.00 90.43  ? 760  ARG C CB    1 
ATOM   9167  C  CG    . ARG C 2  760  ? 9.172   -27.899 -37.018  1.00 99.38  ? 760  ARG C CG    1 
ATOM   9168  C  CD    . ARG C 2  760  ? 9.377   -26.492 -37.550  1.00 100.19 ? 760  ARG C CD    1 
ATOM   9169  N  NE    . ARG C 2  760  ? 8.155   -25.701 -37.467  1.00 93.79  ? 760  ARG C NE    1 
ATOM   9170  C  CZ    . ARG C 2  760  ? 7.827   -24.946 -36.425  1.00 109.04 ? 760  ARG C CZ    1 
ATOM   9171  N  NH1   . ARG C 2  760  ? 8.633   -24.875 -35.374  1.00 129.51 ? 760  ARG C NH1   1 
ATOM   9172  N  NH2   . ARG C 2  760  ? 6.693   -24.261 -36.434  1.00 115.97 ? 760  ARG C NH2   1 
ATOM   9173  N  N     . ASP C 2  761  ? 11.941  -30.615 -38.746  1.00 110.50 ? 761  ASP C N     1 
ATOM   9174  C  CA    . ASP C 2  761  ? 13.228  -31.016 -39.294  1.00 107.10 ? 761  ASP C CA    1 
ATOM   9175  C  C     . ASP C 2  761  ? 14.181  -29.834 -39.167  1.00 99.61  ? 761  ASP C C     1 
ATOM   9176  O  O     . ASP C 2  761  ? 13.884  -28.739 -39.658  1.00 106.23 ? 761  ASP C O     1 
ATOM   9177  C  CB    . ASP C 2  761  ? 13.095  -31.442 -40.758  1.00 99.09  ? 761  ASP C CB    1 
ATOM   9178  C  CG    . ASP C 2  761  ? 12.117  -32.586 -40.950  1.00 117.61 ? 761  ASP C CG    1 
ATOM   9179  O  OD1   . ASP C 2  761  ? 10.944  -32.445 -40.547  1.00 137.61 ? 761  ASP C OD1   1 
ATOM   9180  O  OD2   . ASP C 2  761  ? 12.521  -33.623 -41.517  1.00 96.55  ? 761  ASP C OD2   1 
ATOM   9181  N  N     . THR C 2  762  ? 15.312  -30.047 -38.506  1.00 84.20  ? 762  THR C N     1 
ATOM   9182  C  CA    . THR C 2  762  ? 16.299  -28.998 -38.304  1.00 107.75 ? 762  THR C CA    1 
ATOM   9183  C  C     . THR C 2  762  ? 17.512  -29.248 -39.195  1.00 119.91 ? 762  THR C C     1 
ATOM   9184  O  O     . THR C 2  762  ? 17.603  -30.258 -39.899  1.00 112.40 ? 762  THR C O     1 
ATOM   9185  C  CB    . THR C 2  762  ? 16.700  -28.911 -36.830  1.00 96.50  ? 762  THR C CB    1 
ATOM   9186  O  OG1   . THR C 2  762  ? 17.705  -27.900 -36.665  1.00 123.56 ? 762  THR C OG1   1 
ATOM   9187  C  CG2   . THR C 2  762  ? 17.246  -30.237 -36.360  1.00 86.67  ? 762  THR C CG2   1 
ATOM   9188  N  N     . LYS C 2  763  ? 18.456  -28.305 -39.155  1.00 125.44 ? 763  LYS C N     1 
ATOM   9189  C  CA    . LYS C 2  763  ? 19.638  -28.398 -40.005  1.00 107.74 ? 763  LYS C CA    1 
ATOM   9190  C  C     . LYS C 2  763  ? 20.539  -29.559 -39.604  1.00 98.95  ? 763  LYS C C     1 
ATOM   9191  O  O     . LYS C 2  763  ? 21.224  -30.132 -40.458  1.00 96.50  ? 763  LYS C O     1 
ATOM   9192  C  CB    . LYS C 2  763  ? 20.418  -27.084 -39.959  1.00 124.48 ? 763  LYS C CB    1 
ATOM   9193  C  CG    . LYS C 2  763  ? 19.644  -25.898 -40.504  1.00 120.60 ? 763  LYS C CG    1 
ATOM   9194  C  CD    . LYS C 2  763  ? 19.527  -25.980 -42.015  1.00 149.20 ? 763  LYS C CD    1 
ATOM   9195  C  CE    . LYS C 2  763  ? 18.343  -25.179 -42.525  1.00 142.66 ? 763  LYS C CE    1 
ATOM   9196  N  NZ    . LYS C 2  763  ? 17.051  -25.810 -42.136  1.00 135.08 ? 763  LYS C NZ    1 
ATOM   9197  N  N     . LEU C 2  764  ? 20.551  -29.921 -38.323  1.00 108.07 ? 764  LEU C N     1 
ATOM   9198  C  CA    . LEU C 2  764  ? 21.432  -30.962 -37.817  1.00 107.18 ? 764  LEU C CA    1 
ATOM   9199  C  C     . LEU C 2  764  ? 20.699  -32.265 -37.528  1.00 110.19 ? 764  LEU C C     1 
ATOM   9200  O  O     . LEU C 2  764  ? 21.269  -33.158 -36.894  1.00 116.76 ? 764  LEU C O     1 
ATOM   9201  C  CB    . LEU C 2  764  ? 22.149  -30.473 -36.557  1.00 95.70  ? 764  LEU C CB    1 
ATOM   9202  C  CG    . LEU C 2  764  ? 22.733  -29.062 -36.648  1.00 105.52 ? 764  LEU C CG    1 
ATOM   9203  C  CD1   . LEU C 2  764  ? 21.867  -28.061 -35.892  1.00 99.08  ? 764  LEU C CD1   1 
ATOM   9204  C  CD2   . LEU C 2  764  ? 24.164  -29.033 -36.145  1.00 94.66  ? 764  LEU C CD2   1 
ATOM   9205  N  N     . GLY C 2  765  ? 19.456  -32.397 -37.982  1.00 127.09 ? 765  GLY C N     1 
ATOM   9206  C  CA    . GLY C 2  765  ? 18.691  -33.604 -37.746  1.00 121.36 ? 765  GLY C CA    1 
ATOM   9207  C  C     . GLY C 2  765  ? 17.200  -33.349 -37.751  1.00 107.46 ? 765  GLY C C     1 
ATOM   9208  O  O     . GLY C 2  765  ? 16.684  -32.664 -38.639  1.00 102.56 ? 765  GLY C O     1 
ATOM   9209  N  N     . ALA C 2  766  ? 16.495  -33.885 -36.758  1.00 94.29  ? 766  ALA C N     1 
ATOM   9210  C  CA    . ALA C 2  766  ? 15.057  -33.689 -36.657  1.00 107.10 ? 766  ALA C CA    1 
ATOM   9211  C  C     . ALA C 2  766  ? 14.657  -33.664 -35.192  1.00 98.66  ? 766  ALA C C     1 
ATOM   9212  O  O     . ALA C 2  766  ? 15.092  -34.519 -34.415  1.00 101.88 ? 766  ALA C O     1 
ATOM   9213  C  CB    . ALA C 2  766  ? 14.294  -34.792 -37.399  1.00 119.06 ? 766  ALA C CB    1 
ATOM   9214  N  N     . GLU C 2  767  ? 13.846  -32.674 -34.820  1.00 99.74  ? 767  GLU C N     1 
ATOM   9215  C  CA    . GLU C 2  767  ? 13.241  -32.666 -33.497  1.00 92.54  ? 767  GLU C CA    1 
ATOM   9216  C  C     . GLU C 2  767  ? 12.396  -33.919 -33.324  1.00 104.78 ? 767  GLU C C     1 
ATOM   9217  O  O     . GLU C 2  767  ? 11.581  -34.255 -34.188  1.00 101.64 ? 767  GLU C O     1 
ATOM   9218  C  CB    . GLU C 2  767  ? 12.375  -31.419 -33.309  1.00 85.46  ? 767  GLU C CB    1 
ATOM   9219  C  CG    . GLU C 2  767  ? 13.068  -30.103 -33.621  1.00 90.61  ? 767  GLU C CG    1 
ATOM   9220  C  CD    . GLU C 2  767  ? 12.223  -28.900 -33.239  1.00 104.91 ? 767  GLU C CD    1 
ATOM   9221  O  OE1   . GLU C 2  767  ? 10.993  -29.061 -33.088  1.00 107.23 ? 767  GLU C OE1   1 
ATOM   9222  O  OE2   . GLU C 2  767  ? 12.786  -27.796 -33.082  1.00 105.68 ? 767  GLU C OE2   1 
ATOM   9223  N  N     . GLU C 2  768  ? 12.603  -34.625 -32.218  1.00 99.71  ? 768  GLU C N     1 
ATOM   9224  C  CA    . GLU C 2  768  ? 11.850  -35.836 -31.937  1.00 99.14  ? 768  GLU C CA    1 
ATOM   9225  C  C     . GLU C 2  768  ? 11.187  -35.723 -30.574  1.00 89.64  ? 768  GLU C C     1 
ATOM   9226  O  O     . GLU C 2  768  ? 11.796  -35.248 -29.611  1.00 85.34  ? 768  GLU C O     1 
ATOM   9227  C  CB    . GLU C 2  768  ? 12.743  -37.083 -31.992  1.00 109.91 ? 768  GLU C CB    1 
ATOM   9228  C  CG    . GLU C 2  768  ? 13.970  -37.024 -31.100  1.00 115.60 ? 768  GLU C CG    1 
ATOM   9229  C  CD    . GLU C 2  768  ? 14.619  -38.381 -30.928  1.00 132.99 ? 768  GLU C CD    1 
ATOM   9230  O  OE1   . GLU C 2  768  ? 13.934  -39.398 -31.169  1.00 153.25 ? 768  GLU C OE1   1 
ATOM   9231  O  OE2   . GLU C 2  768  ? 15.810  -38.432 -30.555  1.00 135.67 ? 768  GLU C OE2   1 
ATOM   9232  N  N     . ILE C 2  769  ? 9.930   -36.149 -30.506  1.00 86.38  ? 769  ILE C N     1 
ATOM   9233  C  CA    . ILE C 2  769  ? 9.179   -36.180 -29.258  1.00 65.98  ? 769  ILE C CA    1 
ATOM   9234  C  C     . ILE C 2  769  ? 9.461   -37.520 -28.590  1.00 82.12  ? 769  ILE C C     1 
ATOM   9235  O  O     . ILE C 2  769  ? 9.066   -38.573 -29.098  1.00 98.04  ? 769  ILE C O     1 
ATOM   9236  C  CB    . ILE C 2  769  ? 7.680   -35.977 -29.498  1.00 68.27  ? 769  ILE C CB    1 
ATOM   9237  C  CG1   . ILE C 2  769  ? 7.414   -34.553 -29.996  1.00 62.60  ? 769  ILE C CG1   1 
ATOM   9238  C  CG2   . ILE C 2  769  ? 6.892   -36.283 -28.232  1.00 84.21  ? 769  ILE C CG2   1 
ATOM   9239  C  CD1   . ILE C 2  769  ? 5.981   -34.298 -30.411  1.00 66.57  ? 769  ILE C CD1   1 
ATOM   9240  N  N     . THR C 2  770  ? 10.149  -37.486 -27.451  1.00 77.14  ? 770  THR C N     1 
ATOM   9241  C  CA    . THR C 2  770  ? 10.575  -38.713 -26.799  1.00 90.05  ? 770  THR C CA    1 
ATOM   9242  C  C     . THR C 2  770  ? 10.562  -38.532 -25.290  1.00 85.70  ? 770  THR C C     1 
ATOM   9243  O  O     . THR C 2  770  ? 10.746  -37.426 -24.775  1.00 70.97  ? 770  THR C O     1 
ATOM   9244  C  CB    . THR C 2  770  ? 11.975  -39.138 -27.263  1.00 100.97 ? 770  THR C CB    1 
ATOM   9245  O  OG1   . THR C 2  770  ? 12.403  -40.282 -26.512  1.00 132.16 ? 770  THR C OG1   1 
ATOM   9246  C  CG2   . THR C 2  770  ? 12.970  -38.004 -27.066  1.00 93.48  ? 770  THR C CG2   1 
ATOM   9247  N  N     . ARG C 2  771  ? 10.339  -39.645 -24.588  1.00 94.56  ? 771  ARG C N     1 
ATOM   9248  C  CA    . ARG C 2  771  ? 10.394  -39.638 -23.132  1.00 91.26  ? 771  ARG C CA    1 
ATOM   9249  C  C     . ARG C 2  771  ? 11.816  -39.424 -22.630  1.00 84.27  ? 771  ARG C C     1 
ATOM   9250  O  O     . ARG C 2  771  ? 12.012  -38.874 -21.541  1.00 72.11  ? 771  ARG C O     1 
ATOM   9251  C  CB    . ARG C 2  771  ? 9.825   -40.951 -22.594  1.00 99.12  ? 771  ARG C CB    1 
ATOM   9252  C  CG    . ARG C 2  771  ? 9.589   -40.980 -21.099  1.00 88.20  ? 771  ARG C CG    1 
ATOM   9253  C  CD    . ARG C 2  771  ? 9.080   -42.345 -20.667  1.00 85.54  ? 771  ARG C CD    1 
ATOM   9254  N  NE    . ARG C 2  771  ? 8.711   -42.374 -19.256  1.00 82.52  ? 771  ARG C NE    1 
ATOM   9255  C  CZ    . ARG C 2  771  ? 9.569   -42.579 -18.263  1.00 121.77 ? 771  ARG C CZ    1 
ATOM   9256  N  NH1   . ARG C 2  771  ? 10.855  -42.770 -18.523  1.00 123.30 ? 771  ARG C NH1   1 
ATOM   9257  N  NH2   . ARG C 2  771  ? 9.141   -42.589 -17.008  1.00 138.40 ? 771  ARG C NH2   1 
ATOM   9258  N  N     . ASP C 2  772  ? 12.811  -39.843 -23.407  1.00 91.83  ? 772  ASP C N     1 
ATOM   9259  C  CA    . ASP C 2  772  ? 14.212  -39.686 -23.030  1.00 93.95  ? 772  ASP C CA    1 
ATOM   9260  C  C     . ASP C 2  772  ? 14.620  -38.227 -23.204  1.00 84.53  ? 772  ASP C C     1 
ATOM   9261  O  O     . ASP C 2  772  ? 14.791  -37.751 -24.331  1.00 97.55  ? 772  ASP C O     1 
ATOM   9262  C  CB    . ASP C 2  772  ? 15.083  -40.613 -23.876  1.00 112.43 ? 772  ASP C CB    1 
ATOM   9263  C  CG    . ASP C 2  772  ? 16.529  -40.648 -23.414  1.00 130.63 ? 772  ASP C CG    1 
ATOM   9264  O  OD1   . ASP C 2  772  ? 17.203  -39.597 -23.457  1.00 128.24 ? 772  ASP C OD1   1 
ATOM   9265  O  OD2   . ASP C 2  772  ? 16.992  -41.734 -23.005  1.00 141.97 ? 772  ASP C OD2   1 
ATOM   9266  N  N     . ILE C 2  773  ? 14.777  -37.518 -22.091  1.00 86.92  ? 773  ILE C N     1 
ATOM   9267  C  CA    . ILE C 2  773  ? 15.164  -36.113 -22.083  1.00 79.06  ? 773  ILE C CA    1 
ATOM   9268  C  C     . ILE C 2  773  ? 16.466  -36.000 -21.302  1.00 91.43  ? 773  ILE C C     1 
ATOM   9269  O  O     . ILE C 2  773  ? 16.579  -36.584 -20.223  1.00 120.60 ? 773  ILE C O     1 
ATOM   9270  C  CB    . ILE C 2  773  ? 14.082  -35.211 -21.462  1.00 79.15  ? 773  ILE C CB    1 
ATOM   9271  C  CG1   . ILE C 2  773  ? 12.740  -35.436 -22.164  1.00 72.30  ? 773  ILE C CG1   1 
ATOM   9272  C  CG2   . ILE C 2  773  ? 14.474  -33.746 -21.558  1.00 68.13  ? 773  ILE C CG2   1 
ATOM   9273  C  CD1   . ILE C 2  773  ? 11.598  -34.615 -21.595  1.00 88.59  ? 773  ILE C CD1   1 
ATOM   9274  N  N     . PRO C 2  774  ? 17.473  -35.284 -21.807  1.00 78.89  ? 774  PRO C N     1 
ATOM   9275  C  CA    . PRO C 2  774  ? 18.780  -35.261 -21.132  1.00 112.93 ? 774  PRO C CA    1 
ATOM   9276  C  C     . PRO C 2  774  ? 18.707  -34.610 -19.757  1.00 114.59 ? 774  PRO C C     1 
ATOM   9277  O  O     . PRO C 2  774  ? 18.121  -33.537 -19.590  1.00 108.19 ? 774  PRO C O     1 
ATOM   9278  C  CB    . PRO C 2  774  ? 19.659  -34.447 -22.090  1.00 121.40 ? 774  PRO C CB    1 
ATOM   9279  C  CG    . PRO C 2  774  ? 18.986  -34.562 -23.415  1.00 101.82 ? 774  PRO C CG    1 
ATOM   9280  C  CD    . PRO C 2  774  ? 17.519  -34.612 -23.116  1.00 73.89  ? 774  PRO C CD    1 
ATOM   9281  N  N     . ASN C 2  775  ? 19.309  -35.281 -18.772  1.00 106.96 ? 775  ASN C N     1 
ATOM   9282  C  CA    . ASN C 2  775  ? 19.512  -34.734 -17.428  1.00 114.02 ? 775  ASN C CA    1 
ATOM   9283  C  C     . ASN C 2  775  ? 18.190  -34.405 -16.737  1.00 119.88 ? 775  ASN C C     1 
ATOM   9284  O  O     . ASN C 2  775  ? 18.038  -33.349 -16.119  1.00 127.87 ? 775  ASN C O     1 
ATOM   9285  C  CB    . ASN C 2  775  ? 20.427  -33.506 -17.469  1.00 120.61 ? 775  ASN C CB    1 
ATOM   9286  C  CG    . ASN C 2  775  ? 21.839  -33.848 -17.905  1.00 137.35 ? 775  ASN C CG    1 
ATOM   9287  O  OD1   . ASN C 2  775  ? 22.390  -34.877 -17.513  1.00 127.12 ? 775  ASN C OD1   1 
ATOM   9288  N  ND2   . ASN C 2  775  ? 22.430  -32.988 -18.727  1.00 139.43 ? 775  ASN C ND2   1 
ATOM   9289  N  N     . ILE C 2  776  ? 17.230  -35.321 -16.831  1.00 115.71 ? 776  ILE C N     1 
ATOM   9290  C  CA    . ILE C 2  776  ? 15.955  -35.207 -16.134  1.00 99.37  ? 776  ILE C CA    1 
ATOM   9291  C  C     . ILE C 2  776  ? 15.710  -36.504 -15.376  1.00 103.97 ? 776  ILE C C     1 
ATOM   9292  O  O     . ILE C 2  776  ? 15.947  -37.597 -15.903  1.00 115.48 ? 776  ILE C O     1 
ATOM   9293  C  CB    . ILE C 2  776  ? 14.791  -34.908 -17.105  1.00 101.43 ? 776  ILE C CB    1 
ATOM   9294  C  CG1   . ILE C 2  776  ? 15.088  -33.656 -17.935  1.00 103.06 ? 776  ILE C CG1   1 
ATOM   9295  C  CG2   . ILE C 2  776  ? 13.488  -34.725 -16.340  1.00 95.24  ? 776  ILE C CG2   1 
ATOM   9296  C  CD1   . ILE C 2  776  ? 15.134  -32.375 -17.127  1.00 119.77 ? 776  ILE C CD1   1 
ATOM   9297  N  N     . SER C 2  777  ? 15.244  -36.382 -14.135  1.00 95.85  ? 777  SER C N     1 
ATOM   9298  C  CA    . SER C 2  777  ? 14.997  -37.546 -13.300  1.00 107.66 ? 777  SER C CA    1 
ATOM   9299  C  C     . SER C 2  777  ? 13.841  -38.375 -13.857  1.00 96.44  ? 777  SER C C     1 
ATOM   9300  O  O     . SER C 2  777  ? 13.074  -37.935 -14.718  1.00 101.51 ? 777  SER C O     1 
ATOM   9301  C  CB    . SER C 2  777  ? 14.689  -37.118 -11.864  1.00 118.40 ? 777  SER C CB    1 
ATOM   9302  O  OG    . SER C 2  777  ? 13.480  -36.380 -11.798  1.00 82.97  ? 777  SER C OG    1 
ATOM   9303  N  N     . ASP C 2  778  ? 13.724  -39.603 -13.349  1.00 97.84  ? 778  ASP C N     1 
ATOM   9304  C  CA    . ASP C 2  778  ? 12.568  -40.440 -13.648  1.00 111.41 ? 778  ASP C CA    1 
ATOM   9305  C  C     . ASP C 2  778  ? 11.311  -39.979 -12.922  1.00 107.85 ? 778  ASP C C     1 
ATOM   9306  O  O     . ASP C 2  778  ? 10.243  -40.563 -13.135  1.00 108.58 ? 778  ASP C O     1 
ATOM   9307  C  CB    . ASP C 2  778  ? 12.861  -41.900 -13.288  1.00 117.90 ? 778  ASP C CB    1 
ATOM   9308  C  CG    . ASP C 2  778  ? 13.932  -42.519 -14.167  1.00 128.20 ? 778  ASP C CG    1 
ATOM   9309  O  OD1   . ASP C 2  778  ? 14.628  -41.770 -14.885  1.00 149.85 ? 778  ASP C OD1   1 
ATOM   9310  O  OD2   . ASP C 2  778  ? 14.073  -43.760 -14.144  1.00 117.55 ? 778  ASP C OD2   1 
ATOM   9311  N  N     . GLU C 2  779  ? 11.413  -38.951 -12.079  1.00 92.76  ? 779  GLU C N     1 
ATOM   9312  C  CA    . GLU C 2  779  ? 10.297  -38.478 -11.271  1.00 98.62  ? 779  GLU C CA    1 
ATOM   9313  C  C     . GLU C 2  779  ? 9.485   -37.400 -11.977  1.00 94.39  ? 779  GLU C C     1 
ATOM   9314  O  O     . GLU C 2  779  ? 8.253   -37.389 -11.877  1.00 110.40 ? 779  GLU C O     1 
ATOM   9315  C  CB    . GLU C 2  779  ? 10.819  -37.954 -9.931   1.00 112.29 ? 779  GLU C CB    1 
ATOM   9316  C  CG    . GLU C 2  779  ? 11.844  -38.875 -9.288   1.00 128.72 ? 779  GLU C CG    1 
ATOM   9317  C  CD    . GLU C 2  779  ? 12.589  -38.218 -8.145   1.00 161.82 ? 779  GLU C CD    1 
ATOM   9318  O  OE1   . GLU C 2  779  ? 12.019  -37.309 -7.505   1.00 176.08 ? 779  GLU C OE1   1 
ATOM   9319  O  OE2   . GLU C 2  779  ? 13.749  -38.607 -7.891   1.00 149.04 ? 779  GLU C OE2   1 
ATOM   9320  N  N     . VAL C 2  780  ? 10.152  -36.485 -12.685  1.00 69.26  ? 780  VAL C N     1 
ATOM   9321  C  CA    . VAL C 2  780  ? 9.428   -35.497 -13.478  1.00 76.31  ? 780  VAL C CA    1 
ATOM   9322  C  C     . VAL C 2  780  ? 8.772   -36.164 -14.681  1.00 88.09  ? 780  VAL C C     1 
ATOM   9323  O  O     . VAL C 2  780  ? 7.646   -35.823 -15.061  1.00 90.57  ? 780  VAL C O     1 
ATOM   9324  C  CB    . VAL C 2  780  ? 10.371  -34.358 -13.908  1.00 63.68  ? 780  VAL C CB    1 
ATOM   9325  C  CG1   . VAL C 2  780  ? 9.570   -33.178 -14.439  1.00 71.90  ? 780  VAL C CG1   1 
ATOM   9326  C  CG2   . VAL C 2  780  ? 11.261  -33.932 -12.749  1.00 66.18  ? 780  VAL C CG2   1 
ATOM   9327  N  N     . LEU C 2  781  ? 9.460   -37.127 -15.291  1.00 84.50  ? 781  LEU C N     1 
ATOM   9328  C  CA    . LEU C 2  781  ? 8.938   -37.884 -16.421  1.00 75.19  ? 781  LEU C CA    1 
ATOM   9329  C  C     . LEU C 2  781  ? 7.957   -38.974 -16.001  1.00 81.41  ? 781  LEU C C     1 
ATOM   9330  O  O     . LEU C 2  781  ? 7.526   -39.760 -16.851  1.00 100.17 ? 781  LEU C O     1 
ATOM   9331  C  CB    . LEU C 2  781  ? 10.093  -38.509 -17.208  1.00 83.20  ? 781  LEU C CB    1 
ATOM   9332  C  CG    . LEU C 2  781  ? 11.291  -37.603 -17.504  1.00 87.97  ? 781  LEU C CG    1 
ATOM   9333  C  CD1   . LEU C 2  781  ? 12.396  -38.378 -18.206  1.00 101.60 ? 781  LEU C CD1   1 
ATOM   9334  C  CD2   . LEU C 2  781  ? 10.867  -36.400 -18.332  1.00 89.38  ? 781  LEU C CD2   1 
ATOM   9335  N  N     . ALA C 2  782  ? 7.598   -39.036 -14.715  1.00 80.59  ? 782  ALA C N     1 
ATOM   9336  C  CA    . ALA C 2  782  ? 6.742   -40.113 -14.229  1.00 95.85  ? 782  ALA C CA    1 
ATOM   9337  C  C     . ALA C 2  782  ? 5.315   -39.990 -14.748  1.00 86.10  ? 782  ALA C C     1 
ATOM   9338  O  O     . ALA C 2  782  ? 4.626   -41.005 -14.902  1.00 94.67  ? 782  ALA C O     1 
ATOM   9339  C  CB    . ALA C 2  782  ? 6.746   -40.140 -12.701  1.00 108.55 ? 782  ALA C CB    1 
ATOM   9340  N  N